data_1XWD
# 
_entry.id   1XWD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1XWD         
RCSB  RCSB030842   
WWPDB D_1000030842 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1XWD 
_pdbx_database_status.recvd_initial_deposition_date   2004-10-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fan, Q.R.'         1 
'Hendrickson, W.A.' 2 
# 
_citation.id                        primary 
_citation.title                     'Structure of human follicle-stimulating hormone in complex with its receptor.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            433 
_citation.page_first                269 
_citation.page_last                 277 
_citation.year                      2005 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15662415 
_citation.pdbx_database_id_DOI      10.1038/nature03206 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Fan, Q.R.'         1 ? 
primary 'Hendrickson, W.A.' 2 ? 
# 
_cell.entry_id           1XWD 
_cell.length_a           121.330 
_cell.length_b           66.938 
_cell.length_c           148.629 
_cell.angle_alpha        90.00 
_cell.angle_beta         99.13 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1XWD 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glycoprotein hormones alpha chain' 10217.769 2  ? ? ?                      ? 
2 polymer     man 'Follitropin beta chain' 12500.208 2  ? ? ?                      ? 
3 polymer     man 'Follicle stimulating hormone receptor' 28635.830 2  ? ? 'Extracellular domain' ? 
4 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   1  ? ? ? ? 
5 branched    man 
'beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 586.542   1  
? ? ?                      ? 
6 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   6  ? ? ?                      ? 
7 non-polymer syn 'SULFATE ION' 96.063    3  ? ? ?                      ? 
8 water       nat water 18.015    50 ? ? ?                      ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;Follitropin alpha chain, Follicle-stimulating hormone alpha chain, FSH-alpha, Lutropin alpha chain, Luteinizing hormone alpha chain, LSH-alpha, Thyrotropin alpha chain, Thyroid-stimulating hormone alpha chain, TSH-alpha, Choriogonadotropin alpha chain, Chorionic gonadotrophin alpha subunit, CG-alpha
;
2 'Follicle-stimulating hormone beta subunit, FSH-beta, FSH-B' 
3 'FSH-R, Follitropin receptor' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHT
ACHCSTCYYHKS
;
;APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHT
ACHCSTCYYHKS
;
A,D ? 
2 'polypeptide(L)' no no 
;NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVAT
QCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
;
;NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVAT
QCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
;
B,E ? 
3 'polypeptide(L)' no no 
;GCHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPK
LHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILW
LNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLP
TLEKLVALMEAS
;
;GCHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPK
LHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILW
LNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLP
TLEKLVALMEAS
;
C,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   PRO n 
1 3   ASP n 
1 4   VAL n 
1 5   GLN n 
1 6   ASP n 
1 7   CYS n 
1 8   PRO n 
1 9   GLU n 
1 10  CYS n 
1 11  THR n 
1 12  LEU n 
1 13  GLN n 
1 14  GLU n 
1 15  ASN n 
1 16  PRO n 
1 17  PHE n 
1 18  PHE n 
1 19  SER n 
1 20  GLN n 
1 21  PRO n 
1 22  GLY n 
1 23  ALA n 
1 24  PRO n 
1 25  ILE n 
1 26  LEU n 
1 27  GLN n 
1 28  CYS n 
1 29  MET n 
1 30  GLY n 
1 31  CYS n 
1 32  CYS n 
1 33  PHE n 
1 34  SER n 
1 35  ARG n 
1 36  ALA n 
1 37  TYR n 
1 38  PRO n 
1 39  THR n 
1 40  PRO n 
1 41  LEU n 
1 42  ARG n 
1 43  SER n 
1 44  LYS n 
1 45  LYS n 
1 46  THR n 
1 47  MET n 
1 48  LEU n 
1 49  VAL n 
1 50  GLN n 
1 51  LYS n 
1 52  ASN n 
1 53  VAL n 
1 54  THR n 
1 55  SER n 
1 56  GLU n 
1 57  SER n 
1 58  THR n 
1 59  CYS n 
1 60  CYS n 
1 61  VAL n 
1 62  ALA n 
1 63  LYS n 
1 64  SER n 
1 65  TYR n 
1 66  ASN n 
1 67  ARG n 
1 68  VAL n 
1 69  THR n 
1 70  VAL n 
1 71  MET n 
1 72  GLY n 
1 73  GLY n 
1 74  PHE n 
1 75  LYS n 
1 76  VAL n 
1 77  GLU n 
1 78  ASN n 
1 79  HIS n 
1 80  THR n 
1 81  ALA n 
1 82  CYS n 
1 83  HIS n 
1 84  CYS n 
1 85  SER n 
1 86  THR n 
1 87  CYS n 
1 88  TYR n 
1 89  TYR n 
1 90  HIS n 
1 91  LYS n 
1 92  SER n 
2 1   ASN n 
2 2   SER n 
2 3   CYS n 
2 4   GLU n 
2 5   LEU n 
2 6   THR n 
2 7   ASN n 
2 8   ILE n 
2 9   THR n 
2 10  ILE n 
2 11  ALA n 
2 12  ILE n 
2 13  GLU n 
2 14  LYS n 
2 15  GLU n 
2 16  GLU n 
2 17  CYS n 
2 18  ARG n 
2 19  PHE n 
2 20  CYS n 
2 21  ILE n 
2 22  SER n 
2 23  ILE n 
2 24  ASN n 
2 25  THR n 
2 26  THR n 
2 27  TRP n 
2 28  CYS n 
2 29  ALA n 
2 30  GLY n 
2 31  TYR n 
2 32  CYS n 
2 33  TYR n 
2 34  THR n 
2 35  ARG n 
2 36  ASP n 
2 37  LEU n 
2 38  VAL n 
2 39  TYR n 
2 40  LYS n 
2 41  ASP n 
2 42  PRO n 
2 43  ALA n 
2 44  ARG n 
2 45  PRO n 
2 46  LYS n 
2 47  ILE n 
2 48  GLN n 
2 49  LYS n 
2 50  THR n 
2 51  CYS n 
2 52  THR n 
2 53  PHE n 
2 54  LYS n 
2 55  GLU n 
2 56  LEU n 
2 57  VAL n 
2 58  TYR n 
2 59  GLU n 
2 60  THR n 
2 61  VAL n 
2 62  ARG n 
2 63  VAL n 
2 64  PRO n 
2 65  GLY n 
2 66  CYS n 
2 67  ALA n 
2 68  HIS n 
2 69  HIS n 
2 70  ALA n 
2 71  ASP n 
2 72  SER n 
2 73  LEU n 
2 74  TYR n 
2 75  THR n 
2 76  TYR n 
2 77  PRO n 
2 78  VAL n 
2 79  ALA n 
2 80  THR n 
2 81  GLN n 
2 82  CYS n 
2 83  HIS n 
2 84  CYS n 
2 85  GLY n 
2 86  LYS n 
2 87  CYS n 
2 88  ASP n 
2 89  SER n 
2 90  ASP n 
2 91  SER n 
2 92  THR n 
2 93  ASP n 
2 94  CYS n 
2 95  THR n 
2 96  VAL n 
2 97  ARG n 
2 98  GLY n 
2 99  LEU n 
2 100 GLY n 
2 101 PRO n 
2 102 SER n 
2 103 TYR n 
2 104 CYS n 
2 105 SER n 
2 106 PHE n 
2 107 GLY n 
2 108 GLU n 
2 109 MET n 
2 110 LYS n 
2 111 GLU n 
3 1   GLY n 
3 2   CYS n 
3 3   HIS n 
3 4   HIS n 
3 5   ARG n 
3 6   ILE n 
3 7   CYS n 
3 8   HIS n 
3 9   CYS n 
3 10  SER n 
3 11  ASN n 
3 12  ARG n 
3 13  VAL n 
3 14  PHE n 
3 15  LEU n 
3 16  CYS n 
3 17  GLN n 
3 18  GLU n 
3 19  SER n 
3 20  LYS n 
3 21  VAL n 
3 22  THR n 
3 23  GLU n 
3 24  ILE n 
3 25  PRO n 
3 26  SER n 
3 27  ASP n 
3 28  LEU n 
3 29  PRO n 
3 30  ARG n 
3 31  ASN n 
3 32  ALA n 
3 33  ILE n 
3 34  GLU n 
3 35  LEU n 
3 36  ARG n 
3 37  PHE n 
3 38  VAL n 
3 39  LEU n 
3 40  THR n 
3 41  LYS n 
3 42  LEU n 
3 43  ARG n 
3 44  VAL n 
3 45  ILE n 
3 46  GLN n 
3 47  LYS n 
3 48  GLY n 
3 49  ALA n 
3 50  PHE n 
3 51  SER n 
3 52  GLY n 
3 53  PHE n 
3 54  GLY n 
3 55  ASP n 
3 56  LEU n 
3 57  GLU n 
3 58  LYS n 
3 59  ILE n 
3 60  GLU n 
3 61  ILE n 
3 62  SER n 
3 63  GLN n 
3 64  ASN n 
3 65  ASP n 
3 66  VAL n 
3 67  LEU n 
3 68  GLU n 
3 69  VAL n 
3 70  ILE n 
3 71  GLU n 
3 72  ALA n 
3 73  ASP n 
3 74  VAL n 
3 75  PHE n 
3 76  SER n 
3 77  ASN n 
3 78  LEU n 
3 79  PRO n 
3 80  LYS n 
3 81  LEU n 
3 82  HIS n 
3 83  GLU n 
3 84  ILE n 
3 85  ARG n 
3 86  ILE n 
3 87  GLU n 
3 88  LYS n 
3 89  ALA n 
3 90  ASN n 
3 91  ASN n 
3 92  LEU n 
3 93  LEU n 
3 94  TYR n 
3 95  ILE n 
3 96  ASN n 
3 97  PRO n 
3 98  GLU n 
3 99  ALA n 
3 100 PHE n 
3 101 GLN n 
3 102 ASN n 
3 103 LEU n 
3 104 PRO n 
3 105 ASN n 
3 106 LEU n 
3 107 GLN n 
3 108 TYR n 
3 109 LEU n 
3 110 LEU n 
3 111 ILE n 
3 112 SER n 
3 113 ASN n 
3 114 THR n 
3 115 GLY n 
3 116 ILE n 
3 117 LYS n 
3 118 HIS n 
3 119 LEU n 
3 120 PRO n 
3 121 ASP n 
3 122 VAL n 
3 123 HIS n 
3 124 LYS n 
3 125 ILE n 
3 126 HIS n 
3 127 SER n 
3 128 LEU n 
3 129 GLN n 
3 130 LYS n 
3 131 VAL n 
3 132 LEU n 
3 133 LEU n 
3 134 ASP n 
3 135 ILE n 
3 136 GLN n 
3 137 ASP n 
3 138 ASN n 
3 139 ILE n 
3 140 ASN n 
3 141 ILE n 
3 142 HIS n 
3 143 THR n 
3 144 ILE n 
3 145 GLU n 
3 146 ARG n 
3 147 ASN n 
3 148 SER n 
3 149 PHE n 
3 150 VAL n 
3 151 GLY n 
3 152 LEU n 
3 153 SER n 
3 154 PHE n 
3 155 GLU n 
3 156 SER n 
3 157 VAL n 
3 158 ILE n 
3 159 LEU n 
3 160 TRP n 
3 161 LEU n 
3 162 ASN n 
3 163 LYS n 
3 164 ASN n 
3 165 GLY n 
3 166 ILE n 
3 167 GLN n 
3 168 GLU n 
3 169 ILE n 
3 170 HIS n 
3 171 ASN n 
3 172 CYS n 
3 173 ALA n 
3 174 PHE n 
3 175 ASN n 
3 176 GLY n 
3 177 THR n 
3 178 GLN n 
3 179 LEU n 
3 180 ASP n 
3 181 GLU n 
3 182 LEU n 
3 183 ASN n 
3 184 LEU n 
3 185 SER n 
3 186 ASP n 
3 187 ASN n 
3 188 ASN n 
3 189 ASN n 
3 190 LEU n 
3 191 GLU n 
3 192 GLU n 
3 193 LEU n 
3 194 PRO n 
3 195 ASN n 
3 196 ASP n 
3 197 VAL n 
3 198 PHE n 
3 199 HIS n 
3 200 GLY n 
3 201 ALA n 
3 202 SER n 
3 203 GLY n 
3 204 PRO n 
3 205 VAL n 
3 206 ILE n 
3 207 LEU n 
3 208 ASP n 
3 209 ILE n 
3 210 SER n 
3 211 ARG n 
3 212 THR n 
3 213 ARG n 
3 214 ILE n 
3 215 HIS n 
3 216 SER n 
3 217 LEU n 
3 218 PRO n 
3 219 SER n 
3 220 TYR n 
3 221 GLY n 
3 222 LEU n 
3 223 GLU n 
3 224 ASN n 
3 225 LEU n 
3 226 LYS n 
3 227 LYS n 
3 228 LEU n 
3 229 ARG n 
3 230 ALA n 
3 231 ARG n 
3 232 SER n 
3 233 THR n 
3 234 TYR n 
3 235 ASN n 
3 236 LEU n 
3 237 LYS n 
3 238 LYS n 
3 239 LEU n 
3 240 PRO n 
3 241 THR n 
3 242 LEU n 
3 243 GLU n 
3 244 LYS n 
3 245 LEU n 
3 246 VAL n 
3 247 ALA n 
3 248 LEU n 
3 249 MET n 
3 250 GLU n 
3 251 ALA n 
3 252 SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo CGA  ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'cabbage looper' 'Trichoplusia ni' 7111 
Trichoplusia ? ? ? ? ? ? ? 'High 5' ? ? ? ? ? Baculovirus ? ? ? 'pFastBac Dual' ? ? 
2 1 sample ? ? ? human Homo FSHB ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'cabbage looper' 'Trichoplusia ni' 7111 
Trichoplusia ? ? ? ? ? ? ? 'High 5' ? ? ? ? ? Baculovirus ? ? ? 'pFastBac Dual' ? ? 
3 1 sample ? ? ? human Homo FSHR ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'cabbage looper' 'Trichoplusia ni' 7111 
Trichoplusia ? ? ? ? ? ? ? 'High 5' ? ? ? ? ? Baculovirus ? ? ? 'pFastBac Dual' ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP GLHA_HUMAN P01215 1 
;APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHT
ACHCSTCYYHKS
;
25 ? 
2 UNP FSHB_HUMAN P01225 2 
;NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVAT
QCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
;
19 ? 
3 UNP FSHR_HUMAN P23945 3 
;GCHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPK
LHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILW
LNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLP
TLEKLVALMEAS
;
17 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1XWD A 1 ? 92  ? P01215 25 ? 116 ? 1  92  
2 1 1XWD D 1 ? 92  ? P01215 25 ? 116 ? 1  92  
3 2 1XWD B 1 ? 111 ? P01225 19 ? 129 ? 1  111 
4 2 1XWD E 1 ? 111 ? P01225 19 ? 129 ? 1  111 
5 3 1XWD C 1 ? 252 ? P23945 17 ? 268 ? 17 268 
6 3 1XWD F 1 ? 252 ? P23945 17 ? 268 ? 17 268 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
BMA 'D-saccharide, beta linking' . beta-D-mannopyranose                     ? 'C6 H12 O6'      180.156 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
SO4 non-polymer                  . 'SULFATE ION'                            ? 'O4 S -2'        96.063  
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1XWD 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.03 
_exptl_crystal.density_percent_sol   59 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.4 
_exptl_crystal_grow.pdbx_details    'PEG 3350, lithium sulfate, pH 6.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2003-03-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 31-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   31-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.98 
# 
_reflns.entry_id                     1XWD 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.d_resolution_high            2.9 
_reflns.d_resolution_low             25.0 
_reflns.number_all                   25282 
_reflns.number_obs                   25282 
_reflns.percent_possible_obs         98.6 
_reflns.pdbx_Rmerge_I_obs            0.069 
_reflns.pdbx_Rsym_value              0.069 
_reflns.pdbx_netI_over_sigmaI        12.4 
_reflns.B_iso_Wilson_estimate        45.2 
_reflns.pdbx_redundancy              3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.9 
_reflns_shell.d_res_low              3.0 
_reflns_shell.percent_possible_all   97.7 
_reflns_shell.Rmerge_I_obs           0.388 
_reflns_shell.pdbx_Rsym_value        0.388 
_reflns_shell.meanI_over_sigI_obs    3.4 
_reflns_shell.pdbx_redundancy        3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2494 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1XWD 
_refine.ls_number_reflns_obs                     25282 
_refine.ls_number_reflns_all                     25282 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             25.00 
_refine.ls_d_res_high                            2.92 
_refine.ls_percent_reflns_obs                    98.02 
_refine.ls_R_factor_obs                          0.2213 
_refine.ls_R_factor_all                          0.2213 
_refine.ls_R_factor_R_work                       0.2193 
_refine.ls_R_factor_R_free                       0.259 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1262 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.922 
_refine.correlation_coeff_Fo_to_Fc_free          0.888 
_refine.B_iso_mean                               56.3 
_refine.aniso_B[1][1]                            2.72 
_refine.aniso_B[2][2]                            -0.37 
_refine.aniso_B[3][3]                            -2.72 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -1.18 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 1FL7' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.419 
_refine.overall_SU_ML                            0.333 
_refine.overall_SU_B                             37.017 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1XWD 
_refine_analyze.Luzzati_coordinate_error_obs    0.38 
_refine_analyze.Luzzati_sigma_a_obs             0.44 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.45 
_refine_analyze.Luzzati_sigma_a_free            0.58 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6815 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         166 
_refine_hist.number_atoms_solvent             50 
_refine_hist.number_atoms_total               7031 
_refine_hist.d_res_high                       2.92 
_refine_hist.d_res_low                        25.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.010  0.021  ? 7160 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.427  1.976  ? 9737 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.304  5.000  ? 856  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   40.573 24.472 ? 322  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   19.924 15.000 ? 1214 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   16.710 15.000 ? 38   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.089  0.200  ? 1120 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.004  0.020  ? 5292 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.255  0.200  ? 2955 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.323  0.200  ? 4675 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.180  0.200  ? 214  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.255  0.200  ? 79   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.064  0.200  ? 2    'X-RAY DIFFRACTION' ? 
r_mcbond_it              1.948  5.000  ? 4405 'X-RAY DIFFRACTION' ? 
r_mcangle_it             2.884  6.000  ? 7023 'X-RAY DIFFRACTION' ? 
r_scbond_it              2.901  6.000  ? 3004 'X-RAY DIFFRACTION' ? 
r_scangle_it             4.234  7.500  ? 2714 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 'tight positional'  C 1694 0.37  0.32  1 'X-RAY DIFFRACTION' 1  ? ? ? 
1 'tight positional'  A 285  0.40  0.32  2 'X-RAY DIFFRACTION' 2  ? ? ? 
1 'tight positional'  B 462  0.39  0.32  3 'X-RAY DIFFRACTION' 3  ? ? ? 
1 'medium positional' A 325  0.57  0.63  2 'X-RAY DIFFRACTION' 4  ? ? ? 
1 'medium positional' B 297  1.05  0.63  3 'X-RAY DIFFRACTION' 5  ? ? ? 
1 'loose positional'  C 178  2.94  10.00 1 'X-RAY DIFFRACTION' 6  ? ? ? 
1 'loose positional'  A 60   0.74  10.00 2 'X-RAY DIFFRACTION' 7  ? ? ? 
1 'loose positional'  B 59   1.11  10.00 3 'X-RAY DIFFRACTION' 8  ? ? ? 
1 'tight thermal'     C 1694 3.66  3.16  1 'X-RAY DIFFRACTION' 9  ? ? ? 
1 'tight thermal'     A 285  6.64  3.16  2 'X-RAY DIFFRACTION' 10 ? ? ? 
1 'tight thermal'     B 462  10.01 3.16  3 'X-RAY DIFFRACTION' 11 ? ? ? 
1 'medium thermal'    A 325  5.23  6.32  2 'X-RAY DIFFRACTION' 12 ? ? ? 
1 'medium thermal'    B 297  16.02 6.32  3 'X-RAY DIFFRACTION' 13 ? ? ? 
1 'loose thermal'     C 178  16.04 99.90 1 'X-RAY DIFFRACTION' 14 ? ? ? 
1 'loose thermal'     A 60   4.79  99.90 2 'X-RAY DIFFRACTION' 15 ? ? ? 
1 'loose thermal'     B 59   9.41  99.90 3 'X-RAY DIFFRACTION' 16 ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       2.92 
_refine_ls_shell.d_res_low                        3.08 
_refine_ls_shell.number_reflns_R_work             3271 
_refine_ls_shell.R_factor_R_work                  0.297 
_refine_ls_shell.percent_reflns_obs               93.95 
_refine_ls_shell.R_factor_R_free                  0.356 
_refine_ls_shell.R_factor_R_free_error            0.043 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             192 
_refine_ls_shell.number_reflns_obs                3463 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1  C 
1 2  F 
1 3  C 
1 4  F 
1 5  C 
1 6  F 
1 7  C 
1 8  F 
1 9  C 
1 10 F 
1 11 C 
1 12 F 
1 13 C 
1 14 F 
1 15 C 
1 16 F 
1 17 C 
1 18 F 
1 19 C 
1 20 F 
1 21 C 
1 22 F 
2 1  A 
2 2  D 
2 3  A 
2 4  D 
2 5  A 
2 6  D 
2 7  A 
2 8  D 
2 9  A 
2 10 D 
2 11 A 
2 12 D 
2 13 A 
2 14 D 
2 15 A 
2 16 D 
2 17 A 
2 18 D 
2 19 A 
2 20 D 
3 1  B 
3 2  E 
3 3  B 
3 4  E 
3 5  B 
3 6  E 
3 7  B 
3 8  E 
3 9  B 
3 10 E 
3 11 B 
3 12 E 
3 13 B 
3 14 E 
3 15 B 
3 16 E 
3 17 B 
3 18 E 
3 19 B 
3 20 E 
3 21 B 
3 22 E 
3 23 B 
3 24 E 
3 25 B 
3 26 E 
3 27 B 
3 28 E 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1  1  6 C 18  C 27  C CYS 2   . C ASN 11  . 1 ? 
2  1  6 F 18  F 27  F CYS 2   . F ASN 11  . 1 ? 
3  2  1 C 28  C 66  C ARG 12  . C PHE 50  . 1 ? 
4  2  1 F 28  F 66  F ARG 12  . F PHE 50  . 1 ? 
5  3  6 C 67  C 68  C SER 51  . C GLY 52  . 1 ? 
6  3  6 F 67  F 68  F SER 51  . F GLY 52  . 1 ? 
7  4  1 C 69  C 91  C PHE 53  . C PHE 75  . 1 ? 
8  4  1 F 69  F 91  F PHE 53  . F PHE 75  . 1 ? 
9  5  6 C 92  C 93  C SER 76  . C ASN 77  . 1 ? 
10 5  6 F 92  F 93  F SER 76  . F ASN 77  . 1 ? 
11 6  1 C 94  C 166 C LEU 78  . C VAL 150 . 1 ? 
12 6  1 F 94  F 166 F LEU 78  . F VAL 150 . 1 ? 
13 7  6 C 167 C 168 C GLY 151 . C LEU 152 . 1 ? 
14 7  6 F 167 F 168 F GLY 151 . F LEU 152 . 1 ? 
15 8  1 C 169 C 215 C SER 153 . C HIS 199 . 1 ? 
16 8  1 F 169 F 215 F SER 153 . F HIS 199 . 1 ? 
17 9  6 C 216 C 217 C GLY 200 . C ALA 201 . 1 ? 
18 9  6 F 216 F 217 F GLY 200 . F ALA 201 . 1 ? 
19 10 1 C 218 C 244 C SER 202 . C LEU 228 . 1 ? 
20 10 1 F 218 F 244 F SER 202 . F LEU 228 . 1 ? 
21 11 6 C 245 C 250 C ARG 229 . C TYR 234 . 1 ? 
22 11 6 F 245 F 250 F ARG 229 . F TYR 234 . 1 ? 
1  1  4 A 6   A 16  A ASP 6   . A PRO 16  . 2 ? 
2  1  4 D 6   D 16  D ASP 6   . D PRO 16  . 2 ? 
3  2  6 A 17  A 23  A PHE 17  . A ALA 23  . 2 ? 
4  2  6 D 17  D 23  D PHE 17  . D ALA 23  . 2 ? 
5  3  4 A 24  A 29  A PRO 24  . A MET 29  . 2 ? 
6  3  4 D 24  D 29  D PRO 24  . D MET 29  . 2 ? 
7  4  1 A 30  A 40  A GLY 30  . A PRO 40  . 2 ? 
8  4  1 D 30  D 40  D GLY 30  . D PRO 40  . 2 ? 
9  5  4 A 41  A 53  A LEU 41  . A VAL 53  . 2 ? 
10 5  4 D 41  D 53  D LEU 41  . D VAL 53  . 2 ? 
11 6  1 A 54  A 58  A THR 54  . A THR 58  . 2 ? 
12 6  1 D 54  D 58  D THR 54  . D THR 58  . 2 ? 
13 7  4 A 59  A 67  A CYS 59  . A ARG 67  . 2 ? 
14 7  4 D 59  D 67  D CYS 59  . D ARG 67  . 2 ? 
15 8  1 A 68  A 89  A VAL 68  . A TYR 89  . 2 ? 
16 8  1 D 68  D 89  D VAL 68  . D TYR 89  . 2 ? 
17 9  4 A 90  A 91  A HIS 90  . A LYS 91  . 2 ? 
18 9  4 D 90  D 91  D HIS 90  . D LYS 91  . 2 ? 
19 10 6 A 92  A 92  A SER 92  . A SER 92  . 2 ? 
20 10 6 D 92  D 92  D SER 92  . D SER 92  . 2 ? 
1  1  4 B 3   B 4   B CYS 3   . B GLU 4   . 3 ? 
2  1  4 E 3   E 4   E CYS 3   . E GLU 4   . 3 ? 
3  2  1 B 5   B 12  B LEU 5   . B ILE 12  . 3 ? 
4  2  1 E 5   E 12  E LEU 5   . E ILE 12  . 3 ? 
5  3  4 B 13  B 15  B GLU 13  . B GLU 15  . 3 ? 
6  3  4 E 13  E 15  E GLU 13  . E GLU 15  . 3 ? 
7  4  1 B 16  B 35  B GLU 16  . B ARG 35  . 3 ? 
8  4  1 E 16  E 35  E GLU 16  . E ARG 35  . 3 ? 
9  5  4 B 36  B 37  B ASP 36  . B LEU 37  . 3 ? 
10 5  4 E 36  E 37  E ASP 36  . E LEU 37  . 3 ? 
11 6  6 B 38  B 42  B VAL 38  . B PRO 42  . 3 ? 
12 6  6 E 38  E 42  E VAL 38  . E PRO 42  . 3 ? 
13 7  4 B 43  B 47  B ALA 43  . B ILE 47  . 3 ? 
14 7  4 E 43  E 47  E ALA 43  . E ILE 47  . 3 ? 
15 8  1 B 48  B 55  B GLN 48  . B GLU 55  . 3 ? 
16 8  1 E 48  E 55  E GLN 48  . E GLU 55  . 3 ? 
17 9  4 B 56  B 75  B LEU 56  . B THR 75  . 3 ? 
18 9  4 E 56  E 75  E LEU 56  . E THR 75  . 3 ? 
19 10 1 B 76  B 93  B TYR 76  . B ASP 93  . 3 ? 
20 10 1 E 76  E 93  E TYR 76  . E ASP 93  . 3 ? 
21 11 4 B 94  B 99  B CYS 94  . B LEU 99  . 3 ? 
22 11 4 E 94  E 99  E CYS 94  . E LEU 99  . 3 ? 
23 12 6 B 100 B 101 B GLY 100 . B PRO 101 . 3 ? 
24 12 6 E 100 E 101 E GLY 100 . E PRO 101 . 3 ? 
25 13 1 B 102 B 106 B SER 102 . B PHE 106 . 3 ? 
26 13 1 E 102 E 106 E SER 102 . E PHE 106 . 3 ? 
27 14 6 B 107 B 107 B GLY 107 . B GLY 107 . 3 ? 
28 14 6 E 107 E 107 E GLY 107 . E GLY 107 . 3 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
_struct_ncs_ens.point_group 
1 ? ? 
2 ? ? 
3 ? ? 
# 
_struct.entry_id                  1XWD 
_struct.title                     'Crystal Structure of Human Follicle Stimulating Hormone Complexed with its Receptor' 
_struct.pdbx_descriptor           
'Glycoprotein hormones alpha chain, Follitropin beta chain, Follicle stimulating hormone receptor' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1XWD 
_struct_keywords.pdbx_keywords   'Hormone/Growth Factor' 
_struct_keywords.text            
'Hormone-receptor complex, Leucine-rich repeats, Cysteine-knot motif, Hormone-Growth Factor COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 6 ? 
J N N 6 ? 
K N N 6 ? 
L N N 6 ? 
M N N 7 ? 
N N N 7 ? 
O N N 7 ? 
P N N 6 ? 
Q N N 6 ? 
R N N 8 ? 
S N N 8 ? 
T N N 8 ? 
U N N 8 ? 
V N N 8 ? 
W N N 8 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 40 ? LYS A 45 ? PRO A 40 LYS A 45 1 ? 6 
HELX_P HELX_P2 2 ARG D 42 ? THR D 46 ? ARG D 42 THR D 46 5 ? 5 
HELX_P HELX_P3 3 GLU E 15 ? ARG E 18 ? GLU E 15 ARG E 18 5 ? 4 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 7   SG  ? ? ? 1_555 A CYS 31  SG ? ? A CYS 7   A CYS 31  1_555 ? ? ? ? ? ? ? 2.025 ? ?               
disulf2  disulf ?    ? A CYS 10  SG  ? ? ? 1_555 A CYS 60  SG ? ? A CYS 10  A CYS 60  1_555 ? ? ? ? ? ? ? 2.053 ? ?               
disulf3  disulf ?    ? A CYS 28  SG  ? ? ? 1_555 A CYS 82  SG ? ? A CYS 28  A CYS 82  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf4  disulf ?    ? A CYS 32  SG  ? ? ? 1_555 A CYS 84  SG ? ? A CYS 32  A CYS 84  1_555 ? ? ? ? ? ? ? 2.046 ? ?               
disulf5  disulf ?    ? A CYS 59  SG  ? ? ? 1_555 A CYS 87  SG ? ? A CYS 59  A CYS 87  1_555 ? ? ? ? ? ? ? 2.043 ? ?               
disulf6  disulf ?    ? B CYS 3   SG  ? ? ? 1_555 B CYS 51  SG ? ? B CYS 3   B CYS 51  1_555 ? ? ? ? ? ? ? 2.052 ? ?               
disulf7  disulf ?    ? B CYS 17  SG  ? ? ? 1_555 B CYS 66  SG ? ? B CYS 17  B CYS 66  1_555 ? ? ? ? ? ? ? 2.051 ? ?               
disulf8  disulf ?    ? B CYS 20  SG  ? ? ? 1_555 B CYS 104 SG ? ? B CYS 20  B CYS 104 1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf9  disulf ?    ? B CYS 28  SG  ? ? ? 1_555 B CYS 82  SG ? ? B CYS 28  B CYS 82  1_555 ? ? ? ? ? ? ? 2.057 ? ?               
disulf10 disulf ?    ? B CYS 32  SG  ? ? ? 1_555 B CYS 84  SG ? ? B CYS 32  B CYS 84  1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf11 disulf ?    ? B CYS 87  SG  ? ? ? 1_555 B CYS 94  SG ? ? B CYS 87  B CYS 94  1_555 ? ? ? ? ? ? ? 2.045 ? ?               
disulf12 disulf ?    ? C CYS 2   SG  ? ? ? 1_555 C CYS 9   SG ? ? C CYS 18  C CYS 25  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf13 disulf ?    ? C CYS 7   SG  ? ? ? 1_555 C CYS 16  SG ? ? C CYS 23  C CYS 32  1_555 ? ? ? ? ? ? ? 2.051 ? ?               
disulf14 disulf ?    ? D CYS 7   SG  ? ? ? 1_555 D CYS 31  SG ? ? D CYS 7   D CYS 31  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf15 disulf ?    ? D CYS 10  SG  ? ? ? 1_555 D CYS 60  SG ? ? D CYS 10  D CYS 60  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf16 disulf ?    ? D CYS 28  SG  ? ? ? 1_555 D CYS 82  SG ? ? D CYS 28  D CYS 82  1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf17 disulf ?    ? D CYS 32  SG  ? ? ? 1_555 D CYS 84  SG ? ? D CYS 32  D CYS 84  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf18 disulf ?    ? D CYS 59  SG  ? ? ? 1_555 D CYS 87  SG ? ? D CYS 59  D CYS 87  1_555 ? ? ? ? ? ? ? 2.045 ? ?               
disulf19 disulf ?    ? E CYS 3   SG  ? ? ? 1_555 E CYS 51  SG ? ? E CYS 3   E CYS 51  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf20 disulf ?    ? E CYS 17  SG  ? ? ? 1_555 E CYS 66  SG ? ? E CYS 17  E CYS 66  1_555 ? ? ? ? ? ? ? 2.045 ? ?               
disulf21 disulf ?    ? E CYS 20  SG  ? ? ? 1_555 E CYS 104 SG ? ? E CYS 20  E CYS 104 1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf22 disulf ?    ? E CYS 28  SG  ? ? ? 1_555 E CYS 82  SG ? ? E CYS 28  E CYS 82  1_555 ? ? ? ? ? ? ? 2.046 ? ?               
disulf23 disulf ?    ? E CYS 32  SG  ? ? ? 1_555 E CYS 84  SG ? ? E CYS 32  E CYS 84  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf24 disulf ?    ? E CYS 87  SG  ? ? ? 1_555 E CYS 94  SG ? ? E CYS 87  E CYS 94  1_555 ? ? ? ? ? ? ? 2.046 ? ?               
disulf25 disulf ?    ? F CYS 2   SG  ? ? ? 1_555 F CYS 9   SG ? ? F CYS 18  F CYS 25  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf26 disulf ?    ? F CYS 7   SG  ? ? ? 1_555 F CYS 16  SG ? ? F CYS 23  F CYS 32  1_555 ? ? ? ? ? ? ? 2.020 ? ?               
covale1  covale one  ? A ASN 52  ND2 ? ? ? 1_555 I NAG .   C1 ? ? A ASN 52  A NAG 93  1_555 ? ? ? ? ? ? ? 1.459 ? N-Glycosylation 
covale2  covale one  ? A ASN 78  ND2 ? ? ? 1_555 J NAG .   C1 ? ? A ASN 78  A NAG 94  1_555 ? ? ? ? ? ? ? 1.462 ? N-Glycosylation 
covale3  covale one  ? B ASN 7   ND2 ? ? ? 1_555 K NAG .   C1 ? ? B ASN 7   B NAG 112 1_555 ? ? ? ? ? ? ? 1.440 ? N-Glycosylation 
covale4  covale one  ? B ASN 24  ND2 ? ? ? 1_555 L NAG .   C1 ? ? B ASN 24  B NAG 113 1_555 ? ? ? ? ? ? ? 1.458 ? N-Glycosylation 
covale5  covale one  ? C ASN 175 ND2 ? ? ? 1_555 G NAG .   C1 ? ? C ASN 191 G NAG 1   1_555 ? ? ? ? ? ? ? 1.439 ? N-Glycosylation 
covale6  covale none ? C ASN 175 ND2 ? ? ? 1_555 G NAG .   C2 ? ? C ASN 191 G NAG 1   1_555 ? ? ? ? ? ? ? 1.974 ? ?               
covale7  covale one  ? D ASN 78  ND2 ? ? ? 1_555 P NAG .   C1 ? ? D ASN 78  D NAG 93  1_555 ? ? ? ? ? ? ? 1.458 ? N-Glycosylation 
covale8  covale one  ? E ASN 7   ND2 ? ? ? 1_555 Q NAG .   C1 ? ? E ASN 7   E NAG 112 1_555 ? ? ? ? ? ? ? 1.466 ? N-Glycosylation 
covale9  covale one  ? F ASN 175 ND2 ? ? ? 1_555 H NAG .   C1 ? ? F ASN 191 H NAG 1   1_555 ? ? ? ? ? ? ? 1.448 ? N-Glycosylation 
covale10 covale both ? G NAG .   O4  ? ? ? 1_555 G NAG .   C1 ? ? G NAG 1   G NAG 2   1_555 ? ? ? ? ? ? ? 1.449 ? ?               
covale11 covale both ? H NAG .   O4  ? ? ? 1_555 H NAG .   C1 ? ? H NAG 1   H NAG 2   1_555 ? ? ? ? ? ? ? 1.462 ? ?               
covale12 covale both ? H NAG .   O4  ? ? ? 1_555 H BMA .   C1 ? ? H NAG 2   H BMA 3   1_555 ? ? ? ? ? ? ? 1.468 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4  ? 
B ? 4  ? 
C ? 2  ? 
D ? 2  ? 
E ? 12 ? 
F ? 3  ? 
G ? 2  ? 
H ? 2  ? 
I ? 4  ? 
J ? 4  ? 
K ? 2  ? 
L ? 2  ? 
M ? 11 ? 
N ? 3  ? 
O ? 2  ? 
P ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
A 3  4  ? anti-parallel 
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? parallel      
C 1  2  ? anti-parallel 
D 1  2  ? anti-parallel 
E 1  2  ? anti-parallel 
E 2  3  ? parallel      
E 3  4  ? parallel      
E 4  5  ? parallel      
E 5  6  ? parallel      
E 6  7  ? parallel      
E 7  8  ? parallel      
E 8  9  ? parallel      
E 9  10 ? parallel      
E 10 11 ? parallel      
E 11 12 ? anti-parallel 
F 1  2  ? parallel      
F 2  3  ? parallel      
G 1  2  ? parallel      
H 1  2  ? parallel      
I 1  2  ? anti-parallel 
I 2  3  ? anti-parallel 
I 3  4  ? anti-parallel 
J 1  2  ? anti-parallel 
J 2  3  ? anti-parallel 
J 3  4  ? parallel      
K 1  2  ? anti-parallel 
L 1  2  ? anti-parallel 
M 1  2  ? anti-parallel 
M 2  3  ? parallel      
M 3  4  ? parallel      
M 4  5  ? parallel      
M 5  6  ? parallel      
M 6  7  ? parallel      
M 7  8  ? parallel      
M 8  9  ? parallel      
M 9  10 ? parallel      
M 10 11 ? parallel      
N 1  2  ? parallel      
N 2  3  ? parallel      
O 1  2  ? parallel      
P 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  THR A 11  ? GLU A 14  ? THR A 11  GLU A 14  
A 2  LEU A 26  ? PRO A 38  ? LEU A 26  PRO A 38  
A 3  PHE B 19  ? ARG B 35  ? PHE B 19  ARG B 35  
A 4  GLU B 4   ? LYS B 14  ? GLU B 4   LYS B 14  
B 1  THR A 11  ? GLU A 14  ? THR A 11  GLU A 14  
B 2  LEU A 26  ? PRO A 38  ? LEU A 26  PRO A 38  
B 3  VAL A 53  ? SER A 57  ? VAL A 53  SER A 57  
B 4  THR B 92  ? THR B 95  ? THR B 92  THR B 95  
C 1  CYS A 59  ? VAL A 70  ? CYS A 59  VAL A 70  
C 2  PHE A 74  ? SER A 85  ? PHE A 74  SER A 85  
D 1  THR B 50  ? VAL B 63  ? THR B 50  VAL B 63  
D 2  SER B 72  ? GLY B 85  ? SER B 72  GLY B 85  
E 1  CYS C 7   ? CYS C 9   ? CYS C 23  CYS C 25  
E 2  VAL C 13  ? GLN C 17  ? VAL C 29  GLN C 33  
E 3  GLU C 34  ? VAL C 38  ? GLU C 50  VAL C 54  
E 4  LYS C 58  ? SER C 62  ? LYS C 74  SER C 78  
E 5  GLU C 83  ? GLU C 87  ? GLU C 99  GLU C 103 
E 6  TYR C 108 ? SER C 112 ? TYR C 124 SER C 128 
E 7  VAL C 131 ? GLN C 136 ? VAL C 147 GLN C 152 
E 8  VAL C 157 ? TRP C 160 ? VAL C 173 TRP C 176 
E 9  LEU C 179 ? ASN C 183 ? LEU C 195 ASN C 199 
E 10 ILE C 206 ? ASP C 208 ? ILE C 222 ASP C 224 
E 11 LYS C 227 ? ARG C 229 ? LYS C 243 ARG C 245 
E 12 THR C 233 ? TYR C 234 ? THR C 249 TYR C 250 
F 1  VAL C 44  ? ILE C 45  ? VAL C 60  ILE C 61  
F 2  VAL C 69  ? ILE C 70  ? VAL C 85  ILE C 86  
F 3  TYR C 94  ? ILE C 95  ? TYR C 110 ILE C 111 
G 1  PHE C 75  ? SER C 76  ? PHE C 91  SER C 92  
G 2  PHE C 100 ? GLN C 101 ? PHE C 116 GLN C 117 
H 1  THR C 143 ? ILE C 144 ? THR C 159 ILE C 160 
H 2  GLU C 168 ? ILE C 169 ? GLU C 184 ILE C 185 
I 1  THR D 11  ? GLU D 14  ? THR D 11  GLU D 14  
I 2  LEU D 26  ? PRO D 38  ? LEU D 26  PRO D 38  
I 3  CYS E 20  ? ARG E 35  ? CYS E 20  ARG E 35  
I 4  GLU E 4   ? GLU E 13  ? GLU E 4   GLU E 13  
J 1  THR D 11  ? GLU D 14  ? THR D 11  GLU D 14  
J 2  LEU D 26  ? PRO D 38  ? LEU D 26  PRO D 38  
J 3  VAL D 53  ? SER D 57  ? VAL D 53  SER D 57  
J 4  THR E 92  ? THR E 95  ? THR E 92  THR E 95  
K 1  CYS D 59  ? THR D 69  ? CYS D 59  THR D 69  
K 2  LYS D 75  ? SER D 85  ? LYS D 75  SER D 85  
L 1  THR E 50  ? VAL E 63  ? THR E 50  VAL E 63  
L 2  SER E 72  ? GLY E 85  ? SER E 72  GLY E 85  
M 1  HIS F 8   ? CYS F 9   ? HIS F 24  CYS F 25  
M 2  VAL F 13  ? GLN F 17  ? VAL F 29  GLN F 33  
M 3  GLU F 34  ? VAL F 38  ? GLU F 50  VAL F 54  
M 4  LYS F 58  ? SER F 62  ? LYS F 74  SER F 78  
M 5  GLU F 83  ? ALA F 89  ? GLU F 99  ALA F 105 
M 6  TYR F 108 ? THR F 114 ? TYR F 124 THR F 130 
M 7  VAL F 131 ? GLN F 136 ? VAL F 147 GLN F 152 
M 8  SER F 156 ? TRP F 160 ? SER F 172 TRP F 176 
M 9  GLN F 178 ? ASN F 183 ? GLN F 194 ASN F 199 
M 10 ILE F 206 ? ASP F 208 ? ILE F 222 ASP F 224 
M 11 LYS F 227 ? ARG F 229 ? LYS F 243 ARG F 245 
N 1  VAL F 44  ? ILE F 45  ? VAL F 60  ILE F 61  
N 2  VAL F 69  ? ILE F 70  ? VAL F 85  ILE F 86  
N 3  TYR F 94  ? ILE F 95  ? TYR F 110 ILE F 111 
O 1  PHE F 75  ? SER F 76  ? PHE F 91  SER F 92  
O 2  PHE F 100 ? GLN F 101 ? PHE F 116 GLN F 117 
P 1  THR F 143 ? ILE F 144 ? THR F 159 ILE F 160 
P 2  GLU F 168 ? ILE F 169 ? GLU F 184 ILE F 185 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N GLN A 13  ? N GLN A 13  O GLN A 27  ? O GLN A 27  
A 2  3  N GLY A 30  ? N GLY A 30  O THR B 34  ? O THR B 34  
A 3  4  O TRP B 27  ? O TRP B 27  N THR B 6   ? N THR B 6   
B 1  2  N GLN A 13  ? N GLN A 13  O GLN A 27  ? O GLN A 27  
B 2  3  N TYR A 37  ? N TYR A 37  O THR A 54  ? O THR A 54  
B 3  4  N SER A 55  ? N SER A 55  O ASP B 93  ? O ASP B 93  
C 1  2  N CYS A 59  ? N CYS A 59  O SER A 85  ? O SER A 85  
D 1  2  N THR B 50  ? N THR B 50  O GLY B 85  ? O GLY B 85  
E 1  2  N HIS C 8   ? N HIS C 24  O LEU C 15  ? O LEU C 31  
E 2  3  N PHE C 14  ? N PHE C 30  O ARG C 36  ? O ARG C 52  
E 3  4  N PHE C 37  ? N PHE C 53  O GLU C 60  ? O GLU C 76  
E 4  5  N ILE C 61  ? N ILE C 77  O ARG C 85  ? O ARG C 101 
E 5  6  N ILE C 84  ? N ILE C 100 O LEU C 110 ? O LEU C 126 
E 6  7  N LEU C 109 ? N LEU C 125 O ASP C 134 ? O ASP C 150 
E 7  8  N LEU C 133 ? N LEU C 149 O TRP C 160 ? O TRP C 176 
E 8  9  N LEU C 159 ? N LEU C 175 O GLU C 181 ? O GLU C 197 
E 9  10 N LEU C 182 ? N LEU C 198 O ASP C 208 ? O ASP C 224 
E 10 11 N LEU C 207 ? N LEU C 223 O LYS C 227 ? O LYS C 243 
E 11 12 N LEU C 228 ? N LEU C 244 O TYR C 234 ? O TYR C 250 
F 1  2  N ILE C 45  ? N ILE C 61  O VAL C 69  ? O VAL C 85  
F 2  3  N ILE C 70  ? N ILE C 86  O TYR C 94  ? O TYR C 110 
G 1  2  N PHE C 75  ? N PHE C 91  O GLN C 101 ? O GLN C 117 
H 1  2  N ILE C 144 ? N ILE C 160 O GLU C 168 ? O GLU C 184 
I 1  2  N GLN D 13  ? N GLN D 13  O GLN D 27  ? O GLN D 27  
I 2  3  N GLY D 30  ? N GLY D 30  O THR E 34  ? O THR E 34  
I 3  4  O TRP E 27  ? O TRP E 27  N THR E 6   ? N THR E 6   
J 1  2  N GLN D 13  ? N GLN D 13  O GLN D 27  ? O GLN D 27  
J 2  3  N TYR D 37  ? N TYR D 37  O THR D 54  ? O THR D 54  
J 3  4  N SER D 55  ? N SER D 55  O THR E 95  ? O THR E 95  
K 1  2  N ASN D 66  ? N ASN D 66  O ASN D 78  ? O ASN D 78  
L 1  2  N LYS E 54  ? N LYS E 54  O GLN E 81  ? O GLN E 81  
M 1  2  N HIS F 8   ? N HIS F 24  O LEU F 15  ? O LEU F 31  
M 2  3  N CYS F 16  ? N CYS F 32  O ARG F 36  ? O ARG F 52  
M 3  4  N LEU F 35  ? N LEU F 51  O GLU F 60  ? O GLU F 76  
M 4  5  N ILE F 61  ? N ILE F 77  O ARG F 85  ? O ARG F 101 
M 5  6  N ILE F 84  ? N ILE F 100 O LEU F 110 ? O LEU F 126 
M 6  7  N ILE F 111 ? N ILE F 127 O ASP F 134 ? O ASP F 150 
M 7  8  N VAL F 131 ? N VAL F 147 O ILE F 158 ? O ILE F 174 
M 8  9  N LEU F 159 ? N LEU F 175 O GLU F 181 ? O GLU F 197 
M 9  10 N LEU F 182 ? N LEU F 198 O ILE F 206 ? O ILE F 222 
M 10 11 N LEU F 207 ? N LEU F 223 O LYS F 227 ? O LYS F 243 
N 1  2  N ILE F 45  ? N ILE F 61  O VAL F 69  ? O VAL F 85  
N 2  3  N ILE F 70  ? N ILE F 86  O TYR F 94  ? O TYR F 110 
O 1  2  N PHE F 75  ? N PHE F 91  O GLN F 101 ? O GLN F 117 
P 1  2  N ILE F 144 ? N ILE F 160 O GLU F 168 ? O GLU F 184 
# 
_database_PDB_matrix.entry_id          1XWD 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1XWD 
_atom_sites.fract_transf_matrix[1][1]   0.008242 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001325 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014939 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006814 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 3   ? 1.686   16.663  50.979 1.00 114.63 ? 3   ASP A N   1 
ATOM   2    C CA  . ASP A 1 3   ? 2.759   17.561  50.481 1.00 114.93 ? 3   ASP A CA  1 
ATOM   3    C C   . ASP A 1 3   ? 3.980   17.530  51.403 1.00 114.85 ? 3   ASP A C   1 
ATOM   4    O O   . ASP A 1 3   ? 4.207   16.548  52.120 1.00 114.41 ? 3   ASP A O   1 
ATOM   5    C CB  . ASP A 1 3   ? 2.233   19.004  50.325 1.00 114.95 ? 3   ASP A CB  1 
ATOM   6    C CG  . ASP A 1 3   ? 1.923   19.686  51.662 1.00 114.93 ? 3   ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 3   ? 1.665   18.975  52.659 1.00 115.80 ? 3   ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 3   ? 1.922   20.935  51.777 1.00 114.45 ? 3   ASP A OD2 1 
ATOM   9    N N   . VAL A 1 4   ? 4.744   18.614  51.373 1.00 114.43 ? 4   VAL A N   1 
ATOM   10   C CA  . VAL A 1 4   ? 5.900   18.726  52.244 1.00 113.27 ? 4   VAL A CA  1 
ATOM   11   C C   . VAL A 1 4   ? 5.466   19.115  53.662 1.00 111.95 ? 4   VAL A C   1 
ATOM   12   O O   . VAL A 1 4   ? 5.662   20.264  54.102 1.00 111.03 ? 4   VAL A O   1 
ATOM   13   C CB  . VAL A 1 4   ? 6.991   19.714  51.711 1.00 113.94 ? 4   VAL A CB  1 
ATOM   14   C CG1 . VAL A 1 4   ? 8.237   19.723  52.637 1.00 113.02 ? 4   VAL A CG1 1 
ATOM   15   C CG2 . VAL A 1 4   ? 7.396   19.355  50.262 1.00 114.23 ? 4   VAL A CG2 1 
ATOM   16   N N   . GLN A 1 5   ? 4.847   18.153  54.356 1.00 110.13 ? 5   GLN A N   1 
ATOM   17   C CA  . GLN A 1 5   ? 4.785   18.191  55.819 1.00 107.50 ? 5   GLN A CA  1 
ATOM   18   C C   . GLN A 1 5   ? 6.234   17.913  56.204 1.00 105.01 ? 5   GLN A C   1 
ATOM   19   O O   . GLN A 1 5   ? 7.007   17.474  55.340 1.00 105.84 ? 5   GLN A O   1 
ATOM   20   C CB  . GLN A 1 5   ? 3.834   17.136  56.382 1.00 108.60 ? 5   GLN A CB  1 
ATOM   21   C CG  . GLN A 1 5   ? 4.173   15.696  55.994 1.00 110.03 ? 5   GLN A CG  1 
ATOM   22   C CD  . GLN A 1 5   ? 3.977   14.724  57.143 1.00 111.12 ? 5   GLN A CD  1 
ATOM   23   O OE1 . GLN A 1 5   ? 3.734   15.140  58.288 1.00 111.13 ? 5   GLN A OE1 1 
ATOM   24   N NE2 . GLN A 1 5   ? 4.087   13.414  56.896 1.00 112.29 ? 5   GLN A NE2 1 
ATOM   25   N N   . ASP A 1 6   ? 6.659   18.131  57.438 1.00 99.62  ? 6   ASP A N   1 
ATOM   26   C CA  . ASP A 1 6   ? 8.114   18.065  57.568 1.00 94.14  ? 6   ASP A CA  1 
ATOM   27   C C   . ASP A 1 6   ? 8.815   16.787  58.017 1.00 90.01  ? 6   ASP A C   1 
ATOM   28   O O   . ASP A 1 6   ? 8.491   16.155  59.026 1.00 89.00  ? 6   ASP A O   1 
ATOM   29   C CB  . ASP A 1 6   ? 8.695   19.324  58.212 1.00 94.64  ? 6   ASP A CB  1 
ATOM   30   C CG  . ASP A 1 6   ? 9.364   20.206  57.175 1.00 94.12  ? 6   ASP A CG  1 
ATOM   31   O OD1 . ASP A 1 6   ? 9.201   19.924  55.955 1.00 94.14  ? 6   ASP A OD1 1 
ATOM   32   O OD2 . ASP A 1 6   ? 10.069  21.183  57.504 1.00 95.36  ? 6   ASP A OD2 1 
ATOM   33   N N   . CYS A 1 7   ? 9.802   16.471  57.184 1.00 84.50  ? 7   CYS A N   1 
ATOM   34   C CA  . CYS A 1 7   ? 10.656  15.308  57.272 1.00 78.43  ? 7   CYS A CA  1 
ATOM   35   C C   . CYS A 1 7   ? 11.954  15.668  56.542 1.00 76.59  ? 7   CYS A C   1 
ATOM   36   O O   . CYS A 1 7   ? 12.003  15.628  55.309 1.00 74.72  ? 7   CYS A O   1 
ATOM   37   C CB  . CYS A 1 7   ? 9.975   14.111  56.610 1.00 76.07  ? 7   CYS A CB  1 
ATOM   38   S SG  . CYS A 1 7   ? 10.481  12.486  57.244 1.00 70.52  ? 7   CYS A SG  1 
ATOM   39   N N   . PRO A 1 8   ? 12.997  16.027  57.298 1.00 75.47  ? 8   PRO A N   1 
ATOM   40   C CA  . PRO A 1 8   ? 14.281  16.472  56.738 1.00 73.75  ? 8   PRO A CA  1 
ATOM   41   C C   . PRO A 1 8   ? 14.936  15.449  55.820 1.00 71.87  ? 8   PRO A C   1 
ATOM   42   O O   . PRO A 1 8   ? 14.933  14.260  56.115 1.00 71.77  ? 8   PRO A O   1 
ATOM   43   C CB  . PRO A 1 8   ? 15.146  16.686  57.978 1.00 74.26  ? 8   PRO A CB  1 
ATOM   44   C CG  . PRO A 1 8   ? 14.165  16.947  59.073 1.00 75.45  ? 8   PRO A CG  1 
ATOM   45   C CD  . PRO A 1 8   ? 13.023  16.020  58.773 1.00 75.82  ? 8   PRO A CD  1 
ATOM   46   N N   . GLU A 1 9   ? 15.509  15.929  54.722 1.00 70.29  ? 9   GLU A N   1 
ATOM   47   C CA  . GLU A 1 9   ? 16.174  15.081  53.739 1.00 68.10  ? 9   GLU A CA  1 
ATOM   48   C C   . GLU A 1 9   ? 17.359  14.312  54.317 1.00 64.37  ? 9   GLU A C   1 
ATOM   49   O O   . GLU A 1 9   ? 18.053  14.813  55.194 1.00 65.01  ? 9   GLU A O   1 
ATOM   50   C CB  . GLU A 1 9   ? 16.646  15.944  52.565 1.00 70.96  ? 9   GLU A CB  1 
ATOM   51   C CG  . GLU A 1 9   ? 17.889  15.412  51.861 1.00 76.55  ? 9   GLU A CG  1 
ATOM   52   C CD  . GLU A 1 9   ? 18.305  16.252  50.668 1.00 80.87  ? 9   GLU A CD  1 
ATOM   53   O OE1 . GLU A 1 9   ? 18.568  17.466  50.842 1.00 82.43  ? 9   GLU A OE1 1 
ATOM   54   O OE2 . GLU A 1 9   ? 18.375  15.688  49.554 1.00 83.51  ? 9   GLU A OE2 1 
ATOM   55   N N   . CYS A 1 10  ? 17.579  13.099  53.811 1.00 59.56  ? 10  CYS A N   1 
ATOM   56   C CA  . CYS A 1 10  ? 18.725  12.272  54.176 1.00 55.44  ? 10  CYS A CA  1 
ATOM   57   C C   . CYS A 1 10  ? 20.034  13.012  53.907 1.00 53.25  ? 10  CYS A C   1 
ATOM   58   O O   . CYS A 1 10  ? 20.294  13.434  52.784 1.00 50.97  ? 10  CYS A O   1 
ATOM   59   C CB  . CYS A 1 10  ? 18.678  10.959  53.382 1.00 55.19  ? 10  CYS A CB  1 
ATOM   60   S SG  . CYS A 1 10  ? 19.972  9.724   53.743 1.00 56.35  ? 10  CYS A SG  1 
ATOM   61   N N   . THR A 1 11  ? 20.832  13.193  54.958 1.00 53.08  ? 11  THR A N   1 
ATOM   62   C CA  . THR A 1 11  ? 22.136  13.859  54.860 1.00 54.79  ? 11  THR A CA  1 
ATOM   63   C C   . THR A 1 11  ? 23.069  13.507  56.019 1.00 53.85  ? 11  THR A C   1 
ATOM   64   O O   . THR A 1 11  ? 22.686  12.788  56.948 1.00 53.65  ? 11  THR A O   1 
ATOM   65   C CB  . THR A 1 11  ? 21.998  15.401  54.824 1.00 56.30  ? 11  THR A CB  1 
ATOM   66   O OG1 . THR A 1 11  ? 20.650  15.770  54.512 1.00 60.09  ? 11  THR A OG1 1 
ATOM   67   C CG2 . THR A 1 11  ? 22.861  16.002  53.694 1.00 56.64  ? 11  THR A CG2 1 
ATOM   68   N N   . LEU A 1 12  ? 24.295  14.028  55.944 1.00 53.69  ? 12  LEU A N   1 
ATOM   69   C CA  . LEU A 1 12  ? 25.289  13.894  57.006 1.00 51.97  ? 12  LEU A CA  1 
ATOM   70   C C   . LEU A 1 12  ? 24.963  14.861  58.122 1.00 51.87  ? 12  LEU A C   1 
ATOM   71   O O   . LEU A 1 12  ? 24.569  16.000  57.867 1.00 51.52  ? 12  LEU A O   1 
ATOM   72   C CB  . LEU A 1 12  ? 26.684  14.224  56.489 1.00 50.62  ? 12  LEU A CB  1 
ATOM   73   C CG  . LEU A 1 12  ? 27.348  13.220  55.560 1.00 49.76  ? 12  LEU A CG  1 
ATOM   74   C CD1 . LEU A 1 12  ? 28.542  13.861  54.901 1.00 49.61  ? 12  LEU A CD1 1 
ATOM   75   C CD2 . LEU A 1 12  ? 27.751  11.989  56.327 1.00 50.11  ? 12  LEU A CD2 1 
ATOM   76   N N   . GLN A 1 13  ? 25.113  14.384  59.351 1.00 50.98  ? 13  GLN A N   1 
ATOM   77   C CA  . GLN A 1 13  ? 24.916  15.183  60.540 1.00 50.44  ? 13  GLN A CA  1 
ATOM   78   C C   . GLN A 1 13  ? 26.003  14.771  61.496 1.00 52.45  ? 13  GLN A C   1 
ATOM   79   O O   . GLN A 1 13  ? 26.586  13.695  61.340 1.00 52.04  ? 13  GLN A O   1 
ATOM   80   C CB  . GLN A 1 13  ? 23.574  14.866  61.168 1.00 50.51  ? 13  GLN A CB  1 
ATOM   81   C CG  . GLN A 1 13  ? 22.392  15.212  60.307 1.00 53.05  ? 13  GLN A CG  1 
ATOM   82   C CD  . GLN A 1 13  ? 22.176  16.692  60.186 1.00 52.49  ? 13  GLN A CD  1 
ATOM   83   O OE1 . GLN A 1 13  ? 23.057  17.490  60.507 1.00 55.61  ? 13  GLN A OE1 1 
ATOM   84   N NE2 . GLN A 1 13  ? 20.996  17.073  59.727 1.00 51.84  ? 13  GLN A NE2 1 
ATOM   85   N N   . GLU A 1 14  ? 26.284  15.606  62.490 1.00 52.33  ? 14  GLU A N   1 
ATOM   86   C CA  . GLU A 1 14  ? 27.256  15.191  63.481 1.00 53.43  ? 14  GLU A CA  1 
ATOM   87   C C   . GLU A 1 14  ? 26.621  14.442  64.643 1.00 52.54  ? 14  GLU A C   1 
ATOM   88   O O   . GLU A 1 14  ? 25.559  14.815  65.130 1.00 52.70  ? 14  GLU A O   1 
ATOM   89   C CB  . GLU A 1 14  ? 28.087  16.362  63.973 1.00 56.73  ? 14  GLU A CB  1 
ATOM   90   C CG  . GLU A 1 14  ? 27.331  17.465  64.670 1.00 60.51  ? 14  GLU A CG  1 
ATOM   91   C CD  . GLU A 1 14  ? 28.292  18.417  65.343 1.00 64.33  ? 14  GLU A CD  1 
ATOM   92   O OE1 . GLU A 1 14  ? 29.076  17.948  66.208 1.00 65.08  ? 14  GLU A OE1 1 
ATOM   93   O OE2 . GLU A 1 14  ? 28.271  19.620  64.996 1.00 67.18  ? 14  GLU A OE2 1 
ATOM   94   N N   . ASN A 1 15  ? 27.286  13.372  65.062 1.00 50.80  ? 15  ASN A N   1 
ATOM   95   C CA  . ASN A 1 15  ? 26.835  12.544  66.168 1.00 48.90  ? 15  ASN A CA  1 
ATOM   96   C C   . ASN A 1 15  ? 27.163  13.238  67.484 1.00 48.14  ? 15  ASN A C   1 
ATOM   97   O O   . ASN A 1 15  ? 28.325  13.407  67.816 1.00 49.28  ? 15  ASN A O   1 
ATOM   98   C CB  . ASN A 1 15  ? 27.528  11.193  66.079 1.00 48.61  ? 15  ASN A CB  1 
ATOM   99   C CG  . ASN A 1 15  ? 26.967  10.179  67.046 1.00 51.32  ? 15  ASN A CG  1 
ATOM   100  O OD1 . ASN A 1 15  ? 26.384  9.172   66.642 1.00 52.94  ? 15  ASN A OD1 1 
ATOM   101  N ND2 . ASN A 1 15  ? 27.153  10.429  68.332 1.00 52.06  ? 15  ASN A ND2 1 
ATOM   102  N N   . PRO A 1 16  ? 26.145  13.614  68.256 1.00 48.17  ? 16  PRO A N   1 
ATOM   103  C CA  . PRO A 1 16  ? 26.374  14.364  69.490 1.00 48.22  ? 16  PRO A CA  1 
ATOM   104  C C   . PRO A 1 16  ? 27.185  13.598  70.527 1.00 48.71  ? 16  PRO A C   1 
ATOM   105  O O   . PRO A 1 16  ? 27.912  14.198  71.302 1.00 52.35  ? 16  PRO A O   1 
ATOM   106  C CB  . PRO A 1 16  ? 24.962  14.615  70.025 1.00 48.32  ? 16  PRO A CB  1 
ATOM   107  C CG  . PRO A 1 16  ? 24.061  14.350  68.903 1.00 48.10  ? 16  PRO A CG  1 
ATOM   108  C CD  . PRO A 1 16  ? 24.722  13.298  68.069 1.00 48.76  ? 16  PRO A CD  1 
ATOM   109  N N   . PHE A 1 17  ? 27.070  12.278  70.535 1.00 48.44  ? 17  PHE A N   1 
ATOM   110  C CA  . PHE A 1 17  ? 27.707  11.467  71.561 1.00 48.29  ? 17  PHE A CA  1 
ATOM   111  C C   . PHE A 1 17  ? 29.166  11.139  71.288 1.00 49.50  ? 17  PHE A C   1 
ATOM   112  O O   . PHE A 1 17  ? 29.922  10.924  72.222 1.00 50.77  ? 17  PHE A O   1 
ATOM   113  C CB  . PHE A 1 17  ? 26.924  10.173  71.757 1.00 46.71  ? 17  PHE A CB  1 
ATOM   114  C CG  . PHE A 1 17  ? 25.468  10.323  71.525 1.00 44.46  ? 17  PHE A CG  1 
ATOM   115  C CD1 . PHE A 1 17  ? 24.954  10.276  70.242 1.00 43.03  ? 17  PHE A CD1 1 
ATOM   116  C CD2 . PHE A 1 17  ? 24.608  10.541  72.580 1.00 45.23  ? 17  PHE A CD2 1 
ATOM   117  C CE1 . PHE A 1 17  ? 23.609  10.435  70.017 1.00 45.56  ? 17  PHE A CE1 1 
ATOM   118  C CE2 . PHE A 1 17  ? 23.255  10.700  72.362 1.00 45.80  ? 17  PHE A CE2 1 
ATOM   119  C CZ  . PHE A 1 17  ? 22.755  10.649  71.076 1.00 45.67  ? 17  PHE A CZ  1 
ATOM   120  N N   . PHE A 1 18  ? 29.570  11.081  70.026 1.00 51.08  ? 18  PHE A N   1 
ATOM   121  C CA  . PHE A 1 18  ? 30.957  10.760  69.719 1.00 54.95  ? 18  PHE A CA  1 
ATOM   122  C C   . PHE A 1 18  ? 31.746  11.944  69.142 1.00 58.28  ? 18  PHE A C   1 
ATOM   123  O O   . PHE A 1 18  ? 32.966  11.849  68.949 1.00 58.99  ? 18  PHE A O   1 
ATOM   124  C CB  . PHE A 1 18  ? 31.049  9.578   68.756 1.00 56.32  ? 18  PHE A CB  1 
ATOM   125  C CG  . PHE A 1 18  ? 30.409  8.314   69.258 1.00 56.94  ? 18  PHE A CG  1 
ATOM   126  C CD1 . PHE A 1 18  ? 31.131  7.416   70.039 1.00 57.80  ? 18  PHE A CD1 1 
ATOM   127  C CD2 . PHE A 1 18  ? 29.103  7.996   68.906 1.00 57.12  ? 18  PHE A CD2 1 
ATOM   128  C CE1 . PHE A 1 18  ? 30.550  6.238   70.486 1.00 58.92  ? 18  PHE A CE1 1 
ATOM   129  C CE2 . PHE A 1 18  ? 28.511  6.825   69.346 1.00 58.49  ? 18  PHE A CE2 1 
ATOM   130  C CZ  . PHE A 1 18  ? 29.238  5.939   70.130 1.00 60.01  ? 18  PHE A CZ  1 
ATOM   131  N N   . SER A 1 19  ? 31.054  13.048  68.858 1.00 60.81  ? 19  SER A N   1 
ATOM   132  C CA  . SER A 1 19  ? 31.706  14.270  68.379 1.00 63.86  ? 19  SER A CA  1 
ATOM   133  C C   . SER A 1 19  ? 32.512  15.004  69.472 1.00 65.65  ? 19  SER A C   1 
ATOM   134  O O   . SER A 1 19  ? 32.153  14.975  70.655 1.00 65.61  ? 19  SER A O   1 
ATOM   135  C CB  . SER A 1 19  ? 30.677  15.234  67.772 1.00 64.09  ? 19  SER A CB  1 
ATOM   136  O OG  . SER A 1 19  ? 30.310  14.856  66.457 1.00 63.38  ? 19  SER A OG  1 
ATOM   137  N N   . GLN A 1 20  ? 33.598  15.654  69.045 1.00 67.61  ? 20  GLN A N   1 
ATOM   138  C CA  . GLN A 1 20  ? 34.448  16.513  69.888 1.00 69.18  ? 20  GLN A CA  1 
ATOM   139  C C   . GLN A 1 20  ? 34.771  17.809  69.150 1.00 70.13  ? 20  GLN A C   1 
ATOM   140  O O   . GLN A 1 20  ? 34.804  17.817  67.917 1.00 72.43  ? 20  GLN A O   1 
ATOM   141  C CB  . GLN A 1 20  ? 35.762  15.821  70.207 1.00 68.55  ? 20  GLN A CB  1 
ATOM   142  C CG  . GLN A 1 20  ? 35.819  15.214  71.576 1.00 70.10  ? 20  GLN A CG  1 
ATOM   143  C CD  . GLN A 1 20  ? 36.764  14.050  71.610 1.00 71.43  ? 20  GLN A CD  1 
ATOM   144  O OE1 . GLN A 1 20  ? 36.580  13.077  70.877 1.00 72.61  ? 20  GLN A OE1 1 
ATOM   145  N NE2 . GLN A 1 20  ? 37.786  14.136  72.451 1.00 73.09  ? 20  GLN A NE2 1 
ATOM   146  N N   . PRO A 1 21  ? 35.031  18.901  69.880 1.00 70.15  ? 21  PRO A N   1 
ATOM   147  C CA  . PRO A 1 21  ? 35.404  20.158  69.224 1.00 68.78  ? 21  PRO A CA  1 
ATOM   148  C C   . PRO A 1 21  ? 36.691  19.965  68.422 1.00 66.69  ? 21  PRO A C   1 
ATOM   149  O O   . PRO A 1 21  ? 37.665  19.401  68.933 1.00 65.54  ? 21  PRO A O   1 
ATOM   150  C CB  . PRO A 1 21  ? 35.596  21.129  70.393 1.00 69.05  ? 21  PRO A CB  1 
ATOM   151  C CG  . PRO A 1 21  ? 34.798  20.531  71.504 1.00 69.97  ? 21  PRO A CG  1 
ATOM   152  C CD  . PRO A 1 21  ? 34.995  19.046  71.346 1.00 70.25  ? 21  PRO A CD  1 
ATOM   153  N N   . GLY A 1 22  ? 36.665  20.404  67.165 1.00 64.82  ? 22  GLY A N   1 
ATOM   154  C CA  . GLY A 1 22  ? 37.790  20.219  66.258 1.00 62.80  ? 22  GLY A CA  1 
ATOM   155  C C   . GLY A 1 22  ? 37.763  18.911  65.478 1.00 61.37  ? 22  GLY A C   1 
ATOM   156  O O   . GLY A 1 22  ? 38.336  18.827  64.397 1.00 60.62  ? 22  GLY A O   1 
ATOM   157  N N   . ALA A 1 23  ? 37.105  17.887  66.024 1.00 60.50  ? 23  ALA A N   1 
ATOM   158  C CA  . ALA A 1 23  ? 37.049  16.573  65.374 1.00 59.34  ? 23  ALA A CA  1 
ATOM   159  C C   . ALA A 1 23  ? 35.685  15.869  65.508 1.00 58.02  ? 23  ALA A C   1 
ATOM   160  O O   . ALA A 1 23  ? 35.506  14.993  66.359 1.00 59.47  ? 23  ALA A O   1 
ATOM   161  C CB  . ALA A 1 23  ? 38.184  15.672  65.894 1.00 58.88  ? 23  ALA A CB  1 
ATOM   162  N N   . PRO A 1 24  ? 34.724  16.236  64.659 1.00 55.64  ? 24  PRO A N   1 
ATOM   163  C CA  . PRO A 1 24  ? 33.408  15.619  64.713 1.00 54.78  ? 24  PRO A CA  1 
ATOM   164  C C   . PRO A 1 24  ? 33.373  14.313  63.922 1.00 54.85  ? 24  PRO A C   1 
ATOM   165  O O   . PRO A 1 24  ? 34.123  14.162  62.956 1.00 54.97  ? 24  PRO A O   1 
ATOM   166  C CB  . PRO A 1 24  ? 32.519  16.661  64.030 1.00 54.92  ? 24  PRO A CB  1 
ATOM   167  C CG  . PRO A 1 24  ? 33.421  17.307  63.010 1.00 53.74  ? 24  PRO A CG  1 
ATOM   168  C CD  . PRO A 1 24  ? 34.815  17.243  63.582 1.00 55.25  ? 24  PRO A CD  1 
ATOM   169  N N   . ILE A 1 25  ? 32.524  13.373  64.343 1.00 52.97  ? 25  ILE A N   1 
ATOM   170  C CA  . ILE A 1 25  ? 32.190  12.218  63.510 1.00 49.85  ? 25  ILE A CA  1 
ATOM   171  C C   . ILE A 1 25  ? 30.754  12.386  63.003 1.00 48.21  ? 25  ILE A C   1 
ATOM   172  O O   . ILE A 1 25  ? 29.866  12.813  63.744 1.00 46.14  ? 25  ILE A O   1 
ATOM   173  C CB  . ILE A 1 25  ? 32.339  10.880  64.248 1.00 50.01  ? 25  ILE A CB  1 
ATOM   174  C CG1 . ILE A 1 25  ? 31.350  10.793  65.391 1.00 49.60  ? 25  ILE A CG1 1 
ATOM   175  C CG2 . ILE A 1 25  ? 33.761  10.668  64.737 1.00 48.37  ? 25  ILE A CG2 1 
ATOM   176  C CD1 . ILE A 1 25  ? 30.564  9.538   65.316 1.00 51.63  ? 25  ILE A CD1 1 
ATOM   177  N N   . LEU A 1 26  ? 30.535  12.051  61.735 1.00 47.59  ? 26  LEU A N   1 
ATOM   178  C CA  . LEU A 1 26  ? 29.242  12.312  61.094 1.00 46.71  ? 26  LEU A CA  1 
ATOM   179  C C   . LEU A 1 26  ? 28.394  11.070  60.855 1.00 45.03  ? 26  LEU A C   1 
ATOM   180  O O   . LEU A 1 26  ? 28.894  9.948   60.836 1.00 44.17  ? 26  LEU A O   1 
ATOM   181  C CB  . LEU A 1 26  ? 29.426  13.112  59.801 1.00 46.67  ? 26  LEU A CB  1 
ATOM   182  C CG  . LEU A 1 26  ? 29.766  14.592  59.963 1.00 45.54  ? 26  LEU A CG  1 
ATOM   183  C CD1 . LEU A 1 26  ? 31.255  14.773  60.094 1.00 47.70  ? 26  LEU A CD1 1 
ATOM   184  C CD2 . LEU A 1 26  ? 29.270  15.355  58.758 1.00 49.54  ? 26  LEU A CD2 1 
ATOM   185  N N   . GLN A 1 27  ? 27.098  11.286  60.680 1.00 44.68  ? 27  GLN A N   1 
ATOM   186  C CA  . GLN A 1 27  ? 26.148  10.185  60.605 1.00 46.34  ? 27  GLN A CA  1 
ATOM   187  C C   . GLN A 1 27  ? 24.999  10.483  59.637 1.00 47.31  ? 27  GLN A C   1 
ATOM   188  O O   . GLN A 1 27  ? 24.500  11.615  59.573 1.00 48.73  ? 27  GLN A O   1 
ATOM   189  C CB  . GLN A 1 27  ? 25.624  9.887   62.016 1.00 43.95  ? 27  GLN A CB  1 
ATOM   190  C CG  . GLN A 1 27  ? 24.661  8.742   62.122 1.00 41.87  ? 27  GLN A CG  1 
ATOM   191  C CD  . GLN A 1 27  ? 24.235  8.469   63.546 1.00 40.83  ? 27  GLN A CD  1 
ATOM   192  O OE1 . GLN A 1 27  ? 24.345  9.334   64.418 1.00 41.04  ? 27  GLN A OE1 1 
ATOM   193  N NE2 . GLN A 1 27  ? 23.730  7.268   63.787 1.00 40.25  ? 27  GLN A NE2 1 
ATOM   194  N N   . CYS A 1 28  ? 24.617  9.463   58.868 1.00 47.81  ? 28  CYS A N   1 
ATOM   195  C CA  . CYS A 1 28  ? 23.486  9.538   57.939 1.00 48.52  ? 28  CYS A CA  1 
ATOM   196  C C   . CYS A 1 28  ? 22.146  9.336   58.643 1.00 46.68  ? 28  CYS A C   1 
ATOM   197  O O   . CYS A 1 28  ? 21.854  8.255   59.168 1.00 45.80  ? 28  CYS A O   1 
ATOM   198  C CB  . CYS A 1 28  ? 23.618  8.487   56.834 1.00 50.69  ? 28  CYS A CB  1 
ATOM   199  S SG  . CYS A 1 28  ? 25.000  8.791   55.721 1.00 56.87  ? 28  CYS A SG  1 
ATOM   200  N N   . MET A 1 29  ? 21.342  10.391  58.658 1.00 43.61  ? 29  MET A N   1 
ATOM   201  C CA  . MET A 1 29  ? 19.991  10.310  59.162 1.00 42.09  ? 29  MET A CA  1 
ATOM   202  C C   . MET A 1 29  ? 19.155  11.234  58.313 1.00 43.22  ? 29  MET A C   1 
ATOM   203  O O   . MET A 1 29  ? 19.687  12.147  57.680 1.00 40.57  ? 29  MET A O   1 
ATOM   204  C CB  . MET A 1 29  ? 19.927  10.705  60.625 1.00 43.29  ? 29  MET A CB  1 
ATOM   205  C CG  . MET A 1 29  ? 20.554  12.047  60.970 1.00 40.75  ? 29  MET A CG  1 
ATOM   206  S SD  . MET A 1 29  ? 20.810  12.190  62.744 1.00 40.08  ? 29  MET A SD  1 
ATOM   207  C CE  . MET A 1 29  ? 22.294  11.220  62.942 1.00 35.40  ? 29  MET A CE  1 
ATOM   208  N N   . GLY A 1 30  ? 17.852  10.983  58.285 1.00 44.35  ? 30  GLY A N   1 
ATOM   209  C CA  . GLY A 1 30  ? 16.954  11.761  57.447 1.00 44.71  ? 30  GLY A CA  1 
ATOM   210  C C   . GLY A 1 30  ? 15.802  10.973  56.858 1.00 43.69  ? 30  GLY A C   1 
ATOM   211  O O   . GLY A 1 30  ? 15.454  9.901   57.339 1.00 44.32  ? 30  GLY A O   1 
ATOM   212  N N   . CYS A 1 31  ? 15.216  11.508  55.799 1.00 45.08  ? 31  CYS A N   1 
ATOM   213  C CA  . CYS A 1 31  ? 13.982  10.965  55.280 1.00 46.57  ? 31  CYS A CA  1 
ATOM   214  C C   . CYS A 1 31  ? 14.064  10.536  53.848 1.00 45.66  ? 31  CYS A C   1 
ATOM   215  O O   . CYS A 1 31  ? 14.518  11.292  52.994 1.00 47.88  ? 31  CYS A O   1 
ATOM   216  C CB  . CYS A 1 31  ? 12.879  11.988  55.429 1.00 49.70  ? 31  CYS A CB  1 
ATOM   217  S SG  . CYS A 1 31  ? 12.495  12.289  57.159 1.00 57.71  ? 31  CYS A SG  1 
ATOM   218  N N   . CYS A 1 32  ? 13.603  9.313   53.600 1.00 45.00  ? 32  CYS A N   1 
ATOM   219  C CA  . CYS A 1 32  ? 13.554  8.729   52.265 1.00 41.34  ? 32  CYS A CA  1 
ATOM   220  C C   . CYS A 1 32  ? 12.127  8.456   51.848 1.00 40.75  ? 32  CYS A C   1 
ATOM   221  O O   . CYS A 1 32  ? 11.222  8.417   52.691 1.00 40.47  ? 32  CYS A O   1 
ATOM   222  C CB  . CYS A 1 32  ? 14.323  7.441   52.273 1.00 40.79  ? 32  CYS A CB  1 
ATOM   223  S SG  . CYS A 1 32  ? 16.013  7.797   52.699 1.00 41.52  ? 32  CYS A SG  1 
ATOM   224  N N   . PHE A 1 33  ? 11.915  8.283   50.547 1.00 38.58  ? 33  PHE A N   1 
ATOM   225  C CA  . PHE A 1 33  ? 10.582  7.980   50.059 1.00 34.65  ? 33  PHE A CA  1 
ATOM   226  C C   . PHE A 1 33  ? 10.281  6.498   50.098 1.00 32.07  ? 33  PHE A C   1 
ATOM   227  O O   . PHE A 1 33  ? 11.158  5.682   49.859 1.00 32.73  ? 33  PHE A O   1 
ATOM   228  C CB  . PHE A 1 33  ? 10.420  8.448   48.634 1.00 35.33  ? 33  PHE A CB  1 
ATOM   229  C CG  . PHE A 1 33  ? 9.067   8.191   48.093 1.00 34.30  ? 33  PHE A CG  1 
ATOM   230  C CD1 . PHE A 1 33  ? 8.002   9.007   48.465 1.00 34.07  ? 33  PHE A CD1 1 
ATOM   231  C CD2 . PHE A 1 33  ? 8.840   7.111   47.253 1.00 31.93  ? 33  PHE A CD2 1 
ATOM   232  C CE1 . PHE A 1 33  ? 6.735   8.757   47.994 1.00 36.24  ? 33  PHE A CE1 1 
ATOM   233  C CE2 . PHE A 1 33  ? 7.582   6.847   46.768 1.00 34.52  ? 33  PHE A CE2 1 
ATOM   234  C CZ  . PHE A 1 33  ? 6.520   7.668   47.134 1.00 38.25  ? 33  PHE A CZ  1 
ATOM   235  N N   . SER A 1 34  ? 9.030   6.158   50.369 1.00 31.76  ? 34  SER A N   1 
ATOM   236  C CA  . SER A 1 34  ? 8.587   4.764   50.357 1.00 33.74  ? 34  SER A CA  1 
ATOM   237  C C   . SER A 1 34  ? 7.094   4.745   50.118 1.00 32.89  ? 34  SER A C   1 
ATOM   238  O O   . SER A 1 34  ? 6.458   5.808   50.180 1.00 30.86  ? 34  SER A O   1 
ATOM   239  C CB  . SER A 1 34  ? 8.891   4.100   51.694 1.00 34.89  ? 34  SER A CB  1 
ATOM   240  O OG  . SER A 1 34  ? 8.475   4.938   52.763 1.00 42.58  ? 34  SER A OG  1 
ATOM   241  N N   . ARG A 1 35  ? 6.534   3.554   49.869 1.00 30.20  ? 35  ARG A N   1 
ATOM   242  C CA  . ARG A 1 35  ? 5.097   3.423   49.567 1.00 30.35  ? 35  ARG A CA  1 
ATOM   243  C C   . ARG A 1 35  ? 4.564   1.992   49.497 1.00 30.48  ? 35  ARG A C   1 
ATOM   244  O O   . ARG A 1 35  ? 5.302   1.042   49.207 1.00 30.53  ? 35  ARG A O   1 
ATOM   245  C CB  . ARG A 1 35  ? 4.758   4.126   48.257 1.00 28.21  ? 35  ARG A CB  1 
ATOM   246  C CG  . ARG A 1 35  ? 5.393   3.496   47.051 1.00 29.41  ? 35  ARG A CG  1 
ATOM   247  C CD  . ARG A 1 35  ? 4.768   3.963   45.772 1.00 31.76  ? 35  ARG A CD  1 
ATOM   248  N NE  . ARG A 1 35  ? 5.428   3.397   44.610 1.00 31.80  ? 35  ARG A NE  1 
ATOM   249  C CZ  . ARG A 1 35  ? 4.931   3.442   43.383 1.00 31.01  ? 35  ARG A CZ  1 
ATOM   250  N NH1 . ARG A 1 35  ? 3.749   4.016   43.146 1.00 28.98  ? 35  ARG A NH1 1 
ATOM   251  N NH2 . ARG A 1 35  ? 5.621   2.892   42.395 1.00 29.71  ? 35  ARG A NH2 1 
ATOM   252  N N   . ALA A 1 36  ? 3.265   1.847   49.750 1.00 29.47  ? 36  ALA A N   1 
ATOM   253  C CA  . ALA A 1 36  ? 2.633   0.542   49.689 1.00 31.40  ? 36  ALA A CA  1 
ATOM   254  C C   . ALA A 1 36  ? 1.445   0.600   48.740 1.00 32.44  ? 36  ALA A C   1 
ATOM   255  O O   . ALA A 1 36  ? 0.836   1.658   48.574 1.00 35.41  ? 36  ALA A O   1 
ATOM   256  C CB  . ALA A 1 36  ? 2.191   0.139   51.039 1.00 31.24  ? 36  ALA A CB  1 
ATOM   257  N N   . TYR A 1 37  ? 1.123   -0.537  48.126 1.00 31.69  ? 37  TYR A N   1 
ATOM   258  C CA  . TYR A 1 37  ? 0.056   -0.627  47.133 1.00 30.79  ? 37  TYR A CA  1 
ATOM   259  C C   . TYR A 1 37  ? -0.274  -2.090  46.777 1.00 31.20  ? 37  TYR A C   1 
ATOM   260  O O   . TYR A 1 37  ? 0.553   -2.985  46.951 1.00 31.07  ? 37  TYR A O   1 
ATOM   261  C CB  . TYR A 1 37  ? 0.446   0.158   45.876 1.00 30.67  ? 37  TYR A CB  1 
ATOM   262  C CG  . TYR A 1 37  ? 1.671   -0.371  45.171 1.00 27.37  ? 37  TYR A CG  1 
ATOM   263  C CD1 . TYR A 1 37  ? 1.580   -1.451  44.313 1.00 24.29  ? 37  TYR A CD1 1 
ATOM   264  C CD2 . TYR A 1 37  ? 2.924   0.212   45.365 1.00 27.01  ? 37  TYR A CD2 1 
ATOM   265  C CE1 . TYR A 1 37  ? 2.699   -1.951  43.669 1.00 25.10  ? 37  TYR A CE1 1 
ATOM   266  C CE2 . TYR A 1 37  ? 4.059   -0.287  44.718 1.00 25.18  ? 37  TYR A CE2 1 
ATOM   267  C CZ  . TYR A 1 37  ? 3.930   -1.370  43.876 1.00 24.58  ? 37  TYR A CZ  1 
ATOM   268  O OH  . TYR A 1 37  ? 5.025   -1.899  43.232 1.00 25.55  ? 37  TYR A OH  1 
ATOM   269  N N   . PRO A 1 38  ? -1.484  -2.333  46.280 1.00 31.79  ? 38  PRO A N   1 
ATOM   270  C CA  . PRO A 1 38  ? -1.941  -3.671  45.932 1.00 31.46  ? 38  PRO A CA  1 
ATOM   271  C C   . PRO A 1 38  ? -1.005  -4.412  44.985 1.00 31.81  ? 38  PRO A C   1 
ATOM   272  O O   . PRO A 1 38  ? -0.645  -3.885  43.935 1.00 32.27  ? 38  PRO A O   1 
ATOM   273  C CB  . PRO A 1 38  ? -3.265  -3.394  45.237 1.00 29.87  ? 38  PRO A CB  1 
ATOM   274  C CG  . PRO A 1 38  ? -3.744  -2.198  45.898 1.00 31.31  ? 38  PRO A CG  1 
ATOM   275  C CD  . PRO A 1 38  ? -2.534  -1.334  46.017 1.00 32.12  ? 38  PRO A CD  1 
ATOM   276  N N   . THR A 1 39  ? -0.630  -5.634  45.343 1.00 31.81  ? 39  THR A N   1 
ATOM   277  C CA  . THR A 1 39  ? 0.213   -6.424  44.471 1.00 33.92  ? 39  THR A CA  1 
ATOM   278  C C   . THR A 1 39  ? -0.418  -6.714  43.097 1.00 36.93  ? 39  THR A C   1 
ATOM   279  O O   . THR A 1 39  ? -1.506  -7.300  42.990 1.00 36.48  ? 39  THR A O   1 
ATOM   280  C CB  . THR A 1 39  ? 0.571   -7.741  45.130 1.00 31.63  ? 39  THR A CB  1 
ATOM   281  O OG1 . THR A 1 39  ? 1.246   -7.486  46.356 1.00 31.55  ? 39  THR A OG1 1 
ATOM   282  C CG2 . THR A 1 39  ? 1.595   -8.462  44.315 1.00 32.59  ? 39  THR A CG2 1 
ATOM   283  N N   . PRO A 1 40  ? 0.269   -6.286  42.046 1.00 37.27  ? 40  PRO A N   1 
ATOM   284  C CA  . PRO A 1 40  ? -0.132  -6.576  40.690 1.00 38.46  ? 40  PRO A CA  1 
ATOM   285  C C   . PRO A 1 40  ? -0.359  -8.059  40.518 1.00 43.28  ? 40  PRO A C   1 
ATOM   286  O O   . PRO A 1 40  ? 0.481   -8.874  40.909 1.00 45.14  ? 40  PRO A O   1 
ATOM   287  C CB  . PRO A 1 40  ? 1.088   -6.160  39.903 1.00 37.89  ? 40  PRO A CB  1 
ATOM   288  C CG  . PRO A 1 40  ? 1.575   -5.013  40.646 1.00 39.09  ? 40  PRO A CG  1 
ATOM   289  C CD  . PRO A 1 40  ? 1.442   -5.403  42.081 1.00 38.26  ? 40  PRO A CD  1 
ATOM   290  N N   . LEU A 1 41  ? -1.496  -8.406  39.926 1.00 47.92  ? 41  LEU A N   1 
ATOM   291  C CA  . LEU A 1 41  ? -1.815  -9.801  39.640 1.00 49.23  ? 41  LEU A CA  1 
ATOM   292  C C   . LEU A 1 41  ? -0.645  -10.508 38.997 1.00 48.29  ? 41  LEU A C   1 
ATOM   293  O O   . LEU A 1 41  ? -0.367  -11.657 39.319 1.00 51.19  ? 41  LEU A O   1 
ATOM   294  C CB  . LEU A 1 41  ? -3.053  -9.913  38.746 1.00 50.59  ? 41  LEU A CB  1 
ATOM   295  C CG  . LEU A 1 41  ? -4.352  -10.445 39.370 1.00 53.57  ? 41  LEU A CG  1 
ATOM   296  C CD1 . LEU A 1 41  ? -4.557  -9.960  40.802 1.00 55.10  ? 41  LEU A CD1 1 
ATOM   297  C CD2 . LEU A 1 41  ? -5.548  -10.042 38.516 1.00 57.61  ? 41  LEU A CD2 1 
ATOM   298  N N   . ARG A 1 42  ? 0.053   -9.819  38.101 1.00 48.65  ? 42  ARG A N   1 
ATOM   299  C CA  . ARG A 1 42  ? 1.186   -10.430 37.418 1.00 48.78  ? 42  ARG A CA  1 
ATOM   300  C C   . ARG A 1 42  ? 2.262   -10.847 38.414 1.00 49.53  ? 42  ARG A C   1 
ATOM   301  O O   . ARG A 1 42  ? 2.914   -11.883 38.230 1.00 49.48  ? 42  ARG A O   1 
ATOM   302  C CB  . ARG A 1 42  ? 1.761   -9.485  36.360 1.00 47.95  ? 42  ARG A CB  1 
ATOM   303  C CG  . ARG A 1 42  ? 2.952   -10.045 35.618 1.00 46.53  ? 42  ARG A CG  1 
ATOM   304  C CD  . ARG A 1 42  ? 2.629   -11.152 34.636 1.00 49.94  ? 42  ARG A CD  1 
ATOM   305  N NE  . ARG A 1 42  ? 3.866   -11.703 34.085 1.00 51.39  ? 42  ARG A NE  1 
ATOM   306  C CZ  . ARG A 1 42  ? 4.514   -12.740 34.602 1.00 53.74  ? 42  ARG A CZ  1 
ATOM   307  N NH1 . ARG A 1 42  ? 4.044   -13.357 35.687 1.00 53.53  ? 42  ARG A NH1 1 
ATOM   308  N NH2 . ARG A 1 42  ? 5.639   -13.159 34.037 1.00 54.88  ? 42  ARG A NH2 1 
ATOM   309  N N   . SER A 1 43  ? 2.438   -10.050 39.467 1.00 47.92  ? 43  SER A N   1 
ATOM   310  C CA  . SER A 1 43  ? 3.464   -10.346 40.448 1.00 48.78  ? 43  SER A CA  1 
ATOM   311  C C   . SER A 1 43  ? 3.124   -11.616 41.173 1.00 47.80  ? 43  SER A C   1 
ATOM   312  O O   . SER A 1 43  ? 3.981   -12.465 41.335 1.00 50.96  ? 43  SER A O   1 
ATOM   313  C CB  . SER A 1 43  ? 3.643   -9.208  41.453 1.00 50.12  ? 43  SER A CB  1 
ATOM   314  O OG  . SER A 1 43  ? 4.501   -8.198  40.942 1.00 53.92  ? 43  SER A OG  1 
ATOM   315  N N   . LYS A 1 44  ? 1.873   -11.763 41.587 1.00 47.53  ? 44  LYS A N   1 
ATOM   316  C CA  . LYS A 1 44  ? 1.464   -12.937 42.361 1.00 49.70  ? 44  LYS A CA  1 
ATOM   317  C C   . LYS A 1 44  ? 1.818   -14.275 41.687 1.00 51.13  ? 44  LYS A C   1 
ATOM   318  O O   . LYS A 1 44  ? 1.827   -15.333 42.332 1.00 51.45  ? 44  LYS A O   1 
ATOM   319  C CB  . LYS A 1 44  ? -0.029  -12.865 42.703 1.00 47.73  ? 44  LYS A CB  1 
ATOM   320  C CG  . LYS A 1 44  ? -0.363  -11.720 43.640 1.00 47.27  ? 44  LYS A CG  1 
ATOM   321  C CD  . LYS A 1 44  ? -1.848  -11.588 43.835 1.00 46.54  ? 44  LYS A CD  1 
ATOM   322  C CE  . LYS A 1 44  ? -2.207  -10.238 44.422 1.00 47.09  ? 44  LYS A CE  1 
ATOM   323  N NZ  . LYS A 1 44  ? -3.636  -10.223 44.862 1.00 47.52  ? 44  LYS A NZ  1 
ATOM   324  N N   . LYS A 1 45  ? 2.143   -14.210 40.399 1.00 52.40  ? 45  LYS A N   1 
ATOM   325  C CA  . LYS A 1 45  ? 2.500   -15.392 39.632 1.00 53.78  ? 45  LYS A CA  1 
ATOM   326  C C   . LYS A 1 45  ? 3.966   -15.730 39.772 1.00 53.61  ? 45  LYS A C   1 
ATOM   327  O O   . LYS A 1 45  ? 4.388   -16.831 39.434 1.00 56.92  ? 45  LYS A O   1 
ATOM   328  C CB  . LYS A 1 45  ? 2.165   -15.202 38.154 1.00 54.91  ? 45  LYS A CB  1 
ATOM   329  C CG  . LYS A 1 45  ? 0.692   -15.156 37.859 1.00 56.08  ? 45  LYS A CG  1 
ATOM   330  C CD  . LYS A 1 45  ? 0.446   -15.494 36.417 1.00 58.56  ? 45  LYS A CD  1 
ATOM   331  C CE  . LYS A 1 45  ? -1.019  -15.313 36.082 1.00 62.84  ? 45  LYS A CE  1 
ATOM   332  N NZ  . LYS A 1 45  ? -1.361  -15.974 34.794 1.00 67.59  ? 45  LYS A NZ  1 
ATOM   333  N N   . THR A 1 46  ? 4.754   -14.784 40.254 1.00 54.18  ? 46  THR A N   1 
ATOM   334  C CA  . THR A 1 46  ? 6.173   -15.038 40.430 1.00 55.18  ? 46  THR A CA  1 
ATOM   335  C C   . THR A 1 46  ? 6.468   -15.548 41.835 1.00 54.80  ? 46  THR A C   1 
ATOM   336  O O   . THR A 1 46  ? 7.617   -15.843 42.155 1.00 53.47  ? 46  THR A O   1 
ATOM   337  C CB  . THR A 1 46  ? 7.015   -13.773 40.119 1.00 56.54  ? 46  THR A CB  1 
ATOM   338  O OG1 . THR A 1 46  ? 6.668   -12.707 41.016 1.00 58.04  ? 46  THR A OG1 1 
ATOM   339  C CG2 . THR A 1 46  ? 6.680   -13.232 38.729 1.00 58.14  ? 46  THR A CG2 1 
ATOM   340  N N   . MET A 1 47  ? 5.424   -15.686 42.652 1.00 55.64  ? 47  MET A N   1 
ATOM   341  C CA  . MET A 1 47  ? 5.602   -16.025 44.066 1.00 56.58  ? 47  MET A CA  1 
ATOM   342  C C   . MET A 1 47  ? 4.802   -17.224 44.595 1.00 57.54  ? 47  MET A C   1 
ATOM   343  O O   . MET A 1 47  ? 3.569   -17.296 44.446 1.00 58.46  ? 47  MET A O   1 
ATOM   344  C CB  . MET A 1 47  ? 5.399   -14.770 44.963 1.00 56.09  ? 47  MET A CB  1 
ATOM   345  C CG  . MET A 1 47  ? 4.070   -13.978 44.820 1.00 55.36  ? 47  MET A CG  1 
ATOM   346  S SD  . MET A 1 47  ? 4.167   -12.235 45.412 1.00 52.38  ? 47  MET A SD  1 
ATOM   347  C CE  . MET A 1 47  ? 2.477   -11.910 45.835 1.00 52.33  ? 47  MET A CE  1 
ATOM   348  N N   . LEU A 1 48  ? 5.529   -18.162 45.211 1.00 57.15  ? 48  LEU A N   1 
ATOM   349  C CA  . LEU A 1 48  ? 4.937   -19.335 45.863 1.00 56.31  ? 48  LEU A CA  1 
ATOM   350  C C   . LEU A 1 48  ? 4.103   -18.943 47.084 1.00 55.54  ? 48  LEU A C   1 
ATOM   351  O O   . LEU A 1 48  ? 3.167   -19.662 47.455 1.00 53.38  ? 48  LEU A O   1 
ATOM   352  C CB  . LEU A 1 48  ? 6.028   -20.346 46.277 1.00 57.74  ? 48  LEU A CB  1 
ATOM   353  C CG  . LEU A 1 48  ? 6.614   -21.285 45.194 1.00 58.73  ? 48  LEU A CG  1 
ATOM   354  C CD1 . LEU A 1 48  ? 7.923   -21.951 45.621 1.00 56.57  ? 48  LEU A CD1 1 
ATOM   355  C CD2 . LEU A 1 48  ? 5.615   -22.334 44.712 1.00 55.32  ? 48  LEU A CD2 1 
ATOM   356  N N   . VAL A 1 49  ? 4.455   -17.809 47.704 1.00 54.53  ? 49  VAL A N   1 
ATOM   357  C CA  . VAL A 1 49  ? 3.742   -17.294 48.882 1.00 54.22  ? 49  VAL A CA  1 
ATOM   358  C C   . VAL A 1 49  ? 3.043   -15.966 48.576 1.00 55.26  ? 49  VAL A C   1 
ATOM   359  O O   . VAL A 1 49  ? 3.689   -14.938 48.364 1.00 55.14  ? 49  VAL A O   1 
ATOM   360  C CB  . VAL A 1 49  ? 4.674   -17.114 50.093 1.00 53.05  ? 49  VAL A CB  1 
ATOM   361  C CG1 . VAL A 1 49  ? 3.881   -17.305 51.377 1.00 52.91  ? 49  VAL A CG1 1 
ATOM   362  C CG2 . VAL A 1 49  ? 5.848   -18.082 50.035 1.00 51.76  ? 49  VAL A CG2 1 
ATOM   363  N N   . GLN A 1 50  ? 1.713   -16.012 48.581 1.00 57.41  ? 50  GLN A N   1 
ATOM   364  C CA  . GLN A 1 50  ? 0.853   -14.926 48.111 1.00 58.22  ? 50  GLN A CA  1 
ATOM   365  C C   . GLN A 1 50  ? 0.806   -13.719 49.020 1.00 57.09  ? 50  GLN A C   1 
ATOM   366  O O   . GLN A 1 50  ? 0.385   -13.838 50.165 1.00 59.00  ? 50  GLN A O   1 
ATOM   367  C CB  . GLN A 1 50  ? -0.575  -15.456 47.959 1.00 61.52  ? 50  GLN A CB  1 
ATOM   368  C CG  . GLN A 1 50  ? -0.807  -16.336 46.744 1.00 64.85  ? 50  GLN A CG  1 
ATOM   369  C CD  . GLN A 1 50  ? -1.091  -15.520 45.502 1.00 66.63  ? 50  GLN A CD  1 
ATOM   370  O OE1 . GLN A 1 50  ? -2.133  -14.842 45.409 1.00 63.94  ? 50  GLN A OE1 1 
ATOM   371  N NE2 . GLN A 1 50  ? -0.163  -15.569 44.539 1.00 67.28  ? 50  GLN A NE2 1 
ATOM   372  N N   . LYS A 1 51  ? 1.209   -12.555 48.513 1.00 55.05  ? 51  LYS A N   1 
ATOM   373  C CA  . LYS A 1 51  ? 1.108   -11.305 49.283 1.00 51.83  ? 51  LYS A CA  1 
ATOM   374  C C   . LYS A 1 51  ? 0.217   -10.263 48.576 1.00 49.31  ? 51  LYS A C   1 
ATOM   375  O O   . LYS A 1 51  ? 0.608   -9.681  47.565 1.00 46.64  ? 51  LYS A O   1 
ATOM   376  C CB  . LYS A 1 51  ? 2.498   -10.719 49.549 1.00 51.53  ? 51  LYS A CB  1 
ATOM   377  C CG  . LYS A 1 51  ? 3.505   -11.706 50.105 1.00 52.32  ? 51  LYS A CG  1 
ATOM   378  C CD  . LYS A 1 51  ? 3.408   -11.852 51.622 1.00 53.45  ? 51  LYS A CD  1 
ATOM   379  C CE  . LYS A 1 51  ? 4.455   -12.826 52.154 1.00 51.45  ? 51  LYS A CE  1 
ATOM   380  N NZ  . LYS A 1 51  ? 5.823   -12.502 51.637 1.00 52.08  ? 51  LYS A NZ  1 
ATOM   381  N N   . ASN A 1 52  ? -0.975  -10.030 49.123 1.00 46.77  ? 52  ASN A N   1 
ATOM   382  C CA  . ASN A 1 52  ? -1.919  -9.073  48.543 1.00 46.72  ? 52  ASN A CA  1 
ATOM   383  C C   . ASN A 1 52  ? -1.429  -7.619  48.519 1.00 43.34  ? 52  ASN A C   1 
ATOM   384  O O   . ASN A 1 52  ? -1.968  -6.795  47.783 1.00 43.94  ? 52  ASN A O   1 
ATOM   385  C CB  . ASN A 1 52  ? -3.292  -9.166  49.236 1.00 48.84  ? 52  ASN A CB  1 
ATOM   386  C CG  . ASN A 1 52  ? -4.040  -10.446 48.885 1.00 53.09  ? 52  ASN A CG  1 
ATOM   387  O OD1 . ASN A 1 52  ? -3.768  -11.064 47.848 1.00 52.20  ? 52  ASN A OD1 1 
ATOM   388  N ND2 . ASN A 1 52  ? -4.998  -10.845 49.747 1.00 58.28  ? 52  ASN A ND2 1 
ATOM   389  N N   . VAL A 1 53  ? -0.405  -7.310  49.311 1.00 39.14  ? 53  VAL A N   1 
ATOM   390  C CA  . VAL A 1 53  ? 0.152   -5.958  49.355 1.00 35.46  ? 53  VAL A CA  1 
ATOM   391  C C   . VAL A 1 53  ? 1.649   -5.946  49.035 1.00 33.76  ? 53  VAL A C   1 
ATOM   392  O O   . VAL A 1 53  ? 2.387   -6.847  49.451 1.00 31.41  ? 53  VAL A O   1 
ATOM   393  C CB  . VAL A 1 53  ? -0.067  -5.305  50.735 1.00 34.80  ? 53  VAL A CB  1 
ATOM   394  C CG1 . VAL A 1 53  ? 0.485   -3.867  50.758 1.00 32.75  ? 53  VAL A CG1 1 
ATOM   395  C CG2 . VAL A 1 53  ? -1.535  -5.339  51.108 1.00 31.19  ? 53  VAL A CG2 1 
ATOM   396  N N   . THR A 1 54  ? 2.074   -4.930  48.279 1.00 31.11  ? 54  THR A N   1 
ATOM   397  C CA  . THR A 1 54  ? 3.480   -4.728  47.958 1.00 30.19  ? 54  THR A CA  1 
ATOM   398  C C   . THR A 1 54  ? 3.951   -3.390  48.519 1.00 30.99  ? 54  THR A C   1 
ATOM   399  O O   . THR A 1 54  ? 3.234   -2.380  48.483 1.00 29.43  ? 54  THR A O   1 
ATOM   400  C CB  . THR A 1 54  ? 3.733   -4.816  46.438 1.00 31.12  ? 54  THR A CB  1 
ATOM   401  O OG1 . THR A 1 54  ? 3.657   -6.193  46.018 1.00 30.43  ? 54  THR A OG1 1 
ATOM   402  C CG2 . THR A 1 54  ? 5.160   -4.368  46.078 1.00 26.38  ? 54  THR A CG2 1 
ATOM   403  N N   . SER A 1 55  ? 5.153   -3.418  49.083 1.00 31.31  ? 55  SER A N   1 
ATOM   404  C CA  . SER A 1 55  ? 5.776   -2.236  49.630 1.00 31.39  ? 55  SER A CA  1 
ATOM   405  C C   . SER A 1 55  ? 7.150   -2.052  49.038 1.00 29.88  ? 55  SER A C   1 
ATOM   406  O O   . SER A 1 55  ? 7.950   -2.997  49.006 1.00 29.47  ? 55  SER A O   1 
ATOM   407  C CB  . SER A 1 55  ? 5.936   -2.368  51.132 1.00 32.67  ? 55  SER A CB  1 
ATOM   408  O OG  . SER A 1 55  ? 7.163   -1.768  51.526 1.00 40.19  ? 55  SER A OG  1 
ATOM   409  N N   . GLU A 1 56  ? 7.415   -0.832  48.571 1.00 30.30  ? 56  GLU A N   1 
ATOM   410  C CA  . GLU A 1 56  ? 8.751   -0.433  48.123 1.00 31.96  ? 56  GLU A CA  1 
ATOM   411  C C   . GLU A 1 56  ? 9.251   0.611   49.085 1.00 30.45  ? 56  GLU A C   1 
ATOM   412  O O   . GLU A 1 56  ? 8.514   1.523   49.467 1.00 33.66  ? 56  GLU A O   1 
ATOM   413  C CB  . GLU A 1 56  ? 8.727   0.167   46.734 1.00 30.12  ? 56  GLU A CB  1 
ATOM   414  C CG  . GLU A 1 56  ? 7.534   -0.260  45.950 1.00 34.61  ? 56  GLU A CG  1 
ATOM   415  C CD  . GLU A 1 56  ? 7.495   0.353   44.590 1.00 37.20  ? 56  GLU A CD  1 
ATOM   416  O OE1 . GLU A 1 56  ? 7.765   1.585   44.460 1.00 37.21  ? 56  GLU A OE1 1 
ATOM   417  O OE2 . GLU A 1 56  ? 7.173   -0.429  43.666 1.00 38.28  ? 56  GLU A OE2 1 
ATOM   418  N N   . SER A 1 57  ? 10.509  0.485   49.477 1.00 32.42  ? 57  SER A N   1 
ATOM   419  C CA  . SER A 1 57  ? 11.071  1.397   50.459 1.00 35.58  ? 57  SER A CA  1 
ATOM   420  C C   . SER A 1 57  ? 12.517  1.601   50.222 1.00 34.80  ? 57  SER A C   1 
ATOM   421  O O   . SER A 1 57  ? 13.208  0.728   49.717 1.00 36.70  ? 57  SER A O   1 
ATOM   422  C CB  . SER A 1 57  ? 10.914  0.864   51.878 1.00 35.63  ? 57  SER A CB  1 
ATOM   423  O OG  . SER A 1 57  ? 11.022  -0.548  51.898 1.00 42.75  ? 57  SER A OG  1 
ATOM   424  N N   . THR A 1 58  ? 12.975  2.770   50.618 1.00 35.36  ? 58  THR A N   1 
ATOM   425  C CA  . THR A 1 58  ? 14.366  3.081   50.528 1.00 34.58  ? 58  THR A CA  1 
ATOM   426  C C   . THR A 1 58  ? 14.811  3.600   51.910 1.00 34.48  ? 58  THR A C   1 
ATOM   427  O O   . THR A 1 58  ? 14.000  4.099   52.690 1.00 32.39  ? 58  THR A O   1 
ATOM   428  C CB  . THR A 1 58  ? 14.572  4.044   49.318 1.00 34.78  ? 58  THR A CB  1 
ATOM   429  O OG1 . THR A 1 58  ? 15.798  3.725   48.652 1.00 35.50  ? 58  THR A OG1 1 
ATOM   430  C CG2 . THR A 1 58  ? 14.680  5.506   49.724 1.00 34.55  ? 58  THR A CG2 1 
ATOM   431  N N   . CYS A 1 59  ? 16.079  3.414   52.254 1.00 37.92  ? 59  CYS A N   1 
ATOM   432  C CA  . CYS A 1 59  ? 16.569  3.873   53.564 1.00 38.89  ? 59  CYS A CA  1 
ATOM   433  C C   . CYS A 1 59  ? 17.778  4.784   53.504 1.00 40.54  ? 59  CYS A C   1 
ATOM   434  O O   . CYS A 1 59  ? 18.599  4.729   52.573 1.00 39.89  ? 59  CYS A O   1 
ATOM   435  C CB  . CYS A 1 59  ? 16.859  2.690   54.487 1.00 37.85  ? 59  CYS A CB  1 
ATOM   436  S SG  . CYS A 1 59  ? 15.327  1.889   55.037 1.00 40.88  ? 59  CYS A SG  1 
ATOM   437  N N   . CYS A 1 60  ? 17.856  5.642   54.514 1.00 42.46  ? 60  CYS A N   1 
ATOM   438  C CA  . CYS A 1 60  ? 18.954  6.563   54.664 1.00 42.94  ? 60  CYS A CA  1 
ATOM   439  C C   . CYS A 1 60  ? 20.163  5.806   55.172 1.00 42.94  ? 60  CYS A C   1 
ATOM   440  O O   . CYS A 1 60  ? 20.164  5.369   56.315 1.00 44.20  ? 60  CYS A O   1 
ATOM   441  C CB  . CYS A 1 60  ? 18.569  7.625   55.667 1.00 42.84  ? 60  CYS A CB  1 
ATOM   442  S SG  . CYS A 1 60  ? 19.750  8.965   55.638 1.00 54.00  ? 60  CYS A SG  1 
ATOM   443  N N   . VAL A 1 61  ? 21.173  5.618   54.324 1.00 44.02  ? 61  VAL A N   1 
ATOM   444  C CA  . VAL A 1 61  ? 22.401  4.917   54.736 1.00 44.97  ? 61  VAL A CA  1 
ATOM   445  C C   . VAL A 1 61  ? 23.682  5.535   54.166 1.00 48.57  ? 61  VAL A C   1 
ATOM   446  O O   . VAL A 1 61  ? 23.638  6.387   53.269 1.00 50.89  ? 61  VAL A O   1 
ATOM   447  C CB  . VAL A 1 61  ? 22.385  3.390   54.418 1.00 43.21  ? 61  VAL A CB  1 
ATOM   448  C CG1 . VAL A 1 61  ? 21.124  2.736   54.943 1.00 42.15  ? 61  VAL A CG1 1 
ATOM   449  C CG2 . VAL A 1 61  ? 22.568  3.123   52.926 1.00 42.86  ? 61  VAL A CG2 1 
ATOM   450  N N   . ALA A 1 62  ? 24.818  5.080   54.694 1.00 50.76  ? 62  ALA A N   1 
ATOM   451  C CA  . ALA A 1 62  ? 26.134  5.613   54.364 1.00 50.82  ? 62  ALA A CA  1 
ATOM   452  C C   . ALA A 1 62  ? 26.713  5.028   53.081 1.00 52.81  ? 62  ALA A C   1 
ATOM   453  O O   . ALA A 1 62  ? 27.011  3.833   53.020 1.00 53.42  ? 62  ALA A O   1 
ATOM   454  C CB  . ALA A 1 62  ? 27.064  5.354   55.512 1.00 51.63  ? 62  ALA A CB  1 
ATOM   455  N N   . LYS A 1 63  ? 26.885  5.884   52.073 1.00 54.87  ? 63  LYS A N   1 
ATOM   456  C CA  . LYS A 1 63  ? 27.415  5.489   50.761 1.00 57.23  ? 63  LYS A CA  1 
ATOM   457  C C   . LYS A 1 63  ? 28.914  5.226   50.827 1.00 57.91  ? 63  LYS A C   1 
ATOM   458  O O   . LYS A 1 63  ? 29.439  4.435   50.053 1.00 58.44  ? 63  LYS A O   1 
ATOM   459  C CB  . LYS A 1 63  ? 27.108  6.567   49.711 1.00 57.64  ? 63  LYS A CB  1 
ATOM   460  C CG  . LYS A 1 63  ? 27.355  6.172   48.252 1.00 59.56  ? 63  LYS A CG  1 
ATOM   461  C CD  . LYS A 1 63  ? 27.126  7.370   47.305 1.00 62.44  ? 63  LYS A CD  1 
ATOM   462  C CE  . LYS A 1 63  ? 27.054  6.958   45.813 1.00 64.83  ? 63  LYS A CE  1 
ATOM   463  N NZ  . LYS A 1 63  ? 25.750  6.331   45.395 1.00 62.65  ? 63  LYS A NZ  1 
ATOM   464  N N   . SER A 1 64  ? 29.592  5.899   51.755 1.00 60.21  ? 64  SER A N   1 
ATOM   465  C CA  . SER A 1 64  ? 31.035  5.747   51.962 1.00 61.65  ? 64  SER A CA  1 
ATOM   466  C C   . SER A 1 64  ? 31.395  6.204   53.367 1.00 63.59  ? 64  SER A C   1 
ATOM   467  O O   . SER A 1 64  ? 30.823  7.176   53.871 1.00 64.19  ? 64  SER A O   1 
ATOM   468  C CB  . SER A 1 64  ? 31.819  6.574   50.940 1.00 61.29  ? 64  SER A CB  1 
ATOM   469  O OG  . SER A 1 64  ? 31.594  7.961   51.118 1.00 60.50  ? 64  SER A OG  1 
ATOM   470  N N   . TYR A 1 65  ? 32.343  5.517   54.004 1.00 65.61  ? 65  TYR A N   1 
ATOM   471  C CA  . TYR A 1 65  ? 32.722  5.860   55.371 1.00 67.28  ? 65  TYR A CA  1 
ATOM   472  C C   . TYR A 1 65  ? 34.180  5.547   55.719 1.00 69.12  ? 65  TYR A C   1 
ATOM   473  O O   . TYR A 1 65  ? 34.882  4.887   54.958 1.00 70.23  ? 65  TYR A O   1 
ATOM   474  C CB  . TYR A 1 65  ? 31.771  5.173   56.364 1.00 66.82  ? 65  TYR A CB  1 
ATOM   475  C CG  . TYR A 1 65  ? 31.840  3.665   56.360 1.00 69.37  ? 65  TYR A CG  1 
ATOM   476  C CD1 . TYR A 1 65  ? 31.143  2.914   55.411 1.00 70.28  ? 65  TYR A CD1 1 
ATOM   477  C CD2 . TYR A 1 65  ? 32.599  2.981   57.313 1.00 70.27  ? 65  TYR A CD2 1 
ATOM   478  C CE1 . TYR A 1 65  ? 31.204  1.518   55.408 1.00 71.10  ? 65  TYR A CE1 1 
ATOM   479  C CE2 . TYR A 1 65  ? 32.668  1.589   57.318 1.00 71.06  ? 65  TYR A CE2 1 
ATOM   480  C CZ  . TYR A 1 65  ? 31.966  0.866   56.369 1.00 71.50  ? 65  TYR A CZ  1 
ATOM   481  O OH  . TYR A 1 65  ? 32.037  -0.509  56.374 1.00 73.03  ? 65  TYR A OH  1 
ATOM   482  N N   . ASN A 1 66  ? 34.623  6.065   56.868 1.00 71.79  ? 66  ASN A N   1 
ATOM   483  C CA  . ASN A 1 66  ? 35.942  5.785   57.439 1.00 72.48  ? 66  ASN A CA  1 
ATOM   484  C C   . ASN A 1 66  ? 35.760  5.256   58.855 1.00 74.36  ? 66  ASN A C   1 
ATOM   485  O O   . ASN A 1 66  ? 34.934  5.772   59.607 1.00 74.79  ? 66  ASN A O   1 
ATOM   486  C CB  . ASN A 1 66  ? 36.785  7.052   57.498 1.00 72.54  ? 66  ASN A CB  1 
ATOM   487  C CG  . ASN A 1 66  ? 37.153  7.571   56.127 1.00 73.23  ? 66  ASN A CG  1 
ATOM   488  O OD1 . ASN A 1 66  ? 37.936  6.951   55.406 1.00 73.52  ? 66  ASN A OD1 1 
ATOM   489  N ND2 . ASN A 1 66  ? 36.598  8.724   55.761 1.00 72.60  ? 66  ASN A ND2 1 
ATOM   490  N N   . ARG A 1 67  ? 36.534  4.238   59.223 1.00 76.57  ? 67  ARG A N   1 
ATOM   491  C CA  . ARG A 1 67  ? 36.420  3.635   60.550 1.00 78.42  ? 67  ARG A CA  1 
ATOM   492  C C   . ARG A 1 67  ? 37.465  4.195   61.505 1.00 79.20  ? 67  ARG A C   1 
ATOM   493  O O   . ARG A 1 67  ? 38.591  3.695   61.561 1.00 80.76  ? 67  ARG A O   1 
ATOM   494  C CB  . ARG A 1 67  ? 36.590  2.122   60.461 1.00 78.52  ? 67  ARG A CB  1 
ATOM   495  C CG  . ARG A 1 67  ? 35.820  1.487   59.341 1.00 82.63  ? 67  ARG A CG  1 
ATOM   496  C CD  . ARG A 1 67  ? 35.891  -0.017  59.379 1.00 86.37  ? 67  ARG A CD  1 
ATOM   497  N NE  . ARG A 1 67  ? 35.126  -0.611  58.290 1.00 89.19  ? 67  ARG A NE  1 
ATOM   498  C CZ  . ARG A 1 67  ? 34.883  -1.907  58.173 1.00 90.63  ? 67  ARG A CZ  1 
ATOM   499  N NH1 . ARG A 1 67  ? 35.344  -2.760  59.082 1.00 91.48  ? 67  ARG A NH1 1 
ATOM   500  N NH2 . ARG A 1 67  ? 34.173  -2.353  57.146 1.00 92.95  ? 67  ARG A NH2 1 
ATOM   501  N N   . VAL A 1 68  ? 37.101  5.230   62.263 1.00 79.28  ? 68  VAL A N   1 
ATOM   502  C CA  . VAL A 1 68  ? 38.048  5.844   63.205 1.00 79.09  ? 68  VAL A CA  1 
ATOM   503  C C   . VAL A 1 68  ? 37.773  5.481   64.666 1.00 79.34  ? 68  VAL A C   1 
ATOM   504  O O   . VAL A 1 68  ? 36.668  5.060   65.019 1.00 77.61  ? 68  VAL A O   1 
ATOM   505  C CB  . VAL A 1 68  ? 38.132  7.405   63.056 1.00 78.46  ? 68  VAL A CB  1 
ATOM   506  C CG1 . VAL A 1 68  ? 38.547  7.799   61.641 1.00 78.27  ? 68  VAL A CG1 1 
ATOM   507  C CG2 . VAL A 1 68  ? 36.821  8.072   63.455 1.00 77.43  ? 68  VAL A CG2 1 
ATOM   508  N N   . THR A 1 69  ? 38.800  5.634   65.502 1.00 80.64  ? 69  THR A N   1 
ATOM   509  C CA  . THR A 1 69  ? 38.669  5.386   66.933 1.00 82.31  ? 69  THR A CA  1 
ATOM   510  C C   . THR A 1 69  ? 38.587  6.691   67.727 1.00 82.60  ? 69  THR A C   1 
ATOM   511  O O   . THR A 1 69  ? 39.277  7.669   67.421 1.00 80.90  ? 69  THR A O   1 
ATOM   512  C CB  . THR A 1 69  ? 39.816  4.498   67.453 1.00 82.43  ? 69  THR A CB  1 
ATOM   513  O OG1 . THR A 1 69  ? 39.859  3.291   66.684 1.00 83.38  ? 69  THR A OG1 1 
ATOM   514  C CG2 . THR A 1 69  ? 39.525  4.010   68.874 1.00 82.49  ? 69  THR A CG2 1 
ATOM   515  N N   . VAL A 1 70  ? 37.709  6.688   68.730 1.00 84.42  ? 70  VAL A N   1 
ATOM   516  C CA  . VAL A 1 70  ? 37.487  7.832   69.609 1.00 86.19  ? 70  VAL A CA  1 
ATOM   517  C C   . VAL A 1 70  ? 37.599  7.436   71.079 1.00 87.72  ? 70  VAL A C   1 
ATOM   518  O O   . VAL A 1 70  ? 37.496  6.255   71.434 1.00 87.82  ? 70  VAL A O   1 
ATOM   519  C CB  . VAL A 1 70  ? 36.103  8.513   69.380 1.00 85.59  ? 70  VAL A CB  1 
ATOM   520  C CG1 . VAL A 1 70  ? 36.117  9.381   68.122 1.00 84.67  ? 70  VAL A CG1 1 
ATOM   521  C CG2 . VAL A 1 70  ? 34.977  7.475   69.338 1.00 85.63  ? 70  VAL A CG2 1 
ATOM   522  N N   . MET A 1 71  ? 37.800  8.461   71.905 1.00 89.13  ? 71  MET A N   1 
ATOM   523  C CA  . MET A 1 71  ? 37.957  8.379   73.360 1.00 91.14  ? 71  MET A CA  1 
ATOM   524  C C   . MET A 1 71  ? 38.009  7.025   74.071 1.00 91.37  ? 71  MET A C   1 
ATOM   525  O O   . MET A 1 71  ? 39.088  6.447   74.221 1.00 91.66  ? 71  MET A O   1 
ATOM   526  C CB  . MET A 1 71  ? 36.924  9.279   74.047 1.00 91.80  ? 71  MET A CB  1 
ATOM   527  C CG  . MET A 1 71  ? 37.387  10.712  74.211 1.00 93.03  ? 71  MET A CG  1 
ATOM   528  S SD  . MET A 1 71  ? 36.581  11.514  75.607 1.00 94.83  ? 71  MET A SD  1 
ATOM   529  C CE  . MET A 1 71  ? 34.839  11.454  75.107 1.00 93.35  ? 71  MET A CE  1 
ATOM   530  N N   . GLY A 1 72  ? 36.851  6.529   74.507 1.00 91.10  ? 72  GLY A N   1 
ATOM   531  C CA  . GLY A 1 72  ? 36.787  5.361   75.389 1.00 90.86  ? 72  GLY A CA  1 
ATOM   532  C C   . GLY A 1 72  ? 37.180  4.020   74.802 1.00 91.19  ? 72  GLY A C   1 
ATOM   533  O O   . GLY A 1 72  ? 36.842  2.970   75.361 1.00 91.79  ? 72  GLY A O   1 
ATOM   534  N N   . GLY A 1 73  ? 37.896  4.051   73.680 1.00 90.68  ? 73  GLY A N   1 
ATOM   535  C CA  . GLY A 1 73  ? 38.352  2.836   73.026 1.00 89.11  ? 73  GLY A CA  1 
ATOM   536  C C   . GLY A 1 73  ? 37.260  2.163   72.224 1.00 89.16  ? 73  GLY A C   1 
ATOM   537  O O   . GLY A 1 73  ? 37.305  0.947   72.028 1.00 89.69  ? 73  GLY A O   1 
ATOM   538  N N   . PHE A 1 74  ? 36.270  2.945   71.784 1.00 88.70  ? 74  PHE A N   1 
ATOM   539  C CA  . PHE A 1 74  ? 35.247  2.445   70.864 1.00 86.84  ? 74  PHE A CA  1 
ATOM   540  C C   . PHE A 1 74  ? 35.665  2.749   69.437 1.00 85.50  ? 74  PHE A C   1 
ATOM   541  O O   . PHE A 1 74  ? 36.121  3.857   69.129 1.00 84.55  ? 74  PHE A O   1 
ATOM   542  C CB  . PHE A 1 74  ? 33.877  3.098   71.059 1.00 87.72  ? 74  PHE A CB  1 
ATOM   543  C CG  . PHE A 1 74  ? 33.612  3.578   72.445 1.00 89.03  ? 74  PHE A CG  1 
ATOM   544  C CD1 . PHE A 1 74  ? 33.962  4.876   72.819 1.00 89.91  ? 74  PHE A CD1 1 
ATOM   545  C CD2 . PHE A 1 74  ? 32.973  2.760   73.366 1.00 89.38  ? 74  PHE A CD2 1 
ATOM   546  C CE1 . PHE A 1 74  ? 33.698  5.343   74.100 1.00 90.14  ? 74  PHE A CE1 1 
ATOM   547  C CE2 . PHE A 1 74  ? 32.705  3.215   74.647 1.00 90.37  ? 74  PHE A CE2 1 
ATOM   548  C CZ  . PHE A 1 74  ? 33.067  4.512   75.015 1.00 90.32  ? 74  PHE A CZ  1 
ATOM   549  N N   . LYS A 1 75  ? 35.493  1.756   68.572 1.00 83.66  ? 75  LYS A N   1 
ATOM   550  C CA  . LYS A 1 75  ? 35.688  1.929   67.146 1.00 82.42  ? 75  LYS A CA  1 
ATOM   551  C C   . LYS A 1 75  ? 34.334  2.297   66.532 1.00 79.30  ? 75  LYS A C   1 
ATOM   552  O O   . LYS A 1 75  ? 33.316  1.661   66.820 1.00 79.41  ? 75  LYS A O   1 
ATOM   553  C CB  . LYS A 1 75  ? 36.247  0.642   66.529 1.00 84.54  ? 75  LYS A CB  1 
ATOM   554  C CG  . LYS A 1 75  ? 37.032  0.846   65.230 1.00 87.52  ? 75  LYS A CG  1 
ATOM   555  C CD  . LYS A 1 75  ? 37.747  -0.439  64.796 1.00 88.62  ? 75  LYS A CD  1 
ATOM   556  C CE  . LYS A 1 75  ? 38.767  -0.156  63.698 1.00 89.34  ? 75  LYS A CE  1 
ATOM   557  N NZ  . LYS A 1 75  ? 39.974  -1.029  63.817 1.00 89.11  ? 75  LYS A NZ  1 
ATOM   558  N N   . VAL A 1 76  ? 34.327  3.345   65.710 1.00 75.39  ? 76  VAL A N   1 
ATOM   559  C CA  . VAL A 1 76  ? 33.096  3.835   65.083 1.00 71.31  ? 76  VAL A CA  1 
ATOM   560  C C   . VAL A 1 76  ? 33.295  4.197   63.611 1.00 69.55  ? 76  VAL A C   1 
ATOM   561  O O   . VAL A 1 76  ? 34.431  4.354   63.148 1.00 69.62  ? 76  VAL A O   1 
ATOM   562  C CB  . VAL A 1 76  ? 32.506  5.070   65.835 1.00 70.30  ? 76  VAL A CB  1 
ATOM   563  C CG1 . VAL A 1 76  ? 31.865  4.649   67.159 1.00 68.83  ? 76  VAL A CG1 1 
ATOM   564  C CG2 . VAL A 1 76  ? 33.567  6.150   66.041 1.00 68.21  ? 76  VAL A CG2 1 
ATOM   565  N N   . GLU A 1 77  ? 32.186  4.329   62.883 1.00 66.42  ? 77  GLU A N   1 
ATOM   566  C CA  . GLU A 1 77  ? 32.228  4.696   61.469 1.00 63.97  ? 77  GLU A CA  1 
ATOM   567  C C   . GLU A 1 77  ? 32.008  6.208   61.309 1.00 61.28  ? 77  GLU A C   1 
ATOM   568  O O   . GLU A 1 77  ? 31.089  6.775   61.896 1.00 60.47  ? 77  GLU A O   1 
ATOM   569  C CB  . GLU A 1 77  ? 31.170  3.902   60.672 1.00 65.32  ? 77  GLU A CB  1 
ATOM   570  C CG  . GLU A 1 77  ? 31.084  2.419   61.041 1.00 67.19  ? 77  GLU A CG  1 
ATOM   571  C CD  . GLU A 1 77  ? 30.040  1.637   60.246 1.00 68.40  ? 77  GLU A CD  1 
ATOM   572  O OE1 . GLU A 1 77  ? 30.225  1.444   59.021 1.00 67.74  ? 77  GLU A OE1 1 
ATOM   573  O OE2 . GLU A 1 77  ? 29.044  1.183   60.859 1.00 67.97  ? 77  GLU A OE2 1 
ATOM   574  N N   . ASN A 1 78  ? 32.870  6.860   60.531 1.00 57.46  ? 78  ASN A N   1 
ATOM   575  C CA  . ASN A 1 78  ? 32.719  8.287   60.234 1.00 54.21  ? 78  ASN A CA  1 
ATOM   576  C C   . ASN A 1 78  ? 32.185  8.421   58.809 1.00 52.94  ? 78  ASN A C   1 
ATOM   577  O O   . ASN A 1 78  ? 32.948  8.365   57.849 1.00 55.36  ? 78  ASN A O   1 
ATOM   578  C CB  . ASN A 1 78  ? 34.059  9.020   60.400 1.00 51.31  ? 78  ASN A CB  1 
ATOM   579  C CG  . ASN A 1 78  ? 33.914  10.535  60.429 1.00 50.50  ? 78  ASN A CG  1 
ATOM   580  O OD1 . ASN A 1 78  ? 32.851  11.060  60.757 1.00 44.92  ? 78  ASN A OD1 1 
ATOM   581  N ND2 . ASN A 1 78  ? 35.011  11.244  60.098 1.00 55.13  ? 78  ASN A ND2 1 
ATOM   582  N N   . HIS A 1 79  ? 30.872  8.584   58.673 1.00 50.51  ? 79  HIS A N   1 
ATOM   583  C CA  . HIS A 1 79  ? 30.234  8.648   57.358 1.00 49.53  ? 79  HIS A CA  1 
ATOM   584  C C   . HIS A 1 79  ? 30.699  9.829   56.539 1.00 49.55  ? 79  HIS A C   1 
ATOM   585  O O   . HIS A 1 79  ? 30.795  10.933  57.051 1.00 50.58  ? 79  HIS A O   1 
ATOM   586  C CB  . HIS A 1 79  ? 28.715  8.714   57.501 1.00 47.31  ? 79  HIS A CB  1 
ATOM   587  C CG  . HIS A 1 79  ? 28.132  7.559   58.247 1.00 45.39  ? 79  HIS A CG  1 
ATOM   588  N ND1 . HIS A 1 79  ? 26.882  7.602   58.825 1.00 43.54  ? 79  HIS A ND1 1 
ATOM   589  C CD2 . HIS A 1 79  ? 28.632  6.330   58.517 1.00 43.26  ? 79  HIS A CD2 1 
ATOM   590  C CE1 . HIS A 1 79  ? 26.631  6.446   59.410 1.00 44.04  ? 79  HIS A CE1 1 
ATOM   591  N NE2 . HIS A 1 79  ? 27.679  5.657   59.241 1.00 44.74  ? 79  HIS A NE2 1 
ATOM   592  N N   . THR A 1 80  ? 30.981  9.588   55.265 1.00 51.35  ? 80  THR A N   1 
ATOM   593  C CA  . THR A 1 80  ? 31.416  10.651  54.358 1.00 52.93  ? 80  THR A CA  1 
ATOM   594  C C   . THR A 1 80  ? 30.403  10.969  53.262 1.00 52.64  ? 80  THR A C   1 
ATOM   595  O O   . THR A 1 80  ? 30.447  12.042  52.678 1.00 53.87  ? 80  THR A O   1 
ATOM   596  C CB  . THR A 1 80  ? 32.790  10.329  53.725 1.00 54.37  ? 80  THR A CB  1 
ATOM   597  O OG1 . THR A 1 80  ? 33.049  8.920   53.799 1.00 55.61  ? 80  THR A OG1 1 
ATOM   598  C CG2 . THR A 1 80  ? 33.911  10.963  54.538 1.00 55.37  ? 80  THR A CG2 1 
ATOM   599  N N   . ALA A 1 81  ? 29.503  10.030  52.982 1.00 54.79  ? 81  ALA A N   1 
ATOM   600  C CA  . ALA A 1 81  ? 28.461  10.220  51.977 1.00 53.78  ? 81  ALA A CA  1 
ATOM   601  C C   . ALA A 1 81  ? 27.194  9.456   52.339 1.00 54.60  ? 81  ALA A C   1 
ATOM   602  O O   . ALA A 1 81  ? 27.255  8.302   52.781 1.00 54.81  ? 81  ALA A O   1 
ATOM   603  C CB  . ALA A 1 81  ? 28.961  9.785   50.613 1.00 54.14  ? 81  ALA A CB  1 
ATOM   604  N N   . CYS A 1 82  ? 26.051  10.114  52.152 1.00 53.67  ? 82  CYS A N   1 
ATOM   605  C CA  . CYS A 1 82  ? 24.750  9.507   52.399 1.00 52.44  ? 82  CYS A CA  1 
ATOM   606  C C   . CYS A 1 82  ? 24.012  9.297   51.103 1.00 50.94  ? 82  CYS A C   1 
ATOM   607  O O   . CYS A 1 82  ? 24.361  9.885   50.082 1.00 53.15  ? 82  CYS A O   1 
ATOM   608  C CB  . CYS A 1 82  ? 23.905  10.407  53.290 1.00 53.23  ? 82  CYS A CB  1 
ATOM   609  S SG  . CYS A 1 82  ? 24.650  10.627  54.925 1.00 61.41  ? 82  CYS A SG  1 
ATOM   610  N N   . HIS A 1 83  ? 23.006  8.434   51.153 1.00 48.76  ? 83  HIS A N   1 
ATOM   611  C CA  . HIS A 1 83  ? 22.031  8.292   50.083 1.00 46.40  ? 83  HIS A CA  1 
ATOM   612  C C   . HIS A 1 83  ? 20.873  7.453   50.580 1.00 46.27  ? 83  HIS A C   1 
ATOM   613  O O   . HIS A 1 83  ? 21.012  6.707   51.561 1.00 46.49  ? 83  HIS A O   1 
ATOM   614  C CB  . HIS A 1 83  ? 22.627  7.715   48.772 1.00 45.63  ? 83  HIS A CB  1 
ATOM   615  C CG  . HIS A 1 83  ? 23.201  6.331   48.886 1.00 46.90  ? 83  HIS A CG  1 
ATOM   616  N ND1 . HIS A 1 83  ? 23.920  5.746   47.862 1.00 46.19  ? 83  HIS A ND1 1 
ATOM   617  C CD2 . HIS A 1 83  ? 23.175  5.418   49.890 1.00 48.06  ? 83  HIS A CD2 1 
ATOM   618  C CE1 . HIS A 1 83  ? 24.303  4.536   48.228 1.00 45.12  ? 83  HIS A CE1 1 
ATOM   619  N NE2 . HIS A 1 83  ? 23.864  4.310   49.454 1.00 46.06  ? 83  HIS A NE2 1 
ATOM   620  N N   . CYS A 1 84  ? 19.719  7.607   49.934 1.00 43.76  ? 84  CYS A N   1 
ATOM   621  C CA  . CYS A 1 84  ? 18.596  6.737   50.204 1.00 41.28  ? 84  CYS A CA  1 
ATOM   622  C C   . CYS A 1 84  ? 18.788  5.484   49.344 1.00 41.30  ? 84  CYS A C   1 
ATOM   623  O O   . CYS A 1 84  ? 18.851  5.566   48.120 1.00 40.27  ? 84  CYS A O   1 
ATOM   624  C CB  . CYS A 1 84  ? 17.299  7.447   49.876 1.00 41.57  ? 84  CYS A CB  1 
ATOM   625  S SG  . CYS A 1 84  ? 16.846  8.726   51.077 1.00 43.17  ? 84  CYS A SG  1 
ATOM   626  N N   . SER A 1 85  ? 18.920  4.331   49.997 1.00 39.52  ? 85  SER A N   1 
ATOM   627  C CA  . SER A 1 85  ? 19.190  3.086   49.300 1.00 37.45  ? 85  SER A CA  1 
ATOM   628  C C   . SER A 1 85  ? 18.423  1.940   49.951 1.00 36.97  ? 85  SER A C   1 
ATOM   629  O O   . SER A 1 85  ? 17.464  2.190   50.675 1.00 36.16  ? 85  SER A O   1 
ATOM   630  C CB  . SER A 1 85  ? 20.693  2.819   49.290 1.00 39.17  ? 85  SER A CB  1 
ATOM   631  O OG  . SER A 1 85  ? 20.987  1.585   48.649 1.00 42.84  ? 85  SER A OG  1 
ATOM   632  N N   . THR A 1 86  ? 18.842  0.696   49.703 1.00 36.70  ? 86  THR A N   1 
ATOM   633  C CA  . THR A 1 86  ? 18.100  -0.489  50.148 1.00 37.65  ? 86  THR A CA  1 
ATOM   634  C C   . THR A 1 86  ? 17.972  -0.552  51.658 1.00 39.26  ? 86  THR A C   1 
ATOM   635  O O   . THR A 1 86  ? 18.956  -0.305  52.358 1.00 40.81  ? 86  THR A O   1 
ATOM   636  C CB  . THR A 1 86  ? 18.787  -1.809  49.683 1.00 36.01  ? 86  THR A CB  1 
ATOM   637  O OG1 . THR A 1 86  ? 19.002  -1.787  48.267 1.00 37.07  ? 86  THR A OG1 1 
ATOM   638  C CG2 . THR A 1 86  ? 17.863  -2.993  49.892 1.00 32.40  ? 86  THR A CG2 1 
ATOM   639  N N   . CYS A 1 87  ? 16.767  -0.864  52.143 1.00 37.77  ? 87  CYS A N   1 
ATOM   640  C CA  . CYS A 1 87  ? 16.572  -1.192  53.551 1.00 40.28  ? 87  CYS A CA  1 
ATOM   641  C C   . CYS A 1 87  ? 16.850  -2.669  53.749 1.00 41.05  ? 87  CYS A C   1 
ATOM   642  O O   . CYS A 1 87  ? 16.437  -3.480  52.909 1.00 40.81  ? 87  CYS A O   1 
ATOM   643  C CB  . CYS A 1 87  ? 15.141  -0.954  53.974 1.00 38.71  ? 87  CYS A CB  1 
ATOM   644  S SG  . CYS A 1 87  ? 14.587  0.690   53.558 1.00 44.67  ? 87  CYS A SG  1 
ATOM   645  N N   . TYR A 1 88  ? 17.544  -3.007  54.847 1.00 42.23  ? 88  TYR A N   1 
ATOM   646  C CA  . TYR A 1 88  ? 17.747  -4.413  55.258 1.00 42.00  ? 88  TYR A CA  1 
ATOM   647  C C   . TYR A 1 88  ? 17.095  -4.762  56.622 1.00 40.98  ? 88  TYR A C   1 
ATOM   648  O O   . TYR A 1 88  ? 17.011  -5.941  56.984 1.00 40.24  ? 88  TYR A O   1 
ATOM   649  C CB  . TYR A 1 88  ? 19.244  -4.820  55.281 1.00 40.88  ? 88  TYR A CB  1 
ATOM   650  C CG  . TYR A 1 88  ? 20.005  -4.607  53.985 1.00 42.81  ? 88  TYR A CG  1 
ATOM   651  C CD1 . TYR A 1 88  ? 19.384  -4.756  52.764 1.00 44.21  ? 88  TYR A CD1 1 
ATOM   652  C CD2 . TYR A 1 88  ? 21.369  -4.278  53.992 1.00 46.96  ? 88  TYR A CD2 1 
ATOM   653  C CE1 . TYR A 1 88  ? 20.070  -4.552  51.578 1.00 48.77  ? 88  TYR A CE1 1 
ATOM   654  C CE2 . TYR A 1 88  ? 22.080  -4.075  52.807 1.00 47.13  ? 88  TYR A CE2 1 
ATOM   655  C CZ  . TYR A 1 88  ? 21.413  -4.208  51.590 1.00 50.41  ? 88  TYR A CZ  1 
ATOM   656  O OH  . TYR A 1 88  ? 22.054  -4.015  50.370 1.00 48.10  ? 88  TYR A OH  1 
ATOM   657  N N   . TYR A 1 89  ? 16.626  -3.759  57.365 1.00 38.21  ? 89  TYR A N   1 
ATOM   658  C CA  . TYR A 1 89  ? 16.161  -4.015  58.729 1.00 39.39  ? 89  TYR A CA  1 
ATOM   659  C C   . TYR A 1 89  ? 14.814  -3.369  59.003 1.00 40.88  ? 89  TYR A C   1 
ATOM   660  O O   . TYR A 1 89  ? 14.659  -2.657  59.993 1.00 40.03  ? 89  TYR A O   1 
ATOM   661  C CB  . TYR A 1 89  ? 17.192  -3.514  59.761 1.00 39.67  ? 89  TYR A CB  1 
ATOM   662  C CG  . TYR A 1 89  ? 18.638  -3.752  59.384 1.00 40.16  ? 89  TYR A CG  1 
ATOM   663  C CD1 . TYR A 1 89  ? 19.323  -2.829  58.597 1.00 39.82  ? 89  TYR A CD1 1 
ATOM   664  C CD2 . TYR A 1 89  ? 19.319  -4.899  59.803 1.00 40.41  ? 89  TYR A CD2 1 
ATOM   665  C CE1 . TYR A 1 89  ? 20.644  -3.030  58.222 1.00 42.75  ? 89  TYR A CE1 1 
ATOM   666  C CE2 . TYR A 1 89  ? 20.662  -5.116  59.437 1.00 43.41  ? 89  TYR A CE2 1 
ATOM   667  C CZ  . TYR A 1 89  ? 21.317  -4.168  58.643 1.00 44.60  ? 89  TYR A CZ  1 
ATOM   668  O OH  . TYR A 1 89  ? 22.638  -4.329  58.267 1.00 42.86  ? 89  TYR A OH  1 
ATOM   669  N N   . HIS A 1 90  ? 13.833  -3.646  58.145 1.00 42.62  ? 90  HIS A N   1 
ATOM   670  C CA  . HIS A 1 90  ? 12.530  -2.983  58.230 1.00 42.89  ? 90  HIS A CA  1 
ATOM   671  C C   . HIS A 1 90  ? 11.378  -3.971  58.216 1.00 45.00  ? 90  HIS A C   1 
ATOM   672  O O   . HIS A 1 90  ? 10.207  -3.569  58.264 1.00 44.81  ? 90  HIS A O   1 
ATOM   673  C CB  . HIS A 1 90  ? 12.375  -2.009  57.059 1.00 42.75  ? 90  HIS A CB  1 
ATOM   674  C CG  . HIS A 1 90  ? 12.405  -2.674  55.714 1.00 44.27  ? 90  HIS A CG  1 
ATOM   675  N ND1 . HIS A 1 90  ? 13.517  -3.325  55.227 1.00 46.85  ? 90  HIS A ND1 1 
ATOM   676  C CD2 . HIS A 1 90  ? 11.457  -2.789  54.755 1.00 44.53  ? 90  HIS A CD2 1 
ATOM   677  C CE1 . HIS A 1 90  ? 13.254  -3.812  54.028 1.00 43.08  ? 90  HIS A CE1 1 
ATOM   678  N NE2 . HIS A 1 90  ? 12.010  -3.499  53.718 1.00 43.38  ? 90  HIS A NE2 1 
ATOM   679  N N   . LYS A 1 91  ? 11.714  -5.258  58.154 1.00 46.41  ? 91  LYS A N   1 
ATOM   680  C CA  . LYS A 1 91  ? 10.714  -6.296  57.958 1.00 48.64  ? 91  LYS A CA  1 
ATOM   681  C C   . LYS A 1 91  ? 10.057  -6.787  59.229 1.00 50.71  ? 91  LYS A C   1 
ATOM   682  O O   . LYS A 1 91  ? 10.538  -6.533  60.315 1.00 48.92  ? 91  LYS A O   1 
ATOM   683  C CB  . LYS A 1 91  ? 11.304  -7.483  57.200 1.00 48.35  ? 91  LYS A CB  1 
ATOM   684  C CG  . LYS A 1 91  ? 11.360  -7.296  55.700 1.00 49.20  ? 91  LYS A CG  1 
ATOM   685  C CD  . LYS A 1 91  ? 11.239  -8.638  54.974 1.00 52.77  ? 91  LYS A CD  1 
ATOM   686  C CE  . LYS A 1 91  ? 12.455  -9.556  55.182 1.00 51.20  ? 91  LYS A CE  1 
ATOM   687  N NZ  . LYS A 1 91  ? 13.590  -9.279  54.241 1.00 50.09  ? 91  LYS A NZ  1 
ATOM   688  N N   . SER A 1 92  ? 8.940   -7.494  59.041 1.00 56.66  ? 92  SER A N   1 
ATOM   689  C CA  . SER A 1 92  ? 8.129   -8.146  60.081 1.00 58.02  ? 92  SER A CA  1 
ATOM   690  C C   . SER A 1 92  ? 7.933   -7.390  61.378 1.00 59.80  ? 92  SER A C   1 
ATOM   691  O O   . SER A 1 92  ? 8.754   -7.412  62.304 1.00 63.12  ? 92  SER A O   1 
ATOM   692  C CB  . SER A 1 92  ? 8.636   -9.561  60.357 1.00 58.15  ? 92  SER A CB  1 
ATOM   693  O OG  . SER A 1 92  ? 7.930   -10.485 59.551 1.00 60.41  ? 92  SER A OG  1 
ATOM   694  O OXT . SER A 1 92  ? 6.901   -6.734  61.499 1.00 63.09  ? 92  SER A OXT 1 
ATOM   695  N N   . CYS B 2 3   ? 4.505   10.773  55.130 1.00 48.19  ? 3   CYS B N   1 
ATOM   696  C CA  . CYS B 2 3   ? 3.807   9.481   54.898 1.00 49.51  ? 3   CYS B CA  1 
ATOM   697  C C   . CYS B 2 3   ? 2.324   9.574   55.255 1.00 48.54  ? 3   CYS B C   1 
ATOM   698  O O   . CYS B 2 3   ? 1.978   9.617   56.417 1.00 51.52  ? 3   CYS B O   1 
ATOM   699  C CB  . CYS B 2 3   ? 4.486   8.378   55.704 1.00 48.34  ? 3   CYS B CB  1 
ATOM   700  S SG  . CYS B 2 3   ? 3.647   6.773   55.627 1.00 53.55  ? 3   CYS B SG  1 
ATOM   701  N N   . GLU B 2 4   ? 1.454   9.609   54.251 1.00 50.42  ? 4   GLU B N   1 
ATOM   702  C CA  . GLU B 2 4   ? 0.011   9.730   54.469 1.00 51.74  ? 4   GLU B CA  1 
ATOM   703  C C   . GLU B 2 4   ? -0.753  8.964   53.409 1.00 49.28  ? 4   GLU B C   1 
ATOM   704  O O   . GLU B 2 4   ? -0.169  8.534   52.419 1.00 47.81  ? 4   GLU B O   1 
ATOM   705  C CB  . GLU B 2 4   ? -0.436  11.203  54.448 1.00 55.39  ? 4   GLU B CB  1 
ATOM   706  C CG  . GLU B 2 4   ? -0.212  11.939  53.126 1.00 60.81  ? 4   GLU B CG  1 
ATOM   707  C CD  . GLU B 2 4   ? 1.252   12.319  52.880 1.00 67.74  ? 4   GLU B CD  1 
ATOM   708  O OE1 . GLU B 2 4   ? 1.960   12.694  53.856 1.00 71.90  ? 4   GLU B OE1 1 
ATOM   709  O OE2 . GLU B 2 4   ? 1.702   12.253  51.705 1.00 69.56  ? 4   GLU B OE2 1 
ATOM   710  N N   . LEU B 2 5   ? -2.056  8.794   53.627 1.00 49.35  ? 5   LEU B N   1 
ATOM   711  C CA  . LEU B 2 5   ? -2.916  8.144   52.639 1.00 48.73  ? 5   LEU B CA  1 
ATOM   712  C C   . LEU B 2 5   ? -2.986  9.017   51.408 1.00 49.05  ? 5   LEU B C   1 
ATOM   713  O O   . LEU B 2 5   ? -3.240  10.215  51.504 1.00 49.88  ? 5   LEU B O   1 
ATOM   714  C CB  . LEU B 2 5   ? -4.332  7.955   53.164 1.00 47.23  ? 5   LEU B CB  1 
ATOM   715  C CG  . LEU B 2 5   ? -4.566  7.055   54.365 1.00 46.85  ? 5   LEU B CG  1 
ATOM   716  C CD1 . LEU B 2 5   ? -5.868  7.472   55.029 1.00 46.83  ? 5   LEU B CD1 1 
ATOM   717  C CD2 . LEU B 2 5   ? -4.601  5.596   53.944 1.00 47.11  ? 5   LEU B CD2 1 
ATOM   718  N N   . THR B 2 6   ? -2.749  8.415   50.251 1.00 50.60  ? 6   THR B N   1 
ATOM   719  C CA  . THR B 2 6   ? -2.829  9.135   48.988 1.00 51.99  ? 6   THR B CA  1 
ATOM   720  C C   . THR B 2 6   ? -3.739  8.391   48.010 1.00 50.26  ? 6   THR B C   1 
ATOM   721  O O   . THR B 2 6   ? -3.970  7.182   48.146 1.00 49.32  ? 6   THR B O   1 
ATOM   722  C CB  . THR B 2 6   ? -1.422  9.323   48.382 1.00 52.66  ? 6   THR B CB  1 
ATOM   723  O OG1 . THR B 2 6   ? -0.830  8.044   48.120 1.00 56.20  ? 6   THR B OG1 1 
ATOM   724  C CG2 . THR B 2 6   ? -0.473  9.926   49.407 1.00 56.99  ? 6   THR B CG2 1 
ATOM   725  N N   . ASN B 2 7   ? -4.276  9.113   47.040 1.00 48.73  ? 7   ASN B N   1 
ATOM   726  C CA  . ASN B 2 7   ? -5.066  8.463   46.026 1.00 50.02  ? 7   ASN B CA  1 
ATOM   727  C C   . ASN B 2 7   ? -4.157  7.972   44.932 1.00 47.93  ? 7   ASN B C   1 
ATOM   728  O O   . ASN B 2 7   ? -3.312  8.713   44.446 1.00 48.18  ? 7   ASN B O   1 
ATOM   729  C CB  . ASN B 2 7   ? -6.132  9.398   45.469 1.00 54.55  ? 7   ASN B CB  1 
ATOM   730  C CG  . ASN B 2 7   ? -7.261  9.628   46.451 1.00 59.59  ? 7   ASN B CG  1 
ATOM   731  O OD1 . ASN B 2 7   ? -7.566  8.758   47.281 1.00 59.01  ? 7   ASN B OD1 1 
ATOM   732  N ND2 . ASN B 2 7   ? -7.879  10.807  46.376 1.00 65.79  ? 7   ASN B ND2 1 
ATOM   733  N N   . ILE B 2 8   ? -4.309  6.703   44.576 1.00 46.05  ? 8   ILE B N   1 
ATOM   734  C CA  . ILE B 2 8   ? -3.530  6.116   43.500 1.00 44.32  ? 8   ILE B CA  1 
ATOM   735  C C   . ILE B 2 8   ? -4.449  5.365   42.553 1.00 44.70  ? 8   ILE B C   1 
ATOM   736  O O   . ILE B 2 8   ? -5.618  5.130   42.863 1.00 44.97  ? 8   ILE B O   1 
ATOM   737  C CB  . ILE B 2 8   ? -2.405  5.176   44.029 1.00 42.14  ? 8   ILE B CB  1 
ATOM   738  C CG1 . ILE B 2 8   ? -2.988  3.878   44.596 1.00 41.91  ? 8   ILE B CG1 1 
ATOM   739  C CG2 . ILE B 2 8   ? -1.539  5.907   45.044 1.00 41.26  ? 8   ILE B CG2 1 
ATOM   740  C CD1 . ILE B 2 8   ? -1.944  2.807   44.838 1.00 40.01  ? 8   ILE B CD1 1 
ATOM   741  N N   . THR B 2 9   ? -3.910  4.996   41.397 1.00 45.04  ? 9   THR B N   1 
ATOM   742  C CA  . THR B 2 9   ? -4.652  4.244   40.410 1.00 44.11  ? 9   THR B CA  1 
ATOM   743  C C   . THR B 2 9   ? -3.995  2.881   40.286 1.00 43.02  ? 9   THR B C   1 
ATOM   744  O O   . THR B 2 9   ? -2.840  2.783   39.889 1.00 44.45  ? 9   THR B O   1 
ATOM   745  C CB  . THR B 2 9   ? -4.620  4.982   39.062 1.00 43.93  ? 9   THR B CB  1 
ATOM   746  O OG1 . THR B 2 9   ? -5.085  6.319   39.249 1.00 41.76  ? 9   THR B OG1 1 
ATOM   747  C CG2 . THR B 2 9   ? -5.592  4.364   38.063 1.00 43.96  ? 9   THR B CG2 1 
ATOM   748  N N   . ILE B 2 10  ? -4.720  1.832   40.643 1.00 42.90  ? 10  ILE B N   1 
ATOM   749  C CA  . ILE B 2 10  ? -4.190  0.482   40.524 1.00 44.50  ? 10  ILE B CA  1 
ATOM   750  C C   . ILE B 2 10  ? -4.806  -0.177  39.299 1.00 43.96  ? 10  ILE B C   1 
ATOM   751  O O   . ILE B 2 10  ? -5.923  0.177   38.915 1.00 45.69  ? 10  ILE B O   1 
ATOM   752  C CB  . ILE B 2 10  ? -4.511  -0.341  41.787 1.00 45.69  ? 10  ILE B CB  1 
ATOM   753  C CG1 . ILE B 2 10  ? -6.024  -0.565  41.923 1.00 45.15  ? 10  ILE B CG1 1 
ATOM   754  C CG2 . ILE B 2 10  ? -3.941  0.348   43.007 1.00 42.76  ? 10  ILE B CG2 1 
ATOM   755  C CD1 . ILE B 2 10  ? -6.389  -1.596  42.958 1.00 47.69  ? 10  ILE B CD1 1 
ATOM   756  N N   . ALA B 2 11  ? -4.085  -1.110  38.681 1.00 40.87  ? 11  ALA B N   1 
ATOM   757  C CA  . ALA B 2 11  ? -4.611  -1.826  37.527 1.00 40.06  ? 11  ALA B CA  1 
ATOM   758  C C   . ALA B 2 11  ? -4.974  -3.240  37.927 1.00 41.53  ? 11  ALA B C   1 
ATOM   759  O O   . ALA B 2 11  ? -4.193  -3.936  38.569 1.00 44.40  ? 11  ALA B O   1 
ATOM   760  C CB  . ALA B 2 11  ? -3.626  -1.831  36.394 1.00 36.31  ? 11  ALA B CB  1 
ATOM   761  N N   . ILE B 2 12  ? -6.185  -3.638  37.563 1.00 43.79  ? 12  ILE B N   1 
ATOM   762  C CA  . ILE B 2 12  ? -6.718  -4.961  37.820 1.00 46.08  ? 12  ILE B CA  1 
ATOM   763  C C   . ILE B 2 12  ? -6.756  -5.667  36.489 1.00 48.87  ? 12  ILE B C   1 
ATOM   764  O O   . ILE B 2 12  ? -7.377  -5.154  35.559 1.00 54.49  ? 12  ILE B O   1 
ATOM   765  C CB  . ILE B 2 12  ? -8.127  -4.824  38.346 1.00 45.65  ? 12  ILE B CB  1 
ATOM   766  C CG1 . ILE B 2 12  ? -8.067  -4.282  39.767 1.00 48.84  ? 12  ILE B CG1 1 
ATOM   767  C CG2 . ILE B 2 12  ? -8.865  -6.158  38.259 1.00 47.35  ? 12  ILE B CG2 1 
ATOM   768  C CD1 . ILE B 2 12  ? -9.393  -3.891  40.353 1.00 50.71  ? 12  ILE B CD1 1 
ATOM   769  N N   . GLU B 2 13  ? -6.118  -6.825  36.365 1.00 48.98  ? 13  GLU B N   1 
ATOM   770  C CA  . GLU B 2 13  ? -6.097  -7.453  35.053 1.00 49.70  ? 13  GLU B CA  1 
ATOM   771  C C   . GLU B 2 13  ? -6.805  -8.774  34.950 1.00 50.58  ? 13  GLU B C   1 
ATOM   772  O O   . GLU B 2 13  ? -6.725  -9.611  35.855 1.00 51.69  ? 13  GLU B O   1 
ATOM   773  C CB  . GLU B 2 13  ? -4.681  -7.509  34.460 1.00 49.27  ? 13  GLU B CB  1 
ATOM   774  C CG  . GLU B 2 13  ? -3.797  -8.679  34.812 1.00 49.01  ? 13  GLU B CG  1 
ATOM   775  C CD  . GLU B 2 13  ? -2.421  -8.557  34.158 1.00 51.09  ? 13  GLU B CD  1 
ATOM   776  O OE1 . GLU B 2 13  ? -1.931  -7.420  33.944 1.00 51.18  ? 13  GLU B OE1 1 
ATOM   777  O OE2 . GLU B 2 13  ? -1.822  -9.606  33.853 1.00 53.21  ? 13  GLU B OE2 1 
ATOM   778  N N   . LYS B 2 14  ? -7.528  -8.927  33.841 1.00 50.60  ? 14  LYS B N   1 
ATOM   779  C CA  . LYS B 2 14  ? -8.225  -10.157 33.521 1.00 50.95  ? 14  LYS B CA  1 
ATOM   780  C C   . LYS B 2 14  ? -7.402  -10.917 32.487 1.00 53.16  ? 14  LYS B C   1 
ATOM   781  O O   . LYS B 2 14  ? -7.248  -10.472 31.346 1.00 50.96  ? 14  LYS B O   1 
ATOM   782  C CB  . LYS B 2 14  ? -9.622  -9.858  33.005 1.00 49.76  ? 14  LYS B CB  1 
ATOM   783  C CG  . LYS B 2 14  ? -10.498 -11.079 32.882 1.00 48.30  ? 14  LYS B CG  1 
ATOM   784  C CD  . LYS B 2 14  ? -11.931 -10.728 33.153 1.00 48.02  ? 14  LYS B CD  1 
ATOM   785  C CE  . LYS B 2 14  ? -12.711 -11.961 33.518 1.00 49.29  ? 14  LYS B CE  1 
ATOM   786  N NZ  . LYS B 2 14  ? -14.104 -11.596 33.881 1.00 54.39  ? 14  LYS B NZ  1 
ATOM   787  N N   . GLU B 2 15  ? -6.869  -12.059 32.925 1.00 55.80  ? 15  GLU B N   1 
ATOM   788  C CA  . GLU B 2 15  ? -5.988  -12.882 32.115 1.00 60.17  ? 15  GLU B CA  1 
ATOM   789  C C   . GLU B 2 15  ? -6.684  -13.383 30.858 1.00 59.91  ? 15  GLU B C   1 
ATOM   790  O O   . GLU B 2 15  ? -6.199  -13.179 29.747 1.00 59.28  ? 15  GLU B O   1 
ATOM   791  C CB  . GLU B 2 15  ? -5.476  -14.067 32.944 1.00 63.88  ? 15  GLU B CB  1 
ATOM   792  C CG  . GLU B 2 15  ? -4.244  -14.747 32.363 1.00 71.12  ? 15  GLU B CG  1 
ATOM   793  C CD  . GLU B 2 15  ? -2.942  -14.148 32.870 1.00 76.69  ? 15  GLU B CD  1 
ATOM   794  O OE1 . GLU B 2 15  ? -2.974  -13.116 33.584 1.00 81.68  ? 15  GLU B OE1 1 
ATOM   795  O OE2 . GLU B 2 15  ? -1.870  -14.717 32.562 1.00 82.02  ? 15  GLU B OE2 1 
ATOM   796  N N   . GLU B 2 16  ? -7.823  -14.031 31.040 1.00 61.29  ? 16  GLU B N   1 
ATOM   797  C CA  . GLU B 2 16  ? -8.587  -14.588 29.932 1.00 61.26  ? 16  GLU B CA  1 
ATOM   798  C C   . GLU B 2 16  ? -8.889  -13.554 28.860 1.00 59.09  ? 16  GLU B C   1 
ATOM   799  O O   . GLU B 2 16  ? -8.805  -13.847 27.678 1.00 61.21  ? 16  GLU B O   1 
ATOM   800  C CB  . GLU B 2 16  ? -9.881  -15.245 30.432 1.00 64.69  ? 16  GLU B CB  1 
ATOM   801  C CG  . GLU B 2 16  ? -10.378 -14.769 31.797 1.00 71.25  ? 16  GLU B CG  1 
ATOM   802  C CD  . GLU B 2 16  ? -9.337  -14.913 32.910 1.00 78.06  ? 16  GLU B CD  1 
ATOM   803  O OE1 . GLU B 2 16  ? -8.529  -15.877 32.875 1.00 83.17  ? 16  GLU B OE1 1 
ATOM   804  O OE2 . GLU B 2 16  ? -9.307  -14.057 33.826 1.00 80.23  ? 16  GLU B OE2 1 
ATOM   805  N N   . CYS B 2 17  ? -9.206  -12.336 29.279 1.00 57.14  ? 17  CYS B N   1 
ATOM   806  C CA  . CYS B 2 17  ? -9.615  -11.289 28.348 1.00 54.22  ? 17  CYS B CA  1 
ATOM   807  C C   . CYS B 2 17  ? -8.501  -10.448 27.753 1.00 52.65  ? 17  CYS B C   1 
ATOM   808  O O   . CYS B 2 17  ? -8.770  -9.569  26.939 1.00 52.51  ? 17  CYS B O   1 
ATOM   809  C CB  . CYS B 2 17  ? -10.624 -10.383 29.031 1.00 55.04  ? 17  CYS B CB  1 
ATOM   810  S SG  . CYS B 2 17  ? -12.211 -11.206 29.176 1.00 58.24  ? 17  CYS B SG  1 
ATOM   811  N N   . ARG B 2 18  ? -7.261  -10.711 28.159 1.00 51.85  ? 18  ARG B N   1 
ATOM   812  C CA  . ARG B 2 18  ? -6.105  -9.961  27.686 1.00 47.74  ? 18  ARG B CA  1 
ATOM   813  C C   . ARG B 2 18  ? -6.211  -8.448  27.916 1.00 45.97  ? 18  ARG B C   1 
ATOM   814  O O   . ARG B 2 18  ? -5.780  -7.664  27.075 1.00 45.10  ? 18  ARG B O   1 
ATOM   815  C CB  . ARG B 2 18  ? -5.831  -10.257 26.208 1.00 48.19  ? 18  ARG B CB  1 
ATOM   816  C CG  . ARG B 2 18  ? -5.119  -11.573 25.950 1.00 51.85  ? 18  ARG B CG  1 
ATOM   817  C CD  . ARG B 2 18  ? -4.288  -11.597 24.640 1.00 54.78  ? 18  ARG B CD  1 
ATOM   818  N NE  . ARG B 2 18  ? -3.064  -12.391 24.815 1.00 57.92  ? 18  ARG B NE  1 
ATOM   819  C CZ  . ARG B 2 18  ? -1.808  -11.927 24.734 1.00 58.35  ? 18  ARG B CZ  1 
ATOM   820  N NH1 . ARG B 2 18  ? -1.553  -10.648 24.453 1.00 57.56  ? 18  ARG B NH1 1 
ATOM   821  N NH2 . ARG B 2 18  ? -0.792  -12.763 24.923 1.00 60.08  ? 18  ARG B NH2 1 
ATOM   822  N N   . PHE B 2 19  ? -6.796  -8.033  29.040 1.00 45.18  ? 19  PHE B N   1 
ATOM   823  C CA  . PHE B 2 19  ? -6.763  -6.610  29.428 1.00 45.87  ? 19  PHE B CA  1 
ATOM   824  C C   . PHE B 2 19  ? -6.795  -6.350  30.937 1.00 45.14  ? 19  PHE B C   1 
ATOM   825  O O   . PHE B 2 19  ? -7.007  -7.259  31.742 1.00 42.71  ? 19  PHE B O   1 
ATOM   826  C CB  . PHE B 2 19  ? -7.869  -5.773  28.728 1.00 46.93  ? 19  PHE B CB  1 
ATOM   827  C CG  . PHE B 2 19  ? -9.286  -6.210  29.044 1.00 46.45  ? 19  PHE B CG  1 
ATOM   828  C CD1 . PHE B 2 19  ? -9.806  -6.085  30.331 1.00 46.51  ? 19  PHE B CD1 1 
ATOM   829  C CD2 . PHE B 2 19  ? -10.103 -6.734  28.044 1.00 45.60  ? 19  PHE B CD2 1 
ATOM   830  C CE1 . PHE B 2 19  ? -11.092 -6.500  30.613 1.00 47.35  ? 19  PHE B CE1 1 
ATOM   831  C CE2 . PHE B 2 19  ? -11.398 -7.144  28.323 1.00 44.73  ? 19  PHE B CE2 1 
ATOM   832  C CZ  . PHE B 2 19  ? -11.891 -7.027  29.608 1.00 47.49  ? 19  PHE B CZ  1 
ATOM   833  N N   . CYS B 2 20  ? -6.577  -5.086  31.286 1.00 46.60  ? 20  CYS B N   1 
ATOM   834  C CA  . CYS B 2 20  ? -6.727  -4.593  32.643 1.00 49.51  ? 20  CYS B CA  1 
ATOM   835  C C   . CYS B 2 20  ? -7.773  -3.482  32.654 1.00 50.05  ? 20  CYS B C   1 
ATOM   836  O O   . CYS B 2 20  ? -8.018  -2.845  31.637 1.00 49.11  ? 20  CYS B O   1 
ATOM   837  C CB  . CYS B 2 20  ? -5.408  -4.019  33.153 1.00 49.43  ? 20  CYS B CB  1 
ATOM   838  S SG  . CYS B 2 20  ? -4.011  -5.158  32.975 1.00 57.15  ? 20  CYS B SG  1 
ATOM   839  N N   . ILE B 2 21  ? -8.409  -3.269  33.800 1.00 50.60  ? 21  ILE B N   1 
ATOM   840  C CA  . ILE B 2 21  ? -9.206  -2.065  33.984 1.00 50.07  ? 21  ILE B CA  1 
ATOM   841  C C   . ILE B 2 21  ? -8.499  -1.249  35.067 1.00 49.37  ? 21  ILE B C   1 
ATOM   842  O O   . ILE B 2 21  ? -7.820  -1.815  35.920 1.00 49.81  ? 21  ILE B O   1 
ATOM   843  C CB  . ILE B 2 21  ? -10.696 -2.373  34.348 1.00 49.00  ? 21  ILE B CB  1 
ATOM   844  C CG1 . ILE B 2 21  ? -10.815 -3.155  35.661 1.00 48.34  ? 21  ILE B CG1 1 
ATOM   845  C CG2 . ILE B 2 21  ? -11.366 -3.127  33.211 1.00 48.81  ? 21  ILE B CG2 1 
ATOM   846  C CD1 . ILE B 2 21  ? -12.215 -3.154  36.257 1.00 42.61  ? 21  ILE B CD1 1 
ATOM   847  N N   . SER B 2 22  ? -8.629  0.072   35.003 1.00 48.17  ? 22  SER B N   1 
ATOM   848  C CA  . SER B 2 22  ? -8.037  0.963   35.991 1.00 46.07  ? 22  SER B CA  1 
ATOM   849  C C   . SER B 2 22  ? -9.044  1.350   37.061 1.00 45.37  ? 22  SER B C   1 
ATOM   850  O O   . SER B 2 22  ? -10.168 1.731   36.754 1.00 44.69  ? 22  SER B O   1 
ATOM   851  C CB  . SER B 2 22  ? -7.522  2.233   35.313 1.00 44.66  ? 22  SER B CB  1 
ATOM   852  O OG  . SER B 2 22  ? -6.182  2.070   34.907 1.00 44.51  ? 22  SER B OG  1 
ATOM   853  N N   . ILE B 2 23  ? -8.622  1.285   38.318 1.00 46.84  ? 23  ILE B N   1 
ATOM   854  C CA  . ILE B 2 23  ? -9.474  1.661   39.439 1.00 47.61  ? 23  ILE B CA  1 
ATOM   855  C C   . ILE B 2 23  ? -8.759  2.654   40.339 1.00 47.82  ? 23  ILE B C   1 
ATOM   856  O O   . ILE B 2 23  ? -7.599  2.444   40.683 1.00 49.98  ? 23  ILE B O   1 
ATOM   857  C CB  . ILE B 2 23  ? -9.858  0.400   40.242 1.00 47.54  ? 23  ILE B CB  1 
ATOM   858  C CG1 . ILE B 2 23  ? -10.674 -0.515  39.358 1.00 49.01  ? 23  ILE B CG1 1 
ATOM   859  C CG2 . ILE B 2 23  ? -10.650 0.738   41.506 1.00 46.27  ? 23  ILE B CG2 1 
ATOM   860  C CD1 . ILE B 2 23  ? -11.208 -1.671  40.087 1.00 56.86  ? 23  ILE B CD1 1 
ATOM   861  N N   . ASN B 2 24  ? -9.459  3.723   40.718 1.00 49.77  ? 24  ASN B N   1 
ATOM   862  C CA  . ASN B 2 24  ? -8.970  4.697   41.698 1.00 50.37  ? 24  ASN B CA  1 
ATOM   863  C C   . ASN B 2 24  ? -9.218  4.235   43.119 1.00 48.33  ? 24  ASN B C   1 
ATOM   864  O O   . ASN B 2 24  ? -10.349 3.942   43.491 1.00 50.58  ? 24  ASN B O   1 
ATOM   865  C CB  . ASN B 2 24  ? -9.658  6.042   41.504 1.00 52.94  ? 24  ASN B CB  1 
ATOM   866  C CG  . ASN B 2 24  ? -8.938  6.916   40.517 1.00 57.68  ? 24  ASN B CG  1 
ATOM   867  O OD1 . ASN B 2 24  ? -8.101  6.429   39.741 1.00 56.99  ? 24  ASN B OD1 1 
ATOM   868  N ND2 . ASN B 2 24  ? -9.228  8.228   40.559 1.00 63.47  ? 24  ASN B ND2 1 
ATOM   869  N N   . THR B 2 25  ? -8.162  4.190   43.917 1.00 46.95  ? 25  THR B N   1 
ATOM   870  C CA  . THR B 2 25  ? -8.271  3.776   45.305 1.00 45.80  ? 25  THR B CA  1 
ATOM   871  C C   . THR B 2 25  ? -7.340  4.598   46.205 1.00 45.56  ? 25  THR B C   1 
ATOM   872  O O   . THR B 2 25  ? -6.764  5.596   45.776 1.00 46.05  ? 25  THR B O   1 
ATOM   873  C CB  . THR B 2 25  ? -8.003  2.252   45.415 1.00 46.95  ? 25  THR B CB  1 
ATOM   874  O OG1 . THR B 2 25  ? -8.105  1.835   46.779 1.00 48.95  ? 25  THR B OG1 1 
ATOM   875  C CG2 . THR B 2 25  ? -6.571  1.904   45.009 1.00 48.24  ? 25  THR B CG2 1 
ATOM   876  N N   . THR B 2 26  ? -7.186  4.182   47.452 1.00 45.89  ? 26  THR B N   1 
ATOM   877  C CA  . THR B 2 26  ? -6.393  4.948   48.392 1.00 46.15  ? 26  THR B CA  1 
ATOM   878  C C   . THR B 2 26  ? -5.307  4.099   49.032 1.00 44.41  ? 26  THR B C   1 
ATOM   879  O O   . THR B 2 26  ? -5.617  3.103   49.686 1.00 44.96  ? 26  THR B O   1 
ATOM   880  C CB  . THR B 2 26  ? -7.309  5.507   49.500 1.00 47.74  ? 26  THR B CB  1 
ATOM   881  O OG1 . THR B 2 26  ? -8.617  5.754   48.966 1.00 47.67  ? 26  THR B OG1 1 
ATOM   882  C CG2 . THR B 2 26  ? -6.824  6.867   49.960 1.00 48.14  ? 26  THR B CG2 1 
ATOM   883  N N   . TRP B 2 27  ? -4.047  4.498   48.863 1.00 42.43  ? 27  TRP B N   1 
ATOM   884  C CA  . TRP B 2 27  ? -2.940  3.811   49.537 1.00 41.95  ? 27  TRP B CA  1 
ATOM   885  C C   . TRP B 2 27  ? -1.923  4.700   50.286 1.00 42.53  ? 27  TRP B C   1 
ATOM   886  O O   . TRP B 2 27  ? -2.212  5.855   50.569 1.00 44.86  ? 27  TRP B O   1 
ATOM   887  C CB  . TRP B 2 27  ? -2.263  2.833   48.584 1.00 40.28  ? 27  TRP B CB  1 
ATOM   888  C CG  . TRP B 2 27  ? -2.901  1.527   48.690 1.00 36.59  ? 27  TRP B CG  1 
ATOM   889  C CD1 . TRP B 2 27  ? -3.969  1.076   47.976 1.00 35.69  ? 27  TRP B CD1 1 
ATOM   890  C CD2 . TRP B 2 27  ? -2.572  0.501   49.624 1.00 35.29  ? 27  TRP B CD2 1 
ATOM   891  N NE1 . TRP B 2 27  ? -4.321  -0.184  48.397 1.00 35.02  ? 27  TRP B NE1 1 
ATOM   892  C CE2 . TRP B 2 27  ? -3.476  -0.564  49.408 1.00 36.08  ? 27  TRP B CE2 1 
ATOM   893  C CE3 . TRP B 2 27  ? -1.583  0.356   50.604 1.00 32.52  ? 27  TRP B CE3 1 
ATOM   894  C CZ2 . TRP B 2 27  ? -3.437  -1.750  50.159 1.00 33.91  ? 27  TRP B CZ2 1 
ATOM   895  C CZ3 . TRP B 2 27  ? -1.544  -0.822  51.351 1.00 34.71  ? 27  TRP B CZ3 1 
ATOM   896  C CH2 . TRP B 2 27  ? -2.461  -1.864  51.113 1.00 32.30  ? 27  TRP B CH2 1 
ATOM   897  N N   . CYS B 2 28  ? -0.759  4.141   50.620 1.00 43.26  ? 28  CYS B N   1 
ATOM   898  C CA  . CYS B 2 28  ? 0.289   4.812   51.388 1.00 41.86  ? 28  CYS B CA  1 
ATOM   899  C C   . CYS B 2 28  ? 1.414   5.254   50.492 1.00 42.63  ? 28  CYS B C   1 
ATOM   900  O O   . CYS B 2 28  ? 1.763   4.547   49.543 1.00 45.79  ? 28  CYS B O   1 
ATOM   901  C CB  . CYS B 2 28  ? 0.890   3.845   52.393 1.00 43.89  ? 28  CYS B CB  1 
ATOM   902  S SG  . CYS B 2 28  ? -0.340  3.209   53.531 1.00 48.86  ? 28  CYS B SG  1 
ATOM   903  N N   . ALA B 2 29  ? 1.989   6.409   50.819 1.00 40.46  ? 29  ALA B N   1 
ATOM   904  C CA  . ALA B 2 29  ? 3.157   6.960   50.134 1.00 38.39  ? 29  ALA B CA  1 
ATOM   905  C C   . ALA B 2 29  ? 3.675   8.163   50.913 1.00 37.85  ? 29  ALA B C   1 
ATOM   906  O O   . ALA B 2 29  ? 2.905   8.834   51.596 1.00 36.55  ? 29  ALA B O   1 
ATOM   907  C CB  . ALA B 2 29  ? 2.813   7.365   48.715 1.00 37.34  ? 29  ALA B CB  1 
ATOM   908  N N   . GLY B 2 30  ? 4.974   8.431   50.802 1.00 38.06  ? 30  GLY B N   1 
ATOM   909  C CA  . GLY B 2 30  ? 5.575   9.568   51.491 1.00 39.97  ? 30  GLY B CA  1 
ATOM   910  C C   . GLY B 2 30  ? 6.913   9.304   52.171 1.00 40.47  ? 30  GLY B C   1 
ATOM   911  O O   . GLY B 2 30  ? 7.651   8.372   51.800 1.00 40.33  ? 30  GLY B O   1 
ATOM   912  N N   . TYR B 2 31  ? 7.224   10.124  53.176 1.00 38.78  ? 31  TYR B N   1 
ATOM   913  C CA  . TYR B 2 31  ? 8.530   10.063  53.813 1.00 37.97  ? 31  TYR B CA  1 
ATOM   914  C C   . TYR B 2 31  ? 8.504   9.513   55.225 1.00 39.66  ? 31  TYR B C   1 
ATOM   915  O O   . TYR B 2 31  ? 7.484   9.591   55.915 1.00 41.61  ? 31  TYR B O   1 
ATOM   916  C CB  . TYR B 2 31  ? 9.212   11.423  53.740 1.00 33.69  ? 31  TYR B CB  1 
ATOM   917  C CG  . TYR B 2 31  ? 9.540   11.758  52.314 1.00 33.68  ? 31  TYR B CG  1 
ATOM   918  C CD1 . TYR B 2 31  ? 8.543   12.195  51.436 1.00 35.04  ? 31  TYR B CD1 1 
ATOM   919  C CD2 . TYR B 2 31  ? 10.836  11.601  51.824 1.00 31.96  ? 31  TYR B CD2 1 
ATOM   920  C CE1 . TYR B 2 31  ? 8.831   12.484  50.105 1.00 33.60  ? 31  TYR B CE1 1 
ATOM   921  C CE2 . TYR B 2 31  ? 11.139  11.886  50.496 1.00 33.34  ? 31  TYR B CE2 1 
ATOM   922  C CZ  . TYR B 2 31  ? 10.126  12.327  49.642 1.00 34.44  ? 31  TYR B CZ  1 
ATOM   923  O OH  . TYR B 2 31  ? 10.405  12.591  48.321 1.00 32.66  ? 31  TYR B OH  1 
ATOM   924  N N   . CYS B 2 32  ? 9.619   8.896   55.614 1.00 40.03  ? 32  CYS B N   1 
ATOM   925  C CA  . CYS B 2 32  ? 9.803   8.359   56.954 1.00 40.31  ? 32  CYS B CA  1 
ATOM   926  C C   . CYS B 2 32  ? 11.249  8.568   57.351 1.00 41.07  ? 32  CYS B C   1 
ATOM   927  O O   . CYS B 2 32  ? 12.150  8.540   56.493 1.00 40.75  ? 32  CYS B O   1 
ATOM   928  C CB  . CYS B 2 32  ? 9.455   6.883   56.999 1.00 40.56  ? 32  CYS B CB  1 
ATOM   929  S SG  . CYS B 2 32  ? 7.690   6.565   56.774 1.00 46.62  ? 32  CYS B SG  1 
ATOM   930  N N   . TYR B 2 33  ? 11.471  8.795   58.645 1.00 41.08  ? 33  TYR B N   1 
ATOM   931  C CA  . TYR B 2 33  ? 12.813  9.060   59.148 1.00 40.27  ? 33  TYR B CA  1 
ATOM   932  C C   . TYR B 2 33  ? 13.553  7.744   59.385 1.00 40.20  ? 33  TYR B C   1 
ATOM   933  O O   . TYR B 2 33  ? 12.940  6.739   59.773 1.00 38.54  ? 33  TYR B O   1 
ATOM   934  C CB  . TYR B 2 33  ? 12.734  9.886   60.432 1.00 40.50  ? 33  TYR B CB  1 
ATOM   935  C CG  . TYR B 2 33  ? 14.070  10.213  61.063 1.00 41.11  ? 33  TYR B CG  1 
ATOM   936  C CD1 . TYR B 2 33  ? 14.834  11.287  60.608 1.00 40.93  ? 33  TYR B CD1 1 
ATOM   937  C CD2 . TYR B 2 33  ? 14.563  9.455   62.123 1.00 40.37  ? 33  TYR B CD2 1 
ATOM   938  C CE1 . TYR B 2 33  ? 16.054  11.597  61.183 1.00 40.31  ? 33  TYR B CE1 1 
ATOM   939  C CE2 . TYR B 2 33  ? 15.788  9.752   62.703 1.00 42.38  ? 33  TYR B CE2 1 
ATOM   940  C CZ  . TYR B 2 33  ? 16.524  10.830  62.231 1.00 43.40  ? 33  TYR B CZ  1 
ATOM   941  O OH  . TYR B 2 33  ? 17.736  11.139  62.805 1.00 45.62  ? 33  TYR B OH  1 
ATOM   942  N N   . THR B 2 34  ? 14.857  7.753   59.115 1.00 38.22  ? 34  THR B N   1 
ATOM   943  C CA  . THR B 2 34  ? 15.733  6.620   59.391 1.00 40.80  ? 34  THR B CA  1 
ATOM   944  C C   . THR B 2 34  ? 17.147  7.158   59.576 1.00 42.73  ? 34  THR B C   1 
ATOM   945  O O   . THR B 2 34  ? 17.525  8.165   58.965 1.00 44.05  ? 34  THR B O   1 
ATOM   946  C CB  . THR B 2 34  ? 15.736  5.568   58.247 1.00 40.25  ? 34  THR B CB  1 
ATOM   947  O OG1 . THR B 2 34  ? 15.694  6.232   56.982 1.00 42.85  ? 34  THR B OG1 1 
ATOM   948  C CG2 . THR B 2 34  ? 14.484  4.684   58.278 1.00 37.70  ? 34  THR B CG2 1 
ATOM   949  N N   . ARG B 2 35  ? 17.919  6.486   60.417 1.00 43.94  ? 35  ARG B N   1 
ATOM   950  C CA  . ARG B 2 35  ? 19.319  6.820   60.595 1.00 46.35  ? 35  ARG B CA  1 
ATOM   951  C C   . ARG B 2 35  ? 20.194  5.620   60.299 1.00 46.68  ? 35  ARG B C   1 
ATOM   952  O O   . ARG B 2 35  ? 19.710  4.497   60.253 1.00 49.57  ? 35  ARG B O   1 
ATOM   953  C CB  . ARG B 2 35  ? 19.573  7.308   62.009 1.00 50.36  ? 35  ARG B CB  1 
ATOM   954  C CG  . ARG B 2 35  ? 19.481  6.234   63.075 1.00 56.61  ? 35  ARG B CG  1 
ATOM   955  C CD  . ARG B 2 35  ? 19.437  6.820   64.470 1.00 63.28  ? 35  ARG B CD  1 
ATOM   956  N NE  . ARG B 2 35  ? 18.508  7.941   64.536 1.00 68.75  ? 35  ARG B NE  1 
ATOM   957  C CZ  . ARG B 2 35  ? 18.420  8.779   65.557 1.00 74.11  ? 35  ARG B CZ  1 
ATOM   958  N NH1 . ARG B 2 35  ? 19.207  8.630   66.615 1.00 77.26  ? 35  ARG B NH1 1 
ATOM   959  N NH2 . ARG B 2 35  ? 17.541  9.773   65.515 1.00 76.90  ? 35  ARG B NH2 1 
ATOM   960  N N   . ASP B 2 36  ? 21.476  5.851   60.093 1.00 45.30  ? 36  ASP B N   1 
ATOM   961  C CA  . ASP B 2 36  ? 22.388  4.743   59.905 1.00 44.60  ? 36  ASP B CA  1 
ATOM   962  C C   . ASP B 2 36  ? 23.400  4.797   61.030 1.00 45.80  ? 36  ASP B C   1 
ATOM   963  O O   . ASP B 2 36  ? 24.192  5.729   61.118 1.00 45.06  ? 36  ASP B O   1 
ATOM   964  C CB  . ASP B 2 36  ? 23.057  4.820   58.540 1.00 45.11  ? 36  ASP B CB  1 
ATOM   965  C CG  . ASP B 2 36  ? 23.843  3.570   58.218 1.00 48.74  ? 36  ASP B CG  1 
ATOM   966  O OD1 . ASP B 2 36  ? 23.610  2.529   58.878 1.00 51.00  ? 36  ASP B OD1 1 
ATOM   967  O OD2 . ASP B 2 36  ? 24.715  3.558   57.314 1.00 49.92  ? 36  ASP B OD2 1 
ATOM   968  N N   . LEU B 2 37  ? 23.362  3.798   61.900 1.00 47.03  ? 37  LEU B N   1 
ATOM   969  C CA  . LEU B 2 37  ? 24.223  3.749   63.078 1.00 48.27  ? 37  LEU B CA  1 
ATOM   970  C C   . LEU B 2 37  ? 25.702  3.989   62.772 1.00 49.62  ? 37  LEU B C   1 
ATOM   971  O O   . LEU B 2 37  ? 26.175  3.704   61.671 1.00 48.13  ? 37  LEU B O   1 
ATOM   972  C CB  . LEU B 2 37  ? 24.072  2.397   63.773 1.00 48.96  ? 37  LEU B CB  1 
ATOM   973  C CG  . LEU B 2 37  ? 22.659  1.905   64.093 1.00 50.19  ? 37  LEU B CG  1 
ATOM   974  C CD1 . LEU B 2 37  ? 22.748  0.568   64.803 1.00 50.65  ? 37  LEU B CD1 1 
ATOM   975  C CD2 . LEU B 2 37  ? 21.879  2.925   64.933 1.00 50.92  ? 37  LEU B CD2 1 
ATOM   976  N N   . VAL B 2 38  ? 26.417  4.525   63.761 1.00 52.10  ? 38  VAL B N   1 
ATOM   977  C CA  . VAL B 2 38  ? 27.864  4.735   63.674 1.00 53.55  ? 38  VAL B CA  1 
ATOM   978  C C   . VAL B 2 38  ? 28.580  3.833   64.683 1.00 55.90  ? 38  VAL B C   1 
ATOM   979  O O   . VAL B 2 38  ? 29.751  3.498   64.510 1.00 54.48  ? 38  VAL B O   1 
ATOM   980  C CB  . VAL B 2 38  ? 28.239  6.186   63.941 1.00 52.45  ? 38  VAL B CB  1 
ATOM   981  C CG1 . VAL B 2 38  ? 29.719  6.310   64.037 1.00 53.76  ? 38  VAL B CG1 1 
ATOM   982  C CG2 . VAL B 2 38  ? 27.726  7.071   62.838 1.00 52.24  ? 38  VAL B CG2 1 
ATOM   983  N N   . TYR B 2 39  ? 27.858  3.464   65.742 1.00 60.08  ? 39  TYR B N   1 
ATOM   984  C CA  . TYR B 2 39  ? 28.325  2.481   66.709 1.00 65.24  ? 39  TYR B CA  1 
ATOM   985  C C   . TYR B 2 39  ? 27.471  1.214   66.650 1.00 67.67  ? 39  TYR B C   1 
ATOM   986  O O   . TYR B 2 39  ? 26.240  1.277   66.668 1.00 67.81  ? 39  TYR B O   1 
ATOM   987  C CB  . TYR B 2 39  ? 28.297  3.032   68.130 1.00 67.15  ? 39  TYR B CB  1 
ATOM   988  C CG  . TYR B 2 39  ? 28.795  2.025   69.140 1.00 71.39  ? 39  TYR B CG  1 
ATOM   989  C CD1 . TYR B 2 39  ? 30.167  1.834   69.333 1.00 74.04  ? 39  TYR B CD1 1 
ATOM   990  C CD2 . TYR B 2 39  ? 27.901  1.242   69.881 1.00 73.12  ? 39  TYR B CD2 1 
ATOM   991  C CE1 . TYR B 2 39  ? 30.643  0.902   70.247 1.00 76.40  ? 39  TYR B CE1 1 
ATOM   992  C CE2 . TYR B 2 39  ? 28.364  0.298   70.799 1.00 75.50  ? 39  TYR B CE2 1 
ATOM   993  C CZ  . TYR B 2 39  ? 29.740  0.135   70.975 1.00 77.67  ? 39  TYR B CZ  1 
ATOM   994  O OH  . TYR B 2 39  ? 30.229  -0.787  71.877 1.00 79.74  ? 39  TYR B OH  1 
ATOM   995  N N   . LYS B 2 40  ? 28.144  0.069   66.617 1.00 71.85  ? 40  LYS B N   1 
ATOM   996  C CA  . LYS B 2 40  ? 27.480  -1.222  66.528 1.00 75.84  ? 40  LYS B CA  1 
ATOM   997  C C   . LYS B 2 40  ? 27.608  -2.031  67.806 1.00 78.36  ? 40  LYS B C   1 
ATOM   998  O O   . LYS B 2 40  ? 28.706  -2.427  68.211 1.00 81.22  ? 40  LYS B O   1 
ATOM   999  C CB  . LYS B 2 40  ? 28.015  -2.018  65.328 1.00 76.03  ? 40  LYS B CB  1 
ATOM   1000 C CG  . LYS B 2 40  ? 27.662  -3.499  65.324 1.00 77.59  ? 40  LYS B CG  1 
ATOM   1001 C CD  . LYS B 2 40  ? 28.879  -4.349  65.672 1.00 77.99  ? 40  LYS B CD  1 
ATOM   1002 C CE  . LYS B 2 40  ? 28.694  -5.763  65.172 1.00 79.06  ? 40  LYS B CE  1 
ATOM   1003 N NZ  . LYS B 2 40  ? 29.857  -6.602  65.550 1.00 80.32  ? 40  LYS B NZ  1 
ATOM   1004 N N   . ASP B 2 41  ? 26.467  -2.248  68.446 1.00 81.54  ? 41  ASP B N   1 
ATOM   1005 C CA  . ASP B 2 41  ? 26.352  -3.156  69.583 1.00 83.65  ? 41  ASP B CA  1 
ATOM   1006 C C   . ASP B 2 41  ? 25.671  -4.362  68.909 1.00 85.11  ? 41  ASP B C   1 
ATOM   1007 O O   . ASP B 2 41  ? 24.494  -4.258  68.544 1.00 86.86  ? 41  ASP B O   1 
ATOM   1008 C CB  . ASP B 2 41  ? 25.454  -2.517  70.659 1.00 83.26  ? 41  ASP B CB  1 
ATOM   1009 C CG  . ASP B 2 41  ? 25.686  -3.088  72.058 1.00 82.42  ? 41  ASP B CG  1 
ATOM   1010 O OD1 . ASP B 2 41  ? 26.218  -4.208  72.168 1.00 83.38  ? 41  ASP B OD1 1 
ATOM   1011 O OD2 . ASP B 2 41  ? 25.342  -2.475  73.096 1.00 80.52  ? 41  ASP B OD2 1 
ATOM   1012 N N   . PRO B 2 42  ? 26.396  -5.481  68.693 1.00 85.40  ? 42  PRO B N   1 
ATOM   1013 C CA  . PRO B 2 42  ? 25.807  -6.639  67.983 1.00 84.34  ? 42  PRO B CA  1 
ATOM   1014 C C   . PRO B 2 42  ? 24.505  -7.106  68.639 1.00 84.53  ? 42  PRO B C   1 
ATOM   1015 O O   . PRO B 2 42  ? 23.713  -7.819  68.018 1.00 84.05  ? 42  PRO B O   1 
ATOM   1016 C CB  . PRO B 2 42  ? 26.889  -7.723  68.076 1.00 83.20  ? 42  PRO B CB  1 
ATOM   1017 C CG  . PRO B 2 42  ? 28.151  -7.006  68.393 1.00 84.38  ? 42  PRO B CG  1 
ATOM   1018 C CD  . PRO B 2 42  ? 27.781  -5.747  69.133 1.00 84.59  ? 42  PRO B CD  1 
ATOM   1019 N N   . ALA B 2 43  ? 24.301  -6.674  69.888 1.00 84.74  ? 43  ALA B N   1 
ATOM   1020 C CA  . ALA B 2 43  ? 23.110  -6.984  70.683 1.00 84.59  ? 43  ALA B CA  1 
ATOM   1021 C C   . ALA B 2 43  ? 21.986  -5.933  70.576 1.00 84.87  ? 43  ALA B C   1 
ATOM   1022 O O   . ALA B 2 43  ? 20.839  -6.215  70.932 1.00 84.69  ? 43  ALA B O   1 
ATOM   1023 C CB  . ALA B 2 43  ? 23.506  -7.192  72.142 1.00 83.94  ? 43  ALA B CB  1 
ATOM   1024 N N   . ARG B 2 44  ? 22.314  -4.732  70.090 1.00 85.57  ? 44  ARG B N   1 
ATOM   1025 C CA  . ARG B 2 44  ? 21.316  -3.675  69.866 1.00 86.51  ? 44  ARG B CA  1 
ATOM   1026 C C   . ARG B 2 44  ? 21.189  -3.282  68.383 1.00 86.67  ? 44  ARG B C   1 
ATOM   1027 O O   . ARG B 2 44  ? 21.205  -2.088  68.065 1.00 87.98  ? 44  ARG B O   1 
ATOM   1028 C CB  . ARG B 2 44  ? 21.643  -2.425  70.710 1.00 87.61  ? 44  ARG B CB  1 
ATOM   1029 C CG  . ARG B 2 44  ? 20.655  -1.243  70.573 1.00 86.58  ? 44  ARG B CG  1 
ATOM   1030 C CD  . ARG B 2 44  ? 21.344  0.118   70.671 1.00 87.05  ? 44  ARG B CD  1 
ATOM   1031 N NE  . ARG B 2 44  ? 20.407  1.221   70.899 1.00 87.36  ? 44  ARG B NE  1 
ATOM   1032 C CZ  . ARG B 2 44  ? 20.262  2.279   70.102 1.00 86.00  ? 44  ARG B CZ  1 
ATOM   1033 N NH1 . ARG B 2 44  ? 20.990  2.407   68.996 1.00 86.01  ? 44  ARG B NH1 1 
ATOM   1034 N NH2 . ARG B 2 44  ? 19.381  3.219   70.416 1.00 84.68  ? 44  ARG B NH2 1 
ATOM   1035 N N   . PRO B 2 45  ? 21.061  -4.263  67.472 1.00 85.50  ? 45  PRO B N   1 
ATOM   1036 C CA  . PRO B 2 45  ? 20.907  -3.963  66.051 1.00 83.29  ? 45  PRO B CA  1 
ATOM   1037 C C   . PRO B 2 45  ? 19.870  -2.907  65.669 1.00 80.05  ? 45  PRO B C   1 
ATOM   1038 O O   . PRO B 2 45  ? 18.976  -2.516  66.445 1.00 78.69  ? 45  PRO B O   1 
ATOM   1039 C CB  . PRO B 2 45  ? 20.572  -5.324  65.437 1.00 84.55  ? 45  PRO B CB  1 
ATOM   1040 C CG  . PRO B 2 45  ? 21.351  -6.252  66.269 1.00 86.52  ? 45  PRO B CG  1 
ATOM   1041 C CD  . PRO B 2 45  ? 21.119  -5.724  67.678 1.00 86.13  ? 45  PRO B CD  1 
ATOM   1042 N N   . LYS B 2 46  ? 20.039  -2.484  64.432 1.00 75.76  ? 46  LYS B N   1 
ATOM   1043 C CA  . LYS B 2 46  ? 19.346  -1.374  63.842 1.00 73.13  ? 46  LYS B CA  1 
ATOM   1044 C C   . LYS B 2 46  ? 17.886  -1.660  63.537 1.00 68.58  ? 46  LYS B C   1 
ATOM   1045 O O   . LYS B 2 46  ? 17.457  -2.811  63.460 1.00 67.94  ? 46  LYS B O   1 
ATOM   1046 C CB  . LYS B 2 46  ? 20.114  -0.983  62.574 1.00 76.01  ? 46  LYS B CB  1 
ATOM   1047 C CG  . LYS B 2 46  ? 21.088  -2.099  62.132 1.00 77.66  ? 46  LYS B CG  1 
ATOM   1048 C CD  . LYS B 2 46  ? 22.396  -1.530  61.598 1.00 80.48  ? 46  LYS B CD  1 
ATOM   1049 C CE  . LYS B 2 46  ? 23.539  -2.518  61.808 1.00 81.01  ? 46  LYS B CE  1 
ATOM   1050 N NZ  . LYS B 2 46  ? 24.656  -2.233  60.858 1.00 83.01  ? 46  LYS B NZ  1 
ATOM   1051 N N   . ILE B 2 47  ? 17.129  -0.581  63.389 1.00 62.95  ? 47  ILE B N   1 
ATOM   1052 C CA  . ILE B 2 47  ? 15.749  -0.656  62.965 1.00 57.92  ? 47  ILE B CA  1 
ATOM   1053 C C   . ILE B 2 47  ? 15.476  0.455   61.956 1.00 52.47  ? 47  ILE B C   1 
ATOM   1054 O O   . ILE B 2 47  ? 15.973  1.569   62.092 1.00 51.07  ? 47  ILE B O   1 
ATOM   1055 C CB  . ILE B 2 47  ? 14.801  -0.613  64.178 1.00 58.75  ? 47  ILE B CB  1 
ATOM   1056 C CG1 . ILE B 2 47  ? 14.335  -2.037  64.495 1.00 60.56  ? 47  ILE B CG1 1 
ATOM   1057 C CG2 . ILE B 2 47  ? 13.613  0.291   63.921 1.00 61.17  ? 47  ILE B CG2 1 
ATOM   1058 C CD1 . ILE B 2 47  ? 13.197  -2.130  65.521 1.00 62.91  ? 47  ILE B CD1 1 
ATOM   1059 N N   . GLN B 2 48  ? 14.720  0.120   60.919 1.00 48.05  ? 48  GLN B N   1 
ATOM   1060 C CA  . GLN B 2 48  ? 14.358  1.053   59.870 1.00 42.67  ? 48  GLN B CA  1 
ATOM   1061 C C   . GLN B 2 48  ? 12.851  1.028   59.759 1.00 41.83  ? 48  GLN B C   1 
ATOM   1062 O O   . GLN B 2 48  ? 12.229  0.021   60.052 1.00 44.96  ? 48  GLN B O   1 
ATOM   1063 C CB  . GLN B 2 48  ? 14.990  0.613   58.555 1.00 41.18  ? 48  GLN B CB  1 
ATOM   1064 C CG  . GLN B 2 48  ? 16.505  0.695   58.534 1.00 37.46  ? 48  GLN B CG  1 
ATOM   1065 C CD  . GLN B 2 48  ? 17.122  -0.163  57.453 1.00 39.85  ? 48  GLN B CD  1 
ATOM   1066 O OE1 . GLN B 2 48  ? 16.736  -1.326  57.276 1.00 44.24  ? 48  GLN B OE1 1 
ATOM   1067 N NE2 . GLN B 2 48  ? 18.084  0.398   56.723 1.00 37.15  ? 48  GLN B NE2 1 
ATOM   1068 N N   . LYS B 2 49  ? 12.247  2.134   59.368 1.00 41.88  ? 49  LYS B N   1 
ATOM   1069 C CA  . LYS B 2 49  ? 10.798  2.156   59.227 1.00 41.73  ? 49  LYS B CA  1 
ATOM   1070 C C   . LYS B 2 49  ? 10.406  2.580   57.834 1.00 41.65  ? 49  LYS B C   1 
ATOM   1071 O O   . LYS B 2 49  ? 11.062  3.403   57.200 1.00 42.39  ? 49  LYS B O   1 
ATOM   1072 C CB  . LYS B 2 49  ? 10.151  3.088   60.243 1.00 43.55  ? 49  LYS B CB  1 
ATOM   1073 C CG  . LYS B 2 49  ? 10.190  2.602   61.673 1.00 46.02  ? 49  LYS B CG  1 
ATOM   1074 C CD  . LYS B 2 49  ? 9.610   3.661   62.586 1.00 48.94  ? 49  LYS B CD  1 
ATOM   1075 C CE  . LYS B 2 49  ? 9.780   3.281   64.045 1.00 50.88  ? 49  LYS B CE  1 
ATOM   1076 N NZ  . LYS B 2 49  ? 10.126  4.501   64.864 1.00 53.90  ? 49  LYS B NZ  1 
ATOM   1077 N N   . THR B 2 50  ? 9.312   2.020   57.359 1.00 42.99  ? 50  THR B N   1 
ATOM   1078 C CA  . THR B 2 50  ? 8.871   2.308   56.019 1.00 44.06  ? 50  THR B CA  1 
ATOM   1079 C C   . THR B 2 50  ? 7.442   2.832   56.061 1.00 44.43  ? 50  THR B C   1 
ATOM   1080 O O   . THR B 2 50  ? 6.730   2.652   57.055 1.00 43.79  ? 50  THR B O   1 
ATOM   1081 C CB  . THR B 2 50  ? 9.027   1.037   55.109 1.00 42.90  ? 50  THR B CB  1 
ATOM   1082 O OG1 . THR B 2 50  ? 9.251   1.449   53.762 1.00 44.13  ? 50  THR B OG1 1 
ATOM   1083 C CG2 . THR B 2 50  ? 7.746   0.218   55.018 1.00 42.87  ? 50  THR B CG2 1 
ATOM   1084 N N   . CYS B 2 51  ? 7.043   3.515   54.997 1.00 45.07  ? 51  CYS B N   1 
ATOM   1085 C CA  . CYS B 2 51  ? 5.671   3.950   54.874 1.00 46.43  ? 51  CYS B CA  1 
ATOM   1086 C C   . CYS B 2 51  ? 4.870   2.745   54.451 1.00 44.31  ? 51  CYS B C   1 
ATOM   1087 O O   . CYS B 2 51  ? 5.254   2.056   53.518 1.00 46.96  ? 51  CYS B O   1 
ATOM   1088 C CB  . CYS B 2 51  ? 5.558   5.041   53.829 1.00 47.55  ? 51  CYS B CB  1 
ATOM   1089 S SG  . CYS B 2 51  ? 3.948   5.848   53.820 1.00 48.52  ? 51  CYS B SG  1 
ATOM   1090 N N   . THR B 2 52  ? 3.779   2.479   55.155 1.00 44.55  ? 52  THR B N   1 
ATOM   1091 C CA  . THR B 2 52  ? 2.905   1.337   54.860 1.00 44.52  ? 52  THR B CA  1 
ATOM   1092 C C   . THR B 2 52  ? 1.625   1.413   55.685 1.00 45.00  ? 52  THR B C   1 
ATOM   1093 O O   . THR B 2 52  ? 1.473   2.292   56.541 1.00 44.66  ? 52  THR B O   1 
ATOM   1094 C CB  . THR B 2 52  ? 3.624   -0.013  55.122 1.00 42.75  ? 52  THR B CB  1 
ATOM   1095 O OG1 . THR B 2 52  ? 2.689   -1.083  54.983 1.00 36.95  ? 52  THR B OG1 1 
ATOM   1096 C CG2 . THR B 2 52  ? 4.090   -0.106  56.564 1.00 42.29  ? 52  THR B CG2 1 
ATOM   1097 N N   . PHE B 2 53  ? 0.713   0.486   55.442 1.00 45.22  ? 53  PHE B N   1 
ATOM   1098 C CA  . PHE B 2 53  ? -0.583  0.552   56.092 1.00 47.58  ? 53  PHE B CA  1 
ATOM   1099 C C   . PHE B 2 53  ? -0.517  0.137   57.547 1.00 48.30  ? 53  PHE B C   1 
ATOM   1100 O O   . PHE B 2 53  ? 0.321   -0.671  57.915 1.00 48.43  ? 53  PHE B O   1 
ATOM   1101 C CB  . PHE B 2 53  ? -1.605  -0.311  55.340 1.00 47.35  ? 53  PHE B CB  1 
ATOM   1102 C CG  . PHE B 2 53  ? -1.387  -1.782  55.498 1.00 46.02  ? 53  PHE B CG  1 
ATOM   1103 C CD1 . PHE B 2 53  ? -0.357  -2.422  54.829 1.00 45.23  ? 53  PHE B CD1 1 
ATOM   1104 C CD2 . PHE B 2 53  ? -2.218  -2.531  56.311 1.00 44.48  ? 53  PHE B CD2 1 
ATOM   1105 C CE1 . PHE B 2 53  ? -0.161  -3.780  54.974 1.00 44.33  ? 53  PHE B CE1 1 
ATOM   1106 C CE2 . PHE B 2 53  ? -2.019  -3.892  56.459 1.00 43.94  ? 53  PHE B CE2 1 
ATOM   1107 C CZ  . PHE B 2 53  ? -0.996  -4.517  55.786 1.00 42.56  ? 53  PHE B CZ  1 
ATOM   1108 N N   . LYS B 2 54  ? -1.393  0.726   58.360 1.00 51.65  ? 54  LYS B N   1 
ATOM   1109 C CA  . LYS B 2 54  ? -1.599  0.340   59.752 1.00 54.80  ? 54  LYS B CA  1 
ATOM   1110 C C   . LYS B 2 54  ? -2.877  -0.486  59.813 1.00 55.87  ? 54  LYS B C   1 
ATOM   1111 O O   . LYS B 2 54  ? -2.986  -1.414  60.608 1.00 57.17  ? 54  LYS B O   1 
ATOM   1112 C CB  . LYS B 2 54  ? -1.737  1.567   60.650 1.00 56.16  ? 54  LYS B CB  1 
ATOM   1113 C CG  . LYS B 2 54  ? -2.033  1.233   62.113 1.00 60.52  ? 54  LYS B CG  1 
ATOM   1114 C CD  . LYS B 2 54  ? -1.617  2.372   63.037 1.00 65.29  ? 54  LYS B CD  1 
ATOM   1115 C CE  . LYS B 2 54  ? -1.092  1.850   64.376 1.00 66.26  ? 54  LYS B CE  1 
ATOM   1116 N NZ  . LYS B 2 54  ? -0.219  2.876   65.045 1.00 70.75  ? 54  LYS B NZ  1 
ATOM   1117 N N   . GLU B 2 55  ? -3.845  -0.113  58.979 1.00 57.78  ? 55  GLU B N   1 
ATOM   1118 C CA  . GLU B 2 55  ? -5.117  -0.828  58.843 1.00 61.12  ? 55  GLU B CA  1 
ATOM   1119 C C   . GLU B 2 55  ? -5.619  -0.736  57.389 1.00 59.32  ? 55  GLU B C   1 
ATOM   1120 O O   . GLU B 2 55  ? -5.422  0.285   56.709 1.00 57.99  ? 55  GLU B O   1 
ATOM   1121 C CB  . GLU B 2 55  ? -6.195  -0.301  59.824 1.00 64.03  ? 55  GLU B CB  1 
ATOM   1122 C CG  . GLU B 2 55  ? -5.822  -0.273  61.311 1.00 70.95  ? 55  GLU B CG  1 
ATOM   1123 C CD  . GLU B 2 55  ? -5.821  -1.649  61.998 1.00 74.81  ? 55  GLU B CD  1 
ATOM   1124 O OE1 . GLU B 2 55  ? -6.298  -2.649  61.403 1.00 77.01  ? 55  GLU B OE1 1 
ATOM   1125 O OE2 . GLU B 2 55  ? -5.331  -1.727  63.154 1.00 75.64  ? 55  GLU B OE2 1 
ATOM   1126 N N   . LEU B 2 56  ? -6.256  -1.812  56.926 1.00 56.17  ? 56  LEU B N   1 
ATOM   1127 C CA  . LEU B 2 56  ? -6.752  -1.893  55.558 1.00 54.17  ? 56  LEU B CA  1 
ATOM   1128 C C   . LEU B 2 56  ? -8.077  -2.658  55.469 1.00 53.02  ? 56  LEU B C   1 
ATOM   1129 O O   . LEU B 2 56  ? -8.411  -3.432  56.355 1.00 53.16  ? 56  LEU B O   1 
ATOM   1130 C CB  . LEU B 2 56  ? -5.666  -2.497  54.638 1.00 52.80  ? 56  LEU B CB  1 
ATOM   1131 C CG  . LEU B 2 56  ? -5.549  -3.979  54.251 1.00 50.36  ? 56  LEU B CG  1 
ATOM   1132 C CD1 . LEU B 2 56  ? -4.191  -4.227  53.620 1.00 47.40  ? 56  LEU B CD1 1 
ATOM   1133 C CD2 . LEU B 2 56  ? -5.715  -4.891  55.427 1.00 53.45  ? 56  LEU B CD2 1 
ATOM   1134 N N   . VAL B 2 57  ? -8.847  -2.413  54.413 1.00 52.81  ? 57  VAL B N   1 
ATOM   1135 C CA  . VAL B 2 57  ? -10.098 -3.136  54.194 1.00 51.68  ? 57  VAL B CA  1 
ATOM   1136 C C   . VAL B 2 57  ? -10.154 -3.681  52.766 1.00 51.01  ? 57  VAL B C   1 
ATOM   1137 O O   . VAL B 2 57  ? -9.381  -3.262  51.898 1.00 50.14  ? 57  VAL B O   1 
ATOM   1138 C CB  . VAL B 2 57  ? -11.337 -2.264  54.493 1.00 51.64  ? 57  VAL B CB  1 
ATOM   1139 C CG1 . VAL B 2 57  ? -11.127 -1.481  55.782 1.00 54.45  ? 57  VAL B CG1 1 
ATOM   1140 C CG2 . VAL B 2 57  ? -11.639 -1.325  53.343 1.00 51.11  ? 57  VAL B CG2 1 
ATOM   1141 N N   . TYR B 2 58  ? -11.052 -4.632  52.532 1.00 50.15  ? 58  TYR B N   1 
ATOM   1142 C CA  . TYR B 2 58  ? -11.209 -5.196  51.204 1.00 49.62  ? 58  TYR B CA  1 
ATOM   1143 C C   . TYR B 2 58  ? -12.503 -4.717  50.563 1.00 50.75  ? 58  TYR B C   1 
ATOM   1144 O O   . TYR B 2 58  ? -13.523 -4.557  51.232 1.00 52.07  ? 58  TYR B O   1 
ATOM   1145 C CB  . TYR B 2 58  ? -11.159 -6.713  51.260 1.00 48.32  ? 58  TYR B CB  1 
ATOM   1146 C CG  . TYR B 2 58  ? -9.763  -7.261  51.323 1.00 50.22  ? 58  TYR B CG  1 
ATOM   1147 C CD1 . TYR B 2 58  ? -9.010  -7.186  52.497 1.00 50.52  ? 58  TYR B CD1 1 
ATOM   1148 C CD2 . TYR B 2 58  ? -9.177  -7.856  50.202 1.00 53.04  ? 58  TYR B CD2 1 
ATOM   1149 C CE1 . TYR B 2 58  ? -7.696  -7.689  52.557 1.00 49.51  ? 58  TYR B CE1 1 
ATOM   1150 C CE2 . TYR B 2 58  ? -7.860  -8.365  50.251 1.00 51.90  ? 58  TYR B CE2 1 
ATOM   1151 C CZ  . TYR B 2 58  ? -7.134  -8.276  51.435 1.00 49.54  ? 58  TYR B CZ  1 
ATOM   1152 O OH  . TYR B 2 58  ? -5.852  -8.771  51.498 1.00 50.05  ? 58  TYR B OH  1 
ATOM   1153 N N   . GLU B 2 59  ? -12.445 -4.458  49.265 1.00 51.13  ? 59  GLU B N   1 
ATOM   1154 C CA  . GLU B 2 59  ? -13.613 -4.028  48.523 1.00 51.42  ? 59  GLU B CA  1 
ATOM   1155 C C   . GLU B 2 59  ? -13.641 -4.812  47.235 1.00 50.33  ? 59  GLU B C   1 
ATOM   1156 O O   . GLU B 2 59  ? -12.614 -5.290  46.773 1.00 51.24  ? 59  GLU B O   1 
ATOM   1157 C CB  . GLU B 2 59  ? -13.547 -2.538  48.226 1.00 54.52  ? 59  GLU B CB  1 
ATOM   1158 C CG  . GLU B 2 59  ? -13.265 -1.673  49.444 1.00 60.03  ? 59  GLU B CG  1 
ATOM   1159 C CD  . GLU B 2 59  ? -13.345 -0.193  49.137 1.00 63.40  ? 59  GLU B CD  1 
ATOM   1160 O OE1 . GLU B 2 59  ? -12.695 0.258   48.165 1.00 65.81  ? 59  GLU B OE1 1 
ATOM   1161 O OE2 . GLU B 2 59  ? -14.058 0.524   49.876 1.00 66.46  ? 59  GLU B OE2 1 
ATOM   1162 N N   . THR B 2 60  ? -14.818 -4.941  46.648 1.00 49.79  ? 60  THR B N   1 
ATOM   1163 C CA  . THR B 2 60  ? -14.951 -5.737  45.457 1.00 47.78  ? 60  THR B CA  1 
ATOM   1164 C C   . THR B 2 60  ? -15.308 -4.860  44.295 1.00 45.96  ? 60  THR B C   1 
ATOM   1165 O O   . THR B 2 60  ? -15.790 -3.757  44.474 1.00 45.09  ? 60  THR B O   1 
ATOM   1166 C CB  . THR B 2 60  ? -15.982 -6.830  45.694 1.00 48.09  ? 60  THR B CB  1 
ATOM   1167 O OG1 . THR B 2 60  ? -15.533 -7.624  46.793 1.00 50.32  ? 60  THR B OG1 1 
ATOM   1168 C CG2 . THR B 2 60  ? -16.003 -7.829  44.546 1.00 49.47  ? 60  THR B CG2 1 
ATOM   1169 N N   . VAL B 2 61  ? -15.032 -5.346  43.098 1.00 46.32  ? 61  VAL B N   1 
ATOM   1170 C CA  . VAL B 2 61  ? -15.331 -4.597  41.906 1.00 48.14  ? 61  VAL B CA  1 
ATOM   1171 C C   . VAL B 2 61  ? -15.680 -5.568  40.781 1.00 48.98  ? 61  VAL B C   1 
ATOM   1172 O O   . VAL B 2 61  ? -15.114 -6.658  40.687 1.00 49.64  ? 61  VAL B O   1 
ATOM   1173 C CB  . VAL B 2 61  ? -14.145 -3.665  41.535 1.00 48.26  ? 61  VAL B CB  1 
ATOM   1174 C CG1 . VAL B 2 61  ? -12.947 -4.471  41.050 1.00 49.20  ? 61  VAL B CG1 1 
ATOM   1175 C CG2 . VAL B 2 61  ? -14.573 -2.619  40.516 1.00 48.41  ? 61  VAL B CG2 1 
ATOM   1176 N N   . ARG B 2 62  ? -16.638 -5.168  39.953 1.00 49.86  ? 62  ARG B N   1 
ATOM   1177 C CA  . ARG B 2 62  ? -17.052 -5.955  38.809 1.00 51.30  ? 62  ARG B CA  1 
ATOM   1178 C C   . ARG B 2 62  ? -16.088 -5.690  37.669 1.00 49.10  ? 62  ARG B C   1 
ATOM   1179 O O   . ARG B 2 62  ? -15.745 -4.539  37.396 1.00 47.52  ? 62  ARG B O   1 
ATOM   1180 C CB  . ARG B 2 62  ? -18.478 -5.589  38.396 1.00 56.03  ? 62  ARG B CB  1 
ATOM   1181 C CG  . ARG B 2 62  ? -19.178 -6.680  37.595 1.00 63.55  ? 62  ARG B CG  1 
ATOM   1182 C CD  . ARG B 2 62  ? -20.567 -7.007  38.120 1.00 70.56  ? 62  ARG B CD  1 
ATOM   1183 N NE  . ARG B 2 62  ? -20.730 -8.452  38.291 1.00 75.72  ? 62  ARG B NE  1 
ATOM   1184 C CZ  . ARG B 2 62  ? -21.380 -9.030  39.302 1.00 78.12  ? 62  ARG B CZ  1 
ATOM   1185 N NH1 . ARG B 2 62  ? -21.938 -8.296  40.265 1.00 77.88  ? 62  ARG B NH1 1 
ATOM   1186 N NH2 . ARG B 2 62  ? -21.462 -10.355 39.354 1.00 79.94  ? 62  ARG B NH2 1 
ATOM   1187 N N   . VAL B 2 63  ? -15.662 -6.767  37.012 1.00 46.50  ? 63  VAL B N   1 
ATOM   1188 C CA  . VAL B 2 63  ? -14.644 -6.706  35.961 1.00 43.88  ? 63  VAL B CA  1 
ATOM   1189 C C   . VAL B 2 63  ? -15.255 -7.168  34.649 1.00 42.04  ? 63  VAL B C   1 
ATOM   1190 O O   . VAL B 2 63  ? -15.778 -8.270  34.570 1.00 42.75  ? 63  VAL B O   1 
ATOM   1191 C CB  . VAL B 2 63  ? -13.407 -7.610  36.304 1.00 42.16  ? 63  VAL B CB  1 
ATOM   1192 C CG1 . VAL B 2 63  ? -12.147 -7.096  35.626 1.00 39.04  ? 63  VAL B CG1 1 
ATOM   1193 C CG2 . VAL B 2 63  ? -13.190 -7.682  37.801 1.00 41.49  ? 63  VAL B CG2 1 
ATOM   1194 N N   . PRO B 2 64  ? -15.162 -6.347  33.605 1.00 41.30  ? 64  PRO B N   1 
ATOM   1195 C CA  . PRO B 2 64  ? -15.793 -6.652  32.325 1.00 41.47  ? 64  PRO B CA  1 
ATOM   1196 C C   . PRO B 2 64  ? -15.318 -7.988  31.751 1.00 41.62  ? 64  PRO B C   1 
ATOM   1197 O O   . PRO B 2 64  ? -14.188 -8.392  31.987 1.00 41.80  ? 64  PRO B O   1 
ATOM   1198 C CB  . PRO B 2 64  ? -15.329 -5.507  31.422 1.00 41.15  ? 64  PRO B CB  1 
ATOM   1199 C CG  . PRO B 2 64  ? -14.914 -4.450  32.313 1.00 41.01  ? 64  PRO B CG  1 
ATOM   1200 C CD  . PRO B 2 64  ? -14.376 -5.106  33.538 1.00 41.08  ? 64  PRO B CD  1 
ATOM   1201 N N   . GLY B 2 65  ? -16.185 -8.665  31.010 1.00 41.64  ? 65  GLY B N   1 
ATOM   1202 C CA  . GLY B 2 65  ? -15.802 -9.885  30.333 1.00 42.74  ? 65  GLY B CA  1 
ATOM   1203 C C   . GLY B 2 65  ? -15.349 -9.588  28.915 1.00 45.36  ? 65  GLY B C   1 
ATOM   1204 O O   . GLY B 2 65  ? -14.835 -8.505  28.631 1.00 44.73  ? 65  GLY B O   1 
ATOM   1205 N N   . CYS B 2 66  ? -15.543 -10.565 28.030 1.00 48.24  ? 66  CYS B N   1 
ATOM   1206 C CA  . CYS B 2 66  ? -15.164 -10.468 26.619 1.00 49.88  ? 66  CYS B CA  1 
ATOM   1207 C C   . CYS B 2 66  ? -15.660 -11.724 25.917 1.00 49.19  ? 66  CYS B C   1 
ATOM   1208 O O   . CYS B 2 66  ? -16.375 -12.514 26.517 1.00 48.64  ? 66  CYS B O   1 
ATOM   1209 C CB  . CYS B 2 66  ? -13.640 -10.383 26.481 1.00 50.99  ? 66  CYS B CB  1 
ATOM   1210 S SG  . CYS B 2 66  ? -12.763 -11.756 27.279 1.00 56.37  ? 66  CYS B SG  1 
ATOM   1211 N N   . ALA B 2 67  ? -15.269 -11.883 24.652 1.00 50.75  ? 67  ALA B N   1 
ATOM   1212 C CA  . ALA B 2 67  ? -15.469 -13.100 23.854 1.00 50.02  ? 67  ALA B CA  1 
ATOM   1213 C C   . ALA B 2 67  ? -16.255 -14.222 24.515 1.00 50.75  ? 67  ALA B C   1 
ATOM   1214 O O   . ALA B 2 67  ? -17.475 -14.327 24.329 1.00 52.13  ? 67  ALA B O   1 
ATOM   1215 C CB  . ALA B 2 67  ? -14.116 -13.647 23.394 1.00 52.66  ? 67  ALA B CB  1 
ATOM   1216 N N   . HIS B 2 68  ? -15.560 -15.068 25.271 1.00 48.16  ? 68  HIS B N   1 
ATOM   1217 C CA  . HIS B 2 68  ? -16.194 -16.270 25.806 1.00 48.87  ? 68  HIS B CA  1 
ATOM   1218 C C   . HIS B 2 68  ? -16.048 -16.347 27.298 1.00 47.49  ? 68  HIS B C   1 
ATOM   1219 O O   . HIS B 2 68  ? -15.980 -17.435 27.866 1.00 46.92  ? 68  HIS B O   1 
ATOM   1220 C CB  . HIS B 2 68  ? -15.584 -17.531 25.174 1.00 50.84  ? 68  HIS B CB  1 
ATOM   1221 C CG  . HIS B 2 68  ? -15.758 -17.609 23.691 1.00 52.90  ? 68  HIS B CG  1 
ATOM   1222 N ND1 . HIS B 2 68  ? -14.799 -17.166 22.803 1.00 53.27  ? 68  HIS B ND1 1 
ATOM   1223 C CD2 . HIS B 2 68  ? -16.789 -18.062 22.937 1.00 54.93  ? 68  HIS B CD2 1 
ATOM   1224 C CE1 . HIS B 2 68  ? -15.233 -17.342 21.567 1.00 56.53  ? 68  HIS B CE1 1 
ATOM   1225 N NE2 . HIS B 2 68  ? -16.438 -17.885 21.620 1.00 56.68  ? 68  HIS B NE2 1 
ATOM   1226 N N   . HIS B 2 69  ? -15.978 -15.182 27.929 1.00 48.03  ? 69  HIS B N   1 
ATOM   1227 C CA  . HIS B 2 69  ? -15.768 -15.102 29.371 1.00 47.88  ? 69  HIS B CA  1 
ATOM   1228 C C   . HIS B 2 69  ? -16.618 -13.998 29.928 1.00 45.14  ? 69  HIS B C   1 
ATOM   1229 O O   . HIS B 2 69  ? -16.492 -12.841 29.539 1.00 42.33  ? 69  HIS B O   1 
ATOM   1230 C CB  . HIS B 2 69  ? -14.283 -14.868 29.714 1.00 50.33  ? 69  HIS B CB  1 
ATOM   1231 C CG  . HIS B 2 69  ? -13.353 -15.778 28.980 1.00 51.29  ? 69  HIS B CG  1 
ATOM   1232 N ND1 . HIS B 2 69  ? -12.584 -15.352 27.919 1.00 52.67  ? 69  HIS B ND1 1 
ATOM   1233 C CD2 . HIS B 2 69  ? -13.123 -17.105 29.105 1.00 51.17  ? 69  HIS B CD2 1 
ATOM   1234 C CE1 . HIS B 2 69  ? -11.905 -16.374 27.432 1.00 52.00  ? 69  HIS B CE1 1 
ATOM   1235 N NE2 . HIS B 2 69  ? -12.215 -17.449 28.134 1.00 52.44  ? 69  HIS B NE2 1 
ATOM   1236 N N   . ALA B 2 70  ? -17.497 -14.388 30.835 1.00 44.33  ? 70  ALA B N   1 
ATOM   1237 C CA  . ALA B 2 70  ? -18.418 -13.468 31.456 1.00 44.74  ? 70  ALA B CA  1 
ATOM   1238 C C   . ALA B 2 70  ? -17.701 -12.601 32.482 1.00 43.94  ? 70  ALA B C   1 
ATOM   1239 O O   . ALA B 2 70  ? -16.584 -12.916 32.911 1.00 43.13  ? 70  ALA B O   1 
ATOM   1240 C CB  . ALA B 2 70  ? -19.567 -14.240 32.114 1.00 44.30  ? 70  ALA B CB  1 
ATOM   1241 N N   . ASP B 2 71  ? -18.358 -11.497 32.836 1.00 42.79  ? 71  ASP B N   1 
ATOM   1242 C CA  . ASP B 2 71  ? -17.924 -10.601 33.886 1.00 41.00  ? 71  ASP B CA  1 
ATOM   1243 C C   . ASP B 2 71  ? -17.472 -11.409 35.082 1.00 41.78  ? 71  ASP B C   1 
ATOM   1244 O O   . ASP B 2 71  ? -17.858 -12.564 35.239 1.00 43.72  ? 71  ASP B O   1 
ATOM   1245 C CB  . ASP B 2 71  ? -19.082 -9.702  34.311 1.00 40.56  ? 71  ASP B CB  1 
ATOM   1246 C CG  . ASP B 2 71  ? -19.455 -8.691  33.253 1.00 40.21  ? 71  ASP B CG  1 
ATOM   1247 O OD1 . ASP B 2 71  ? -18.630 -8.394  32.372 1.00 42.52  ? 71  ASP B OD1 1 
ATOM   1248 O OD2 . ASP B 2 71  ? -20.566 -8.137  33.238 1.00 42.44  ? 71  ASP B OD2 1 
ATOM   1249 N N   . SER B 2 72  ? -16.653 -10.796 35.925 1.00 41.30  ? 72  SER B N   1 
ATOM   1250 C CA  . SER B 2 72  ? -16.175 -11.449 37.121 1.00 40.56  ? 72  SER B CA  1 
ATOM   1251 C C   . SER B 2 72  ? -16.078 -10.444 38.245 1.00 41.86  ? 72  SER B C   1 
ATOM   1252 O O   . SER B 2 72  ? -16.356 -9.260  38.065 1.00 42.16  ? 72  SER B O   1 
ATOM   1253 C CB  . SER B 2 72  ? -14.806 -12.060 36.864 1.00 40.80  ? 72  SER B CB  1 
ATOM   1254 O OG  . SER B 2 72  ? -13.890 -11.066 36.442 1.00 38.96  ? 72  SER B OG  1 
ATOM   1255 N N   . LEU B 2 73  ? -15.683 -10.938 39.411 1.00 44.38  ? 73  LEU B N   1 
ATOM   1256 C CA  . LEU B 2 73  ? -15.422 -10.088 40.565 1.00 46.35  ? 73  LEU B CA  1 
ATOM   1257 C C   . LEU B 2 73  ? -13.949 -10.121 40.995 1.00 48.48  ? 73  LEU B C   1 
ATOM   1258 O O   . LEU B 2 73  ? -13.242 -11.122 40.809 1.00 49.68  ? 73  LEU B O   1 
ATOM   1259 C CB  . LEU B 2 73  ? -16.304 -10.513 41.720 1.00 44.53  ? 73  LEU B CB  1 
ATOM   1260 C CG  . LEU B 2 73  ? -17.759 -10.608 41.318 1.00 40.81  ? 73  LEU B CG  1 
ATOM   1261 C CD1 . LEU B 2 73  ? -18.488 -11.431 42.355 1.00 40.22  ? 73  LEU B CD1 1 
ATOM   1262 C CD2 . LEU B 2 73  ? -18.322 -9.210  41.183 1.00 38.17  ? 73  LEU B CD2 1 
ATOM   1263 N N   . TYR B 2 74  ? -13.485 -9.015  41.564 1.00 49.85  ? 74  TYR B N   1 
ATOM   1264 C CA  . TYR B 2 74  ? -12.122 -8.950  42.038 1.00 50.78  ? 74  TYR B CA  1 
ATOM   1265 C C   . TYR B 2 74  ? -12.068 -8.237  43.380 1.00 50.14  ? 74  TYR B C   1 
ATOM   1266 O O   . TYR B 2 74  ? -12.630 -7.153  43.533 1.00 49.86  ? 74  TYR B O   1 
ATOM   1267 C CB  . TYR B 2 74  ? -11.248 -8.252  41.005 1.00 52.50  ? 74  TYR B CB  1 
ATOM   1268 C CG  . TYR B 2 74  ? -9.809  -8.174  41.415 1.00 57.49  ? 74  TYR B CG  1 
ATOM   1269 C CD1 . TYR B 2 74  ? -9.020  -9.322  41.478 1.00 60.25  ? 74  TYR B CD1 1 
ATOM   1270 C CD2 . TYR B 2 74  ? -9.233  -6.952  41.758 1.00 58.37  ? 74  TYR B CD2 1 
ATOM   1271 C CE1 . TYR B 2 74  ? -7.684  -9.251  41.859 1.00 63.81  ? 74  TYR B CE1 1 
ATOM   1272 C CE2 . TYR B 2 74  ? -7.907  -6.867  42.142 1.00 62.02  ? 74  TYR B CE2 1 
ATOM   1273 C CZ  . TYR B 2 74  ? -7.134  -8.019  42.191 1.00 64.45  ? 74  TYR B CZ  1 
ATOM   1274 O OH  . TYR B 2 74  ? -5.816  -7.939  42.577 1.00 66.72  ? 74  TYR B OH  1 
ATOM   1275 N N   . THR B 2 75  ? -11.411 -8.863  44.355 1.00 50.11  ? 75  THR B N   1 
ATOM   1276 C CA  . THR B 2 75  ? -11.286 -8.292  45.699 1.00 50.21  ? 75  THR B CA  1 
ATOM   1277 C C   . THR B 2 75  ? -9.895  -7.712  45.864 1.00 48.33  ? 75  THR B C   1 
ATOM   1278 O O   . THR B 2 75  ? -8.908  -8.359  45.541 1.00 49.74  ? 75  THR B O   1 
ATOM   1279 C CB  . THR B 2 75  ? -11.552 -9.353  46.788 1.00 50.63  ? 75  THR B CB  1 
ATOM   1280 O OG1 . THR B 2 75  ? -12.220 -10.483 46.219 1.00 50.83  ? 75  THR B OG1 1 
ATOM   1281 C CG2 . THR B 2 75  ? -12.550 -8.831  47.798 1.00 52.38  ? 75  THR B CG2 1 
ATOM   1282 N N   . TYR B 2 76  ? -9.818  -6.484  46.357 1.00 50.94  ? 76  TYR B N   1 
ATOM   1283 C CA  . TYR B 2 76  ? -8.537  -5.791  46.458 1.00 51.55  ? 76  TYR B CA  1 
ATOM   1284 C C   . TYR B 2 76  ? -8.388  -5.012  47.769 1.00 50.10  ? 76  TYR B C   1 
ATOM   1285 O O   . TYR B 2 76  ? -9.389  -4.614  48.383 1.00 47.81  ? 76  TYR B O   1 
ATOM   1286 C CB  . TYR B 2 76  ? -8.318  -4.886  45.230 1.00 52.99  ? 76  TYR B CB  1 
ATOM   1287 C CG  . TYR B 2 76  ? -9.293  -3.742  45.115 1.00 53.07  ? 76  TYR B CG  1 
ATOM   1288 C CD1 . TYR B 2 76  ? -10.579 -3.946  44.626 1.00 52.90  ? 76  TYR B CD1 1 
ATOM   1289 C CD2 . TYR B 2 76  ? -8.923  -2.453  45.492 1.00 53.73  ? 76  TYR B CD2 1 
ATOM   1290 C CE1 . TYR B 2 76  ? -11.477 -2.907  44.525 1.00 55.24  ? 76  TYR B CE1 1 
ATOM   1291 C CE2 . TYR B 2 76  ? -9.809  -1.399  45.394 1.00 55.87  ? 76  TYR B CE2 1 
ATOM   1292 C CZ  . TYR B 2 76  ? -11.090 -1.630  44.909 1.00 57.66  ? 76  TYR B CZ  1 
ATOM   1293 O OH  . TYR B 2 76  ? -11.987 -0.583  44.809 1.00 59.74  ? 76  TYR B OH  1 
ATOM   1294 N N   . PRO B 2 77  ? -7.136  -4.804  48.202 1.00 49.04  ? 77  PRO B N   1 
ATOM   1295 C CA  . PRO B 2 77  ? -6.833  -4.104  49.457 1.00 47.80  ? 77  PRO B CA  1 
ATOM   1296 C C   . PRO B 2 77  ? -6.905  -2.593  49.354 1.00 45.65  ? 77  PRO B C   1 
ATOM   1297 O O   . PRO B 2 77  ? -6.448  -2.018  48.372 1.00 44.23  ? 77  PRO B O   1 
ATOM   1298 C CB  . PRO B 2 77  ? -5.396  -4.528  49.781 1.00 46.30  ? 77  PRO B CB  1 
ATOM   1299 C CG  . PRO B 2 77  ? -4.864  -5.208  48.555 1.00 48.75  ? 77  PRO B CG  1 
ATOM   1300 C CD  . PRO B 2 77  ? -5.910  -5.217  47.494 1.00 48.60  ? 77  PRO B CD  1 
ATOM   1301 N N   . VAL B 2 78  ? -7.468  -1.966  50.382 1.00 45.33  ? 78  VAL B N   1 
ATOM   1302 C CA  . VAL B 2 78  ? -7.554  -0.513  50.465 1.00 46.78  ? 78  VAL B CA  1 
ATOM   1303 C C   . VAL B 2 78  ? -7.013  0.023   51.818 1.00 48.60  ? 78  VAL B C   1 
ATOM   1304 O O   . VAL B 2 78  ? -7.603  -0.201  52.879 1.00 49.44  ? 78  VAL B O   1 
ATOM   1305 C CB  . VAL B 2 78  ? -9.014  -0.043  50.198 1.00 44.37  ? 78  VAL B CB  1 
ATOM   1306 C CG1 . VAL B 2 78  ? -9.227  1.404   50.577 1.00 41.87  ? 78  VAL B CG1 1 
ATOM   1307 C CG2 . VAL B 2 78  ? -9.348  -0.244  48.749 1.00 45.38  ? 78  VAL B CG2 1 
ATOM   1308 N N   . ALA B 2 79  ? -5.883  0.725   51.777 1.00 48.20  ? 79  ALA B N   1 
ATOM   1309 C CA  . ALA B 2 79  ? -5.360  1.368   52.977 1.00 49.49  ? 79  ALA B CA  1 
ATOM   1310 C C   . ALA B 2 79  ? -6.438  2.218   53.669 1.00 50.13  ? 79  ALA B C   1 
ATOM   1311 O O   . ALA B 2 79  ? -7.247  2.866   53.006 1.00 50.96  ? 79  ALA B O   1 
ATOM   1312 C CB  . ALA B 2 79  ? -4.152  2.227   52.620 1.00 48.87  ? 79  ALA B CB  1 
ATOM   1313 N N   . THR B 2 80  ? -6.463  2.194   54.997 1.00 52.07  ? 80  THR B N   1 
ATOM   1314 C CA  . THR B 2 80  ? -7.415  3.004   55.760 1.00 52.57  ? 80  THR B CA  1 
ATOM   1315 C C   . THR B 2 80  ? -6.625  3.969   56.615 1.00 52.91  ? 80  THR B C   1 
ATOM   1316 O O   . THR B 2 80  ? -7.125  5.012   57.029 1.00 51.65  ? 80  THR B O   1 
ATOM   1317 C CB  . THR B 2 80  ? -8.291  2.134   56.679 1.00 51.81  ? 80  THR B CB  1 
ATOM   1318 O OG1 . THR B 2 80  ? -9.089  1.244   55.895 1.00 53.83  ? 80  THR B OG1 1 
ATOM   1319 C CG2 . THR B 2 80  ? -9.312  2.974   57.372 1.00 54.26  ? 80  THR B CG2 1 
ATOM   1320 N N   . GLN B 2 81  ? -5.372  3.604   56.866 1.00 54.27  ? 81  GLN B N   1 
ATOM   1321 C CA  . GLN B 2 81  ? -4.523  4.350   57.773 1.00 54.43  ? 81  GLN B CA  1 
ATOM   1322 C C   . GLN B 2 81  ? -3.077  3.957   57.512 1.00 53.26  ? 81  GLN B C   1 
ATOM   1323 O O   . GLN B 2 81  ? -2.748  2.777   57.471 1.00 53.83  ? 81  GLN B O   1 
ATOM   1324 C CB  . GLN B 2 81  ? -4.907  4.010   59.213 1.00 55.56  ? 81  GLN B CB  1 
ATOM   1325 C CG  . GLN B 2 81  ? -4.563  5.080   60.231 1.00 60.78  ? 81  GLN B CG  1 
ATOM   1326 C CD  . GLN B 2 81  ? -4.687  4.581   61.656 1.00 62.18  ? 81  GLN B CD  1 
ATOM   1327 O OE1 . GLN B 2 81  ? -3.836  4.874   62.502 1.00 63.43  ? 81  GLN B OE1 1 
ATOM   1328 N NE2 . GLN B 2 81  ? -5.742  3.817   61.928 1.00 63.80  ? 81  GLN B NE2 1 
ATOM   1329 N N   . CYS B 2 82  ? -2.215  4.944   57.313 1.00 52.04  ? 82  CYS B N   1 
ATOM   1330 C CA  . CYS B 2 82  ? -0.811  4.653   57.114 1.00 51.80  ? 82  CYS B CA  1 
ATOM   1331 C C   . CYS B 2 82  ? -0.037  4.979   58.359 1.00 50.09  ? 82  CYS B C   1 
ATOM   1332 O O   . CYS B 2 82  ? -0.581  5.543   59.299 1.00 49.09  ? 82  CYS B O   1 
ATOM   1333 C CB  . CYS B 2 82  ? -0.254  5.434   55.933 1.00 51.00  ? 82  CYS B CB  1 
ATOM   1334 S SG  . CYS B 2 82  ? -1.075  4.921   54.404 1.00 61.33  ? 82  CYS B SG  1 
ATOM   1335 N N   . HIS B 2 83  ? 1.225   4.569   58.362 1.00 49.75  ? 83  HIS B N   1 
ATOM   1336 C CA  . HIS B 2 83  ? 2.180   4.935   59.392 1.00 47.46  ? 83  HIS B CA  1 
ATOM   1337 C C   . HIS B 2 83  ? 3.555   4.560   58.911 1.00 47.06  ? 83  HIS B C   1 
ATOM   1338 O O   . HIS B 2 83  ? 3.699   3.842   57.922 1.00 45.59  ? 83  HIS B O   1 
ATOM   1339 C CB  . HIS B 2 83  ? 1.883   4.262   60.745 1.00 47.97  ? 83  HIS B CB  1 
ATOM   1340 C CG  . HIS B 2 83  ? 2.080   2.773   60.774 1.00 46.72  ? 83  HIS B CG  1 
ATOM   1341 N ND1 . HIS B 2 83  ? 1.833   1.954   59.694 1.00 47.22  ? 83  HIS B ND1 1 
ATOM   1342 C CD2 . HIS B 2 83  ? 2.444   1.951   61.786 1.00 46.86  ? 83  HIS B CD2 1 
ATOM   1343 C CE1 . HIS B 2 83  ? 2.060   0.697   60.031 1.00 44.62  ? 83  HIS B CE1 1 
ATOM   1344 N NE2 . HIS B 2 83  ? 2.432   0.668   61.296 1.00 44.53  ? 83  HIS B NE2 1 
ATOM   1345 N N   . CYS B 2 84  ? 4.558   5.091   59.596 1.00 47.03  ? 84  CYS B N   1 
ATOM   1346 C CA  . CYS B 2 84  ? 5.928   4.680   59.396 1.00 44.95  ? 84  CYS B CA  1 
ATOM   1347 C C   . CYS B 2 84  ? 6.154   3.535   60.360 1.00 44.74  ? 84  CYS B C   1 
ATOM   1348 O O   . CYS B 2 84  ? 6.208   3.728   61.569 1.00 46.04  ? 84  CYS B O   1 
ATOM   1349 C CB  . CYS B 2 84  ? 6.870   5.826   59.694 1.00 43.14  ? 84  CYS B CB  1 
ATOM   1350 S SG  . CYS B 2 84  ? 6.721   7.142   58.475 1.00 44.50  ? 84  CYS B SG  1 
ATOM   1351 N N   . GLY B 2 85  ? 6.253   2.331   59.821 1.00 44.15  ? 85  GLY B N   1 
ATOM   1352 C CA  . GLY B 2 85  ? 6.414   1.173   60.667 1.00 45.78  ? 85  GLY B CA  1 
ATOM   1353 C C   . GLY B 2 85  ? 7.269   0.159   59.975 1.00 45.12  ? 85  GLY B C   1 
ATOM   1354 O O   . GLY B 2 85  ? 8.009   0.503   59.065 1.00 48.20  ? 85  GLY B O   1 
ATOM   1355 N N   . LYS B 2 86  ? 7.182   -1.080  60.430 1.00 44.78  ? 86  LYS B N   1 
ATOM   1356 C CA  . LYS B 2 86  ? 7.811   -2.182  59.753 1.00 46.55  ? 86  LYS B CA  1 
ATOM   1357 C C   . LYS B 2 86  ? 6.803   -2.725  58.773 1.00 46.40  ? 86  LYS B C   1 
ATOM   1358 O O   . LYS B 2 86  ? 5.610   -2.803  59.091 1.00 46.44  ? 86  LYS B O   1 
ATOM   1359 C CB  . LYS B 2 86  ? 8.210   -3.267  60.757 1.00 49.26  ? 86  LYS B CB  1 
ATOM   1360 C CG  . LYS B 2 86  ? 9.480   -2.914  61.531 1.00 53.75  ? 86  LYS B CG  1 
ATOM   1361 C CD  . LYS B 2 86  ? 9.809   -3.941  62.602 1.00 57.64  ? 86  LYS B CD  1 
ATOM   1362 C CE  . LYS B 2 86  ? 11.188  -3.672  63.196 1.00 60.60  ? 86  LYS B CE  1 
ATOM   1363 N NZ  . LYS B 2 86  ? 12.286  -3.573  62.169 1.00 61.91  ? 86  LYS B NZ  1 
ATOM   1364 N N   . CYS B 2 87  ? 7.261   -3.078  57.575 1.00 46.69  ? 87  CYS B N   1 
ATOM   1365 C CA  . CYS B 2 87  ? 6.367   -3.761  56.650 1.00 49.61  ? 87  CYS B CA  1 
ATOM   1366 C C   . CYS B 2 87  ? 6.074   -5.131  57.260 1.00 46.65  ? 87  CYS B C   1 
ATOM   1367 O O   . CYS B 2 87  ? 6.961   -5.802  57.765 1.00 44.71  ? 87  CYS B O   1 
ATOM   1368 C CB  . CYS B 2 87  ? 6.962   -3.906  55.240 1.00 50.11  ? 87  CYS B CB  1 
ATOM   1369 S SG  . CYS B 2 87  ? 8.258   -5.156  55.197 1.00 59.01  ? 87  CYS B SG  1 
ATOM   1370 N N   . ASP B 2 88  ? 4.814   -5.521  57.231 1.00 46.60  ? 88  ASP B N   1 
ATOM   1371 C CA  . ASP B 2 88  ? 4.398   -6.765  57.825 1.00 47.82  ? 88  ASP B CA  1 
ATOM   1372 C C   . ASP B 2 88  ? 4.588   -7.872  56.796 1.00 47.25  ? 88  ASP B C   1 
ATOM   1373 O O   . ASP B 2 88  ? 3.735   -8.078  55.934 1.00 50.35  ? 88  ASP B O   1 
ATOM   1374 C CB  . ASP B 2 88  ? 2.944   -6.633  58.267 1.00 49.18  ? 88  ASP B CB  1 
ATOM   1375 C CG  . ASP B 2 88  ? 2.362   -7.939  58.708 1.00 53.89  ? 88  ASP B CG  1 
ATOM   1376 O OD1 . ASP B 2 88  ? 3.061   -8.703  59.419 1.00 56.14  ? 88  ASP B OD1 1 
ATOM   1377 O OD2 . ASP B 2 88  ? 1.205   -8.270  58.364 1.00 59.11  ? 88  ASP B OD2 1 
ATOM   1378 N N   . SER B 2 89  ? 5.708   -8.587  56.891 1.00 47.04  ? 89  SER B N   1 
ATOM   1379 C CA  . SER B 2 89  ? 6.079   -9.582  55.875 1.00 45.82  ? 89  SER B CA  1 
ATOM   1380 C C   . SER B 2 89  ? 5.147   -10.782 55.744 1.00 44.73  ? 89  SER B C   1 
ATOM   1381 O O   . SER B 2 89  ? 5.297   -11.580 54.826 1.00 43.60  ? 89  SER B O   1 
ATOM   1382 C CB  . SER B 2 89  ? 7.522   -10.047 56.061 1.00 44.52  ? 89  SER B CB  1 
ATOM   1383 O OG  . SER B 2 89  ? 7.616   -10.971 57.112 1.00 42.60  ? 89  SER B OG  1 
ATOM   1384 N N   . ASP B 2 90  ? 4.191   -10.918 56.655 1.00 45.76  ? 90  ASP B N   1 
ATOM   1385 C CA  . ASP B 2 90  ? 3.126   -11.899 56.473 1.00 47.10  ? 90  ASP B CA  1 
ATOM   1386 C C   . ASP B 2 90  ? 2.218   -11.500 55.302 1.00 45.89  ? 90  ASP B C   1 
ATOM   1387 O O   . ASP B 2 90  ? 1.916   -12.307 54.425 1.00 45.44  ? 90  ASP B O   1 
ATOM   1388 C CB  . ASP B 2 90  ? 2.286   -12.035 57.745 1.00 49.03  ? 90  ASP B CB  1 
ATOM   1389 C CG  . ASP B 2 90  ? 3.059   -12.674 58.895 1.00 50.91  ? 90  ASP B CG  1 
ATOM   1390 O OD1 . ASP B 2 90  ? 4.087   -13.353 58.649 1.00 50.65  ? 90  ASP B OD1 1 
ATOM   1391 O OD2 . ASP B 2 90  ? 2.679   -12.537 60.081 1.00 51.13  ? 90  ASP B OD2 1 
ATOM   1392 N N   . SER B 2 91  ? 1.810   -10.241 55.288 1.00 45.34  ? 91  SER B N   1 
ATOM   1393 C CA  . SER B 2 91  ? 0.873   -9.743  54.299 1.00 44.39  ? 91  SER B CA  1 
ATOM   1394 C C   . SER B 2 91  ? 1.530   -8.885  53.231 1.00 42.65  ? 91  SER B C   1 
ATOM   1395 O O   . SER B 2 91  ? 0.887   -8.517  52.248 1.00 43.27  ? 91  SER B O   1 
ATOM   1396 C CB  . SER B 2 91  ? -0.179  -8.901  55.002 1.00 45.49  ? 91  SER B CB  1 
ATOM   1397 O OG  . SER B 2 91  ? 0.440   -7.766  55.602 1.00 47.56  ? 91  SER B OG  1 
ATOM   1398 N N   . THR B 2 92  ? 2.796   -8.543  53.423 1.00 40.27  ? 92  THR B N   1 
ATOM   1399 C CA  . THR B 2 92  ? 3.427   -7.603  52.512 1.00 39.66  ? 92  THR B CA  1 
ATOM   1400 C C   . THR B 2 92  ? 4.693   -8.137  51.857 1.00 40.39  ? 92  THR B C   1 
ATOM   1401 O O   . THR B 2 92  ? 5.441   -8.916  52.450 1.00 39.68  ? 92  THR B O   1 
ATOM   1402 C CB  . THR B 2 92  ? 3.708   -6.269  53.234 1.00 38.82  ? 92  THR B CB  1 
ATOM   1403 O OG1 . THR B 2 92  ? 2.484   -5.758  53.787 1.00 36.61  ? 92  THR B OG1 1 
ATOM   1404 C CG2 . THR B 2 92  ? 4.153   -5.217  52.247 1.00 37.46  ? 92  THR B CG2 1 
ATOM   1405 N N   . ASP B 2 93  ? 4.899   -7.731  50.610 1.00 40.65  ? 93  ASP B N   1 
ATOM   1406 C CA  . ASP B 2 93  ? 6.098   -8.063  49.890 1.00 38.89  ? 93  ASP B CA  1 
ATOM   1407 C C   . ASP B 2 93  ? 6.992   -6.861  50.038 1.00 37.64  ? 93  ASP B C   1 
ATOM   1408 O O   . ASP B 2 93  ? 6.700   -5.782  49.534 1.00 37.79  ? 93  ASP B O   1 
ATOM   1409 C CB  . ASP B 2 93  ? 5.798   -8.341  48.427 1.00 39.62  ? 93  ASP B CB  1 
ATOM   1410 C CG  . ASP B 2 93  ? 7.031   -8.788  47.669 1.00 42.78  ? 93  ASP B CG  1 
ATOM   1411 O OD1 . ASP B 2 93  ? 7.716   -9.697  48.172 1.00 48.54  ? 93  ASP B OD1 1 
ATOM   1412 O OD2 . ASP B 2 93  ? 7.396   -8.293  46.578 1.00 43.30  ? 93  ASP B OD2 1 
ATOM   1413 N N   . CYS B 2 94  ? 8.090   -7.063  50.749 1.00 40.04  ? 94  CYS B N   1 
ATOM   1414 C CA  . CYS B 2 94  ? 8.996   -5.978  51.123 1.00 41.00  ? 94  CYS B CA  1 
ATOM   1415 C C   . CYS B 2 94  ? 10.202  -5.880  50.205 1.00 39.65  ? 94  CYS B C   1 
ATOM   1416 O O   . CYS B 2 94  ? 11.293  -6.345  50.544 1.00 38.58  ? 94  CYS B O   1 
ATOM   1417 C CB  . CYS B 2 94  ? 9.454   -6.172  52.567 1.00 41.07  ? 94  CYS B CB  1 
ATOM   1418 S SG  . CYS B 2 94  ? 8.081   -6.534  53.697 1.00 43.08  ? 94  CYS B SG  1 
ATOM   1419 N N   . THR B 2 95  ? 9.996   -5.261  49.048 1.00 39.99  ? 95  THR B N   1 
ATOM   1420 C CA  . THR B 2 95  ? 11.077  -5.068  48.087 1.00 42.25  ? 95  THR B CA  1 
ATOM   1421 C C   . THR B 2 95  ? 11.581  -3.643  48.022 1.00 39.00  ? 95  THR B C   1 
ATOM   1422 O O   . THR B 2 95  ? 11.116  -2.760  48.742 1.00 36.86  ? 95  THR B O   1 
ATOM   1423 C CB  . THR B 2 95  ? 10.607  -5.427  46.680 1.00 47.24  ? 95  THR B CB  1 
ATOM   1424 O OG1 . THR B 2 95  ? 9.349   -4.767  46.416 1.00 48.68  ? 95  THR B OG1 1 
ATOM   1425 C CG2 . THR B 2 95  ? 10.355  -6.946  46.565 1.00 49.51  ? 95  THR B CG2 1 
ATOM   1426 N N   . VAL B 2 96  ? 12.543  -3.445  47.131 1.00 36.32  ? 96  VAL B N   1 
ATOM   1427 C CA  . VAL B 2 96  ? 12.995  -2.120  46.785 1.00 36.27  ? 96  VAL B CA  1 
ATOM   1428 C C   . VAL B 2 96  ? 12.037  -1.582  45.739 1.00 38.02  ? 96  VAL B C   1 
ATOM   1429 O O   . VAL B 2 96  ? 11.571  -0.466  45.866 1.00 38.11  ? 96  VAL B O   1 
ATOM   1430 C CB  . VAL B 2 96  ? 14.406  -2.143  46.198 1.00 35.77  ? 96  VAL B CB  1 
ATOM   1431 C CG1 . VAL B 2 96  ? 14.801  -0.745  45.674 1.00 34.90  ? 96  VAL B CG1 1 
ATOM   1432 C CG2 . VAL B 2 96  ? 15.398  -2.696  47.232 1.00 32.37  ? 96  VAL B CG2 1 
ATOM   1433 N N   . ARG B 2 97  ? 11.745  -2.389  44.717 1.00 40.89  ? 97  ARG B N   1 
ATOM   1434 C CA  . ARG B 2 97  ? 10.832  -2.003  43.637 1.00 41.24  ? 97  ARG B CA  1 
ATOM   1435 C C   . ARG B 2 97  ? 9.886   -3.137  43.251 1.00 40.37  ? 97  ARG B C   1 
ATOM   1436 O O   . ARG B 2 97  ? 10.290  -4.287  43.100 1.00 40.36  ? 97  ARG B O   1 
ATOM   1437 C CB  . ARG B 2 97  ? 11.622  -1.608  42.397 1.00 41.27  ? 97  ARG B CB  1 
ATOM   1438 C CG  . ARG B 2 97  ? 11.894  -0.140  42.229 1.00 45.83  ? 97  ARG B CG  1 
ATOM   1439 C CD  . ARG B 2 97  ? 13.020  0.120   41.223 1.00 52.92  ? 97  ARG B CD  1 
ATOM   1440 N NE  . ARG B 2 97  ? 14.158  -0.783  41.469 1.00 58.90  ? 97  ARG B NE  1 
ATOM   1441 C CZ  . ARG B 2 97  ? 15.338  -0.429  41.990 1.00 60.26  ? 97  ARG B CZ  1 
ATOM   1442 N NH1 . ARG B 2 97  ? 15.599  0.842   42.316 1.00 57.34  ? 97  ARG B NH1 1 
ATOM   1443 N NH2 . ARG B 2 97  ? 16.274  -1.359  42.165 1.00 59.63  ? 97  ARG B NH2 1 
ATOM   1444 N N   . GLY B 2 98  ? 8.618   -2.814  43.090 1.00 38.38  ? 98  GLY B N   1 
ATOM   1445 C CA  . GLY B 2 98  ? 7.705   -3.813  42.604 1.00 39.07  ? 98  GLY B CA  1 
ATOM   1446 C C   . GLY B 2 98  ? 7.578   -3.500  41.138 1.00 38.80  ? 98  GLY B C   1 
ATOM   1447 O O   . GLY B 2 98  ? 8.426   -2.800  40.578 1.00 37.51  ? 98  GLY B O   1 
ATOM   1448 N N   . LEU B 2 99  ? 6.516   -4.011  40.523 1.00 37.73  ? 99  LEU B N   1 
ATOM   1449 C CA  . LEU B 2 99  ? 6.179   -3.630  39.171 1.00 33.78  ? 99  LEU B CA  1 
ATOM   1450 C C   . LEU B 2 99  ? 5.406   -2.304  39.140 1.00 33.86  ? 99  LEU B C   1 
ATOM   1451 O O   . LEU B 2 99  ? 5.339   -1.681  38.083 1.00 36.35  ? 99  LEU B O   1 
ATOM   1452 C CB  . LEU B 2 99  ? 5.380   -4.735  38.480 1.00 33.90  ? 99  LEU B CB  1 
ATOM   1453 C CG  . LEU B 2 99  ? 6.159   -6.042  38.274 1.00 35.49  ? 99  LEU B CG  1 
ATOM   1454 C CD1 . LEU B 2 99  ? 5.232   -7.184  37.941 1.00 29.43  ? 99  LEU B CD1 1 
ATOM   1455 C CD2 . LEU B 2 99  ? 7.243   -5.875  37.201 1.00 36.12  ? 99  LEU B CD2 1 
ATOM   1456 N N   . GLY B 2 100 ? 4.856   -1.861  40.278 1.00 31.12  ? 100 GLY B N   1 
ATOM   1457 C CA  . GLY B 2 100 ? 4.042   -0.627  40.338 1.00 30.17  ? 100 GLY B CA  1 
ATOM   1458 C C   . GLY B 2 100 ? 2.542   -0.925  40.424 1.00 32.10  ? 100 GLY B C   1 
ATOM   1459 O O   . GLY B 2 100 ? 2.103   -1.986  39.976 1.00 32.75  ? 100 GLY B O   1 
ATOM   1460 N N   . PRO B 2 101 ? 1.740   -0.032  41.018 1.00 31.55  ? 101 PRO B N   1 
ATOM   1461 C CA  . PRO B 2 101 ? 0.314   -0.264  41.134 1.00 31.49  ? 101 PRO B CA  1 
ATOM   1462 C C   . PRO B 2 101 ? -0.318  -0.553  39.799 1.00 32.98  ? 101 PRO B C   1 
ATOM   1463 O O   . PRO B 2 101 ? -0.875  -1.615  39.603 1.00 37.96  ? 101 PRO B O   1 
ATOM   1464 C CB  . PRO B 2 101 ? -0.215  1.071   41.655 1.00 30.32  ? 101 PRO B CB  1 
ATOM   1465 C CG  . PRO B 2 101 ? 0.866   1.631   42.408 1.00 29.12  ? 101 PRO B CG  1 
ATOM   1466 C CD  . PRO B 2 101 ? 2.110   1.235   41.666 1.00 33.87  ? 101 PRO B CD  1 
ATOM   1467 N N   . SER B 2 102 ? -0.188  0.378   38.872 1.00 37.23  ? 102 SER B N   1 
ATOM   1468 C CA  . SER B 2 102 ? -0.952  0.330   37.640 1.00 38.44  ? 102 SER B CA  1 
ATOM   1469 C C   . SER B 2 102 ? -0.261  -0.473  36.569 1.00 39.85  ? 102 SER B C   1 
ATOM   1470 O O   . SER B 2 102 ? -0.321  -0.120  35.381 1.00 40.21  ? 102 SER B O   1 
ATOM   1471 C CB  . SER B 2 102 ? -1.212  1.749   37.143 1.00 38.37  ? 102 SER B CB  1 
ATOM   1472 O OG  . SER B 2 102 ? 0.026   2.410   36.932 1.00 41.86  ? 102 SER B OG  1 
ATOM   1473 N N   . TYR B 2 103 ? 0.386   -1.559  36.985 1.00 41.28  ? 103 TYR B N   1 
ATOM   1474 C CA  . TYR B 2 103 ? 1.072   -2.426  36.042 1.00 43.07  ? 103 TYR B CA  1 
ATOM   1475 C C   . TYR B 2 103 ? 0.111   -3.297  35.262 1.00 45.53  ? 103 TYR B C   1 
ATOM   1476 O O   . TYR B 2 103 ? -0.831  -3.848  35.827 1.00 47.14  ? 103 TYR B O   1 
ATOM   1477 C CB  . TYR B 2 103 ? 2.077   -3.331  36.738 1.00 41.87  ? 103 TYR B CB  1 
ATOM   1478 C CG  . TYR B 2 103 ? 2.741   -4.224  35.740 1.00 40.49  ? 103 TYR B CG  1 
ATOM   1479 C CD1 . TYR B 2 103 ? 3.713   -3.713  34.873 1.00 41.25  ? 103 TYR B CD1 1 
ATOM   1480 C CD2 . TYR B 2 103 ? 2.371   -5.556  35.611 1.00 38.83  ? 103 TYR B CD2 1 
ATOM   1481 C CE1 . TYR B 2 103 ? 4.316   -4.501  33.915 1.00 38.58  ? 103 TYR B CE1 1 
ATOM   1482 C CE2 . TYR B 2 103 ? 2.971   -6.366  34.651 1.00 41.22  ? 103 TYR B CE2 1 
ATOM   1483 C CZ  . TYR B 2 103 ? 3.943   -5.821  33.808 1.00 40.57  ? 103 TYR B CZ  1 
ATOM   1484 O OH  . TYR B 2 103 ? 4.551   -6.589  32.852 1.00 43.63  ? 103 TYR B OH  1 
ATOM   1485 N N   . CYS B 2 104 ? 0.363   -3.442  33.965 1.00 49.69  ? 104 CYS B N   1 
ATOM   1486 C CA  . CYS B 2 104 ? -0.482  -4.290  33.127 1.00 51.60  ? 104 CYS B CA  1 
ATOM   1487 C C   . CYS B 2 104 ? 0.316   -5.109  32.132 1.00 50.51  ? 104 CYS B C   1 
ATOM   1488 O O   . CYS B 2 104 ? 1.154   -4.568  31.419 1.00 50.65  ? 104 CYS B O   1 
ATOM   1489 C CB  . CYS B 2 104 ? -1.493  -3.446  32.361 1.00 53.67  ? 104 CYS B CB  1 
ATOM   1490 S SG  . CYS B 2 104 ? -2.709  -4.502  31.547 1.00 56.95  ? 104 CYS B SG  1 
ATOM   1491 N N   . SER B 2 105 ? 0.028   -6.405  32.065 1.00 51.22  ? 105 SER B N   1 
ATOM   1492 C CA  . SER B 2 105 ? 0.729   -7.304  31.144 1.00 52.58  ? 105 SER B CA  1 
ATOM   1493 C C   . SER B 2 105 ? 0.410   -7.042  29.672 1.00 54.71  ? 105 SER B C   1 
ATOM   1494 O O   . SER B 2 105 ? 1.097   -7.568  28.790 1.00 55.97  ? 105 SER B O   1 
ATOM   1495 C CB  . SER B 2 105 ? 0.389   -8.764  31.448 1.00 50.12  ? 105 SER B CB  1 
ATOM   1496 O OG  . SER B 2 105 ? 0.676   -9.085  32.787 1.00 50.03  ? 105 SER B OG  1 
ATOM   1497 N N   . PHE B 2 106 ? -0.633  -6.250  29.413 1.00 55.61  ? 106 PHE B N   1 
ATOM   1498 C CA  . PHE B 2 106 ? -1.113  -6.011  28.056 1.00 56.34  ? 106 PHE B CA  1 
ATOM   1499 C C   . PHE B 2 106 ? -1.146  -4.513  27.759 1.00 60.71  ? 106 PHE B C   1 
ATOM   1500 O O   . PHE B 2 106 ? -1.510  -3.703  28.615 1.00 63.53  ? 106 PHE B O   1 
ATOM   1501 C CB  . PHE B 2 106 ? -2.490  -6.642  27.876 1.00 53.18  ? 106 PHE B CB  1 
ATOM   1502 C CG  . PHE B 2 106 ? -2.658  -7.947  28.603 1.00 50.26  ? 106 PHE B CG  1 
ATOM   1503 C CD1 . PHE B 2 106 ? -2.168  -9.124  28.071 1.00 49.25  ? 106 PHE B CD1 1 
ATOM   1504 C CD2 . PHE B 2 106 ? -3.303  -7.998  29.834 1.00 51.91  ? 106 PHE B CD2 1 
ATOM   1505 C CE1 . PHE B 2 106 ? -2.317  -10.341 28.753 1.00 49.00  ? 106 PHE B CE1 1 
ATOM   1506 C CE2 . PHE B 2 106 ? -3.457  -9.220  30.523 1.00 50.32  ? 106 PHE B CE2 1 
ATOM   1507 C CZ  . PHE B 2 106 ? -2.963  -10.386 29.978 1.00 47.92  ? 106 PHE B CZ  1 
ATOM   1508 N N   . GLY B 2 107 ? -0.753  -4.147  26.542 1.00 63.66  ? 107 GLY B N   1 
ATOM   1509 C CA  . GLY B 2 107 ? -0.593  -2.737  26.180 1.00 66.94  ? 107 GLY B CA  1 
ATOM   1510 C C   . GLY B 2 107 ? 0.862   -2.270  26.293 1.00 69.62  ? 107 GLY B C   1 
ATOM   1511 O O   . GLY B 2 107 ? 1.797   -3.074  26.487 1.00 68.83  ? 107 GLY B O   1 
ATOM   1512 N N   . CYS C 3 2   ? 19.258  5.771   27.034 1.00 108.60 ? 18  CYS C N   1 
ATOM   1513 C CA  . CYS C 3 2   ? 20.036  4.739   26.303 1.00 109.89 ? 18  CYS C CA  1 
ATOM   1514 C C   . CYS C 3 2   ? 19.294  3.411   26.149 1.00 110.78 ? 18  CYS C C   1 
ATOM   1515 O O   . CYS C 3 2   ? 18.487  3.032   27.000 1.00 110.68 ? 18  CYS C O   1 
ATOM   1516 C CB  . CYS C 3 2   ? 21.392  4.506   26.974 1.00 109.59 ? 18  CYS C CB  1 
ATOM   1517 S SG  . CYS C 3 2   ? 22.301  3.075   26.273 1.00 108.70 ? 18  CYS C SG  1 
ATOM   1518 N N   . HIS C 3 3   ? 19.610  2.692   25.072 1.00 112.33 ? 19  HIS C N   1 
ATOM   1519 C CA  . HIS C 3 3   ? 18.839  1.514   24.706 1.00 114.39 ? 19  HIS C CA  1 
ATOM   1520 C C   . HIS C 3 3   ? 19.663  0.446   23.948 1.00 114.84 ? 19  HIS C C   1 
ATOM   1521 O O   . HIS C 3 3   ? 20.731  0.721   23.374 1.00 114.92 ? 19  HIS C O   1 
ATOM   1522 C CB  . HIS C 3 3   ? 17.622  1.963   23.865 1.00 115.00 ? 19  HIS C CB  1 
ATOM   1523 C CG  . HIS C 3 3   ? 16.292  1.362   24.280 1.00 114.78 ? 19  HIS C CG  1 
ATOM   1524 N ND1 . HIS C 3 3   ? 15.209  1.297   23.418 1.00 114.59 ? 19  HIS C ND1 1 
ATOM   1525 C CD2 . HIS C 3 3   ? 15.880  0.803   25.445 1.00 114.44 ? 19  HIS C CD2 1 
ATOM   1526 C CE1 . HIS C 3 3   ? 14.194  0.721   24.031 1.00 113.98 ? 19  HIS C CE1 1 
ATOM   1527 N NE2 . HIS C 3 3   ? 14.573  0.409   25.259 1.00 113.81 ? 19  HIS C NE2 1 
ATOM   1528 N N   . HIS C 3 4   ? 19.118  -0.771  23.990 1.00 114.49 ? 20  HIS C N   1 
ATOM   1529 C CA  . HIS C 3 4   ? 19.483  -1.963  23.226 1.00 113.29 ? 20  HIS C CA  1 
ATOM   1530 C C   . HIS C 3 4   ? 18.065  -2.482  23.031 1.00 112.10 ? 20  HIS C C   1 
ATOM   1531 O O   . HIS C 3 4   ? 17.154  -1.969  23.703 1.00 113.48 ? 20  HIS C O   1 
ATOM   1532 C CB  . HIS C 3 4   ? 20.347  -2.922  24.059 1.00 113.16 ? 20  HIS C CB  1 
ATOM   1533 C CG  . HIS C 3 4   ? 20.490  -4.312  23.482 1.00 113.54 ? 20  HIS C CG  1 
ATOM   1534 N ND1 . HIS C 3 4   ? 19.428  -5.188  23.381 1.00 113.68 ? 20  HIS C ND1 1 
ATOM   1535 C CD2 . HIS C 3 4   ? 21.579  -4.977  23.014 1.00 113.78 ? 20  HIS C CD2 1 
ATOM   1536 C CE1 . HIS C 3 4   ? 19.858  -6.321  22.850 1.00 113.81 ? 20  HIS C CE1 1 
ATOM   1537 N NE2 . HIS C 3 4   ? 21.159  -6.220  22.619 1.00 113.62 ? 20  HIS C NE2 1 
ATOM   1538 N N   . ARG C 3 5   ? 17.807  -3.451  22.159 1.00 108.34 ? 21  ARG C N   1 
ATOM   1539 C CA  . ARG C 3 5   ? 16.401  -3.850  21.991 1.00 103.98 ? 21  ARG C CA  1 
ATOM   1540 C C   . ARG C 3 5   ? 15.741  -4.270  23.310 1.00 100.56 ? 21  ARG C C   1 
ATOM   1541 O O   . ARG C 3 5   ? 14.814  -3.612  23.795 1.00 99.05  ? 21  ARG C O   1 
ATOM   1542 C CB  . ARG C 3 5   ? 16.265  -4.977  20.964 1.00 104.89 ? 21  ARG C CB  1 
ATOM   1543 C CG  . ARG C 3 5   ? 16.894  -4.671  19.617 1.00 105.22 ? 21  ARG C CG  1 
ATOM   1544 C CD  . ARG C 3 5   ? 17.536  -5.887  18.991 1.00 106.70 ? 21  ARG C CD  1 
ATOM   1545 N NE  . ARG C 3 5   ? 16.615  -7.017  18.964 1.00 108.53 ? 21  ARG C NE  1 
ATOM   1546 C CZ  . ARG C 3 5   ? 16.990  -8.291  19.030 1.00 108.99 ? 21  ARG C CZ  1 
ATOM   1547 N NH1 . ARG C 3 5   ? 18.279  -8.609  19.130 1.00 108.91 ? 21  ARG C NH1 1 
ATOM   1548 N NH2 . ARG C 3 5   ? 16.074  -9.252  19.003 1.00 109.75 ? 21  ARG C NH2 1 
ATOM   1549 N N   . ILE C 3 6   ? 16.264  -5.351  23.889 1.00 97.29  ? 22  ILE C N   1 
ATOM   1550 C CA  . ILE C 3 6   ? 15.643  -6.057  25.012 1.00 93.98  ? 22  ILE C CA  1 
ATOM   1551 C C   . ILE C 3 6   ? 16.051  -5.532  26.384 1.00 91.62  ? 22  ILE C C   1 
ATOM   1552 O O   . ILE C 3 6   ? 15.347  -5.770  27.364 1.00 89.58  ? 22  ILE C O   1 
ATOM   1553 C CB  . ILE C 3 6   ? 15.959  -7.571  24.905 1.00 94.72  ? 22  ILE C CB  1 
ATOM   1554 C CG1 . ILE C 3 6   ? 17.434  -7.854  25.237 1.00 94.36  ? 22  ILE C CG1 1 
ATOM   1555 C CG2 . ILE C 3 6   ? 15.615  -8.078  23.509 1.00 94.65  ? 22  ILE C CG2 1 
ATOM   1556 C CD1 . ILE C 3 6   ? 17.952  -9.207  24.778 1.00 94.01  ? 22  ILE C CD1 1 
ATOM   1557 N N   . CYS C 3 7   ? 17.187  -4.833  26.454 1.00 89.78  ? 23  CYS C N   1 
ATOM   1558 C CA  . CYS C 3 7   ? 17.668  -4.246  27.701 1.00 88.22  ? 23  CYS C CA  1 
ATOM   1559 C C   . CYS C 3 7   ? 17.976  -2.768  27.528 1.00 88.56  ? 23  CYS C C   1 
ATOM   1560 O O   . CYS C 3 7   ? 18.356  -2.324  26.447 1.00 87.92  ? 23  CYS C O   1 
ATOM   1561 C CB  . CYS C 3 7   ? 18.910  -4.983  28.223 1.00 85.38  ? 23  CYS C CB  1 
ATOM   1562 S SG  . CYS C 3 7   ? 18.634  -6.741  28.588 1.00 85.38  ? 23  CYS C SG  1 
ATOM   1563 N N   . HIS C 3 8   ? 17.791  -2.020  28.614 1.00 89.93  ? 24  HIS C N   1 
ATOM   1564 C CA  . HIS C 3 8   ? 18.120  -0.606  28.665 1.00 90.52  ? 24  HIS C CA  1 
ATOM   1565 C C   . HIS C 3 8   ? 19.466  -0.451  29.320 1.00 91.01  ? 24  HIS C C   1 
ATOM   1566 O O   . HIS C 3 8   ? 19.636  -0.760  30.501 1.00 89.36  ? 24  HIS C O   1 
ATOM   1567 C CB  . HIS C 3 8   ? 17.099  0.174   29.490 1.00 90.27  ? 24  HIS C CB  1 
ATOM   1568 C CG  . HIS C 3 8   ? 15.680  -0.232  29.216 1.00 92.27  ? 24  HIS C CG  1 
ATOM   1569 N ND1 . HIS C 3 8   ? 14.797  0.564   28.519 1.00 93.37  ? 24  HIS C ND1 1 
ATOM   1570 C CD2 . HIS C 3 8   ? 14.999  -1.361  29.534 1.00 93.33  ? 24  HIS C CD2 1 
ATOM   1571 C CE1 . HIS C 3 8   ? 13.632  -0.051  28.423 1.00 93.57  ? 24  HIS C CE1 1 
ATOM   1572 N NE2 . HIS C 3 8   ? 13.728  -1.222  29.030 1.00 94.93  ? 24  HIS C NE2 1 
ATOM   1573 N N   . CYS C 3 9   ? 20.427  0.008   28.544 1.00 93.11  ? 25  CYS C N   1 
ATOM   1574 C CA  . CYS C 3 9   ? 21.652  0.473   29.133 1.00 94.66  ? 25  CYS C CA  1 
ATOM   1575 C C   . CYS C 3 9   ? 21.348  1.880   29.633 1.00 92.60  ? 25  CYS C C   1 
ATOM   1576 O O   . CYS C 3 9   ? 21.516  2.856   28.922 1.00 92.62  ? 25  CYS C O   1 
ATOM   1577 C CB  . CYS C 3 9   ? 22.812  0.458   28.124 1.00 98.21  ? 25  CYS C CB  1 
ATOM   1578 S SG  . CYS C 3 9   ? 23.462  2.083   27.617 1.00 105.91 ? 25  CYS C SG  1 
ATOM   1579 N N   . SER C 3 10  ? 20.844  1.986   30.854 1.00 90.85  ? 26  SER C N   1 
ATOM   1580 C CA  . SER C 3 10  ? 20.701  3.299   31.447 1.00 87.46  ? 26  SER C CA  1 
ATOM   1581 C C   . SER C 3 10  ? 22.093  3.682   31.913 1.00 84.72  ? 26  SER C C   1 
ATOM   1582 O O   . SER C 3 10  ? 23.095  3.180   31.399 1.00 85.96  ? 26  SER C O   1 
ATOM   1583 C CB  . SER C 3 10  ? 19.701  3.303   32.606 1.00 88.83  ? 26  SER C CB  1 
ATOM   1584 O OG  . SER C 3 10  ? 19.755  4.528   33.334 1.00 89.50  ? 26  SER C OG  1 
ATOM   1585 N N   . ASN C 3 11  ? 22.164  4.558   32.890 1.00 80.57  ? 27  ASN C N   1 
ATOM   1586 C CA  . ASN C 3 11  ? 23.441  5.076   33.321 1.00 76.41  ? 27  ASN C CA  1 
ATOM   1587 C C   . ASN C 3 11  ? 24.203  4.134   34.262 1.00 74.33  ? 27  ASN C C   1 
ATOM   1588 O O   . ASN C 3 11  ? 24.189  4.299   35.490 1.00 73.34  ? 27  ASN C O   1 
ATOM   1589 C CB  . ASN C 3 11  ? 23.201  6.454   33.912 1.00 76.89  ? 27  ASN C CB  1 
ATOM   1590 C CG  . ASN C 3 11  ? 22.432  7.332   32.936 1.00 76.06  ? 27  ASN C CG  1 
ATOM   1591 O OD1 . ASN C 3 11  ? 23.006  7.883   31.994 1.00 76.70  ? 27  ASN C OD1 1 
ATOM   1592 N ND2 . ASN C 3 11  ? 21.123  7.461   33.155 1.00 75.11  ? 27  ASN C ND2 1 
ATOM   1593 N N   . ARG C 3 12  ? 24.855  3.141   33.652 1.00 69.77  ? 28  ARG C N   1 
ATOM   1594 C CA  . ARG C 3 12  ? 25.637  2.113   34.360 1.00 66.83  ? 28  ARG C CA  1 
ATOM   1595 C C   . ARG C 3 12  ? 24.749  1.168   35.183 1.00 64.94  ? 28  ARG C C   1 
ATOM   1596 O O   . ARG C 3 12  ? 25.231  0.320   35.938 1.00 63.07  ? 28  ARG C O   1 
ATOM   1597 C CB  . ARG C 3 12  ? 26.714  2.759   35.234 1.00 65.75  ? 28  ARG C CB  1 
ATOM   1598 C CG  . ARG C 3 12  ? 27.761  3.511   34.444 1.00 66.82  ? 28  ARG C CG  1 
ATOM   1599 C CD  . ARG C 3 12  ? 29.139  2.892   34.532 1.00 68.63  ? 28  ARG C CD  1 
ATOM   1600 N NE  . ARG C 3 12  ? 30.034  3.673   35.389 1.00 70.50  ? 28  ARG C NE  1 
ATOM   1601 C CZ  . ARG C 3 12  ? 31.162  3.215   35.930 1.00 71.64  ? 28  ARG C CZ  1 
ATOM   1602 N NH1 . ARG C 3 12  ? 31.551  1.962   35.725 1.00 71.76  ? 28  ARG C NH1 1 
ATOM   1603 N NH2 . ARG C 3 12  ? 31.908  4.012   36.688 1.00 73.76  ? 28  ARG C NH2 1 
ATOM   1604 N N   . VAL C 3 13  ? 23.439  1.339   35.004 1.00 63.18  ? 29  VAL C N   1 
ATOM   1605 C CA  . VAL C 3 13  ? 22.395  0.594   35.701 1.00 61.08  ? 29  VAL C CA  1 
ATOM   1606 C C   . VAL C 3 13  ? 21.517  -0.068  34.637 1.00 60.67  ? 29  VAL C C   1 
ATOM   1607 O O   . VAL C 3 13  ? 20.720  0.604   33.980 1.00 61.27  ? 29  VAL C O   1 
ATOM   1608 C CB  . VAL C 3 13  ? 21.582  1.545   36.629 1.00 60.66  ? 29  VAL C CB  1 
ATOM   1609 C CG1 . VAL C 3 13  ? 20.107  1.179   36.673 1.00 61.26  ? 29  VAL C CG1 1 
ATOM   1610 C CG2 . VAL C 3 13  ? 22.174  1.571   38.016 1.00 58.49  ? 29  VAL C CG2 1 
ATOM   1611 N N   . PHE C 3 14  ? 21.677  -1.379  34.455 1.00 59.22  ? 30  PHE C N   1 
ATOM   1612 C CA  . PHE C 3 14  ? 21.020  -2.104  33.363 1.00 56.32  ? 30  PHE C CA  1 
ATOM   1613 C C   . PHE C 3 14  ? 19.760  -2.833  33.793 1.00 54.89  ? 30  PHE C C   1 
ATOM   1614 O O   . PHE C 3 14  ? 19.746  -3.493  34.828 1.00 55.67  ? 30  PHE C O   1 
ATOM   1615 C CB  . PHE C 3 14  ? 21.995  -3.096  32.722 1.00 56.03  ? 30  PHE C CB  1 
ATOM   1616 C CG  . PHE C 3 14  ? 23.251  -2.463  32.191 1.00 55.89  ? 30  PHE C CG  1 
ATOM   1617 C CD1 . PHE C 3 14  ? 23.362  -1.082  32.062 1.00 57.45  ? 30  PHE C CD1 1 
ATOM   1618 C CD2 . PHE C 3 14  ? 24.314  -3.256  31.789 1.00 56.74  ? 30  PHE C CD2 1 
ATOM   1619 C CE1 . PHE C 3 14  ? 24.525  -0.503  31.565 1.00 58.65  ? 30  PHE C CE1 1 
ATOM   1620 C CE2 . PHE C 3 14  ? 25.479  -2.691  31.288 1.00 55.88  ? 30  PHE C CE2 1 
ATOM   1621 C CZ  . PHE C 3 14  ? 25.587  -1.316  31.176 1.00 57.31  ? 30  PHE C CZ  1 
ATOM   1622 N N   . LEU C 3 15  ? 18.711  -2.725  32.986 1.00 52.75  ? 31  LEU C N   1 
ATOM   1623 C CA  . LEU C 3 15  ? 17.452  -3.374  33.303 1.00 52.80  ? 31  LEU C CA  1 
ATOM   1624 C C   . LEU C 3 15  ? 16.922  -4.218  32.150 1.00 55.53  ? 31  LEU C C   1 
ATOM   1625 O O   . LEU C 3 15  ? 16.564  -3.702  31.087 1.00 57.63  ? 31  LEU C O   1 
ATOM   1626 C CB  . LEU C 3 15  ? 16.402  -2.344  33.755 1.00 49.38  ? 31  LEU C CB  1 
ATOM   1627 C CG  . LEU C 3 15  ? 14.908  -2.680  33.680 1.00 47.61  ? 31  LEU C CG  1 
ATOM   1628 C CD1 . LEU C 3 15  ? 14.516  -3.799  34.628 1.00 47.32  ? 31  LEU C CD1 1 
ATOM   1629 C CD2 . LEU C 3 15  ? 14.093  -1.439  33.964 1.00 48.83  ? 31  LEU C CD2 1 
ATOM   1630 N N   . CYS C 3 16  ? 16.879  -5.526  32.370 1.00 56.60  ? 32  CYS C N   1 
ATOM   1631 C CA  . CYS C 3 16  ? 16.247  -6.407  31.419 1.00 58.93  ? 32  CYS C CA  1 
ATOM   1632 C C   . CYS C 3 16  ? 14.881  -6.725  31.984 1.00 57.99  ? 32  CYS C C   1 
ATOM   1633 O O   . CYS C 3 16  ? 14.765  -7.509  32.917 1.00 59.79  ? 32  CYS C O   1 
ATOM   1634 C CB  . CYS C 3 16  ? 17.067  -7.675  31.210 1.00 61.85  ? 32  CYS C CB  1 
ATOM   1635 S SG  . CYS C 3 16  ? 18.718  -7.357  30.542 1.00 72.55  ? 32  CYS C SG  1 
ATOM   1636 N N   . GLN C 3 17  ? 13.850  -6.086  31.440 1.00 57.91  ? 33  GLN C N   1 
ATOM   1637 C CA  . GLN C 3 17  ? 12.488  -6.296  31.900 1.00 58.16  ? 33  GLN C CA  1 
ATOM   1638 C C   . GLN C 3 17  ? 11.658  -6.808  30.747 1.00 59.41  ? 33  GLN C C   1 
ATOM   1639 O O   . GLN C 3 17  ? 11.869  -6.401  29.608 1.00 59.66  ? 33  GLN C O   1 
ATOM   1640 C CB  . GLN C 3 17  ? 11.911  -4.988  32.430 1.00 59.08  ? 33  GLN C CB  1 
ATOM   1641 C CG  . GLN C 3 17  ? 10.495  -5.112  32.983 1.00 61.93  ? 33  GLN C CG  1 
ATOM   1642 C CD  . GLN C 3 17  ? 10.214  -4.170  34.137 1.00 63.77  ? 33  GLN C CD  1 
ATOM   1643 O OE1 . GLN C 3 17  ? 11.135  -3.712  34.824 1.00 65.45  ? 33  GLN C OE1 1 
ATOM   1644 N NE2 . GLN C 3 17  ? 8.949   -3.853  34.411 1.00 61.69  ? 33  GLN C NE2 1 
ATOM   1645 N N   . GLU C 3 18  ? 10.705  -7.694  31.047 1.00 62.35  ? 34  GLU C N   1 
ATOM   1646 C CA  . GLU C 3 18  ? 9.845   -8.221  30.002 1.00 65.26  ? 34  GLU C CA  1 
ATOM   1647 C C   . GLU C 3 18  ? 10.749  -8.628  28.877 1.00 68.56  ? 34  GLU C C   1 
ATOM   1648 O O   . GLU C 3 18  ? 10.739  -8.015  27.804 1.00 71.62  ? 34  GLU C O   1 
ATOM   1649 C CB  . GLU C 3 18  ? 8.890   -7.144  29.480 1.00 62.99  ? 34  GLU C CB  1 
ATOM   1650 C CG  . GLU C 3 18  ? 7.813   -6.712  30.449 1.00 62.00  ? 34  GLU C CG  1 
ATOM   1651 C CD  . GLU C 3 18  ? 6.645   -7.675  30.447 1.00 61.76  ? 34  GLU C CD  1 
ATOM   1652 O OE1 . GLU C 3 18  ? 6.745   -8.750  29.812 1.00 60.20  ? 34  GLU C OE1 1 
ATOM   1653 O OE2 . GLU C 3 18  ? 5.622   -7.355  31.079 1.00 63.45  ? 34  GLU C OE2 1 
ATOM   1654 N N   . SER C 3 19  ? 11.557  -9.651  29.111 1.00 71.30  ? 35  SER C N   1 
ATOM   1655 C CA  . SER C 3 19  ? 12.658  -9.899  28.205 1.00 75.07  ? 35  SER C CA  1 
ATOM   1656 C C   . SER C 3 19  ? 12.340  -10.712 26.951 1.00 77.55  ? 35  SER C C   1 
ATOM   1657 O O   . SER C 3 19  ? 11.326  -11.407 26.846 1.00 77.39  ? 35  SER C O   1 
ATOM   1658 C CB  . SER C 3 19  ? 13.857  -10.494 28.945 1.00 75.28  ? 35  SER C CB  1 
ATOM   1659 O OG  . SER C 3 19  ? 15.068  -9.946  28.454 1.00 74.53  ? 35  SER C OG  1 
ATOM   1660 N N   . LYS C 3 20  ? 13.250  -10.554 25.997 1.00 80.52  ? 36  LYS C N   1 
ATOM   1661 C CA  . LYS C 3 20  ? 13.338  -11.361 24.807 1.00 83.73  ? 36  LYS C CA  1 
ATOM   1662 C C   . LYS C 3 20  ? 14.567  -12.254 25.020 1.00 85.77  ? 36  LYS C C   1 
ATOM   1663 O O   . LYS C 3 20  ? 15.372  -12.474 24.103 1.00 87.21  ? 36  LYS C O   1 
ATOM   1664 C CB  . LYS C 3 20  ? 13.455  -10.469 23.549 1.00 83.61  ? 36  LYS C CB  1 
ATOM   1665 C CG  . LYS C 3 20  ? 13.982  -11.152 22.265 1.00 82.47  ? 36  LYS C CG  1 
ATOM   1666 C CD  . LYS C 3 20  ? 12.901  -11.947 21.546 1.00 81.27  ? 36  LYS C CD  1 
ATOM   1667 C CE  . LYS C 3 20  ? 13.313  -13.401 21.346 1.00 79.56  ? 36  LYS C CE  1 
ATOM   1668 N NZ  . LYS C 3 20  ? 14.614  -13.560 20.644 1.00 78.57  ? 36  LYS C NZ  1 
ATOM   1669 N N   . VAL C 3 21  ? 14.716  -12.763 26.245 1.00 86.08  ? 37  VAL C N   1 
ATOM   1670 C CA  . VAL C 3 21  ? 15.856  -13.632 26.521 1.00 86.27  ? 37  VAL C CA  1 
ATOM   1671 C C   . VAL C 3 21  ? 15.535  -14.898 27.282 1.00 84.54  ? 37  VAL C C   1 
ATOM   1672 O O   . VAL C 3 21  ? 14.632  -14.941 28.109 1.00 84.74  ? 37  VAL C O   1 
ATOM   1673 C CB  . VAL C 3 21  ? 17.004  -12.900 27.266 1.00 88.01  ? 37  VAL C CB  1 
ATOM   1674 C CG1 . VAL C 3 21  ? 17.577  -11.764 26.427 1.00 88.15  ? 37  VAL C CG1 1 
ATOM   1675 C CG2 . VAL C 3 21  ? 16.568  -12.426 28.659 1.00 89.23  ? 37  VAL C CG2 1 
ATOM   1676 N N   . THR C 3 22  ? 16.330  -15.920 26.973 1.00 84.15  ? 38  THR C N   1 
ATOM   1677 C CA  . THR C 3 22  ? 16.333  -17.190 27.685 1.00 86.35  ? 38  THR C CA  1 
ATOM   1678 C C   . THR C 3 22  ? 17.690  -17.326 28.372 1.00 85.29  ? 38  THR C C   1 
ATOM   1679 O O   . THR C 3 22  ? 17.875  -18.153 29.280 1.00 84.83  ? 38  THR C O   1 
ATOM   1680 C CB  . THR C 3 22  ? 16.084  -18.383 26.718 1.00 88.20  ? 38  THR C CB  1 
ATOM   1681 O OG1 . THR C 3 22  ? 17.073  -18.386 25.679 1.00 90.51  ? 38  THR C OG1 1 
ATOM   1682 C CG2 . THR C 3 22  ? 14.738  -18.238 25.988 1.00 88.23  ? 38  THR C CG2 1 
ATOM   1683 N N   . GLU C 3 23  ? 18.615  -16.500 27.908 1.00 84.50  ? 39  GLU C N   1 
ATOM   1684 C CA  . GLU C 3 23  ? 19.963  -16.391 28.450 1.00 82.83  ? 39  GLU C CA  1 
ATOM   1685 C C   . GLU C 3 23  ? 20.306  -14.929 28.652 1.00 80.45  ? 39  GLU C C   1 
ATOM   1686 O O   . GLU C 3 23  ? 19.826  -14.051 27.926 1.00 77.82  ? 39  GLU C O   1 
ATOM   1687 C CB  . GLU C 3 23  ? 20.998  -16.992 27.498 1.00 84.85  ? 39  GLU C CB  1 
ATOM   1688 C CG  . GLU C 3 23  ? 21.726  -18.214 28.037 1.00 87.67  ? 39  GLU C CG  1 
ATOM   1689 C CD  . GLU C 3 23  ? 21.010  -19.519 27.724 1.00 90.31  ? 39  GLU C CD  1 
ATOM   1690 O OE1 . GLU C 3 23  ? 20.074  -19.511 26.890 1.00 91.12  ? 39  GLU C OE1 1 
ATOM   1691 O OE2 . GLU C 3 23  ? 21.388  -20.558 28.314 1.00 90.32  ? 39  GLU C OE2 1 
ATOM   1692 N N   . ILE C 3 24  ? 21.135  -14.667 29.648 1.00 77.07  ? 40  ILE C N   1 
ATOM   1693 C CA  . ILE C 3 24  ? 21.645  -13.330 29.857 1.00 74.29  ? 40  ILE C CA  1 
ATOM   1694 C C   . ILE C 3 24  ? 22.520  -12.944 28.666 1.00 74.03  ? 40  ILE C C   1 
ATOM   1695 O O   . ILE C 3 24  ? 23.428  -13.695 28.300 1.00 73.68  ? 40  ILE C O   1 
ATOM   1696 C CB  . ILE C 3 24  ? 22.443  -13.296 31.164 1.00 72.87  ? 40  ILE C CB  1 
ATOM   1697 C CG1 . ILE C 3 24  ? 21.493  -13.417 32.353 1.00 70.36  ? 40  ILE C CG1 1 
ATOM   1698 C CG2 . ILE C 3 24  ? 23.288  -12.029 31.258 1.00 72.26  ? 40  ILE C CG2 1 
ATOM   1699 C CD1 . ILE C 3 24  ? 22.176  -13.787 33.632 1.00 70.14  ? 40  ILE C CD1 1 
ATOM   1700 N N   . PRO C 3 25  ? 22.252  -11.782 28.046 1.00 73.20  ? 41  PRO C N   1 
ATOM   1701 C CA  . PRO C 3 25  ? 23.033  -11.343 26.884 1.00 72.46  ? 41  PRO C CA  1 
ATOM   1702 C C   . PRO C 3 25  ? 24.526  -11.303 27.194 1.00 72.86  ? 41  PRO C C   1 
ATOM   1703 O O   . PRO C 3 25  ? 24.923  -11.046 28.331 1.00 72.84  ? 41  PRO C O   1 
ATOM   1704 C CB  . PRO C 3 25  ? 22.512  -9.925  26.617 1.00 71.55  ? 41  PRO C CB  1 
ATOM   1705 C CG  . PRO C 3 25  ? 21.172  -9.887  27.226 1.00 72.01  ? 41  PRO C CG  1 
ATOM   1706 C CD  . PRO C 3 25  ? 21.234  -10.763 28.445 1.00 72.57  ? 41  PRO C CD  1 
ATOM   1707 N N   . SER C 3 26  ? 25.333  -11.573 26.176 1.00 73.66  ? 42  SER C N   1 
ATOM   1708 C CA  . SER C 3 26  ? 26.785  -11.501 26.304 1.00 73.76  ? 42  SER C CA  1 
ATOM   1709 C C   . SER C 3 26  ? 27.269  -10.072 26.083 1.00 74.21  ? 42  SER C C   1 
ATOM   1710 O O   . SER C 3 26  ? 28.256  -9.644  26.686 1.00 74.34  ? 42  SER C O   1 
ATOM   1711 C CB  . SER C 3 26  ? 27.465  -12.448 25.315 1.00 73.36  ? 42  SER C CB  1 
ATOM   1712 O OG  . SER C 3 26  ? 26.861  -12.368 24.038 1.00 73.78  ? 42  SER C OG  1 
ATOM   1713 N N   . ASP C 3 27  ? 26.548  -9.338  25.233 1.00 73.84  ? 43  ASP C N   1 
ATOM   1714 C CA  . ASP C 3 27  ? 26.935  -7.975  24.873 1.00 73.93  ? 43  ASP C CA  1 
ATOM   1715 C C   . ASP C 3 27  ? 26.495  -6.894  25.874 1.00 73.17  ? 43  ASP C C   1 
ATOM   1716 O O   . ASP C 3 27  ? 26.137  -5.784  25.480 1.00 75.43  ? 43  ASP C O   1 
ATOM   1717 C CB  . ASP C 3 27  ? 26.448  -7.638  23.452 1.00 75.87  ? 43  ASP C CB  1 
ATOM   1718 C CG  . ASP C 3 27  ? 24.943  -7.363  23.368 1.00 78.40  ? 43  ASP C CG  1 
ATOM   1719 O OD1 . ASP C 3 27  ? 24.148  -8.214  23.832 1.00 78.40  ? 43  ASP C OD1 1 
ATOM   1720 O OD2 . ASP C 3 27  ? 24.490  -6.312  22.844 1.00 79.17  ? 43  ASP C OD2 1 
ATOM   1721 N N   . LEU C 3 28  ? 26.524  -7.214  27.164 1.00 70.25  ? 44  LEU C N   1 
ATOM   1722 C CA  . LEU C 3 28  ? 26.248  -6.203  28.161 1.00 67.94  ? 44  LEU C CA  1 
ATOM   1723 C C   . LEU C 3 28  ? 27.546  -5.446  28.468 1.00 67.44  ? 44  LEU C C   1 
ATOM   1724 O O   . LEU C 3 28  ? 28.594  -6.064  28.659 1.00 67.02  ? 44  LEU C O   1 
ATOM   1725 C CB  . LEU C 3 28  ? 25.646  -6.815  29.435 1.00 68.14  ? 44  LEU C CB  1 
ATOM   1726 C CG  . LEU C 3 28  ? 24.244  -7.455  29.429 1.00 66.84  ? 44  LEU C CG  1 
ATOM   1727 C CD1 . LEU C 3 28  ? 23.969  -8.118  30.773 1.00 65.83  ? 44  LEU C CD1 1 
ATOM   1728 C CD2 . LEU C 3 28  ? 23.125  -6.468  29.089 1.00 65.22  ? 44  LEU C CD2 1 
ATOM   1729 N N   . PRO C 3 29  ? 27.476  -4.115  28.487 1.00 67.36  ? 45  PRO C N   1 
ATOM   1730 C CA  . PRO C 3 29  ? 28.627  -3.257  28.785 1.00 67.83  ? 45  PRO C CA  1 
ATOM   1731 C C   . PRO C 3 29  ? 29.357  -3.669  30.049 1.00 68.25  ? 45  PRO C C   1 
ATOM   1732 O O   . PRO C 3 29  ? 28.751  -3.743  31.116 1.00 68.72  ? 45  PRO C O   1 
ATOM   1733 C CB  . PRO C 3 29  ? 27.995  -1.886  28.972 1.00 67.88  ? 45  PRO C CB  1 
ATOM   1734 C CG  . PRO C 3 29  ? 26.817  -1.920  28.057 1.00 69.21  ? 45  PRO C CG  1 
ATOM   1735 C CD  . PRO C 3 29  ? 26.287  -3.327  28.115 1.00 67.95  ? 45  PRO C CD  1 
ATOM   1736 N N   . ARG C 3 30  ? 30.660  -3.907  29.914 1.00 69.87  ? 46  ARG C N   1 
ATOM   1737 C CA  . ARG C 3 30  ? 31.499  -4.440  30.995 1.00 70.45  ? 46  ARG C CA  1 
ATOM   1738 C C   . ARG C 3 30  ? 31.694  -3.536  32.218 1.00 69.28  ? 46  ARG C C   1 
ATOM   1739 O O   . ARG C 3 30  ? 32.247  -3.969  33.229 1.00 70.89  ? 46  ARG C O   1 
ATOM   1740 C CB  . ARG C 3 30  ? 32.860  -4.895  30.438 1.00 71.49  ? 46  ARG C CB  1 
ATOM   1741 C CG  . ARG C 3 30  ? 32.833  -6.266  29.760 1.00 74.14  ? 46  ARG C CG  1 
ATOM   1742 C CD  . ARG C 3 30  ? 32.262  -7.383  30.642 1.00 76.44  ? 46  ARG C CD  1 
ATOM   1743 N NE  . ARG C 3 30  ? 32.154  -8.661  29.935 1.00 79.91  ? 46  ARG C NE  1 
ATOM   1744 C CZ  . ARG C 3 30  ? 31.047  -9.119  29.352 1.00 81.00  ? 46  ARG C CZ  1 
ATOM   1745 N NH1 . ARG C 3 30  ? 29.918  -8.416  29.374 1.00 82.10  ? 46  ARG C NH1 1 
ATOM   1746 N NH2 . ARG C 3 30  ? 31.064  -10.294 28.742 1.00 82.07  ? 46  ARG C NH2 1 
ATOM   1747 N N   . ASN C 3 31  ? 31.232  -2.293  32.132 1.00 68.02  ? 47  ASN C N   1 
ATOM   1748 C CA  . ASN C 3 31  ? 31.366  -1.345  33.236 1.00 67.27  ? 47  ASN C CA  1 
ATOM   1749 C C   . ASN C 3 31  ? 30.017  -0.993  33.902 1.00 67.26  ? 47  ASN C C   1 
ATOM   1750 O O   . ASN C 3 31  ? 29.662  0.180   34.058 1.00 68.00  ? 47  ASN C O   1 
ATOM   1751 C CB  . ASN C 3 31  ? 32.099  -0.082  32.756 1.00 67.41  ? 47  ASN C CB  1 
ATOM   1752 C CG  . ASN C 3 31  ? 31.220  0.830   31.892 1.00 67.14  ? 47  ASN C CG  1 
ATOM   1753 O OD1 . ASN C 3 31  ? 30.487  0.368   31.007 1.00 65.75  ? 47  ASN C OD1 1 
ATOM   1754 N ND2 . ASN C 3 31  ? 31.295  2.135   32.158 1.00 66.12  ? 47  ASN C ND2 1 
ATOM   1755 N N   . ALA C 3 32  ? 29.258  -2.013  34.292 1.00 64.83  ? 48  ALA C N   1 
ATOM   1756 C CA  . ALA C 3 32  ? 27.982  -1.772  34.944 1.00 61.83  ? 48  ALA C CA  1 
ATOM   1757 C C   . ALA C 3 32  ? 28.136  -1.832  36.457 1.00 60.93  ? 48  ALA C C   1 
ATOM   1758 O O   . ALA C 3 32  ? 28.911  -2.635  36.980 1.00 60.06  ? 48  ALA C O   1 
ATOM   1759 C CB  . ALA C 3 32  ? 26.953  -2.778  34.475 1.00 61.22  ? 48  ALA C CB  1 
ATOM   1760 N N   . ILE C 3 33  ? 27.396  -0.966  37.145 1.00 59.53  ? 49  ILE C N   1 
ATOM   1761 C CA  . ILE C 3 33  ? 27.345  -0.948  38.610 1.00 57.75  ? 49  ILE C CA  1 
ATOM   1762 C C   . ILE C 3 33  ? 26.181  -1.818  39.128 1.00 55.72  ? 49  ILE C C   1 
ATOM   1763 O O   . ILE C 3 33  ? 26.216  -2.311  40.256 1.00 54.16  ? 49  ILE C O   1 
ATOM   1764 C CB  . ILE C 3 33  ? 27.179  0.508   39.130 1.00 58.55  ? 49  ILE C CB  1 
ATOM   1765 C CG1 . ILE C 3 33  ? 28.191  1.444   38.461 1.00 58.91  ? 49  ILE C CG1 1 
ATOM   1766 C CG2 . ILE C 3 33  ? 27.349  0.559   40.642 1.00 59.72  ? 49  ILE C CG2 1 
ATOM   1767 C CD1 . ILE C 3 33  ? 27.860  2.937   38.616 1.00 60.72  ? 49  ILE C CD1 1 
ATOM   1768 N N   . GLU C 3 34  ? 25.161  -2.002  38.288 1.00 53.79  ? 50  GLU C N   1 
ATOM   1769 C CA  . GLU C 3 34  ? 23.950  -2.730  38.664 1.00 51.89  ? 50  GLU C CA  1 
ATOM   1770 C C   . GLU C 3 34  ? 23.257  -3.390  37.469 1.00 48.77  ? 50  GLU C C   1 
ATOM   1771 O O   . GLU C 3 34  ? 23.012  -2.756  36.445 1.00 46.79  ? 50  GLU C O   1 
ATOM   1772 C CB  . GLU C 3 34  ? 22.976  -1.767  39.361 1.00 54.98  ? 50  GLU C CB  1 
ATOM   1773 C CG  . GLU C 3 34  ? 21.745  -2.384  40.018 1.00 57.41  ? 50  GLU C CG  1 
ATOM   1774 C CD  . GLU C 3 34  ? 21.122  -1.455  41.059 1.00 61.30  ? 50  GLU C CD  1 
ATOM   1775 O OE1 . GLU C 3 34  ? 21.862  -0.649  41.688 1.00 60.84  ? 50  GLU C OE1 1 
ATOM   1776 O OE2 . GLU C 3 34  ? 19.888  -1.538  41.261 1.00 62.83  ? 50  GLU C OE2 1 
ATOM   1777 N N   . LEU C 3 35  ? 22.947  -4.671  37.618 1.00 45.28  ? 51  LEU C N   1 
ATOM   1778 C CA  . LEU C 3 35  ? 22.150  -5.378  36.638 1.00 42.80  ? 51  LEU C CA  1 
ATOM   1779 C C   . LEU C 3 35  ? 20.835  -5.831  37.270 1.00 41.88  ? 51  LEU C C   1 
ATOM   1780 O O   . LEU C 3 35  ? 20.822  -6.508  38.303 1.00 42.33  ? 51  LEU C O   1 
ATOM   1781 C CB  . LEU C 3 35  ? 22.897  -6.595  36.108 1.00 42.83  ? 51  LEU C CB  1 
ATOM   1782 C CG  . LEU C 3 35  ? 24.349  -6.411  35.671 1.00 43.74  ? 51  LEU C CG  1 
ATOM   1783 C CD1 . LEU C 3 35  ? 25.034  -7.763  35.665 1.00 44.39  ? 51  LEU C CD1 1 
ATOM   1784 C CD2 . LEU C 3 35  ? 24.460  -5.731  34.305 1.00 39.92  ? 51  LEU C CD2 1 
ATOM   1785 N N   . ARG C 3 36  ? 19.728  -5.451  36.654 1.00 39.49  ? 52  ARG C N   1 
ATOM   1786 C CA  . ARG C 3 36  ? 18.433  -5.897  37.122 1.00 38.38  ? 52  ARG C CA  1 
ATOM   1787 C C   . ARG C 3 36  ? 17.800  -6.764  36.058 1.00 35.92  ? 52  ARG C C   1 
ATOM   1788 O O   . ARG C 3 36  ? 17.693  -6.348  34.906 1.00 34.17  ? 52  ARG C O   1 
ATOM   1789 C CB  . ARG C 3 36  ? 17.516  -4.708  37.408 1.00 40.08  ? 52  ARG C CB  1 
ATOM   1790 C CG  . ARG C 3 36  ? 18.055  -3.780  38.455 1.00 45.35  ? 52  ARG C CG  1 
ATOM   1791 C CD  . ARG C 3 36  ? 17.232  -2.522  38.664 1.00 49.31  ? 52  ARG C CD  1 
ATOM   1792 N NE  . ARG C 3 36  ? 18.066  -1.515  39.308 1.00 52.26  ? 52  ARG C NE  1 
ATOM   1793 C CZ  . ARG C 3 36  ? 17.676  -0.294  39.646 1.00 53.86  ? 52  ARG C CZ  1 
ATOM   1794 N NH1 . ARG C 3 36  ? 16.431  0.111   39.418 1.00 54.57  ? 52  ARG C NH1 1 
ATOM   1795 N NH2 . ARG C 3 36  ? 18.544  0.527   40.221 1.00 55.21  ? 52  ARG C NH2 1 
ATOM   1796 N N   . PHE C 3 37  ? 17.401  -7.972  36.439 1.00 32.81  ? 53  PHE C N   1 
ATOM   1797 C CA  . PHE C 3 37  ? 16.608  -8.794  35.556 1.00 31.46  ? 53  PHE C CA  1 
ATOM   1798 C C   . PHE C 3 37  ? 15.246  -9.000  36.225 1.00 33.10  ? 53  PHE C C   1 
ATOM   1799 O O   . PHE C 3 37  ? 15.132  -9.646  37.274 1.00 33.21  ? 53  PHE C O   1 
ATOM   1800 C CB  . PHE C 3 37  ? 17.291  -10.118 35.258 1.00 30.10  ? 53  PHE C CB  1 
ATOM   1801 C CG  . PHE C 3 37  ? 18.716  -9.978  34.791 1.00 29.97  ? 53  PHE C CG  1 
ATOM   1802 C CD1 . PHE C 3 37  ? 19.762  -9.889  35.706 1.00 30.93  ? 53  PHE C CD1 1 
ATOM   1803 C CD2 . PHE C 3 37  ? 19.024  -9.972  33.440 1.00 28.56  ? 53  PHE C CD2 1 
ATOM   1804 C CE1 . PHE C 3 37  ? 21.102  -9.773  35.286 1.00 27.85  ? 53  PHE C CE1 1 
ATOM   1805 C CE2 . PHE C 3 37  ? 20.357  -9.859  33.018 1.00 28.89  ? 53  PHE C CE2 1 
ATOM   1806 C CZ  . PHE C 3 37  ? 21.396  -9.768  33.949 1.00 27.55  ? 53  PHE C CZ  1 
ATOM   1807 N N   . VAL C 3 38  ? 14.221  -8.418  35.607 1.00 33.26  ? 54  VAL C N   1 
ATOM   1808 C CA  . VAL C 3 38  ? 12.851  -8.437  36.108 1.00 32.92  ? 54  VAL C CA  1 
ATOM   1809 C C   . VAL C 3 38  ? 11.900  -8.981  35.046 1.00 33.91  ? 54  VAL C C   1 
ATOM   1810 O O   . VAL C 3 38  ? 12.115  -8.775  33.857 1.00 34.37  ? 54  VAL C O   1 
ATOM   1811 C CB  . VAL C 3 38  ? 12.396  -7.015  36.474 1.00 31.97  ? 54  VAL C CB  1 
ATOM   1812 C CG1 . VAL C 3 38  ? 10.929  -6.993  36.827 1.00 32.44  ? 54  VAL C CG1 1 
ATOM   1813 C CG2 . VAL C 3 38  ? 13.226  -6.468  37.611 1.00 32.62  ? 54  VAL C CG2 1 
ATOM   1814 N N   . LEU C 3 39  ? 10.851  -9.675  35.478 1.00 35.94  ? 55  LEU C N   1 
ATOM   1815 C CA  . LEU C 3 39  ? 9.815   -10.178 34.575 1.00 37.17  ? 55  LEU C CA  1 
ATOM   1816 C C   . LEU C 3 39  ? 10.366  -10.836 33.325 1.00 37.81  ? 55  LEU C C   1 
ATOM   1817 O O   . LEU C 3 39  ? 9.786   -10.758 32.252 1.00 41.04  ? 55  LEU C O   1 
ATOM   1818 C CB  . LEU C 3 39  ? 8.846   -9.058  34.193 1.00 37.15  ? 55  LEU C CB  1 
ATOM   1819 C CG  . LEU C 3 39  ? 7.579   -9.112  35.049 1.00 40.21  ? 55  LEU C CG  1 
ATOM   1820 C CD1 . LEU C 3 39  ? 6.478   -8.233  34.458 1.00 37.66  ? 55  LEU C CD1 1 
ATOM   1821 C CD2 . LEU C 3 39  ? 7.082   -10.560 35.205 1.00 41.26  ? 55  LEU C CD2 1 
ATOM   1822 N N   . THR C 3 40  ? 11.490  -11.506 33.480 1.00 40.24  ? 56  THR C N   1 
ATOM   1823 C CA  . THR C 3 40  ? 12.205  -12.057 32.351 1.00 40.30  ? 56  THR C CA  1 
ATOM   1824 C C   . THR C 3 40  ? 11.707  -13.436 31.976 1.00 40.94  ? 56  THR C C   1 
ATOM   1825 O O   . THR C 3 40  ? 10.980  -14.082 32.750 1.00 41.39  ? 56  THR C O   1 
ATOM   1826 C CB  . THR C 3 40  ? 13.705  -12.089 32.694 1.00 41.03  ? 56  THR C CB  1 
ATOM   1827 O OG1 . THR C 3 40  ? 14.332  -10.885 32.237 1.00 40.44  ? 56  THR C OG1 1 
ATOM   1828 C CG2 . THR C 3 40  ? 14.390  -13.149 31.952 1.00 39.85  ? 56  THR C CG2 1 
ATOM   1829 N N   . LYS C 3 41  ? 12.109  -13.872 30.780 1.00 41.19  ? 57  LYS C N   1 
ATOM   1830 C CA  . LYS C 3 41  ? 11.816  -15.204 30.280 1.00 39.87  ? 57  LYS C CA  1 
ATOM   1831 C C   . LYS C 3 41  ? 13.048  -16.119 30.396 1.00 38.91  ? 57  LYS C C   1 
ATOM   1832 O O   . LYS C 3 41  ? 13.078  -17.189 29.817 1.00 40.66  ? 57  LYS C O   1 
ATOM   1833 C CB  . LYS C 3 41  ? 11.302  -15.110 28.842 1.00 40.20  ? 57  LYS C CB  1 
ATOM   1834 C CG  . LYS C 3 41  ? 9.936   -15.754 28.616 1.00 43.15  ? 57  LYS C CG  1 
ATOM   1835 C CD  . LYS C 3 41  ? 8.884   -15.244 29.615 1.00 46.95  ? 57  LYS C CD  1 
ATOM   1836 C CE  . LYS C 3 41  ? 7.697   -16.216 29.771 1.00 49.02  ? 57  LYS C CE  1 
ATOM   1837 N NZ  . LYS C 3 41  ? 6.855   -15.892 30.973 1.00 49.73  ? 57  LYS C NZ  1 
ATOM   1838 N N   . LEU C 3 42  ? 14.052  -15.689 31.158 1.00 39.45  ? 58  LEU C N   1 
ATOM   1839 C CA  . LEU C 3 42  ? 15.259  -16.475 31.435 1.00 38.23  ? 58  LEU C CA  1 
ATOM   1840 C C   . LEU C 3 42  ? 14.929  -17.811 32.059 1.00 39.24  ? 58  LEU C C   1 
ATOM   1841 O O   . LEU C 3 42  ? 14.169  -17.864 33.028 1.00 39.45  ? 58  LEU C O   1 
ATOM   1842 C CB  . LEU C 3 42  ? 16.148  -15.737 32.425 1.00 38.41  ? 58  LEU C CB  1 
ATOM   1843 C CG  . LEU C 3 42  ? 17.041  -14.600 31.938 1.00 40.40  ? 58  LEU C CG  1 
ATOM   1844 C CD1 . LEU C 3 42  ? 17.461  -13.704 33.116 1.00 40.83  ? 58  LEU C CD1 1 
ATOM   1845 C CD2 . LEU C 3 42  ? 18.254  -15.151 31.232 1.00 39.39  ? 58  LEU C CD2 1 
ATOM   1846 N N   . ARG C 3 43  ? 15.509  -18.883 31.516 1.00 40.99  ? 59  ARG C N   1 
ATOM   1847 C CA  . ARG C 3 43  ? 15.305  -20.234 32.053 1.00 40.16  ? 59  ARG C CA  1 
ATOM   1848 C C   . ARG C 3 43  ? 16.519  -20.608 32.851 1.00 39.03  ? 59  ARG C C   1 
ATOM   1849 O O   . ARG C 3 43  ? 16.410  -21.327 33.838 1.00 39.94  ? 59  ARG C O   1 
ATOM   1850 C CB  . ARG C 3 43  ? 15.132  -21.279 30.950 1.00 42.29  ? 59  ARG C CB  1 
ATOM   1851 C CG  . ARG C 3 43  ? 13.971  -21.067 30.004 1.00 46.96  ? 59  ARG C CG  1 
ATOM   1852 C CD  . ARG C 3 43  ? 12.791  -21.966 30.273 1.00 52.32  ? 59  ARG C CD  1 
ATOM   1853 N NE  . ARG C 3 43  ? 11.629  -21.494 29.519 1.00 61.50  ? 59  ARG C NE  1 
ATOM   1854 C CZ  . ARG C 3 43  ? 10.355  -21.766 29.822 1.00 63.36  ? 59  ARG C CZ  1 
ATOM   1855 N NH1 . ARG C 3 43  ? 10.058  -22.529 30.882 1.00 63.50  ? 59  ARG C NH1 1 
ATOM   1856 N NH2 . ARG C 3 43  ? 9.375   -21.269 29.061 1.00 60.63  ? 59  ARG C NH2 1 
ATOM   1857 N N   . VAL C 3 44  ? 17.679  -20.131 32.409 1.00 38.34  ? 60  VAL C N   1 
ATOM   1858 C CA  . VAL C 3 44  ? 18.946  -20.440 33.066 1.00 40.22  ? 60  VAL C CA  1 
ATOM   1859 C C   . VAL C 3 44  ? 19.780  -19.187 33.164 1.00 40.97  ? 60  VAL C C   1 
ATOM   1860 O O   . VAL C 3 44  ? 19.688  -18.312 32.314 1.00 43.54  ? 60  VAL C O   1 
ATOM   1861 C CB  . VAL C 3 44  ? 19.784  -21.515 32.277 1.00 39.54  ? 60  VAL C CB  1 
ATOM   1862 C CG1 . VAL C 3 44  ? 21.153  -21.735 32.905 1.00 37.93  ? 60  VAL C CG1 1 
ATOM   1863 C CG2 . VAL C 3 44  ? 19.074  -22.811 32.248 1.00 38.47  ? 60  VAL C CG2 1 
ATOM   1864 N N   . ILE C 3 45  ? 20.599  -19.107 34.206 1.00 42.43  ? 61  ILE C N   1 
ATOM   1865 C CA  . ILE C 3 45  ? 21.658  -18.114 34.263 1.00 43.78  ? 61  ILE C CA  1 
ATOM   1866 C C   . ILE C 3 45  ? 22.963  -18.910 34.083 1.00 45.40  ? 61  ILE C C   1 
ATOM   1867 O O   . ILE C 3 45  ? 23.438  -19.579 35.011 1.00 44.44  ? 61  ILE C O   1 
ATOM   1868 C CB  . ILE C 3 45  ? 21.595  -17.293 35.591 1.00 43.81  ? 61  ILE C CB  1 
ATOM   1869 C CG1 . ILE C 3 45  ? 20.315  -16.446 35.632 1.00 43.55  ? 61  ILE C CG1 1 
ATOM   1870 C CG2 . ILE C 3 45  ? 22.801  -16.389 35.729 1.00 43.68  ? 61  ILE C CG2 1 
ATOM   1871 C CD1 . ILE C 3 45  ? 19.818  -16.136 37.023 1.00 40.98  ? 61  ILE C CD1 1 
ATOM   1872 N N   . GLN C 3 46  ? 23.504  -18.847 32.863 1.00 47.61  ? 62  GLN C N   1 
ATOM   1873 C CA  . GLN C 3 46  ? 24.678  -19.613 32.409 1.00 48.05  ? 62  GLN C CA  1 
ATOM   1874 C C   . GLN C 3 46  ? 25.947  -19.419 33.236 1.00 47.73  ? 62  GLN C C   1 
ATOM   1875 O O   . GLN C 3 46  ? 26.019  -18.516 34.058 1.00 47.97  ? 62  GLN C O   1 
ATOM   1876 C CB  . GLN C 3 46  ? 24.982  -19.271 30.942 1.00 48.82  ? 62  GLN C CB  1 
ATOM   1877 C CG  . GLN C 3 46  ? 25.468  -17.828 30.692 1.00 51.09  ? 62  GLN C CG  1 
ATOM   1878 C CD  . GLN C 3 46  ? 24.371  -16.871 30.212 1.00 52.54  ? 62  GLN C CD  1 
ATOM   1879 O OE1 . GLN C 3 46  ? 23.303  -16.767 30.818 1.00 52.50  ? 62  GLN C OE1 1 
ATOM   1880 N NE2 . GLN C 3 46  ? 24.600  -16.136 29.131 1.00 52.72  ? 62  GLN C NE2 1 
ATOM   1881 N N   . LYS C 3 47  ? 26.948  -20.272 32.996 1.00 48.81  ? 63  LYS C N   1 
ATOM   1882 C CA  . LYS C 3 47  ? 28.250  -20.190 33.659 1.00 48.78  ? 63  LYS C CA  1 
ATOM   1883 C C   . LYS C 3 47  ? 29.024  -18.970 33.197 1.00 48.90  ? 63  LYS C C   1 
ATOM   1884 O O   . LYS C 3 47  ? 29.071  -18.676 32.010 1.00 50.06  ? 63  LYS C O   1 
ATOM   1885 C CB  . LYS C 3 47  ? 29.075  -21.453 33.387 1.00 49.36  ? 63  LYS C CB  1 
ATOM   1886 C CG  . LYS C 3 47  ? 30.570  -21.261 33.612 1.00 51.17  ? 63  LYS C CG  1 
ATOM   1887 C CD  . LYS C 3 47  ? 31.387  -22.501 33.284 1.00 52.73  ? 63  LYS C CD  1 
ATOM   1888 C CE  . LYS C 3 47  ? 32.831  -22.343 33.742 1.00 50.96  ? 63  LYS C CE  1 
ATOM   1889 N NZ  . LYS C 3 47  ? 33.401  -23.648 34.188 1.00 51.61  ? 63  LYS C NZ  1 
ATOM   1890 N N   . GLY C 3 48  ? 29.641  -18.267 34.142 1.00 50.43  ? 64  GLY C N   1 
ATOM   1891 C CA  . GLY C 3 48  ? 30.375  -17.044 33.843 1.00 51.73  ? 64  GLY C CA  1 
ATOM   1892 C C   . GLY C 3 48  ? 29.471  -15.964 33.271 1.00 53.11  ? 64  GLY C C   1 
ATOM   1893 O O   . GLY C 3 48  ? 29.902  -15.142 32.462 1.00 53.94  ? 64  GLY C O   1 
ATOM   1894 N N   . ALA C 3 49  ? 28.210  -15.970 33.690 1.00 53.60  ? 65  ALA C N   1 
ATOM   1895 C CA  . ALA C 3 49  ? 27.237  -15.014 33.198 1.00 53.95  ? 65  ALA C CA  1 
ATOM   1896 C C   . ALA C 3 49  ? 27.733  -13.628 33.523 1.00 55.18  ? 65  ALA C C   1 
ATOM   1897 O O   . ALA C 3 49  ? 27.794  -12.769 32.655 1.00 56.72  ? 65  ALA C O   1 
ATOM   1898 C CB  . ALA C 3 49  ? 25.885  -15.254 33.839 1.00 52.99  ? 65  ALA C CB  1 
ATOM   1899 N N   . PHE C 3 50  ? 28.122  -13.425 34.775 1.00 56.50  ? 66  PHE C N   1 
ATOM   1900 C CA  . PHE C 3 50  ? 28.610  -12.130 35.216 1.00 58.08  ? 66  PHE C CA  1 
ATOM   1901 C C   . PHE C 3 50  ? 30.132  -12.121 35.240 1.00 60.67  ? 66  PHE C C   1 
ATOM   1902 O O   . PHE C 3 50  ? 30.763  -11.527 36.118 1.00 60.04  ? 66  PHE C O   1 
ATOM   1903 C CB  . PHE C 3 50  ? 27.987  -11.783 36.571 1.00 56.90  ? 66  PHE C CB  1 
ATOM   1904 C CG  . PHE C 3 50  ? 26.491  -11.975 36.602 1.00 57.54  ? 66  PHE C CG  1 
ATOM   1905 C CD1 . PHE C 3 50  ? 25.660  -11.216 35.775 1.00 57.75  ? 66  PHE C CD1 1 
ATOM   1906 C CD2 . PHE C 3 50  ? 25.911  -12.937 37.421 1.00 57.00  ? 66  PHE C CD2 1 
ATOM   1907 C CE1 . PHE C 3 50  ? 24.269  -11.403 35.779 1.00 57.99  ? 66  PHE C CE1 1 
ATOM   1908 C CE2 . PHE C 3 50  ? 24.519  -13.127 37.434 1.00 57.69  ? 66  PHE C CE2 1 
ATOM   1909 C CZ  . PHE C 3 50  ? 23.701  -12.360 36.612 1.00 56.43  ? 66  PHE C CZ  1 
ATOM   1910 N N   . SER C 3 51  ? 30.710  -12.793 34.245 1.00 63.68  ? 67  SER C N   1 
ATOM   1911 C CA  . SER C 3 51  ? 32.151  -12.838 34.076 1.00 66.67  ? 67  SER C CA  1 
ATOM   1912 C C   . SER C 3 51  ? 32.633  -11.586 33.347 1.00 67.75  ? 67  SER C C   1 
ATOM   1913 O O   . SER C 3 51  ? 32.168  -11.264 32.242 1.00 66.67  ? 67  SER C O   1 
ATOM   1914 C CB  . SER C 3 51  ? 32.568  -14.096 33.303 1.00 66.64  ? 67  SER C CB  1 
ATOM   1915 O OG  . SER C 3 51  ? 33.734  -14.685 33.876 1.00 70.18  ? 67  SER C OG  1 
ATOM   1916 N N   . GLY C 3 52  ? 33.548  -10.870 33.994 1.00 68.53  ? 68  GLY C N   1 
ATOM   1917 C CA  . GLY C 3 52  ? 34.172  -9.705  33.389 1.00 70.81  ? 68  GLY C CA  1 
ATOM   1918 C C   . GLY C 3 52  ? 33.662  -8.362  33.876 1.00 71.45  ? 68  GLY C C   1 
ATOM   1919 O O   . GLY C 3 52  ? 33.963  -7.330  33.264 1.00 73.70  ? 68  GLY C O   1 
ATOM   1920 N N   . PHE C 3 53  ? 32.902  -8.365  34.972 1.00 69.28  ? 69  PHE C N   1 
ATOM   1921 C CA  . PHE C 3 53  ? 32.367  -7.127  35.547 1.00 67.07  ? 69  PHE C CA  1 
ATOM   1922 C C   . PHE C 3 53  ? 33.090  -6.784  36.846 1.00 68.07  ? 69  PHE C C   1 
ATOM   1923 O O   . PHE C 3 53  ? 32.659  -7.184  37.936 1.00 68.80  ? 69  PHE C O   1 
ATOM   1924 C CB  . PHE C 3 53  ? 30.862  -7.253  35.807 1.00 65.59  ? 69  PHE C CB  1 
ATOM   1925 C CG  . PHE C 3 53  ? 30.038  -7.450  34.564 1.00 62.71  ? 69  PHE C CG  1 
ATOM   1926 C CD1 . PHE C 3 53  ? 29.550  -6.364  33.861 1.00 62.42  ? 69  PHE C CD1 1 
ATOM   1927 C CD2 . PHE C 3 53  ? 29.732  -8.721  34.110 1.00 61.33  ? 69  PHE C CD2 1 
ATOM   1928 C CE1 . PHE C 3 53  ? 28.789  -6.547  32.716 1.00 61.47  ? 69  PHE C CE1 1 
ATOM   1929 C CE2 . PHE C 3 53  ? 28.972  -8.903  32.966 1.00 59.84  ? 69  PHE C CE2 1 
ATOM   1930 C CZ  . PHE C 3 53  ? 28.499  -7.817  32.274 1.00 59.18  ? 69  PHE C CZ  1 
ATOM   1931 N N   . GLY C 3 54  ? 34.195  -6.048  36.721 1.00 68.43  ? 70  GLY C N   1 
ATOM   1932 C CA  . GLY C 3 54  ? 34.998  -5.628  37.870 1.00 66.53  ? 70  GLY C CA  1 
ATOM   1933 C C   . GLY C 3 54  ? 34.452  -4.379  38.534 1.00 65.79  ? 70  GLY C C   1 
ATOM   1934 O O   . GLY C 3 54  ? 35.084  -3.813  39.429 1.00 65.78  ? 70  GLY C O   1 
ATOM   1935 N N   . ASP C 3 55  ? 33.272  -3.955  38.083 1.00 65.65  ? 71  ASP C N   1 
ATOM   1936 C CA  . ASP C 3 55  ? 32.598  -2.772  38.615 1.00 64.94  ? 71  ASP C CA  1 
ATOM   1937 C C   . ASP C 3 55  ? 31.199  -3.072  39.162 1.00 62.86  ? 71  ASP C C   1 
ATOM   1938 O O   . ASP C 3 55  ? 30.518  -2.166  39.634 1.00 64.03  ? 71  ASP C O   1 
ATOM   1939 C CB  . ASP C 3 55  ? 32.493  -1.700  37.521 1.00 67.13  ? 71  ASP C CB  1 
ATOM   1940 C CG  . ASP C 3 55  ? 33.836  -1.066  37.183 1.00 71.63  ? 71  ASP C CG  1 
ATOM   1941 O OD1 . ASP C 3 55  ? 34.892  -1.638  37.557 1.00 74.62  ? 71  ASP C OD1 1 
ATOM   1942 O OD2 . ASP C 3 55  ? 33.914  0.006   36.535 1.00 73.47  ? 71  ASP C OD2 1 
ATOM   1943 N N   . LEU C 3 56  ? 30.772  -4.332  39.099 1.00 59.99  ? 72  LEU C N   1 
ATOM   1944 C CA  . LEU C 3 56  ? 29.405  -4.706  39.472 1.00 56.81  ? 72  LEU C CA  1 
ATOM   1945 C C   . LEU C 3 56  ? 29.210  -4.672  40.975 1.00 57.05  ? 72  LEU C C   1 
ATOM   1946 O O   . LEU C 3 56  ? 30.011  -5.228  41.727 1.00 59.85  ? 72  LEU C O   1 
ATOM   1947 C CB  . LEU C 3 56  ? 29.061  -6.086  38.915 1.00 54.71  ? 72  LEU C CB  1 
ATOM   1948 C CG  . LEU C 3 56  ? 27.591  -6.496  38.803 1.00 53.51  ? 72  LEU C CG  1 
ATOM   1949 C CD1 . LEU C 3 56  ? 26.690  -5.340  38.438 1.00 52.16  ? 72  LEU C CD1 1 
ATOM   1950 C CD2 . LEU C 3 56  ? 27.480  -7.583  37.767 1.00 53.30  ? 72  LEU C CD2 1 
ATOM   1951 N N   . GLU C 3 57  ? 28.137  -4.023  41.413 1.00 54.88  ? 73  GLU C N   1 
ATOM   1952 C CA  . GLU C 3 57  ? 27.911  -3.830  42.838 1.00 53.70  ? 73  GLU C CA  1 
ATOM   1953 C C   . GLU C 3 57  ? 26.669  -4.555  43.349 1.00 51.33  ? 73  GLU C C   1 
ATOM   1954 O O   . GLU C 3 57  ? 26.679  -5.082  44.463 1.00 51.07  ? 73  GLU C O   1 
ATOM   1955 C CB  . GLU C 3 57  ? 27.850  -2.331  43.160 1.00 56.43  ? 73  GLU C CB  1 
ATOM   1956 C CG  . GLU C 3 57  ? 29.199  -1.614  43.087 1.00 60.50  ? 73  GLU C CG  1 
ATOM   1957 C CD  . GLU C 3 57  ? 29.127  -0.129  43.451 1.00 64.98  ? 73  GLU C CD  1 
ATOM   1958 O OE1 . GLU C 3 57  ? 28.322  0.255   44.338 1.00 67.29  ? 73  GLU C OE1 1 
ATOM   1959 O OE2 . GLU C 3 57  ? 29.893  0.664   42.852 1.00 66.87  ? 73  GLU C OE2 1 
ATOM   1960 N N   . LYS C 3 58  ? 25.613  -4.576  42.534 1.00 47.44  ? 74  LYS C N   1 
ATOM   1961 C CA  . LYS C 3 58  ? 24.377  -5.287  42.852 1.00 44.64  ? 74  LYS C CA  1 
ATOM   1962 C C   . LYS C 3 58  ? 23.856  -6.060  41.645 1.00 44.26  ? 74  LYS C C   1 
ATOM   1963 O O   . LYS C 3 58  ? 23.944  -5.582  40.515 1.00 44.85  ? 74  LYS C O   1 
ATOM   1964 C CB  . LYS C 3 58  ? 23.271  -4.327  43.278 1.00 44.01  ? 74  LYS C CB  1 
ATOM   1965 C CG  . LYS C 3 58  ? 23.640  -3.316  44.331 1.00 48.50  ? 74  LYS C CG  1 
ATOM   1966 C CD  . LYS C 3 58  ? 22.415  -2.496  44.759 1.00 50.72  ? 74  LYS C CD  1 
ATOM   1967 C CE  . LYS C 3 58  ? 22.804  -1.371  45.709 1.00 52.97  ? 74  LYS C CE  1 
ATOM   1968 N NZ  . LYS C 3 58  ? 21.692  -1.052  46.645 1.00 56.13  ? 74  LYS C NZ  1 
ATOM   1969 N N   . ILE C 3 59  ? 23.299  -7.245  41.907 1.00 42.22  ? 75  ILE C N   1 
ATOM   1970 C CA  . ILE C 3 59  ? 22.577  -8.032  40.912 1.00 38.72  ? 75  ILE C CA  1 
ATOM   1971 C C   . ILE C 3 59  ? 21.194  -8.362  41.473 1.00 38.78  ? 75  ILE C C   1 
ATOM   1972 O O   . ILE C 3 59  ? 21.079  -9.101  42.442 1.00 40.04  ? 75  ILE C O   1 
ATOM   1973 C CB  . ILE C 3 59  ? 23.341  -9.332  40.574 1.00 39.56  ? 75  ILE C CB  1 
ATOM   1974 C CG1 . ILE C 3 59  ? 24.704  -8.995  39.952 1.00 41.48  ? 75  ILE C CG1 1 
ATOM   1975 C CG2 . ILE C 3 59  ? 22.536  -10.226 39.625 1.00 36.89  ? 75  ILE C CG2 1 
ATOM   1976 C CD1 . ILE C 3 59  ? 25.637  -10.195 39.813 1.00 40.65  ? 75  ILE C CD1 1 
ATOM   1977 N N   . GLU C 3 60  ? 20.154  -7.788  40.876 1.00 38.79  ? 76  GLU C N   1 
ATOM   1978 C CA  . GLU C 3 60  ? 18.770  -8.070  41.256 1.00 38.40  ? 76  GLU C CA  1 
ATOM   1979 C C   . GLU C 3 60  ? 18.203  -9.020  40.207 1.00 36.56  ? 76  GLU C C   1 
ATOM   1980 O O   . GLU C 3 60  ? 18.179  -8.692  39.018 1.00 36.75  ? 76  GLU C O   1 
ATOM   1981 C CB  . GLU C 3 60  ? 17.941  -6.761  41.317 1.00 41.13  ? 76  GLU C CB  1 
ATOM   1982 C CG  . GLU C 3 60  ? 16.466  -6.895  41.746 1.00 49.34  ? 76  GLU C CG  1 
ATOM   1983 C CD  . GLU C 3 60  ? 15.580  -5.651  41.436 1.00 54.93  ? 76  GLU C CD  1 
ATOM   1984 O OE1 . GLU C 3 60  ? 16.014  -4.753  40.672 1.00 57.33  ? 76  GLU C OE1 1 
ATOM   1985 O OE2 . GLU C 3 60  ? 14.424  -5.567  41.950 1.00 52.74  ? 76  GLU C OE2 1 
ATOM   1986 N N   . ILE C 3 61  ? 17.795  -10.208 40.645 1.00 34.05  ? 77  ILE C N   1 
ATOM   1987 C CA  . ILE C 3 61  ? 17.037  -11.140 39.803 1.00 32.85  ? 77  ILE C CA  1 
ATOM   1988 C C   . ILE C 3 61  ? 15.640  -11.324 40.419 1.00 34.43  ? 77  ILE C C   1 
ATOM   1989 O O   . ILE C 3 61  ? 15.453  -12.106 41.354 1.00 35.36  ? 77  ILE C O   1 
ATOM   1990 C CB  . ILE C 3 61  ? 17.765  -12.469 39.675 1.00 31.48  ? 77  ILE C CB  1 
ATOM   1991 C CG1 . ILE C 3 61  ? 19.137  -12.237 39.047 1.00 29.71  ? 77  ILE C CG1 1 
ATOM   1992 C CG2 . ILE C 3 61  ? 16.957  -13.437 38.824 1.00 30.48  ? 77  ILE C CG2 1 
ATOM   1993 C CD1 . ILE C 3 61  ? 20.187  -13.180 39.547 1.00 28.79  ? 77  ILE C CD1 1 
ATOM   1994 N N   . SER C 3 62  ? 14.665  -10.598 39.881 1.00 35.46  ? 78  SER C N   1 
ATOM   1995 C CA  . SER C 3 62  ? 13.356  -10.492 40.520 1.00 37.84  ? 78  SER C CA  1 
ATOM   1996 C C   . SER C 3 62  ? 12.146  -10.769 39.616 1.00 37.11  ? 78  SER C C   1 
ATOM   1997 O O   . SER C 3 62  ? 12.067  -10.305 38.485 1.00 37.94  ? 78  SER C O   1 
ATOM   1998 C CB  . SER C 3 62  ? 13.235  -9.106  41.167 1.00 38.92  ? 78  SER C CB  1 
ATOM   1999 O OG  . SER C 3 62  ? 12.012  -8.966  41.885 1.00 47.88  ? 78  SER C OG  1 
ATOM   2000 N N   . GLN C 3 63  ? 11.206  -11.544 40.134 1.00 37.60  ? 79  GLN C N   1 
ATOM   2001 C CA  . GLN C 3 63  ? 9.969   -11.876 39.430 1.00 38.38  ? 79  GLN C CA  1 
ATOM   2002 C C   . GLN C 3 63  ? 10.172  -12.593 38.083 1.00 37.96  ? 79  GLN C C   1 
ATOM   2003 O O   . GLN C 3 63  ? 9.561   -12.253 37.079 1.00 38.04  ? 79  GLN C O   1 
ATOM   2004 C CB  . GLN C 3 63  ? 9.071   -10.641 39.305 1.00 38.76  ? 79  GLN C CB  1 
ATOM   2005 C CG  . GLN C 3 63  ? 9.031   -9.799  40.581 1.00 44.01  ? 79  GLN C CG  1 
ATOM   2006 C CD  . GLN C 3 63  ? 7.834   -8.861  40.664 1.00 47.04  ? 79  GLN C CD  1 
ATOM   2007 O OE1 . GLN C 3 63  ? 6.686   -9.281  40.493 1.00 50.86  ? 79  GLN C OE1 1 
ATOM   2008 N NE2 . GLN C 3 63  ? 8.101   -7.589  40.946 1.00 49.28  ? 79  GLN C NE2 1 
ATOM   2009 N N   . ASN C 3 64  ? 11.026  -13.612 38.095 1.00 40.30  ? 80  ASN C N   1 
ATOM   2010 C CA  . ASN C 3 64  ? 11.327  -14.414 36.905 1.00 40.36  ? 80  ASN C CA  1 
ATOM   2011 C C   . ASN C 3 64  ? 10.610  -15.758 36.893 1.00 40.36  ? 80  ASN C C   1 
ATOM   2012 O O   . ASN C 3 64  ? 11.082  -16.721 37.468 1.00 42.39  ? 80  ASN C O   1 
ATOM   2013 C CB  . ASN C 3 64  ? 12.833  -14.581 36.773 1.00 38.50  ? 80  ASN C CB  1 
ATOM   2014 C CG  . ASN C 3 64  ? 13.514  -13.282 36.353 1.00 41.15  ? 80  ASN C CG  1 
ATOM   2015 O OD1 . ASN C 3 64  ? 13.528  -12.938 35.173 1.00 38.95  ? 80  ASN C OD1 1 
ATOM   2016 N ND2 . ASN C 3 64  ? 14.069  -12.552 37.321 1.00 41.77  ? 80  ASN C ND2 1 
ATOM   2017 N N   . ASP C 3 65  ? 9.471   -15.794 36.208 1.00 43.28  ? 81  ASP C N   1 
ATOM   2018 C CA  . ASP C 3 65  ? 8.547   -16.934 36.173 1.00 43.91  ? 81  ASP C CA  1 
ATOM   2019 C C   . ASP C 3 65  ? 9.093   -18.284 35.827 1.00 42.15  ? 81  ASP C C   1 
ATOM   2020 O O   . ASP C 3 65  ? 8.601   -19.271 36.333 1.00 45.12  ? 81  ASP C O   1 
ATOM   2021 C CB  . ASP C 3 65  ? 7.445   -16.683 35.147 1.00 50.14  ? 81  ASP C CB  1 
ATOM   2022 C CG  . ASP C 3 65  ? 6.172   -16.174 35.765 1.00 54.30  ? 81  ASP C CG  1 
ATOM   2023 O OD1 . ASP C 3 65  ? 6.205   -15.788 36.955 1.00 60.63  ? 81  ASP C OD1 1 
ATOM   2024 O OD2 . ASP C 3 65  ? 5.102   -16.120 35.110 1.00 56.07  ? 81  ASP C OD2 1 
ATOM   2025 N N   . VAL C 3 66  ? 10.053  -18.341 34.920 1.00 40.73  ? 82  VAL C N   1 
ATOM   2026 C CA  . VAL C 3 66  ? 10.496  -19.626 34.399 1.00 40.71  ? 82  VAL C CA  1 
ATOM   2027 C C   . VAL C 3 66  ? 11.985  -19.857 34.603 1.00 41.79  ? 82  VAL C C   1 
ATOM   2028 O O   . VAL C 3 66  ? 12.588  -20.719 33.952 1.00 42.01  ? 82  VAL C O   1 
ATOM   2029 C CB  . VAL C 3 66  ? 10.102  -19.816 32.895 1.00 40.29  ? 82  VAL C CB  1 
ATOM   2030 C CG1 . VAL C 3 66  ? 8.608   -19.804 32.731 1.00 40.38  ? 82  VAL C CG1 1 
ATOM   2031 C CG2 . VAL C 3 66  ? 10.747  -18.762 31.992 1.00 41.82  ? 82  VAL C CG2 1 
ATOM   2032 N N   . LEU C 3 67  ? 12.576  -19.081 35.509 1.00 42.69  ? 83  LEU C N   1 
ATOM   2033 C CA  . LEU C 3 67  ? 13.974  -19.277 35.890 1.00 43.80  ? 83  LEU C CA  1 
ATOM   2034 C C   . LEU C 3 67  ? 14.064  -20.586 36.662 1.00 45.10  ? 83  LEU C C   1 
ATOM   2035 O O   . LEU C 3 67  ? 13.397  -20.749 37.680 1.00 46.51  ? 83  LEU C O   1 
ATOM   2036 C CB  . LEU C 3 67  ? 14.465  -18.114 36.741 1.00 43.26  ? 83  LEU C CB  1 
ATOM   2037 C CG  . LEU C 3 67  ? 15.890  -18.222 37.281 1.00 44.37  ? 83  LEU C CG  1 
ATOM   2038 C CD1 . LEU C 3 67  ? 16.915  -18.316 36.150 1.00 45.32  ? 83  LEU C CD1 1 
ATOM   2039 C CD2 . LEU C 3 67  ? 16.186  -17.035 38.185 1.00 45.51  ? 83  LEU C CD2 1 
ATOM   2040 N N   . GLU C 3 68  ? 14.884  -21.515 36.176 1.00 45.46  ? 84  GLU C N   1 
ATOM   2041 C CA  . GLU C 3 68  ? 14.893  -22.870 36.724 1.00 46.54  ? 84  GLU C CA  1 
ATOM   2042 C C   . GLU C 3 68  ? 16.237  -23.342 37.249 1.00 46.34  ? 84  GLU C C   1 
ATOM   2043 O O   . GLU C 3 68  ? 16.295  -24.184 38.146 1.00 44.40  ? 84  GLU C O   1 
ATOM   2044 C CB  . GLU C 3 68  ? 14.392  -23.858 35.664 1.00 48.60  ? 84  GLU C CB  1 
ATOM   2045 C CG  . GLU C 3 68  ? 12.877  -23.819 35.457 1.00 54.13  ? 84  GLU C CG  1 
ATOM   2046 C CD  . GLU C 3 68  ? 12.396  -24.615 34.244 1.00 57.27  ? 84  GLU C CD  1 
ATOM   2047 O OE1 . GLU C 3 68  ? 13.228  -25.223 33.519 1.00 58.68  ? 84  GLU C OE1 1 
ATOM   2048 O OE2 . GLU C 3 68  ? 11.166  -24.628 34.017 1.00 59.80  ? 84  GLU C OE2 1 
ATOM   2049 N N   . VAL C 3 69  ? 17.310  -22.778 36.701 1.00 46.38  ? 85  VAL C N   1 
ATOM   2050 C CA  . VAL C 3 69  ? 18.657  -23.264 36.958 1.00 45.34  ? 85  VAL C CA  1 
ATOM   2051 C C   . VAL C 3 69  ? 19.673  -22.137 37.079 1.00 45.79  ? 85  VAL C C   1 
ATOM   2052 O O   . VAL C 3 69  ? 19.662  -21.186 36.295 1.00 46.83  ? 85  VAL C O   1 
ATOM   2053 C CB  . VAL C 3 69  ? 19.117  -24.197 35.798 1.00 45.41  ? 85  VAL C CB  1 
ATOM   2054 C CG1 . VAL C 3 69  ? 20.511  -24.772 36.060 1.00 44.05  ? 85  VAL C CG1 1 
ATOM   2055 C CG2 . VAL C 3 69  ? 18.087  -25.299 35.539 1.00 43.94  ? 85  VAL C CG2 1 
ATOM   2056 N N   . ILE C 3 70  ? 20.550  -22.254 38.071 1.00 45.93  ? 86  ILE C N   1 
ATOM   2057 C CA  . ILE C 3 70  ? 21.704  -21.373 38.172 1.00 46.23  ? 86  ILE C CA  1 
ATOM   2058 C C   . ILE C 3 70  ? 22.955  -22.243 38.074 1.00 47.96  ? 86  ILE C C   1 
ATOM   2059 O O   . ILE C 3 70  ? 23.240  -23.075 38.942 1.00 47.78  ? 86  ILE C O   1 
ATOM   2060 C CB  . ILE C 3 70  ? 21.658  -20.501 39.456 1.00 45.66  ? 86  ILE C CB  1 
ATOM   2061 C CG1 . ILE C 3 70  ? 20.554  -19.440 39.309 1.00 45.52  ? 86  ILE C CG1 1 
ATOM   2062 C CG2 . ILE C 3 70  ? 23.012  -19.843 39.733 1.00 42.33  ? 86  ILE C CG2 1 
ATOM   2063 C CD1 . ILE C 3 70  ? 20.294  -18.598 40.556 1.00 45.94  ? 86  ILE C CD1 1 
ATOM   2064 N N   . GLU C 3 71  ? 23.679  -22.052 36.978 1.00 49.90  ? 87  GLU C N   1 
ATOM   2065 C CA  . GLU C 3 71  ? 24.870  -22.826 36.678 1.00 51.81  ? 87  GLU C CA  1 
ATOM   2066 C C   . GLU C 3 71  ? 26.002  -22.608 37.679 1.00 52.64  ? 87  GLU C C   1 
ATOM   2067 O O   . GLU C 3 71  ? 25.840  -21.895 38.666 1.00 53.43  ? 87  GLU C O   1 
ATOM   2068 C CB  . GLU C 3 71  ? 25.331  -22.512 35.252 1.00 51.78  ? 87  GLU C CB  1 
ATOM   2069 C CG  . GLU C 3 71  ? 25.159  -23.691 34.321 1.00 54.86  ? 87  GLU C CG  1 
ATOM   2070 C CD  . GLU C 3 71  ? 25.011  -23.311 32.862 1.00 57.22  ? 87  GLU C CD  1 
ATOM   2071 O OE1 . GLU C 3 71  ? 25.891  -22.604 32.332 1.00 57.68  ? 87  GLU C OE1 1 
ATOM   2072 O OE2 . GLU C 3 71  ? 24.019  -23.750 32.238 1.00 59.23  ? 87  GLU C OE2 1 
ATOM   2073 N N   . ALA C 3 72  ? 27.136  -23.259 37.430 1.00 54.47  ? 88  ALA C N   1 
ATOM   2074 C CA  . ALA C 3 72  ? 28.341  -23.069 38.230 1.00 55.24  ? 88  ALA C CA  1 
ATOM   2075 C C   . ALA C 3 72  ? 29.053  -21.786 37.808 1.00 56.35  ? 88  ALA C C   1 
ATOM   2076 O O   . ALA C 3 72  ? 29.045  -21.425 36.631 1.00 55.17  ? 88  ALA C O   1 
ATOM   2077 C CB  . ALA C 3 72  ? 29.280  -24.261 38.064 1.00 54.47  ? 88  ALA C CB  1 
ATOM   2078 N N   . ASP C 3 73  ? 29.662  -21.116 38.789 1.00 58.11  ? 89  ASP C N   1 
ATOM   2079 C CA  . ASP C 3 73  ? 30.500  -19.922 38.583 1.00 60.35  ? 89  ASP C CA  1 
ATOM   2080 C C   . ASP C 3 73  ? 29.780  -18.760 37.932 1.00 59.71  ? 89  ASP C C   1 
ATOM   2081 O O   . ASP C 3 73  ? 30.291  -18.130 37.004 1.00 60.25  ? 89  ASP C O   1 
ATOM   2082 C CB  . ASP C 3 73  ? 31.767  -20.269 37.789 1.00 62.99  ? 89  ASP C CB  1 
ATOM   2083 C CG  . ASP C 3 73  ? 32.332  -21.617 38.180 1.00 66.12  ? 89  ASP C CG  1 
ATOM   2084 O OD1 . ASP C 3 73  ? 32.384  -21.911 39.397 1.00 68.66  ? 89  ASP C OD1 1 
ATOM   2085 O OD2 . ASP C 3 73  ? 32.721  -22.442 37.326 1.00 68.80  ? 89  ASP C OD2 1 
ATOM   2086 N N   . VAL C 3 74  ? 28.588  -18.482 38.439 1.00 59.46  ? 90  VAL C N   1 
ATOM   2087 C CA  . VAL C 3 74  ? 27.815  -17.356 37.965 1.00 58.59  ? 90  VAL C CA  1 
ATOM   2088 C C   . VAL C 3 74  ? 28.291  -16.129 38.732 1.00 58.60  ? 90  VAL C C   1 
ATOM   2089 O O   . VAL C 3 74  ? 28.520  -15.066 38.147 1.00 59.20  ? 90  VAL C O   1 
ATOM   2090 C CB  . VAL C 3 74  ? 26.301  -17.597 38.166 1.00 58.78  ? 90  VAL C CB  1 
ATOM   2091 C CG1 . VAL C 3 74  ? 25.496  -16.463 37.553 1.00 56.57  ? 90  VAL C CG1 1 
ATOM   2092 C CG2 . VAL C 3 74  ? 25.891  -18.939 37.541 1.00 56.70  ? 90  VAL C CG2 1 
ATOM   2093 N N   . PHE C 3 75  ? 28.469  -16.293 40.038 1.00 58.26  ? 91  PHE C N   1 
ATOM   2094 C CA  . PHE C 3 75  ? 28.945  -15.199 40.876 1.00 58.75  ? 91  PHE C CA  1 
ATOM   2095 C C   . PHE C 3 75  ? 30.401  -15.448 41.269 1.00 59.40  ? 91  PHE C C   1 
ATOM   2096 O O   . PHE C 3 75  ? 30.680  -16.070 42.294 1.00 59.38  ? 91  PHE C O   1 
ATOM   2097 C CB  . PHE C 3 75  ? 28.039  -15.031 42.111 1.00 57.19  ? 91  PHE C CB  1 
ATOM   2098 C CG  . PHE C 3 75  ? 26.568  -15.013 41.792 1.00 53.85  ? 91  PHE C CG  1 
ATOM   2099 C CD1 . PHE C 3 75  ? 25.983  -13.905 41.187 1.00 53.70  ? 91  PHE C CD1 1 
ATOM   2100 C CD2 . PHE C 3 75  ? 25.772  -16.109 42.086 1.00 52.88  ? 91  PHE C CD2 1 
ATOM   2101 C CE1 . PHE C 3 75  ? 24.623  -13.887 40.883 1.00 52.24  ? 91  PHE C CE1 1 
ATOM   2102 C CE2 . PHE C 3 75  ? 24.414  -16.110 41.794 1.00 53.04  ? 91  PHE C CE2 1 
ATOM   2103 C CZ  . PHE C 3 75  ? 23.835  -14.994 41.187 1.00 54.26  ? 91  PHE C CZ  1 
ATOM   2104 N N   . SER C 3 76  ? 31.321  -14.977 40.429 1.00 61.42  ? 92  SER C N   1 
ATOM   2105 C CA  . SER C 3 76  ? 32.768  -15.160 40.634 1.00 64.09  ? 92  SER C CA  1 
ATOM   2106 C C   . SER C 3 76  ? 33.574  -14.093 39.894 1.00 65.81  ? 92  SER C C   1 
ATOM   2107 O O   . SER C 3 76  ? 33.129  -13.573 38.869 1.00 67.27  ? 92  SER C O   1 
ATOM   2108 C CB  . SER C 3 76  ? 33.214  -16.561 40.197 1.00 64.42  ? 92  SER C CB  1 
ATOM   2109 O OG  . SER C 3 76  ? 32.752  -16.880 38.895 1.00 63.94  ? 92  SER C OG  1 
ATOM   2110 N N   . ASN C 3 77  ? 34.763  -13.785 40.407 1.00 67.64  ? 93  ASN C N   1 
ATOM   2111 C CA  . ASN C 3 77  ? 35.560  -12.662 39.906 1.00 69.82  ? 93  ASN C CA  1 
ATOM   2112 C C   . ASN C 3 77  ? 34.702  -11.395 39.899 1.00 68.63  ? 93  ASN C C   1 
ATOM   2113 O O   . ASN C 3 77  ? 34.572  -10.707 38.886 1.00 69.34  ? 93  ASN C O   1 
ATOM   2114 C CB  . ASN C 3 77  ? 36.154  -12.950 38.510 1.00 73.07  ? 93  ASN C CB  1 
ATOM   2115 C CG  . ASN C 3 77  ? 36.922  -11.752 37.926 1.00 76.86  ? 93  ASN C CG  1 
ATOM   2116 O OD1 . ASN C 3 77  ? 36.627  -11.291 36.815 1.00 78.27  ? 93  ASN C OD1 1 
ATOM   2117 N ND2 . ASN C 3 77  ? 37.896  -11.235 38.687 1.00 78.69  ? 93  ASN C ND2 1 
ATOM   2118 N N   . LEU C 3 78  ? 34.093  -11.113 41.045 1.00 67.17  ? 94  LEU C N   1 
ATOM   2119 C CA  . LEU C 3 78  ? 33.256  -9.932  41.199 1.00 65.14  ? 94  LEU C CA  1 
ATOM   2120 C C   . LEU C 3 78  ? 33.725  -9.168  42.439 1.00 65.09  ? 94  LEU C C   1 
ATOM   2121 O O   . LEU C 3 78  ? 33.046  -9.163  43.473 1.00 64.99  ? 94  LEU C O   1 
ATOM   2122 C CB  . LEU C 3 78  ? 31.781  -10.339 41.289 1.00 64.31  ? 94  LEU C CB  1 
ATOM   2123 C CG  . LEU C 3 78  ? 31.120  -10.832 39.988 1.00 63.76  ? 94  LEU C CG  1 
ATOM   2124 C CD1 . LEU C 3 78  ? 29.882  -11.672 40.261 1.00 64.02  ? 94  LEU C CD1 1 
ATOM   2125 C CD2 . LEU C 3 78  ? 30.776  -9.679  39.061 1.00 63.46  ? 94  LEU C CD2 1 
ATOM   2126 N N   . PRO C 3 79  ? 34.894  -8.519  42.328 1.00 65.05  ? 95  PRO C N   1 
ATOM   2127 C CA  . PRO C 3 79  ? 35.547  -7.851  43.462 1.00 63.72  ? 95  PRO C CA  1 
ATOM   2128 C C   . PRO C 3 79  ? 34.745  -6.733  44.109 1.00 61.89  ? 95  PRO C C   1 
ATOM   2129 O O   . PRO C 3 79  ? 34.967  -6.433  45.276 1.00 62.20  ? 95  PRO C O   1 
ATOM   2130 C CB  . PRO C 3 79  ? 36.839  -7.290  42.849 1.00 64.07  ? 95  PRO C CB  1 
ATOM   2131 C CG  . PRO C 3 79  ? 37.064  -8.112  41.629 1.00 64.36  ? 95  PRO C CG  1 
ATOM   2132 C CD  . PRO C 3 79  ? 35.684  -8.358  41.090 1.00 64.91  ? 95  PRO C CD  1 
ATOM   2133 N N   . LYS C 3 80  ? 33.830  -6.125  43.360 1.00 60.39  ? 96  LYS C N   1 
ATOM   2134 C CA  . LYS C 3 80  ? 33.053  -4.989  43.856 1.00 58.94  ? 96  LYS C CA  1 
ATOM   2135 C C   . LYS C 3 80  ? 31.626  -5.350  44.248 1.00 57.04  ? 96  LYS C C   1 
ATOM   2136 O O   . LYS C 3 80  ? 30.868  -4.490  44.686 1.00 57.90  ? 96  LYS C O   1 
ATOM   2137 C CB  . LYS C 3 80  ? 33.005  -3.880  42.799 1.00 60.45  ? 96  LYS C CB  1 
ATOM   2138 C CG  . LYS C 3 80  ? 34.131  -2.862  42.842 1.00 61.14  ? 96  LYS C CG  1 
ATOM   2139 C CD  . LYS C 3 80  ? 33.911  -1.814  41.749 1.00 63.76  ? 96  LYS C CD  1 
ATOM   2140 C CE  . LYS C 3 80  ? 35.135  -0.924  41.509 1.00 65.08  ? 96  LYS C CE  1 
ATOM   2141 N NZ  . LYS C 3 80  ? 35.213  0.232   42.454 1.00 63.97  ? 96  LYS C NZ  1 
ATOM   2142 N N   . LEU C 3 81  ? 31.252  -6.611  44.062 1.00 56.10  ? 97  LEU C N   1 
ATOM   2143 C CA  . LEU C 3 81  ? 29.882  -7.078  44.337 1.00 55.36  ? 97  LEU C CA  1 
ATOM   2144 C C   . LEU C 3 81  ? 29.527  -7.033  45.834 1.00 55.69  ? 97  LEU C C   1 
ATOM   2145 O O   . LEU C 3 81  ? 30.223  -7.615  46.676 1.00 55.70  ? 97  LEU C O   1 
ATOM   2146 C CB  . LEU C 3 81  ? 29.686  -8.495  43.776 1.00 52.04  ? 97  LEU C CB  1 
ATOM   2147 C CG  . LEU C 3 81  ? 28.308  -9.135  43.836 1.00 47.91  ? 97  LEU C CG  1 
ATOM   2148 C CD1 . LEU C 3 81  ? 27.414  -8.523  42.789 1.00 49.64  ? 97  LEU C CD1 1 
ATOM   2149 C CD2 . LEU C 3 81  ? 28.428  -10.608 43.611 1.00 47.02  ? 97  LEU C CD2 1 
ATOM   2150 N N   . HIS C 3 82  ? 28.444  -6.338  46.159 1.00 54.30  ? 98  HIS C N   1 
ATOM   2151 C CA  . HIS C 3 82  ? 28.049  -6.189  47.551 1.00 55.67  ? 98  HIS C CA  1 
ATOM   2152 C C   . HIS C 3 82  ? 26.729  -6.868  47.879 1.00 55.29  ? 98  HIS C C   1 
ATOM   2153 O O   . HIS C 3 82  ? 26.517  -7.322  49.008 1.00 54.29  ? 98  HIS C O   1 
ATOM   2154 C CB  . HIS C 3 82  ? 27.974  -4.707  47.917 1.00 58.42  ? 98  HIS C CB  1 
ATOM   2155 C CG  . HIS C 3 82  ? 29.314  -4.064  48.046 1.00 63.59  ? 98  HIS C CG  1 
ATOM   2156 N ND1 . HIS C 3 82  ? 30.211  -4.416  49.034 1.00 67.10  ? 98  HIS C ND1 1 
ATOM   2157 C CD2 . HIS C 3 82  ? 29.919  -3.099  47.311 1.00 65.56  ? 98  HIS C CD2 1 
ATOM   2158 C CE1 . HIS C 3 82  ? 31.308  -3.692  48.907 1.00 67.45  ? 98  HIS C CE1 1 
ATOM   2159 N NE2 . HIS C 3 82  ? 31.158  -2.886  47.867 1.00 68.03  ? 98  HIS C NE2 1 
ATOM   2160 N N   . GLU C 3 83  ? 25.862  -6.964  46.878 1.00 53.29  ? 99  GLU C N   1 
ATOM   2161 C CA  . GLU C 3 83  ? 24.516  -7.439  47.096 1.00 51.99  ? 99  GLU C CA  1 
ATOM   2162 C C   . GLU C 3 83  ? 24.048  -8.328  45.964 1.00 49.08  ? 99  GLU C C   1 
ATOM   2163 O O   . GLU C 3 83  ? 24.134  -7.948  44.804 1.00 49.81  ? 99  GLU C O   1 
ATOM   2164 C CB  . GLU C 3 83  ? 23.587  -6.226  47.212 1.00 54.06  ? 99  GLU C CB  1 
ATOM   2165 C CG  . GLU C 3 83  ? 22.136  -6.552  47.508 1.00 60.50  ? 99  GLU C CG  1 
ATOM   2166 C CD  . GLU C 3 83  ? 21.218  -5.358  47.287 1.00 66.92  ? 99  GLU C CD  1 
ATOM   2167 O OE1 . GLU C 3 83  ? 21.521  -4.254  47.820 1.00 69.28  ? 99  GLU C OE1 1 
ATOM   2168 O OE2 . GLU C 3 83  ? 20.194  -5.528  46.575 1.00 67.50  ? 99  GLU C OE2 1 
ATOM   2169 N N   . ILE C 3 84  ? 23.562  -9.517  46.312 1.00 46.34  ? 100 ILE C N   1 
ATOM   2170 C CA  . ILE C 3 84  ? 22.871  -10.388 45.362 1.00 43.00  ? 100 ILE C CA  1 
ATOM   2171 C C   . ILE C 3 84  ? 21.442  -10.550 45.856 1.00 43.07  ? 100 ILE C C   1 
ATOM   2172 O O   . ILE C 3 84  ? 21.219  -10.897 47.019 1.00 42.24  ? 100 ILE C O   1 
ATOM   2173 C CB  . ILE C 3 84  ? 23.546  -11.766 45.266 1.00 41.98  ? 100 ILE C CB  1 
ATOM   2174 C CG1 . ILE C 3 84  ? 24.974  -11.629 44.753 1.00 42.08  ? 100 ILE C CG1 1 
ATOM   2175 C CG2 . ILE C 3 84  ? 22.751  -12.690 44.361 1.00 39.45  ? 100 ILE C CG2 1 
ATOM   2176 C CD1 . ILE C 3 84  ? 25.815  -12.877 44.928 1.00 44.92  ? 100 ILE C CD1 1 
ATOM   2177 N N   . ARG C 3 85  ? 20.480  -10.287 44.978 1.00 42.70  ? 101 ARG C N   1 
ATOM   2178 C CA  . ARG C 3 85  ? 19.067  -10.421 45.326 1.00 43.75  ? 101 ARG C CA  1 
ATOM   2179 C C   . ARG C 3 85  ? 18.349  -11.295 44.325 1.00 42.20  ? 101 ARG C C   1 
ATOM   2180 O O   . ARG C 3 85  ? 18.090  -10.876 43.200 1.00 44.94  ? 101 ARG C O   1 
ATOM   2181 C CB  . ARG C 3 85  ? 18.381  -9.058  45.387 1.00 45.03  ? 101 ARG C CB  1 
ATOM   2182 C CG  . ARG C 3 85  ? 18.390  -8.413  46.764 1.00 51.71  ? 101 ARG C CG  1 
ATOM   2183 C CD  . ARG C 3 85  ? 18.122  -6.918  46.722 1.00 54.84  ? 101 ARG C CD  1 
ATOM   2184 N NE  . ARG C 3 85  ? 16.702  -6.617  46.608 1.00 61.84  ? 101 ARG C NE  1 
ATOM   2185 C CZ  . ARG C 3 85  ? 15.903  -6.364  47.642 1.00 67.88  ? 101 ARG C CZ  1 
ATOM   2186 N NH1 . ARG C 3 85  ? 16.378  -6.363  48.886 1.00 68.80  ? 101 ARG C NH1 1 
ATOM   2187 N NH2 . ARG C 3 85  ? 14.619  -6.104  47.432 1.00 73.03  ? 101 ARG C NH2 1 
ATOM   2188 N N   . ILE C 3 86  ? 18.046  -12.518 44.737 1.00 41.97  ? 102 ILE C N   1 
ATOM   2189 C CA  . ILE C 3 86  ? 17.264  -13.441 43.926 1.00 39.54  ? 102 ILE C CA  1 
ATOM   2190 C C   . ILE C 3 86  ? 15.909  -13.484 44.579 1.00 40.84  ? 102 ILE C C   1 
ATOM   2191 O O   . ILE C 3 86  ? 15.746  -14.086 45.645 1.00 42.18  ? 102 ILE C O   1 
ATOM   2192 C CB  . ILE C 3 86  ? 17.877  -14.852 43.927 1.00 36.47  ? 102 ILE C CB  1 
ATOM   2193 C CG1 . ILE C 3 86  ? 19.261  -14.827 43.301 1.00 37.29  ? 102 ILE C CG1 1 
ATOM   2194 C CG2 . ILE C 3 86  ? 17.009  -15.798 43.162 1.00 34.31  ? 102 ILE C CG2 1 
ATOM   2195 C CD1 . ILE C 3 86  ? 19.952  -16.170 43.286 1.00 41.27  ? 102 ILE C CD1 1 
ATOM   2196 N N   . GLU C 3 87  ? 14.941  -12.822 43.959 1.00 40.76  ? 103 GLU C N   1 
ATOM   2197 C CA  . GLU C 3 87  ? 13.600  -12.777 44.514 1.00 41.97  ? 103 GLU C CA  1 
ATOM   2198 C C   . GLU C 3 87  ? 12.603  -13.331 43.519 1.00 40.93  ? 103 GLU C C   1 
ATOM   2199 O O   . GLU C 3 87  ? 12.731  -13.138 42.297 1.00 41.33  ? 103 GLU C O   1 
ATOM   2200 C CB  . GLU C 3 87  ? 13.182  -11.336 44.870 1.00 43.89  ? 103 GLU C CB  1 
ATOM   2201 C CG  . GLU C 3 87  ? 14.075  -10.601 45.863 1.00 51.44  ? 103 GLU C CG  1 
ATOM   2202 C CD  . GLU C 3 87  ? 14.063  -9.084  45.649 1.00 58.42  ? 103 GLU C CD  1 
ATOM   2203 O OE1 . GLU C 3 87  ? 13.031  -8.426  45.937 1.00 59.83  ? 103 GLU C OE1 1 
ATOM   2204 O OE2 . GLU C 3 87  ? 15.095  -8.535  45.181 1.00 64.82  ? 103 GLU C OE2 1 
ATOM   2205 N N   . LYS C 3 88  ? 11.615  -14.030 44.064 1.00 38.99  ? 104 LYS C N   1 
ATOM   2206 C CA  . LYS C 3 88  ? 10.429  -14.411 43.317 1.00 38.55  ? 104 LYS C CA  1 
ATOM   2207 C C   . LYS C 3 88  ? 10.687  -15.227 42.057 1.00 38.76  ? 104 LYS C C   1 
ATOM   2208 O O   . LYS C 3 88  ? 10.208  -14.875 40.987 1.00 38.38  ? 104 LYS C O   1 
ATOM   2209 C CB  . LYS C 3 88  ? 9.596   -13.151 42.995 1.00 37.52  ? 104 LYS C CB  1 
ATOM   2210 C CG  . LYS C 3 88  ? 8.651   -12.727 44.117 1.00 37.95  ? 104 LYS C CG  1 
ATOM   2211 C CD  . LYS C 3 88  ? 8.405   -11.249 44.121 1.00 39.34  ? 104 LYS C CD  1 
ATOM   2212 C CE  . LYS C 3 88  ? 9.551   -10.537 44.810 1.00 43.35  ? 104 LYS C CE  1 
ATOM   2213 N NZ  . LYS C 3 88  ? 9.680   -9.124  44.358 1.00 48.61  ? 104 LYS C NZ  1 
ATOM   2214 N N   . ALA C 3 89  ? 11.457  -16.306 42.191 1.00 39.58  ? 105 ALA C N   1 
ATOM   2215 C CA  . ALA C 3 89  ? 11.613  -17.279 41.113 1.00 40.54  ? 105 ALA C CA  1 
ATOM   2216 C C   . ALA C 3 89  ? 10.855  -18.559 41.498 1.00 43.52  ? 105 ALA C C   1 
ATOM   2217 O O   . ALA C 3 89  ? 11.362  -19.482 42.138 1.00 43.07  ? 105 ALA C O   1 
ATOM   2218 C CB  . ALA C 3 89  ? 13.062  -17.547 40.805 1.00 38.61  ? 105 ALA C CB  1 
ATOM   2219 N N   . ASN C 3 90  ? 9.585   -18.525 41.127 1.00 47.50  ? 106 ASN C N   1 
ATOM   2220 C CA  . ASN C 3 90  ? 8.602   -19.579 41.262 1.00 47.46  ? 106 ASN C CA  1 
ATOM   2221 C C   . ASN C 3 90  ? 9.108   -21.000 40.998 1.00 46.79  ? 106 ASN C C   1 
ATOM   2222 O O   . ASN C 3 90  ? 8.782   -21.921 41.733 1.00 46.73  ? 106 ASN C O   1 
ATOM   2223 C CB  . ASN C 3 90  ? 7.512   -19.259 40.238 1.00 50.55  ? 106 ASN C CB  1 
ATOM   2224 C CG  . ASN C 3 90  ? 6.161   -19.667 40.694 1.00 54.57  ? 106 ASN C CG  1 
ATOM   2225 O OD1 . ASN C 3 90  ? 5.909   -19.769 41.899 1.00 58.85  ? 106 ASN C OD1 1 
ATOM   2226 N ND2 . ASN C 3 90  ? 5.257   -19.897 39.740 1.00 55.59  ? 106 ASN C ND2 1 
ATOM   2227 N N   . ASN C 3 91  ? 9.890   -21.164 39.934 1.00 45.88  ? 107 ASN C N   1 
ATOM   2228 C CA  . ASN C 3 91  ? 10.302  -22.477 39.465 1.00 44.43  ? 107 ASN C CA  1 
ATOM   2229 C C   . ASN C 3 91  ? 11.790  -22.718 39.583 1.00 44.44  ? 107 ASN C C   1 
ATOM   2230 O O   . ASN C 3 91  ? 12.294  -23.705 39.049 1.00 43.22  ? 107 ASN C O   1 
ATOM   2231 C CB  . ASN C 3 91  ? 9.887   -22.662 38.005 1.00 45.41  ? 107 ASN C CB  1 
ATOM   2232 C CG  . ASN C 3 91  ? 8.391   -22.534 37.800 1.00 48.29  ? 107 ASN C CG  1 
ATOM   2233 O OD1 . ASN C 3 91  ? 7.609   -23.309 38.345 1.00 53.98  ? 107 ASN C OD1 1 
ATOM   2234 N ND2 . ASN C 3 91  ? 7.986   -21.562 37.005 1.00 48.87  ? 107 ASN C ND2 1 
ATOM   2235 N N   . LEU C 3 92  ? 12.497  -21.814 40.259 1.00 44.02  ? 108 LEU C N   1 
ATOM   2236 C CA  . LEU C 3 92  ? 13.925  -22.011 40.487 1.00 41.64  ? 108 LEU C CA  1 
ATOM   2237 C C   . LEU C 3 92  ? 14.066  -23.110 41.510 1.00 42.22  ? 108 LEU C C   1 
ATOM   2238 O O   . LEU C 3 92  ? 13.974  -22.872 42.715 1.00 41.84  ? 108 LEU C O   1 
ATOM   2239 C CB  . LEU C 3 92  ? 14.621  -20.744 40.985 1.00 40.82  ? 108 LEU C CB  1 
ATOM   2240 C CG  . LEU C 3 92  ? 16.142  -20.832 41.219 1.00 42.76  ? 108 LEU C CG  1 
ATOM   2241 C CD1 . LEU C 3 92  ? 16.909  -21.070 39.918 1.00 40.77  ? 108 LEU C CD1 1 
ATOM   2242 C CD2 . LEU C 3 92  ? 16.670  -19.577 41.919 1.00 41.92  ? 108 LEU C CD2 1 
ATOM   2243 N N   . LEU C 3 93  ? 14.274  -24.321 41.006 1.00 42.42  ? 109 LEU C N   1 
ATOM   2244 C CA  . LEU C 3 93  ? 14.448  -25.481 41.850 1.00 41.35  ? 109 LEU C CA  1 
ATOM   2245 C C   . LEU C 3 93  ? 15.906  -25.905 42.009 1.00 39.67  ? 109 LEU C C   1 
ATOM   2246 O O   . LEU C 3 93  ? 16.208  -26.715 42.873 1.00 42.71  ? 109 LEU C O   1 
ATOM   2247 C CB  . LEU C 3 93  ? 13.602  -26.652 41.334 1.00 43.80  ? 109 LEU C CB  1 
ATOM   2248 C CG  . LEU C 3 93  ? 12.084  -26.463 41.120 1.00 45.35  ? 109 LEU C CG  1 
ATOM   2249 C CD1 . LEU C 3 93  ? 11.435  -27.840 41.046 1.00 47.07  ? 109 LEU C CD1 1 
ATOM   2250 C CD2 . LEU C 3 93  ? 11.386  -25.623 42.189 1.00 43.13  ? 109 LEU C CD2 1 
ATOM   2251 N N   . TYR C 3 94  ? 16.819  -25.354 41.223 1.00 36.10  ? 110 TYR C N   1 
ATOM   2252 C CA  . TYR C 3 94  ? 18.188  -25.800 41.344 1.00 37.84  ? 110 TYR C CA  1 
ATOM   2253 C C   . TYR C 3 94  ? 19.250  -24.699 41.281 1.00 40.74  ? 110 TYR C C   1 
ATOM   2254 O O   . TYR C 3 94  ? 19.373  -23.991 40.286 1.00 43.96  ? 110 TYR C O   1 
ATOM   2255 C CB  . TYR C 3 94  ? 18.477  -26.897 40.292 1.00 38.42  ? 110 TYR C CB  1 
ATOM   2256 C CG  . TYR C 3 94  ? 19.930  -27.333 40.253 1.00 37.82  ? 110 TYR C CG  1 
ATOM   2257 C CD1 . TYR C 3 94  ? 20.396  -28.369 41.069 1.00 35.12  ? 110 TYR C CD1 1 
ATOM   2258 C CD2 . TYR C 3 94  ? 20.844  -26.683 39.420 1.00 36.03  ? 110 TYR C CD2 1 
ATOM   2259 C CE1 . TYR C 3 94  ? 21.742  -28.748 41.052 1.00 36.36  ? 110 TYR C CE1 1 
ATOM   2260 C CE2 . TYR C 3 94  ? 22.185  -27.045 39.403 1.00 37.27  ? 110 TYR C CE2 1 
ATOM   2261 C CZ  . TYR C 3 94  ? 22.632  -28.077 40.217 1.00 37.00  ? 110 TYR C CZ  1 
ATOM   2262 O OH  . TYR C 3 94  ? 23.964  -28.422 40.183 1.00 34.51  ? 110 TYR C OH  1 
ATOM   2263 N N   . ILE C 3 95  ? 20.027  -24.559 42.348 1.00 42.35  ? 111 ILE C N   1 
ATOM   2264 C CA  . ILE C 3 95  ? 21.206  -23.699 42.304 1.00 44.08  ? 111 ILE C CA  1 
ATOM   2265 C C   . ILE C 3 95  ? 22.409  -24.615 42.439 1.00 47.16  ? 111 ILE C C   1 
ATOM   2266 O O   . ILE C 3 95  ? 22.519  -25.365 43.417 1.00 49.72  ? 111 ILE C O   1 
ATOM   2267 C CB  . ILE C 3 95  ? 21.208  -22.648 43.432 1.00 43.93  ? 111 ILE C CB  1 
ATOM   2268 C CG1 . ILE C 3 95  ? 20.007  -21.709 43.300 1.00 41.70  ? 111 ILE C CG1 1 
ATOM   2269 C CG2 . ILE C 3 95  ? 22.529  -21.848 43.439 1.00 43.97  ? 111 ILE C CG2 1 
ATOM   2270 C CD1 . ILE C 3 95  ? 19.919  -20.683 44.409 1.00 40.39  ? 111 ILE C CD1 1 
ATOM   2271 N N   . ASN C 3 96  ? 23.300  -24.562 41.452 1.00 49.32  ? 112 ASN C N   1 
ATOM   2272 C CA  . ASN C 3 96  ? 24.475  -25.416 41.441 1.00 52.28  ? 112 ASN C CA  1 
ATOM   2273 C C   . ASN C 3 96  ? 25.380  -25.151 42.629 1.00 53.62  ? 112 ASN C C   1 
ATOM   2274 O O   . ASN C 3 96  ? 25.738  -23.998 42.881 1.00 54.88  ? 112 ASN C O   1 
ATOM   2275 C CB  . ASN C 3 96  ? 25.271  -25.236 40.154 1.00 53.72  ? 112 ASN C CB  1 
ATOM   2276 C CG  . ASN C 3 96  ? 26.654  -25.852 40.247 1.00 55.54  ? 112 ASN C CG  1 
ATOM   2277 O OD1 . ASN C 3 96  ? 27.647  -25.153 40.440 1.00 57.17  ? 112 ASN C OD1 1 
ATOM   2278 N ND2 . ASN C 3 96  ? 26.719  -27.169 40.150 1.00 55.81  ? 112 ASN C ND2 1 
ATOM   2279 N N   . PRO C 3 97  ? 25.744  -26.216 43.361 1.00 54.36  ? 113 PRO C N   1 
ATOM   2280 C CA  . PRO C 3 97  ? 26.626  -26.126 44.537 1.00 54.09  ? 113 PRO C CA  1 
ATOM   2281 C C   . PRO C 3 97  ? 27.957  -25.376 44.350 1.00 54.62  ? 113 PRO C C   1 
ATOM   2282 O O   . PRO C 3 97  ? 28.690  -25.176 45.323 1.00 54.61  ? 113 PRO C O   1 
ATOM   2283 C CB  . PRO C 3 97  ? 26.849  -27.588 44.905 1.00 53.63  ? 113 PRO C CB  1 
ATOM   2284 C CG  . PRO C 3 97  ? 25.573  -28.270 44.455 1.00 52.66  ? 113 PRO C CG  1 
ATOM   2285 C CD  . PRO C 3 97  ? 25.258  -27.596 43.152 1.00 53.29  ? 113 PRO C CD  1 
ATOM   2286 N N   . GLU C 3 98  ? 28.257  -24.954 43.124 1.00 53.71  ? 114 GLU C N   1 
ATOM   2287 C CA  . GLU C 3 98  ? 29.420  -24.111 42.883 1.00 54.71  ? 114 GLU C CA  1 
ATOM   2288 C C   . GLU C 3 98  ? 29.064  -22.782 42.204 1.00 53.92  ? 114 GLU C C   1 
ATOM   2289 O O   . GLU C 3 98  ? 29.879  -22.214 41.463 1.00 55.09  ? 114 GLU C O   1 
ATOM   2290 C CB  . GLU C 3 98  ? 30.471  -24.857 42.067 1.00 57.16  ? 114 GLU C CB  1 
ATOM   2291 C CG  . GLU C 3 98  ? 31.215  -25.919 42.854 1.00 62.90  ? 114 GLU C CG  1 
ATOM   2292 C CD  . GLU C 3 98  ? 32.716  -25.877 42.597 1.00 67.56  ? 114 GLU C CD  1 
ATOM   2293 O OE1 . GLU C 3 98  ? 33.124  -25.997 41.413 1.00 67.56  ? 114 GLU C OE1 1 
ATOM   2294 O OE2 . GLU C 3 98  ? 33.479  -25.717 43.586 1.00 67.82  ? 114 GLU C OE2 1 
ATOM   2295 N N   . ALA C 3 99  ? 27.860  -22.281 42.477 1.00 51.94  ? 115 ALA C N   1 
ATOM   2296 C CA  . ALA C 3 99  ? 27.403  -21.015 41.897 1.00 50.73  ? 115 ALA C CA  1 
ATOM   2297 C C   . ALA C 3 99  ? 28.162  -19.787 42.414 1.00 50.23  ? 115 ALA C C   1 
ATOM   2298 O O   . ALA C 3 99  ? 28.513  -18.900 41.630 1.00 50.89  ? 115 ALA C O   1 
ATOM   2299 C CB  . ALA C 3 99  ? 25.891  -20.840 42.102 1.00 48.35  ? 115 ALA C CB  1 
ATOM   2300 N N   . PHE C 3 100 ? 28.421  -19.747 43.721 1.00 49.74  ? 116 PHE C N   1 
ATOM   2301 C CA  . PHE C 3 100 ? 29.056  -18.593 44.369 1.00 50.34  ? 116 PHE C CA  1 
ATOM   2302 C C   . PHE C 3 100 ? 30.517  -18.867 44.700 1.00 50.02  ? 116 PHE C C   1 
ATOM   2303 O O   . PHE C 3 100 ? 30.822  -19.868 45.336 1.00 48.84  ? 116 PHE C O   1 
ATOM   2304 C CB  . PHE C 3 100 ? 28.339  -18.243 45.677 1.00 50.50  ? 116 PHE C CB  1 
ATOM   2305 C CG  . PHE C 3 100 ? 26.858  -18.037 45.541 1.00 48.69  ? 116 PHE C CG  1 
ATOM   2306 C CD1 . PHE C 3 100 ? 26.349  -16.820 45.132 1.00 49.03  ? 116 PHE C CD1 1 
ATOM   2307 C CD2 . PHE C 3 100 ? 25.976  -19.045 45.879 1.00 48.37  ? 116 PHE C CD2 1 
ATOM   2308 C CE1 . PHE C 3 100 ? 24.989  -16.623 45.030 1.00 49.04  ? 116 PHE C CE1 1 
ATOM   2309 C CE2 . PHE C 3 100 ? 24.615  -18.854 45.776 1.00 49.19  ? 116 PHE C CE2 1 
ATOM   2310 C CZ  . PHE C 3 100 ? 24.122  -17.640 45.353 1.00 49.31  ? 116 PHE C CZ  1 
ATOM   2311 N N   . GLN C 3 101 ? 31.406  -17.957 44.307 1.00 50.81  ? 117 GLN C N   1 
ATOM   2312 C CA  . GLN C 3 101 ? 32.840  -18.149 44.496 1.00 53.18  ? 117 GLN C CA  1 
ATOM   2313 C C   . GLN C 3 101 ? 33.639  -16.871 44.729 1.00 54.23  ? 117 GLN C C   1 
ATOM   2314 O O   . GLN C 3 101 ? 33.672  -15.977 43.880 1.00 55.54  ? 117 GLN C O   1 
ATOM   2315 C CB  . GLN C 3 101 ? 33.434  -18.899 43.302 1.00 54.40  ? 117 GLN C CB  1 
ATOM   2316 C CG  . GLN C 3 101 ? 33.008  -20.344 43.253 1.00 58.07  ? 117 GLN C CG  1 
ATOM   2317 C CD  . GLN C 3 101 ? 33.728  -21.124 42.210 1.00 60.95  ? 117 GLN C CD  1 
ATOM   2318 O OE1 . GLN C 3 101 ? 34.581  -20.588 41.500 1.00 64.06  ? 117 GLN C OE1 1 
ATOM   2319 N NE2 . GLN C 3 101 ? 33.390  -22.403 42.098 1.00 63.19  ? 117 GLN C NE2 1 
ATOM   2320 N N   . ASN C 3 102 ? 34.310  -16.824 45.876 1.00 54.41  ? 118 ASN C N   1 
ATOM   2321 C CA  . ASN C 3 102 ? 35.140  -15.698 46.285 1.00 54.08  ? 118 ASN C CA  1 
ATOM   2322 C C   . ASN C 3 102 ? 34.596  -14.333 45.883 1.00 53.02  ? 118 ASN C C   1 
ATOM   2323 O O   . ASN C 3 102 ? 34.865  -13.823 44.789 1.00 50.71  ? 118 ASN C O   1 
ATOM   2324 C CB  . ASN C 3 102 ? 36.606  -15.863 45.826 1.00 56.32  ? 118 ASN C CB  1 
ATOM   2325 C CG  . ASN C 3 102 ? 37.554  -14.865 46.515 1.00 59.02  ? 118 ASN C CG  1 
ATOM   2326 O OD1 . ASN C 3 102 ? 38.099  -13.958 45.877 1.00 60.62  ? 118 ASN C OD1 1 
ATOM   2327 N ND2 . ASN C 3 102 ? 37.725  -15.018 47.824 1.00 59.87  ? 118 ASN C ND2 1 
ATOM   2328 N N   . LEU C 3 103 ? 33.807  -13.763 46.787 1.00 51.86  ? 119 LEU C N   1 
ATOM   2329 C CA  . LEU C 3 103 ? 33.336  -12.391 46.644 1.00 50.70  ? 119 LEU C CA  1 
ATOM   2330 C C   . LEU C 3 103 ? 33.781  -11.648 47.903 1.00 50.16  ? 119 LEU C C   1 
ATOM   2331 O O   . LEU C 3 103 ? 33.016  -11.506 48.851 1.00 51.35  ? 119 LEU C O   1 
ATOM   2332 C CB  . LEU C 3 103 ? 31.815  -12.353 46.476 1.00 48.36  ? 119 LEU C CB  1 
ATOM   2333 C CG  . LEU C 3 103 ? 31.232  -13.367 45.489 1.00 46.47  ? 119 LEU C CG  1 
ATOM   2334 C CD1 . LEU C 3 103 ? 29.749  -13.520 45.725 1.00 47.04  ? 119 LEU C CD1 1 
ATOM   2335 C CD2 . LEU C 3 103 ? 31.516  -12.970 44.051 1.00 43.75  ? 119 LEU C CD2 1 
ATOM   2336 N N   . PRO C 3 104 ? 35.035  -11.189 47.923 1.00 50.57  ? 120 PRO C N   1 
ATOM   2337 C CA  . PRO C 3 104 ? 35.584  -10.531 49.107 1.00 49.86  ? 120 PRO C CA  1 
ATOM   2338 C C   . PRO C 3 104 ? 34.663  -9.458  49.653 1.00 50.27  ? 120 PRO C C   1 
ATOM   2339 O O   . PRO C 3 104 ? 34.716  -9.155  50.840 1.00 52.49  ? 120 PRO C O   1 
ATOM   2340 C CB  . PRO C 3 104 ? 36.878  -9.905  48.589 1.00 49.38  ? 120 PRO C CB  1 
ATOM   2341 C CG  . PRO C 3 104 ? 37.301  -10.822 47.489 1.00 49.84  ? 120 PRO C CG  1 
ATOM   2342 C CD  . PRO C 3 104 ? 36.020  -11.252 46.826 1.00 50.35  ? 120 PRO C CD  1 
ATOM   2343 N N   . ASN C 3 105 ? 33.804  -8.914  48.796 1.00 49.59  ? 121 ASN C N   1 
ATOM   2344 C CA  . ASN C 3 105 ? 32.975  -7.781  49.173 1.00 48.59  ? 121 ASN C CA  1 
ATOM   2345 C C   . ASN C 3 105 ? 31.499  -8.056  49.452 1.00 47.89  ? 121 ASN C C   1 
ATOM   2346 O O   . ASN C 3 105 ? 30.710  -7.120  49.638 1.00 48.57  ? 121 ASN C O   1 
ATOM   2347 C CB  . ASN C 3 105 ? 33.116  -6.675  48.121 1.00 49.44  ? 121 ASN C CB  1 
ATOM   2348 C CG  . ASN C 3 105 ? 33.906  -5.496  48.631 1.00 51.04  ? 121 ASN C CG  1 
ATOM   2349 O OD1 . ASN C 3 105 ? 33.927  -5.231  49.831 1.00 53.34  ? 121 ASN C OD1 1 
ATOM   2350 N ND2 . ASN C 3 105 ? 34.544  -4.764  47.725 1.00 53.24  ? 121 ASN C ND2 1 
ATOM   2351 N N   . LEU C 3 106 ? 31.118  -9.325  49.505 1.00 45.31  ? 122 LEU C N   1 
ATOM   2352 C CA  . LEU C 3 106 ? 29.709  -9.649  49.690 1.00 44.11  ? 122 LEU C CA  1 
ATOM   2353 C C   . LEU C 3 106 ? 29.204  -9.227  51.050 1.00 43.90  ? 122 LEU C C   1 
ATOM   2354 O O   . LEU C 3 106 ? 29.624  -9.752  52.071 1.00 44.69  ? 122 LEU C O   1 
ATOM   2355 C CB  . LEU C 3 106 ? 29.445  -11.133 49.468 1.00 43.57  ? 122 LEU C CB  1 
ATOM   2356 C CG  . LEU C 3 106 ? 27.970  -11.484 49.296 1.00 43.67  ? 122 LEU C CG  1 
ATOM   2357 C CD1 . LEU C 3 106 ? 27.369  -10.799 48.058 1.00 43.04  ? 122 LEU C CD1 1 
ATOM   2358 C CD2 . LEU C 3 106 ? 27.826  -12.987 49.207 1.00 44.59  ? 122 LEU C CD2 1 
ATOM   2359 N N   . GLN C 3 107 ? 28.308  -8.255  51.062 1.00 44.35  ? 123 GLN C N   1 
ATOM   2360 C CA  . GLN C 3 107 ? 27.741  -7.788  52.313 1.00 44.48  ? 123 GLN C CA  1 
ATOM   2361 C C   . GLN C 3 107 ? 26.365  -8.394  52.509 1.00 43.23  ? 123 GLN C C   1 
ATOM   2362 O O   . GLN C 3 107 ? 25.974  -8.720  53.624 1.00 43.00  ? 123 GLN C O   1 
ATOM   2363 C CB  . GLN C 3 107 ? 27.652  -6.258  52.331 1.00 46.22  ? 123 GLN C CB  1 
ATOM   2364 C CG  . GLN C 3 107 ? 28.990  -5.555  52.535 1.00 50.07  ? 123 GLN C CG  1 
ATOM   2365 C CD  . GLN C 3 107 ? 28.877  -4.030  52.551 1.00 52.75  ? 123 GLN C CD  1 
ATOM   2366 O OE1 . GLN C 3 107 ? 28.004  -3.445  51.903 1.00 54.84  ? 123 GLN C OE1 1 
ATOM   2367 N NE2 . GLN C 3 107 ? 29.775  -3.386  53.283 1.00 55.27  ? 123 GLN C NE2 1 
ATOM   2368 N N   . TYR C 3 108 ? 25.645  -8.571  51.409 1.00 43.89  ? 124 TYR C N   1 
ATOM   2369 C CA  . TYR C 3 108 ? 24.262  -9.003  51.468 1.00 43.38  ? 124 TYR C CA  1 
ATOM   2370 C C   . TYR C 3 108 ? 23.966  -10.087 50.438 1.00 40.90  ? 124 TYR C C   1 
ATOM   2371 O O   . TYR C 3 108 ? 24.329  -9.955  49.274 1.00 41.25  ? 124 TYR C O   1 
ATOM   2372 C CB  . TYR C 3 108 ? 23.360  -7.780  51.253 1.00 46.41  ? 124 TYR C CB  1 
ATOM   2373 C CG  . TYR C 3 108 ? 21.884  -8.079  51.305 1.00 55.89  ? 124 TYR C CG  1 
ATOM   2374 C CD1 . TYR C 3 108 ? 21.335  -8.808  52.365 1.00 60.96  ? 124 TYR C CD1 1 
ATOM   2375 C CD2 . TYR C 3 108 ? 21.024  -7.629  50.303 1.00 58.39  ? 124 TYR C CD2 1 
ATOM   2376 C CE1 . TYR C 3 108 ? 19.963  -9.093  52.420 1.00 62.69  ? 124 TYR C CE1 1 
ATOM   2377 C CE2 . TYR C 3 108 ? 19.654  -7.903  50.350 1.00 61.99  ? 124 TYR C CE2 1 
ATOM   2378 C CZ  . TYR C 3 108 ? 19.131  -8.637  51.413 1.00 62.88  ? 124 TYR C CZ  1 
ATOM   2379 O OH  . TYR C 3 108 ? 17.781  -8.919  51.473 1.00 64.68  ? 124 TYR C OH  1 
ATOM   2380 N N   . LEU C 3 109 ? 23.329  -11.167 50.880 1.00 38.99  ? 125 LEU C N   1 
ATOM   2381 C CA  . LEU C 3 109 ? 22.862  -12.218 49.966 1.00 38.15  ? 125 LEU C CA  1 
ATOM   2382 C C   . LEU C 3 109 ? 21.419  -12.614 50.266 1.00 36.65  ? 125 LEU C C   1 
ATOM   2383 O O   . LEU C 3 109 ? 21.140  -13.244 51.286 1.00 35.81  ? 125 LEU C O   1 
ATOM   2384 C CB  . LEU C 3 109 ? 23.760  -13.445 50.028 1.00 38.47  ? 125 LEU C CB  1 
ATOM   2385 C CG  . LEU C 3 109 ? 23.242  -14.684 49.297 1.00 39.58  ? 125 LEU C CG  1 
ATOM   2386 C CD1 . LEU C 3 109 ? 22.988  -14.400 47.821 1.00 39.97  ? 125 LEU C CD1 1 
ATOM   2387 C CD2 . LEU C 3 109 ? 24.242  -15.790 49.448 1.00 40.39  ? 125 LEU C CD2 1 
ATOM   2388 N N   . LEU C 3 110 ? 20.518  -12.254 49.358 1.00 36.30  ? 126 LEU C N   1 
ATOM   2389 C CA  . LEU C 3 110 ? 19.092  -12.462 49.560 1.00 36.02  ? 126 LEU C CA  1 
ATOM   2390 C C   . LEU C 3 110 ? 18.527  -13.491 48.616 1.00 34.68  ? 126 LEU C C   1 
ATOM   2391 O O   . LEU C 3 110 ? 18.616  -13.336 47.402 1.00 35.65  ? 126 LEU C O   1 
ATOM   2392 C CB  . LEU C 3 110 ? 18.320  -11.152 49.361 1.00 37.97  ? 126 LEU C CB  1 
ATOM   2393 C CG  . LEU C 3 110 ? 16.781  -11.279 49.352 1.00 44.03  ? 126 LEU C CG  1 
ATOM   2394 C CD1 . LEU C 3 110 ? 16.220  -11.778 50.700 1.00 48.27  ? 126 LEU C CD1 1 
ATOM   2395 C CD2 . LEU C 3 110 ? 16.091  -9.969  48.957 1.00 46.43  ? 126 LEU C CD2 1 
ATOM   2396 N N   . ILE C 3 111 ? 17.948  -14.547 49.175 1.00 32.87  ? 127 ILE C N   1 
ATOM   2397 C CA  . ILE C 3 111 ? 17.216  -15.502 48.365 1.00 32.65  ? 127 ILE C CA  1 
ATOM   2398 C C   . ILE C 3 111 ? 15.869  -15.721 49.005 1.00 33.85  ? 127 ILE C C   1 
ATOM   2399 O O   . ILE C 3 111 ? 15.784  -16.257 50.103 1.00 33.88  ? 127 ILE C O   1 
ATOM   2400 C CB  . ILE C 3 111 ? 17.950  -16.831 48.230 1.00 31.46  ? 127 ILE C CB  1 
ATOM   2401 C CG1 . ILE C 3 111 ? 19.356  -16.602 47.664 1.00 30.71  ? 127 ILE C CG1 1 
ATOM   2402 C CG2 . ILE C 3 111 ? 17.159  -17.740 47.325 1.00 32.36  ? 127 ILE C CG2 1 
ATOM   2403 C CD1 . ILE C 3 111 ? 20.087  -17.842 47.305 1.00 26.43  ? 127 ILE C CD1 1 
ATOM   2404 N N   . SER C 3 112 ? 14.817  -15.294 48.315 1.00 35.05  ? 128 SER C N   1 
ATOM   2405 C CA  . SER C 3 112 ? 13.479  -15.394 48.860 1.00 36.79  ? 128 SER C CA  1 
ATOM   2406 C C   . SER C 3 112 ? 12.403  -15.689 47.821 1.00 36.44  ? 128 SER C C   1 
ATOM   2407 O O   . SER C 3 112 ? 12.556  -15.394 46.640 1.00 35.18  ? 128 SER C O   1 
ATOM   2408 C CB  . SER C 3 112 ? 13.131  -14.124 49.636 1.00 39.18  ? 128 SER C CB  1 
ATOM   2409 O OG  . SER C 3 112 ? 12.727  -13.081 48.764 1.00 45.10  ? 128 SER C OG  1 
ATOM   2410 N N   . ASN C 3 113 ? 11.299  -16.253 48.309 1.00 37.83  ? 129 ASN C N   1 
ATOM   2411 C CA  . ASN C 3 113 ? 10.162  -16.681 47.501 1.00 36.37  ? 129 ASN C CA  1 
ATOM   2412 C C   . ASN C 3 113 ? 10.554  -17.528 46.286 1.00 38.28  ? 129 ASN C C   1 
ATOM   2413 O O   . ASN C 3 113 ? 10.099  -17.294 45.167 1.00 39.80  ? 129 ASN C O   1 
ATOM   2414 C CB  . ASN C 3 113 ? 9.288   -15.494 47.121 1.00 35.62  ? 129 ASN C CB  1 
ATOM   2415 C CG  . ASN C 3 113 ? 7.855   -15.699 47.525 1.00 36.41  ? 129 ASN C CG  1 
ATOM   2416 O OD1 . ASN C 3 113 ? 7.399   -16.831 47.629 1.00 42.34  ? 129 ASN C OD1 1 
ATOM   2417 N ND2 . ASN C 3 113 ? 7.127   -14.608 47.753 1.00 36.15  ? 129 ASN C ND2 1 
ATOM   2418 N N   . THR C 3 114 ? 11.382  -18.536 46.561 1.00 40.12  ? 130 THR C N   1 
ATOM   2419 C CA  . THR C 3 114 ? 11.951  -19.421 45.553 1.00 43.38  ? 130 THR C CA  1 
ATOM   2420 C C   . THR C 3 114 ? 11.470  -20.858 45.740 1.00 44.49  ? 130 THR C C   1 
ATOM   2421 O O   . THR C 3 114 ? 10.735  -21.167 46.673 1.00 45.81  ? 130 THR C O   1 
ATOM   2422 C CB  . THR C 3 114 ? 13.479  -19.376 45.661 1.00 44.57  ? 130 THR C CB  1 
ATOM   2423 O OG1 . THR C 3 114 ? 13.903  -18.005 45.633 1.00 47.78  ? 130 THR C OG1 1 
ATOM   2424 C CG2 . THR C 3 114 ? 14.137  -20.016 44.455 1.00 46.04  ? 130 THR C CG2 1 
ATOM   2425 N N   . GLY C 3 115 ? 11.899  -21.732 44.832 1.00 45.18  ? 131 GLY C N   1 
ATOM   2426 C CA  . GLY C 3 115 ? 11.567  -23.138 44.890 1.00 46.39  ? 131 GLY C CA  1 
ATOM   2427 C C   . GLY C 3 115 ? 12.761  -24.007 45.252 1.00 49.60  ? 131 GLY C C   1 
ATOM   2428 O O   . GLY C 3 115 ? 12.621  -25.228 45.342 1.00 53.06  ? 131 GLY C O   1 
ATOM   2429 N N   . ILE C 3 116 ? 13.931  -23.402 45.457 1.00 50.62  ? 132 ILE C N   1 
ATOM   2430 C CA  . ILE C 3 116 ? 15.117  -24.173 45.854 1.00 49.05  ? 132 ILE C CA  1 
ATOM   2431 C C   . ILE C 3 116 ? 14.763  -25.045 47.046 1.00 50.05  ? 132 ILE C C   1 
ATOM   2432 O O   . ILE C 3 116 ? 13.919  -24.674 47.874 1.00 47.98  ? 132 ILE C O   1 
ATOM   2433 C CB  . ILE C 3 116 ? 16.342  -23.272 46.194 1.00 48.27  ? 132 ILE C CB  1 
ATOM   2434 C CG1 . ILE C 3 116 ? 15.983  -22.180 47.207 1.00 49.64  ? 132 ILE C CG1 1 
ATOM   2435 C CG2 . ILE C 3 116 ? 16.900  -22.645 44.949 1.00 47.70  ? 132 ILE C CG2 1 
ATOM   2436 C CD1 . ILE C 3 116 ? 17.184  -21.474 47.797 1.00 47.14  ? 132 ILE C CD1 1 
ATOM   2437 N N   . LYS C 3 117 ? 15.403  -26.206 47.119 1.00 51.63  ? 133 LYS C N   1 
ATOM   2438 C CA  . LYS C 3 117 ? 15.118  -27.159 48.192 1.00 52.62  ? 133 LYS C CA  1 
ATOM   2439 C C   . LYS C 3 117 ? 16.308  -27.325 49.121 1.00 51.12  ? 133 LYS C C   1 
ATOM   2440 O O   . LYS C 3 117 ? 16.225  -28.008 50.140 1.00 49.40  ? 133 LYS C O   1 
ATOM   2441 C CB  . LYS C 3 117 ? 14.689  -28.503 47.610 1.00 55.31  ? 133 LYS C CB  1 
ATOM   2442 C CG  . LYS C 3 117 ? 13.622  -28.378 46.520 1.00 60.21  ? 133 LYS C CG  1 
ATOM   2443 C CD  . LYS C 3 117 ? 13.221  -29.726 45.936 1.00 63.56  ? 133 LYS C CD  1 
ATOM   2444 C CE  . LYS C 3 117 ? 12.211  -29.529 44.817 1.00 66.07  ? 133 LYS C CE  1 
ATOM   2445 N NZ  . LYS C 3 117 ? 11.772  -30.823 44.229 1.00 67.82  ? 133 LYS C NZ  1 
ATOM   2446 N N   . HIS C 3 118 ? 17.413  -26.680 48.748 1.00 51.48  ? 134 HIS C N   1 
ATOM   2447 C CA  . HIS C 3 118 ? 18.650  -26.681 49.511 1.00 52.32  ? 134 HIS C CA  1 
ATOM   2448 C C   . HIS C 3 118 ? 19.206  -25.275 49.721 1.00 50.55  ? 134 HIS C C   1 
ATOM   2449 O O   . HIS C 3 118 ? 19.156  -24.439 48.819 1.00 50.88  ? 134 HIS C O   1 
ATOM   2450 C CB  . HIS C 3 118 ? 19.713  -27.506 48.793 1.00 55.25  ? 134 HIS C CB  1 
ATOM   2451 C CG  . HIS C 3 118 ? 19.482  -28.989 48.864 1.00 59.38  ? 134 HIS C CG  1 
ATOM   2452 N ND1 . HIS C 3 118 ? 19.899  -29.855 47.872 1.00 61.98  ? 134 HIS C ND1 1 
ATOM   2453 C CD2 . HIS C 3 118 ? 18.888  -29.754 49.814 1.00 60.63  ? 134 HIS C CD2 1 
ATOM   2454 C CE1 . HIS C 3 118 ? 19.575  -31.091 48.207 1.00 63.79  ? 134 HIS C CE1 1 
ATOM   2455 N NE2 . HIS C 3 118 ? 18.960  -31.056 49.382 1.00 64.01  ? 134 HIS C NE2 1 
ATOM   2456 N N   . LEU C 3 119 ? 19.747  -25.030 50.913 1.00 47.76  ? 135 LEU C N   1 
ATOM   2457 C CA  . LEU C 3 119 ? 20.457  -23.784 51.200 1.00 44.73  ? 135 LEU C CA  1 
ATOM   2458 C C   . LEU C 3 119 ? 21.677  -23.638 50.286 1.00 44.99  ? 135 LEU C C   1 
ATOM   2459 O O   . LEU C 3 119 ? 22.312  -24.625 49.932 1.00 47.71  ? 135 LEU C O   1 
ATOM   2460 C CB  . LEU C 3 119 ? 20.900  -23.760 52.658 1.00 42.76  ? 135 LEU C CB  1 
ATOM   2461 C CG  . LEU C 3 119 ? 19.835  -23.596 53.743 1.00 40.49  ? 135 LEU C CG  1 
ATOM   2462 C CD1 . LEU C 3 119 ? 20.528  -23.530 55.068 1.00 40.74  ? 135 LEU C CD1 1 
ATOM   2463 C CD2 . LEU C 3 119 ? 19.013  -22.340 53.545 1.00 41.42  ? 135 LEU C CD2 1 
ATOM   2464 N N   . PRO C 3 120 ? 22.017  -22.413 49.905 1.00 44.45  ? 136 PRO C N   1 
ATOM   2465 C CA  . PRO C 3 120 ? 23.126  -22.172 48.989 1.00 45.35  ? 136 PRO C CA  1 
ATOM   2466 C C   . PRO C 3 120 ? 24.426  -22.723 49.536 1.00 46.87  ? 136 PRO C C   1 
ATOM   2467 O O   . PRO C 3 120 ? 24.578  -22.821 50.749 1.00 49.07  ? 136 PRO C O   1 
ATOM   2468 C CB  . PRO C 3 120 ? 23.215  -20.650 48.950 1.00 44.83  ? 136 PRO C CB  1 
ATOM   2469 C CG  . PRO C 3 120 ? 21.901  -20.189 49.351 1.00 44.70  ? 136 PRO C CG  1 
ATOM   2470 C CD  . PRO C 3 120 ? 21.396  -21.158 50.344 1.00 44.88  ? 136 PRO C CD  1 
ATOM   2471 N N   . ASP C 3 121 ? 25.357  -23.071 48.653 1.00 49.30  ? 137 ASP C N   1 
ATOM   2472 C CA  . ASP C 3 121 ? 26.698  -23.493 49.075 1.00 51.99  ? 137 ASP C CA  1 
ATOM   2473 C C   . ASP C 3 121 ? 27.572  -22.248 49.133 1.00 51.31  ? 137 ASP C C   1 
ATOM   2474 O O   . ASP C 3 121 ? 27.965  -21.695 48.107 1.00 51.10  ? 137 ASP C O   1 
ATOM   2475 C CB  . ASP C 3 121 ? 27.281  -24.538 48.112 1.00 54.92  ? 137 ASP C CB  1 
ATOM   2476 C CG  . ASP C 3 121 ? 28.532  -25.239 48.674 1.00 58.34  ? 137 ASP C CG  1 
ATOM   2477 O OD1 . ASP C 3 121 ? 29.565  -24.564 48.889 1.00 59.74  ? 137 ASP C OD1 1 
ATOM   2478 O OD2 . ASP C 3 121 ? 28.557  -26.473 48.908 1.00 59.95  ? 137 ASP C OD2 1 
ATOM   2479 N N   . VAL C 3 122 ? 27.880  -21.815 50.344 1.00 50.92  ? 138 VAL C N   1 
ATOM   2480 C CA  . VAL C 3 122 ? 28.537  -20.533 50.520 1.00 50.60  ? 138 VAL C CA  1 
ATOM   2481 C C   . VAL C 3 122 ? 29.978  -20.689 50.935 1.00 51.53  ? 138 VAL C C   1 
ATOM   2482 O O   . VAL C 3 122 ? 30.685  -19.687 51.106 1.00 48.28  ? 138 VAL C O   1 
ATOM   2483 C CB  . VAL C 3 122 ? 27.801  -19.672 51.581 1.00 50.40  ? 138 VAL C CB  1 
ATOM   2484 C CG1 . VAL C 3 122 ? 26.364  -19.402 51.158 1.00 49.46  ? 138 VAL C CG1 1 
ATOM   2485 C CG2 . VAL C 3 122 ? 27.835  -20.348 52.938 1.00 50.47  ? 138 VAL C CG2 1 
ATOM   2486 N N   . HIS C 3 123 ? 30.416  -21.946 51.065 1.00 54.21  ? 139 HIS C N   1 
ATOM   2487 C CA  . HIS C 3 123 ? 31.721  -22.232 51.674 1.00 55.49  ? 139 HIS C CA  1 
ATOM   2488 C C   . HIS C 3 123 ? 32.923  -21.797 50.855 1.00 54.69  ? 139 HIS C C   1 
ATOM   2489 O O   . HIS C 3 123 ? 34.047  -21.808 51.341 1.00 54.41  ? 139 HIS C O   1 
ATOM   2490 C CB  . HIS C 3 123 ? 31.829  -23.678 52.217 1.00 57.14  ? 139 HIS C CB  1 
ATOM   2491 C CG  . HIS C 3 123 ? 32.036  -24.736 51.176 1.00 63.11  ? 139 HIS C CG  1 
ATOM   2492 N ND1 . HIS C 3 123 ? 31.061  -25.650 50.840 1.00 65.39  ? 139 HIS C ND1 1 
ATOM   2493 C CD2 . HIS C 3 123 ? 33.131  -25.070 50.449 1.00 65.87  ? 139 HIS C CD2 1 
ATOM   2494 C CE1 . HIS C 3 123 ? 31.538  -26.489 49.937 1.00 66.70  ? 139 HIS C CE1 1 
ATOM   2495 N NE2 . HIS C 3 123 ? 32.791  -26.159 49.682 1.00 67.19  ? 139 HIS C NE2 1 
ATOM   2496 N N   . LYS C 3 124 ? 32.666  -21.345 49.634 1.00 55.77  ? 140 LYS C N   1 
ATOM   2497 C CA  . LYS C 3 124 ? 33.721  -20.779 48.800 1.00 55.16  ? 140 LYS C CA  1 
ATOM   2498 C C   . LYS C 3 124 ? 33.716  -19.243 48.718 1.00 54.47  ? 140 LYS C C   1 
ATOM   2499 O O   . LYS C 3 124 ? 34.666  -18.665 48.186 1.00 54.39  ? 140 LYS C O   1 
ATOM   2500 C CB  . LYS C 3 124 ? 33.682  -21.390 47.394 1.00 56.07  ? 140 LYS C CB  1 
ATOM   2501 C CG  . LYS C 3 124 ? 34.058  -22.866 47.372 1.00 58.43  ? 140 LYS C CG  1 
ATOM   2502 C CD  . LYS C 3 124 ? 35.015  -23.175 46.228 1.00 61.47  ? 140 LYS C CD  1 
ATOM   2503 C CE  . LYS C 3 124 ? 35.970  -24.300 46.604 1.00 61.46  ? 140 LYS C CE  1 
ATOM   2504 N NZ  . LYS C 3 124 ? 36.678  -24.809 45.402 1.00 62.31  ? 140 LYS C NZ  1 
ATOM   2505 N N   . ILE C 3 125 ? 32.677  -18.590 49.256 1.00 52.84  ? 141 ILE C N   1 
ATOM   2506 C CA  . ILE C 3 125 ? 32.550  -17.126 49.144 1.00 52.19  ? 141 ILE C CA  1 
ATOM   2507 C C   . ILE C 3 125 ? 33.707  -16.372 49.802 1.00 52.92  ? 141 ILE C C   1 
ATOM   2508 O O   . ILE C 3 125 ? 34.305  -15.497 49.165 1.00 53.24  ? 141 ILE C O   1 
ATOM   2509 C CB  . ILE C 3 125 ? 31.180  -16.614 49.672 1.00 51.50  ? 141 ILE C CB  1 
ATOM   2510 C CG1 . ILE C 3 125 ? 30.052  -17.045 48.743 1.00 50.34  ? 141 ILE C CG1 1 
ATOM   2511 C CG2 . ILE C 3 125 ? 31.164  -15.089 49.773 1.00 50.45  ? 141 ILE C CG2 1 
ATOM   2512 C CD1 . ILE C 3 125 ? 28.677  -16.750 49.297 1.00 50.18  ? 141 ILE C CD1 1 
ATOM   2513 N N   . HIS C 3 126 ? 34.018  -16.715 51.057 1.00 51.79  ? 142 HIS C N   1 
ATOM   2514 C CA  . HIS C 3 126 ? 35.119  -16.101 51.818 1.00 51.81  ? 142 HIS C CA  1 
ATOM   2515 C C   . HIS C 3 126 ? 35.032  -14.589 51.842 1.00 51.71  ? 142 HIS C C   1 
ATOM   2516 O O   . HIS C 3 126 ? 36.047  -13.904 51.682 1.00 51.76  ? 142 HIS C O   1 
ATOM   2517 C CB  . HIS C 3 126 ? 36.488  -16.484 51.241 1.00 53.27  ? 142 HIS C CB  1 
ATOM   2518 C CG  . HIS C 3 126 ? 36.796  -17.944 51.308 1.00 58.00  ? 142 HIS C CG  1 
ATOM   2519 N ND1 . HIS C 3 126 ? 36.942  -18.622 52.503 1.00 60.74  ? 142 HIS C ND1 1 
ATOM   2520 C CD2 . HIS C 3 126 ? 37.003  -18.857 50.326 1.00 58.26  ? 142 HIS C CD2 1 
ATOM   2521 C CE1 . HIS C 3 126 ? 37.215  -19.891 52.252 1.00 60.82  ? 142 HIS C CE1 1 
ATOM   2522 N NE2 . HIS C 3 126 ? 37.258  -20.060 50.939 1.00 60.48  ? 142 HIS C NE2 1 
ATOM   2523 N N   . SER C 3 127 ? 33.829  -14.059 52.020 1.00 50.86  ? 143 SER C N   1 
ATOM   2524 C CA  . SER C 3 127 ? 33.670  -12.615 52.047 1.00 50.68  ? 143 SER C CA  1 
ATOM   2525 C C   . SER C 3 127 ? 34.439  -11.990 53.214 1.00 50.09  ? 143 SER C C   1 
ATOM   2526 O O   . SER C 3 127 ? 34.409  -12.504 54.336 1.00 49.05  ? 143 SER C O   1 
ATOM   2527 C CB  . SER C 3 127 ? 32.192  -12.229 52.111 1.00 50.26  ? 143 SER C CB  1 
ATOM   2528 O OG  . SER C 3 127 ? 32.050  -10.818 52.106 1.00 50.62  ? 143 SER C OG  1 
ATOM   2529 N N   . LEU C 3 128 ? 35.132  -10.888 52.924 1.00 50.36  ? 144 LEU C N   1 
ATOM   2530 C CA  . LEU C 3 128 ? 35.924  -10.144 53.915 1.00 50.70  ? 144 LEU C CA  1 
ATOM   2531 C C   . LEU C 3 128 ? 35.104  -9.257  54.849 1.00 50.12  ? 144 LEU C C   1 
ATOM   2532 O O   . LEU C 3 128 ? 35.635  -8.712  55.820 1.00 50.68  ? 144 LEU C O   1 
ATOM   2533 C CB  . LEU C 3 128 ? 36.965  -9.264  53.223 1.00 50.92  ? 144 LEU C CB  1 
ATOM   2534 C CG  . LEU C 3 128 ? 38.288  -9.863  52.747 1.00 52.22  ? 144 LEU C CG  1 
ATOM   2535 C CD1 . LEU C 3 128 ? 39.285  -8.722  52.644 1.00 52.53  ? 144 LEU C CD1 1 
ATOM   2536 C CD2 . LEU C 3 128 ? 38.819  -10.962 53.676 1.00 51.75  ? 144 LEU C CD2 1 
ATOM   2537 N N   . GLN C 3 129 ? 33.824  -9.084  54.550 1.00 48.23  ? 145 GLN C N   1 
ATOM   2538 C CA  . GLN C 3 129 ? 32.991  -8.275  55.417 1.00 46.28  ? 145 GLN C CA  1 
ATOM   2539 C C   . GLN C 3 129 ? 31.937  -9.132  56.101 1.00 44.56  ? 145 GLN C C   1 
ATOM   2540 O O   . GLN C 3 129 ? 31.701  -10.289 55.740 1.00 41.67  ? 145 GLN C O   1 
ATOM   2541 C CB  . GLN C 3 129 ? 32.300  -7.154  54.625 1.00 46.61  ? 145 GLN C CB  1 
ATOM   2542 C CG  . GLN C 3 129 ? 32.778  -7.001  53.199 1.00 49.35  ? 145 GLN C CG  1 
ATOM   2543 C CD  . GLN C 3 129 ? 33.742  -5.852  53.018 1.00 52.13  ? 145 GLN C CD  1 
ATOM   2544 O OE1 . GLN C 3 129 ? 33.406  -4.697  53.306 1.00 52.56  ? 145 GLN C OE1 1 
ATOM   2545 N NE2 . GLN C 3 129 ? 34.940  -6.156  52.513 1.00 52.35  ? 145 GLN C NE2 1 
ATOM   2546 N N   . LYS C 3 130 ? 31.329  -8.547  57.122 1.00 42.44  ? 146 LYS C N   1 
ATOM   2547 C CA  . LYS C 3 130 ? 30.116  -9.079  57.681 1.00 41.68  ? 146 LYS C CA  1 
ATOM   2548 C C   . LYS C 3 130 ? 29.101  -9.244  56.556 1.00 40.38  ? 146 LYS C C   1 
ATOM   2549 O O   . LYS C 3 130 ? 28.939  -8.363  55.706 1.00 40.33  ? 146 LYS C O   1 
ATOM   2550 C CB  . LYS C 3 130 ? 29.591  -8.130  58.747 1.00 43.71  ? 146 LYS C CB  1 
ATOM   2551 C CG  . LYS C 3 130 ? 30.520  -8.063  59.930 1.00 47.52  ? 146 LYS C CG  1 
ATOM   2552 C CD  . LYS C 3 130 ? 30.155  -6.982  60.904 1.00 49.76  ? 146 LYS C CD  1 
ATOM   2553 C CE  . LYS C 3 130 ? 31.104  -7.070  62.078 1.00 54.03  ? 146 LYS C CE  1 
ATOM   2554 N NZ  . LYS C 3 130 ? 30.919  -5.922  62.987 1.00 61.27  ? 146 LYS C NZ  1 
ATOM   2555 N N   . VAL C 3 131 ? 28.452  -10.401 56.550 1.00 39.54  ? 147 VAL C N   1 
ATOM   2556 C CA  . VAL C 3 131 ? 27.453  -10.745 55.554 1.00 37.11  ? 147 VAL C CA  1 
ATOM   2557 C C   . VAL C 3 131 ? 26.117  -10.891 56.255 1.00 37.31  ? 147 VAL C C   1 
ATOM   2558 O O   . VAL C 3 131 ? 26.050  -11.369 57.387 1.00 38.27  ? 147 VAL C O   1 
ATOM   2559 C CB  . VAL C 3 131 ? 27.775  -12.090 54.837 1.00 36.07  ? 147 VAL C CB  1 
ATOM   2560 C CG1 . VAL C 3 131 ? 26.728  -12.414 53.813 1.00 36.20  ? 147 VAL C CG1 1 
ATOM   2561 C CG2 . VAL C 3 131 ? 29.109  -12.038 54.167 1.00 34.46  ? 147 VAL C CG2 1 
ATOM   2562 N N   . LEU C 3 132 ? 25.065  -10.440 55.579 1.00 37.52  ? 148 LEU C N   1 
ATOM   2563 C CA  . LEU C 3 132 ? 23.693  -10.679 55.993 1.00 34.20  ? 148 LEU C CA  1 
ATOM   2564 C C   . LEU C 3 132 ? 23.176  -11.700 55.014 1.00 32.48  ? 148 LEU C C   1 
ATOM   2565 O O   . LEU C 3 132 ? 23.030  -11.407 53.833 1.00 30.83  ? 148 LEU C O   1 
ATOM   2566 C CB  . LEU C 3 132 ? 22.881  -9.395  55.892 1.00 35.85  ? 148 LEU C CB  1 
ATOM   2567 C CG  . LEU C 3 132 ? 21.359  -9.466  55.848 1.00 35.64  ? 148 LEU C CG  1 
ATOM   2568 C CD1 . LEU C 3 132 ? 20.807  -10.472 56.853 1.00 39.70  ? 148 LEU C CD1 1 
ATOM   2569 C CD2 . LEU C 3 132 ? 20.844  -8.100  56.136 1.00 34.74  ? 148 LEU C CD2 1 
ATOM   2570 N N   . LEU C 3 133 ? 22.950  -12.911 55.496 1.00 32.92  ? 149 LEU C N   1 
ATOM   2571 C CA  . LEU C 3 133 ? 22.433  -13.975 54.650 1.00 33.54  ? 149 LEU C CA  1 
ATOM   2572 C C   . LEU C 3 133 ? 20.951  -14.077 54.965 1.00 35.42  ? 149 LEU C C   1 
ATOM   2573 O O   . LEU C 3 133 ? 20.557  -14.447 56.077 1.00 35.35  ? 149 LEU C O   1 
ATOM   2574 C CB  . LEU C 3 133 ? 23.143  -15.294 54.941 1.00 31.93  ? 149 LEU C CB  1 
ATOM   2575 C CG  . LEU C 3 133 ? 22.767  -16.485 54.041 1.00 32.68  ? 149 LEU C CG  1 
ATOM   2576 C CD1 . LEU C 3 133 ? 23.536  -16.475 52.715 1.00 32.04  ? 149 LEU C CD1 1 
ATOM   2577 C CD2 . LEU C 3 133 ? 23.008  -17.794 54.762 1.00 30.20  ? 149 LEU C CD2 1 
ATOM   2578 N N   . ASP C 3 134 ? 20.127  -13.728 53.988 1.00 35.06  ? 150 ASP C N   1 
ATOM   2579 C CA  . ASP C 3 134 ? 18.711  -13.622 54.241 1.00 37.78  ? 150 ASP C CA  1 
ATOM   2580 C C   . ASP C 3 134 ? 17.937  -14.488 53.275 1.00 39.23  ? 150 ASP C C   1 
ATOM   2581 O O   . ASP C 3 134 ? 17.530  -14.051 52.201 1.00 42.12  ? 150 ASP C O   1 
ATOM   2582 C CB  . ASP C 3 134 ? 18.269  -12.162 54.147 1.00 39.67  ? 150 ASP C CB  1 
ATOM   2583 C CG  . ASP C 3 134 ? 16.780  -11.986 54.408 1.00 43.64  ? 150 ASP C CG  1 
ATOM   2584 O OD1 . ASP C 3 134 ? 16.140  -12.922 54.927 1.00 44.83  ? 150 ASP C OD1 1 
ATOM   2585 O OD2 . ASP C 3 134 ? 16.175  -10.932 54.121 1.00 49.74  ? 150 ASP C OD2 1 
ATOM   2586 N N   . ILE C 3 135 ? 17.727  -15.727 53.689 1.00 39.48  ? 151 ILE C N   1 
ATOM   2587 C CA  . ILE C 3 135 ? 17.031  -16.714 52.895 1.00 40.03  ? 151 ILE C CA  1 
ATOM   2588 C C   . ILE C 3 135 ? 15.642  -16.962 53.504 1.00 42.98  ? 151 ILE C C   1 
ATOM   2589 O O   . ILE C 3 135 ? 15.538  -17.495 54.614 1.00 44.53  ? 151 ILE C O   1 
ATOM   2590 C CB  . ILE C 3 135 ? 17.908  -17.958 52.858 1.00 38.64  ? 151 ILE C CB  1 
ATOM   2591 C CG1 . ILE C 3 135 ? 19.055  -17.701 51.893 1.00 38.01  ? 151 ILE C CG1 1 
ATOM   2592 C CG2 . ILE C 3 135 ? 17.126  -19.166 52.431 1.00 40.67  ? 151 ILE C CG2 1 
ATOM   2593 C CD1 . ILE C 3 135 ? 20.328  -18.315 52.274 1.00 39.66  ? 151 ILE C CD1 1 
ATOM   2594 N N   . GLN C 3 136 ? 14.585  -16.547 52.792 1.00 45.30  ? 152 GLN C N   1 
ATOM   2595 C CA  . GLN C 3 136 ? 13.205  -16.622 53.319 1.00 46.21  ? 152 GLN C CA  1 
ATOM   2596 C C   . GLN C 3 136 ? 12.182  -17.110 52.320 1.00 46.67  ? 152 GLN C C   1 
ATOM   2597 O O   . GLN C 3 136 ? 12.447  -17.177 51.121 1.00 47.92  ? 152 GLN C O   1 
ATOM   2598 C CB  . GLN C 3 136 ? 12.686  -15.260 53.765 1.00 45.91  ? 152 GLN C CB  1 
ATOM   2599 C CG  . GLN C 3 136 ? 13.463  -14.525 54.782 1.00 49.04  ? 152 GLN C CG  1 
ATOM   2600 C CD  . GLN C 3 136 ? 12.959  -13.102 54.902 1.00 53.40  ? 152 GLN C CD  1 
ATOM   2601 O OE1 . GLN C 3 136 ? 13.536  -12.295 55.634 1.00 56.99  ? 152 GLN C OE1 1 
ATOM   2602 N NE2 . GLN C 3 136 ? 11.880  -12.784 54.186 1.00 53.88  ? 152 GLN C NE2 1 
ATOM   2603 N N   . ASP C 3 137 ? 10.991  -17.403 52.844 1.00 46.62  ? 153 ASP C N   1 
ATOM   2604 C CA  . ASP C 3 137 ? 9.815   -17.798 52.059 1.00 44.88  ? 153 ASP C CA  1 
ATOM   2605 C C   . ASP C 3 137 ? 10.099  -18.900 51.010 1.00 43.12  ? 153 ASP C C   1 
ATOM   2606 O O   . ASP C 3 137 ? 9.378   -19.059 50.036 1.00 41.09  ? 153 ASP C O   1 
ATOM   2607 C CB  . ASP C 3 137 ? 9.136   -16.549 51.449 1.00 46.94  ? 153 ASP C CB  1 
ATOM   2608 C CG  . ASP C 3 137 ? 8.204   -15.810 52.452 1.00 48.97  ? 153 ASP C CG  1 
ATOM   2609 O OD1 . ASP C 3 137 ? 7.266   -16.437 53.000 1.00 52.38  ? 153 ASP C OD1 1 
ATOM   2610 O OD2 . ASP C 3 137 ? 8.326   -14.590 52.723 1.00 47.17  ? 153 ASP C OD2 1 
ATOM   2611 N N   . ASN C 3 138 ? 11.153  -19.667 51.240 1.00 42.42  ? 154 ASN C N   1 
ATOM   2612 C CA  . ASN C 3 138 ? 11.469  -20.806 50.388 1.00 44.51  ? 154 ASN C CA  1 
ATOM   2613 C C   . ASN C 3 138 ? 10.878  -22.074 50.989 1.00 46.34  ? 154 ASN C C   1 
ATOM   2614 O O   . ASN C 3 138 ? 11.577  -22.842 51.671 1.00 47.43  ? 154 ASN C O   1 
ATOM   2615 C CB  . ASN C 3 138 ? 12.972  -20.962 50.246 1.00 42.29  ? 154 ASN C CB  1 
ATOM   2616 C CG  . ASN C 3 138 ? 13.619  -19.717 49.755 1.00 42.95  ? 154 ASN C CG  1 
ATOM   2617 O OD1 . ASN C 3 138 ? 13.420  -19.324 48.611 1.00 43.26  ? 154 ASN C OD1 1 
ATOM   2618 N ND2 . ASN C 3 138 ? 14.390  -19.062 50.623 1.00 42.12  ? 154 ASN C ND2 1 
ATOM   2619 N N   . ILE C 3 139 ? 9.598   -22.301 50.711 1.00 45.73  ? 155 ILE C N   1 
ATOM   2620 C CA  . ILE C 3 139 ? 8.857   -23.362 51.373 1.00 45.71  ? 155 ILE C CA  1 
ATOM   2621 C C   . ILE C 3 139 ? 9.431   -24.774 51.215 1.00 43.88  ? 155 ILE C C   1 
ATOM   2622 O O   . ILE C 3 139 ? 9.097   -25.648 51.995 1.00 45.36  ? 155 ILE C O   1 
ATOM   2623 C CB  . ILE C 3 139 ? 7.361   -23.275 50.984 1.00 48.94  ? 155 ILE C CB  1 
ATOM   2624 C CG1 . ILE C 3 139 ? 6.483   -23.535 52.221 1.00 54.09  ? 155 ILE C CG1 1 
ATOM   2625 C CG2 . ILE C 3 139 ? 7.038   -24.173 49.778 1.00 47.72  ? 155 ILE C CG2 1 
ATOM   2626 C CD1 . ILE C 3 139 ? 5.043   -22.954 52.124 1.00 59.14  ? 155 ILE C CD1 1 
ATOM   2627 N N   . ASN C 3 140 ? 10.329  -24.983 50.253 1.00 43.67  ? 156 ASN C N   1 
ATOM   2628 C CA  . ASN C 3 140 ? 10.912  -26.307 49.996 1.00 42.56  ? 156 ASN C CA  1 
ATOM   2629 C C   . ASN C 3 140 ? 12.224  -26.608 50.697 1.00 43.60  ? 156 ASN C C   1 
ATOM   2630 O O   . ASN C 3 140 ? 12.762  -27.694 50.509 1.00 45.13  ? 156 ASN C O   1 
ATOM   2631 C CB  . ASN C 3 140 ? 11.155  -26.530 48.500 1.00 44.13  ? 156 ASN C CB  1 
ATOM   2632 C CG  . ASN C 3 140 ? 9.884   -26.547 47.685 1.00 45.35  ? 156 ASN C CG  1 
ATOM   2633 O OD1 . ASN C 3 140 ? 8.834   -26.978 48.162 1.00 46.30  ? 156 ASN C OD1 1 
ATOM   2634 N ND2 . ASN C 3 140 ? 9.968   -26.071 46.448 1.00 44.34  ? 156 ASN C ND2 1 
ATOM   2635 N N   . ILE C 3 141 ? 12.783  -25.669 51.458 1.00 43.63  ? 157 ILE C N   1 
ATOM   2636 C CA  . ILE C 3 141 ? 14.024  -25.984 52.180 1.00 43.36  ? 157 ILE C CA  1 
ATOM   2637 C C   . ILE C 3 141 ? 13.673  -26.614 53.510 1.00 44.36  ? 157 ILE C C   1 
ATOM   2638 O O   . ILE C 3 141 ? 13.135  -25.946 54.400 1.00 45.03  ? 157 ILE C O   1 
ATOM   2639 C CB  . ILE C 3 141 ? 14.908  -24.755 52.452 1.00 43.22  ? 157 ILE C CB  1 
ATOM   2640 C CG1 . ILE C 3 141 ? 15.327  -24.068 51.154 1.00 43.87  ? 157 ILE C CG1 1 
ATOM   2641 C CG2 . ILE C 3 141 ? 16.140  -25.190 53.235 1.00 42.02  ? 157 ILE C CG2 1 
ATOM   2642 C CD1 . ILE C 3 141 ? 15.901  -22.682 51.373 1.00 44.24  ? 157 ILE C CD1 1 
ATOM   2643 N N   . HIS C 3 142 ? 14.018  -27.889 53.661 1.00 44.76  ? 158 HIS C N   1 
ATOM   2644 C CA  . HIS C 3 142 ? 13.655  -28.619 54.863 1.00 42.64  ? 158 HIS C CA  1 
ATOM   2645 C C   . HIS C 3 142 ? 14.801  -28.921 55.837 1.00 42.71  ? 158 HIS C C   1 
ATOM   2646 O O   . HIS C 3 142 ? 14.548  -29.212 57.003 1.00 43.32  ? 158 HIS C O   1 
ATOM   2647 C CB  . HIS C 3 142 ? 12.934  -29.904 54.478 1.00 41.54  ? 158 HIS C CB  1 
ATOM   2648 C CG  . HIS C 3 142 ? 11.658  -29.678 53.709 1.00 40.44  ? 158 HIS C CG  1 
ATOM   2649 N ND1 . HIS C 3 142 ? 10.590  -28.976 54.230 1.00 41.29  ? 158 HIS C ND1 1 
ATOM   2650 C CD2 . HIS C 3 142 ? 11.273  -30.088 52.475 1.00 39.50  ? 158 HIS C CD2 1 
ATOM   2651 C CE1 . HIS C 3 142 ? 9.608   -28.952 53.346 1.00 40.69  ? 158 HIS C CE1 1 
ATOM   2652 N NE2 . HIS C 3 142 ? 9.995   -29.623 52.276 1.00 40.63  ? 158 HIS C NE2 1 
ATOM   2653 N N   . THR C 3 143 ? 16.047  -28.833 55.369 1.00 43.36  ? 159 THR C N   1 
ATOM   2654 C CA  . THR C 3 143 ? 17.199  -29.263 56.175 1.00 46.64  ? 159 THR C CA  1 
ATOM   2655 C C   . THR C 3 143 ? 18.398  -28.281 56.182 1.00 48.31  ? 159 THR C C   1 
ATOM   2656 O O   . THR C 3 143 ? 18.700  -27.657 55.161 1.00 50.58  ? 159 THR C O   1 
ATOM   2657 C CB  . THR C 3 143 ? 17.664  -30.652 55.662 1.00 46.81  ? 159 THR C CB  1 
ATOM   2658 O OG1 . THR C 3 143 ? 16.607  -31.603 55.834 1.00 47.97  ? 159 THR C OG1 1 
ATOM   2659 C CG2 . THR C 3 143 ? 18.804  -31.207 56.504 1.00 49.98  ? 159 THR C CG2 1 
ATOM   2660 N N   . ILE C 3 144 ? 19.066  -28.142 57.334 1.00 49.15  ? 160 ILE C N   1 
ATOM   2661 C CA  . ILE C 3 144 ? 20.385  -27.482 57.425 1.00 51.25  ? 160 ILE C CA  1 
ATOM   2662 C C   . ILE C 3 144 ? 21.383  -28.555 57.846 1.00 52.30  ? 160 ILE C C   1 
ATOM   2663 O O   . ILE C 3 144 ? 21.086  -29.352 58.733 1.00 52.84  ? 160 ILE C O   1 
ATOM   2664 C CB  . ILE C 3 144 ? 20.423  -26.349 58.471 1.00 50.36  ? 160 ILE C CB  1 
ATOM   2665 C CG1 . ILE C 3 144 ? 19.274  -25.359 58.280 1.00 50.00  ? 160 ILE C CG1 1 
ATOM   2666 C CG2 . ILE C 3 144 ? 21.759  -25.619 58.412 1.00 49.11  ? 160 ILE C CG2 1 
ATOM   2667 C CD1 . ILE C 3 144 ? 19.142  -24.338 59.412 1.00 49.41  ? 160 ILE C CD1 1 
ATOM   2668 N N   . GLU C 3 145 ? 22.562  -28.580 57.242 1.00 54.11  ? 161 GLU C N   1 
ATOM   2669 C CA  . GLU C 3 145 ? 23.439  -29.722 57.458 1.00 56.90  ? 161 GLU C CA  1 
ATOM   2670 C C   . GLU C 3 145 ? 24.827  -29.383 57.951 1.00 57.34  ? 161 GLU C C   1 
ATOM   2671 O O   . GLU C 3 145 ? 25.261  -28.231 57.891 1.00 57.91  ? 161 GLU C O   1 
ATOM   2672 C CB  . GLU C 3 145 ? 23.507  -30.571 56.186 1.00 59.48  ? 161 GLU C CB  1 
ATOM   2673 C CG  . GLU C 3 145 ? 22.135  -30.854 55.596 1.00 64.92  ? 161 GLU C CG  1 
ATOM   2674 C CD  . GLU C 3 145 ? 22.005  -32.255 55.039 1.00 69.15  ? 161 GLU C CD  1 
ATOM   2675 O OE1 . GLU C 3 145 ? 22.594  -33.198 55.623 1.00 69.61  ? 161 GLU C OE1 1 
ATOM   2676 O OE2 . GLU C 3 145 ? 21.295  -32.408 54.016 1.00 70.95  ? 161 GLU C OE2 1 
ATOM   2677 N N   . ARG C 3 146 ? 25.521  -30.407 58.452 1.00 57.88  ? 162 ARG C N   1 
ATOM   2678 C CA  . ARG C 3 146 ? 26.850  -30.213 58.990 1.00 58.41  ? 162 ARG C CA  1 
ATOM   2679 C C   . ARG C 3 146 ? 27.559  -29.237 58.051 1.00 57.19  ? 162 ARG C C   1 
ATOM   2680 O O   . ARG C 3 146 ? 27.701  -29.501 56.861 1.00 58.53  ? 162 ARG C O   1 
ATOM   2681 C CB  . ARG C 3 146 ? 27.601  -31.551 59.132 1.00 58.66  ? 162 ARG C CB  1 
ATOM   2682 C CG  . ARG C 3 146 ? 26.706  -32.793 59.388 1.00 62.64  ? 162 ARG C CG  1 
ATOM   2683 C CD  . ARG C 3 146 ? 26.763  -33.416 60.806 1.00 63.83  ? 162 ARG C CD  1 
ATOM   2684 N NE  . ARG C 3 146 ? 25.575  -34.258 61.059 1.00 64.71  ? 162 ARG C NE  1 
ATOM   2685 C CZ  . ARG C 3 146 ? 25.304  -34.934 62.181 1.00 62.66  ? 162 ARG C CZ  1 
ATOM   2686 N NH1 . ARG C 3 146 ? 26.146  -34.908 63.203 1.00 62.24  ? 162 ARG C NH1 1 
ATOM   2687 N NH2 . ARG C 3 146 ? 24.180  -35.636 62.270 1.00 60.16  ? 162 ARG C NH2 1 
ATOM   2688 N N   . ASN C 3 147 ? 27.933  -28.081 58.591 1.00 55.29  ? 163 ASN C N   1 
ATOM   2689 C CA  . ASN C 3 147 ? 28.775  -27.106 57.888 1.00 55.36  ? 163 ASN C CA  1 
ATOM   2690 C C   . ASN C 3 147 ? 28.139  -26.282 56.752 1.00 54.08  ? 163 ASN C C   1 
ATOM   2691 O O   . ASN C 3 147 ? 28.738  -26.104 55.692 1.00 54.23  ? 163 ASN C O   1 
ATOM   2692 C CB  . ASN C 3 147 ? 30.080  -27.780 57.427 1.00 55.80  ? 163 ASN C CB  1 
ATOM   2693 C CG  . ASN C 3 147 ? 31.027  -28.064 58.583 1.00 60.17  ? 163 ASN C CG  1 
ATOM   2694 O OD1 . ASN C 3 147 ? 32.245  -27.950 58.441 1.00 64.28  ? 163 ASN C OD1 1 
ATOM   2695 N ND2 . ASN C 3 147 ? 30.473  -28.423 59.739 1.00 60.70  ? 163 ASN C ND2 1 
ATOM   2696 N N   . SER C 3 148 ? 26.948  -25.746 56.999 1.00 52.27  ? 164 SER C N   1 
ATOM   2697 C CA  . SER C 3 148 ? 26.209  -25.005 55.980 1.00 50.07  ? 164 SER C CA  1 
ATOM   2698 C C   . SER C 3 148 ? 26.687  -23.568 55.737 1.00 50.44  ? 164 SER C C   1 
ATOM   2699 O O   . SER C 3 148 ? 26.581  -23.059 54.626 1.00 51.07  ? 164 SER C O   1 
ATOM   2700 C CB  . SER C 3 148 ? 24.715  -25.008 56.306 1.00 50.06  ? 164 SER C CB  1 
ATOM   2701 O OG  . SER C 3 148 ? 24.137  -26.291 56.129 1.00 46.78  ? 164 SER C OG  1 
ATOM   2702 N N   . PHE C 3 149 ? 27.223  -22.915 56.762 1.00 49.79  ? 165 PHE C N   1 
ATOM   2703 C CA  . PHE C 3 149 ? 27.609  -21.513 56.629 1.00 47.97  ? 165 PHE C CA  1 
ATOM   2704 C C   . PHE C 3 149 ? 29.107  -21.276 56.839 1.00 49.77  ? 165 PHE C C   1 
ATOM   2705 O O   . PHE C 3 149 ? 29.563  -20.132 56.944 1.00 50.82  ? 165 PHE C O   1 
ATOM   2706 C CB  . PHE C 3 149 ? 26.769  -20.662 57.579 1.00 45.31  ? 165 PHE C CB  1 
ATOM   2707 C CG  . PHE C 3 149 ? 25.322  -21.044 57.596 1.00 44.17  ? 165 PHE C CG  1 
ATOM   2708 C CD1 . PHE C 3 149 ? 24.445  -20.554 56.639 1.00 44.60  ? 165 PHE C CD1 1 
ATOM   2709 C CD2 . PHE C 3 149 ? 24.837  -21.918 58.551 1.00 42.81  ? 165 PHE C CD2 1 
ATOM   2710 C CE1 . PHE C 3 149 ? 23.107  -20.919 56.645 1.00 42.28  ? 165 PHE C CE1 1 
ATOM   2711 C CE2 . PHE C 3 149 ? 23.501  -22.283 58.557 1.00 41.81  ? 165 PHE C CE2 1 
ATOM   2712 C CZ  . PHE C 3 149 ? 22.641  -21.785 57.600 1.00 41.19  ? 165 PHE C CZ  1 
ATOM   2713 N N   . VAL C 3 150 ? 29.874  -22.361 56.886 1.00 50.62  ? 166 VAL C N   1 
ATOM   2714 C CA  . VAL C 3 150 ? 31.322  -22.261 57.027 1.00 52.67  ? 166 VAL C CA  1 
ATOM   2715 C C   . VAL C 3 150 ? 31.904  -21.627 55.783 1.00 52.33  ? 166 VAL C C   1 
ATOM   2716 O O   . VAL C 3 150 ? 31.463  -21.912 54.682 1.00 53.30  ? 166 VAL C O   1 
ATOM   2717 C CB  . VAL C 3 150 ? 31.992  -23.640 57.176 1.00 53.85  ? 166 VAL C CB  1 
ATOM   2718 C CG1 . VAL C 3 150 ? 33.436  -23.480 57.675 1.00 53.65  ? 166 VAL C CG1 1 
ATOM   2719 C CG2 . VAL C 3 150 ? 31.193  -24.514 58.115 1.00 55.40  ? 166 VAL C CG2 1 
ATOM   2720 N N   . GLY C 3 151 ? 32.896  -20.768 55.965 1.00 52.73  ? 167 GLY C N   1 
ATOM   2721 C CA  . GLY C 3 151 ? 33.583  -20.170 54.836 1.00 51.56  ? 167 GLY C CA  1 
ATOM   2722 C C   . GLY C 3 151 ? 32.861  -18.998 54.205 1.00 51.83  ? 167 GLY C C   1 
ATOM   2723 O O   . GLY C 3 151 ? 33.427  -18.328 53.334 1.00 53.26  ? 167 GLY C O   1 
ATOM   2724 N N   . LEU C 3 152 ? 31.624  -18.734 54.633 1.00 49.65  ? 168 LEU C N   1 
ATOM   2725 C CA  . LEU C 3 152 ? 30.861  -17.615 54.078 1.00 47.42  ? 168 LEU C CA  1 
ATOM   2726 C C   . LEU C 3 152 ? 31.618  -16.303 54.233 1.00 47.05  ? 168 LEU C C   1 
ATOM   2727 O O   . LEU C 3 152 ? 31.815  -15.585 53.246 1.00 46.35  ? 168 LEU C O   1 
ATOM   2728 C CB  . LEU C 3 152 ? 29.468  -17.520 54.713 1.00 46.86  ? 168 LEU C CB  1 
ATOM   2729 C CG  . LEU C 3 152 ? 28.567  -16.316 54.402 1.00 45.18  ? 168 LEU C CG  1 
ATOM   2730 C CD1 . LEU C 3 152 ? 28.263  -16.195 52.934 1.00 45.29  ? 168 LEU C CD1 1 
ATOM   2731 C CD2 . LEU C 3 152 ? 27.279  -16.445 55.172 1.00 46.37  ? 168 LEU C CD2 1 
ATOM   2732 N N   . SER C 3 153 ? 32.050  -16.016 55.462 1.00 46.91  ? 169 SER C N   1 
ATOM   2733 C CA  . SER C 3 153 ? 32.772  -14.782 55.785 1.00 47.25  ? 169 SER C CA  1 
ATOM   2734 C C   . SER C 3 153 ? 33.852  -14.983 56.831 1.00 48.46  ? 169 SER C C   1 
ATOM   2735 O O   . SER C 3 153 ? 33.894  -15.998 57.517 1.00 49.72  ? 169 SER C O   1 
ATOM   2736 C CB  . SER C 3 153 ? 31.811  -13.703 56.287 1.00 47.49  ? 169 SER C CB  1 
ATOM   2737 O OG  . SER C 3 153 ? 32.490  -12.466 56.433 1.00 47.55  ? 169 SER C OG  1 
ATOM   2738 N N   . PHE C 3 154 ? 34.735  -14.000 56.947 1.00 51.20  ? 170 PHE C N   1 
ATOM   2739 C CA  . PHE C 3 154 ? 35.780  -14.037 57.963 1.00 51.83  ? 170 PHE C CA  1 
ATOM   2740 C C   . PHE C 3 154 ? 35.311  -13.374 59.249 1.00 52.43  ? 170 PHE C C   1 
ATOM   2741 O O   . PHE C 3 154 ? 36.080  -13.247 60.203 1.00 52.64  ? 170 PHE C O   1 
ATOM   2742 C CB  . PHE C 3 154 ? 37.073  -13.384 57.461 1.00 51.07  ? 170 PHE C CB  1 
ATOM   2743 C CG  . PHE C 3 154 ? 37.864  -14.257 56.533 1.00 52.29  ? 170 PHE C CG  1 
ATOM   2744 C CD1 . PHE C 3 154 ? 38.050  -15.615 56.813 1.00 51.84  ? 170 PHE C CD1 1 
ATOM   2745 C CD2 . PHE C 3 154 ? 38.436  -13.725 55.382 1.00 53.12  ? 170 PHE C CD2 1 
ATOM   2746 C CE1 . PHE C 3 154 ? 38.786  -16.434 55.953 1.00 52.15  ? 170 PHE C CE1 1 
ATOM   2747 C CE2 . PHE C 3 154 ? 39.181  -14.533 54.514 1.00 53.75  ? 170 PHE C CE2 1 
ATOM   2748 C CZ  . PHE C 3 154 ? 39.356  -15.892 54.801 1.00 52.09  ? 170 PHE C CZ  1 
ATOM   2749 N N   . GLU C 3 155 ? 34.046  -12.956 59.278 1.00 52.67  ? 171 GLU C N   1 
ATOM   2750 C CA  . GLU C 3 155 ? 33.502  -12.337 60.483 1.00 52.83  ? 171 GLU C CA  1 
ATOM   2751 C C   . GLU C 3 155 ? 32.034  -12.572 60.766 1.00 50.86  ? 171 GLU C C   1 
ATOM   2752 O O   . GLU C 3 155 ? 31.385  -13.400 60.144 1.00 51.13  ? 171 GLU C O   1 
ATOM   2753 C CB  . GLU C 3 155 ? 33.777  -10.823 60.515 1.00 54.50  ? 171 GLU C CB  1 
ATOM   2754 C CG  . GLU C 3 155 ? 34.369  -10.221 59.257 1.00 56.99  ? 171 GLU C CG  1 
ATOM   2755 C CD  . GLU C 3 155 ? 35.529  -9.317  59.601 1.00 60.08  ? 171 GLU C CD  1 
ATOM   2756 O OE1 . GLU C 3 155 ? 35.328  -8.397  60.429 1.00 61.98  ? 171 GLU C OE1 1 
ATOM   2757 O OE2 . GLU C 3 155 ? 36.642  -9.542  59.069 1.00 60.40  ? 171 GLU C OE2 1 
ATOM   2758 N N   . SER C 3 156 ? 31.570  -11.839 61.772 1.00 50.30  ? 172 SER C N   1 
ATOM   2759 C CA  . SER C 3 156 ? 30.189  -11.725 62.172 1.00 48.15  ? 172 SER C CA  1 
ATOM   2760 C C   . SER C 3 156 ? 29.285  -11.920 60.960 1.00 47.72  ? 172 SER C C   1 
ATOM   2761 O O   . SER C 3 156 ? 29.435  -11.265 59.930 1.00 48.04  ? 172 SER C O   1 
ATOM   2762 C CB  . SER C 3 156 ? 30.001  -10.330 62.791 1.00 49.42  ? 172 SER C CB  1 
ATOM   2763 O OG  . SER C 3 156 ? 28.678  -10.078 63.213 1.00 50.77  ? 172 SER C OG  1 
ATOM   2764 N N   . VAL C 3 157 ? 28.351  -12.846 61.091 1.00 44.83  ? 173 VAL C N   1 
ATOM   2765 C CA  . VAL C 3 157 ? 27.455  -13.172 60.010 1.00 41.10  ? 173 VAL C CA  1 
ATOM   2766 C C   . VAL C 3 157 ? 26.017  -13.215 60.544 1.00 41.48  ? 173 VAL C C   1 
ATOM   2767 O O   . VAL C 3 157 ? 25.759  -13.805 61.590 1.00 44.04  ? 173 VAL C O   1 
ATOM   2768 C CB  . VAL C 3 157 ? 27.910  -14.506 59.390 1.00 41.18  ? 173 VAL C CB  1 
ATOM   2769 C CG1 . VAL C 3 157 ? 26.773  -15.515 59.287 1.00 40.98  ? 173 VAL C CG1 1 
ATOM   2770 C CG2 . VAL C 3 157 ? 28.591  -14.251 58.057 1.00 40.53  ? 173 VAL C CG2 1 
ATOM   2771 N N   . ILE C 3 158 ? 25.086  -12.553 59.869 1.00 40.01  ? 174 ILE C N   1 
ATOM   2772 C CA  . ILE C 3 158 ? 23.686  -12.638 60.282 1.00 39.22  ? 174 ILE C CA  1 
ATOM   2773 C C   . ILE C 3 158 ? 22.978  -13.589 59.335 1.00 39.52  ? 174 ILE C C   1 
ATOM   2774 O O   . ILE C 3 158 ? 23.011  -13.395 58.114 1.00 40.96  ? 174 ILE C O   1 
ATOM   2775 C CB  . ILE C 3 158 ? 22.983  -11.250 60.269 1.00 38.81  ? 174 ILE C CB  1 
ATOM   2776 C CG1 . ILE C 3 158 ? 23.603  -10.311 61.311 1.00 34.24  ? 174 ILE C CG1 1 
ATOM   2777 C CG2 . ILE C 3 158 ? 21.464  -11.417 60.496 1.00 38.27  ? 174 ILE C CG2 1 
ATOM   2778 C CD1 . ILE C 3 158 ? 23.422  -8.848  60.996 1.00 26.01  ? 174 ILE C CD1 1 
ATOM   2779 N N   . LEU C 3 159 ? 22.351  -14.615 59.907 1.00 38.69  ? 175 LEU C N   1 
ATOM   2780 C CA  . LEU C 3 159 ? 21.613  -15.612 59.138 1.00 37.61  ? 175 LEU C CA  1 
ATOM   2781 C C   . LEU C 3 159 ? 20.132  -15.510 59.394 1.00 36.96  ? 175 LEU C C   1 
ATOM   2782 O O   . LEU C 3 159 ? 19.653  -15.817 60.486 1.00 36.17  ? 175 LEU C O   1 
ATOM   2783 C CB  . LEU C 3 159 ? 22.049  -17.021 59.506 1.00 37.96  ? 175 LEU C CB  1 
ATOM   2784 C CG  . LEU C 3 159 ? 23.540  -17.295 59.544 1.00 41.71  ? 175 LEU C CG  1 
ATOM   2785 C CD1 . LEU C 3 159 ? 23.773  -18.699 60.048 1.00 44.35  ? 175 LEU C CD1 1 
ATOM   2786 C CD2 . LEU C 3 159 ? 24.090  -17.143 58.160 1.00 45.44  ? 175 LEU C CD2 1 
ATOM   2787 N N   . TRP C 3 160 ? 19.403  -15.071 58.384 1.00 37.46  ? 176 TRP C N   1 
ATOM   2788 C CA  . TRP C 3 160 ? 17.966  -15.065 58.478 1.00 37.30  ? 176 TRP C CA  1 
ATOM   2789 C C   . TRP C 3 160 ? 17.458  -16.241 57.667 1.00 37.07  ? 176 TRP C C   1 
ATOM   2790 O O   . TRP C 3 160 ? 17.196  -16.119 56.484 1.00 37.85  ? 176 TRP C O   1 
ATOM   2791 C CB  . TRP C 3 160 ? 17.395  -13.740 57.979 1.00 37.71  ? 176 TRP C CB  1 
ATOM   2792 C CG  . TRP C 3 160 ? 17.579  -12.592 58.936 1.00 37.58  ? 176 TRP C CG  1 
ATOM   2793 C CD1 . TRP C 3 160 ? 17.846  -12.674 60.266 1.00 39.33  ? 176 TRP C CD1 1 
ATOM   2794 C CD2 . TRP C 3 160 ? 17.456  -11.194 58.643 1.00 39.21  ? 176 TRP C CD2 1 
ATOM   2795 N NE1 . TRP C 3 160 ? 17.917  -11.419 60.820 1.00 41.11  ? 176 TRP C NE1 1 
ATOM   2796 C CE2 . TRP C 3 160 ? 17.670  -10.491 59.845 1.00 39.43  ? 176 TRP C CE2 1 
ATOM   2797 C CE3 . TRP C 3 160 ? 17.172  -10.461 57.485 1.00 40.53  ? 176 TRP C CE3 1 
ATOM   2798 C CZ2 . TRP C 3 160 ? 17.633  -9.105  59.919 1.00 39.35  ? 176 TRP C CZ2 1 
ATOM   2799 C CZ3 . TRP C 3 160 ? 17.136  -9.078  57.560 1.00 39.06  ? 176 TRP C CZ3 1 
ATOM   2800 C CH2 . TRP C 3 160 ? 17.361  -8.418  58.767 1.00 39.56  ? 176 TRP C CH2 1 
ATOM   2801 N N   . LEU C 3 161 ? 17.354  -17.390 58.324 1.00 37.44  ? 177 LEU C N   1 
ATOM   2802 C CA  . LEU C 3 161 ? 16.822  -18.596 57.722 1.00 36.64  ? 177 LEU C CA  1 
ATOM   2803 C C   . LEU C 3 161 ? 15.343  -18.716 58.071 1.00 37.51  ? 177 LEU C C   1 
ATOM   2804 O O   . LEU C 3 161 ? 14.766  -19.782 58.179 1.00 38.26  ? 177 LEU C O   1 
ATOM   2805 C CB  . LEU C 3 161 ? 17.614  -19.775 58.225 1.00 38.66  ? 177 LEU C CB  1 
ATOM   2806 C CG  . LEU C 3 161 ? 19.114  -19.618 57.977 1.00 38.89  ? 177 LEU C CG  1 
ATOM   2807 C CD1 . LEU C 3 161 ? 19.861  -20.739 58.665 1.00 38.90  ? 177 LEU C CD1 1 
ATOM   2808 C CD2 . LEU C 3 161 ? 19.421  -19.602 56.489 1.00 39.56  ? 177 LEU C CD2 1 
ATOM   2809 N N   . ASN C 3 162 ? 14.771  -17.543 58.241 1.00 41.30  ? 178 ASN C N   1 
ATOM   2810 C CA  . ASN C 3 162 ? 13.380  -17.235 58.454 1.00 42.33  ? 178 ASN C CA  1 
ATOM   2811 C C   . ASN C 3 162 ? 12.391  -17.868 57.438 1.00 42.79  ? 178 ASN C C   1 
ATOM   2812 O O   . ASN C 3 162 ? 12.657  -17.911 56.235 1.00 42.64  ? 178 ASN C O   1 
ATOM   2813 C CB  . ASN C 3 162 ? 13.337  -15.711 58.306 1.00 44.32  ? 178 ASN C CB  1 
ATOM   2814 C CG  . ASN C 3 162 ? 12.193  -15.077 59.006 1.00 48.22  ? 178 ASN C CG  1 
ATOM   2815 O OD1 . ASN C 3 162 ? 11.890  -13.915 58.764 1.00 50.19  ? 178 ASN C OD1 1 
ATOM   2816 N ND2 . ASN C 3 162 ? 11.547  -15.819 59.896 1.00 56.42  ? 178 ASN C ND2 1 
ATOM   2817 N N   . LYS C 3 163 ? 11.256  -18.351 57.937 1.00 42.21  ? 179 LYS C N   1 
ATOM   2818 C CA  . LYS C 3 163 ? 10.096  -18.728 57.105 1.00 43.56  ? 179 LYS C CA  1 
ATOM   2819 C C   . LYS C 3 163 ? 10.302  -19.679 55.923 1.00 43.25  ? 179 LYS C C   1 
ATOM   2820 O O   . LYS C 3 163 ? 9.953   -19.352 54.790 1.00 46.26  ? 179 LYS C O   1 
ATOM   2821 C CB  . LYS C 3 163 ? 9.388   -17.475 56.569 1.00 42.66  ? 179 LYS C CB  1 
ATOM   2822 C CG  . LYS C 3 163 ? 9.000   -16.463 57.610 1.00 47.14  ? 179 LYS C CG  1 
ATOM   2823 C CD  . LYS C 3 163 ? 7.750   -15.722 57.185 1.00 49.32  ? 179 LYS C CD  1 
ATOM   2824 C CE  . LYS C 3 163 ? 7.856   -14.252 57.506 1.00 47.68  ? 179 LYS C CE  1 
ATOM   2825 N NZ  . LYS C 3 163 ? 6.583   -13.584 57.119 1.00 52.88  ? 179 LYS C NZ  1 
ATOM   2826 N N   . ASN C 3 164 ? 10.850  -20.854 56.157 1.00 41.32  ? 180 ASN C N   1 
ATOM   2827 C CA  . ASN C 3 164 ? 10.968  -21.804 55.062 1.00 39.82  ? 180 ASN C CA  1 
ATOM   2828 C C   . ASN C 3 164 ? 10.229  -23.058 55.488 1.00 40.25  ? 180 ASN C C   1 
ATOM   2829 O O   . ASN C 3 164 ? 9.171   -22.980 56.116 1.00 40.17  ? 180 ASN C O   1 
ATOM   2830 C CB  . ASN C 3 164 ? 12.445  -22.075 54.736 1.00 39.80  ? 180 ASN C CB  1 
ATOM   2831 C CG  . ASN C 3 164 ? 13.262  -20.787 54.609 1.00 40.16  ? 180 ASN C CG  1 
ATOM   2832 O OD1 . ASN C 3 164 ? 13.167  -20.067 53.623 1.00 40.72  ? 180 ASN C OD1 1 
ATOM   2833 N ND2 . ASN C 3 164 ? 14.051  -20.488 55.628 1.00 42.62  ? 180 ASN C ND2 1 
ATOM   2834 N N   . GLY C 3 165 ? 10.776  -24.216 55.164 1.00 41.17  ? 181 GLY C N   1 
ATOM   2835 C CA  . GLY C 3 165 ? 10.164  -25.455 55.606 1.00 41.92  ? 181 GLY C CA  1 
ATOM   2836 C C   . GLY C 3 165 ? 11.173  -26.283 56.352 1.00 41.22  ? 181 GLY C C   1 
ATOM   2837 O O   . GLY C 3 165 ? 11.148  -27.505 56.281 1.00 42.43  ? 181 GLY C O   1 
ATOM   2838 N N   . ILE C 3 166 ? 12.089  -25.610 57.035 1.00 42.18  ? 182 ILE C N   1 
ATOM   2839 C CA  . ILE C 3 166 ? 13.083  -26.290 57.847 1.00 43.63  ? 182 ILE C CA  1 
ATOM   2840 C C   . ILE C 3 166 ? 12.359  -27.150 58.881 1.00 46.15  ? 182 ILE C C   1 
ATOM   2841 O O   . ILE C 3 166 ? 11.399  -26.695 59.522 1.00 47.71  ? 182 ILE C O   1 
ATOM   2842 C CB  . ILE C 3 166 ? 14.038  -25.260 58.502 1.00 41.90  ? 182 ILE C CB  1 
ATOM   2843 C CG1 . ILE C 3 166 ? 14.989  -24.695 57.435 1.00 41.27  ? 182 ILE C CG1 1 
ATOM   2844 C CG2 . ILE C 3 166 ? 14.807  -25.879 59.647 1.00 37.14  ? 182 ILE C CG2 1 
ATOM   2845 C CD1 . ILE C 3 166 ? 15.646  -23.368 57.795 1.00 38.94  ? 182 ILE C CD1 1 
ATOM   2846 N N   . GLN C 3 167 ? 12.797  -28.403 58.988 1.00 47.52  ? 183 GLN C N   1 
ATOM   2847 C CA  . GLN C 3 167 ? 12.230  -29.370 59.926 1.00 50.25  ? 183 GLN C CA  1 
ATOM   2848 C C   . GLN C 3 167 ? 13.339  -30.040 60.725 1.00 51.17  ? 183 GLN C C   1 
ATOM   2849 O O   . GLN C 3 167 ? 13.119  -30.506 61.842 1.00 50.32  ? 183 GLN C O   1 
ATOM   2850 C CB  . GLN C 3 167 ? 11.442  -30.442 59.172 1.00 52.23  ? 183 GLN C CB  1 
ATOM   2851 C CG  . GLN C 3 167 ? 10.134  -29.957 58.579 1.00 55.19  ? 183 GLN C CG  1 
ATOM   2852 C CD  . GLN C 3 167 ? 9.406   -31.033 57.800 1.00 59.25  ? 183 GLN C CD  1 
ATOM   2853 O OE1 . GLN C 3 167 ? 9.954   -31.620 56.858 1.00 61.85  ? 183 GLN C OE1 1 
ATOM   2854 N NE2 . GLN C 3 167 ? 8.159   -31.294 58.184 1.00 61.27  ? 183 GLN C NE2 1 
ATOM   2855 N N   . GLU C 3 168 ? 14.528  -30.079 60.132 1.00 52.62  ? 184 GLU C N   1 
ATOM   2856 C CA  . GLU C 3 168 ? 15.688  -30.705 60.736 1.00 54.13  ? 184 GLU C CA  1 
ATOM   2857 C C   . GLU C 3 168 ? 16.966  -29.881 60.554 1.00 53.98  ? 184 GLU C C   1 
ATOM   2858 O O   . GLU C 3 168 ? 17.313  -29.494 59.434 1.00 53.79  ? 184 GLU C O   1 
ATOM   2859 C CB  . GLU C 3 168 ? 15.901  -32.076 60.099 1.00 56.79  ? 184 GLU C CB  1 
ATOM   2860 C CG  . GLU C 3 168 ? 15.639  -33.255 61.017 1.00 61.73  ? 184 GLU C CG  1 
ATOM   2861 C CD  . GLU C 3 168 ? 16.678  -34.344 60.825 1.00 65.53  ? 184 GLU C CD  1 
ATOM   2862 O OE1 . GLU C 3 168 ? 17.858  -34.114 61.179 1.00 67.69  ? 184 GLU C OE1 1 
ATOM   2863 O OE2 . GLU C 3 168 ? 16.316  -35.426 60.314 1.00 66.76  ? 184 GLU C OE2 1 
ATOM   2864 N N   . ILE C 3 169 ? 17.660  -29.615 61.659 1.00 52.73  ? 185 ILE C N   1 
ATOM   2865 C CA  . ILE C 3 169 ? 18.988  -29.011 61.605 1.00 51.85  ? 185 ILE C CA  1 
ATOM   2866 C C   . ILE C 3 169 ? 19.948  -30.064 62.149 1.00 53.68  ? 185 ILE C C   1 
ATOM   2867 O O   . ILE C 3 169 ? 19.637  -30.709 63.138 1.00 56.06  ? 185 ILE C O   1 
ATOM   2868 C CB  . ILE C 3 169 ? 19.036  -27.721 62.439 1.00 50.12  ? 185 ILE C CB  1 
ATOM   2869 C CG1 . ILE C 3 169 ? 17.987  -26.725 61.924 1.00 48.69  ? 185 ILE C CG1 1 
ATOM   2870 C CG2 . ILE C 3 169 ? 20.411  -27.098 62.362 1.00 49.24  ? 185 ILE C CG2 1 
ATOM   2871 C CD1 . ILE C 3 169 ? 17.665  -25.585 62.856 1.00 45.19  ? 185 ILE C CD1 1 
ATOM   2872 N N   . HIS C 3 170 ? 21.083  -30.270 61.485 1.00 55.13  ? 186 HIS C N   1 
ATOM   2873 C CA  . HIS C 3 170 ? 22.067  -31.269 61.918 1.00 56.42  ? 186 HIS C CA  1 
ATOM   2874 C C   . HIS C 3 170 ? 23.156  -30.643 62.781 1.00 57.55  ? 186 HIS C C   1 
ATOM   2875 O O   . HIS C 3 170 ? 23.460  -29.461 62.628 1.00 58.02  ? 186 HIS C O   1 
ATOM   2876 C CB  . HIS C 3 170 ? 22.737  -31.932 60.711 1.00 57.66  ? 186 HIS C CB  1 
ATOM   2877 C CG  . HIS C 3 170 ? 21.821  -32.787 59.893 1.00 62.13  ? 186 HIS C CG  1 
ATOM   2878 N ND1 . HIS C 3 170 ? 22.150  -33.224 58.626 1.00 63.64  ? 186 HIS C ND1 1 
ATOM   2879 C CD2 . HIS C 3 170 ? 20.585  -33.276 60.151 1.00 64.47  ? 186 HIS C CD2 1 
ATOM   2880 C CE1 . HIS C 3 170 ? 21.158  -33.949 58.142 1.00 64.83  ? 186 HIS C CE1 1 
ATOM   2881 N NE2 . HIS C 3 170 ? 20.195  -33.997 59.047 1.00 65.34  ? 186 HIS C NE2 1 
ATOM   2882 N N   . ASN C 3 171 ? 23.767  -31.437 63.663 1.00 57.82  ? 187 ASN C N   1 
ATOM   2883 C CA  . ASN C 3 171 ? 24.877  -30.945 64.486 1.00 56.67  ? 187 ASN C CA  1 
ATOM   2884 C C   . ASN C 3 171 ? 25.930  -30.269 63.624 1.00 56.46  ? 187 ASN C C   1 
ATOM   2885 O O   . ASN C 3 171 ? 26.090  -30.609 62.449 1.00 54.59  ? 187 ASN C O   1 
ATOM   2886 C CB  . ASN C 3 171 ? 25.540  -32.080 65.273 1.00 55.33  ? 187 ASN C CB  1 
ATOM   2887 C CG  . ASN C 3 171 ? 24.570  -32.814 66.157 1.00 54.83  ? 187 ASN C CG  1 
ATOM   2888 O OD1 . ASN C 3 171 ? 24.152  -32.312 67.200 1.00 53.62  ? 187 ASN C OD1 1 
ATOM   2889 N ND2 . ASN C 3 171 ? 24.200  -34.019 65.741 1.00 56.94  ? 187 ASN C ND2 1 
ATOM   2890 N N   . CYS C 3 172 ? 26.636  -29.309 64.219 1.00 56.81  ? 188 CYS C N   1 
ATOM   2891 C CA  . CYS C 3 172 ? 27.714  -28.602 63.538 1.00 57.62  ? 188 CYS C CA  1 
ATOM   2892 C C   . CYS C 3 172 ? 27.204  -27.930 62.270 1.00 56.53  ? 188 CYS C C   1 
ATOM   2893 O O   . CYS C 3 172 ? 27.942  -27.778 61.297 1.00 58.14  ? 188 CYS C O   1 
ATOM   2894 C CB  . CYS C 3 172 ? 28.876  -29.561 63.215 1.00 58.00  ? 188 CYS C CB  1 
ATOM   2895 S SG  . CYS C 3 172 ? 29.712  -30.256 64.670 1.00 65.97  ? 188 CYS C SG  1 
ATOM   2896 N N   . ALA C 3 173 ? 25.928  -27.552 62.283 1.00 54.91  ? 189 ALA C N   1 
ATOM   2897 C CA  . ALA C 3 173 ? 25.321  -26.825 61.178 1.00 52.15  ? 189 ALA C CA  1 
ATOM   2898 C C   . ALA C 3 173 ? 26.036  -25.491 61.031 1.00 51.65  ? 189 ALA C C   1 
ATOM   2899 O O   . ALA C 3 173 ? 26.321  -25.045 59.911 1.00 51.50  ? 189 ALA C O   1 
ATOM   2900 C CB  . ALA C 3 173 ? 23.859  -26.592 61.457 1.00 51.24  ? 189 ALA C CB  1 
ATOM   2901 N N   . PHE C 3 174 ? 26.337  -24.880 62.179 1.00 50.11  ? 190 PHE C N   1 
ATOM   2902 C CA  . PHE C 3 174 ? 26.975  -23.568 62.230 1.00 49.12  ? 190 PHE C CA  1 
ATOM   2903 C C   . PHE C 3 174 ? 28.439  -23.645 62.659 1.00 49.40  ? 190 PHE C C   1 
ATOM   2904 O O   . PHE C 3 174 ? 29.045  -22.660 63.063 1.00 47.28  ? 190 PHE C O   1 
ATOM   2905 C CB  . PHE C 3 174 ? 26.192  -22.632 63.148 1.00 47.42  ? 190 PHE C CB  1 
ATOM   2906 C CG  . PHE C 3 174 ? 24.707  -22.686 62.947 1.00 44.78  ? 190 PHE C CG  1 
ATOM   2907 C CD1 . PHE C 3 174 ? 24.099  -21.902 61.980 1.00 42.89  ? 190 PHE C CD1 1 
ATOM   2908 C CD2 . PHE C 3 174 ? 23.917  -23.519 63.734 1.00 43.23  ? 190 PHE C CD2 1 
ATOM   2909 C CE1 . PHE C 3 174 ? 22.732  -21.947 61.795 1.00 41.84  ? 190 PHE C CE1 1 
ATOM   2910 C CE2 . PHE C 3 174 ? 22.547  -23.572 63.553 1.00 42.67  ? 190 PHE C CE2 1 
ATOM   2911 C CZ  . PHE C 3 174 ? 21.952  -22.784 62.579 1.00 41.61  ? 190 PHE C CZ  1 
ATOM   2912 N N   . ASN C 3 175 ? 29.006  -24.835 62.553 1.00 52.08  ? 191 ASN C N   1 
ATOM   2913 C CA  . ASN C 3 175 ? 30.426  -25.027 62.766 1.00 53.89  ? 191 ASN C CA  1 
ATOM   2914 C C   . ASN C 3 175 ? 31.239  -24.041 61.930 1.00 53.58  ? 191 ASN C C   1 
ATOM   2915 O O   . ASN C 3 175 ? 30.840  -23.684 60.822 1.00 53.59  ? 191 ASN C O   1 
ATOM   2916 C CB  . ASN C 3 175 ? 30.800  -26.453 62.397 1.00 56.26  ? 191 ASN C CB  1 
ATOM   2917 C CG  . ASN C 3 175 ? 32.237  -26.759 62.687 1.00 61.74  ? 191 ASN C CG  1 
ATOM   2918 O OD1 . ASN C 3 175 ? 32.717  -26.576 63.814 1.00 59.97  ? 191 ASN C OD1 1 
ATOM   2919 N ND2 . ASN C 3 175 ? 32.945  -27.230 61.669 1.00 66.64  ? 191 ASN C ND2 1 
ATOM   2920 N N   . GLY C 3 176 ? 32.368  -23.599 62.477 1.00 53.19  ? 192 GLY C N   1 
ATOM   2921 C CA  . GLY C 3 176 ? 33.233  -22.634 61.802 1.00 53.00  ? 192 GLY C CA  1 
ATOM   2922 C C   . GLY C 3 176 ? 32.596  -21.284 61.484 1.00 52.75  ? 192 GLY C C   1 
ATOM   2923 O O   . GLY C 3 176 ? 33.056  -20.565 60.589 1.00 52.77  ? 192 GLY C O   1 
ATOM   2924 N N   . THR C 3 177 ? 31.548  -20.923 62.213 1.00 51.29  ? 193 THR C N   1 
ATOM   2925 C CA  . THR C 3 177 ? 30.879  -19.663 61.941 1.00 52.70  ? 193 THR C CA  1 
ATOM   2926 C C   . THR C 3 177 ? 30.720  -18.764 63.185 1.00 52.12  ? 193 THR C C   1 
ATOM   2927 O O   . THR C 3 177 ? 30.506  -19.256 64.295 1.00 53.64  ? 193 THR C O   1 
ATOM   2928 C CB  . THR C 3 177 ? 29.529  -19.926 61.176 1.00 53.27  ? 193 THR C CB  1 
ATOM   2929 O OG1 . THR C 3 177 ? 29.111  -18.738 60.504 1.00 56.16  ? 193 THR C OG1 1 
ATOM   2930 C CG2 . THR C 3 177 ? 28.380  -20.221 62.109 1.00 54.56  ? 193 THR C CG2 1 
ATOM   2931 N N   . GLN C 3 178 ? 30.860  -17.452 62.987 1.00 51.41  ? 194 GLN C N   1 
ATOM   2932 C CA  . GLN C 3 178 ? 30.720  -16.453 64.060 1.00 50.62  ? 194 GLN C CA  1 
ATOM   2933 C C   . GLN C 3 178 ? 29.303  -15.876 64.053 1.00 49.87  ? 194 GLN C C   1 
ATOM   2934 O O   . GLN C 3 178 ? 29.045  -14.826 63.452 1.00 49.14  ? 194 GLN C O   1 
ATOM   2935 C CB  . GLN C 3 178 ? 31.741  -15.329 63.879 1.00 52.37  ? 194 GLN C CB  1 
ATOM   2936 C CG  . GLN C 3 178 ? 33.142  -15.806 63.499 1.00 56.73  ? 194 GLN C CG  1 
ATOM   2937 C CD  . GLN C 3 178 ? 34.199  -14.723 63.639 1.00 59.52  ? 194 GLN C CD  1 
ATOM   2938 O OE1 . GLN C 3 178 ? 34.275  -14.040 64.670 1.00 62.60  ? 194 GLN C OE1 1 
ATOM   2939 N NE2 . GLN C 3 178 ? 35.029  -14.572 62.612 1.00 58.94  ? 194 GLN C NE2 1 
ATOM   2940 N N   . LEU C 3 179 ? 28.402  -16.568 64.744 1.00 48.78  ? 195 LEU C N   1 
ATOM   2941 C CA  . LEU C 3 179 ? 26.968  -16.309 64.666 1.00 45.93  ? 195 LEU C CA  1 
ATOM   2942 C C   . LEU C 3 179 ? 26.494  -15.054 65.353 1.00 46.67  ? 195 LEU C C   1 
ATOM   2943 O O   . LEU C 3 179 ? 26.201  -15.049 66.545 1.00 46.94  ? 195 LEU C O   1 
ATOM   2944 C CB  . LEU C 3 179 ? 26.197  -17.502 65.213 1.00 45.80  ? 195 LEU C CB  1 
ATOM   2945 C CG  . LEU C 3 179 ? 25.945  -18.609 64.210 1.00 45.10  ? 195 LEU C CG  1 
ATOM   2946 C CD1 . LEU C 3 179 ? 24.939  -19.567 64.789 1.00 46.22  ? 195 LEU C CD1 1 
ATOM   2947 C CD2 . LEU C 3 179 ? 25.418  -17.990 62.931 1.00 46.69  ? 195 LEU C CD2 1 
ATOM   2948 N N   . ASP C 3 180 ? 26.398  -13.989 64.576 1.00 48.55  ? 196 ASP C N   1 
ATOM   2949 C CA  . ASP C 3 180 ? 25.919  -12.709 65.071 1.00 49.55  ? 196 ASP C CA  1 
ATOM   2950 C C   . ASP C 3 180 ? 24.435  -12.785 65.420 1.00 49.44  ? 196 ASP C C   1 
ATOM   2951 O O   . ASP C 3 180 ? 24.032  -12.388 66.509 1.00 49.70  ? 196 ASP C O   1 
ATOM   2952 C CB  . ASP C 3 180 ? 26.141  -11.651 64.002 1.00 52.06  ? 196 ASP C CB  1 
ATOM   2953 C CG  . ASP C 3 180 ? 26.272  -10.273 64.575 1.00 55.16  ? 196 ASP C CG  1 
ATOM   2954 O OD1 . ASP C 3 180 ? 26.340  -10.163 65.816 1.00 59.09  ? 196 ASP C OD1 1 
ATOM   2955 O OD2 . ASP C 3 180 ? 26.332  -9.253  63.842 1.00 58.34  ? 196 ASP C OD2 1 
ATOM   2956 N N   . GLU C 3 181 ? 23.628  -13.292 64.490 1.00 47.71  ? 197 GLU C N   1 
ATOM   2957 C CA  . GLU C 3 181 ? 22.198  -13.438 64.719 1.00 46.89  ? 197 GLU C CA  1 
ATOM   2958 C C   . GLU C 3 181 ? 21.670  -14.623 63.937 1.00 44.44  ? 197 GLU C C   1 
ATOM   2959 O O   . GLU C 3 181 ? 22.172  -14.915 62.855 1.00 47.00  ? 197 GLU C O   1 
ATOM   2960 C CB  . GLU C 3 181 ? 21.443  -12.170 64.311 1.00 48.66  ? 197 GLU C CB  1 
ATOM   2961 C CG  . GLU C 3 181 ? 19.960  -12.234 64.662 1.00 53.40  ? 197 GLU C CG  1 
ATOM   2962 C CD  . GLU C 3 181 ? 19.169  -11.019 64.215 1.00 55.67  ? 197 GLU C CD  1 
ATOM   2963 O OE1 . GLU C 3 181 ? 19.804  -9.967  63.955 1.00 58.06  ? 197 GLU C OE1 1 
ATOM   2964 O OE2 . GLU C 3 181 ? 17.912  -11.122 64.137 1.00 54.84  ? 197 GLU C OE2 1 
ATOM   2965 N N   . LEU C 3 182 ? 20.662  -15.297 64.487 1.00 39.97  ? 198 LEU C N   1 
ATOM   2966 C CA  . LEU C 3 182 ? 20.075  -16.475 63.864 1.00 36.54  ? 198 LEU C CA  1 
ATOM   2967 C C   . LEU C 3 182 ? 18.577  -16.451 64.030 1.00 37.02  ? 198 LEU C C   1 
ATOM   2968 O O   . LEU C 3 182 ? 18.051  -16.430 65.149 1.00 35.10  ? 198 LEU C O   1 
ATOM   2969 C CB  . LEU C 3 182 ? 20.599  -17.760 64.488 1.00 35.80  ? 198 LEU C CB  1 
ATOM   2970 C CG  . LEU C 3 182 ? 19.976  -19.034 63.913 1.00 32.89  ? 198 LEU C CG  1 
ATOM   2971 C CD1 . LEU C 3 182 ? 20.629  -19.328 62.588 1.00 33.12  ? 198 LEU C CD1 1 
ATOM   2972 C CD2 . LEU C 3 182 ? 20.156  -20.201 64.864 1.00 30.15  ? 198 LEU C CD2 1 
ATOM   2973 N N   . ASN C 3 183 ? 17.896  -16.465 62.895 1.00 37.05  ? 199 ASN C N   1 
ATOM   2974 C CA  . ASN C 3 183 ? 16.458  -16.414 62.870 1.00 35.84  ? 199 ASN C CA  1 
ATOM   2975 C C   . ASN C 3 183 ? 15.941  -17.672 62.217 1.00 35.64  ? 199 ASN C C   1 
ATOM   2976 O O   . ASN C 3 183 ? 16.224  -17.933 61.039 1.00 35.60  ? 199 ASN C O   1 
ATOM   2977 C CB  . ASN C 3 183 ? 15.988  -15.194 62.085 1.00 37.03  ? 199 ASN C CB  1 
ATOM   2978 C CG  . ASN C 3 183 ? 14.576  -14.790 62.437 1.00 35.91  ? 199 ASN C CG  1 
ATOM   2979 O OD1 . ASN C 3 183 ? 13.726  -15.623 62.771 1.00 33.05  ? 199 ASN C OD1 1 
ATOM   2980 N ND2 . ASN C 3 183 ? 14.320  -13.497 62.374 1.00 38.72  ? 199 ASN C ND2 1 
ATOM   2981 N N   . LEU C 3 184 ? 15.195  -18.445 62.997 1.00 32.73  ? 200 LEU C N   1 
ATOM   2982 C CA  . LEU C 3 184 ? 14.623  -19.686 62.529 1.00 34.00  ? 200 LEU C CA  1 
ATOM   2983 C C   . LEU C 3 184 ? 13.147  -19.621 62.801 1.00 35.79  ? 200 LEU C C   1 
ATOM   2984 O O   . LEU C 3 184 ? 12.503  -20.651 62.973 1.00 35.91  ? 200 LEU C O   1 
ATOM   2985 C CB  . LEU C 3 184 ? 15.236  -20.876 63.257 1.00 33.13  ? 200 LEU C CB  1 
ATOM   2986 C CG  . LEU C 3 184 ? 16.755  -20.951 63.351 1.00 33.04  ? 200 LEU C CG  1 
ATOM   2987 C CD1 . LEU C 3 184 ? 17.134  -21.932 64.431 1.00 34.21  ? 200 LEU C CD1 1 
ATOM   2988 C CD2 . LEU C 3 184 ? 17.373  -21.332 62.028 1.00 32.37  ? 200 LEU C CD2 1 
ATOM   2989 N N   . SER C 3 185 ? 12.619  -18.398 62.846 1.00 38.62  ? 201 SER C N   1 
ATOM   2990 C CA  . SER C 3 185 ? 11.195  -18.165 63.059 1.00 39.20  ? 201 SER C CA  1 
ATOM   2991 C C   . SER C 3 185 ? 10.366  -18.680 61.905 1.00 40.84  ? 201 SER C C   1 
ATOM   2992 O O   . SER C 3 185 ? 10.822  -18.723 60.759 1.00 40.98  ? 201 SER C O   1 
ATOM   2993 C CB  . SER C 3 185 ? 10.903  -16.675 63.218 1.00 40.12  ? 201 SER C CB  1 
ATOM   2994 O OG  . SER C 3 185 ? 11.431  -16.179 64.432 1.00 42.71  ? 201 SER C OG  1 
ATOM   2995 N N   . ASP C 3 186 ? 9.144   -19.075 62.229 1.00 43.33  ? 202 ASP C N   1 
ATOM   2996 C CA  . ASP C 3 186 ? 8.155   -19.474 61.233 1.00 47.41  ? 202 ASP C CA  1 
ATOM   2997 C C   . ASP C 3 186 ? 8.509   -20.706 60.418 1.00 48.03  ? 202 ASP C C   1 
ATOM   2998 O O   . ASP C 3 186 ? 7.805   -21.030 59.469 1.00 51.98  ? 202 ASP C O   1 
ATOM   2999 C CB  . ASP C 3 186 ? 7.777   -18.291 60.338 1.00 49.50  ? 202 ASP C CB  1 
ATOM   3000 C CG  . ASP C 3 186 ? 7.230   -17.114 61.145 1.00 55.82  ? 202 ASP C CG  1 
ATOM   3001 O OD1 . ASP C 3 186 ? 6.013   -17.138 61.444 1.00 56.92  ? 202 ASP C OD1 1 
ATOM   3002 O OD2 . ASP C 3 186 ? 7.956   -16.150 61.533 1.00 56.27  ? 202 ASP C OD2 1 
ATOM   3003 N N   . ASN C 3 187 ? 9.591   -21.388 60.781 1.00 47.42  ? 203 ASN C N   1 
ATOM   3004 C CA  . ASN C 3 187 ? 9.813   -22.747 60.296 1.00 47.23  ? 203 ASN C CA  1 
ATOM   3005 C C   . ASN C 3 187 ? 9.047   -23.642 61.266 1.00 48.82  ? 203 ASN C C   1 
ATOM   3006 O O   . ASN C 3 187 ? 9.657   -24.309 62.101 1.00 49.53  ? 203 ASN C O   1 
ATOM   3007 C CB  . ASN C 3 187 ? 11.281  -23.108 60.370 1.00 46.52  ? 203 ASN C CB  1 
ATOM   3008 C CG  . ASN C 3 187 ? 12.086  -22.487 59.272 1.00 45.91  ? 203 ASN C CG  1 
ATOM   3009 O OD1 . ASN C 3 187 ? 12.124  -22.998 58.155 1.00 44.09  ? 203 ASN C OD1 1 
ATOM   3010 N ND2 . ASN C 3 187 ? 12.774  -21.395 59.588 1.00 44.97  ? 203 ASN C ND2 1 
ATOM   3011 N N   . ASN C 3 188 ? 7.720   -23.672 61.145 1.00 49.56  ? 204 ASN C N   1 
ATOM   3012 C CA  . ASN C 3 188 ? 6.886   -24.236 62.214 1.00 50.14  ? 204 ASN C CA  1 
ATOM   3013 C C   . ASN C 3 188 ? 6.802   -25.741 62.373 1.00 48.22  ? 204 ASN C C   1 
ATOM   3014 O O   . ASN C 3 188 ? 6.033   -26.241 63.191 1.00 47.38  ? 204 ASN C O   1 
ATOM   3015 C CB  . ASN C 3 188 ? 5.489   -23.566 62.299 1.00 51.44  ? 204 ASN C CB  1 
ATOM   3016 C CG  . ASN C 3 188 ? 4.917   -23.167 60.949 1.00 52.79  ? 204 ASN C CG  1 
ATOM   3017 O OD1 . ASN C 3 188 ? 3.811   -22.618 60.884 1.00 53.88  ? 204 ASN C OD1 1 
ATOM   3018 N ND2 . ASN C 3 188 ? 5.654   -23.432 59.871 1.00 54.21  ? 204 ASN C ND2 1 
ATOM   3019 N N   . ASN C 3 189 ? 7.613   -26.469 61.621 1.00 47.73  ? 205 ASN C N   1 
ATOM   3020 C CA  . ASN C 3 189 ? 7.728   -27.904 61.844 1.00 48.63  ? 205 ASN C CA  1 
ATOM   3021 C C   . ASN C 3 189 ? 9.041   -28.265 62.514 1.00 48.26  ? 205 ASN C C   1 
ATOM   3022 O O   . ASN C 3 189 ? 9.331   -29.436 62.728 1.00 49.40  ? 205 ASN C O   1 
ATOM   3023 C CB  . ASN C 3 189 ? 7.584   -28.683 60.536 1.00 49.44  ? 205 ASN C CB  1 
ATOM   3024 C CG  . ASN C 3 189 ? 6.184   -28.628 59.986 1.00 48.98  ? 205 ASN C CG  1 
ATOM   3025 O OD1 . ASN C 3 189 ? 5.209   -28.802 60.721 1.00 47.90  ? 205 ASN C OD1 1 
ATOM   3026 N ND2 . ASN C 3 189 ? 6.072   -28.380 58.689 1.00 47.76  ? 205 ASN C ND2 1 
ATOM   3027 N N   . LEU C 3 190 ? 9.843   -27.257 62.826 1.00 48.49  ? 206 LEU C N   1 
ATOM   3028 C CA  . LEU C 3 190 ? 11.103  -27.480 63.513 1.00 49.48  ? 206 LEU C CA  1 
ATOM   3029 C C   . LEU C 3 190 ? 10.874  -27.544 65.020 1.00 51.56  ? 206 LEU C C   1 
ATOM   3030 O O   . LEU C 3 190 ? 10.428  -26.567 65.633 1.00 50.33  ? 206 LEU C O   1 
ATOM   3031 C CB  . LEU C 3 190 ? 12.068  -26.368 63.172 1.00 46.98  ? 206 LEU C CB  1 
ATOM   3032 C CG  . LEU C 3 190 ? 13.381  -26.432 63.919 1.00 44.77  ? 206 LEU C CG  1 
ATOM   3033 C CD1 . LEU C 3 190 ? 14.324  -27.387 63.222 1.00 41.18  ? 206 LEU C CD1 1 
ATOM   3034 C CD2 . LEU C 3 190 ? 13.937  -25.031 63.959 1.00 45.22  ? 206 LEU C CD2 1 
ATOM   3035 N N   . GLU C 3 191 ? 11.180  -28.695 65.617 1.00 54.43  ? 207 GLU C N   1 
ATOM   3036 C CA  . GLU C 3 191 ? 10.878  -28.904 67.035 1.00 57.25  ? 207 GLU C CA  1 
ATOM   3037 C C   . GLU C 3 191 ? 12.065  -29.275 67.909 1.00 57.13  ? 207 GLU C C   1 
ATOM   3038 O O   . GLU C 3 191 ? 11.930  -29.367 69.123 1.00 57.68  ? 207 GLU C O   1 
ATOM   3039 C CB  . GLU C 3 191 ? 9.736   -29.923 67.209 1.00 58.58  ? 207 GLU C CB  1 
ATOM   3040 C CG  . GLU C 3 191 ? 9.684   -31.012 66.146 1.00 62.62  ? 207 GLU C CG  1 
ATOM   3041 C CD  . GLU C 3 191 ? 8.308   -31.654 66.022 1.00 64.25  ? 207 GLU C CD  1 
ATOM   3042 O OE1 . GLU C 3 191 ? 7.330   -30.953 65.657 1.00 64.25  ? 207 GLU C OE1 1 
ATOM   3043 O OE2 . GLU C 3 191 ? 8.213   -32.871 66.278 1.00 65.99  ? 207 GLU C OE2 1 
ATOM   3044 N N   . GLU C 3 192 ? 13.230  -29.466 67.307 1.00 57.79  ? 208 GLU C N   1 
ATOM   3045 C CA  . GLU C 3 192 ? 14.410  -29.809 68.086 1.00 59.73  ? 208 GLU C CA  1 
ATOM   3046 C C   . GLU C 3 192 ? 15.662  -29.194 67.520 1.00 59.84  ? 208 GLU C C   1 
ATOM   3047 O O   . GLU C 3 192 ? 15.790  -29.033 66.309 1.00 60.13  ? 208 GLU C O   1 
ATOM   3048 C CB  . GLU C 3 192 ? 14.601  -31.324 68.133 1.00 60.58  ? 208 GLU C CB  1 
ATOM   3049 C CG  . GLU C 3 192 ? 13.830  -32.018 69.239 1.00 63.79  ? 208 GLU C CG  1 
ATOM   3050 C CD  . GLU C 3 192 ? 13.546  -33.472 68.922 1.00 66.19  ? 208 GLU C CD  1 
ATOM   3051 O OE1 . GLU C 3 192 ? 14.075  -33.988 67.902 1.00 66.67  ? 208 GLU C OE1 1 
ATOM   3052 O OE2 . GLU C 3 192 ? 12.788  -34.099 69.699 1.00 68.23  ? 208 GLU C OE2 1 
ATOM   3053 N N   . LEU C 3 193 ? 16.583  -28.857 68.414 1.00 59.62  ? 209 LEU C N   1 
ATOM   3054 C CA  . LEU C 3 193 ? 17.917  -28.461 68.024 1.00 59.11  ? 209 LEU C CA  1 
ATOM   3055 C C   . LEU C 3 193 ? 18.896  -29.480 68.579 1.00 59.91  ? 209 LEU C C   1 
ATOM   3056 O O   . LEU C 3 193 ? 18.932  -29.713 69.787 1.00 61.52  ? 209 LEU C O   1 
ATOM   3057 C CB  . LEU C 3 193 ? 18.261  -27.078 68.566 1.00 57.90  ? 209 LEU C CB  1 
ATOM   3058 C CG  . LEU C 3 193 ? 17.515  -25.921 67.923 1.00 57.65  ? 209 LEU C CG  1 
ATOM   3059 C CD1 . LEU C 3 193 ? 17.500  -24.727 68.862 1.00 58.19  ? 209 LEU C CD1 1 
ATOM   3060 C CD2 . LEU C 3 193 ? 18.171  -25.580 66.609 1.00 57.82  ? 209 LEU C CD2 1 
ATOM   3061 N N   . PRO C 3 194 ? 19.658  -30.123 67.699 1.00 60.53  ? 210 PRO C N   1 
ATOM   3062 C CA  . PRO C 3 194 ? 20.701  -31.052 68.113 1.00 61.18  ? 210 PRO C CA  1 
ATOM   3063 C C   . PRO C 3 194 ? 21.550  -30.420 69.206 1.00 61.89  ? 210 PRO C C   1 
ATOM   3064 O O   . PRO C 3 194 ? 21.903  -29.241 69.109 1.00 61.54  ? 210 PRO C O   1 
ATOM   3065 C CB  . PRO C 3 194 ? 21.536  -31.203 66.849 1.00 61.79  ? 210 PRO C CB  1 
ATOM   3066 C CG  . PRO C 3 194 ? 20.585  -31.040 65.762 1.00 60.78  ? 210 PRO C CG  1 
ATOM   3067 C CD  . PRO C 3 194 ? 19.524  -30.081 66.233 1.00 60.91  ? 210 PRO C CD  1 
ATOM   3068 N N   . ASN C 3 195 ? 21.875  -31.199 70.233 1.00 63.35  ? 211 ASN C N   1 
ATOM   3069 C CA  . ASN C 3 195 ? 22.642  -30.677 71.353 1.00 62.98  ? 211 ASN C CA  1 
ATOM   3070 C C   . ASN C 3 195 ? 24.049  -30.253 70.936 1.00 62.37  ? 211 ASN C C   1 
ATOM   3071 O O   . ASN C 3 195 ? 24.810  -29.731 71.749 1.00 61.96  ? 211 ASN C O   1 
ATOM   3072 C CB  . ASN C 3 195 ? 22.678  -31.676 72.503 1.00 63.78  ? 211 ASN C CB  1 
ATOM   3073 C CG  . ASN C 3 195 ? 22.401  -31.016 73.839 1.00 65.95  ? 211 ASN C CG  1 
ATOM   3074 O OD1 . ASN C 3 195 ? 23.196  -30.213 74.328 1.00 66.83  ? 211 ASN C OD1 1 
ATOM   3075 N ND2 . ASN C 3 195 ? 21.259  -31.341 74.431 1.00 67.79  ? 211 ASN C ND2 1 
ATOM   3076 N N   . ASP C 3 196 ? 24.368  -30.448 69.657 1.00 61.45  ? 212 ASP C N   1 
ATOM   3077 C CA  . ASP C 3 196 ? 25.645  -30.013 69.104 1.00 60.42  ? 212 ASP C CA  1 
ATOM   3078 C C   . ASP C 3 196 ? 25.515  -29.040 67.920 1.00 58.71  ? 212 ASP C C   1 
ATOM   3079 O O   . ASP C 3 196 ? 26.425  -28.956 67.095 1.00 58.42  ? 212 ASP C O   1 
ATOM   3080 C CB  . ASP C 3 196 ? 26.491  -31.225 68.687 1.00 61.80  ? 212 ASP C CB  1 
ATOM   3081 C CG  . ASP C 3 196 ? 27.141  -31.931 69.875 1.00 62.01  ? 212 ASP C CG  1 
ATOM   3082 O OD1 . ASP C 3 196 ? 27.756  -31.248 70.721 1.00 62.25  ? 212 ASP C OD1 1 
ATOM   3083 O OD2 . ASP C 3 196 ? 27.098  -33.172 70.013 1.00 60.79  ? 212 ASP C OD2 1 
ATOM   3084 N N   . VAL C 3 197 ? 24.407  -28.301 67.835 1.00 57.66  ? 213 VAL C N   1 
ATOM   3085 C CA  . VAL C 3 197 ? 24.230  -27.350 66.724 1.00 56.07  ? 213 VAL C CA  1 
ATOM   3086 C C   . VAL C 3 197 ? 25.322  -26.294 66.667 1.00 55.18  ? 213 VAL C C   1 
ATOM   3087 O O   . VAL C 3 197 ? 25.897  -26.025 65.606 1.00 54.58  ? 213 VAL C O   1 
ATOM   3088 C CB  . VAL C 3 197 ? 22.848  -26.618 66.716 1.00 55.19  ? 213 VAL C CB  1 
ATOM   3089 C CG1 . VAL C 3 197 ? 21.815  -27.455 66.008 1.00 55.42  ? 213 VAL C CG1 1 
ATOM   3090 C CG2 . VAL C 3 197 ? 22.385  -26.251 68.109 1.00 53.73  ? 213 VAL C CG2 1 
ATOM   3091 N N   . PHE C 3 198 ? 25.627  -25.710 67.816 1.00 54.17  ? 214 PHE C N   1 
ATOM   3092 C CA  . PHE C 3 198 ? 26.549  -24.593 67.823 1.00 54.13  ? 214 PHE C CA  1 
ATOM   3093 C C   . PHE C 3 198 ? 27.989  -25.040 67.987 1.00 54.67  ? 214 PHE C C   1 
ATOM   3094 O O   . PHE C 3 198 ? 28.888  -24.215 68.123 1.00 55.33  ? 214 PHE C O   1 
ATOM   3095 C CB  . PHE C 3 198 ? 26.108  -23.535 68.852 1.00 52.09  ? 214 PHE C CB  1 
ATOM   3096 C CG  . PHE C 3 198 ? 24.688  -23.067 68.657 1.00 47.46  ? 214 PHE C CG  1 
ATOM   3097 C CD1 . PHE C 3 198 ? 24.296  -22.463 67.467 1.00 47.18  ? 214 PHE C CD1 1 
ATOM   3098 C CD2 . PHE C 3 198 ? 23.738  -23.256 69.646 1.00 46.54  ? 214 PHE C CD2 1 
ATOM   3099 C CE1 . PHE C 3 198 ? 22.987  -22.057 67.270 1.00 46.12  ? 214 PHE C CE1 1 
ATOM   3100 C CE2 . PHE C 3 198 ? 22.425  -22.851 69.459 1.00 45.98  ? 214 PHE C CE2 1 
ATOM   3101 C CZ  . PHE C 3 198 ? 22.049  -22.253 68.267 1.00 46.60  ? 214 PHE C CZ  1 
ATOM   3102 N N   . HIS C 3 199 ? 28.201  -26.353 67.933 1.00 55.68  ? 215 HIS C N   1 
ATOM   3103 C CA  . HIS C 3 199 ? 29.538  -26.918 68.017 1.00 56.62  ? 215 HIS C CA  1 
ATOM   3104 C C   . HIS C 3 199 ? 30.495  -26.170 67.103 1.00 55.48  ? 215 HIS C C   1 
ATOM   3105 O O   . HIS C 3 199 ? 30.270  -26.062 65.902 1.00 55.50  ? 215 HIS C O   1 
ATOM   3106 C CB  . HIS C 3 199 ? 29.525  -28.400 67.641 1.00 59.61  ? 215 HIS C CB  1 
ATOM   3107 C CG  . HIS C 3 199 ? 30.740  -29.156 68.100 1.00 64.72  ? 215 HIS C CG  1 
ATOM   3108 N ND1 . HIS C 3 199 ? 30.846  -29.706 69.364 1.00 64.99  ? 215 HIS C ND1 1 
ATOM   3109 C CD2 . HIS C 3 199 ? 31.898  -29.458 67.462 1.00 65.02  ? 215 HIS C CD2 1 
ATOM   3110 C CE1 . HIS C 3 199 ? 32.014  -30.310 69.483 1.00 66.07  ? 215 HIS C CE1 1 
ATOM   3111 N NE2 . HIS C 3 199 ? 32.672  -30.173 68.344 1.00 66.24  ? 215 HIS C NE2 1 
ATOM   3112 N N   . GLY C 3 200 ? 31.550  -25.635 67.700 1.00 54.91  ? 216 GLY C N   1 
ATOM   3113 C CA  . GLY C 3 200 ? 32.577  -24.927 66.951 1.00 54.32  ? 216 GLY C CA  1 
ATOM   3114 C C   . GLY C 3 200 ? 32.118  -23.615 66.358 1.00 51.94  ? 216 GLY C C   1 
ATOM   3115 O O   . GLY C 3 200 ? 32.559  -23.238 65.278 1.00 51.16  ? 216 GLY C O   1 
ATOM   3116 N N   . ALA C 3 201 ? 31.240  -22.921 67.073 1.00 52.08  ? 217 ALA C N   1 
ATOM   3117 C CA  . ALA C 3 201 ? 30.733  -21.627 66.632 1.00 52.67  ? 217 ALA C CA  1 
ATOM   3118 C C   . ALA C 3 201 ? 30.766  -20.563 67.732 1.00 52.84  ? 217 ALA C C   1 
ATOM   3119 O O   . ALA C 3 201 ? 30.627  -20.873 68.921 1.00 51.04  ? 217 ALA C O   1 
ATOM   3120 C CB  . ALA C 3 201 ? 29.308  -21.773 66.090 1.00 51.39  ? 217 ALA C CB  1 
ATOM   3121 N N   . SER C 3 202 ? 30.936  -19.309 67.311 1.00 53.37  ? 218 SER C N   1 
ATOM   3122 C CA  . SER C 3 202 ? 30.842  -18.152 68.195 1.00 54.16  ? 218 SER C CA  1 
ATOM   3123 C C   . SER C 3 202 ? 29.443  -17.946 68.797 1.00 55.14  ? 218 SER C C   1 
ATOM   3124 O O   . SER C 3 202 ? 29.192  -16.910 69.427 1.00 58.30  ? 218 SER C O   1 
ATOM   3125 C CB  . SER C 3 202 ? 31.259  -16.878 67.463 1.00 54.72  ? 218 SER C CB  1 
ATOM   3126 O OG  . SER C 3 202 ? 32.667  -16.767 67.399 1.00 54.95  ? 218 SER C OG  1 
ATOM   3127 N N   . GLY C 3 203 ? 28.548  -18.919 68.596 1.00 52.48  ? 219 GLY C N   1 
ATOM   3128 C CA  . GLY C 3 203 ? 27.228  -18.931 69.224 1.00 47.98  ? 219 GLY C CA  1 
ATOM   3129 C C   . GLY C 3 203 ? 26.407  -17.684 68.995 1.00 47.73  ? 219 GLY C C   1 
ATOM   3130 O O   . GLY C 3 203 ? 26.926  -16.572 69.029 1.00 47.60  ? 219 GLY C O   1 
ATOM   3131 N N   . PRO C 3 204 ? 25.105  -17.846 68.799 1.00 46.24  ? 220 PRO C N   1 
ATOM   3132 C CA  . PRO C 3 204 ? 24.241  -16.714 68.514 1.00 45.71  ? 220 PRO C CA  1 
ATOM   3133 C C   . PRO C 3 204 ? 24.339  -15.671 69.613 1.00 46.14  ? 220 PRO C C   1 
ATOM   3134 O O   . PRO C 3 204 ? 24.446  -16.026 70.791 1.00 48.88  ? 220 PRO C O   1 
ATOM   3135 C CB  . PRO C 3 204 ? 22.839  -17.322 68.534 1.00 44.78  ? 220 PRO C CB  1 
ATOM   3136 C CG  . PRO C 3 204 ? 23.028  -18.741 68.365 1.00 45.56  ? 220 PRO C CG  1 
ATOM   3137 C CD  . PRO C 3 204 ? 24.350  -19.098 68.932 1.00 46.18  ? 220 PRO C CD  1 
ATOM   3138 N N   . VAL C 3 205 ? 24.324  -14.400 69.229 1.00 45.11  ? 221 VAL C N   1 
ATOM   3139 C CA  . VAL C 3 205 ? 24.169  -13.316 70.192 1.00 43.24  ? 221 VAL C CA  1 
ATOM   3140 C C   . VAL C 3 205 ? 22.662  -13.080 70.341 1.00 43.17  ? 221 VAL C C   1 
ATOM   3141 O O   . VAL C 3 205 ? 22.154  -12.985 71.455 1.00 44.01  ? 221 VAL C O   1 
ATOM   3142 C CB  . VAL C 3 205 ? 24.911  -12.030 69.746 1.00 42.99  ? 221 VAL C CB  1 
ATOM   3143 C CG1 . VAL C 3 205 ? 24.698  -10.893 70.743 1.00 42.06  ? 221 VAL C CG1 1 
ATOM   3144 C CG2 . VAL C 3 205 ? 26.397  -12.319 69.578 1.00 40.94  ? 221 VAL C CG2 1 
ATOM   3145 N N   . ILE C 3 206 ? 21.960  -13.005 69.213 1.00 42.40  ? 222 ILE C N   1 
ATOM   3146 C CA  . ILE C 3 206 ? 20.499  -12.897 69.188 1.00 42.93  ? 222 ILE C CA  1 
ATOM   3147 C C   . ILE C 3 206 ? 19.966  -14.187 68.571 1.00 40.57  ? 222 ILE C C   1 
ATOM   3148 O O   . ILE C 3 206 ? 20.482  -14.614 67.550 1.00 42.77  ? 222 ILE C O   1 
ATOM   3149 C CB  . ILE C 3 206 ? 20.051  -11.692 68.313 1.00 43.63  ? 222 ILE C CB  1 
ATOM   3150 C CG1 . ILE C 3 206 ? 20.740  -10.402 68.752 1.00 44.18  ? 222 ILE C CG1 1 
ATOM   3151 C CG2 . ILE C 3 206 ? 18.539  -11.502 68.373 1.00 45.95  ? 222 ILE C CG2 1 
ATOM   3152 C CD1 . ILE C 3 206 ? 20.320  -9.202  67.936 1.00 42.53  ? 222 ILE C CD1 1 
ATOM   3153 N N   . LEU C 3 207 ? 18.947  -14.802 69.170 1.00 39.35  ? 223 LEU C N   1 
ATOM   3154 C CA  . LEU C 3 207 ? 18.391  -16.050 68.619 1.00 39.98  ? 223 LEU C CA  1 
ATOM   3155 C C   . LEU C 3 207 ? 16.882  -16.029 68.497 1.00 40.85  ? 223 LEU C C   1 
ATOM   3156 O O   . LEU C 3 207 ? 16.182  -15.879 69.491 1.00 42.97  ? 223 LEU C O   1 
ATOM   3157 C CB  . LEU C 3 207 ? 18.800  -17.271 69.453 1.00 38.51  ? 223 LEU C CB  1 
ATOM   3158 C CG  . LEU C 3 207 ? 18.217  -18.618 68.975 1.00 36.84  ? 223 LEU C CG  1 
ATOM   3159 C CD1 . LEU C 3 207 ? 18.898  -19.077 67.697 1.00 32.40  ? 223 LEU C CD1 1 
ATOM   3160 C CD2 . LEU C 3 207 ? 18.348  -19.678 70.051 1.00 34.14  ? 223 LEU C CD2 1 
ATOM   3161 N N   . ASP C 3 208 ? 16.388  -16.240 67.285 1.00 41.83  ? 224 ASP C N   1 
ATOM   3162 C CA  . ASP C 3 208 ? 14.966  -16.138 67.010 1.00 43.64  ? 224 ASP C CA  1 
ATOM   3163 C C   . ASP C 3 208 ? 14.326  -17.501 66.688 1.00 41.70  ? 224 ASP C C   1 
ATOM   3164 O O   . ASP C 3 208 ? 14.522  -18.047 65.607 1.00 42.43  ? 224 ASP C O   1 
ATOM   3165 C CB  . ASP C 3 208 ? 14.771  -15.160 65.850 1.00 48.08  ? 224 ASP C CB  1 
ATOM   3166 C CG  . ASP C 3 208 ? 13.531  -14.304 65.990 1.00 54.35  ? 224 ASP C CG  1 
ATOM   3167 O OD1 . ASP C 3 208 ? 12.415  -14.849 66.193 1.00 58.25  ? 224 ASP C OD1 1 
ATOM   3168 O OD2 . ASP C 3 208 ? 13.592  -13.058 65.891 1.00 61.58  ? 224 ASP C OD2 1 
ATOM   3169 N N   . ILE C 3 209 ? 13.567  -18.045 67.630 1.00 39.89  ? 225 ILE C N   1 
ATOM   3170 C CA  . ILE C 3 209 ? 12.922  -19.346 67.443 1.00 39.74  ? 225 ILE C CA  1 
ATOM   3171 C C   . ILE C 3 209 ? 11.405  -19.201 67.486 1.00 41.14  ? 225 ILE C C   1 
ATOM   3172 O O   . ILE C 3 209 ? 10.661  -20.170 67.652 1.00 40.42  ? 225 ILE C O   1 
ATOM   3173 C CB  . ILE C 3 209 ? 13.383  -20.353 68.514 1.00 38.29  ? 225 ILE C CB  1 
ATOM   3174 C CG1 . ILE C 3 209 ? 13.363  -19.701 69.896 1.00 37.97  ? 225 ILE C CG1 1 
ATOM   3175 C CG2 . ILE C 3 209 ? 14.768  -20.853 68.200 1.00 39.30  ? 225 ILE C CG2 1 
ATOM   3176 C CD1 . ILE C 3 209 ? 13.524  -20.660 71.023 1.00 38.88  ? 225 ILE C CD1 1 
ATOM   3177 N N   . SER C 3 210 ? 10.955  -17.969 67.335 1.00 42.39  ? 226 SER C N   1 
ATOM   3178 C CA  . SER C 3 210 ? 9.539   -17.658 67.302 1.00 44.47  ? 226 SER C CA  1 
ATOM   3179 C C   . SER C 3 210 ? 8.756   -18.568 66.343 1.00 45.38  ? 226 SER C C   1 
ATOM   3180 O O   . SER C 3 210 ? 9.256   -18.983 65.296 1.00 45.36  ? 226 SER C O   1 
ATOM   3181 C CB  . SER C 3 210 ? 9.369   -16.199 66.906 1.00 43.52  ? 226 SER C CB  1 
ATOM   3182 O OG  . SER C 3 210 ? 8.342   -15.610 67.663 1.00 48.40  ? 226 SER C OG  1 
ATOM   3183 N N   . ARG C 3 211 ? 7.521   -18.875 66.715 1.00 46.28  ? 227 ARG C N   1 
ATOM   3184 C CA  . ARG C 3 211 ? 6.664   -19.757 65.921 1.00 47.45  ? 227 ARG C CA  1 
ATOM   3185 C C   . ARG C 3 211 ? 7.354   -21.017 65.389 1.00 47.26  ? 227 ARG C C   1 
ATOM   3186 O O   . ARG C 3 211 ? 7.284   -21.311 64.201 1.00 48.98  ? 227 ARG C O   1 
ATOM   3187 C CB  . ARG C 3 211 ? 5.986   -18.971 64.789 1.00 48.15  ? 227 ARG C CB  1 
ATOM   3188 C CG  . ARG C 3 211 ? 4.570   -18.491 65.133 1.00 51.32  ? 227 ARG C CG  1 
ATOM   3189 C CD  . ARG C 3 211 ? 4.038   -17.346 64.261 1.00 52.26  ? 227 ARG C CD  1 
ATOM   3190 N NE  . ARG C 3 211 ? 5.038   -16.295 64.072 1.00 54.00  ? 227 ARG C NE  1 
ATOM   3191 C CZ  . ARG C 3 211 ? 5.392   -15.414 65.001 1.00 56.35  ? 227 ARG C CZ  1 
ATOM   3192 N NH1 . ARG C 3 211 ? 4.824   -15.447 66.205 1.00 56.65  ? 227 ARG C NH1 1 
ATOM   3193 N NH2 . ARG C 3 211 ? 6.329   -14.504 64.729 1.00 57.14  ? 227 ARG C NH2 1 
ATOM   3194 N N   . THR C 3 212 ? 8.026   -21.745 66.266 1.00 47.03  ? 228 THR C N   1 
ATOM   3195 C CA  . THR C 3 212 ? 8.500   -23.090 65.954 1.00 48.42  ? 228 THR C CA  1 
ATOM   3196 C C   . THR C 3 212 ? 7.893   -23.988 67.009 1.00 49.82  ? 228 THR C C   1 
ATOM   3197 O O   . THR C 3 212 ? 7.120   -23.520 67.845 1.00 50.94  ? 228 THR C O   1 
ATOM   3198 C CB  . THR C 3 212 ? 10.030  -23.201 66.011 1.00 47.95  ? 228 THR C CB  1 
ATOM   3199 O OG1 . THR C 3 212 ? 10.515  -22.516 67.171 1.00 49.45  ? 228 THR C OG1 1 
ATOM   3200 C CG2 . THR C 3 212 ? 10.671  -22.494 64.838 1.00 47.24  ? 228 THR C CG2 1 
ATOM   3201 N N   . ARG C 3 213 ? 8.237   -25.272 66.990 1.00 50.01  ? 229 ARG C N   1 
ATOM   3202 C CA  . ARG C 3 213 ? 7.772   -26.145 68.050 1.00 51.76  ? 229 ARG C CA  1 
ATOM   3203 C C   . ARG C 3 213 ? 8.911   -26.496 69.020 1.00 53.32  ? 229 ARG C C   1 
ATOM   3204 O O   . ARG C 3 213 ? 8.750   -27.374 69.868 1.00 53.98  ? 229 ARG C O   1 
ATOM   3205 C CB  . ARG C 3 213 ? 7.078   -27.387 67.490 1.00 52.66  ? 229 ARG C CB  1 
ATOM   3206 C CG  . ARG C 3 213 ? 5.900   -27.075 66.560 1.00 56.50  ? 229 ARG C CG  1 
ATOM   3207 C CD  . ARG C 3 213 ? 4.790   -28.132 66.516 1.00 59.70  ? 229 ARG C CD  1 
ATOM   3208 N NE  . ARG C 3 213 ? 5.275   -29.490 66.780 1.00 65.77  ? 229 ARG C NE  1 
ATOM   3209 C CZ  . ARG C 3 213 ? 4.951   -30.216 67.858 1.00 67.11  ? 229 ARG C CZ  1 
ATOM   3210 N NH1 . ARG C 3 213 ? 4.127   -29.726 68.781 1.00 67.20  ? 229 ARG C NH1 1 
ATOM   3211 N NH2 . ARG C 3 213 ? 5.450   -31.437 68.015 1.00 67.62  ? 229 ARG C NH2 1 
ATOM   3212 N N   . ILE C 3 214 ? 10.043  -25.787 68.898 1.00 53.09  ? 230 ILE C N   1 
ATOM   3213 C CA  . ILE C 3 214 ? 11.197  -25.923 69.808 1.00 52.13  ? 230 ILE C CA  1 
ATOM   3214 C C   . ILE C 3 214 ? 10.791  -25.651 71.250 1.00 53.79  ? 230 ILE C C   1 
ATOM   3215 O O   . ILE C 3 214 ? 10.180  -24.620 71.544 1.00 53.46  ? 230 ILE C O   1 
ATOM   3216 C CB  . ILE C 3 214 ? 12.332  -24.933 69.443 1.00 50.95  ? 230 ILE C CB  1 
ATOM   3217 C CG1 . ILE C 3 214 ? 12.757  -25.106 67.986 1.00 49.29  ? 230 ILE C CG1 1 
ATOM   3218 C CG2 . ILE C 3 214 ? 13.524  -25.100 70.394 1.00 48.47  ? 230 ILE C CG2 1 
ATOM   3219 C CD1 . ILE C 3 214 ? 13.886  -24.210 67.575 1.00 46.95  ? 230 ILE C CD1 1 
ATOM   3220 N N   . HIS C 3 215 ? 11.146  -26.567 72.147 1.00 54.80  ? 231 HIS C N   1 
ATOM   3221 C CA  . HIS C 3 215 ? 10.789  -26.424 73.548 1.00 57.08  ? 231 HIS C CA  1 
ATOM   3222 C C   . HIS C 3 215 ? 11.964  -26.590 74.507 1.00 57.21  ? 231 HIS C C   1 
ATOM   3223 O O   . HIS C 3 215 ? 11.784  -26.900 75.685 1.00 57.93  ? 231 HIS C O   1 
ATOM   3224 C CB  . HIS C 3 215 ? 9.643   -27.371 73.892 1.00 59.45  ? 231 HIS C CB  1 
ATOM   3225 C CG  . HIS C 3 215 ? 8.371   -27.047 73.171 1.00 65.35  ? 231 HIS C CG  1 
ATOM   3226 N ND1 . HIS C 3 215 ? 8.023   -25.756 72.825 1.00 68.03  ? 231 HIS C ND1 1 
ATOM   3227 C CD2 . HIS C 3 215 ? 7.362   -27.841 72.733 1.00 67.81  ? 231 HIS C CD2 1 
ATOM   3228 C CE1 . HIS C 3 215 ? 6.859   -25.769 72.198 1.00 69.33  ? 231 HIS C CE1 1 
ATOM   3229 N NE2 . HIS C 3 215 ? 6.436   -27.022 72.129 1.00 70.49  ? 231 HIS C NE2 1 
ATOM   3230 N N   . SER C 3 216 ? 13.165  -26.345 73.996 1.00 56.72  ? 232 SER C N   1 
ATOM   3231 C CA  . SER C 3 216 ? 14.376  -26.435 74.785 1.00 56.06  ? 232 SER C CA  1 
ATOM   3232 C C   . SER C 3 216 ? 15.552  -26.023 73.929 1.00 55.72  ? 232 SER C C   1 
ATOM   3233 O O   . SER C 3 216 ? 15.497  -26.114 72.709 1.00 55.35  ? 232 SER C O   1 
ATOM   3234 C CB  . SER C 3 216 ? 14.596  -27.874 75.253 1.00 57.11  ? 232 SER C CB  1 
ATOM   3235 O OG  . SER C 3 216 ? 15.212  -28.658 74.243 1.00 60.57  ? 232 SER C OG  1 
ATOM   3236 N N   . LEU C 3 217 ? 16.625  -25.591 74.569 1.00 56.68  ? 233 LEU C N   1 
ATOM   3237 C CA  . LEU C 3 217 ? 17.836  -25.271 73.844 1.00 57.73  ? 233 LEU C CA  1 
ATOM   3238 C C   . LEU C 3 217 ? 19.007  -26.113 74.327 1.00 58.69  ? 233 LEU C C   1 
ATOM   3239 O O   . LEU C 3 217 ? 18.992  -26.606 75.440 1.00 59.19  ? 233 LEU C O   1 
ATOM   3240 C CB  . LEU C 3 217 ? 18.185  -23.803 74.035 1.00 57.36  ? 233 LEU C CB  1 
ATOM   3241 C CG  . LEU C 3 217 ? 17.190  -22.806 73.479 1.00 56.64  ? 233 LEU C CG  1 
ATOM   3242 C CD1 . LEU C 3 217 ? 17.089  -21.618 74.389 1.00 57.21  ? 233 LEU C CD1 1 
ATOM   3243 C CD2 . LEU C 3 217 ? 17.608  -22.384 72.100 1.00 59.35  ? 233 LEU C CD2 1 
ATOM   3244 N N   . PRO C 3 218 ? 20.012  -26.291 73.472 1.00 60.80  ? 234 PRO C N   1 
ATOM   3245 C CA  . PRO C 3 218 ? 21.248  -26.981 73.828 1.00 63.62  ? 234 PRO C CA  1 
ATOM   3246 C C   . PRO C 3 218 ? 21.938  -26.355 75.045 1.00 65.59  ? 234 PRO C C   1 
ATOM   3247 O O   . PRO C 3 218 ? 21.853  -25.145 75.255 1.00 66.75  ? 234 PRO C O   1 
ATOM   3248 C CB  . PRO C 3 218 ? 22.110  -26.767 72.586 1.00 63.72  ? 234 PRO C CB  1 
ATOM   3249 C CG  . PRO C 3 218 ? 21.127  -26.752 71.500 1.00 62.45  ? 234 PRO C CG  1 
ATOM   3250 C CD  . PRO C 3 218 ? 19.999  -25.936 72.039 1.00 62.01  ? 234 PRO C CD  1 
ATOM   3251 N N   . SER C 3 219 ? 22.638  -27.184 75.816 1.00 67.39  ? 235 SER C N   1 
ATOM   3252 C CA  . SER C 3 219 ? 23.303  -26.742 77.042 1.00 70.40  ? 235 SER C CA  1 
ATOM   3253 C C   . SER C 3 219 ? 24.498  -25.813 76.809 1.00 71.49  ? 235 SER C C   1 
ATOM   3254 O O   . SER C 3 219 ? 24.693  -24.859 77.571 1.00 73.35  ? 235 SER C O   1 
ATOM   3255 C CB  . SER C 3 219 ? 23.706  -27.945 77.895 1.00 70.76  ? 235 SER C CB  1 
ATOM   3256 O OG  . SER C 3 219 ? 24.095  -29.033 77.057 1.00 74.21  ? 235 SER C OG  1 
ATOM   3257 N N   . TYR C 3 220 ? 25.299  -26.076 75.778 1.00 71.69  ? 236 TYR C N   1 
ATOM   3258 C CA  . TYR C 3 220 ? 26.378  -25.143 75.443 1.00 72.80  ? 236 TYR C CA  1 
ATOM   3259 C C   . TYR C 3 220 ? 26.128  -24.454 74.095 1.00 72.07  ? 236 TYR C C   1 
ATOM   3260 O O   . TYR C 3 220 ? 25.257  -24.866 73.324 1.00 72.88  ? 236 TYR C O   1 
ATOM   3261 C CB  . TYR C 3 220 ? 27.745  -25.836 75.452 1.00 73.56  ? 236 TYR C CB  1 
ATOM   3262 C CG  . TYR C 3 220 ? 28.053  -26.585 74.178 1.00 76.11  ? 236 TYR C CG  1 
ATOM   3263 C CD1 . TYR C 3 220 ? 27.468  -27.831 73.926 1.00 76.61  ? 236 TYR C CD1 1 
ATOM   3264 C CD2 . TYR C 3 220 ? 28.920  -26.048 73.215 1.00 76.09  ? 236 TYR C CD2 1 
ATOM   3265 C CE1 . TYR C 3 220 ? 27.743  -28.531 72.757 1.00 76.01  ? 236 TYR C CE1 1 
ATOM   3266 C CE2 . TYR C 3 220 ? 29.196  -26.739 72.035 1.00 76.00  ? 236 TYR C CE2 1 
ATOM   3267 C CZ  . TYR C 3 220 ? 28.604  -27.980 71.819 1.00 76.17  ? 236 TYR C CZ  1 
ATOM   3268 O OH  . TYR C 3 220 ? 28.863  -28.685 70.675 1.00 76.15  ? 236 TYR C OH  1 
ATOM   3269 N N   . GLY C 3 221 ? 26.905  -23.407 73.824 1.00 71.29  ? 237 GLY C N   1 
ATOM   3270 C CA  . GLY C 3 221 ? 26.792  -22.660 72.578 1.00 67.55  ? 237 GLY C CA  1 
ATOM   3271 C C   . GLY C 3 221 ? 26.090  -21.329 72.750 1.00 64.96  ? 237 GLY C C   1 
ATOM   3272 O O   . GLY C 3 221 ? 26.295  -20.419 71.953 1.00 66.19  ? 237 GLY C O   1 
ATOM   3273 N N   . LEU C 3 222 ? 25.272  -21.209 73.792 1.00 62.59  ? 238 LEU C N   1 
ATOM   3274 C CA  . LEU C 3 222 ? 24.495  -19.995 74.016 1.00 60.57  ? 238 LEU C CA  1 
ATOM   3275 C C   . LEU C 3 222 ? 25.112  -19.042 75.028 1.00 58.14  ? 238 LEU C C   1 
ATOM   3276 O O   . LEU C 3 222 ? 24.413  -18.249 75.641 1.00 56.23  ? 238 LEU C O   1 
ATOM   3277 C CB  . LEU C 3 222 ? 23.065  -20.349 74.424 1.00 61.89  ? 238 LEU C CB  1 
ATOM   3278 C CG  . LEU C 3 222 ? 22.245  -21.054 73.334 1.00 64.20  ? 238 LEU C CG  1 
ATOM   3279 C CD1 . LEU C 3 222 ? 20.954  -21.606 73.921 1.00 64.20  ? 238 LEU C CD1 1 
ATOM   3280 C CD2 . LEU C 3 222 ? 21.957  -20.126 72.150 1.00 64.08  ? 238 LEU C CD2 1 
ATOM   3281 N N   . GLU C 3 223 ? 26.433  -19.105 75.161 1.00 57.74  ? 239 GLU C N   1 
ATOM   3282 C CA  . GLU C 3 223 ? 27.181  -18.277 76.112 1.00 57.80  ? 239 GLU C CA  1 
ATOM   3283 C C   . GLU C 3 223 ? 27.177  -16.779 75.830 1.00 56.29  ? 239 GLU C C   1 
ATOM   3284 O O   . GLU C 3 223 ? 27.488  -15.984 76.710 1.00 56.76  ? 239 GLU C O   1 
ATOM   3285 C CB  . GLU C 3 223 ? 28.623  -18.788 76.258 1.00 59.91  ? 239 GLU C CB  1 
ATOM   3286 C CG  . GLU C 3 223 ? 29.086  -19.745 75.161 1.00 63.72  ? 239 GLU C CG  1 
ATOM   3287 C CD  . GLU C 3 223 ? 28.740  -21.205 75.437 1.00 65.61  ? 239 GLU C CD  1 
ATOM   3288 O OE1 . GLU C 3 223 ? 27.878  -21.483 76.302 1.00 66.37  ? 239 GLU C OE1 1 
ATOM   3289 O OE2 . GLU C 3 223 ? 29.337  -22.084 74.773 1.00 67.04  ? 239 GLU C OE2 1 
ATOM   3290 N N   . ASN C 3 224 ? 26.815  -16.393 74.611 1.00 56.30  ? 240 ASN C N   1 
ATOM   3291 C CA  . ASN C 3 224 ? 26.763  -14.983 74.230 1.00 53.57  ? 240 ASN C CA  1 
ATOM   3292 C C   . ASN C 3 224 ? 25.336  -14.499 73.957 1.00 51.20  ? 240 ASN C C   1 
ATOM   3293 O O   . ASN C 3 224 ? 25.133  -13.367 73.520 1.00 49.64  ? 240 ASN C O   1 
ATOM   3294 C CB  . ASN C 3 224 ? 27.663  -14.716 73.017 1.00 55.59  ? 240 ASN C CB  1 
ATOM   3295 C CG  . ASN C 3 224 ? 29.061  -15.305 73.172 1.00 58.43  ? 240 ASN C CG  1 
ATOM   3296 O OD1 . ASN C 3 224 ? 29.550  -16.010 72.282 1.00 61.05  ? 240 ASN C OD1 1 
ATOM   3297 N ND2 . ASN C 3 224 ? 29.710  -15.018 74.299 1.00 61.04  ? 240 ASN C ND2 1 
ATOM   3298 N N   . LEU C 3 225 ? 24.360  -15.363 74.217 1.00 49.13  ? 241 LEU C N   1 
ATOM   3299 C CA  . LEU C 3 225 ? 22.958  -15.018 74.059 1.00 49.28  ? 241 LEU C CA  1 
ATOM   3300 C C   . LEU C 3 225 ? 22.620  -13.745 74.845 1.00 49.69  ? 241 LEU C C   1 
ATOM   3301 O O   . LEU C 3 225 ? 22.698  -13.733 76.066 1.00 50.08  ? 241 LEU C O   1 
ATOM   3302 C CB  . LEU C 3 225 ? 22.076  -16.168 74.563 1.00 48.69  ? 241 LEU C CB  1 
ATOM   3303 C CG  . LEU C 3 225 ? 20.946  -16.737 73.686 1.00 48.33  ? 241 LEU C CG  1 
ATOM   3304 C CD1 . LEU C 3 225 ? 19.694  -17.026 74.514 1.00 46.81  ? 241 LEU C CD1 1 
ATOM   3305 C CD2 . LEU C 3 225 ? 20.607  -15.796 72.549 1.00 47.58  ? 241 LEU C CD2 1 
ATOM   3306 N N   . LYS C 3 226 ? 22.268  -12.673 74.139 1.00 50.68  ? 242 LYS C N   1 
ATOM   3307 C CA  . LYS C 3 226 ? 21.813  -11.432 74.782 1.00 51.61  ? 242 LYS C CA  1 
ATOM   3308 C C   . LYS C 3 226 ? 20.321  -11.214 74.569 1.00 51.65  ? 242 LYS C C   1 
ATOM   3309 O O   . LYS C 3 226 ? 19.690  -10.464 75.312 1.00 52.69  ? 242 LYS C O   1 
ATOM   3310 C CB  . LYS C 3 226 ? 22.557  -10.202 74.250 1.00 52.36  ? 242 LYS C CB  1 
ATOM   3311 C CG  . LYS C 3 226 ? 24.019  -10.065 74.680 1.00 54.31  ? 242 LYS C CG  1 
ATOM   3312 C CD  . LYS C 3 226 ? 24.201  -9.961  76.182 1.00 53.14  ? 242 LYS C CD  1 
ATOM   3313 C CE  . LYS C 3 226 ? 25.672  -10.089 76.528 1.00 55.48  ? 242 LYS C CE  1 
ATOM   3314 N NZ  . LYS C 3 226 ? 25.918  -10.044 77.999 1.00 57.95  ? 242 LYS C NZ  1 
ATOM   3315 N N   . LYS C 3 227 ? 19.767  -11.852 73.541 1.00 52.38  ? 243 LYS C N   1 
ATOM   3316 C CA  . LYS C 3 227 ? 18.348  -11.720 73.227 1.00 50.70  ? 243 LYS C CA  1 
ATOM   3317 C C   . LYS C 3 227 ? 17.768  -13.039 72.685 1.00 49.66  ? 243 LYS C C   1 
ATOM   3318 O O   . LYS C 3 227 ? 18.356  -13.657 71.795 1.00 49.97  ? 243 LYS C O   1 
ATOM   3319 C CB  . LYS C 3 227 ? 18.169  -10.593 72.210 1.00 50.96  ? 243 LYS C CB  1 
ATOM   3320 C CG  . LYS C 3 227 ? 16.859  -9.854  72.324 1.00 52.44  ? 243 LYS C CG  1 
ATOM   3321 C CD  . LYS C 3 227 ? 16.868  -8.601  71.451 1.00 54.75  ? 243 LYS C CD  1 
ATOM   3322 C CE  . LYS C 3 227 ? 17.174  -7.349  72.282 1.00 56.26  ? 243 LYS C CE  1 
ATOM   3323 N NZ  . LYS C 3 227 ? 17.037  -6.117  71.458 1.00 57.09  ? 243 LYS C NZ  1 
ATOM   3324 N N   . LEU C 3 228 ? 16.634  -13.478 73.228 1.00 46.29  ? 244 LEU C N   1 
ATOM   3325 C CA  . LEU C 3 228 ? 15.952  -14.656 72.688 1.00 42.51  ? 244 LEU C CA  1 
ATOM   3326 C C   . LEU C 3 228 ? 14.520  -14.319 72.310 1.00 41.67  ? 244 LEU C C   1 
ATOM   3327 O O   . LEU C 3 228 ? 13.721  -13.944 73.155 1.00 41.39  ? 244 LEU C O   1 
ATOM   3328 C CB  . LEU C 3 228 ? 15.973  -15.800 73.691 1.00 39.92  ? 244 LEU C CB  1 
ATOM   3329 C CG  . LEU C 3 228 ? 15.090  -17.019 73.438 1.00 37.34  ? 244 LEU C CG  1 
ATOM   3330 C CD1 . LEU C 3 228 ? 15.690  -17.943 72.401 1.00 35.61  ? 244 LEU C CD1 1 
ATOM   3331 C CD2 . LEU C 3 228 ? 14.937  -17.756 74.732 1.00 39.55  ? 244 LEU C CD2 1 
ATOM   3332 N N   . ARG C 3 229 ? 14.202  -14.438 71.030 1.00 42.84  ? 245 ARG C N   1 
ATOM   3333 C CA  . ARG C 3 229 ? 12.843  -14.174 70.582 1.00 45.42  ? 245 ARG C CA  1 
ATOM   3334 C C   . ARG C 3 229 ? 12.111  -15.492 70.477 1.00 46.31  ? 245 ARG C C   1 
ATOM   3335 O O   . ARG C 3 229 ? 12.484  -16.349 69.680 1.00 46.83  ? 245 ARG C O   1 
ATOM   3336 C CB  . ARG C 3 229 ? 12.823  -13.443 69.233 1.00 44.97  ? 245 ARG C CB  1 
ATOM   3337 C CG  . ARG C 3 229 ? 13.686  -12.178 69.175 1.00 47.35  ? 245 ARG C CG  1 
ATOM   3338 C CD  . ARG C 3 229 ? 13.169  -11.123 68.202 1.00 48.31  ? 245 ARG C CD  1 
ATOM   3339 N NE  . ARG C 3 229 ? 14.252  -10.528 67.421 1.00 48.85  ? 245 ARG C NE  1 
ATOM   3340 C CZ  . ARG C 3 229 ? 14.906  -9.417  67.750 1.00 49.27  ? 245 ARG C CZ  1 
ATOM   3341 N NH1 . ARG C 3 229 ? 14.597  -8.748  68.861 1.00 50.23  ? 245 ARG C NH1 1 
ATOM   3342 N NH2 . ARG C 3 229 ? 15.870  -8.966  66.960 1.00 47.61  ? 245 ARG C NH2 1 
ATOM   3343 N N   . ALA C 3 230 ? 11.092  -15.669 71.303 1.00 47.83  ? 246 ALA C N   1 
ATOM   3344 C CA  . ALA C 3 230 ? 10.311  -16.893 71.255 1.00 53.94  ? 246 ALA C CA  1 
ATOM   3345 C C   . ALA C 3 230 ? 8.845   -16.503 71.142 1.00 57.49  ? 246 ALA C C   1 
ATOM   3346 O O   . ALA C 3 230 ? 8.390   -16.171 70.053 1.00 58.55  ? 246 ALA C O   1 
ATOM   3347 C CB  . ALA C 3 230 ? 10.577  -17.758 72.476 1.00 52.77  ? 246 ALA C CB  1 
ATOM   3348 N N   . ARG C 3 231 ? 8.104   -16.544 72.248 1.00 62.05  ? 247 ARG C N   1 
ATOM   3349 C CA  . ARG C 3 231 ? 6.743   -16.007 72.258 1.00 64.81  ? 247 ARG C CA  1 
ATOM   3350 C C   . ARG C 3 231 ? 6.816   -14.521 72.631 1.00 64.61  ? 247 ARG C C   1 
ATOM   3351 O O   . ARG C 3 231 ? 6.019   -13.709 72.160 1.00 66.94  ? 247 ARG C O   1 
ATOM   3352 C CB  . ARG C 3 231 ? 5.834   -16.784 73.210 1.00 67.01  ? 247 ARG C CB  1 
ATOM   3353 C CG  . ARG C 3 231 ? 4.336   -16.579 72.951 1.00 70.90  ? 247 ARG C CG  1 
ATOM   3354 C CD  . ARG C 3 231 ? 3.912   -16.779 71.479 1.00 75.60  ? 247 ARG C CD  1 
ATOM   3355 N NE  . ARG C 3 231 ? 2.466   -16.630 71.247 1.00 77.95  ? 247 ARG C NE  1 
ATOM   3356 C CZ  . ARG C 3 231 ? 1.790   -15.478 71.306 1.00 78.18  ? 247 ARG C CZ  1 
ATOM   3357 N NH1 . ARG C 3 231 ? 2.401   -14.333 71.610 1.00 77.51  ? 247 ARG C NH1 1 
ATOM   3358 N NH2 . ARG C 3 231 ? 0.485   -15.472 71.068 1.00 77.02  ? 247 ARG C NH2 1 
ATOM   3359 N N   . SER C 3 232 ? 7.781   -14.183 73.478 1.00 62.49  ? 248 SER C N   1 
ATOM   3360 C CA  . SER C 3 232 ? 8.119   -12.801 73.755 1.00 61.17  ? 248 SER C CA  1 
ATOM   3361 C C   . SER C 3 232 ? 9.626   -12.704 73.594 1.00 61.95  ? 248 SER C C   1 
ATOM   3362 O O   . SER C 3 232 ? 10.265  -13.663 73.156 1.00 63.15  ? 248 SER C O   1 
ATOM   3363 C CB  . SER C 3 232 ? 7.691   -12.418 75.161 1.00 59.96  ? 248 SER C CB  1 
ATOM   3364 O OG  . SER C 3 232 ? 6.303   -12.642 75.328 1.00 59.01  ? 248 SER C OG  1 
ATOM   3365 N N   . THR C 3 233 ? 10.191  -11.555 73.938 1.00 61.98  ? 249 THR C N   1 
ATOM   3366 C CA  . THR C 3 233 ? 11.634  -11.348 73.845 1.00 63.36  ? 249 THR C CA  1 
ATOM   3367 C C   . THR C 3 233 ? 12.239  -11.373 75.247 1.00 63.06  ? 249 THR C C   1 
ATOM   3368 O O   . THR C 3 233 ? 11.570  -11.007 76.210 1.00 64.27  ? 249 THR C O   1 
ATOM   3369 C CB  . THR C 3 233 ? 11.907  -10.014 73.119 1.00 64.72  ? 249 THR C CB  1 
ATOM   3370 O OG1 . THR C 3 233 ? 11.387  -10.097 71.785 1.00 67.01  ? 249 THR C OG1 1 
ATOM   3371 C CG2 . THR C 3 233 ? 13.399  -9.767  72.923 1.00 65.28  ? 249 THR C CG2 1 
ATOM   3372 N N   . TYR C 3 234 ? 13.491  -11.811 75.367 1.00 63.40  ? 250 TYR C N   1 
ATOM   3373 C CA  . TYR C 3 234 ? 14.135  -11.945 76.679 1.00 63.77  ? 250 TYR C CA  1 
ATOM   3374 C C   . TYR C 3 234 ? 15.504  -11.277 76.736 1.00 66.86  ? 250 TYR C C   1 
ATOM   3375 O O   . TYR C 3 234 ? 16.137  -11.096 75.694 1.00 69.52  ? 250 TYR C O   1 
ATOM   3376 C CB  . TYR C 3 234 ? 14.251  -13.426 77.056 1.00 61.32  ? 250 TYR C CB  1 
ATOM   3377 C CG  . TYR C 3 234 ? 12.920  -14.101 77.301 1.00 56.70  ? 250 TYR C CG  1 
ATOM   3378 C CD1 . TYR C 3 234 ? 12.341  -14.092 78.563 1.00 56.22  ? 250 TYR C CD1 1 
ATOM   3379 C CD2 . TYR C 3 234 ? 12.238  -14.740 76.271 1.00 55.08  ? 250 TYR C CD2 1 
ATOM   3380 C CE1 . TYR C 3 234 ? 11.118  -14.702 78.797 1.00 55.37  ? 250 TYR C CE1 1 
ATOM   3381 C CE2 . TYR C 3 234 ? 11.011  -15.349 76.491 1.00 54.63  ? 250 TYR C CE2 1 
ATOM   3382 C CZ  . TYR C 3 234 ? 10.460  -15.327 77.759 1.00 55.22  ? 250 TYR C CZ  1 
ATOM   3383 O OH  . TYR C 3 234 ? 9.253   -15.934 77.998 1.00 55.26  ? 250 TYR C OH  1 
ATOM   3384 N N   . ASN C 3 235 ? 15.950  -10.915 77.948 1.00 69.97  ? 251 ASN C N   1 
ATOM   3385 C CA  . ASN C 3 235 ? 17.271  -10.287 78.168 1.00 72.54  ? 251 ASN C CA  1 
ATOM   3386 C C   . ASN C 3 235 ? 17.697  -10.214 79.648 1.00 74.48  ? 251 ASN C C   1 
ATOM   3387 O O   . ASN C 3 235 ? 18.643  -10.883 80.074 1.00 73.66  ? 251 ASN C O   1 
ATOM   3388 C CB  . ASN C 3 235 ? 17.306  -8.877  77.544 1.00 73.17  ? 251 ASN C CB  1 
ATOM   3389 C CG  . ASN C 3 235 ? 16.481  -7.858  78.334 1.00 74.79  ? 251 ASN C CG  1 
ATOM   3390 O OD1 . ASN C 3 235 ? 15.308  -8.091  78.653 1.00 75.34  ? 251 ASN C OD1 1 
ATOM   3391 N ND2 . ASN C 3 235 ? 17.104  -6.730  78.663 1.00 75.34  ? 251 ASN C ND2 1 
ATOM   3392 N N   . LEU C 3 236 ? 16.996  -9.361  80.403 1.00 77.23  ? 252 LEU C N   1 
ATOM   3393 C CA  . LEU C 3 236 ? 17.178  -9.189  81.840 1.00 77.57  ? 252 LEU C CA  1 
ATOM   3394 C C   . LEU C 3 236 ? 15.876  -9.651  82.505 1.00 77.93  ? 252 LEU C C   1 
ATOM   3395 O O   . LEU C 3 236 ? 15.558  -9.293  83.644 1.00 78.60  ? 252 LEU C O   1 
ATOM   3396 C CB  . LEU C 3 236 ? 17.497  -7.724  82.188 1.00 78.01  ? 252 LEU C CB  1 
ATOM   3397 C CG  . LEU C 3 236 ? 17.995  -7.383  83.604 1.00 81.30  ? 252 LEU C CG  1 
ATOM   3398 C CD1 . LEU C 3 236 ? 19.422  -7.888  83.833 1.00 81.66  ? 252 LEU C CD1 1 
ATOM   3399 C CD2 . LEU C 3 236 ? 17.903  -5.877  83.879 1.00 81.52  ? 252 LEU C CD2 1 
ATOM   3400 N N   . LYS C 3 237 ? 15.126  -10.447 81.743 1.00 77.55  ? 253 LYS C N   1 
ATOM   3401 C CA  . LYS C 3 237 ? 13.934  -11.136 82.218 1.00 76.43  ? 253 LYS C CA  1 
ATOM   3402 C C   . LYS C 3 237 ? 14.342  -12.553 82.612 1.00 75.76  ? 253 LYS C C   1 
ATOM   3403 O O   . LYS C 3 237 ? 13.532  -13.339 83.117 1.00 75.73  ? 253 LYS C O   1 
ATOM   3404 C CB  . LYS C 3 237 ? 12.849  -11.165 81.129 1.00 76.28  ? 253 LYS C CB  1 
ATOM   3405 C CG  . LYS C 3 237 ? 12.500  -9.793  80.552 1.00 77.34  ? 253 LYS C CG  1 
ATOM   3406 C CD  . LYS C 3 237 ? 11.479  -9.898  79.420 1.00 77.83  ? 253 LYS C CD  1 
ATOM   3407 C CE  . LYS C 3 237 ? 11.120  -8.521  78.854 1.00 77.66  ? 253 LYS C CE  1 
ATOM   3408 N NZ  . LYS C 3 237 ? 12.173  -7.969  77.958 1.00 76.33  ? 253 LYS C NZ  1 
ATOM   3409 N N   . LYS C 3 238 ? 15.620  -12.852 82.369 1.00 73.93  ? 254 LYS C N   1 
ATOM   3410 C CA  . LYS C 3 238 ? 16.239  -14.133 82.667 1.00 72.35  ? 254 LYS C CA  1 
ATOM   3411 C C   . LYS C 3 238 ? 17.734  -13.893 82.829 1.00 73.08  ? 254 LYS C C   1 
ATOM   3412 O O   . LYS C 3 238 ? 18.358  -13.293 81.955 1.00 74.80  ? 254 LYS C O   1 
ATOM   3413 C CB  . LYS C 3 238 ? 16.053  -15.105 81.504 1.00 71.90  ? 254 LYS C CB  1 
ATOM   3414 C CG  . LYS C 3 238 ? 14.694  -15.769 81.401 1.00 70.05  ? 254 LYS C CG  1 
ATOM   3415 C CD  . LYS C 3 238 ? 14.742  -16.936 80.427 1.00 70.74  ? 254 LYS C CD  1 
ATOM   3416 C CE  . LYS C 3 238 ? 15.154  -18.234 81.155 1.00 75.47  ? 254 LYS C CE  1 
ATOM   3417 N NZ  . LYS C 3 238 ? 15.171  -19.442 80.266 1.00 76.88  ? 254 LYS C NZ  1 
ATOM   3418 N N   . LEU C 3 239 ? 18.312  -14.350 83.939 1.00 73.25  ? 255 LEU C N   1 
ATOM   3419 C CA  . LEU C 3 239 ? 19.776  -14.335 84.095 1.00 75.11  ? 255 LEU C CA  1 
ATOM   3420 C C   . LEU C 3 239 ? 20.396  -15.652 83.566 1.00 75.49  ? 255 LEU C C   1 
ATOM   3421 O O   . LEU C 3 239 ? 21.557  -15.657 83.143 1.00 75.89  ? 255 LEU C O   1 
ATOM   3422 C CB  . LEU C 3 239 ? 20.197  -13.993 85.515 1.00 76.94  ? 255 LEU C CB  1 
ATOM   3423 C CG  . LEU C 3 239 ? 19.861  -12.571 86.016 1.00 78.77  ? 255 LEU C CG  1 
ATOM   3424 C CD1 . LEU C 3 239 ? 20.002  -12.483 87.553 1.00 79.66  ? 255 LEU C CD1 1 
ATOM   3425 C CD2 . LEU C 3 239 ? 20.698  -11.482 85.310 1.00 77.59  ? 255 LEU C CD2 1 
ATOM   3426 N N   . PRO C 3 240 ? 19.640  -16.765 83.664 1.00 75.59  ? 256 PRO C N   1 
ATOM   3427 C CA  . PRO C 3 240 ? 19.966  -18.010 82.948 1.00 75.52  ? 256 PRO C CA  1 
ATOM   3428 C C   . PRO C 3 240 ? 19.878  -17.935 81.396 1.00 75.59  ? 256 PRO C C   1 
ATOM   3429 O O   . PRO C 3 240 ? 19.705  -18.984 80.769 1.00 76.13  ? 256 PRO C O   1 
ATOM   3430 C CB  . PRO C 3 240 ? 18.892  -18.978 83.456 1.00 75.24  ? 256 PRO C CB  1 
ATOM   3431 C CG  . PRO C 3 240 ? 18.683  -18.546 84.834 1.00 74.84  ? 256 PRO C CG  1 
ATOM   3432 C CD  . PRO C 3 240 ? 18.626  -17.039 84.723 1.00 75.23  ? 256 PRO C CD  1 
ATOM   3433 N N   . THR C 3 241 ? 20.002  -16.746 80.788 1.00 75.77  ? 257 THR C N   1 
ATOM   3434 C CA  . THR C 3 241 ? 20.179  -16.675 79.329 1.00 76.05  ? 257 THR C CA  1 
ATOM   3435 C C   . THR C 3 241 ? 21.589  -17.199 79.004 1.00 75.89  ? 257 THR C C   1 
ATOM   3436 O O   . THR C 3 241 ? 22.338  -16.663 78.191 1.00 77.07  ? 257 THR C O   1 
ATOM   3437 C CB  . THR C 3 241 ? 19.892  -15.249 78.753 1.00 76.25  ? 257 THR C CB  1 
ATOM   3438 O OG1 . THR C 3 241 ? 18.642  -14.760 79.255 1.00 76.09  ? 257 THR C OG1 1 
ATOM   3439 C CG2 . THR C 3 241 ? 19.673  -15.304 77.250 1.00 75.26  ? 257 THR C CG2 1 
ATOM   3440 N N   . LEU C 3 242 ? 21.919  -18.262 79.726 1.00 75.91  ? 258 LEU C N   1 
ATOM   3441 C CA  . LEU C 3 242 ? 23.035  -19.140 79.484 1.00 74.78  ? 258 LEU C CA  1 
ATOM   3442 C C   . LEU C 3 242 ? 22.424  -20.494 79.835 1.00 74.53  ? 258 LEU C C   1 
ATOM   3443 O O   . LEU C 3 242 ? 22.711  -21.099 80.871 1.00 72.85  ? 258 LEU C O   1 
ATOM   3444 C CB  . LEU C 3 242 ? 24.260  -18.790 80.340 1.00 77.10  ? 258 LEU C CB  1 
ATOM   3445 C CG  . LEU C 3 242 ? 25.553  -19.604 80.118 1.00 78.46  ? 258 LEU C CG  1 
ATOM   3446 C CD1 . LEU C 3 242 ? 25.947  -19.607 78.647 1.00 78.87  ? 258 LEU C CD1 1 
ATOM   3447 C CD2 . LEU C 3 242 ? 26.708  -19.097 80.995 1.00 77.12  ? 258 LEU C CD2 1 
ATOM   3448 N N   . GLU C 3 243 ? 21.522  -20.914 78.954 1.00 75.47  ? 259 GLU C N   1 
ATOM   3449 C CA  . GLU C 3 243 ? 20.818  -22.184 79.058 1.00 76.44  ? 259 GLU C CA  1 
ATOM   3450 C C   . GLU C 3 243 ? 21.611  -23.265 78.349 1.00 77.02  ? 259 GLU C C   1 
ATOM   3451 O O   . GLU C 3 243 ? 21.346  -23.626 77.196 1.00 75.47  ? 259 GLU C O   1 
ATOM   3452 C CB  . GLU C 3 243 ? 19.451  -22.093 78.405 1.00 75.77  ? 259 GLU C CB  1 
ATOM   3453 C CG  . GLU C 3 243 ? 18.485  -21.188 79.131 1.00 76.76  ? 259 GLU C CG  1 
ATOM   3454 C CD  . GLU C 3 243 ? 17.208  -21.030 78.356 1.00 77.08  ? 259 GLU C CD  1 
ATOM   3455 O OE1 . GLU C 3 243 ? 16.600  -22.068 78.016 1.00 80.20  ? 259 GLU C OE1 1 
ATOM   3456 O OE2 . GLU C 3 243 ? 16.808  -19.880 78.081 1.00 77.74  ? 259 GLU C OE2 1 
ATOM   3457 N N   . ASP D 1 6   ? 8.597   -65.879 5.673  1.00 88.74  ? 6   ASP D N   1 
ATOM   3458 C CA  . ASP D 1 6   ? 9.640   -66.654 6.407  1.00 88.60  ? 6   ASP D CA  1 
ATOM   3459 C C   . ASP D 1 6   ? 10.882  -65.826 6.755  1.00 87.32  ? 6   ASP D C   1 
ATOM   3460 O O   . ASP D 1 6   ? 11.514  -65.216 5.881  1.00 86.37  ? 6   ASP D O   1 
ATOM   3461 C CB  . ASP D 1 6   ? 10.050  -67.909 5.612  1.00 90.33  ? 6   ASP D CB  1 
ATOM   3462 C CG  . ASP D 1 6   ? 11.172  -68.698 6.295  1.00 91.23  ? 6   ASP D CG  1 
ATOM   3463 O OD1 . ASP D 1 6   ? 10.985  -69.129 7.455  1.00 91.81  ? 6   ASP D OD1 1 
ATOM   3464 O OD2 . ASP D 1 6   ? 12.268  -68.925 5.731  1.00 91.81  ? 6   ASP D OD2 1 
ATOM   3465 N N   . CYS D 1 7   ? 11.215  -65.828 8.047  1.00 85.53  ? 7   CYS D N   1 
ATOM   3466 C CA  . CYS D 1 7   ? 12.400  -65.160 8.578  1.00 83.27  ? 7   CYS D CA  1 
ATOM   3467 C C   . CYS D 1 7   ? 13.219  -66.148 9.421  1.00 81.82  ? 7   CYS D C   1 
ATOM   3468 O O   . CYS D 1 7   ? 12.687  -66.729 10.368 1.00 81.38  ? 7   CYS D O   1 
ATOM   3469 C CB  . CYS D 1 7   ? 11.988  -63.965 9.449  1.00 81.70  ? 7   CYS D CB  1 
ATOM   3470 S SG  . CYS D 1 7   ? 13.098  -62.523 9.356  1.00 81.12  ? 7   CYS D SG  1 
ATOM   3471 N N   . PRO D 1 8   ? 14.499  -66.360 9.076  1.00 80.66  ? 8   PRO D N   1 
ATOM   3472 C CA  . PRO D 1 8   ? 15.386  -67.210 9.881  1.00 79.64  ? 8   PRO D CA  1 
ATOM   3473 C C   . PRO D 1 8   ? 15.416  -66.752 11.341 1.00 78.48  ? 8   PRO D C   1 
ATOM   3474 O O   . PRO D 1 8   ? 14.537  -66.015 11.775 1.00 79.06  ? 8   PRO D O   1 
ATOM   3475 C CB  . PRO D 1 8   ? 16.756  -67.010 9.226  1.00 80.69  ? 8   PRO D CB  1 
ATOM   3476 C CG  . PRO D 1 8   ? 16.449  -66.653 7.817  1.00 81.60  ? 8   PRO D CG  1 
ATOM   3477 C CD  . PRO D 1 8   ? 15.186  -65.834 7.881  1.00 81.24  ? 8   PRO D CD  1 
ATOM   3478 N N   . GLU D 1 9   ? 16.418  -67.176 12.097 1.00 77.08  ? 9   GLU D N   1 
ATOM   3479 C CA  . GLU D 1 9   ? 16.466  -66.818 13.507 1.00 75.38  ? 9   GLU D CA  1 
ATOM   3480 C C   . GLU D 1 9   ? 17.834  -66.280 13.921 1.00 73.52  ? 9   GLU D C   1 
ATOM   3481 O O   . GLU D 1 9   ? 18.874  -66.808 13.522 1.00 73.86  ? 9   GLU D O   1 
ATOM   3482 C CB  . GLU D 1 9   ? 16.079  -68.028 14.354 1.00 76.77  ? 9   GLU D CB  1 
ATOM   3483 C CG  . GLU D 1 9   ? 15.772  -67.714 15.806 1.00 78.89  ? 9   GLU D CG  1 
ATOM   3484 C CD  . GLU D 1 9   ? 16.353  -68.754 16.740 1.00 80.75  ? 9   GLU D CD  1 
ATOM   3485 O OE1 . GLU D 1 9   ? 16.137  -69.966 16.490 1.00 81.44  ? 9   GLU D OE1 1 
ATOM   3486 O OE2 . GLU D 1 9   ? 17.034  -68.355 17.718 1.00 82.08  ? 9   GLU D OE2 1 
ATOM   3487 N N   . CYS D 1 10  ? 17.815  -65.225 14.731 1.00 70.70  ? 10  CYS D N   1 
ATOM   3488 C CA  . CYS D 1 10  ? 19.028  -64.550 15.180 1.00 67.93  ? 10  CYS D CA  1 
ATOM   3489 C C   . CYS D 1 10  ? 19.954  -65.467 15.974 1.00 66.72  ? 10  CYS D C   1 
ATOM   3490 O O   . CYS D 1 10  ? 19.783  -65.648 17.179 1.00 66.44  ? 10  CYS D O   1 
ATOM   3491 C CB  . CYS D 1 10  ? 18.655  -63.312 15.986 1.00 66.65  ? 10  CYS D CB  1 
ATOM   3492 S SG  . CYS D 1 10  ? 20.064  -62.462 16.730 1.00 68.15  ? 10  CYS D SG  1 
ATOM   3493 N N   . THR D 1 11  ? 20.943  -66.026 15.281 1.00 66.94  ? 11  THR D N   1 
ATOM   3494 C CA  . THR D 1 11  ? 21.865  -67.011 15.853 1.00 67.13  ? 11  THR D CA  1 
ATOM   3495 C C   . THR D 1 11  ? 23.295  -66.804 15.339 1.00 66.83  ? 11  THR D C   1 
ATOM   3496 O O   . THR D 1 11  ? 23.563  -65.892 14.553 1.00 67.33  ? 11  THR D O   1 
ATOM   3497 C CB  . THR D 1 11  ? 21.390  -68.442 15.471 1.00 66.79  ? 11  THR D CB  1 
ATOM   3498 O OG1 . THR D 1 11  ? 19.961  -68.505 15.539 1.00 67.73  ? 11  THR D OG1 1 
ATOM   3499 C CG2 . THR D 1 11  ? 21.863  -69.480 16.490 1.00 66.42  ? 11  THR D CG2 1 
ATOM   3500 N N   . LEU D 1 12  ? 24.210  -67.649 15.798 1.00 65.96  ? 12  LEU D N   1 
ATOM   3501 C CA  . LEU D 1 12  ? 25.559  -67.676 15.253 1.00 65.16  ? 12  LEU D CA  1 
ATOM   3502 C C   . LEU D 1 12  ? 25.557  -68.315 13.865 1.00 64.95  ? 12  LEU D C   1 
ATOM   3503 O O   . LEU D 1 12  ? 24.769  -69.219 13.582 1.00 64.37  ? 12  LEU D O   1 
ATOM   3504 C CB  . LEU D 1 12  ? 26.487  -68.448 16.179 1.00 64.84  ? 12  LEU D CB  1 
ATOM   3505 C CG  . LEU D 1 12  ? 26.808  -67.714 17.478 1.00 65.56  ? 12  LEU D CG  1 
ATOM   3506 C CD1 . LEU D 1 12  ? 27.112  -68.712 18.590 1.00 67.27  ? 12  LEU D CD1 1 
ATOM   3507 C CD2 . LEU D 1 12  ? 27.968  -66.754 17.259 1.00 64.82  ? 12  LEU D CD2 1 
ATOM   3508 N N   . GLN D 1 13  ? 26.440  -67.825 13.002 1.00 64.75  ? 13  GLN D N   1 
ATOM   3509 C CA  . GLN D 1 13  ? 26.574  -68.326 11.641 1.00 63.88  ? 13  GLN D CA  1 
ATOM   3510 C C   . GLN D 1 13  ? 27.994  -68.130 11.162 1.00 63.62  ? 13  GLN D C   1 
ATOM   3511 O O   . GLN D 1 13  ? 28.670  -67.203 11.598 1.00 63.94  ? 13  GLN D O   1 
ATOM   3512 C CB  . GLN D 1 13  ? 25.594  -67.627 10.701 1.00 64.04  ? 13  GLN D CB  1 
ATOM   3513 C CG  . GLN D 1 13  ? 24.271  -68.365 10.551 1.00 67.55  ? 13  GLN D CG  1 
ATOM   3514 C CD  . GLN D 1 13  ? 24.446  -69.882 10.452 1.00 70.39  ? 13  GLN D CD  1 
ATOM   3515 O OE1 . GLN D 1 13  ? 25.195  -70.385 9.599  1.00 73.02  ? 13  GLN D OE1 1 
ATOM   3516 N NE2 . GLN D 1 13  ? 23.758  -70.615 11.326 1.00 69.45  ? 13  GLN D NE2 1 
ATOM   3517 N N   . GLU D 1 14  ? 28.453  -69.007 10.276 1.00 63.40  ? 14  GLU D N   1 
ATOM   3518 C CA  . GLU D 1 14  ? 29.820  -68.919 9.780  1.00 63.78  ? 14  GLU D CA  1 
ATOM   3519 C C   . GLU D 1 14  ? 29.970  -67.818 8.736  1.00 61.49  ? 14  GLU D C   1 
ATOM   3520 O O   . GLU D 1 14  ? 29.110  -67.648 7.862  1.00 60.59  ? 14  GLU D O   1 
ATOM   3521 C CB  . GLU D 1 14  ? 30.277  -70.263 9.201  1.00 66.19  ? 14  GLU D CB  1 
ATOM   3522 C CG  . GLU D 1 14  ? 31.790  -70.376 9.046  1.00 70.97  ? 14  GLU D CG  1 
ATOM   3523 C CD  . GLU D 1 14  ? 32.227  -71.460 8.066  1.00 75.48  ? 14  GLU D CD  1 
ATOM   3524 O OE1 . GLU D 1 14  ? 31.449  -71.804 7.137  1.00 76.35  ? 14  GLU D OE1 1 
ATOM   3525 O OE2 . GLU D 1 14  ? 33.369  -71.959 8.220  1.00 77.39  ? 14  GLU D OE2 1 
ATOM   3526 N N   . ASN D 1 15  ? 31.056  -67.061 8.846  1.00 58.31  ? 15  ASN D N   1 
ATOM   3527 C CA  . ASN D 1 15  ? 31.345  -66.018 7.877  1.00 57.45  ? 15  ASN D CA  1 
ATOM   3528 C C   . ASN D 1 15  ? 32.453  -66.456 6.922  1.00 57.15  ? 15  ASN D C   1 
ATOM   3529 O O   . ASN D 1 15  ? 33.625  -66.517 7.302  1.00 56.21  ? 15  ASN D O   1 
ATOM   3530 C CB  . ASN D 1 15  ? 31.713  -64.712 8.574  1.00 58.19  ? 15  ASN D CB  1 
ATOM   3531 C CG  . ASN D 1 15  ? 31.790  -63.546 7.612  1.00 58.20  ? 15  ASN D CG  1 
ATOM   3532 O OD1 . ASN D 1 15  ? 32.495  -62.577 7.860  1.00 59.99  ? 15  ASN D OD1 1 
ATOM   3533 N ND2 . ASN D 1 15  ? 31.058  -63.630 6.514  1.00 60.38  ? 15  ASN D ND2 1 
ATOM   3534 N N   . PRO D 1 16  ? 32.074  -66.752 5.674  1.00 56.97  ? 16  PRO D N   1 
ATOM   3535 C CA  . PRO D 1 16  ? 32.991  -67.282 4.668  1.00 55.76  ? 16  PRO D CA  1 
ATOM   3536 C C   . PRO D 1 16  ? 34.160  -66.361 4.350  1.00 55.60  ? 16  PRO D C   1 
ATOM   3537 O O   . PRO D 1 16  ? 35.233  -66.835 3.971  1.00 55.68  ? 16  PRO D O   1 
ATOM   3538 C CB  . PRO D 1 16  ? 32.099  -67.435 3.439  1.00 55.81  ? 16  PRO D CB  1 
ATOM   3539 C CG  . PRO D 1 16  ? 30.732  -67.527 3.983  1.00 56.07  ? 16  PRO D CG  1 
ATOM   3540 C CD  . PRO D 1 16  ? 30.719  -66.576 5.125  1.00 57.11  ? 16  PRO D CD  1 
ATOM   3541 N N   . PHE D 1 17  ? 33.962  -65.055 4.514  1.00 54.52  ? 17  PHE D N   1 
ATOM   3542 C CA  . PHE D 1 17  ? 34.994  -64.084 4.157  1.00 53.56  ? 17  PHE D CA  1 
ATOM   3543 C C   . PHE D 1 17  ? 36.162  -64.026 5.130  1.00 53.92  ? 17  PHE D C   1 
ATOM   3544 O O   . PHE D 1 17  ? 37.205  -63.461 4.809  1.00 54.47  ? 17  PHE D O   1 
ATOM   3545 C CB  . PHE D 1 17  ? 34.371  -62.704 3.957  1.00 51.43  ? 17  PHE D CB  1 
ATOM   3546 C CG  . PHE D 1 17  ? 33.233  -62.703 2.994  1.00 48.56  ? 17  PHE D CG  1 
ATOM   3547 C CD1 . PHE D 1 17  ? 31.964  -63.076 3.406  1.00 46.78  ? 17  PHE D CD1 1 
ATOM   3548 C CD2 . PHE D 1 17  ? 33.433  -62.365 1.665  1.00 48.75  ? 17  PHE D CD2 1 
ATOM   3549 C CE1 . PHE D 1 17  ? 30.905  -63.095 2.514  1.00 48.69  ? 17  PHE D CE1 1 
ATOM   3550 C CE2 . PHE D 1 17  ? 32.377  -62.381 0.756  1.00 48.85  ? 17  PHE D CE2 1 
ATOM   3551 C CZ  . PHE D 1 17  ? 31.110  -62.751 1.180  1.00 48.60  ? 17  PHE D CZ  1 
ATOM   3552 N N   . PHE D 1 18  ? 35.990  -64.630 6.305  1.00 55.41  ? 18  PHE D N   1 
ATOM   3553 C CA  . PHE D 1 18  ? 37.036  -64.657 7.329  1.00 56.45  ? 18  PHE D CA  1 
ATOM   3554 C C   . PHE D 1 18  ? 37.299  -66.040 7.901  1.00 57.95  ? 18  PHE D C   1 
ATOM   3555 O O   . PHE D 1 18  ? 38.361  -66.280 8.469  1.00 57.94  ? 18  PHE D O   1 
ATOM   3556 C CB  . PHE D 1 18  ? 36.699  -63.679 8.448  1.00 55.53  ? 18  PHE D CB  1 
ATOM   3557 C CG  . PHE D 1 18  ? 36.664  -62.255 7.996  1.00 54.26  ? 18  PHE D CG  1 
ATOM   3558 C CD1 . PHE D 1 18  ? 37.843  -61.542 7.811  1.00 53.15  ? 18  PHE D CD1 1 
ATOM   3559 C CD2 . PHE D 1 18  ? 35.456  -61.635 7.722  1.00 52.75  ? 18  PHE D CD2 1 
ATOM   3560 C CE1 . PHE D 1 18  ? 37.815  -60.224 7.376  1.00 53.88  ? 18  PHE D CE1 1 
ATOM   3561 C CE2 . PHE D 1 18  ? 35.415  -60.320 7.287  1.00 53.05  ? 18  PHE D CE2 1 
ATOM   3562 C CZ  . PHE D 1 18  ? 36.596  -59.613 7.114  1.00 53.89  ? 18  PHE D CZ  1 
ATOM   3563 N N   . SER D 1 19  ? 36.335  -66.940 7.741  1.00 61.59  ? 19  SER D N   1 
ATOM   3564 C CA  . SER D 1 19  ? 36.478  -68.327 8.183  1.00 65.82  ? 19  SER D CA  1 
ATOM   3565 C C   . SER D 1 19  ? 37.471  -69.118 7.327  1.00 69.32  ? 19  SER D C   1 
ATOM   3566 O O   . SER D 1 19  ? 37.738  -68.775 6.170  1.00 69.35  ? 19  SER D O   1 
ATOM   3567 C CB  . SER D 1 19  ? 35.126  -69.042 8.169  1.00 64.84  ? 19  SER D CB  1 
ATOM   3568 O OG  . SER D 1 19  ? 34.199  -68.384 9.009  1.00 67.34  ? 19  SER D OG  1 
ATOM   3569 N N   . GLN D 1 20  ? 38.007  -70.183 7.926  1.00 73.81  ? 20  GLN D N   1 
ATOM   3570 C CA  . GLN D 1 20  ? 38.940  -71.104 7.273  1.00 77.27  ? 20  GLN D CA  1 
ATOM   3571 C C   . GLN D 1 20  ? 38.699  -72.520 7.814  1.00 79.05  ? 20  GLN D C   1 
ATOM   3572 O O   . GLN D 1 20  ? 38.147  -72.673 8.909  1.00 79.25  ? 20  GLN D O   1 
ATOM   3573 C CB  . GLN D 1 20  ? 40.386  -70.680 7.547  1.00 77.89  ? 20  GLN D CB  1 
ATOM   3574 C CG  . GLN D 1 20  ? 40.810  -69.405 6.842  1.00 78.02  ? 20  GLN D CG  1 
ATOM   3575 C CD  . GLN D 1 20  ? 42.162  -68.922 7.301  1.00 79.42  ? 20  GLN D CD  1 
ATOM   3576 O OE1 . GLN D 1 20  ? 42.480  -68.976 8.494  1.00 79.42  ? 20  GLN D OE1 1 
ATOM   3577 N NE2 . GLN D 1 20  ? 42.966  -68.443 6.358  1.00 80.16  ? 20  GLN D NE2 1 
ATOM   3578 N N   . PRO D 1 21  ? 39.107  -73.557 7.059  1.00 80.94  ? 21  PRO D N   1 
ATOM   3579 C CA  . PRO D 1 21  ? 38.958  -74.951 7.519  1.00 80.96  ? 21  PRO D CA  1 
ATOM   3580 C C   . PRO D 1 21  ? 39.459  -75.188 8.957  1.00 80.24  ? 21  PRO D C   1 
ATOM   3581 O O   . PRO D 1 21  ? 38.745  -75.784 9.768  1.00 80.24  ? 21  PRO D O   1 
ATOM   3582 C CB  . PRO D 1 21  ? 39.785  -75.749 6.501  1.00 80.97  ? 21  PRO D CB  1 
ATOM   3583 C CG  . PRO D 1 21  ? 39.725  -74.927 5.251  1.00 80.95  ? 21  PRO D CG  1 
ATOM   3584 C CD  . PRO D 1 21  ? 39.728  -73.487 5.719  1.00 80.97  ? 21  PRO D CD  1 
ATOM   3585 N N   . GLY D 1 22  ? 40.666  -74.707 9.260  1.00 79.05  ? 22  GLY D N   1 
ATOM   3586 C CA  . GLY D 1 22  ? 41.249  -74.859 10.587 1.00 76.97  ? 22  GLY D CA  1 
ATOM   3587 C C   . GLY D 1 22  ? 40.607  -73.935 11.605 1.00 76.79  ? 22  GLY D C   1 
ATOM   3588 O O   . GLY D 1 22  ? 40.046  -74.394 12.606 1.00 76.32  ? 22  GLY D O   1 
ATOM   3589 N N   . ALA D 1 23  ? 40.679  -72.630 11.337 1.00 76.14  ? 23  ALA D N   1 
ATOM   3590 C CA  . ALA D 1 23  ? 40.180  -71.615 12.264 1.00 74.18  ? 23  ALA D CA  1 
ATOM   3591 C C   . ALA D 1 23  ? 38.983  -70.834 11.712 1.00 71.82  ? 23  ALA D C   1 
ATOM   3592 O O   . ALA D 1 23  ? 39.153  -69.887 10.942 1.00 71.82  ? 23  ALA D O   1 
ATOM   3593 C CB  . ALA D 1 23  ? 41.320  -70.661 12.669 1.00 74.14  ? 23  ALA D CB  1 
ATOM   3594 N N   . PRO D 1 24  ? 37.767  -71.240 12.105 1.00 69.40  ? 24  PRO D N   1 
ATOM   3595 C CA  . PRO D 1 24  ? 36.536  -70.584 11.660 1.00 67.76  ? 24  PRO D CA  1 
ATOM   3596 C C   . PRO D 1 24  ? 36.180  -69.363 12.503 1.00 65.79  ? 24  PRO D C   1 
ATOM   3597 O O   . PRO D 1 24  ? 36.643  -69.226 13.634 1.00 65.43  ? 24  PRO D O   1 
ATOM   3598 C CB  . PRO D 1 24  ? 35.465  -71.665 11.853 1.00 67.09  ? 24  PRO D CB  1 
ATOM   3599 C CG  . PRO D 1 24  ? 36.190  -72.862 12.360 1.00 68.07  ? 24  PRO D CG  1 
ATOM   3600 C CD  . PRO D 1 24  ? 37.468  -72.385 12.977 1.00 68.72  ? 24  PRO D CD  1 
ATOM   3601 N N   . ILE D 1 25  ? 35.359  -68.484 11.937 1.00 63.75  ? 25  ILE D N   1 
ATOM   3602 C CA  . ILE D 1 25  ? 34.872  -67.308 12.642 1.00 61.56  ? 25  ILE D CA  1 
ATOM   3603 C C   . ILE D 1 25  ? 33.366  -67.198 12.489 1.00 60.45  ? 25  ILE D C   1 
ATOM   3604 O O   . ILE D 1 25  ? 32.818  -67.436 11.406 1.00 57.84  ? 25  ILE D O   1 
ATOM   3605 C CB  . ILE D 1 25  ? 35.577  -66.039 12.154 1.00 61.55  ? 25  ILE D CB  1 
ATOM   3606 C CG1 . ILE D 1 25  ? 36.985  -66.004 12.734 1.00 60.75  ? 25  ILE D CG1 1 
ATOM   3607 C CG2 . ILE D 1 25  ? 34.825  -64.784 12.603 1.00 62.44  ? 25  ILE D CG2 1 
ATOM   3608 C CD1 . ILE D 1 25  ? 37.815  -64.914 12.203 1.00 61.17  ? 25  ILE D CD1 1 
ATOM   3609 N N   . LEU D 1 26  ? 32.712  -66.837 13.595 1.00 59.67  ? 26  LEU D N   1 
ATOM   3610 C CA  . LEU D 1 26  ? 31.254  -66.752 13.652 1.00 58.37  ? 26  LEU D CA  1 
ATOM   3611 C C   . LEU D 1 26  ? 30.720  -65.329 13.780 1.00 56.75  ? 26  LEU D C   1 
ATOM   3612 O O   . LEU D 1 26  ? 31.270  -64.506 14.519 1.00 54.96  ? 26  LEU D O   1 
ATOM   3613 C CB  . LEU D 1 26  ? 30.710  -67.620 14.785 1.00 58.50  ? 26  LEU D CB  1 
ATOM   3614 C CG  . LEU D 1 26  ? 30.977  -69.112 14.642 1.00 57.81  ? 26  LEU D CG  1 
ATOM   3615 C CD1 . LEU D 1 26  ? 32.304  -69.440 15.285 1.00 59.07  ? 26  LEU D CD1 1 
ATOM   3616 C CD2 . LEU D 1 26  ? 29.859  -69.886 15.304 1.00 59.24  ? 26  LEU D CD2 1 
ATOM   3617 N N   . GLN D 1 27  ? 29.633  -65.077 13.050 1.00 55.17  ? 27  GLN D N   1 
ATOM   3618 C CA  . GLN D 1 27  ? 28.997  -63.769 12.955 1.00 53.87  ? 27  GLN D CA  1 
ATOM   3619 C C   . GLN D 1 27  ? 27.528  -63.850 13.358 1.00 54.80  ? 27  GLN D C   1 
ATOM   3620 O O   . GLN D 1 27  ? 26.785  -64.694 12.849 1.00 54.03  ? 27  GLN D O   1 
ATOM   3621 C CB  . GLN D 1 27  ? 29.100  -63.244 11.518 1.00 51.02  ? 27  GLN D CB  1 
ATOM   3622 C CG  . GLN D 1 27  ? 29.023  -61.743 11.394 1.00 46.51  ? 27  GLN D CG  1 
ATOM   3623 C CD  . GLN D 1 27  ? 28.896  -61.274 9.962  1.00 44.72  ? 27  GLN D CD  1 
ATOM   3624 O OE1 . GLN D 1 27  ? 27.914  -61.573 9.297  1.00 47.43  ? 27  GLN D OE1 1 
ATOM   3625 N NE2 . GLN D 1 27  ? 29.879  -60.528 9.489  1.00 40.96  ? 27  GLN D NE2 1 
ATOM   3626 N N   . CYS D 1 28  ? 27.125  -62.963 14.269 1.00 56.14  ? 28  CYS D N   1 
ATOM   3627 C CA  . CYS D 1 28  ? 25.734  -62.836 14.716 1.00 56.46  ? 28  CYS D CA  1 
ATOM   3628 C C   . CYS D 1 28  ? 24.827  -62.332 13.609 1.00 55.68  ? 28  CYS D C   1 
ATOM   3629 O O   . CYS D 1 28  ? 24.921  -61.178 13.195 1.00 55.35  ? 28  CYS D O   1 
ATOM   3630 C CB  . CYS D 1 28  ? 25.634  -61.865 15.891 1.00 58.09  ? 28  CYS D CB  1 
ATOM   3631 S SG  . CYS D 1 28  ? 26.246  -62.540 17.448 1.00 63.56  ? 28  CYS D SG  1 
ATOM   3632 N N   . MET D 1 29  ? 23.955  -63.198 13.120 1.00 55.18  ? 29  MET D N   1 
ATOM   3633 C CA  . MET D 1 29  ? 22.989  -62.769 12.127 1.00 56.08  ? 29  MET D CA  1 
ATOM   3634 C C   . MET D 1 29  ? 21.677  -63.532 12.225 1.00 57.11  ? 29  MET D C   1 
ATOM   3635 O O   . MET D 1 29  ? 21.637  -64.650 12.744 1.00 57.12  ? 29  MET D O   1 
ATOM   3636 C CB  . MET D 1 29  ? 23.578  -62.812 10.714 1.00 57.04  ? 29  MET D CB  1 
ATOM   3637 C CG  . MET D 1 29  ? 24.033  -64.148 10.185 1.00 56.46  ? 29  MET D CG  1 
ATOM   3638 S SD  . MET D 1 29  ? 24.495  -63.889 8.462  1.00 57.08  ? 29  MET D SD  1 
ATOM   3639 C CE  . MET D 1 29  ? 26.295  -63.945 8.533  1.00 54.60  ? 29  MET D CE  1 
ATOM   3640 N N   . GLY D 1 30  ? 20.606  -62.904 11.745 1.00 57.67  ? 30  GLY D N   1 
ATOM   3641 C CA  . GLY D 1 30  ? 19.278  -63.502 11.806 1.00 59.16  ? 30  GLY D CA  1 
ATOM   3642 C C   . GLY D 1 30  ? 18.132  -62.509 11.870 1.00 59.21  ? 30  GLY D C   1 
ATOM   3643 O O   . GLY D 1 30  ? 18.184  -61.439 11.265 1.00 58.89  ? 30  GLY D O   1 
ATOM   3644 N N   . CYS D 1 31  ? 17.091  -62.871 12.608 1.00 59.75  ? 31  CYS D N   1 
ATOM   3645 C CA  . CYS D 1 31  ? 15.888  -62.064 12.653 1.00 61.63  ? 31  CYS D CA  1 
ATOM   3646 C C   . CYS D 1 31  ? 15.467  -61.700 14.064 1.00 61.67  ? 31  CYS D C   1 
ATOM   3647 O O   . CYS D 1 31  ? 15.595  -62.502 15.000 1.00 61.28  ? 31  CYS D O   1 
ATOM   3648 C CB  . CYS D 1 31  ? 14.746  -62.789 11.948 1.00 65.16  ? 31  CYS D CB  1 
ATOM   3649 S SG  . CYS D 1 31  ? 14.928  -62.923 10.151 1.00 72.18  ? 31  CYS D SG  1 
ATOM   3650 N N   . CYS D 1 32  ? 14.969  -60.473 14.197 1.00 60.74  ? 32  CYS D N   1 
ATOM   3651 C CA  . CYS D 1 32  ? 14.480  -59.945 15.463 1.00 59.30  ? 32  CYS D CA  1 
ATOM   3652 C C   . CYS D 1 32  ? 13.170  -59.196 15.219 1.00 58.66  ? 32  CYS D C   1 
ATOM   3653 O O   . CYS D 1 32  ? 12.862  -58.833 14.079 1.00 57.62  ? 32  CYS D O   1 
ATOM   3654 C CB  . CYS D 1 32  ? 15.524  -59.021 16.093 1.00 59.39  ? 32  CYS D CB  1 
ATOM   3655 S SG  . CYS D 1 32  ? 17.066  -59.824 16.620 1.00 61.64  ? 32  CYS D SG  1 
ATOM   3656 N N   . PHE D 1 33  ? 12.402  -58.976 16.286 1.00 56.92  ? 33  PHE D N   1 
ATOM   3657 C CA  . PHE D 1 33  ? 11.100  -58.333 16.169 1.00 55.24  ? 33  PHE D CA  1 
ATOM   3658 C C   . PHE D 1 33  ? 11.183  -56.818 16.183 1.00 54.51  ? 33  PHE D C   1 
ATOM   3659 O O   . PHE D 1 33  ? 12.064  -56.254 16.813 1.00 55.51  ? 33  PHE D O   1 
ATOM   3660 C CB  . PHE D 1 33  ? 10.174  -58.797 17.294 1.00 56.40  ? 33  PHE D CB  1 
ATOM   3661 C CG  . PHE D 1 33  ? 8.741   -58.386 17.101 1.00 56.34  ? 33  PHE D CG  1 
ATOM   3662 C CD1 . PHE D 1 33  ? 7.928   -59.063 16.197 1.00 55.70  ? 33  PHE D CD1 1 
ATOM   3663 C CD2 . PHE D 1 33  ? 8.214   -57.313 17.804 1.00 55.57  ? 33  PHE D CD2 1 
ATOM   3664 C CE1 . PHE D 1 33  ? 6.613   -58.680 15.999 1.00 56.36  ? 33  PHE D CE1 1 
ATOM   3665 C CE2 . PHE D 1 33  ? 6.901   -56.924 17.615 1.00 57.26  ? 33  PHE D CE2 1 
ATOM   3666 C CZ  . PHE D 1 33  ? 6.096   -57.611 16.708 1.00 57.71  ? 33  PHE D CZ  1 
ATOM   3667 N N   . SER D 1 34  ? 10.259  -56.168 15.481 1.00 53.65  ? 34  SER D N   1 
ATOM   3668 C CA  . SER D 1 34  ? 10.128  -54.709 15.501 1.00 54.02  ? 34  SER D CA  1 
ATOM   3669 C C   . SER D 1 34  ? 8.765   -54.290 14.956 1.00 52.79  ? 34  SER D C   1 
ATOM   3670 O O   . SER D 1 34  ? 8.171   -55.009 14.163 1.00 53.25  ? 34  SER D O   1 
ATOM   3671 C CB  . SER D 1 34  ? 11.264  -54.025 14.715 1.00 54.98  ? 34  SER D CB  1 
ATOM   3672 O OG  . SER D 1 34  ? 11.240  -54.333 13.332 1.00 56.35  ? 34  SER D OG  1 
ATOM   3673 N N   . ARG D 1 35  ? 8.277   -53.131 15.384 1.00 51.55  ? 35  ARG D N   1 
ATOM   3674 C CA  . ARG D 1 35  ? 6.968   -52.640 14.958 1.00 50.56  ? 35  ARG D CA  1 
ATOM   3675 C C   . ARG D 1 35  ? 6.897   -51.113 14.856 1.00 51.76  ? 35  ARG D C   1 
ATOM   3676 O O   . ARG D 1 35  ? 7.796   -50.396 15.310 1.00 53.82  ? 35  ARG D O   1 
ATOM   3677 C CB  . ARG D 1 35  ? 5.896   -53.134 15.927 1.00 49.22  ? 35  ARG D CB  1 
ATOM   3678 C CG  . ARG D 1 35  ? 5.908   -52.432 17.275 1.00 49.56  ? 35  ARG D CG  1 
ATOM   3679 C CD  . ARG D 1 35  ? 5.396   -53.296 18.412 1.00 51.08  ? 35  ARG D CD  1 
ATOM   3680 N NE  . ARG D 1 35  ? 5.071   -52.507 19.597 1.00 51.20  ? 35  ARG D NE  1 
ATOM   3681 C CZ  . ARG D 1 35  ? 4.503   -52.992 20.697 1.00 53.13  ? 35  ARG D CZ  1 
ATOM   3682 N NH1 . ARG D 1 35  ? 4.181   -54.282 20.795 1.00 51.13  ? 35  ARG D NH1 1 
ATOM   3683 N NH2 . ARG D 1 35  ? 4.254   -52.177 21.710 1.00 54.38  ? 35  ARG D NH2 1 
ATOM   3684 N N   . ALA D 1 36  ? 5.822   -50.628 14.246 1.00 51.39  ? 36  ALA D N   1 
ATOM   3685 C CA  . ALA D 1 36  ? 5.544   -49.198 14.173 1.00 52.04  ? 36  ALA D CA  1 
ATOM   3686 C C   . ALA D 1 36  ? 4.077   -48.953 14.543 1.00 52.89  ? 36  ALA D C   1 
ATOM   3687 O O   . ALA D 1 36  ? 3.188   -49.708 14.125 1.00 53.46  ? 36  ALA D O   1 
ATOM   3688 C CB  . ALA D 1 36  ? 5.849   -48.659 12.783 1.00 49.89  ? 36  ALA D CB  1 
ATOM   3689 N N   . TYR D 1 37  ? 3.837   -47.915 15.345 1.00 51.92  ? 37  TYR D N   1 
ATOM   3690 C CA  . TYR D 1 37  ? 2.483   -47.531 15.749 1.00 51.79  ? 37  TYR D CA  1 
ATOM   3691 C C   . TYR D 1 37  ? 2.372   -46.025 15.985 1.00 52.80  ? 37  TYR D C   1 
ATOM   3692 O O   . TYR D 1 37  ? 3.391   -45.359 16.159 1.00 52.94  ? 37  TYR D O   1 
ATOM   3693 C CB  . TYR D 1 37  ? 2.040   -48.300 17.007 1.00 50.84  ? 37  TYR D CB  1 
ATOM   3694 C CG  . TYR D 1 37  ? 2.986   -48.233 18.181 1.00 51.13  ? 37  TYR D CG  1 
ATOM   3695 C CD1 . TYR D 1 37  ? 3.071   -47.089 18.974 1.00 52.47  ? 37  TYR D CD1 1 
ATOM   3696 C CD2 . TYR D 1 37  ? 3.783   -49.322 18.516 1.00 50.71  ? 37  TYR D CD2 1 
ATOM   3697 C CE1 . TYR D 1 37  ? 3.941   -47.032 20.068 1.00 51.71  ? 37  TYR D CE1 1 
ATOM   3698 C CE2 . TYR D 1 37  ? 4.650   -49.274 19.605 1.00 50.80  ? 37  TYR D CE2 1 
ATOM   3699 C CZ  . TYR D 1 37  ? 4.723   -48.127 20.375 1.00 50.89  ? 37  TYR D CZ  1 
ATOM   3700 O OH  . TYR D 1 37  ? 5.581   -48.075 21.445 1.00 51.20  ? 37  TYR D OH  1 
ATOM   3701 N N   . PRO D 1 38  ? 1.144   -45.480 15.957 1.00 54.15  ? 38  PRO D N   1 
ATOM   3702 C CA  . PRO D 1 38  ? 0.918   -44.060 16.260 1.00 53.69  ? 38  PRO D CA  1 
ATOM   3703 C C   . PRO D 1 38  ? 1.464   -43.665 17.641 1.00 53.39  ? 38  PRO D C   1 
ATOM   3704 O O   . PRO D 1 38  ? 1.248   -44.363 18.638 1.00 51.89  ? 38  PRO D O   1 
ATOM   3705 C CB  . PRO D 1 38  ? -0.606  -43.937 16.220 1.00 53.14  ? 38  PRO D CB  1 
ATOM   3706 C CG  . PRO D 1 38  ? -1.015  -44.969 15.254 1.00 53.76  ? 38  PRO D CG  1 
ATOM   3707 C CD  . PRO D 1 38  ? -0.114  -46.140 15.559 1.00 53.87  ? 38  PRO D CD  1 
ATOM   3708 N N   . THR D 1 39  ? 2.172   -42.544 17.669 1.00 52.50  ? 39  THR D N   1 
ATOM   3709 C CA  . THR D 1 39  ? 2.813   -42.076 18.872 1.00 53.48  ? 39  THR D CA  1 
ATOM   3710 C C   . THR D 1 39  ? 1.775   -41.617 19.872 1.00 54.74  ? 39  THR D C   1 
ATOM   3711 O O   . THR D 1 39  ? 1.044   -40.664 19.611 1.00 55.86  ? 39  THR D O   1 
ATOM   3712 C CB  . THR D 1 39  ? 3.772   -40.914 18.547 1.00 53.27  ? 39  THR D CB  1 
ATOM   3713 O OG1 . THR D 1 39  ? 4.770   -41.359 17.624 1.00 52.99  ? 39  THR D OG1 1 
ATOM   3714 C CG2 . THR D 1 39  ? 4.562   -40.514 19.775 1.00 52.00  ? 39  THR D CG2 1 
ATOM   3715 N N   . PRO D 1 40  ? 1.700   -42.296 21.018 1.00 55.42  ? 40  PRO D N   1 
ATOM   3716 C CA  . PRO D 1 40  ? 0.783   -41.906 22.078 1.00 56.48  ? 40  PRO D CA  1 
ATOM   3717 C C   . PRO D 1 40  ? 0.915   -40.416 22.334 1.00 58.92  ? 40  PRO D C   1 
ATOM   3718 O O   . PRO D 1 40  ? 2.026   -39.880 22.295 1.00 59.68  ? 40  PRO D O   1 
ATOM   3719 C CB  . PRO D 1 40  ? 1.300   -42.682 23.281 1.00 55.24  ? 40  PRO D CB  1 
ATOM   3720 C CG  . PRO D 1 40  ? 1.849   -43.901 22.687 1.00 55.55  ? 40  PRO D CG  1 
ATOM   3721 C CD  . PRO D 1 40  ? 2.485   -43.484 21.392 1.00 55.23  ? 40  PRO D CD  1 
ATOM   3722 N N   . LEU D 1 41  ? -0.212  -39.755 22.581 1.00 62.56  ? 41  LEU D N   1 
ATOM   3723 C CA  . LEU D 1 41  ? -0.223  -38.314 22.840 1.00 64.28  ? 41  LEU D CA  1 
ATOM   3724 C C   . LEU D 1 41  ? 0.567   -37.956 24.103 1.00 63.94  ? 41  LEU D C   1 
ATOM   3725 O O   . LEU D 1 41  ? 1.080   -36.843 24.222 1.00 63.27  ? 41  LEU D O   1 
ATOM   3726 C CB  . LEU D 1 41  ? -1.655  -37.795 22.956 1.00 65.27  ? 41  LEU D CB  1 
ATOM   3727 C CG  . LEU D 1 41  ? -1.810  -36.336 22.516 1.00 67.13  ? 41  LEU D CG  1 
ATOM   3728 C CD1 . LEU D 1 41  ? -2.545  -36.254 21.172 1.00 65.70  ? 41  LEU D CD1 1 
ATOM   3729 C CD2 . LEU D 1 41  ? -2.535  -35.527 23.594 1.00 67.85  ? 41  LEU D CD2 1 
ATOM   3730 N N   . ARG D 1 42  ? 0.653   -38.910 25.030 1.00 63.77  ? 42  ARG D N   1 
ATOM   3731 C CA  . ARG D 1 42  ? 1.442   -38.761 26.251 1.00 63.12  ? 42  ARG D CA  1 
ATOM   3732 C C   . ARG D 1 42  ? 2.929   -38.686 25.909 1.00 63.69  ? 42  ARG D C   1 
ATOM   3733 O O   . ARG D 1 42  ? 3.675   -37.926 26.523 1.00 64.35  ? 42  ARG D O   1 
ATOM   3734 C CB  . ARG D 1 42  ? 1.156   -39.917 27.213 1.00 62.53  ? 42  ARG D CB  1 
ATOM   3735 C CG  . ARG D 1 42  ? 1.946   -39.880 28.514 1.00 61.84  ? 42  ARG D CG  1 
ATOM   3736 C CD  . ARG D 1 42  ? 1.453   -38.867 29.536 1.00 59.74  ? 42  ARG D CD  1 
ATOM   3737 N NE  . ARG D 1 42  ? 2.432   -38.643 30.604 1.00 59.81  ? 42  ARG D NE  1 
ATOM   3738 C CZ  . ARG D 1 42  ? 3.440   -37.767 30.552 1.00 60.61  ? 42  ARG D CZ  1 
ATOM   3739 N NH1 . ARG D 1 42  ? 3.637   -37.011 29.479 1.00 58.93  ? 42  ARG D NH1 1 
ATOM   3740 N NH2 . ARG D 1 42  ? 4.266   -37.647 31.584 1.00 60.60  ? 42  ARG D NH2 1 
ATOM   3741 N N   . SER D 1 43  ? 3.346   -39.475 24.923 1.00 65.04  ? 43  SER D N   1 
ATOM   3742 C CA  . SER D 1 43  ? 4.718   -39.431 24.419 1.00 64.65  ? 43  SER D CA  1 
ATOM   3743 C C   . SER D 1 43  ? 4.997   -38.117 23.686 1.00 64.52  ? 43  SER D C   1 
ATOM   3744 O O   . SER D 1 43  ? 6.053   -37.517 23.880 1.00 64.50  ? 43  SER D O   1 
ATOM   3745 C CB  . SER D 1 43  ? 5.000   -40.616 23.494 1.00 64.22  ? 43  SER D CB  1 
ATOM   3746 O OG  . SER D 1 43  ? 5.305   -41.780 24.238 1.00 66.13  ? 43  SER D OG  1 
ATOM   3747 N N   . LYS D 1 44  ? 4.045   -37.673 22.862 1.00 63.23  ? 44  LYS D N   1 
ATOM   3748 C CA  . LYS D 1 44  ? 4.192   -36.430 22.097 1.00 63.46  ? 44  LYS D CA  1 
ATOM   3749 C C   . LYS D 1 44  ? 4.413   -35.215 23.010 1.00 64.08  ? 44  LYS D C   1 
ATOM   3750 O O   . LYS D 1 44  ? 4.655   -34.100 22.535 1.00 61.88  ? 44  LYS D O   1 
ATOM   3751 C CB  . LYS D 1 44  ? 2.965   -36.195 21.209 1.00 63.16  ? 44  LYS D CB  1 
ATOM   3752 C CG  . LYS D 1 44  ? 2.648   -37.312 20.221 1.00 63.56  ? 44  LYS D CG  1 
ATOM   3753 C CD  . LYS D 1 44  ? 1.873   -36.777 19.012 1.00 64.55  ? 44  LYS D CD  1 
ATOM   3754 C CE  . LYS D 1 44  ? 2.792   -35.920 18.136 1.00 65.84  ? 44  LYS D CE  1 
ATOM   3755 N NZ  . LYS D 1 44  ? 2.093   -35.045 17.158 1.00 66.84  ? 44  LYS D NZ  1 
ATOM   3756 N N   . LYS D 1 45  ? 4.327   -35.450 24.317 1.00 64.72  ? 45  LYS D N   1 
ATOM   3757 C CA  . LYS D 1 45  ? 4.474   -34.398 25.314 1.00 67.30  ? 45  LYS D CA  1 
ATOM   3758 C C   . LYS D 1 45  ? 5.892   -34.337 25.882 1.00 66.80  ? 45  LYS D C   1 
ATOM   3759 O O   . LYS D 1 45  ? 6.291   -33.328 26.466 1.00 67.74  ? 45  LYS D O   1 
ATOM   3760 C CB  . LYS D 1 45  ? 3.448   -34.587 26.441 1.00 68.29  ? 45  LYS D CB  1 
ATOM   3761 C CG  . LYS D 1 45  ? 3.536   -33.539 27.566 1.00 71.74  ? 45  LYS D CG  1 
ATOM   3762 C CD  . LYS D 1 45  ? 2.697   -33.949 28.774 1.00 73.52  ? 45  LYS D CD  1 
ATOM   3763 C CE  . LYS D 1 45  ? 2.804   -32.916 29.890 1.00 73.30  ? 45  LYS D CE  1 
ATOM   3764 N NZ  . LYS D 1 45  ? 2.428   -33.503 31.208 1.00 74.14  ? 45  LYS D NZ  1 
ATOM   3765 N N   . THR D 1 46  ? 6.652   -35.413 25.714 1.00 65.81  ? 46  THR D N   1 
ATOM   3766 C CA  . THR D 1 46  ? 8.018   -35.460 26.230 1.00 64.50  ? 46  THR D CA  1 
ATOM   3767 C C   . THR D 1 46  ? 9.027   -34.983 25.190 1.00 64.37  ? 46  THR D C   1 
ATOM   3768 O O   . THR D 1 46  ? 10.224  -34.934 25.469 1.00 63.84  ? 46  THR D O   1 
ATOM   3769 C CB  . THR D 1 46  ? 8.382   -36.891 26.675 1.00 64.44  ? 46  THR D CB  1 
ATOM   3770 O OG1 . THR D 1 46  ? 7.995   -37.812 25.655 1.00 65.05  ? 46  THR D OG1 1 
ATOM   3771 C CG2 . THR D 1 46  ? 7.569   -37.320 27.880 1.00 63.27  ? 46  THR D CG2 1 
ATOM   3772 N N   . MET D 1 47  ? 8.541   -34.618 24.002 1.00 64.85  ? 47  MET D N   1 
ATOM   3773 C CA  . MET D 1 47  ? 9.420   -34.272 22.872 1.00 64.29  ? 47  MET D CA  1 
ATOM   3774 C C   . MET D 1 47  ? 9.200   -32.891 22.274 1.00 64.08  ? 47  MET D C   1 
ATOM   3775 O O   . MET D 1 47  ? 8.087   -32.556 21.872 1.00 63.88  ? 47  MET D O   1 
ATOM   3776 C CB  . MET D 1 47  ? 9.357   -35.339 21.753 1.00 63.04  ? 47  MET D CB  1 
ATOM   3777 C CG  . MET D 1 47  ? 8.064   -36.135 21.646 1.00 60.59  ? 47  MET D CG  1 
ATOM   3778 S SD  . MET D 1 47  ? 8.258   -37.587 20.591 1.00 58.40  ? 47  MET D SD  1 
ATOM   3779 C CE  . MET D 1 47  ? 7.331   -37.061 19.200 1.00 58.23  ? 47  MET D CE  1 
ATOM   3780 N N   . LEU D 1 48  ? 10.278  -32.106 22.207 1.00 63.74  ? 48  LEU D N   1 
ATOM   3781 C CA  . LEU D 1 48  ? 10.244  -30.781 21.590 1.00 63.61  ? 48  LEU D CA  1 
ATOM   3782 C C   . LEU D 1 48  ? 10.041  -30.885 20.087 1.00 64.29  ? 48  LEU D C   1 
ATOM   3783 O O   . LEU D 1 48  ? 9.402   -30.020 19.487 1.00 66.26  ? 48  LEU D O   1 
ATOM   3784 C CB  . LEU D 1 48  ? 11.529  -30.003 21.868 1.00 64.65  ? 48  LEU D CB  1 
ATOM   3785 C CG  . LEU D 1 48  ? 11.813  -29.440 23.272 1.00 67.42  ? 48  LEU D CG  1 
ATOM   3786 C CD1 . LEU D 1 48  ? 13.276  -28.997 23.346 1.00 66.24  ? 48  LEU D CD1 1 
ATOM   3787 C CD2 . LEU D 1 48  ? 10.863  -28.291 23.667 1.00 64.95  ? 48  LEU D CD2 1 
ATOM   3788 N N   . VAL D 1 49  ? 10.606  -31.927 19.480 1.00 63.30  ? 49  VAL D N   1 
ATOM   3789 C CA  . VAL D 1 49  ? 10.400  -32.203 18.061 1.00 62.20  ? 49  VAL D CA  1 
ATOM   3790 C C   . VAL D 1 49  ? 9.386   -33.342 17.981 1.00 62.65  ? 49  VAL D C   1 
ATOM   3791 O O   . VAL D 1 49  ? 9.639   -34.438 18.486 1.00 64.72  ? 49  VAL D O   1 
ATOM   3792 C CB  . VAL D 1 49  ? 11.721  -32.583 17.343 1.00 61.88  ? 49  VAL D CB  1 
ATOM   3793 C CG1 . VAL D 1 49  ? 11.461  -32.996 15.902 1.00 59.87  ? 49  VAL D CG1 1 
ATOM   3794 C CG2 . VAL D 1 49  ? 12.720  -31.423 17.393 1.00 61.08  ? 49  VAL D CG2 1 
ATOM   3795 N N   . GLN D 1 50  ? 8.246   -33.067 17.348 1.00 62.31  ? 50  GLN D N   1 
ATOM   3796 C CA  . GLN D 1 50  ? 7.114   -33.996 17.302 1.00 61.63  ? 50  GLN D CA  1 
ATOM   3797 C C   . GLN D 1 50  ? 7.216   -35.032 16.192 1.00 60.39  ? 50  GLN D C   1 
ATOM   3798 O O   . GLN D 1 50  ? 7.531   -34.703 15.054 1.00 60.40  ? 50  GLN D O   1 
ATOM   3799 C CB  . GLN D 1 50  ? 5.804   -33.212 17.159 1.00 63.58  ? 50  GLN D CB  1 
ATOM   3800 C CG  . GLN D 1 50  ? 5.492   -32.271 18.319 1.00 66.37  ? 50  GLN D CG  1 
ATOM   3801 C CD  . GLN D 1 50  ? 4.949   -33.002 19.535 1.00 69.43  ? 50  GLN D CD  1 
ATOM   3802 O OE1 . GLN D 1 50  ? 4.063   -33.849 19.413 1.00 70.45  ? 50  GLN D OE1 1 
ATOM   3803 N NE2 . GLN D 1 50  ? 5.470   -32.667 20.714 1.00 70.13  ? 50  GLN D NE2 1 
ATOM   3804 N N   . LYS D 1 51  ? 6.946   -36.287 16.533 1.00 59.21  ? 51  LYS D N   1 
ATOM   3805 C CA  . LYS D 1 51  ? 6.972   -37.384 15.567 1.00 60.20  ? 51  LYS D CA  1 
ATOM   3806 C C   . LYS D 1 51  ? 5.640   -38.123 15.646 1.00 60.85  ? 51  LYS D C   1 
ATOM   3807 O O   . LYS D 1 51  ? 5.276   -38.639 16.705 1.00 60.12  ? 51  LYS D O   1 
ATOM   3808 C CB  . LYS D 1 51  ? 8.112   -38.368 15.866 1.00 60.84  ? 51  LYS D CB  1 
ATOM   3809 C CG  . LYS D 1 51  ? 9.468   -37.761 16.210 1.00 61.26  ? 51  LYS D CG  1 
ATOM   3810 C CD  . LYS D 1 51  ? 10.225  -37.349 14.973 1.00 61.74  ? 51  LYS D CD  1 
ATOM   3811 C CE  . LYS D 1 51  ? 11.372  -36.409 15.315 1.00 63.99  ? 51  LYS D CE  1 
ATOM   3812 N NZ  . LYS D 1 51  ? 12.683  -37.099 15.466 1.00 62.90  ? 51  LYS D NZ  1 
ATOM   3813 N N   . ASN D 1 52  ? 4.915   -38.179 14.531 1.00 61.59  ? 52  ASN D N   1 
ATOM   3814 C CA  . ASN D 1 52  ? 3.589   -38.803 14.518 1.00 61.18  ? 52  ASN D CA  1 
ATOM   3815 C C   . ASN D 1 52  ? 3.656   -40.314 14.680 1.00 59.49  ? 52  ASN D C   1 
ATOM   3816 O O   . ASN D 1 52  ? 2.734   -40.924 15.219 1.00 60.00  ? 52  ASN D O   1 
ATOM   3817 C CB  . ASN D 1 52  ? 2.821   -38.444 13.241 1.00 63.39  ? 52  ASN D CB  1 
ATOM   3818 C CG  . ASN D 1 52  ? 2.675   -36.939 13.037 1.00 65.25  ? 52  ASN D CG  1 
ATOM   3819 O OD1 . ASN D 1 52  ? 3.241   -36.375 12.092 1.00 67.75  ? 52  ASN D OD1 1 
ATOM   3820 N ND2 . ASN D 1 52  ? 1.909   -36.285 13.916 1.00 63.36  ? 52  ASN D ND2 1 
ATOM   3821 N N   . VAL D 1 53  ? 4.750   -40.911 14.214 1.00 56.90  ? 53  VAL D N   1 
ATOM   3822 C CA  . VAL D 1 53  ? 4.943   -42.360 14.313 1.00 55.49  ? 53  VAL D CA  1 
ATOM   3823 C C   . VAL D 1 53  ? 6.011   -42.729 15.348 1.00 53.86  ? 53  VAL D C   1 
ATOM   3824 O O   . VAL D 1 53  ? 6.991   -42.009 15.531 1.00 53.83  ? 53  VAL D O   1 
ATOM   3825 C CB  . VAL D 1 53  ? 5.359   -42.980 12.952 1.00 56.02  ? 53  VAL D CB  1 
ATOM   3826 C CG1 . VAL D 1 53  ? 5.027   -44.465 12.918 1.00 53.16  ? 53  VAL D CG1 1 
ATOM   3827 C CG2 . VAL D 1 53  ? 4.682   -42.258 11.804 1.00 55.72  ? 53  VAL D CG2 1 
ATOM   3828 N N   . THR D 1 54  ? 5.799   -43.852 16.024 1.00 51.30  ? 54  THR D N   1 
ATOM   3829 C CA  . THR D 1 54  ? 6.754   -44.382 16.990 1.00 50.43  ? 54  THR D CA  1 
ATOM   3830 C C   . THR D 1 54  ? 7.194   -45.781 16.593 1.00 49.90  ? 54  THR D C   1 
ATOM   3831 O O   . THR D 1 54  ? 6.387   -46.706 16.521 1.00 50.04  ? 54  THR D O   1 
ATOM   3832 C CB  . THR D 1 54  ? 6.154   -44.389 18.399 1.00 50.29  ? 54  THR D CB  1 
ATOM   3833 O OG1 . THR D 1 54  ? 6.261   -43.070 18.944 1.00 52.96  ? 54  THR D OG1 1 
ATOM   3834 C CG2 . THR D 1 54  ? 6.987   -45.258 19.349 1.00 47.30  ? 54  THR D CG2 1 
ATOM   3835 N N   . SER D 1 55  ? 8.486   -45.929 16.339 1.00 49.79  ? 55  SER D N   1 
ATOM   3836 C CA  . SER D 1 55  ? 9.035   -47.207 15.923 1.00 48.93  ? 55  SER D CA  1 
ATOM   3837 C C   . SER D 1 55  ? 9.850   -47.825 17.038 1.00 47.51  ? 55  SER D C   1 
ATOM   3838 O O   . SER D 1 55  ? 10.752  -47.190 17.576 1.00 47.80  ? 55  SER D O   1 
ATOM   3839 C CB  . SER D 1 55  ? 9.905   -47.011 14.681 1.00 48.80  ? 55  SER D CB  1 
ATOM   3840 O OG  . SER D 1 55  ? 10.773  -48.112 14.497 1.00 54.49  ? 55  SER D OG  1 
ATOM   3841 N N   . GLU D 1 56  ? 9.515   -49.047 17.423 1.00 46.66  ? 56  GLU D N   1 
ATOM   3842 C CA  . GLU D 1 56  ? 10.384  -49.753 18.345 1.00 46.67  ? 56  GLU D CA  1 
ATOM   3843 C C   . GLU D 1 56  ? 10.988  -50.942 17.647 1.00 45.83  ? 56  GLU D C   1 
ATOM   3844 O O   . GLU D 1 56  ? 10.314  -51.661 16.915 1.00 45.26  ? 56  GLU D O   1 
ATOM   3845 C CB  . GLU D 1 56  ? 9.719   -50.104 19.685 1.00 47.25  ? 56  GLU D CB  1 
ATOM   3846 C CG  . GLU D 1 56  ? 8.310   -50.645 19.649 1.00 49.45  ? 56  GLU D CG  1 
ATOM   3847 C CD  . GLU D 1 56  ? 7.892   -51.201 21.005 1.00 53.00  ? 56  GLU D CD  1 
ATOM   3848 O OE1 . GLU D 1 56  ? 7.455   -50.414 21.882 1.00 50.15  ? 56  GLU D OE1 1 
ATOM   3849 O OE2 . GLU D 1 56  ? 8.007   -52.436 21.188 1.00 54.39  ? 56  GLU D OE2 1 
ATOM   3850 N N   . SER D 1 57  ? 12.288  -51.100 17.843 1.00 46.53  ? 57  SER D N   1 
ATOM   3851 C CA  . SER D 1 57  ? 13.057  -52.111 17.144 1.00 48.19  ? 57  SER D CA  1 
ATOM   3852 C C   . SER D 1 57  ? 14.162  -52.700 17.978 1.00 48.76  ? 57  SER D C   1 
ATOM   3853 O O   . SER D 1 57  ? 14.771  -52.039 18.826 1.00 49.56  ? 57  SER D O   1 
ATOM   3854 C CB  . SER D 1 57  ? 13.679  -51.527 15.877 1.00 48.61  ? 57  SER D CB  1 
ATOM   3855 O OG  . SER D 1 57  ? 14.320  -50.300 16.167 1.00 49.95  ? 57  SER D OG  1 
ATOM   3856 N N   . THR D 1 58  ? 14.420  -53.962 17.689 1.00 48.43  ? 58  THR D N   1 
ATOM   3857 C CA  . THR D 1 58  ? 15.491  -54.697 18.304 1.00 48.81  ? 58  THR D CA  1 
ATOM   3858 C C   . THR D 1 58  ? 16.306  -55.238 17.121 1.00 48.64  ? 58  THR D C   1 
ATOM   3859 O O   . THR D 1 58  ? 15.806  -55.257 16.000 1.00 49.69  ? 58  THR D O   1 
ATOM   3860 C CB  . THR D 1 58  ? 14.893  -55.781 19.252 1.00 49.61  ? 58  THR D CB  1 
ATOM   3861 O OG1 . THR D 1 58  ? 15.942  -56.487 19.917 1.00 54.66  ? 58  THR D OG1 1 
ATOM   3862 C CG2 . THR D 1 58  ? 14.129  -56.850 18.491 1.00 46.31  ? 58  THR D CG2 1 
ATOM   3863 N N   . CYS D 1 59  ? 17.564  -55.611 17.343 1.00 48.68  ? 59  CYS D N   1 
ATOM   3864 C CA  . CYS D 1 59  ? 18.442  -56.038 16.251 1.00 49.68  ? 59  CYS D CA  1 
ATOM   3865 C C   . CYS D 1 59  ? 19.364  -57.155 16.671 1.00 51.73  ? 59  CYS D C   1 
ATOM   3866 O O   . CYS D 1 59  ? 19.779  -57.227 17.819 1.00 54.57  ? 59  CYS D O   1 
ATOM   3867 C CB  . CYS D 1 59  ? 19.296  -54.876 15.758 1.00 49.14  ? 59  CYS D CB  1 
ATOM   3868 S SG  . CYS D 1 59  ? 18.368  -53.644 14.825 1.00 53.36  ? 59  CYS D SG  1 
ATOM   3869 N N   . CYS D 1 60  ? 19.699  -58.017 15.724 1.00 52.41  ? 60  CYS D N   1 
ATOM   3870 C CA  . CYS D 1 60  ? 20.569  -59.137 15.991 1.00 52.99  ? 60  CYS D CA  1 
ATOM   3871 C C   . CYS D 1 60  ? 22.003  -58.682 16.172 1.00 52.00  ? 60  CYS D C   1 
ATOM   3872 O O   . CYS D 1 60  ? 22.686  -58.399 15.203 1.00 51.00  ? 60  CYS D O   1 
ATOM   3873 C CB  . CYS D 1 60  ? 20.487  -60.122 14.841 1.00 55.02  ? 60  CYS D CB  1 
ATOM   3874 S SG  . CYS D 1 60  ? 21.244  -61.687 15.270 1.00 62.07  ? 60  CYS D SG  1 
ATOM   3875 N N   . VAL D 1 61  ? 22.466  -58.606 17.414 1.00 53.34  ? 61  VAL D N   1 
ATOM   3876 C CA  . VAL D 1 61  ? 23.847  -58.188 17.653 1.00 54.52  ? 61  VAL D CA  1 
ATOM   3877 C C   . VAL D 1 61  ? 24.637  -59.137 18.546 1.00 55.59  ? 61  VAL D C   1 
ATOM   3878 O O   . VAL D 1 61  ? 24.067  -59.959 19.269 1.00 55.59  ? 61  VAL D O   1 
ATOM   3879 C CB  . VAL D 1 61  ? 23.954  -56.714 18.161 1.00 54.19  ? 61  VAL D CB  1 
ATOM   3880 C CG1 . VAL D 1 61  ? 23.173  -55.780 17.238 1.00 52.56  ? 61  VAL D CG1 1 
ATOM   3881 C CG2 . VAL D 1 61  ? 23.504  -56.572 19.622 1.00 53.11  ? 61  VAL D CG2 1 
ATOM   3882 N N   . ALA D 1 62  ? 25.959  -59.022 18.467 1.00 57.11  ? 62  ALA D N   1 
ATOM   3883 C CA  . ALA D 1 62  ? 26.856  -59.901 19.204 1.00 59.09  ? 62  ALA D CA  1 
ATOM   3884 C C   . ALA D 1 62  ? 26.938  -59.513 20.661 1.00 60.40  ? 62  ALA D C   1 
ATOM   3885 O O   . ALA D 1 62  ? 27.249  -58.366 20.989 1.00 61.23  ? 62  ALA D O   1 
ATOM   3886 C CB  . ALA D 1 62  ? 28.241  -59.864 18.591 1.00 58.40  ? 62  ALA D CB  1 
ATOM   3887 N N   . LYS D 1 63  ? 26.665  -60.469 21.538 1.00 61.87  ? 63  LYS D N   1 
ATOM   3888 C CA  . LYS D 1 63  ? 26.809  -60.224 22.969 1.00 64.69  ? 63  LYS D CA  1 
ATOM   3889 C C   . LYS D 1 63  ? 28.266  -60.331 23.437 1.00 65.84  ? 63  LYS D C   1 
ATOM   3890 O O   . LYS D 1 63  ? 28.814  -59.377 24.005 1.00 65.03  ? 63  LYS D O   1 
ATOM   3891 C CB  . LYS D 1 63  ? 25.954  -61.191 23.746 1.00 63.54  ? 63  LYS D CB  1 
ATOM   3892 C CG  . LYS D 1 63  ? 25.714  -60.787 25.174 1.00 65.72  ? 63  LYS D CG  1 
ATOM   3893 C CD  . LYS D 1 63  ? 24.703  -61.730 25.768 1.00 68.28  ? 63  LYS D CD  1 
ATOM   3894 C CE  . LYS D 1 63  ? 24.669  -63.046 24.972 1.00 70.88  ? 63  LYS D CE  1 
ATOM   3895 N NZ  . LYS D 1 63  ? 23.819  -62.992 23.727 1.00 71.53  ? 63  LYS D NZ  1 
ATOM   3896 N N   . SER D 1 64  ? 28.880  -61.492 23.208 1.00 66.89  ? 64  SER D N   1 
ATOM   3897 C CA  . SER D 1 64  ? 30.283  -61.699 23.558 1.00 67.19  ? 64  SER D CA  1 
ATOM   3898 C C   . SER D 1 64  ? 31.098  -61.951 22.305 1.00 67.41  ? 64  SER D C   1 
ATOM   3899 O O   . SER D 1 64  ? 30.589  -62.494 21.325 1.00 66.15  ? 64  SER D O   1 
ATOM   3900 C CB  . SER D 1 64  ? 30.433  -62.883 24.514 1.00 66.57  ? 64  SER D CB  1 
ATOM   3901 O OG  . SER D 1 64  ? 29.862  -64.047 23.947 1.00 66.04  ? 64  SER D OG  1 
ATOM   3902 N N   . TYR D 1 65  ? 32.362  -61.546 22.351 1.00 68.67  ? 65  TYR D N   1 
ATOM   3903 C CA  . TYR D 1 65  ? 33.288  -61.815 21.268 1.00 69.75  ? 65  TYR D CA  1 
ATOM   3904 C C   . TYR D 1 65  ? 34.751  -61.772 21.699 1.00 71.13  ? 65  TYR D C   1 
ATOM   3905 O O   . TYR D 1 65  ? 35.127  -60.990 22.570 1.00 72.31  ? 65  TYR D O   1 
ATOM   3906 C CB  . TYR D 1 65  ? 33.054  -60.850 20.102 1.00 69.48  ? 65  TYR D CB  1 
ATOM   3907 C CG  . TYR D 1 65  ? 33.291  -59.382 20.396 1.00 70.86  ? 65  TYR D CG  1 
ATOM   3908 C CD1 . TYR D 1 65  ? 34.569  -58.828 20.305 1.00 72.65  ? 65  TYR D CD1 1 
ATOM   3909 C CD2 . TYR D 1 65  ? 32.233  -58.538 20.722 1.00 71.07  ? 65  TYR D CD2 1 
ATOM   3910 C CE1 . TYR D 1 65  ? 34.790  -57.474 20.550 1.00 73.61  ? 65  TYR D CE1 1 
ATOM   3911 C CE2 . TYR D 1 65  ? 32.444  -57.182 20.964 1.00 72.39  ? 65  TYR D CE2 1 
ATOM   3912 C CZ  . TYR D 1 65  ? 33.724  -56.659 20.875 1.00 73.82  ? 65  TYR D CZ  1 
ATOM   3913 O OH  . TYR D 1 65  ? 33.938  -55.318 21.111 1.00 77.60  ? 65  TYR D OH  1 
ATOM   3914 N N   . ASN D 1 66  ? 35.560  -62.637 21.090 1.00 72.40  ? 66  ASN D N   1 
ATOM   3915 C CA  . ASN D 1 66  ? 37.011  -62.603 21.229 1.00 73.20  ? 66  ASN D CA  1 
ATOM   3916 C C   . ASN D 1 66  ? 37.574  -61.834 20.049 1.00 74.01  ? 66  ASN D C   1 
ATOM   3917 O O   . ASN D 1 66  ? 37.140  -62.032 18.920 1.00 74.72  ? 66  ASN D O   1 
ATOM   3918 C CB  . ASN D 1 66  ? 37.589  -64.014 21.191 1.00 74.13  ? 66  ASN D CB  1 
ATOM   3919 C CG  . ASN D 1 66  ? 37.126  -64.867 22.343 1.00 74.23  ? 66  ASN D CG  1 
ATOM   3920 O OD1 . ASN D 1 66  ? 37.650  -64.765 23.453 1.00 74.57  ? 66  ASN D OD1 1 
ATOM   3921 N ND2 . ASN D 1 66  ? 36.148  -65.730 22.085 1.00 74.60  ? 66  ASN D ND2 1 
ATOM   3922 N N   . ARG D 1 67  ? 38.547  -60.972 20.303 1.00 75.90  ? 67  ARG D N   1 
ATOM   3923 C CA  . ARG D 1 67  ? 39.173  -60.191 19.236 1.00 78.17  ? 67  ARG D CA  1 
ATOM   3924 C C   . ARG D 1 67  ? 40.347  -60.973 18.610 1.00 78.60  ? 67  ARG D C   1 
ATOM   3925 O O   . ARG D 1 67  ? 41.490  -60.849 19.051 1.00 79.64  ? 67  ARG D O   1 
ATOM   3926 C CB  . ARG D 1 67  ? 39.632  -58.843 19.797 1.00 78.97  ? 67  ARG D CB  1 
ATOM   3927 C CG  . ARG D 1 67  ? 39.988  -57.828 18.746 1.00 82.46  ? 67  ARG D CG  1 
ATOM   3928 C CD  . ARG D 1 67  ? 40.830  -56.697 19.283 1.00 87.24  ? 67  ARG D CD  1 
ATOM   3929 N NE  . ARG D 1 67  ? 41.674  -56.117 18.239 1.00 91.80  ? 67  ARG D NE  1 
ATOM   3930 C CZ  . ARG D 1 67  ? 42.575  -55.159 18.442 1.00 93.70  ? 67  ARG D CZ  1 
ATOM   3931 N NH1 . ARG D 1 67  ? 42.765  -54.652 19.660 1.00 94.27  ? 67  ARG D NH1 1 
ATOM   3932 N NH2 . ARG D 1 67  ? 43.293  -54.705 17.419 1.00 94.36  ? 67  ARG D NH2 1 
ATOM   3933 N N   . VAL D 1 68  ? 40.055  -61.755 17.568 1.00 79.29  ? 68  VAL D N   1 
ATOM   3934 C CA  . VAL D 1 68  ? 41.025  -62.707 16.994 1.00 78.85  ? 68  VAL D CA  1 
ATOM   3935 C C   . VAL D 1 68  ? 41.713  -62.270 15.683 1.00 79.66  ? 68  VAL D C   1 
ATOM   3936 O O   . VAL D 1 68  ? 41.240  -61.364 14.994 1.00 78.86  ? 68  VAL D O   1 
ATOM   3937 C CB  . VAL D 1 68  ? 40.385  -64.120 16.828 1.00 78.40  ? 68  VAL D CB  1 
ATOM   3938 C CG1 . VAL D 1 68  ? 39.604  -64.513 18.087 1.00 77.22  ? 68  VAL D CG1 1 
ATOM   3939 C CG2 . VAL D 1 68  ? 39.491  -64.176 15.603 1.00 78.21  ? 68  VAL D CG2 1 
ATOM   3940 N N   . THR D 1 69  ? 42.829  -62.931 15.360 1.00 81.81  ? 69  THR D N   1 
ATOM   3941 C CA  . THR D 1 69  ? 43.670  -62.612 14.189 1.00 83.38  ? 69  THR D CA  1 
ATOM   3942 C C   . THR D 1 69  ? 43.564  -63.681 13.091 1.00 83.86  ? 69  THR D C   1 
ATOM   3943 O O   . THR D 1 69  ? 43.704  -64.872 13.371 1.00 83.51  ? 69  THR D O   1 
ATOM   3944 C CB  . THR D 1 69  ? 45.156  -62.457 14.620 1.00 83.56  ? 69  THR D CB  1 
ATOM   3945 O OG1 . THR D 1 69  ? 45.245  -61.589 15.757 1.00 84.66  ? 69  THR D OG1 1 
ATOM   3946 C CG2 . THR D 1 69  ? 45.964  -61.736 13.551 1.00 84.07  ? 69  THR D CG2 1 
ATOM   3947 N N   . VAL D 1 70  ? 43.340  -63.247 11.847 1.00 84.90  ? 70  VAL D N   1 
ATOM   3948 C CA  . VAL D 1 70  ? 43.175  -64.176 10.710 1.00 85.37  ? 70  VAL D CA  1 
ATOM   3949 C C   . VAL D 1 70  ? 44.260  -64.109 9.630  1.00 87.20  ? 70  VAL D C   1 
ATOM   3950 O O   . VAL D 1 70  ? 45.091  -63.199 9.634  1.00 87.32  ? 70  VAL D O   1 
ATOM   3951 C CB  . VAL D 1 70  ? 41.797  -64.020 10.042 1.00 83.19  ? 70  VAL D CB  1 
ATOM   3952 C CG1 . VAL D 1 70  ? 40.728  -64.537 10.961 1.00 81.42  ? 70  VAL D CG1 1 
ATOM   3953 C CG2 . VAL D 1 70  ? 41.546  -62.568 9.661  1.00 82.00  ? 70  VAL D CG2 1 
ATOM   3954 N N   . MET D 1 71  ? 44.228  -65.075 8.706  1.00 89.03  ? 71  MET D N   1 
ATOM   3955 C CA  . MET D 1 71  ? 45.225  -65.199 7.627  1.00 91.05  ? 71  MET D CA  1 
ATOM   3956 C C   . MET D 1 71  ? 45.563  -63.863 6.967  1.00 91.45  ? 71  MET D C   1 
ATOM   3957 O O   . MET D 1 71  ? 46.739  -63.565 6.734  1.00 91.99  ? 71  MET D O   1 
ATOM   3958 C CB  . MET D 1 71  ? 44.759  -66.210 6.570  1.00 91.49  ? 71  MET D CB  1 
ATOM   3959 C CG  . MET D 1 71  ? 45.779  -66.541 5.472  1.00 92.76  ? 71  MET D CG  1 
ATOM   3960 S SD  . MET D 1 71  ? 47.355  -67.222 6.066  1.00 95.69  ? 71  MET D SD  1 
ATOM   3961 C CE  . MET D 1 71  ? 48.501  -65.887 5.704  1.00 94.11  ? 71  MET D CE  1 
ATOM   3962 N N   . GLY D 1 72  ? 44.536  -63.064 6.678  1.00 90.93  ? 72  GLY D N   1 
ATOM   3963 C CA  . GLY D 1 72  ? 44.735  -61.744 6.089  1.00 90.37  ? 72  GLY D CA  1 
ATOM   3964 C C   . GLY D 1 72  ? 45.637  -60.828 6.910  1.00 90.00  ? 72  GLY D C   1 
ATOM   3965 O O   . GLY D 1 72  ? 46.045  -59.766 6.430  1.00 90.43  ? 72  GLY D O   1 
ATOM   3966 N N   . GLY D 1 73  ? 45.970  -61.253 8.133  1.00 89.13  ? 73  GLY D N   1 
ATOM   3967 C CA  . GLY D 1 73  ? 46.704  -60.413 9.082  1.00 88.50  ? 73  GLY D CA  1 
ATOM   3968 C C   . GLY D 1 73  ? 45.746  -59.439 9.754  1.00 88.26  ? 73  GLY D C   1 
ATOM   3969 O O   . GLY D 1 73  ? 46.159  -58.498 10.439 1.00 88.82  ? 73  GLY D O   1 
ATOM   3970 N N   . PHE D 1 74  ? 44.454  -59.689 9.539  1.00 87.94  ? 74  PHE D N   1 
ATOM   3971 C CA  . PHE D 1 74  ? 43.387  -58.834 10.026 1.00 85.55  ? 74  PHE D CA  1 
ATOM   3972 C C   . PHE D 1 74  ? 43.019  -59.201 11.439 1.00 83.91  ? 74  PHE D C   1 
ATOM   3973 O O   . PHE D 1 74  ? 43.297  -60.311 11.901 1.00 82.09  ? 74  PHE D O   1 
ATOM   3974 C CB  . PHE D 1 74  ? 42.142  -58.967 9.139  1.00 86.74  ? 74  PHE D CB  1 
ATOM   3975 C CG  . PHE D 1 74  ? 42.183  -58.129 7.905  1.00 88.61  ? 74  PHE D CG  1 
ATOM   3976 C CD1 . PHE D 1 74  ? 42.773  -58.613 6.741  1.00 89.98  ? 74  PHE D CD1 1 
ATOM   3977 C CD2 . PHE D 1 74  ? 41.642  -56.844 7.905  1.00 90.86  ? 74  PHE D CD2 1 
ATOM   3978 C CE1 . PHE D 1 74  ? 42.831  -57.828 5.590  1.00 91.69  ? 74  PHE D CE1 1 
ATOM   3979 C CE2 . PHE D 1 74  ? 41.689  -56.050 6.760  1.00 92.15  ? 74  PHE D CE2 1 
ATOM   3980 C CZ  . PHE D 1 74  ? 42.285  -56.543 5.599  1.00 91.99  ? 74  PHE D CZ  1 
ATOM   3981 N N   . LYS D 1 75  ? 42.388  -58.248 12.107 1.00 82.05  ? 75  LYS D N   1 
ATOM   3982 C CA  . LYS D 1 75  ? 41.847  -58.467 13.425 1.00 79.51  ? 75  LYS D CA  1 
ATOM   3983 C C   . LYS D 1 75  ? 40.338  -58.296 13.325 1.00 76.89  ? 75  LYS D C   1 
ATOM   3984 O O   . LYS D 1 75  ? 39.848  -57.202 13.031 1.00 78.67  ? 75  LYS D O   1 
ATOM   3985 C CB  . LYS D 1 75  ? 42.461  -57.498 14.440 1.00 80.28  ? 75  LYS D CB  1 
ATOM   3986 C CG  . LYS D 1 75  ? 43.978  -57.408 14.352 1.00 80.97  ? 75  LYS D CG  1 
ATOM   3987 C CD  . LYS D 1 75  ? 44.616  -57.397 15.726 1.00 81.97  ? 75  LYS D CD  1 
ATOM   3988 C CE  . LYS D 1 75  ? 46.111  -57.661 15.620 1.00 80.46  ? 75  LYS D CE  1 
ATOM   3989 N NZ  . LYS D 1 75  ? 46.732  -57.716 16.965 1.00 79.88  ? 75  LYS D NZ  1 
ATOM   3990 N N   . VAL D 1 76  ? 39.609  -59.384 13.543 1.00 72.83  ? 76  VAL D N   1 
ATOM   3991 C CA  . VAL D 1 76  ? 38.147  -59.371 13.492 1.00 68.01  ? 76  VAL D CA  1 
ATOM   3992 C C   . VAL D 1 76  ? 37.568  -59.883 14.809 1.00 65.70  ? 76  VAL D C   1 
ATOM   3993 O O   . VAL D 1 76  ? 38.298  -60.382 15.654 1.00 65.33  ? 76  VAL D O   1 
ATOM   3994 C CB  . VAL D 1 76  ? 37.603  -60.213 12.314 1.00 66.95  ? 76  VAL D CB  1 
ATOM   3995 C CG1 . VAL D 1 76  ? 38.082  -59.663 10.982 1.00 64.18  ? 76  VAL D CG1 1 
ATOM   3996 C CG2 . VAL D 1 76  ? 37.998  -61.667 12.462 1.00 65.58  ? 76  VAL D CG2 1 
ATOM   3997 N N   . GLU D 1 77  ? 36.263  -59.759 14.991 1.00 62.91  ? 77  GLU D N   1 
ATOM   3998 C CA  . GLU D 1 77  ? 35.644  -60.256 16.210 1.00 61.68  ? 77  GLU D CA  1 
ATOM   3999 C C   . GLU D 1 77  ? 35.018  -61.607 15.932 1.00 60.10  ? 77  GLU D C   1 
ATOM   4000 O O   . GLU D 1 77  ? 34.268  -61.758 14.979 1.00 61.36  ? 77  GLU D O   1 
ATOM   4001 C CB  . GLU D 1 77  ? 34.553  -59.310 16.692 1.00 62.82  ? 77  GLU D CB  1 
ATOM   4002 C CG  . GLU D 1 77  ? 34.908  -57.837 16.674 1.00 65.84  ? 77  GLU D CG  1 
ATOM   4003 C CD  . GLU D 1 77  ? 33.669  -56.964 16.593 1.00 67.28  ? 77  GLU D CD  1 
ATOM   4004 O OE1 . GLU D 1 77  ? 32.617  -57.387 17.118 1.00 67.92  ? 77  GLU D OE1 1 
ATOM   4005 O OE2 . GLU D 1 77  ? 33.741  -55.863 16.003 1.00 67.69  ? 77  GLU D OE2 1 
ATOM   4006 N N   . ASN D 1 78  ? 35.323  -62.592 16.760 1.00 57.98  ? 78  ASN D N   1 
ATOM   4007 C CA  . ASN D 1 78  ? 34.713  -63.901 16.622 1.00 56.28  ? 78  ASN D CA  1 
ATOM   4008 C C   . ASN D 1 78  ? 33.544  -63.927 17.591 1.00 54.92  ? 78  ASN D C   1 
ATOM   4009 O O   . ASN D 1 78  ? 33.723  -63.882 18.800 1.00 54.88  ? 78  ASN D O   1 
ATOM   4010 C CB  . ASN D 1 78  ? 35.752  -64.995 16.912 1.00 56.50  ? 78  ASN D CB  1 
ATOM   4011 C CG  . ASN D 1 78  ? 35.183  -66.395 16.826 1.00 57.74  ? 78  ASN D CG  1 
ATOM   4012 O OD1 . ASN D 1 78  ? 34.460  -66.731 15.881 1.00 53.65  ? 78  ASN D OD1 1 
ATOM   4013 N ND2 . ASN D 1 78  ? 35.513  -67.230 17.828 1.00 61.69  ? 78  ASN D ND2 1 
ATOM   4014 N N   . HIS D 1 79  ? 32.333  -63.952 17.060 1.00 54.31  ? 79  HIS D N   1 
ATOM   4015 C CA  . HIS D 1 79  ? 31.169  -63.935 17.927 1.00 54.52  ? 79  HIS D CA  1 
ATOM   4016 C C   . HIS D 1 79  ? 30.963  -65.299 18.550 1.00 55.94  ? 79  HIS D C   1 
ATOM   4017 O O   . HIS D 1 79  ? 31.127  -66.321 17.883 1.00 57.43  ? 79  HIS D O   1 
ATOM   4018 C CB  . HIS D 1 79  ? 29.921  -63.489 17.162 1.00 52.36  ? 79  HIS D CB  1 
ATOM   4019 C CG  . HIS D 1 79  ? 30.036  -62.117 16.579 1.00 47.83  ? 79  HIS D CG  1 
ATOM   4020 N ND1 . HIS D 1 79  ? 29.233  -61.677 15.552 1.00 45.84  ? 79  HIS D ND1 1 
ATOM   4021 C CD2 . HIS D 1 79  ? 30.870  -61.091 16.870 1.00 46.24  ? 79  HIS D CD2 1 
ATOM   4022 C CE1 . HIS D 1 79  ? 29.560  -60.434 15.242 1.00 46.19  ? 79  HIS D CE1 1 
ATOM   4023 N NE2 . HIS D 1 79  ? 30.553  -60.057 16.024 1.00 45.91  ? 79  HIS D NE2 1 
ATOM   4024 N N   . THR D 1 80  ? 30.630  -65.300 19.840 1.00 57.66  ? 80  THR D N   1 
ATOM   4025 C CA  . THR D 1 80  ? 30.386  -66.531 20.600 1.00 57.32  ? 80  THR D CA  1 
ATOM   4026 C C   . THR D 1 80  ? 28.983  -66.519 21.212 1.00 58.11  ? 80  THR D C   1 
ATOM   4027 O O   . THR D 1 80  ? 28.484  -67.563 21.637 1.00 58.24  ? 80  THR D O   1 
ATOM   4028 C CB  . THR D 1 80  ? 31.440  -66.721 21.715 1.00 56.58  ? 80  THR D CB  1 
ATOM   4029 O OG1 . THR D 1 80  ? 31.296  -65.689 22.697 1.00 55.65  ? 80  THR D OG1 1 
ATOM   4030 C CG2 . THR D 1 80  ? 32.855  -66.535 21.186 1.00 56.18  ? 80  THR D CG2 1 
ATOM   4031 N N   . ALA D 1 81  ? 28.363  -65.334 21.259 1.00 59.30  ? 81  ALA D N   1 
ATOM   4032 C CA  . ALA D 1 81  ? 26.997  -65.168 21.774 1.00 59.49  ? 81  ALA D CA  1 
ATOM   4033 C C   . ALA D 1 81  ? 26.212  -64.059 21.045 1.00 60.16  ? 81  ALA D C   1 
ATOM   4034 O O   . ALA D 1 81  ? 26.778  -63.012 20.700 1.00 60.39  ? 81  ALA D O   1 
ATOM   4035 C CB  . ALA D 1 81  ? 27.027  -64.911 23.283 1.00 58.73  ? 81  ALA D CB  1 
ATOM   4036 N N   . CYS D 1 82  ? 24.911  -64.304 20.826 1.00 60.45  ? 82  CYS D N   1 
ATOM   4037 C CA  . CYS D 1 82  ? 24.008  -63.391 20.093 1.00 60.04  ? 82  CYS D CA  1 
ATOM   4038 C C   . CYS D 1 82  ? 22.657  -63.169 20.761 1.00 57.88  ? 82  CYS D C   1 
ATOM   4039 O O   . CYS D 1 82  ? 21.917  -64.112 21.029 1.00 59.08  ? 82  CYS D O   1 
ATOM   4040 C CB  . CYS D 1 82  ? 23.734  -63.924 18.687 1.00 61.19  ? 82  CYS D CB  1 
ATOM   4041 S SG  . CYS D 1 82  ? 25.226  -64.281 17.732 1.00 67.42  ? 82  CYS D SG  1 
ATOM   4042 N N   . HIS D 1 83  ? 22.327  -61.913 21.007 1.00 55.80  ? 83  HIS D N   1 
ATOM   4043 C CA  . HIS D 1 83  ? 21.032  -61.583 21.556 1.00 54.14  ? 83  HIS D CA  1 
ATOM   4044 C C   . HIS D 1 83  ? 20.411  -60.462 20.745 1.00 55.80  ? 83  HIS D C   1 
ATOM   4045 O O   . HIS D 1 83  ? 21.129  -59.605 20.221 1.00 56.58  ? 83  HIS D O   1 
ATOM   4046 C CB  . HIS D 1 83  ? 21.148  -61.187 23.041 1.00 52.87  ? 83  HIS D CB  1 
ATOM   4047 C CG  . HIS D 1 83  ? 22.028  -60.000 23.309 1.00 52.39  ? 83  HIS D CG  1 
ATOM   4048 N ND1 . HIS D 1 83  ? 21.842  -59.178 24.401 1.00 52.80  ? 83  HIS D ND1 1 
ATOM   4049 C CD2 . HIS D 1 83  ? 23.100  -59.499 22.645 1.00 53.68  ? 83  HIS D CD2 1 
ATOM   4050 C CE1 . HIS D 1 83  ? 22.757  -58.223 24.398 1.00 51.76  ? 83  HIS D CE1 1 
ATOM   4051 N NE2 . HIS D 1 83  ? 23.532  -58.393 23.342 1.00 52.16  ? 83  HIS D NE2 1 
ATOM   4052 N N   . CYS D 1 84  ? 19.087  -60.488 20.606 1.00 55.27  ? 84  CYS D N   1 
ATOM   4053 C CA  . CYS D 1 84  ? 18.378  -59.349 20.032 1.00 54.33  ? 84  CYS D CA  1 
ATOM   4054 C C   . CYS D 1 84  ? 18.439  -58.201 21.031 1.00 52.50  ? 84  CYS D C   1 
ATOM   4055 O O   . CYS D 1 84  ? 17.823  -58.278 22.086 1.00 54.39  ? 84  CYS D O   1 
ATOM   4056 C CB  . CYS D 1 84  ? 16.931  -59.699 19.744 1.00 54.40  ? 84  CYS D CB  1 
ATOM   4057 S SG  . CYS D 1 84  ? 16.755  -60.826 18.355 1.00 59.24  ? 84  CYS D SG  1 
ATOM   4058 N N   . SER D 1 85  ? 19.185  -57.154 20.688 1.00 49.29  ? 85  SER D N   1 
ATOM   4059 C CA  . SER D 1 85  ? 19.396  -56.007 21.563 1.00 48.95  ? 85  SER D CA  1 
ATOM   4060 C C   . SER D 1 85  ? 19.193  -54.667 20.805 1.00 48.90  ? 85  SER D C   1 
ATOM   4061 O O   . SER D 1 85  ? 18.619  -54.646 19.716 1.00 47.34  ? 85  SER D O   1 
ATOM   4062 C CB  . SER D 1 85  ? 20.797  -56.116 22.179 1.00 49.65  ? 85  SER D CB  1 
ATOM   4063 O OG  . SER D 1 85  ? 21.130  -54.994 22.979 1.00 52.01  ? 85  SER D OG  1 
ATOM   4064 N N   . THR D 1 86  ? 19.655  -53.562 21.393 1.00 48.23  ? 86  THR D N   1 
ATOM   4065 C CA  . THR D 1 86  ? 19.545  -52.212 20.813 1.00 47.87  ? 86  THR D CA  1 
ATOM   4066 C C   . THR D 1 86  ? 20.106  -52.051 19.388 1.00 48.43  ? 86  THR D C   1 
ATOM   4067 O O   . THR D 1 86  ? 21.191  -52.538 19.067 1.00 50.10  ? 86  THR D O   1 
ATOM   4068 C CB  . THR D 1 86  ? 20.256  -51.182 21.731 1.00 47.10  ? 86  THR D CB  1 
ATOM   4069 O OG1 . THR D 1 86  ? 19.867  -51.394 23.097 1.00 48.78  ? 86  THR D OG1 1 
ATOM   4070 C CG2 . THR D 1 86  ? 19.800  -49.766 21.418 1.00 42.91  ? 86  THR D CG2 1 
ATOM   4071 N N   . CYS D 1 87  ? 19.359  -51.352 18.543 1.00 48.23  ? 87  CYS D N   1 
ATOM   4072 C CA  . CYS D 1 87  ? 19.833  -51.010 17.216 1.00 48.51  ? 87  CYS D CA  1 
ATOM   4073 C C   . CYS D 1 87  ? 20.519  -49.666 17.324 1.00 47.70  ? 87  CYS D C   1 
ATOM   4074 O O   . CYS D 1 87  ? 20.063  -48.782 18.037 1.00 48.00  ? 87  CYS D O   1 
ATOM   4075 C CB  . CYS D 1 87  ? 18.677  -50.884 16.220 1.00 49.01  ? 87  CYS D CB  1 
ATOM   4076 S SG  . CYS D 1 87  ? 17.533  -52.287 16.107 1.00 53.09  ? 87  CYS D SG  1 
ATOM   4077 N N   . TYR D 1 88  ? 21.624  -49.515 16.618 1.00 49.07  ? 88  TYR D N   1 
ATOM   4078 C CA  . TYR D 1 88  ? 22.277  -48.232 16.550 1.00 49.71  ? 88  TYR D CA  1 
ATOM   4079 C C   . TYR D 1 88  ? 22.203  -47.651 15.128 1.00 48.80  ? 88  TYR D C   1 
ATOM   4080 O O   . TYR D 1 88  ? 22.196  -46.437 14.955 1.00 49.75  ? 88  TYR D O   1 
ATOM   4081 C CB  . TYR D 1 88  ? 23.743  -48.337 17.014 1.00 51.77  ? 88  TYR D CB  1 
ATOM   4082 C CG  . TYR D 1 88  ? 23.973  -48.751 18.472 1.00 56.50  ? 88  TYR D CG  1 
ATOM   4083 C CD1 . TYR D 1 88  ? 22.909  -48.871 19.370 1.00 57.93  ? 88  TYR D CD1 1 
ATOM   4084 C CD2 . TYR D 1 88  ? 25.279  -48.997 18.955 1.00 60.76  ? 88  TYR D CD2 1 
ATOM   4085 C CE1 . TYR D 1 88  ? 23.117  -49.251 20.702 1.00 62.27  ? 88  TYR D CE1 1 
ATOM   4086 C CE2 . TYR D 1 88  ? 25.508  -49.376 20.299 1.00 63.99  ? 88  TYR D CE2 1 
ATOM   4087 C CZ  . TYR D 1 88  ? 24.406  -49.499 21.165 1.00 67.12  ? 88  TYR D CZ  1 
ATOM   4088 O OH  . TYR D 1 88  ? 24.570  -49.864 22.491 1.00 69.69  ? 88  TYR D OH  1 
ATOM   4089 N N   . TYR D 1 89  ? 22.111  -48.504 14.112 1.00 47.04  ? 89  TYR D N   1 
ATOM   4090 C CA  . TYR D 1 89  ? 22.324  -48.022 12.749 1.00 47.12  ? 89  TYR D CA  1 
ATOM   4091 C C   . TYR D 1 89  ? 21.111  -48.153 11.862 1.00 48.17  ? 89  TYR D C   1 
ATOM   4092 O O   . TYR D 1 89  ? 21.224  -48.462 10.684 1.00 48.19  ? 89  TYR D O   1 
ATOM   4093 C CB  . TYR D 1 89  ? 23.516  -48.753 12.116 1.00 46.36  ? 89  TYR D CB  1 
ATOM   4094 C CG  . TYR D 1 89  ? 24.713  -48.916 13.027 1.00 45.91  ? 89  TYR D CG  1 
ATOM   4095 C CD1 . TYR D 1 89  ? 24.808  -50.015 13.877 1.00 43.97  ? 89  TYR D CD1 1 
ATOM   4096 C CD2 . TYR D 1 89  ? 25.747  -47.975 13.040 1.00 45.29  ? 89  TYR D CD2 1 
ATOM   4097 C CE1 . TYR D 1 89  ? 25.886  -50.180 14.713 1.00 45.87  ? 89  TYR D CE1 1 
ATOM   4098 C CE2 . TYR D 1 89  ? 26.847  -48.131 13.880 1.00 47.67  ? 89  TYR D CE2 1 
ATOM   4099 C CZ  . TYR D 1 89  ? 26.905  -49.243 14.719 1.00 47.61  ? 89  TYR D CZ  1 
ATOM   4100 O OH  . TYR D 1 89  ? 27.972  -49.434 15.569 1.00 47.11  ? 89  TYR D OH  1 
ATOM   4101 N N   . HIS D 1 90  ? 19.944  -47.873 12.415 1.00 50.91  ? 90  HIS D N   1 
ATOM   4102 C CA  . HIS D 1 90  ? 18.714  -48.138 11.689 1.00 53.14  ? 90  HIS D CA  1 
ATOM   4103 C C   . HIS D 1 90  ? 17.922  -46.901 11.243 1.00 56.49  ? 90  HIS D C   1 
ATOM   4104 O O   . HIS D 1 90  ? 16.861  -47.035 10.625 1.00 55.89  ? 90  HIS D O   1 
ATOM   4105 C CB  . HIS D 1 90  ? 17.847  -49.111 12.511 1.00 52.47  ? 90  HIS D CB  1 
ATOM   4106 C CG  . HIS D 1 90  ? 17.401  -48.565 13.833 1.00 53.52  ? 90  HIS D CG  1 
ATOM   4107 N ND1 . HIS D 1 90  ? 18.227  -47.830 14.658 1.00 54.27  ? 90  HIS D ND1 1 
ATOM   4108 C CD2 . HIS D 1 90  ? 16.212  -48.652 14.475 1.00 52.73  ? 90  HIS D CD2 1 
ATOM   4109 C CE1 . HIS D 1 90  ? 17.563  -47.481 15.745 1.00 54.08  ? 90  HIS D CE1 1 
ATOM   4110 N NE2 . HIS D 1 90  ? 16.338  -47.966 15.658 1.00 53.03  ? 90  HIS D NE2 1 
ATOM   4111 N N   . LYS D 1 91  ? 18.438  -45.706 11.526 1.00 60.00  ? 91  LYS D N   1 
ATOM   4112 C CA  . LYS D 1 91  ? 17.694  -44.483 11.223 1.00 62.58  ? 91  LYS D CA  1 
ATOM   4113 C C   . LYS D 1 91  ? 18.117  -43.833 9.905  1.00 65.24  ? 91  LYS D C   1 
ATOM   4114 O O   . LYS D 1 91  ? 19.120  -44.225 9.310  1.00 63.20  ? 91  LYS D O   1 
ATOM   4115 C CB  . LYS D 1 91  ? 17.818  -43.446 12.349 1.00 62.32  ? 91  LYS D CB  1 
ATOM   4116 C CG  . LYS D 1 91  ? 17.842  -43.967 13.773 1.00 62.15  ? 91  LYS D CG  1 
ATOM   4117 C CD  . LYS D 1 91  ? 18.117  -42.787 14.704 1.00 61.28  ? 91  LYS D CD  1 
ATOM   4118 C CE  . LYS D 1 91  ? 18.887  -43.195 15.936 1.00 60.73  ? 91  LYS D CE  1 
ATOM   4119 N NZ  . LYS D 1 91  ? 19.257  -41.977 16.694 1.00 63.21  ? 91  LYS D NZ  1 
ATOM   4120 N N   . SER D 1 92  ? 17.326  -42.838 9.485  1.00 69.99  ? 92  SER D N   1 
ATOM   4121 C CA  . SER D 1 92  ? 17.513  -42.022 8.264  1.00 73.90  ? 92  SER D CA  1 
ATOM   4122 C C   . SER D 1 92  ? 18.358  -42.626 7.117  1.00 76.45  ? 92  SER D C   1 
ATOM   4123 O O   . SER D 1 92  ? 19.509  -42.213 6.874  1.00 77.95  ? 92  SER D O   1 
ATOM   4124 C CB  . SER D 1 92  ? 18.004  -40.608 8.627  1.00 74.71  ? 92  SER D CB  1 
ATOM   4125 O OG  . SER D 1 92  ? 16.907  -39.708 8.737  1.00 73.42  ? 92  SER D OG  1 
ATOM   4126 O OXT . SER D 1 92  ? 17.882  -43.522 6.397  1.00 77.48  ? 92  SER D OXT 1 
ATOM   4127 N N   . CYS E 2 3   ? 7.982   -58.972 8.813  1.00 75.64  ? 3   CYS E N   1 
ATOM   4128 C CA  . CYS E 2 3   ? 7.376   -57.630 8.595  1.00 75.72  ? 3   CYS E CA  1 
ATOM   4129 C C   . CYS E 2 3   ? 6.164   -57.767 7.699  1.00 75.94  ? 3   CYS E C   1 
ATOM   4130 O O   . CYS E 2 3   ? 6.234   -58.369 6.624  1.00 76.17  ? 3   CYS E O   1 
ATOM   4131 C CB  . CYS E 2 3   ? 8.388   -56.657 7.973  1.00 75.77  ? 3   CYS E CB  1 
ATOM   4132 S SG  . CYS E 2 3   ? 7.989   -54.895 8.196  1.00 74.24  ? 3   CYS E SG  1 
ATOM   4133 N N   . GLU E 2 4   ? 5.052   -57.205 8.162  1.00 76.53  ? 4   GLU E N   1 
ATOM   4134 C CA  . GLU E 2 4   ? 3.771   -57.283 7.470  1.00 77.04  ? 4   GLU E CA  1 
ATOM   4135 C C   . GLU E 2 4   ? 2.868   -56.133 7.918  1.00 76.06  ? 4   GLU E C   1 
ATOM   4136 O O   . GLU E 2 4   ? 3.150   -55.465 8.916  1.00 76.14  ? 4   GLU E O   1 
ATOM   4137 C CB  . GLU E 2 4   ? 3.090   -58.626 7.784  1.00 77.85  ? 4   GLU E CB  1 
ATOM   4138 C CG  . GLU E 2 4   ? 3.080   -58.992 9.266  1.00 80.76  ? 4   GLU E CG  1 
ATOM   4139 C CD  . GLU E 2 4   ? 1.905   -59.875 9.658  1.00 83.67  ? 4   GLU E CD  1 
ATOM   4140 O OE1 . GLU E 2 4   ? 1.548   -60.789 8.880  1.00 84.99  ? 4   GLU E OE1 1 
ATOM   4141 O OE2 . GLU E 2 4   ? 1.341   -59.658 10.753 1.00 85.28  ? 4   GLU E OE2 1 
ATOM   4142 N N   . LEU E 2 5   ? 1.799   -55.891 7.160  1.00 74.40  ? 5   LEU E N   1 
ATOM   4143 C CA  . LEU E 2 5   ? 0.762   -54.949 7.579  1.00 72.76  ? 5   LEU E CA  1 
ATOM   4144 C C   . LEU E 2 5   ? -0.174  -55.710 8.524  1.00 72.94  ? 5   LEU E C   1 
ATOM   4145 O O   . LEU E 2 5   ? -0.689  -56.774 8.168  1.00 73.59  ? 5   LEU E O   1 
ATOM   4146 C CB  . LEU E 2 5   ? -0.006  -54.395 6.368  1.00 71.10  ? 5   LEU E CB  1 
ATOM   4147 C CG  . LEU E 2 5   ? 0.638   -53.253 5.563  1.00 69.87  ? 5   LEU E CG  1 
ATOM   4148 C CD1 . LEU E 2 5   ? 0.243   -53.319 4.107  1.00 68.06  ? 5   LEU E CD1 1 
ATOM   4149 C CD2 . LEU E 2 5   ? 0.269   -51.902 6.138  1.00 68.45  ? 5   LEU E CD2 1 
ATOM   4150 N N   . THR E 2 6   ? -0.367  -55.180 9.732  1.00 72.79  ? 6   THR E N   1 
ATOM   4151 C CA  . THR E 2 6   ? -1.190  -55.844 10.751 1.00 72.97  ? 6   THR E CA  1 
ATOM   4152 C C   . THR E 2 6   ? -2.064  -54.889 11.577 1.00 73.47  ? 6   THR E C   1 
ATOM   4153 O O   . THR E 2 6   ? -1.669  -53.756 11.860 1.00 73.20  ? 6   THR E O   1 
ATOM   4154 C CB  . THR E 2 6   ? -0.318  -56.764 11.675 1.00 72.78  ? 6   THR E CB  1 
ATOM   4155 O OG1 . THR E 2 6   ? -0.668  -56.551 13.047 1.00 72.53  ? 6   THR E OG1 1 
ATOM   4156 C CG2 . THR E 2 6   ? 1.155   -56.374 11.625 1.00 72.40  ? 6   THR E CG2 1 
ATOM   4157 N N   . ASN E 2 7   ? -3.260  -55.362 11.939 1.00 74.31  ? 7   ASN E N   1 
ATOM   4158 C CA  . ASN E 2 7   ? -4.216  -54.601 12.754 1.00 75.04  ? 7   ASN E CA  1 
ATOM   4159 C C   . ASN E 2 7   ? -3.732  -54.444 14.194 1.00 73.89  ? 7   ASN E C   1 
ATOM   4160 O O   . ASN E 2 7   ? -3.184  -55.386 14.778 1.00 73.83  ? 7   ASN E O   1 
ATOM   4161 C CB  . ASN E 2 7   ? -5.595  -55.289 12.775 1.00 76.71  ? 7   ASN E CB  1 
ATOM   4162 C CG  . ASN E 2 7   ? -6.345  -55.190 11.446 1.00 79.93  ? 7   ASN E CG  1 
ATOM   4163 O OD1 . ASN E 2 7   ? -5.995  -54.391 10.566 1.00 80.34  ? 7   ASN E OD1 1 
ATOM   4164 N ND2 . ASN E 2 7   ? -7.406  -56.003 11.311 1.00 83.26  ? 7   ASN E ND2 1 
ATOM   4165 N N   . ILE E 2 8   ? -3.948  -53.258 14.763 1.00 72.39  ? 8   ILE E N   1 
ATOM   4166 C CA  . ILE E 2 8   ? -3.601  -52.976 16.160 1.00 71.17  ? 8   ILE E CA  1 
ATOM   4167 C C   . ILE E 2 8   ? -4.691  -52.143 16.834 1.00 71.34  ? 8   ILE E C   1 
ATOM   4168 O O   . ILE E 2 8   ? -5.707  -51.828 16.215 1.00 71.47  ? 8   ILE E O   1 
ATOM   4169 C CB  . ILE E 2 8   ? -2.227  -52.253 16.272 1.00 70.36  ? 8   ILE E CB  1 
ATOM   4170 C CG1 . ILE E 2 8   ? -2.082  -51.202 15.163 1.00 69.37  ? 8   ILE E CG1 1 
ATOM   4171 C CG2 . ILE E 2 8   ? -1.080  -53.274 16.262 1.00 68.97  ? 8   ILE E CG2 1 
ATOM   4172 C CD1 . ILE E 2 8   ? -1.269  -49.990 15.557 1.00 68.42  ? 8   ILE E CD1 1 
ATOM   4173 N N   . THR E 2 9   ? -4.471  -51.784 18.096 1.00 71.86  ? 9   THR E N   1 
ATOM   4174 C CA  . THR E 2 9   ? -5.450  -51.014 18.863 1.00 72.68  ? 9   THR E CA  1 
ATOM   4175 C C   . THR E 2 9   ? -4.848  -49.733 19.439 1.00 72.42  ? 9   THR E C   1 
ATOM   4176 O O   . THR E 2 9   ? -4.207  -49.769 20.491 1.00 72.88  ? 9   THR E O   1 
ATOM   4177 C CB  . THR E 2 9   ? -6.024  -51.867 20.019 1.00 73.26  ? 9   THR E CB  1 
ATOM   4178 O OG1 . THR E 2 9   ? -5.884  -53.263 19.718 1.00 74.33  ? 9   THR E OG1 1 
ATOM   4179 C CG2 . THR E 2 9   ? -7.523  -51.640 20.161 1.00 72.83  ? 9   THR E CG2 1 
ATOM   4180 N N   . ILE E 2 10  ? -5.047  -48.604 18.762 1.00 72.04  ? 10  ILE E N   1 
ATOM   4181 C CA  . ILE E 2 10  ? -4.498  -47.345 19.269 1.00 71.51  ? 10  ILE E CA  1 
ATOM   4182 C C   . ILE E 2 10  ? -5.491  -46.631 20.170 1.00 71.60  ? 10  ILE E C   1 
ATOM   4183 O O   . ILE E 2 10  ? -6.697  -46.665 19.933 1.00 72.51  ? 10  ILE E O   1 
ATOM   4184 C CB  . ILE E 2 10  ? -4.001  -46.384 18.130 1.00 71.03  ? 10  ILE E CB  1 
ATOM   4185 C CG1 . ILE E 2 10  ? -5.167  -45.663 17.438 1.00 69.94  ? 10  ILE E CG1 1 
ATOM   4186 C CG2 . ILE E 2 10  ? -3.124  -47.139 17.140 1.00 70.71  ? 10  ILE E CG2 1 
ATOM   4187 C CD1 . ILE E 2 10  ? -4.779  -44.356 16.746 1.00 68.61  ? 10  ILE E CD1 1 
ATOM   4188 N N   . ALA E 2 11  ? -4.968  -46.015 21.223 1.00 71.50  ? 11  ALA E N   1 
ATOM   4189 C CA  . ALA E 2 11  ? -5.764  -45.193 22.110 1.00 71.69  ? 11  ALA E CA  1 
ATOM   4190 C C   . ALA E 2 11  ? -5.462  -43.733 21.787 1.00 72.90  ? 11  ALA E C   1 
ATOM   4191 O O   . ALA E 2 11  ? -4.306  -43.312 21.820 1.00 73.76  ? 11  ALA E O   1 
ATOM   4192 C CB  . ALA E 2 11  ? -5.430  -45.503 23.558 1.00 70.41  ? 11  ALA E CB  1 
ATOM   4193 N N   . ILE E 2 12  ? -6.496  -42.972 21.438 1.00 75.09  ? 12  ILE E N   1 
ATOM   4194 C CA  . ILE E 2 12  ? -6.341  -41.541 21.185 1.00 76.68  ? 12  ILE E CA  1 
ATOM   4195 C C   . ILE E 2 12  ? -6.802  -40.784 22.436 1.00 78.88  ? 12  ILE E C   1 
ATOM   4196 O O   . ILE E 2 12  ? -7.641  -41.292 23.193 1.00 79.17  ? 12  ILE E O   1 
ATOM   4197 C CB  . ILE E 2 12  ? -7.133  -41.126 19.912 1.00 75.95  ? 12  ILE E CB  1 
ATOM   4198 C CG1 . ILE E 2 12  ? -6.292  -40.186 19.042 1.00 74.89  ? 12  ILE E CG1 1 
ATOM   4199 C CG2 . ILE E 2 12  ? -8.492  -40.512 20.266 1.00 75.69  ? 12  ILE E CG2 1 
ATOM   4200 C CD1 . ILE E 2 12  ? -6.694  -40.203 17.579 1.00 75.53  ? 12  ILE E CD1 1 
ATOM   4201 N N   . GLU E 2 13  ? -6.251  -39.591 22.675 1.00 81.12  ? 13  GLU E N   1 
ATOM   4202 C CA  . GLU E 2 13  ? -6.639  -38.831 23.867 1.00 82.86  ? 13  GLU E CA  1 
ATOM   4203 C C   . GLU E 2 13  ? -6.698  -37.311 23.690 1.00 83.74  ? 13  GLU E C   1 
ATOM   4204 O O   . GLU E 2 13  ? -5.952  -36.732 22.890 1.00 84.58  ? 13  GLU E O   1 
ATOM   4205 C CB  . GLU E 2 13  ? -5.728  -39.202 25.065 1.00 82.58  ? 13  GLU E CB  1 
ATOM   4206 C CG  . GLU E 2 13  ? -4.468  -38.332 25.225 1.00 83.57  ? 13  GLU E CG  1 
ATOM   4207 C CD  . GLU E 2 13  ? -3.788  -38.506 26.580 1.00 84.01  ? 13  GLU E CD  1 
ATOM   4208 O OE1 . GLU E 2 13  ? -3.939  -39.584 27.203 1.00 84.09  ? 13  GLU E OE1 1 
ATOM   4209 O OE2 . GLU E 2 13  ? -3.098  -37.561 27.024 1.00 83.30  ? 13  GLU E OE2 1 
ATOM   4210 N N   . LYS E 2 14  ? -7.625  -36.685 24.419 1.00 84.06  ? 14  LYS E N   1 
ATOM   4211 C CA  . LYS E 2 14  ? -7.632  -35.230 24.586 1.00 84.54  ? 14  LYS E CA  1 
ATOM   4212 C C   . LYS E 2 14  ? -7.591  -34.927 26.087 1.00 85.13  ? 14  LYS E C   1 
ATOM   4213 O O   . LYS E 2 14  ? -8.535  -35.211 26.830 1.00 84.87  ? 14  LYS E O   1 
ATOM   4214 C CB  . LYS E 2 14  ? -8.798  -34.552 23.858 1.00 83.91  ? 14  LYS E CB  1 
ATOM   4215 C CG  . LYS E 2 14  ? -10.180 -34.705 24.461 1.00 83.53  ? 14  LYS E CG  1 
ATOM   4216 C CD  . LYS E 2 14  ? -11.210 -34.159 23.486 1.00 84.33  ? 14  LYS E CD  1 
ATOM   4217 C CE  . LYS E 2 14  ? -12.451 -33.649 24.174 1.00 84.32  ? 14  LYS E CE  1 
ATOM   4218 N NZ  . LYS E 2 14  ? -12.234 -32.333 24.831 1.00 84.90  ? 14  LYS E NZ  1 
ATOM   4219 N N   . GLU E 2 15  ? -6.458  -34.363 26.502 1.00 86.19  ? 15  GLU E N   1 
ATOM   4220 C CA  . GLU E 2 15  ? -6.078  -34.175 27.903 1.00 86.87  ? 15  GLU E CA  1 
ATOM   4221 C C   . GLU E 2 15  ? -7.190  -33.677 28.824 1.00 86.51  ? 15  GLU E C   1 
ATOM   4222 O O   . GLU E 2 15  ? -7.346  -34.158 29.949 1.00 86.14  ? 15  GLU E O   1 
ATOM   4223 C CB  . GLU E 2 15  ? -4.880  -33.219 27.958 1.00 87.64  ? 15  GLU E CB  1 
ATOM   4224 C CG  . GLU E 2 15  ? -4.215  -33.091 29.317 1.00 90.52  ? 15  GLU E CG  1 
ATOM   4225 C CD  . GLU E 2 15  ? -3.637  -31.706 29.550 1.00 91.80  ? 15  GLU E CD  1 
ATOM   4226 O OE1 . GLU E 2 15  ? -4.406  -30.720 29.476 1.00 92.61  ? 15  GLU E OE1 1 
ATOM   4227 O OE2 . GLU E 2 15  ? -2.418  -31.603 29.814 1.00 92.32  ? 15  GLU E OE2 1 
ATOM   4228 N N   . GLU E 2 16  ? -7.966  -32.725 28.319 1.00 86.10  ? 16  GLU E N   1 
ATOM   4229 C CA  . GLU E 2 16  ? -8.987  -32.015 29.089 1.00 86.38  ? 16  GLU E CA  1 
ATOM   4230 C C   . GLU E 2 16  ? -10.180 -32.845 29.569 1.00 84.94  ? 16  GLU E C   1 
ATOM   4231 O O   . GLU E 2 16  ? -11.057 -32.320 30.256 1.00 84.77  ? 16  GLU E O   1 
ATOM   4232 C CB  . GLU E 2 16  ? -9.495  -30.824 28.259 1.00 87.90  ? 16  GLU E CB  1 
ATOM   4233 C CG  . GLU E 2 16  ? -10.144 -31.238 26.937 1.00 90.61  ? 16  GLU E CG  1 
ATOM   4234 C CD  . GLU E 2 16  ? -9.581  -30.484 25.736 1.00 92.28  ? 16  GLU E CD  1 
ATOM   4235 O OE1 . GLU E 2 16  ? -8.337  -30.269 25.665 1.00 92.72  ? 16  GLU E OE1 1 
ATOM   4236 O OE2 . GLU E 2 16  ? -10.385 -30.125 24.846 1.00 93.62  ? 16  GLU E OE2 1 
ATOM   4237 N N   . CYS E 2 17  ? -10.203 -34.131 29.227 1.00 83.87  ? 17  CYS E N   1 
ATOM   4238 C CA  . CYS E 2 17  ? -11.384 -34.960 29.474 1.00 83.00  ? 17  CYS E CA  1 
ATOM   4239 C C   . CYS E 2 17  ? -11.191 -36.185 30.364 1.00 81.14  ? 17  CYS E C   1 
ATOM   4240 O O   . CYS E 2 17  ? -12.175 -36.770 30.819 1.00 80.64  ? 17  CYS E O   1 
ATOM   4241 C CB  . CYS E 2 17  ? -12.017 -35.375 28.144 1.00 84.90  ? 17  CYS E CB  1 
ATOM   4242 S SG  . CYS E 2 17  ? -12.981 -34.073 27.330 1.00 88.96  ? 17  CYS E SG  1 
ATOM   4243 N N   . ARG E 2 18  ? -9.939  -36.571 30.607 1.00 78.69  ? 18  ARG E N   1 
ATOM   4244 C CA  . ARG E 2 18  ? -9.620  -37.676 31.519 1.00 76.77  ? 18  ARG E CA  1 
ATOM   4245 C C   . ARG E 2 18  ? -9.946  -39.060 30.963 1.00 75.95  ? 18  ARG E C   1 
ATOM   4246 O O   . ARG E 2 18  ? -10.244 -39.978 31.731 1.00 75.96  ? 18  ARG E O   1 
ATOM   4247 C CB  . ARG E 2 18  ? -10.327 -37.493 32.875 1.00 76.54  ? 18  ARG E CB  1 
ATOM   4248 C CG  . ARG E 2 18  ? -9.704  -36.460 33.787 1.00 75.40  ? 18  ARG E CG  1 
ATOM   4249 C CD  . ARG E 2 18  ? -8.916  -37.066 34.922 1.00 75.15  ? 18  ARG E CD  1 
ATOM   4250 N NE  . ARG E 2 18  ? -7.708  -36.294 35.179 1.00 76.92  ? 18  ARG E NE  1 
ATOM   4251 C CZ  . ARG E 2 18  ? -6.843  -36.552 36.150 1.00 77.65  ? 18  ARG E CZ  1 
ATOM   4252 N NH1 . ARG E 2 18  ? -7.052  -37.570 36.981 1.00 77.52  ? 18  ARG E NH1 1 
ATOM   4253 N NH2 . ARG E 2 18  ? -5.764  -35.790 36.291 1.00 78.09  ? 18  ARG E NH2 1 
ATOM   4254 N N   . PHE E 2 19  ? -9.890  -39.218 29.640 1.00 74.98  ? 19  PHE E N   1 
ATOM   4255 C CA  . PHE E 2 19  ? -10.125 -40.526 29.017 1.00 74.58  ? 19  PHE E CA  1 
ATOM   4256 C C   . PHE E 2 19  ? -9.467  -40.726 27.641 1.00 74.85  ? 19  PHE E C   1 
ATOM   4257 O O   . PHE E 2 19  ? -9.134  -39.756 26.951 1.00 73.79  ? 19  PHE E O   1 
ATOM   4258 C CB  . PHE E 2 19  ? -11.639 -40.846 28.937 1.00 74.37  ? 19  PHE E CB  1 
ATOM   4259 C CG  . PHE E 2 19  ? -12.446 -39.888 28.073 1.00 74.53  ? 19  PHE E CG  1 
ATOM   4260 C CD1 . PHE E 2 19  ? -12.393 -39.949 26.678 1.00 74.72  ? 19  PHE E CD1 1 
ATOM   4261 C CD2 . PHE E 2 19  ? -13.290 -38.950 28.659 1.00 74.02  ? 19  PHE E CD2 1 
ATOM   4262 C CE1 . PHE E 2 19  ? -13.148 -39.074 25.884 1.00 73.36  ? 19  PHE E CE1 1 
ATOM   4263 C CE2 . PHE E 2 19  ? -14.047 -38.077 27.872 1.00 73.70  ? 19  PHE E CE2 1 
ATOM   4264 C CZ  . PHE E 2 19  ? -13.971 -38.141 26.484 1.00 72.88  ? 19  PHE E CZ  1 
ATOM   4265 N N   . CYS E 2 20  ? -9.266  -41.994 27.271 1.00 75.38  ? 20  CYS E N   1 
ATOM   4266 C CA  . CYS E 2 20  ? -8.885  -42.360 25.903 1.00 76.11  ? 20  CYS E CA  1 
ATOM   4267 C C   . CYS E 2 20  ? -9.838  -43.405 25.320 1.00 75.59  ? 20  CYS E C   1 
ATOM   4268 O O   . CYS E 2 20  ? -10.352 -44.280 26.034 1.00 74.69  ? 20  CYS E O   1 
ATOM   4269 C CB  . CYS E 2 20  ? -7.449  -42.891 25.783 1.00 76.91  ? 20  CYS E CB  1 
ATOM   4270 S SG  . CYS E 2 20  ? -6.281  -42.426 27.075 1.00 79.60  ? 20  CYS E SG  1 
ATOM   4271 N N   . ILE E 2 21  ? -10.047 -43.301 24.009 1.00 74.90  ? 21  ILE E N   1 
ATOM   4272 C CA  . ILE E 2 21  ? -10.892 -44.221 23.265 1.00 73.54  ? 21  ILE E CA  1 
ATOM   4273 C C   . ILE E 2 21  ? -10.034 -45.170 22.442 1.00 72.34  ? 21  ILE E C   1 
ATOM   4274 O O   . ILE E 2 21  ? -9.095  -44.746 21.766 1.00 71.46  ? 21  ILE E O   1 
ATOM   4275 C CB  . ILE E 2 21  ? -11.882 -43.452 22.330 1.00 73.70  ? 21  ILE E CB  1 
ATOM   4276 C CG1 . ILE E 2 21  ? -11.126 -42.666 21.244 1.00 73.80  ? 21  ILE E CG1 1 
ATOM   4277 C CG2 . ILE E 2 21  ? -12.772 -42.525 23.157 1.00 73.70  ? 21  ILE E CG2 1 
ATOM   4278 C CD1 . ILE E 2 21  ? -12.013 -42.039 20.170 1.00 73.36  ? 21  ILE E CD1 1 
ATOM   4279 N N   . SER E 2 22  ? -10.351 -46.456 22.527 1.00 70.75  ? 22  SER E N   1 
ATOM   4280 C CA  . SER E 2 22  ? -9.696  -47.446 21.693 1.00 69.84  ? 22  SER E CA  1 
ATOM   4281 C C   . SER E 2 22  ? -10.140 -47.225 20.249 1.00 69.45  ? 22  SER E C   1 
ATOM   4282 O O   . SER E 2 22  ? -11.292 -46.862 20.007 1.00 69.53  ? 22  SER E O   1 
ATOM   4283 C CB  . SER E 2 22  ? -10.082 -48.857 22.143 1.00 69.52  ? 22  SER E CB  1 
ATOM   4284 O OG  . SER E 2 22  ? -9.757  -49.062 23.510 1.00 69.51  ? 22  SER E OG  1 
ATOM   4285 N N   . ILE E 2 23  ? -9.209  -47.397 19.311 1.00 68.82  ? 23  ILE E N   1 
ATOM   4286 C CA  . ILE E 2 23  ? -9.509  -47.388 17.870 1.00 68.54  ? 23  ILE E CA  1 
ATOM   4287 C C   . ILE E 2 23  ? -8.826  -48.595 17.220 1.00 69.42  ? 23  ILE E C   1 
ATOM   4288 O O   . ILE E 2 23  ? -7.848  -49.126 17.760 1.00 69.98  ? 23  ILE E O   1 
ATOM   4289 C CB  . ILE E 2 23  ? -9.060  -46.053 17.174 1.00 67.59  ? 23  ILE E CB  1 
ATOM   4290 C CG1 . ILE E 2 23  ? -10.006 -44.907 17.538 1.00 67.18  ? 23  ILE E CG1 1 
ATOM   4291 C CG2 . ILE E 2 23  ? -9.024  -46.194 15.649 1.00 65.70  ? 23  ILE E CG2 1 
ATOM   4292 C CD1 . ILE E 2 23  ? -9.623  -43.577 16.916 1.00 67.14  ? 23  ILE E CD1 1 
ATOM   4293 N N   . ASN E 2 24  ? -9.365  -49.033 16.079 1.00 69.82  ? 24  ASN E N   1 
ATOM   4294 C CA  . ASN E 2 24  ? -8.764  -50.103 15.278 1.00 69.71  ? 24  ASN E CA  1 
ATOM   4295 C C   . ASN E 2 24  ? -8.192  -49.598 13.944 1.00 69.09  ? 24  ASN E C   1 
ATOM   4296 O O   . ASN E 2 24  ? -8.866  -48.901 13.181 1.00 67.94  ? 24  ASN E O   1 
ATOM   4297 C CB  . ASN E 2 24  ? -9.754  -51.252 15.073 1.00 70.35  ? 24  ASN E CB  1 
ATOM   4298 C CG  . ASN E 2 24  ? -9.769  -52.219 16.250 1.00 71.33  ? 24  ASN E CG  1 
ATOM   4299 O OD1 . ASN E 2 24  ? -9.308  -51.889 17.349 1.00 70.46  ? 24  ASN E OD1 1 
ATOM   4300 N ND2 . ASN E 2 24  ? -10.296 -53.421 16.021 1.00 72.64  ? 24  ASN E ND2 1 
ATOM   4301 N N   . THR E 2 25  ? -6.933  -49.959 13.690 1.00 69.39  ? 25  THR E N   1 
ATOM   4302 C CA  . THR E 2 25  ? -6.169  -49.473 12.538 1.00 68.61  ? 25  THR E CA  1 
ATOM   4303 C C   . THR E 2 25  ? -5.076  -50.469 12.146 1.00 67.67  ? 25  THR E C   1 
ATOM   4304 O O   . THR E 2 25  ? -4.669  -51.313 12.949 1.00 66.12  ? 25  THR E O   1 
ATOM   4305 C CB  . THR E 2 25  ? -5.569  -48.063 12.857 1.00 69.03  ? 25  THR E CB  1 
ATOM   4306 O OG1 . THR E 2 25  ? -6.626  -47.097 12.889 1.00 70.07  ? 25  THR E OG1 1 
ATOM   4307 C CG2 . THR E 2 25  ? -4.663  -47.559 11.741 1.00 68.30  ? 25  THR E CG2 1 
ATOM   4308 N N   . THR E 2 26  ? -4.619  -50.362 10.900 1.00 67.82  ? 26  THR E N   1 
ATOM   4309 C CA  . THR E 2 26  ? -3.586  -51.237 10.344 1.00 68.05  ? 26  THR E CA  1 
ATOM   4310 C C   . THR E 2 26  ? -2.192  -50.589 10.320 1.00 67.31  ? 26  THR E C   1 
ATOM   4311 O O   . THR E 2 26  ? -2.021  -49.451 9.856  1.00 66.84  ? 26  THR E O   1 
ATOM   4312 C CB  . THR E 2 26  ? -3.991  -51.724 8.928  1.00 68.80  ? 26  THR E CB  1 
ATOM   4313 O OG1 . THR E 2 26  ? -2.817  -52.158 8.220  1.00 70.39  ? 26  THR E OG1 1 
ATOM   4314 C CG2 . THR E 2 26  ? -4.546  -50.570 8.073  1.00 68.25  ? 26  THR E CG2 1 
ATOM   4315 N N   . TRP E 2 27  ? -1.206  -51.344 10.811 1.00 66.40  ? 27  TRP E N   1 
ATOM   4316 C CA  . TRP E 2 27  ? 0.172   -50.867 10.987 1.00 64.79  ? 27  TRP E CA  1 
ATOM   4317 C C   . TRP E 2 27  ? 1.217   -51.971 10.889 1.00 64.76  ? 27  TRP E C   1 
ATOM   4318 O O   . TRP E 2 27  ? 0.872   -53.152 10.834 1.00 65.28  ? 27  TRP E O   1 
ATOM   4319 C CB  . TRP E 2 27  ? 0.314   -50.153 12.338 1.00 63.20  ? 27  TRP E CB  1 
ATOM   4320 C CG  . TRP E 2 27  ? 0.188   -48.699 12.190 1.00 60.25  ? 27  TRP E CG  1 
ATOM   4321 C CD1 . TRP E 2 27  ? -0.913  -47.937 12.440 1.00 59.66  ? 27  TRP E CD1 1 
ATOM   4322 C CD2 . TRP E 2 27  ? 1.191   -47.813 11.705 1.00 58.44  ? 27  TRP E CD2 1 
ATOM   4323 N NE1 . TRP E 2 27  ? -0.653  -46.621 12.146 1.00 59.58  ? 27  TRP E NE1 1 
ATOM   4324 C CE2 . TRP E 2 27  ? 0.635   -46.519 11.687 1.00 57.92  ? 27  TRP E CE2 1 
ATOM   4325 C CE3 . TRP E 2 27  ? 2.513   -47.983 11.272 1.00 57.92  ? 27  TRP E CE3 1 
ATOM   4326 C CZ2 . TRP E 2 27  ? 1.354   -45.401 11.271 1.00 56.45  ? 27  TRP E CZ2 1 
ATOM   4327 C CZ3 . TRP E 2 27  ? 3.226   -46.875 10.860 1.00 57.80  ? 27  TRP E CZ3 1 
ATOM   4328 C CH2 . TRP E 2 27  ? 2.642   -45.600 10.857 1.00 57.52  ? 27  TRP E CH2 1 
ATOM   4329 N N   . CYS E 2 28  ? 2.490   -51.568 10.888 1.00 64.15  ? 28  CYS E N   1 
ATOM   4330 C CA  . CYS E 2 28  ? 3.623   -52.493 10.778 1.00 62.95  ? 28  CYS E CA  1 
ATOM   4331 C C   . CYS E 2 28  ? 3.899   -53.262 12.067 1.00 61.36  ? 28  CYS E C   1 
ATOM   4332 O O   . CYS E 2 28  ? 3.754   -52.724 13.166 1.00 61.71  ? 28  CYS E O   1 
ATOM   4333 C CB  . CYS E 2 28  ? 4.896   -51.732 10.390 1.00 64.59  ? 28  CYS E CB  1 
ATOM   4334 S SG  . CYS E 2 28  ? 4.758   -50.695 8.913  1.00 69.15  ? 28  CYS E SG  1 
ATOM   4335 N N   . ALA E 2 29  ? 4.291   -54.526 11.910 1.00 58.64  ? 29  ALA E N   1 
ATOM   4336 C CA  . ALA E 2 29  ? 4.788   -55.370 12.998 1.00 56.67  ? 29  ALA E CA  1 
ATOM   4337 C C   . ALA E 2 29  ? 5.239   -56.679 12.384 1.00 57.09  ? 29  ALA E C   1 
ATOM   4338 O O   . ALA E 2 29  ? 4.634   -57.150 11.421 1.00 58.50  ? 29  ALA E O   1 
ATOM   4339 C CB  . ALA E 2 29  ? 3.737   -55.610 14.049 1.00 55.02  ? 29  ALA E CB  1 
ATOM   4340 N N   . GLY E 2 30  ? 6.295   -57.265 12.938 1.00 56.61  ? 30  GLY E N   1 
ATOM   4341 C CA  . GLY E 2 30  ? 6.862   -58.487 12.378 1.00 56.34  ? 30  GLY E CA  1 
ATOM   4342 C C   . GLY E 2 30  ? 8.377   -58.480 12.409 1.00 55.60  ? 30  GLY E C   1 
ATOM   4343 O O   . GLY E 2 30  ? 8.976   -57.659 13.097 1.00 55.97  ? 30  GLY E O   1 
ATOM   4344 N N   . TYR E 2 31  ? 8.992   -59.372 11.638 1.00 54.92  ? 31  TYR E N   1 
ATOM   4345 C CA  . TYR E 2 31  ? 10.439  -59.599 11.718 1.00 55.34  ? 31  TYR E CA  1 
ATOM   4346 C C   . TYR E 2 31  ? 11.240  -59.066 10.541 1.00 56.03  ? 31  TYR E C   1 
ATOM   4347 O O   . TYR E 2 31  ? 10.742  -59.024 9.420  1.00 57.76  ? 31  TYR E O   1 
ATOM   4348 C CB  . TYR E 2 31  ? 10.719  -61.099 11.897 1.00 54.26  ? 31  TYR E CB  1 
ATOM   4349 C CG  . TYR E 2 31  ? 10.286  -61.636 13.249 1.00 55.06  ? 31  TYR E CG  1 
ATOM   4350 C CD1 . TYR E 2 31  ? 8.956   -61.972 13.498 1.00 53.84  ? 31  TYR E CD1 1 
ATOM   4351 C CD2 . TYR E 2 31  ? 11.207  -61.797 14.283 1.00 54.37  ? 31  TYR E CD2 1 
ATOM   4352 C CE1 . TYR E 2 31  ? 8.560   -62.456 14.737 1.00 52.92  ? 31  TYR E CE1 1 
ATOM   4353 C CE2 . TYR E 2 31  ? 10.819  -62.285 15.524 1.00 52.49  ? 31  TYR E CE2 1 
ATOM   4354 C CZ  . TYR E 2 31  ? 9.496   -62.607 15.742 1.00 52.43  ? 31  TYR E CZ  1 
ATOM   4355 O OH  . TYR E 2 31  ? 9.107   -63.083 16.966 1.00 52.92  ? 31  TYR E OH  1 
ATOM   4356 N N   . CYS E 2 32  ? 12.483  -58.657 10.810 1.00 55.72  ? 32  CYS E N   1 
ATOM   4357 C CA  . CYS E 2 32  ? 13.408  -58.190 9.770  1.00 55.04  ? 32  CYS E CA  1 
ATOM   4358 C C   . CYS E 2 32  ? 14.789  -58.818 9.953  1.00 53.16  ? 32  CYS E C   1 
ATOM   4359 O O   . CYS E 2 32  ? 15.158  -59.172 11.071 1.00 52.22  ? 32  CYS E O   1 
ATOM   4360 C CB  . CYS E 2 32  ? 13.520  -56.663 9.784  1.00 56.55  ? 32  CYS E CB  1 
ATOM   4361 S SG  . CYS E 2 32  ? 12.096  -55.802 9.066  1.00 61.32  ? 32  CYS E SG  1 
ATOM   4362 N N   . TYR E 2 33  ? 15.540  -58.956 8.858  1.00 52.04  ? 33  TYR E N   1 
ATOM   4363 C CA  . TYR E 2 33  ? 16.876  -59.561 8.894  1.00 49.78  ? 33  TYR E CA  1 
ATOM   4364 C C   . TYR E 2 33  ? 18.001  -58.539 9.114  1.00 49.12  ? 33  TYR E C   1 
ATOM   4365 O O   . TYR E 2 33  ? 18.070  -57.522 8.430  1.00 48.43  ? 33  TYR E O   1 
ATOM   4366 C CB  . TYR E 2 33  ? 17.147  -60.364 7.610  1.00 49.35  ? 33  TYR E CB  1 
ATOM   4367 C CG  . TYR E 2 33  ? 18.362  -61.278 7.711  1.00 51.08  ? 33  TYR E CG  1 
ATOM   4368 C CD1 . TYR E 2 33  ? 18.240  -62.581 8.201  1.00 51.33  ? 33  TYR E CD1 1 
ATOM   4369 C CD2 . TYR E 2 33  ? 19.629  -60.838 7.320  1.00 50.14  ? 33  TYR E CD2 1 
ATOM   4370 C CE1 . TYR E 2 33  ? 19.340  -63.420 8.297  1.00 52.44  ? 33  TYR E CE1 1 
ATOM   4371 C CE2 . TYR E 2 33  ? 20.735  -61.664 7.416  1.00 51.76  ? 33  TYR E CE2 1 
ATOM   4372 C CZ  . TYR E 2 33  ? 20.588  -62.953 7.906  1.00 54.10  ? 33  TYR E CZ  1 
ATOM   4373 O OH  . TYR E 2 33  ? 21.688  -63.779 8.006  1.00 55.56  ? 33  TYR E OH  1 
ATOM   4374 N N   . THR E 2 34  ? 18.879  -58.813 10.077 1.00 47.65  ? 34  THR E N   1 
ATOM   4375 C CA  . THR E 2 34  ? 20.031  -57.952 10.327 1.00 46.93  ? 34  THR E CA  1 
ATOM   4376 C C   . THR E 2 34  ? 21.248  -58.793 10.701 1.00 48.01  ? 34  THR E C   1 
ATOM   4377 O O   . THR E 2 34  ? 21.110  -59.860 11.307 1.00 46.89  ? 34  THR E O   1 
ATOM   4378 C CB  . THR E 2 34  ? 19.744  -56.944 11.457 1.00 45.66  ? 34  THR E CB  1 
ATOM   4379 O OG1 . THR E 2 34  ? 19.901  -57.585 12.718 1.00 42.41  ? 34  THR E OG1 1 
ATOM   4380 C CG2 . THR E 2 34  ? 18.290  -56.520 11.459 1.00 45.11  ? 34  THR E CG2 1 
ATOM   4381 N N   . ARG E 2 35  ? 22.433  -58.320 10.329 1.00 47.51  ? 35  ARG E N   1 
ATOM   4382 C CA  . ARG E 2 35  ? 23.664  -58.986 10.734 1.00 49.39  ? 35  ARG E CA  1 
ATOM   4383 C C   . ARG E 2 35  ? 24.615  -58.019 11.408 1.00 49.47  ? 35  ARG E C   1 
ATOM   4384 O O   . ARG E 2 35  ? 24.644  -56.842 11.075 1.00 51.91  ? 35  ARG E O   1 
ATOM   4385 C CB  . ARG E 2 35  ? 24.352  -59.667 9.549  1.00 53.46  ? 35  ARG E CB  1 
ATOM   4386 C CG  . ARG E 2 35  ? 24.655  -58.800 8.328  1.00 59.84  ? 35  ARG E CG  1 
ATOM   4387 C CD  . ARG E 2 35  ? 24.662  -59.609 7.016  1.00 65.02  ? 35  ARG E CD  1 
ATOM   4388 N NE  . ARG E 2 35  ? 24.781  -58.762 5.829  1.00 71.52  ? 35  ARG E NE  1 
ATOM   4389 C CZ  . ARG E 2 35  ? 25.860  -58.718 5.037  1.00 75.31  ? 35  ARG E CZ  1 
ATOM   4390 N NH1 . ARG E 2 35  ? 26.929  -59.483 5.296  1.00 76.91  ? 35  ARG E NH1 1 
ATOM   4391 N NH2 . ARG E 2 35  ? 25.872  -57.908 3.980  1.00 74.82  ? 35  ARG E NH2 1 
ATOM   4392 N N   . ASP E 2 36  ? 25.377  -58.515 12.373 1.00 48.36  ? 36  ASP E N   1 
ATOM   4393 C CA  . ASP E 2 36  ? 26.372  -57.702 13.054 1.00 48.16  ? 36  ASP E CA  1 
ATOM   4394 C C   . ASP E 2 36  ? 27.677  -58.009 12.387 1.00 47.87  ? 36  ASP E C   1 
ATOM   4395 O O   . ASP E 2 36  ? 28.099  -59.148 12.376 1.00 51.04  ? 36  ASP E O   1 
ATOM   4396 C CB  . ASP E 2 36  ? 26.461  -58.082 14.527 1.00 48.31  ? 36  ASP E CB  1 
ATOM   4397 C CG  . ASP E 2 36  ? 27.116  -57.007 15.381 1.00 49.62  ? 36  ASP E CG  1 
ATOM   4398 O OD1 . ASP E 2 36  ? 27.191  -55.822 14.970 1.00 49.62  ? 36  ASP E OD1 1 
ATOM   4399 O OD2 . ASP E 2 36  ? 27.558  -57.285 16.513 1.00 52.58  ? 36  ASP E OD2 1 
ATOM   4400 N N   . LEU E 2 37  ? 28.318  -57.007 11.811 1.00 48.77  ? 37  LEU E N   1 
ATOM   4401 C CA  . LEU E 2 37  ? 29.546  -57.264 11.090 1.00 48.61  ? 37  LEU E CA  1 
ATOM   4402 C C   . LEU E 2 37  ? 30.679  -57.621 12.026 1.00 47.56  ? 37  LEU E C   1 
ATOM   4403 O O   . LEU E 2 37  ? 30.856  -57.024 13.089 1.00 47.73  ? 37  LEU E O   1 
ATOM   4404 C CB  . LEU E 2 37  ? 29.917  -56.084 10.200 1.00 51.75  ? 37  LEU E CB  1 
ATOM   4405 C CG  . LEU E 2 37  ? 28.901  -55.809 9.090  1.00 54.46  ? 37  LEU E CG  1 
ATOM   4406 C CD1 . LEU E 2 37  ? 29.324  -54.570 8.285  1.00 57.58  ? 37  LEU E CD1 1 
ATOM   4407 C CD2 . LEU E 2 37  ? 28.690  -57.050 8.185  1.00 52.05  ? 37  LEU E CD2 1 
ATOM   4408 N N   . VAL E 2 38  ? 31.429  -58.626 11.606 1.00 46.64  ? 38  VAL E N   1 
ATOM   4409 C CA  . VAL E 2 38  ? 32.534  -59.160 12.361 1.00 46.49  ? 38  VAL E CA  1 
ATOM   4410 C C   . VAL E 2 38  ? 33.751  -58.266 12.183 1.00 47.45  ? 38  VAL E C   1 
ATOM   4411 O O   . VAL E 2 38  ? 34.673  -58.268 13.001 1.00 46.29  ? 38  VAL E O   1 
ATOM   4412 C CB  . VAL E 2 38  ? 32.786  -60.599 11.910 1.00 45.78  ? 38  VAL E CB  1 
ATOM   4413 C CG1 . VAL E 2 38  ? 34.255  -60.875 11.706 1.00 47.38  ? 38  VAL E CG1 1 
ATOM   4414 C CG2 . VAL E 2 38  ? 32.178  -61.545 12.907 1.00 44.64  ? 38  VAL E CG2 1 
ATOM   4415 N N   . TYR E 2 39  ? 33.713  -57.481 11.117 1.00 49.60  ? 39  TYR E N   1 
ATOM   4416 C CA  . TYR E 2 39  ? 34.764  -56.550 10.777 1.00 54.11  ? 39  TYR E CA  1 
ATOM   4417 C C   . TYR E 2 39  ? 34.096  -55.277 10.330 1.00 56.92  ? 39  TYR E C   1 
ATOM   4418 O O   . TYR E 2 39  ? 33.478  -55.235 9.265  1.00 59.76  ? 39  TYR E O   1 
ATOM   4419 C CB  . TYR E 2 39  ? 35.598  -57.112 9.623  1.00 55.60  ? 39  TYR E CB  1 
ATOM   4420 C CG  . TYR E 2 39  ? 36.467  -56.099 8.904  1.00 58.88  ? 39  TYR E CG  1 
ATOM   4421 C CD1 . TYR E 2 39  ? 37.606  -55.554 9.528  1.00 61.51  ? 39  TYR E CD1 1 
ATOM   4422 C CD2 . TYR E 2 39  ? 36.167  -55.692 7.594  1.00 57.49  ? 39  TYR E CD2 1 
ATOM   4423 C CE1 . TYR E 2 39  ? 38.419  -54.624 8.873  1.00 60.41  ? 39  TYR E CE1 1 
ATOM   4424 C CE2 . TYR E 2 39  ? 36.975  -54.761 6.930  1.00 59.71  ? 39  TYR E CE2 1 
ATOM   4425 C CZ  . TYR E 2 39  ? 38.095  -54.233 7.581  1.00 61.07  ? 39  TYR E CZ  1 
ATOM   4426 O OH  . TYR E 2 39  ? 38.895  -53.320 6.950  1.00 62.14  ? 39  TYR E OH  1 
ATOM   4427 N N   . LYS E 2 40  ? 34.179  -54.234 11.138 1.00 59.70  ? 40  LYS E N   1 
ATOM   4428 C CA  . LYS E 2 40  ? 33.656  -52.974 10.658 1.00 64.13  ? 40  LYS E CA  1 
ATOM   4429 C C   . LYS E 2 40  ? 34.742  -52.183 9.941  1.00 65.47  ? 40  LYS E C   1 
ATOM   4430 O O   . LYS E 2 40  ? 35.770  -51.825 10.516 1.00 64.84  ? 40  LYS E O   1 
ATOM   4431 C CB  . LYS E 2 40  ? 32.956  -52.159 11.762 1.00 65.02  ? 40  LYS E CB  1 
ATOM   4432 C CG  . LYS E 2 40  ? 31.410  -52.240 11.703 1.00 64.36  ? 40  LYS E CG  1 
ATOM   4433 C CD  . LYS E 2 40  ? 30.851  -53.517 12.343 1.00 61.91  ? 40  LYS E CD  1 
ATOM   4434 C CE  . LYS E 2 40  ? 30.545  -53.323 13.824 1.00 60.63  ? 40  LYS E CE  1 
ATOM   4435 N NZ  . LYS E 2 40  ? 30.209  -54.614 14.475 1.00 60.92  ? 40  LYS E NZ  1 
ATOM   4436 N N   . ASP E 2 41  ? 34.502  -51.964 8.653  1.00 68.47  ? 41  ASP E N   1 
ATOM   4437 C CA  . ASP E 2 41  ? 35.349  -51.130 7.825  1.00 70.06  ? 41  ASP E CA  1 
ATOM   4438 C C   . ASP E 2 41  ? 34.748  -49.725 7.833  1.00 70.56  ? 41  ASP E C   1 
ATOM   4439 O O   . ASP E 2 41  ? 33.645  -49.515 7.310  1.00 68.52  ? 41  ASP E O   1 
ATOM   4440 C CB  . ASP E 2 41  ? 35.400  -51.676 6.397  1.00 70.53  ? 41  ASP E CB  1 
ATOM   4441 C CG  . ASP E 2 41  ? 36.285  -50.851 5.493  1.00 71.68  ? 41  ASP E CG  1 
ATOM   4442 O OD1 . ASP E 2 41  ? 37.518  -50.876 5.675  1.00 72.13  ? 41  ASP E OD1 1 
ATOM   4443 O OD2 . ASP E 2 41  ? 35.817  -50.148 4.575  1.00 73.58  ? 41  ASP E OD2 1 
ATOM   4444 N N   . PRO E 2 42  ? 35.463  -48.772 8.449  1.00 71.10  ? 42  PRO E N   1 
ATOM   4445 C CA  . PRO E 2 42  ? 35.026  -47.377 8.544  1.00 71.75  ? 42  PRO E CA  1 
ATOM   4446 C C   . PRO E 2 42  ? 34.434  -46.840 7.245  1.00 73.21  ? 42  PRO E C   1 
ATOM   4447 O O   . PRO E 2 42  ? 33.359  -46.250 7.267  1.00 73.08  ? 42  PRO E O   1 
ATOM   4448 C CB  . PRO E 2 42  ? 36.312  -46.639 8.891  1.00 69.61  ? 42  PRO E CB  1 
ATOM   4449 C CG  . PRO E 2 42  ? 37.063  -47.617 9.700  1.00 70.11  ? 42  PRO E CG  1 
ATOM   4450 C CD  . PRO E 2 42  ? 36.769  -48.970 9.107  1.00 69.71  ? 42  PRO E CD  1 
ATOM   4451 N N   . ALA E 2 43  ? 35.135  -47.073 6.135  1.00 75.25  ? 43  ALA E N   1 
ATOM   4452 C CA  . ALA E 2 43  ? 34.737  -46.595 4.808  1.00 77.43  ? 43  ALA E CA  1 
ATOM   4453 C C   . ALA E 2 43  ? 33.494  -47.288 4.220  1.00 78.90  ? 43  ALA E C   1 
ATOM   4454 O O   . ALA E 2 43  ? 32.903  -46.804 3.248  1.00 78.05  ? 43  ALA E O   1 
ATOM   4455 C CB  . ALA E 2 43  ? 35.928  -46.697 3.840  1.00 77.58  ? 43  ALA E CB  1 
ATOM   4456 N N   . ARG E 2 44  ? 33.112  -48.425 4.803  1.00 81.43  ? 44  ARG E N   1 
ATOM   4457 C CA  . ARG E 2 44  ? 31.898  -49.134 4.398  1.00 82.71  ? 44  ARG E CA  1 
ATOM   4458 C C   . ARG E 2 44  ? 30.901  -49.082 5.558  1.00 81.51  ? 44  ARG E C   1 
ATOM   4459 O O   . ARG E 2 44  ? 30.904  -49.950 6.440  1.00 80.88  ? 44  ARG E O   1 
ATOM   4460 C CB  . ARG E 2 44  ? 32.216  -50.581 4.000  1.00 84.93  ? 44  ARG E CB  1 
ATOM   4461 C CG  . ARG E 2 44  ? 31.387  -51.107 2.825  1.00 89.62  ? 44  ARG E CG  1 
ATOM   4462 C CD  . ARG E 2 44  ? 29.970  -51.587 3.193  1.00 94.97  ? 44  ARG E CD  1 
ATOM   4463 N NE  . ARG E 2 44  ? 29.021  -51.438 2.082  1.00 99.14  ? 44  ARG E NE  1 
ATOM   4464 C CZ  . ARG E 2 44  ? 28.393  -50.298 1.758  1.00 100.75 ? 44  ARG E CZ  1 
ATOM   4465 N NH1 . ARG E 2 44  ? 28.603  -49.182 2.456  1.00 101.29 ? 44  ARG E NH1 1 
ATOM   4466 N NH2 . ARG E 2 44  ? 27.546  -50.271 0.731  1.00 100.70 ? 44  ARG E NH2 1 
ATOM   4467 N N   . PRO E 2 45  ? 30.057  -48.047 5.560  1.00 80.96  ? 45  PRO E N   1 
ATOM   4468 C CA  . PRO E 2 45  ? 29.091  -47.809 6.638  1.00 80.54  ? 45  PRO E CA  1 
ATOM   4469 C C   . PRO E 2 45  ? 28.046  -48.908 6.809  1.00 79.10  ? 45  PRO E C   1 
ATOM   4470 O O   . PRO E 2 45  ? 27.471  -49.390 5.828  1.00 76.86  ? 45  PRO E O   1 
ATOM   4471 C CB  . PRO E 2 45  ? 28.426  -46.489 6.235  1.00 81.31  ? 45  PRO E CB  1 
ATOM   4472 C CG  . PRO E 2 45  ? 29.370  -45.868 5.285  1.00 81.95  ? 45  PRO E CG  1 
ATOM   4473 C CD  . PRO E 2 45  ? 29.965  -47.010 4.518  1.00 81.42  ? 45  PRO E CD  1 
ATOM   4474 N N   . LYS E 2 46  ? 27.811  -49.268 8.071  1.00 77.66  ? 46  LYS E N   1 
ATOM   4475 C CA  . LYS E 2 46  ? 26.891  -50.329 8.475  1.00 76.77  ? 46  LYS E CA  1 
ATOM   4476 C C   . LYS E 2 46  ? 25.417  -49.879 8.463  1.00 75.40  ? 46  LYS E C   1 
ATOM   4477 O O   . LYS E 2 46  ? 25.123  -48.735 8.810  1.00 76.94  ? 46  LYS E O   1 
ATOM   4478 C CB  . LYS E 2 46  ? 27.283  -50.795 9.881  1.00 76.30  ? 46  LYS E CB  1 
ATOM   4479 C CG  . LYS E 2 46  ? 26.462  -51.950 10.388 1.00 77.32  ? 46  LYS E CG  1 
ATOM   4480 C CD  . LYS E 2 46  ? 27.059  -52.569 11.635 1.00 79.46  ? 46  LYS E CD  1 
ATOM   4481 C CE  . LYS E 2 46  ? 26.754  -54.056 11.670 1.00 77.40  ? 46  LYS E CE  1 
ATOM   4482 N NZ  . LYS E 2 46  ? 25.490  -54.369 10.939 1.00 76.41  ? 46  LYS E NZ  1 
ATOM   4483 N N   . ILE E 2 47  ? 24.498  -50.769 8.072  1.00 71.69  ? 47  ILE E N   1 
ATOM   4484 C CA  . ILE E 2 47  ? 23.056  -50.452 8.081  1.00 67.84  ? 47  ILE E CA  1 
ATOM   4485 C C   . ILE E 2 47  ? 22.211  -51.564 8.716  1.00 64.61  ? 47  ILE E C   1 
ATOM   4486 O O   . ILE E 2 47  ? 22.492  -52.741 8.512  1.00 66.19  ? 47  ILE E O   1 
ATOM   4487 C CB  . ILE E 2 47  ? 22.545  -50.179 6.648  1.00 68.62  ? 47  ILE E CB  1 
ATOM   4488 C CG1 . ILE E 2 47  ? 23.155  -48.890 6.088  1.00 69.91  ? 47  ILE E CG1 1 
ATOM   4489 C CG2 . ILE E 2 47  ? 21.028  -50.057 6.644  1.00 69.21  ? 47  ILE E CG2 1 
ATOM   4490 C CD1 . ILE E 2 47  ? 23.299  -48.898 4.560  1.00 70.45  ? 47  ILE E CD1 1 
ATOM   4491 N N   . GLN E 2 48  ? 21.182  -51.190 9.478  1.00 58.85  ? 48  GLN E N   1 
ATOM   4492 C CA  . GLN E 2 48  ? 20.268  -52.164 10.078 1.00 56.17  ? 48  GLN E CA  1 
ATOM   4493 C C   . GLN E 2 48  ? 18.828  -51.797 9.774  1.00 56.84  ? 48  GLN E C   1 
ATOM   4494 O O   . GLN E 2 48  ? 18.451  -50.640 9.913  1.00 58.22  ? 48  GLN E O   1 
ATOM   4495 C CB  . GLN E 2 48  ? 20.423  -52.215 11.590 1.00 54.14  ? 48  GLN E CB  1 
ATOM   4496 C CG  . GLN E 2 48  ? 21.716  -52.794 12.109 1.00 52.37  ? 48  GLN E CG  1 
ATOM   4497 C CD  . GLN E 2 48  ? 21.799  -52.661 13.607 1.00 53.09  ? 48  GLN E CD  1 
ATOM   4498 O OE1 . GLN E 2 48  ? 21.478  -51.610 14.157 1.00 54.59  ? 48  GLN E OE1 1 
ATOM   4499 N NE2 . GLN E 2 48  ? 22.215  -53.724 14.280 1.00 53.45  ? 48  GLN E NE2 1 
ATOM   4500 N N   . LYS E 2 49  ? 18.019  -52.785 9.393  1.00 56.37  ? 49  LYS E N   1 
ATOM   4501 C CA  . LYS E 2 49  ? 16.621  -52.545 9.027  1.00 54.17  ? 49  LYS E CA  1 
ATOM   4502 C C   . LYS E 2 49  ? 15.598  -52.899 10.104 1.00 54.65  ? 49  LYS E C   1 
ATOM   4503 O O   . LYS E 2 49  ? 15.820  -53.763 10.942 1.00 53.70  ? 49  LYS E O   1 
ATOM   4504 C CB  . LYS E 2 49  ? 16.296  -53.255 7.721  1.00 54.26  ? 49  LYS E CB  1 
ATOM   4505 C CG  . LYS E 2 49  ? 16.860  -52.542 6.518  1.00 53.94  ? 49  LYS E CG  1 
ATOM   4506 C CD  . LYS E 2 49  ? 16.843  -53.420 5.292  1.00 53.98  ? 49  LYS E CD  1 
ATOM   4507 C CE  . LYS E 2 49  ? 17.277  -52.618 4.087  1.00 56.53  ? 49  LYS E CE  1 
ATOM   4508 N NZ  . LYS E 2 49  ? 17.318  -53.448 2.859  1.00 59.84  ? 49  LYS E NZ  1 
ATOM   4509 N N   . THR E 2 50  ? 14.465  -52.213 10.049 1.00 56.04  ? 50  THR E N   1 
ATOM   4510 C CA  . THR E 2 50  ? 13.410  -52.311 11.044 1.00 57.58  ? 50  THR E CA  1 
ATOM   4511 C C   . THR E 2 50  ? 12.089  -52.498 10.318 1.00 57.57  ? 50  THR E C   1 
ATOM   4512 O O   . THR E 2 50  ? 11.967  -52.119 9.156  1.00 56.63  ? 50  THR E O   1 
ATOM   4513 C CB  . THR E 2 50  ? 13.369  -50.981 11.856 1.00 58.58  ? 50  THR E CB  1 
ATOM   4514 O OG1 . THR E 2 50  ? 14.496  -50.926 12.734 1.00 61.93  ? 50  THR E OG1 1 
ATOM   4515 C CG2 . THR E 2 50  ? 12.168  -50.911 12.800 1.00 59.46  ? 50  THR E CG2 1 
ATOM   4516 N N   . CYS E 2 51  ? 11.104  -53.084 10.992 1.00 58.37  ? 51  CYS E N   1 
ATOM   4517 C CA  . CYS E 2 51  ? 9.752   -53.084 10.454 1.00 60.69  ? 51  CYS E CA  1 
ATOM   4518 C C   . CYS E 2 51  ? 9.144   -51.685 10.622 1.00 59.91  ? 51  CYS E C   1 
ATOM   4519 O O   . CYS E 2 51  ? 9.036   -51.169 11.734 1.00 60.26  ? 51  CYS E O   1 
ATOM   4520 C CB  . CYS E 2 51  ? 8.884   -54.144 11.127 1.00 62.74  ? 51  CYS E CB  1 
ATOM   4521 S SG  . CYS E 2 51  ? 7.448   -54.649 10.142 1.00 69.68  ? 51  CYS E SG  1 
ATOM   4522 N N   . THR E 2 52  ? 8.787   -51.071 9.496  1.00 59.29  ? 52  THR E N   1 
ATOM   4523 C CA  . THR E 2 52  ? 8.222   -49.724 9.469  1.00 58.86  ? 52  THR E CA  1 
ATOM   4524 C C   . THR E 2 52  ? 7.439   -49.489 8.162  1.00 61.24  ? 52  THR E C   1 
ATOM   4525 O O   . THR E 2 52  ? 7.454   -50.329 7.246  1.00 60.67  ? 52  THR E O   1 
ATOM   4526 C CB  . THR E 2 52  ? 9.333   -48.640 9.680  1.00 57.56  ? 52  THR E CB  1 
ATOM   4527 O OG1 . THR E 2 52  ? 8.730   -47.377 9.955  1.00 56.92  ? 52  THR E OG1 1 
ATOM   4528 C CG2 . THR E 2 52  ? 10.132  -48.377 8.409  1.00 57.61  ? 52  THR E CG2 1 
ATOM   4529 N N   . PHE E 2 53  ? 6.749   -48.354 8.086  1.00 61.82  ? 53  PHE E N   1 
ATOM   4530 C CA  . PHE E 2 53  ? 5.956   -48.000 6.918  1.00 61.63  ? 53  PHE E CA  1 
ATOM   4531 C C   . PHE E 2 53  ? 6.763   -47.508 5.718  1.00 63.99  ? 53  PHE E C   1 
ATOM   4532 O O   . PHE E 2 53  ? 7.772   -46.825 5.880  1.00 65.74  ? 53  PHE E O   1 
ATOM   4533 C CB  . PHE E 2 53  ? 4.937   -46.933 7.302  1.00 59.95  ? 53  PHE E CB  1 
ATOM   4534 C CG  . PHE E 2 53  ? 5.543   -45.604 7.640  1.00 58.66  ? 53  PHE E CG  1 
ATOM   4535 C CD1 . PHE E 2 53  ? 5.742   -44.647 6.649  1.00 59.40  ? 53  PHE E CD1 1 
ATOM   4536 C CD2 . PHE E 2 53  ? 5.895   -45.296 8.943  1.00 59.80  ? 53  PHE E CD2 1 
ATOM   4537 C CE1 . PHE E 2 53  ? 6.291   -43.402 6.951  1.00 60.03  ? 53  PHE E CE1 1 
ATOM   4538 C CE2 . PHE E 2 53  ? 6.448   -44.055 9.258  1.00 60.68  ? 53  PHE E CE2 1 
ATOM   4539 C CZ  . PHE E 2 53  ? 6.645   -43.107 8.260  1.00 60.71  ? 53  PHE E CZ  1 
ATOM   4540 N N   . LYS E 2 54  ? 6.310   -47.856 4.513  1.00 67.10  ? 54  LYS E N   1 
ATOM   4541 C CA  . LYS E 2 54  ? 6.867   -47.267 3.291  1.00 68.17  ? 54  LYS E CA  1 
ATOM   4542 C C   . LYS E 2 54  ? 6.017   -46.071 2.841  1.00 68.93  ? 54  LYS E C   1 
ATOM   4543 O O   . LYS E 2 54  ? 6.566   -45.052 2.406  1.00 68.24  ? 54  LYS E O   1 
ATOM   4544 C CB  . LYS E 2 54  ? 7.003   -48.290 2.154  1.00 67.98  ? 54  LYS E CB  1 
ATOM   4545 C CG  . LYS E 2 54  ? 7.990   -47.841 1.075  1.00 69.03  ? 54  LYS E CG  1 
ATOM   4546 C CD  . LYS E 2 54  ? 7.984   -48.736 -0.158 1.00 71.16  ? 54  LYS E CD  1 
ATOM   4547 C CE  . LYS E 2 54  ? 8.853   -48.132 -1.264 1.00 71.70  ? 54  LYS E CE  1 
ATOM   4548 N NZ  . LYS E 2 54  ? 9.025   -49.031 -2.438 1.00 71.52  ? 54  LYS E NZ  1 
ATOM   4549 N N   . GLU E 2 55  ? 4.688   -46.207 2.949  1.00 69.89  ? 55  GLU E N   1 
ATOM   4550 C CA  . GLU E 2 55  ? 3.744   -45.125 2.611  1.00 70.86  ? 55  GLU E CA  1 
ATOM   4551 C C   . GLU E 2 55  ? 2.680   -44.897 3.696  1.00 71.08  ? 55  GLU E C   1 
ATOM   4552 O O   . GLU E 2 55  ? 2.249   -45.842 4.368  1.00 69.93  ? 55  GLU E O   1 
ATOM   4553 C CB  . GLU E 2 55  ? 3.077   -45.366 1.247  1.00 71.22  ? 55  GLU E CB  1 
ATOM   4554 C CG  . GLU E 2 55  ? 4.034   -45.457 0.054  1.00 72.64  ? 55  GLU E CG  1 
ATOM   4555 C CD  . GLU E 2 55  ? 4.799   -44.169 -0.238 1.00 74.13  ? 55  GLU E CD  1 
ATOM   4556 O OE1 . GLU E 2 55  ? 4.566   -43.145 0.441  1.00 75.75  ? 55  GLU E OE1 1 
ATOM   4557 O OE2 . GLU E 2 55  ? 5.641   -44.179 -1.163 1.00 74.00  ? 55  GLU E OE2 1 
ATOM   4558 N N   . LEU E 2 56  ? 2.273   -43.634 3.850  1.00 72.37  ? 56  LEU E N   1 
ATOM   4559 C CA  . LEU E 2 56  ? 1.309   -43.215 4.878  1.00 74.19  ? 56  LEU E CA  1 
ATOM   4560 C C   . LEU E 2 56  ? 0.194   -42.314 4.357  1.00 75.04  ? 56  LEU E C   1 
ATOM   4561 O O   . LEU E 2 56  ? 0.419   -41.451 3.507  1.00 74.70  ? 56  LEU E O   1 
ATOM   4562 C CB  . LEU E 2 56  ? 2.019   -42.452 6.012  1.00 73.62  ? 56  LEU E CB  1 
ATOM   4563 C CG  . LEU E 2 56  ? 2.623   -43.194 7.206  1.00 74.17  ? 56  LEU E CG  1 
ATOM   4564 C CD1 . LEU E 2 56  ? 3.013   -42.204 8.289  1.00 74.16  ? 56  LEU E CD1 1 
ATOM   4565 C CD2 . LEU E 2 56  ? 1.670   -44.218 7.764  1.00 73.55  ? 56  LEU E CD2 1 
ATOM   4566 N N   . VAL E 2 57  ? -1.007  -42.513 4.894  1.00 76.29  ? 57  VAL E N   1 
ATOM   4567 C CA  . VAL E 2 57  ? -2.134  -41.618 4.631  1.00 77.90  ? 57  VAL E CA  1 
ATOM   4568 C C   . VAL E 2 57  ? -2.776  -41.160 5.944  1.00 79.44  ? 57  VAL E C   1 
ATOM   4569 O O   . VAL E 2 57  ? -2.579  -41.786 6.991  1.00 78.49  ? 57  VAL E O   1 
ATOM   4570 C CB  . VAL E 2 57  ? -3.198  -42.254 3.705  1.00 77.23  ? 57  VAL E CB  1 
ATOM   4571 C CG1 . VAL E 2 57  ? -2.680  -42.325 2.276  1.00 76.91  ? 57  VAL E CG1 1 
ATOM   4572 C CG2 . VAL E 2 57  ? -3.612  -43.631 4.212  1.00 77.19  ? 57  VAL E CG2 1 
ATOM   4573 N N   . TYR E 2 58  ? -3.544  -40.072 5.876  1.00 81.93  ? 58  TYR E N   1 
ATOM   4574 C CA  . TYR E 2 58  ? -4.174  -39.484 7.060  1.00 84.43  ? 58  TYR E CA  1 
ATOM   4575 C C   . TYR E 2 58  ? -5.701  -39.662 7.153  1.00 85.62  ? 58  TYR E C   1 
ATOM   4576 O O   . TYR E 2 58  ? -6.450  -39.231 6.274  1.00 86.11  ? 58  TYR E O   1 
ATOM   4577 C CB  . TYR E 2 58  ? -3.794  -37.999 7.182  1.00 84.20  ? 58  TYR E CB  1 
ATOM   4578 C CG  . TYR E 2 58  ? -2.408  -37.766 7.749  1.00 85.11  ? 58  TYR E CG  1 
ATOM   4579 C CD1 . TYR E 2 58  ? -2.134  -38.017 9.098  1.00 85.39  ? 58  TYR E CD1 1 
ATOM   4580 C CD2 . TYR E 2 58  ? -1.370  -37.295 6.940  1.00 84.66  ? 58  TYR E CD2 1 
ATOM   4581 C CE1 . TYR E 2 58  ? -0.859  -37.806 9.630  1.00 85.33  ? 58  TYR E CE1 1 
ATOM   4582 C CE2 . TYR E 2 58  ? -0.090  -37.078 7.465  1.00 84.79  ? 58  TYR E CE2 1 
ATOM   4583 C CZ  . TYR E 2 58  ? 0.154   -37.337 8.811  1.00 84.97  ? 58  TYR E CZ  1 
ATOM   4584 O OH  . TYR E 2 58  ? 1.406   -37.125 9.341  1.00 85.12  ? 58  TYR E OH  1 
ATOM   4585 N N   . GLU E 2 59  ? -6.139  -40.311 8.230  1.00 87.00  ? 59  GLU E N   1 
ATOM   4586 C CA  . GLU E 2 59  ? -7.555  -40.518 8.519  1.00 88.41  ? 59  GLU E CA  1 
ATOM   4587 C C   . GLU E 2 59  ? -7.935  -39.686 9.748  1.00 89.08  ? 59  GLU E C   1 
ATOM   4588 O O   . GLU E 2 59  ? -7.106  -39.471 10.637 1.00 89.48  ? 59  GLU E O   1 
ATOM   4589 C CB  . GLU E 2 59  ? -7.833  -42.005 8.772  1.00 89.13  ? 59  GLU E CB  1 
ATOM   4590 C CG  . GLU E 2 59  ? -9.307  -42.382 8.871  1.00 91.88  ? 59  GLU E CG  1 
ATOM   4591 C CD  . GLU E 2 59  ? -9.931  -42.781 7.537  1.00 93.42  ? 59  GLU E CD  1 
ATOM   4592 O OE1 . GLU E 2 59  ? -9.688  -42.098 6.514  1.00 94.45  ? 59  GLU E OE1 1 
ATOM   4593 O OE2 . GLU E 2 59  ? -10.688 -43.780 7.517  1.00 94.25  ? 59  GLU E OE2 1 
ATOM   4594 N N   . THR E 2 60  ? -9.180  -39.210 9.788  1.00 89.74  ? 60  THR E N   1 
ATOM   4595 C CA  . THR E 2 60  ? -9.677  -38.427 10.924 1.00 89.42  ? 60  THR E CA  1 
ATOM   4596 C C   . THR E 2 60  ? -10.805 -39.179 11.632 1.00 89.82  ? 60  THR E C   1 
ATOM   4597 O O   . THR E 2 60  ? -11.512 -39.977 11.007 1.00 89.71  ? 60  THR E O   1 
ATOM   4598 C CB  . THR E 2 60  ? -10.160 -37.030 10.466 1.00 88.97  ? 60  THR E CB  1 
ATOM   4599 O OG1 . THR E 2 60  ? -9.195  -36.453 9.575  1.00 88.55  ? 60  THR E OG1 1 
ATOM   4600 C CG2 . THR E 2 60  ? -10.185 -36.062 11.641 1.00 88.70  ? 60  THR E CG2 1 
ATOM   4601 N N   . VAL E 2 61  ? -10.956 -38.922 12.933 1.00 90.46  ? 61  VAL E N   1 
ATOM   4602 C CA  . VAL E 2 61  ? -11.957 -39.602 13.761 1.00 91.26  ? 61  VAL E CA  1 
ATOM   4603 C C   . VAL E 2 61  ? -12.655 -38.650 14.742 1.00 91.63  ? 61  VAL E C   1 
ATOM   4604 O O   . VAL E 2 61  ? -12.205 -37.520 14.956 1.00 91.61  ? 61  VAL E O   1 
ATOM   4605 C CB  . VAL E 2 61  ? -11.321 -40.804 14.527 1.00 91.46  ? 61  VAL E CB  1 
ATOM   4606 C CG1 . VAL E 2 61  ? -10.474 -40.314 15.706 1.00 91.71  ? 61  VAL E CG1 1 
ATOM   4607 C CG2 . VAL E 2 61  ? -12.395 -41.805 14.977 1.00 91.03  ? 61  VAL E CG2 1 
ATOM   4608 N N   . ARG E 2 62  ? -13.754 -39.124 15.328 1.00 92.15  ? 62  ARG E N   1 
ATOM   4609 C CA  . ARG E 2 62  ? -14.539 -38.349 16.282 1.00 92.36  ? 62  ARG E CA  1 
ATOM   4610 C C   . ARG E 2 62  ? -13.894 -38.273 17.671 1.00 92.23  ? 62  ARG E C   1 
ATOM   4611 O O   . ARG E 2 62  ? -13.772 -39.284 18.371 1.00 92.81  ? 62  ARG E O   1 
ATOM   4612 C CB  . ARG E 2 62  ? -15.963 -38.922 16.392 1.00 92.51  ? 62  ARG E CB  1 
ATOM   4613 C CG  . ARG E 2 62  ? -16.035 -40.417 16.698 1.00 93.47  ? 62  ARG E CG  1 
ATOM   4614 C CD  . ARG E 2 62  ? -17.455 -40.942 16.751 1.00 95.76  ? 62  ARG E CD  1 
ATOM   4615 N NE  . ARG E 2 62  ? -17.537 -42.299 17.299 1.00 97.01  ? 62  ARG E NE  1 
ATOM   4616 C CZ  . ARG E 2 62  ? -18.679 -42.953 17.505 1.00 96.89  ? 62  ARG E CZ  1 
ATOM   4617 N NH1 . ARG E 2 62  ? -19.849 -42.384 17.211 1.00 96.57  ? 62  ARG E NH1 1 
ATOM   4618 N NH2 . ARG E 2 62  ? -18.656 -44.182 18.010 1.00 96.90  ? 62  ARG E NH2 1 
ATOM   4619 N N   . VAL E 2 63  ? -13.467 -37.070 18.048 1.00 91.49  ? 63  VAL E N   1 
ATOM   4620 C CA  . VAL E 2 63  ? -12.939 -36.823 19.393 1.00 90.60  ? 63  VAL E CA  1 
ATOM   4621 C C   . VAL E 2 63  ? -14.004 -36.023 20.148 1.00 90.56  ? 63  VAL E C   1 
ATOM   4622 O O   . VAL E 2 63  ? -14.022 -34.790 20.093 1.00 90.54  ? 63  VAL E O   1 
ATOM   4623 C CB  . VAL E 2 63  ? -11.598 -36.049 19.371 1.00 90.15  ? 63  VAL E CB  1 
ATOM   4624 C CG1 . VAL E 2 63  ? -10.944 -36.094 20.736 1.00 89.15  ? 63  VAL E CG1 1 
ATOM   4625 C CG2 . VAL E 2 63  ? -10.658 -36.632 18.332 1.00 89.69  ? 63  VAL E CG2 1 
ATOM   4626 N N   . PRO E 2 64  ? -14.883 -36.730 20.867 1.00 90.49  ? 64  PRO E N   1 
ATOM   4627 C CA  . PRO E 2 64  ? -16.067 -36.114 21.481 1.00 90.59  ? 64  PRO E CA  1 
ATOM   4628 C C   . PRO E 2 64  ? -15.752 -35.081 22.568 1.00 90.85  ? 64  PRO E C   1 
ATOM   4629 O O   . PRO E 2 64  ? -14.609 -35.001 23.045 1.00 90.48  ? 64  PRO E O   1 
ATOM   4630 C CB  . PRO E 2 64  ? -16.822 -37.315 22.082 1.00 90.42  ? 64  PRO E CB  1 
ATOM   4631 C CG  . PRO E 2 64  ? -16.197 -38.533 21.463 1.00 90.10  ? 64  PRO E CG  1 
ATOM   4632 C CD  . PRO E 2 64  ? -14.776 -38.162 21.202 1.00 90.10  ? 64  PRO E CD  1 
ATOM   4633 N N   . GLY E 2 65  ? -16.766 -34.288 22.933 1.00 91.00  ? 65  GLY E N   1 
ATOM   4634 C CA  . GLY E 2 65  ? -16.647 -33.322 24.025 1.00 90.95  ? 65  GLY E CA  1 
ATOM   4635 C C   . GLY E 2 65  ? -17.048 -33.978 25.338 1.00 91.38  ? 65  GLY E C   1 
ATOM   4636 O O   . GLY E 2 65  ? -17.501 -35.128 25.348 1.00 91.48  ? 65  GLY E O   1 
ATOM   4637 N N   . CYS E 2 66  ? -16.889 -33.258 26.447 1.00 91.37  ? 66  CYS E N   1 
ATOM   4638 C CA  . CYS E 2 66  ? -17.214 -33.815 27.759 1.00 91.44  ? 66  CYS E CA  1 
ATOM   4639 C C   . CYS E 2 66  ? -17.855 -32.814 28.727 1.00 91.50  ? 66  CYS E C   1 
ATOM   4640 O O   . CYS E 2 66  ? -18.930 -32.271 28.439 1.00 90.65  ? 66  CYS E O   1 
ATOM   4641 C CB  . CYS E 2 66  ? -15.981 -34.492 28.377 1.00 91.13  ? 66  CYS E CB  1 
ATOM   4642 S SG  . CYS E 2 66  ? -14.512 -33.432 28.525 1.00 93.74  ? 66  CYS E SG  1 
ATOM   4643 N N   . ALA E 2 67  ? -17.193 -32.585 29.866 1.00 92.19  ? 67  ALA E N   1 
ATOM   4644 C CA  . ALA E 2 67  ? -17.715 -31.741 30.944 1.00 92.79  ? 67  ALA E CA  1 
ATOM   4645 C C   . ALA E 2 67  ? -18.097 -30.329 30.491 1.00 93.26  ? 67  ALA E C   1 
ATOM   4646 O O   . ALA E 2 67  ? -19.284 -29.996 30.431 1.00 93.77  ? 67  ALA E O   1 
ATOM   4647 C CB  . ALA E 2 67  ? -16.716 -31.689 32.106 1.00 92.27  ? 67  ALA E CB  1 
ATOM   4648 N N   . HIS E 2 68  ? -17.096 -29.508 30.171 1.00 93.30  ? 68  HIS E N   1 
ATOM   4649 C CA  . HIS E 2 68  ? -17.326 -28.137 29.706 1.00 92.76  ? 68  HIS E CA  1 
ATOM   4650 C C   . HIS E 2 68  ? -16.421 -27.777 28.521 1.00 92.66  ? 68  HIS E C   1 
ATOM   4651 O O   . HIS E 2 68  ? -16.185 -26.595 28.249 1.00 92.69  ? 68  HIS E O   1 
ATOM   4652 C CB  . HIS E 2 68  ? -17.106 -27.135 30.854 1.00 92.52  ? 68  HIS E CB  1 
ATOM   4653 C CG  . HIS E 2 68  ? -18.098 -27.256 31.973 1.00 92.46  ? 68  HIS E CG  1 
ATOM   4654 N ND1 . HIS E 2 68  ? -19.403 -26.805 31.867 1.00 92.32  ? 68  HIS E ND1 1 
ATOM   4655 C CD2 . HIS E 2 68  ? -17.969 -27.763 33.229 1.00 92.33  ? 68  HIS E CD2 1 
ATOM   4656 C CE1 . HIS E 2 68  ? -20.035 -27.034 33.007 1.00 92.05  ? 68  HIS E CE1 1 
ATOM   4657 N NE2 . HIS E 2 68  ? -19.188 -27.614 33.850 1.00 92.21  ? 68  HIS E NE2 1 
ATOM   4658 N N   . HIS E 2 69  ? -15.937 -28.798 27.812 1.00 92.42  ? 69  HIS E N   1 
ATOM   4659 C CA  . HIS E 2 69  ? -14.974 -28.607 26.722 1.00 92.26  ? 69  HIS E CA  1 
ATOM   4660 C C   . HIS E 2 69  ? -15.497 -29.037 25.353 1.00 92.00  ? 69  HIS E C   1 
ATOM   4661 O O   . HIS E 2 69  ? -16.208 -30.039 25.235 1.00 92.08  ? 69  HIS E O   1 
ATOM   4662 C CB  . HIS E 2 69  ? -13.670 -29.353 27.031 1.00 92.18  ? 69  HIS E CB  1 
ATOM   4663 C CG  . HIS E 2 69  ? -12.944 -28.834 28.232 1.00 91.86  ? 69  HIS E CG  1 
ATOM   4664 N ND1 . HIS E 2 69  ? -13.341 -29.128 29.524 1.00 91.72  ? 69  HIS E ND1 1 
ATOM   4665 C CD2 . HIS E 2 69  ? -11.843 -28.047 28.338 1.00 90.85  ? 69  HIS E CD2 1 
ATOM   4666 C CE1 . HIS E 2 69  ? -12.515 -28.542 30.373 1.00 91.42  ? 69  HIS E CE1 1 
ATOM   4667 N NE2 . HIS E 2 69  ? -11.598 -27.881 29.679 1.00 91.12  ? 69  HIS E NE2 1 
ATOM   4668 N N   . ALA E 2 70  ? -15.116 -28.276 24.326 1.00 91.41  ? 70  ALA E N   1 
ATOM   4669 C CA  . ALA E 2 70  ? -15.569 -28.505 22.954 1.00 90.79  ? 70  ALA E CA  1 
ATOM   4670 C C   . ALA E 2 70  ? -14.919 -29.725 22.301 1.00 90.22  ? 70  ALA E C   1 
ATOM   4671 O O   . ALA E 2 70  ? -13.791 -30.094 22.643 1.00 89.95  ? 70  ALA E O   1 
ATOM   4672 C CB  . ALA E 2 70  ? -15.329 -27.253 22.100 1.00 90.36  ? 70  ALA E CB  1 
ATOM   4673 N N   . ASP E 2 71  ? -15.645 -30.349 21.368 1.00 89.64  ? 71  ASP E N   1 
ATOM   4674 C CA  . ASP E 2 71  ? -15.140 -31.512 20.634 1.00 88.79  ? 71  ASP E CA  1 
ATOM   4675 C C   . ASP E 2 71  ? -14.228 -31.055 19.489 1.00 89.05  ? 71  ASP E C   1 
ATOM   4676 O O   . ASP E 2 71  ? -14.478 -30.027 18.852 1.00 89.24  ? 71  ASP E O   1 
ATOM   4677 C CB  . ASP E 2 71  ? -16.302 -32.444 20.182 1.00 87.44  ? 71  ASP E CB  1 
ATOM   4678 C CG  . ASP E 2 71  ? -16.718 -32.268 18.711 1.00 85.88  ? 71  ASP E CG  1 
ATOM   4679 O OD1 . ASP E 2 71  ? -16.841 -31.127 18.224 1.00 85.09  ? 71  ASP E OD1 1 
ATOM   4680 O OD2 . ASP E 2 71  ? -16.981 -33.253 17.985 1.00 83.86  ? 71  ASP E OD2 1 
ATOM   4681 N N   . SER E 2 72  ? -13.148 -31.799 19.267 1.00 89.21  ? 72  SER E N   1 
ATOM   4682 C CA  . SER E 2 72  ? -12.166 -31.448 18.245 1.00 89.10  ? 72  SER E CA  1 
ATOM   4683 C C   . SER E 2 72  ? -11.884 -32.620 17.306 1.00 89.50  ? 72  SER E C   1 
ATOM   4684 O O   . SER E 2 72  ? -12.345 -33.740 17.545 1.00 88.89  ? 72  SER E O   1 
ATOM   4685 C CB  . SER E 2 72  ? -10.873 -30.954 18.904 1.00 88.38  ? 72  SER E CB  1 
ATOM   4686 O OG  . SER E 2 72  ? -10.498 -31.799 19.980 1.00 87.93  ? 72  SER E OG  1 
ATOM   4687 N N   . LEU E 2 73  ? -11.143 -32.349 16.231 1.00 90.42  ? 73  LEU E N   1 
ATOM   4688 C CA  . LEU E 2 73  ? -10.771 -33.381 15.255 1.00 91.22  ? 73  LEU E CA  1 
ATOM   4689 C C   . LEU E 2 73  ? -9.282  -33.732 15.308 1.00 91.41  ? 73  LEU E C   1 
ATOM   4690 O O   . LEU E 2 73  ? -8.418  -32.847 15.281 1.00 90.98  ? 73  LEU E O   1 
ATOM   4691 C CB  . LEU E 2 73  ? -11.161 -32.959 13.830 1.00 90.61  ? 73  LEU E CB  1 
ATOM   4692 C CG  . LEU E 2 73  ? -12.636 -33.069 13.424 1.00 90.62  ? 73  LEU E CG  1 
ATOM   4693 C CD1 . LEU E 2 73  ? -12.846 -32.495 12.024 1.00 90.57  ? 73  LEU E CD1 1 
ATOM   4694 C CD2 . LEU E 2 73  ? -13.125 -34.517 13.498 1.00 90.34  ? 73  LEU E CD2 1 
ATOM   4695 N N   . TYR E 2 74  ? -8.994  -35.031 15.383 1.00 91.49  ? 74  TYR E N   1 
ATOM   4696 C CA  . TYR E 2 74  ? -7.618  -35.497 15.431 1.00 91.24  ? 74  TYR E CA  1 
ATOM   4697 C C   . TYR E 2 74  ? -7.289  -36.446 14.292 1.00 90.69  ? 74  TYR E C   1 
ATOM   4698 O O   . TYR E 2 74  ? -7.926  -37.493 14.126 1.00 90.75  ? 74  TYR E O   1 
ATOM   4699 C CB  . TYR E 2 74  ? -7.297  -36.154 16.777 1.00 92.14  ? 74  TYR E CB  1 
ATOM   4700 C CG  . TYR E 2 74  ? -5.819  -36.152 17.076 1.00 93.63  ? 74  TYR E CG  1 
ATOM   4701 C CD1 . TYR E 2 74  ? -5.203  -35.010 17.596 1.00 94.65  ? 74  TYR E CD1 1 
ATOM   4702 C CD2 . TYR E 2 74  ? -5.029  -37.277 16.819 1.00 94.26  ? 74  TYR E CD2 1 
ATOM   4703 C CE1 . TYR E 2 74  ? -3.839  -34.986 17.861 1.00 96.30  ? 74  TYR E CE1 1 
ATOM   4704 C CE2 . TYR E 2 74  ? -3.663  -37.269 17.080 1.00 95.79  ? 74  TYR E CE2 1 
ATOM   4705 C CZ  . TYR E 2 74  ? -3.072  -36.118 17.600 1.00 97.06  ? 74  TYR E CZ  1 
ATOM   4706 O OH  . TYR E 2 74  ? -1.719  -36.091 17.867 1.00 98.40  ? 74  TYR E OH  1 
ATOM   4707 N N   . THR E 2 75  ? -6.283  -36.055 13.515 1.00 89.45  ? 75  THR E N   1 
ATOM   4708 C CA  . THR E 2 75  ? -5.781  -36.836 12.390 1.00 87.98  ? 75  THR E CA  1 
ATOM   4709 C C   . THR E 2 75  ? -4.708  -37.832 12.847 1.00 87.00  ? 75  THR E C   1 
ATOM   4710 O O   . THR E 2 75  ? -3.685  -37.446 13.421 1.00 87.34  ? 75  THR E O   1 
ATOM   4711 C CB  . THR E 2 75  ? -5.217  -35.891 11.291 1.00 88.22  ? 75  THR E CB  1 
ATOM   4712 O OG1 . THR E 2 75  ? -4.462  -34.833 11.904 1.00 88.03  ? 75  THR E OG1 1 
ATOM   4713 C CG2 . THR E 2 75  ? -6.343  -35.153 10.575 1.00 87.64  ? 75  THR E CG2 1 
ATOM   4714 N N   . TYR E 2 76  ? -4.956  -39.115 12.599 1.00 84.42  ? 76  TYR E N   1 
ATOM   4715 C CA  . TYR E 2 76  ? -4.006  -40.174 12.938 1.00 82.28  ? 76  TYR E CA  1 
ATOM   4716 C C   . TYR E 2 76  ? -3.539  -40.871 11.660 1.00 81.25  ? 76  TYR E C   1 
ATOM   4717 O O   . TYR E 2 76  ? -4.361  -41.244 10.821 1.00 81.04  ? 76  TYR E O   1 
ATOM   4718 C CB  . TYR E 2 76  ? -4.652  -41.188 13.889 1.00 82.41  ? 76  TYR E CB  1 
ATOM   4719 C CG  . TYR E 2 76  ? -5.777  -41.987 13.264 1.00 83.50  ? 76  TYR E CG  1 
ATOM   4720 C CD1 . TYR E 2 76  ? -7.036  -41.409 13.045 1.00 83.36  ? 76  TYR E CD1 1 
ATOM   4721 C CD2 . TYR E 2 76  ? -5.582  -43.320 12.884 1.00 83.69  ? 76  TYR E CD2 1 
ATOM   4722 C CE1 . TYR E 2 76  ? -8.073  -42.137 12.460 1.00 83.89  ? 76  TYR E CE1 1 
ATOM   4723 C CE2 . TYR E 2 76  ? -6.611  -44.055 12.300 1.00 84.56  ? 76  TYR E CE2 1 
ATOM   4724 C CZ  . TYR E 2 76  ? -7.852  -43.459 12.093 1.00 84.61  ? 76  TYR E CZ  1 
ATOM   4725 O OH  . TYR E 2 76  ? -8.869  -44.186 11.520 1.00 84.72  ? 76  TYR E OH  1 
ATOM   4726 N N   . PRO E 2 77  ? -2.221  -41.036 11.494 1.00 80.18  ? 77  PRO E N   1 
ATOM   4727 C CA  . PRO E 2 77  ? -1.673  -41.708 10.309 1.00 78.13  ? 77  PRO E CA  1 
ATOM   4728 C C   . PRO E 2 77  ? -1.943  -43.218 10.256 1.00 76.49  ? 77  PRO E C   1 
ATOM   4729 O O   . PRO E 2 77  ? -1.928  -43.897 11.292 1.00 75.19  ? 77  PRO E O   1 
ATOM   4730 C CB  . PRO E 2 77  ? -0.170  -41.415 10.399 1.00 78.21  ? 77  PRO E CB  1 
ATOM   4731 C CG  . PRO E 2 77  ? 0.088   -41.181 11.851 1.00 79.26  ? 77  PRO E CG  1 
ATOM   4732 C CD  . PRO E 2 77  ? -1.160  -40.559 12.403 1.00 79.98  ? 77  PRO E CD  1 
ATOM   4733 N N   . VAL E 2 78  ? -2.204  -43.717 9.047  1.00 75.14  ? 78  VAL E N   1 
ATOM   4734 C CA  . VAL E 2 78  ? -2.430  -45.146 8.802  1.00 73.86  ? 78  VAL E CA  1 
ATOM   4735 C C   . VAL E 2 78  ? -1.381  -45.679 7.814  1.00 73.49  ? 78  VAL E C   1 
ATOM   4736 O O   . VAL E 2 78  ? -1.070  -45.035 6.803  1.00 72.60  ? 78  VAL E O   1 
ATOM   4737 C CB  . VAL E 2 78  ? -3.855  -45.441 8.239  1.00 73.23  ? 78  VAL E CB  1 
ATOM   4738 C CG1 . VAL E 2 78  ? -4.185  -46.923 8.398  1.00 72.52  ? 78  VAL E CG1 1 
ATOM   4739 C CG2 . VAL E 2 78  ? -4.914  -44.591 8.934  1.00 72.03  ? 78  VAL E CG2 1 
ATOM   4740 N N   . ALA E 2 79  ? -0.840  -46.857 8.116  1.00 72.74  ? 79  ALA E N   1 
ATOM   4741 C CA  . ALA E 2 79  ? 0.178   -47.471 7.272  1.00 73.09  ? 79  ALA E CA  1 
ATOM   4742 C C   . ALA E 2 79  ? -0.425  -48.062 6.009  1.00 73.16  ? 79  ALA E C   1 
ATOM   4743 O O   . ALA E 2 79  ? -1.314  -48.912 6.078  1.00 74.16  ? 79  ALA E O   1 
ATOM   4744 C CB  . ALA E 2 79  ? 0.928   -48.545 8.049  1.00 72.90  ? 79  ALA E CB  1 
ATOM   4745 N N   . THR E 2 80  ? 0.049   -47.594 4.859  1.00 72.78  ? 80  THR E N   1 
ATOM   4746 C CA  . THR E 2 80  ? -0.391  -48.134 3.573  1.00 72.31  ? 80  THR E CA  1 
ATOM   4747 C C   . THR E 2 80  ? 0.510   -49.304 3.146  1.00 73.10  ? 80  THR E C   1 
ATOM   4748 O O   . THR E 2 80  ? 0.025   -50.328 2.652  1.00 73.21  ? 80  THR E O   1 
ATOM   4749 C CB  . THR E 2 80  ? -0.410  -47.033 2.491  1.00 71.28  ? 80  THR E CB  1 
ATOM   4750 O OG1 . THR E 2 80  ? -1.168  -45.912 2.958  1.00 70.31  ? 80  THR E OG1 1 
ATOM   4751 C CG2 . THR E 2 80  ? -1.174  -47.497 1.282  1.00 71.21  ? 80  THR E CG2 1 
ATOM   4752 N N   . GLN E 2 81  ? 1.816   -49.150 3.361  1.00 73.05  ? 81  GLN E N   1 
ATOM   4753 C CA  . GLN E 2 81  ? 2.799   -50.163 2.989  1.00 71.92  ? 81  GLN E CA  1 
ATOM   4754 C C   . GLN E 2 81  ? 3.845   -50.373 4.081  1.00 71.24  ? 81  GLN E C   1 
ATOM   4755 O O   . GLN E 2 81  ? 4.321   -49.414 4.679  1.00 69.94  ? 81  GLN E O   1 
ATOM   4756 C CB  . GLN E 2 81  ? 3.502   -49.754 1.700  1.00 72.65  ? 81  GLN E CB  1 
ATOM   4757 C CG  . GLN E 2 81  ? 2.780   -50.128 0.425  1.00 71.53  ? 81  GLN E CG  1 
ATOM   4758 C CD  . GLN E 2 81  ? 3.724   -50.130 -0.761 1.00 72.31  ? 81  GLN E CD  1 
ATOM   4759 O OE1 . GLN E 2 81  ? 3.953   -51.177 -1.371 1.00 72.65  ? 81  GLN E OE1 1 
ATOM   4760 N NE2 . GLN E 2 81  ? 4.298   -48.967 -1.075 1.00 71.60  ? 81  GLN E NE2 1 
ATOM   4761 N N   . CYS E 2 82  ? 4.210   -51.631 4.311  1.00 69.98  ? 82  CYS E N   1 
ATOM   4762 C CA  . CYS E 2 82  ? 5.165   -51.983 5.354  1.00 69.49  ? 82  CYS E CA  1 
ATOM   4763 C C   . CYS E 2 82  ? 6.314   -52.835 4.854  1.00 68.69  ? 82  CYS E C   1 
ATOM   4764 O O   . CYS E 2 82  ? 6.116   -53.993 4.472  1.00 71.06  ? 82  CYS E O   1 
ATOM   4765 C CB  . CYS E 2 82  ? 4.456   -52.720 6.481  1.00 69.13  ? 82  CYS E CB  1 
ATOM   4766 S SG  . CYS E 2 82  ? 3.530   -51.595 7.546  1.00 75.92  ? 82  CYS E SG  1 
ATOM   4767 N N   . HIS E 2 83  ? 7.516   -52.264 4.875  1.00 65.66  ? 83  HIS E N   1 
ATOM   4768 C CA  . HIS E 2 83  ? 8.720   -52.975 4.459  1.00 61.40  ? 83  HIS E CA  1 
ATOM   4769 C C   . HIS E 2 83  ? 9.747   -53.045 5.576  1.00 60.30  ? 83  HIS E C   1 
ATOM   4770 O O   . HIS E 2 83  ? 9.541   -52.510 6.664  1.00 59.98  ? 83  HIS E O   1 
ATOM   4771 C CB  . HIS E 2 83  ? 9.343   -52.287 3.239  1.00 60.80  ? 83  HIS E CB  1 
ATOM   4772 C CG  . HIS E 2 83  ? 9.926   -50.934 3.524  1.00 59.85  ? 83  HIS E CG  1 
ATOM   4773 N ND1 . HIS E 2 83  ? 10.726  -50.267 2.618  1.00 60.09  ? 83  HIS E ND1 1 
ATOM   4774 C CD2 . HIS E 2 83  ? 9.834   -50.126 4.609  1.00 59.02  ? 83  HIS E CD2 1 
ATOM   4775 C CE1 . HIS E 2 83  ? 11.096  -49.107 3.131  1.00 60.14  ? 83  HIS E CE1 1 
ATOM   4776 N NE2 . HIS E 2 83  ? 10.568  -48.998 4.338  1.00 59.18  ? 83  HIS E NE2 1 
ATOM   4777 N N   . CYS E 2 84  ? 10.850  -53.726 5.290  1.00 59.58  ? 84  CYS E N   1 
ATOM   4778 C CA  . CYS E 2 84  ? 12.024  -53.692 6.136  1.00 57.15  ? 84  CYS E CA  1 
ATOM   4779 C C   . CYS E 2 84  ? 12.890  -52.596 5.580  1.00 56.73  ? 84  CYS E C   1 
ATOM   4780 O O   . CYS E 2 84  ? 13.461  -52.730 4.503  1.00 56.55  ? 84  CYS E O   1 
ATOM   4781 C CB  . CYS E 2 84  ? 12.783  -55.004 6.094  1.00 56.77  ? 84  CYS E CB  1 
ATOM   4782 S SG  . CYS E 2 84  ? 12.003  -56.276 7.093  1.00 59.68  ? 84  CYS E SG  1 
ATOM   4783 N N   . GLY E 2 85  ? 12.956  -51.501 6.320  1.00 57.67  ? 85  GLY E N   1 
ATOM   4784 C CA  . GLY E 2 85  ? 13.752  -50.361 5.930  1.00 58.32  ? 85  GLY E CA  1 
ATOM   4785 C C   . GLY E 2 85  ? 14.115  -49.542 7.143  1.00 59.77  ? 85  GLY E C   1 
ATOM   4786 O O   . GLY E 2 85  ? 13.781  -49.891 8.278  1.00 59.97  ? 85  GLY E O   1 
ATOM   4787 N N   . LYS E 2 86  ? 14.792  -48.433 6.887  1.00 60.44  ? 86  LYS E N   1 
ATOM   4788 C CA  . LYS E 2 86  ? 15.267  -47.553 7.930  1.00 62.55  ? 86  LYS E CA  1 
ATOM   4789 C C   . LYS E 2 86  ? 14.129  -46.730 8.472  1.00 62.76  ? 86  LYS E C   1 
ATOM   4790 O O   . LYS E 2 86  ? 13.401  -46.127 7.691  1.00 64.68  ? 86  LYS E O   1 
ATOM   4791 C CB  . LYS E 2 86  ? 16.327  -46.623 7.340  1.00 64.23  ? 86  LYS E CB  1 
ATOM   4792 C CG  . LYS E 2 86  ? 17.627  -47.333 6.972  1.00 67.65  ? 86  LYS E CG  1 
ATOM   4793 C CD  . LYS E 2 86  ? 18.511  -46.436 6.128  1.00 70.26  ? 86  LYS E CD  1 
ATOM   4794 C CE  . LYS E 2 86  ? 19.846  -47.098 5.851  1.00 73.03  ? 86  LYS E CE  1 
ATOM   4795 N NZ  . LYS E 2 86  ? 20.818  -46.153 5.228  1.00 75.53  ? 86  LYS E NZ  1 
ATOM   4796 N N   . CYS E 2 87  ? 13.949  -46.697 9.791  1.00 63.02  ? 87  CYS E N   1 
ATOM   4797 C CA  . CYS E 2 87  ? 12.933  -45.798 10.339 1.00 63.55  ? 87  CYS E CA  1 
ATOM   4798 C C   . CYS E 2 87  ? 13.297  -44.367 9.903  1.00 62.25  ? 87  CYS E C   1 
ATOM   4799 O O   . CYS E 2 87  ? 14.463  -43.958 9.948  1.00 60.45  ? 87  CYS E O   1 
ATOM   4800 C CB  . CYS E 2 87  ? 12.765  -45.932 11.875 1.00 62.73  ? 87  CYS E CB  1 
ATOM   4801 S SG  . CYS E 2 87  ? 14.189  -45.388 12.844 1.00 70.51  ? 87  CYS E SG  1 
ATOM   4802 N N   . ASP E 2 88  ? 12.293  -43.641 9.423  1.00 61.60  ? 88  ASP E N   1 
ATOM   4803 C CA  . ASP E 2 88  ? 12.494  -42.295 8.911  1.00 62.56  ? 88  ASP E CA  1 
ATOM   4804 C C   . ASP E 2 88  ? 12.464  -41.311 10.082 1.00 62.14  ? 88  ASP E C   1 
ATOM   4805 O O   . ASP E 2 88  ? 11.384  -40.878 10.498 1.00 62.04  ? 88  ASP E O   1 
ATOM   4806 C CB  . ASP E 2 88  ? 11.395  -41.975 7.885  1.00 64.35  ? 88  ASP E CB  1 
ATOM   4807 C CG  . ASP E 2 88  ? 11.711  -40.742 7.042  1.00 66.60  ? 88  ASP E CG  1 
ATOM   4808 O OD1 . ASP E 2 88  ? 11.664  -39.612 7.576  1.00 66.72  ? 88  ASP E OD1 1 
ATOM   4809 O OD2 . ASP E 2 88  ? 12.009  -40.828 5.832  1.00 68.13  ? 88  ASP E OD2 1 
ATOM   4810 N N   . SER E 2 89  ? 13.636  -40.952 10.614 1.00 59.37  ? 89  SER E N   1 
ATOM   4811 C CA  . SER E 2 89  ? 13.671  -40.079 11.801 1.00 58.91  ? 89  SER E CA  1 
ATOM   4812 C C   . SER E 2 89  ? 13.054  -38.681 11.613 1.00 59.32  ? 89  SER E C   1 
ATOM   4813 O O   . SER E 2 89  ? 12.760  -38.003 12.591 1.00 60.45  ? 89  SER E O   1 
ATOM   4814 C CB  . SER E 2 89  ? 15.077  -40.004 12.430 1.00 57.54  ? 89  SER E CB  1 
ATOM   4815 O OG  . SER E 2 89  ? 16.085  -39.801 11.466 1.00 56.90  ? 89  SER E OG  1 
ATOM   4816 N N   . ASP E 2 90  ? 12.836  -38.265 10.366 1.00 58.88  ? 90  ASP E N   1 
ATOM   4817 C CA  . ASP E 2 90  ? 12.165  -37.003 10.079 1.00 58.71  ? 90  ASP E CA  1 
ATOM   4818 C C   . ASP E 2 90  ? 10.710  -37.010 10.584 1.00 59.28  ? 90  ASP E C   1 
ATOM   4819 O O   . ASP E 2 90  ? 10.126  -35.953 10.855 1.00 59.88  ? 90  ASP E O   1 
ATOM   4820 C CB  . ASP E 2 90  ? 12.185  -36.717 8.573  1.00 59.54  ? 90  ASP E CB  1 
ATOM   4821 C CG  . ASP E 2 90  ? 13.421  -35.933 8.126  1.00 61.60  ? 90  ASP E CG  1 
ATOM   4822 O OD1 . ASP E 2 90  ? 14.556  -36.464 8.160  1.00 62.63  ? 90  ASP E OD1 1 
ATOM   4823 O OD2 . ASP E 2 90  ? 13.321  -34.771 7.686  1.00 63.73  ? 90  ASP E OD2 1 
ATOM   4824 N N   . SER E 2 91  ? 10.140  -38.206 10.714 1.00 57.49  ? 91  SER E N   1 
ATOM   4825 C CA  . SER E 2 91  ? 8.749   -38.378 11.130 1.00 56.42  ? 91  SER E CA  1 
ATOM   4826 C C   . SER E 2 91  ? 8.596   -39.478 12.188 1.00 56.93  ? 91  SER E C   1 
ATOM   4827 O O   . SER E 2 91  ? 7.520   -39.649 12.777 1.00 56.97  ? 91  SER E O   1 
ATOM   4828 C CB  . SER E 2 91  ? 7.909   -38.749 9.916  1.00 55.60  ? 91  SER E CB  1 
ATOM   4829 O OG  . SER E 2 91  ? 8.289   -40.030 9.439  1.00 54.73  ? 91  SER E OG  1 
ATOM   4830 N N   . THR E 2 92  ? 9.675   -40.228 12.409 1.00 56.02  ? 92  THR E N   1 
ATOM   4831 C CA  . THR E 2 92  ? 9.658   -41.378 13.299 1.00 54.61  ? 92  THR E CA  1 
ATOM   4832 C C   . THR E 2 92  ? 10.508  -41.159 14.556 1.00 55.13  ? 92  THR E C   1 
ATOM   4833 O O   . THR E 2 92  ? 11.558  -40.511 14.530 1.00 54.20  ? 92  THR E O   1 
ATOM   4834 C CB  . THR E 2 92  ? 10.117  -42.654 12.533 1.00 54.43  ? 92  THR E CB  1 
ATOM   4835 O OG1 . THR E 2 92  ? 9.158   -42.980 11.522 1.00 54.19  ? 92  THR E OG1 1 
ATOM   4836 C CG2 . THR E 2 92  ? 10.098  -43.873 13.427 1.00 56.17  ? 92  THR E CG2 1 
ATOM   4837 N N   . ASP E 2 93  ? 10.008  -41.688 15.664 1.00 55.82  ? 93  ASP E N   1 
ATOM   4838 C CA  . ASP E 2 93  ? 10.717  -41.693 16.925 1.00 56.07  ? 93  ASP E CA  1 
ATOM   4839 C C   . ASP E 2 93  ? 11.235  -43.116 17.123 1.00 56.39  ? 93  ASP E C   1 
ATOM   4840 O O   . ASP E 2 93  ? 10.493  -44.027 17.510 1.00 55.67  ? 93  ASP E O   1 
ATOM   4841 C CB  . ASP E 2 93  ? 9.779   -41.280 18.052 1.00 56.73  ? 93  ASP E CB  1 
ATOM   4842 C CG  . ASP E 2 93  ? 10.372  -41.533 19.419 1.00 58.07  ? 93  ASP E CG  1 
ATOM   4843 O OD1 . ASP E 2 93  ? 11.506  -41.079 19.657 1.00 59.44  ? 93  ASP E OD1 1 
ATOM   4844 O OD2 . ASP E 2 93  ? 9.763   -42.178 20.301 1.00 57.59  ? 93  ASP E OD2 1 
ATOM   4845 N N   . CYS E 2 94  ? 12.519  -43.286 16.839 1.00 57.22  ? 94  CYS E N   1 
ATOM   4846 C CA  . CYS E 2 94  ? 13.159  -44.583 16.825 1.00 57.76  ? 94  CYS E CA  1 
ATOM   4847 C C   . CYS E 2 94  ? 13.612  -44.948 18.218 1.00 58.47  ? 94  CYS E C   1 
ATOM   4848 O O   . CYS E 2 94  ? 14.448  -44.267 18.805 1.00 61.83  ? 94  CYS E O   1 
ATOM   4849 C CB  . CYS E 2 94  ? 14.332  -44.542 15.856 1.00 58.91  ? 94  CYS E CB  1 
ATOM   4850 S SG  . CYS E 2 94  ? 13.847  -43.914 14.221 1.00 63.08  ? 94  CYS E SG  1 
ATOM   4851 N N   . THR E 2 95  ? 13.049  -46.024 18.750 1.00 58.63  ? 95  THR E N   1 
ATOM   4852 C CA  . THR E 2 95  ? 13.322  -46.448 20.119 1.00 58.67  ? 95  THR E CA  1 
ATOM   4853 C C   . THR E 2 95  ? 13.489  -47.944 20.210 1.00 57.38  ? 95  THR E C   1 
ATOM   4854 O O   . THR E 2 95  ? 13.179  -48.661 19.269 1.00 56.95  ? 95  THR E O   1 
ATOM   4855 C CB  . THR E 2 95  ? 12.157  -46.063 21.037 1.00 60.13  ? 95  THR E CB  1 
ATOM   4856 O OG1 . THR E 2 95  ? 10.925  -46.134 20.302 1.00 58.97  ? 95  THR E OG1 1 
ATOM   4857 C CG2 . THR E 2 95  ? 12.278  -44.617 21.471 1.00 61.81  ? 95  THR E CG2 1 
ATOM   4858 N N   . VAL E 2 96  ? 13.982  -48.401 21.356 1.00 57.49  ? 96  VAL E N   1 
ATOM   4859 C CA  . VAL E 2 96  ? 14.042  -49.824 21.655 1.00 58.06  ? 96  VAL E CA  1 
ATOM   4860 C C   . VAL E 2 96  ? 12.672  -50.187 22.194 1.00 58.55  ? 96  VAL E C   1 
ATOM   4861 O O   . VAL E 2 96  ? 12.126  -51.254 21.896 1.00 58.82  ? 96  VAL E O   1 
ATOM   4862 C CB  . VAL E 2 96  ? 15.118  -50.150 22.715 1.00 57.96  ? 96  VAL E CB  1 
ATOM   4863 C CG1 . VAL E 2 96  ? 15.399  -51.657 22.764 1.00 58.17  ? 96  VAL E CG1 1 
ATOM   4864 C CG2 . VAL E 2 96  ? 16.392  -49.409 22.404 1.00 57.36  ? 96  VAL E CG2 1 
ATOM   4865 N N   . ARG E 2 97  ? 12.117  -49.274 22.983 1.00 58.63  ? 97  ARG E N   1 
ATOM   4866 C CA  . ARG E 2 97  ? 10.819  -49.474 23.569 1.00 59.20  ? 97  ARG E CA  1 
ATOM   4867 C C   . ARG E 2 97  ? 10.136  -48.137 23.665 1.00 59.74  ? 97  ARG E C   1 
ATOM   4868 O O   . ARG E 2 97  ? 10.732  -47.155 24.089 1.00 60.44  ? 97  ARG E O   1 
ATOM   4869 C CB  . ARG E 2 97  ? 10.955  -50.087 24.958 1.00 59.92  ? 97  ARG E CB  1 
ATOM   4870 C CG  . ARG E 2 97  ? 9.937   -51.158 25.248 1.00 63.00  ? 97  ARG E CG  1 
ATOM   4871 C CD  . ARG E 2 97  ? 10.180  -52.423 24.452 1.00 68.55  ? 97  ARG E CD  1 
ATOM   4872 N NE  . ARG E 2 97  ? 9.038   -53.336 24.470 1.00 73.39  ? 97  ARG E NE  1 
ATOM   4873 C CZ  . ARG E 2 97  ? 9.136   -54.662 24.368 1.00 75.65  ? 97  ARG E CZ  1 
ATOM   4874 N NH1 . ARG E 2 97  ? 10.327  -55.244 24.256 1.00 77.06  ? 97  ARG E NH1 1 
ATOM   4875 N NH2 . ARG E 2 97  ? 8.042   -55.413 24.388 1.00 76.72  ? 97  ARG E NH2 1 
ATOM   4876 N N   . GLY E 2 98  ? 8.881   -48.108 23.244 1.00 61.58  ? 98  GLY E N   1 
ATOM   4877 C CA  . GLY E 2 98  ? 8.055   -46.921 23.379 1.00 61.25  ? 98  GLY E CA  1 
ATOM   4878 C C   . GLY E 2 98  ? 7.015   -47.167 24.447 1.00 61.47  ? 98  GLY E C   1 
ATOM   4879 O O   . GLY E 2 98  ? 7.098   -48.149 25.184 1.00 61.61  ? 98  GLY E O   1 
ATOM   4880 N N   . LEU E 2 99  ? 6.022   -46.289 24.514 1.00 61.67  ? 99  LEU E N   1 
ATOM   4881 C CA  . LEU E 2 99  ? 5.007   -46.359 25.554 1.00 62.73  ? 99  LEU E CA  1 
ATOM   4882 C C   . LEU E 2 99  ? 3.918   -47.407 25.349 1.00 63.31  ? 99  LEU E C   1 
ATOM   4883 O O   . LEU E 2 99  ? 3.133   -47.675 26.263 1.00 63.26  ? 99  LEU E O   1 
ATOM   4884 C CB  . LEU E 2 99  ? 4.373   -44.981 25.739 1.00 63.04  ? 99  LEU E CB  1 
ATOM   4885 C CG  . LEU E 2 99  ? 5.058   -44.100 26.774 1.00 63.20  ? 99  LEU E CG  1 
ATOM   4886 C CD1 . LEU E 2 99  ? 4.312   -42.782 26.894 1.00 62.42  ? 99  LEU E CD1 1 
ATOM   4887 C CD2 . LEU E 2 99  ? 5.080   -44.845 28.107 1.00 62.64  ? 99  LEU E CD2 1 
ATOM   4888 N N   . GLY E 2 100 ? 3.882   -48.006 24.161 1.00 63.72  ? 100 GLY E N   1 
ATOM   4889 C CA  . GLY E 2 100 ? 2.839   -48.966 23.820 1.00 64.72  ? 100 GLY E CA  1 
ATOM   4890 C C   . GLY E 2 100 ? 1.873   -48.328 22.838 1.00 65.47  ? 100 GLY E C   1 
ATOM   4891 O O   . GLY E 2 100 ? 1.796   -47.102 22.762 1.00 64.82  ? 100 GLY E O   1 
ATOM   4892 N N   . PRO E 2 101 ? 1.122   -49.141 22.093 1.00 66.07  ? 101 PRO E N   1 
ATOM   4893 C CA  . PRO E 2 101 ? 0.197   -48.608 21.087 1.00 65.85  ? 101 PRO E CA  1 
ATOM   4894 C C   . PRO E 2 101 ? -1.107  -48.146 21.725 1.00 65.55  ? 101 PRO E C   1 
ATOM   4895 O O   . PRO E 2 101 ? -1.657  -47.102 21.354 1.00 64.79  ? 101 PRO E O   1 
ATOM   4896 C CB  . PRO E 2 101 ? -0.025  -49.797 20.144 1.00 65.84  ? 101 PRO E CB  1 
ATOM   4897 C CG  . PRO E 2 101 ? 0.850   -50.939 20.714 1.00 66.96  ? 101 PRO E CG  1 
ATOM   4898 C CD  . PRO E 2 101 ? 1.072   -50.613 22.156 1.00 66.21  ? 101 PRO E CD  1 
ATOM   4899 N N   . SER E 2 102 ? -1.579  -48.932 22.688 1.00 63.55  ? 102 SER E N   1 
ATOM   4900 C CA  . SER E 2 102 ? -2.786  -48.631 23.435 1.00 62.91  ? 102 SER E CA  1 
ATOM   4901 C C   . SER E 2 102 ? -2.383  -48.120 24.807 1.00 62.80  ? 102 SER E C   1 
ATOM   4902 O O   . SER E 2 102 ? -2.671  -48.749 25.829 1.00 62.31  ? 102 SER E O   1 
ATOM   4903 C CB  . SER E 2 102 ? -3.656  -49.886 23.565 1.00 62.80  ? 102 SER E CB  1 
ATOM   4904 O OG  . SER E 2 102 ? -2.890  -50.992 24.012 1.00 62.14  ? 102 SER E OG  1 
ATOM   4905 N N   . TYR E 2 103 ? -1.688  -46.986 24.828 1.00 63.09  ? 103 TYR E N   1 
ATOM   4906 C CA  . TYR E 2 103 ? -1.325  -46.366 26.094 1.00 64.15  ? 103 TYR E CA  1 
ATOM   4907 C C   . TYR E 2 103 ? -2.289  -45.254 26.470 1.00 65.43  ? 103 TYR E C   1 
ATOM   4908 O O   . TYR E 2 103 ? -2.488  -44.297 25.717 1.00 64.70  ? 103 TYR E O   1 
ATOM   4909 C CB  . TYR E 2 103 ? 0.111   -45.837 26.094 1.00 62.60  ? 103 TYR E CB  1 
ATOM   4910 C CG  . TYR E 2 103 ? 0.490   -45.205 27.417 1.00 60.33  ? 103 TYR E CG  1 
ATOM   4911 C CD1 . TYR E 2 103 ? 0.923   -45.989 28.482 1.00 58.95  ? 103 TYR E CD1 1 
ATOM   4912 C CD2 . TYR E 2 103 ? 0.390   -43.826 27.611 1.00 58.48  ? 103 TYR E CD2 1 
ATOM   4913 C CE1 . TYR E 2 103 ? 1.257   -45.422 29.694 1.00 56.55  ? 103 TYR E CE1 1 
ATOM   4914 C CE2 . TYR E 2 103 ? 0.722   -43.251 28.822 1.00 55.81  ? 103 TYR E CE2 1 
ATOM   4915 C CZ  . TYR E 2 103 ? 1.153   -44.057 29.858 1.00 56.19  ? 103 TYR E CZ  1 
ATOM   4916 O OH  . TYR E 2 103 ? 1.487   -43.497 31.064 1.00 57.18  ? 103 TYR E OH  1 
ATOM   4917 N N   . CYS E 2 104 ? -2.866  -45.390 27.658 1.00 67.62  ? 104 CYS E N   1 
ATOM   4918 C CA  . CYS E 2 104 ? -3.806  -44.418 28.169 1.00 70.03  ? 104 CYS E CA  1 
ATOM   4919 C C   . CYS E 2 104 ? -3.313  -43.858 29.495 1.00 70.23  ? 104 CYS E C   1 
ATOM   4920 O O   . CYS E 2 104 ? -3.153  -44.596 30.473 1.00 69.73  ? 104 CYS E O   1 
ATOM   4921 C CB  . CYS E 2 104 ? -5.174  -45.063 28.333 1.00 71.82  ? 104 CYS E CB  1 
ATOM   4922 S SG  . CYS E 2 104 ? -6.487  -43.845 28.522 1.00 79.01  ? 104 CYS E SG  1 
ATOM   4923 N N   . SER E 2 105 ? -3.074  -42.548 29.520 1.00 70.92  ? 105 SER E N   1 
ATOM   4924 C CA  . SER E 2 105 ? -2.538  -41.882 30.707 1.00 72.08  ? 105 SER E CA  1 
ATOM   4925 C C   . SER E 2 105 ? -3.486  -41.898 31.905 1.00 73.47  ? 105 SER E C   1 
ATOM   4926 O O   . SER E 2 105 ? -3.124  -41.448 32.994 1.00 74.26  ? 105 SER E O   1 
ATOM   4927 C CB  . SER E 2 105 ? -2.101  -40.445 30.382 1.00 71.24  ? 105 SER E CB  1 
ATOM   4928 O OG  . SER E 2 105 ? -3.070  -39.770 29.604 1.00 69.65  ? 105 SER E OG  1 
ATOM   4929 N N   . PHE E 2 106 ? -4.686  -42.437 31.705 1.00 74.19  ? 106 PHE E N   1 
ATOM   4930 C CA  . PHE E 2 106 ? -5.687  -42.498 32.757 1.00 76.05  ? 106 PHE E CA  1 
ATOM   4931 C C   . PHE E 2 106 ? -6.057  -43.936 33.083 1.00 78.73  ? 106 PHE E C   1 
ATOM   4932 O O   . PHE E 2 106 ? -6.423  -44.704 32.186 1.00 79.88  ? 106 PHE E O   1 
ATOM   4933 C CB  . PHE E 2 106 ? -6.938  -41.721 32.341 1.00 74.90  ? 106 PHE E CB  1 
ATOM   4934 C CG  . PHE E 2 106 ? -6.645  -40.379 31.732 1.00 74.20  ? 106 PHE E CG  1 
ATOM   4935 C CD1 . PHE E 2 106 ? -6.206  -39.318 32.519 1.00 74.59  ? 106 PHE E CD1 1 
ATOM   4936 C CD2 . PHE E 2 106 ? -6.806  -40.176 30.370 1.00 72.91  ? 106 PHE E CD2 1 
ATOM   4937 C CE1 . PHE E 2 106 ? -5.927  -38.073 31.954 1.00 73.82  ? 106 PHE E CE1 1 
ATOM   4938 C CE2 . PHE E 2 106 ? -6.538  -38.933 29.799 1.00 73.03  ? 106 PHE E CE2 1 
ATOM   4939 C CZ  . PHE E 2 106 ? -6.094  -37.881 30.591 1.00 72.83  ? 106 PHE E CZ  1 
ATOM   4940 N N   . GLY E 2 107 ? -5.952  -44.290 34.371 1.00 81.72  ? 107 GLY E N   1 
ATOM   4941 C CA  . GLY E 2 107 ? -6.327  -45.622 34.843 1.00 84.37  ? 107 GLY E CA  1 
ATOM   4942 C C   . GLY E 2 107 ? -5.156  -46.586 34.934 1.00 86.11  ? 107 GLY E C   1 
ATOM   4943 O O   . GLY E 2 107 ? -5.187  -47.670 34.329 1.00 87.00  ? 107 GLY E O   1 
ATOM   4944 N N   . CYS F 3 2   ? 13.405  -60.998 41.095 1.00 54.32  ? 18  CYS F N   1 
ATOM   4945 C CA  . CYS F 3 2   ? 13.803  -59.710 41.713 1.00 53.36  ? 18  CYS F CA  1 
ATOM   4946 C C   . CYS F 3 2   ? 12.594  -58.857 42.079 1.00 50.06  ? 18  CYS F C   1 
ATOM   4947 O O   . CYS F 3 2   ? 11.560  -58.910 41.419 1.00 47.80  ? 18  CYS F O   1 
ATOM   4948 C CB  . CYS F 3 2   ? 14.706  -58.936 40.760 1.00 56.49  ? 18  CYS F CB  1 
ATOM   4949 S SG  . CYS F 3 2   ? 15.133  -57.270 41.315 1.00 68.78  ? 18  CYS F SG  1 
ATOM   4950 N N   . HIS F 3 3   ? 12.743  -58.058 43.132 1.00 48.52  ? 19  HIS F N   1 
ATOM   4951 C CA  . HIS F 3 3   ? 11.682  -57.163 43.573 1.00 47.90  ? 19  HIS F CA  1 
ATOM   4952 C C   . HIS F 3 3   ? 12.243  -55.902 44.207 1.00 48.18  ? 19  HIS F C   1 
ATOM   4953 O O   . HIS F 3 3   ? 13.170  -55.957 45.015 1.00 48.94  ? 19  HIS F O   1 
ATOM   4954 C CB  . HIS F 3 3   ? 10.759  -57.880 44.546 1.00 46.09  ? 19  HIS F CB  1 
ATOM   4955 C CG  . HIS F 3 3   ? 9.548   -57.082 44.950 1.00 45.35  ? 19  HIS F CG  1 
ATOM   4956 N ND1 . HIS F 3 3   ? 8.328   -57.205 44.321 1.00 46.62  ? 19  HIS F ND1 1 
ATOM   4957 C CD2 . HIS F 3 3   ? 9.384   -56.166 45.931 1.00 45.12  ? 19  HIS F CD2 1 
ATOM   4958 C CE1 . HIS F 3 3   ? 7.457   -56.399 44.899 1.00 46.56  ? 19  HIS F CE1 1 
ATOM   4959 N NE2 . HIS F 3 3   ? 8.074   -55.756 45.878 1.00 44.95  ? 19  HIS F NE2 1 
ATOM   4960 N N   . HIS F 3 4   ? 11.663  -54.763 43.833 1.00 47.45  ? 20  HIS F N   1 
ATOM   4961 C CA  . HIS F 3 4   ? 12.055  -53.463 44.379 1.00 46.35  ? 20  HIS F CA  1 
ATOM   4962 C C   . HIS F 3 4   ? 10.836  -52.712 44.914 1.00 46.24  ? 20  HIS F C   1 
ATOM   4963 O O   . HIS F 3 4   ? 9.745   -52.833 44.367 1.00 46.15  ? 20  HIS F O   1 
ATOM   4964 C CB  . HIS F 3 4   ? 12.752  -52.627 43.304 1.00 45.96  ? 20  HIS F CB  1 
ATOM   4965 C CG  . HIS F 3 4   ? 13.394  -51.385 43.846 1.00 46.44  ? 20  HIS F CG  1 
ATOM   4966 N ND1 . HIS F 3 4   ? 12.679  -50.247 44.152 1.00 47.98  ? 20  HIS F ND1 1 
ATOM   4967 C CD2 . HIS F 3 4   ? 14.684  -51.116 44.152 1.00 45.62  ? 20  HIS F CD2 1 
ATOM   4968 C CE1 . HIS F 3 4   ? 13.500  -49.329 44.627 1.00 48.51  ? 20  HIS F CE1 1 
ATOM   4969 N NE2 . HIS F 3 4   ? 14.724  -49.831 44.637 1.00 48.50  ? 20  HIS F NE2 1 
ATOM   4970 N N   . ARG F 3 5   ? 11.020  -51.932 45.975 1.00 47.94  ? 21  ARG F N   1 
ATOM   4971 C CA  . ARG F 3 5   ? 9.909   -51.181 46.564 1.00 50.81  ? 21  ARG F CA  1 
ATOM   4972 C C   . ARG F 3 5   ? 9.111   -50.400 45.525 1.00 52.91  ? 21  ARG F C   1 
ATOM   4973 O O   . ARG F 3 5   ? 7.877   -50.438 45.521 1.00 52.90  ? 21  ARG F O   1 
ATOM   4974 C CB  . ARG F 3 5   ? 10.400  -50.230 47.659 1.00 49.67  ? 21  ARG F CB  1 
ATOM   4975 C CG  . ARG F 3 5   ? 10.341  -50.834 49.044 1.00 52.57  ? 21  ARG F CG  1 
ATOM   4976 C CD  . ARG F 3 5   ? 10.497  -49.822 50.179 1.00 54.90  ? 21  ARG F CD  1 
ATOM   4977 N NE  . ARG F 3 5   ? 10.531  -50.466 51.494 1.00 54.84  ? 21  ARG F NE  1 
ATOM   4978 C CZ  . ARG F 3 5   ? 9.454   -50.850 52.177 1.00 55.20  ? 21  ARG F CZ  1 
ATOM   4979 N NH1 . ARG F 3 5   ? 8.236   -50.664 51.678 1.00 54.33  ? 21  ARG F NH1 1 
ATOM   4980 N NH2 . ARG F 3 5   ? 9.592   -51.416 53.370 1.00 54.88  ? 21  ARG F NH2 1 
ATOM   4981 N N   . ILE F 3 6   ? 9.822   -49.714 44.635 1.00 55.49  ? 22  ILE F N   1 
ATOM   4982 C CA  . ILE F 3 6   ? 9.179   -48.839 43.667 1.00 56.70  ? 22  ILE F CA  1 
ATOM   4983 C C   . ILE F 3 6   ? 9.377   -49.259 42.209 1.00 57.60  ? 22  ILE F C   1 
ATOM   4984 O O   . ILE F 3 6   ? 8.456   -49.104 41.402 1.00 58.61  ? 22  ILE F O   1 
ATOM   4985 C CB  . ILE F 3 6   ? 9.593   -47.359 43.928 1.00 56.98  ? 22  ILE F CB  1 
ATOM   4986 C CG1 . ILE F 3 6   ? 8.516   -46.407 43.420 1.00 56.62  ? 22  ILE F CG1 1 
ATOM   4987 C CG2 . ILE F 3 6   ? 10.976  -47.047 43.360 1.00 56.48  ? 22  ILE F CG2 1 
ATOM   4988 C CD1 . ILE F 3 6   ? 8.305   -45.218 44.342 1.00 59.59  ? 22  ILE F CD1 1 
ATOM   4989 N N   . CYS F 3 7   ? 10.549  -49.813 41.886 1.00 57.98  ? 23  CYS F N   1 
ATOM   4990 C CA  . CYS F 3 7   ? 10.866  -50.226 40.512 1.00 58.17  ? 23  CYS F CA  1 
ATOM   4991 C C   . CYS F 3 7   ? 10.461  -51.657 40.200 1.00 57.61  ? 23  CYS F C   1 
ATOM   4992 O O   . CYS F 3 7   ? 10.492  -52.521 41.066 1.00 57.56  ? 23  CYS F O   1 
ATOM   4993 C CB  . CYS F 3 7   ? 12.359  -50.064 40.228 1.00 58.02  ? 23  CYS F CB  1 
ATOM   4994 S SG  . CYS F 3 7   ? 12.968  -48.394 40.555 1.00 60.30  ? 23  CYS F SG  1 
ATOM   4995 N N   . HIS F 3 8   ? 10.082  -51.896 38.952 1.00 58.80  ? 24  HIS F N   1 
ATOM   4996 C CA  . HIS F 3 8   ? 9.754   -53.233 38.488 1.00 60.31  ? 24  HIS F CA  1 
ATOM   4997 C C   . HIS F 3 8   ? 11.045  -53.838 37.999 1.00 59.92  ? 24  HIS F C   1 
ATOM   4998 O O   . HIS F 3 8   ? 11.587  -53.386 37.000 1.00 61.21  ? 24  HIS F O   1 
ATOM   4999 C CB  . HIS F 3 8   ? 8.761   -53.190 37.317 1.00 62.07  ? 24  HIS F CB  1 
ATOM   5000 C CG  . HIS F 3 8   ? 7.713   -52.127 37.445 1.00 67.18  ? 24  HIS F CG  1 
ATOM   5001 N ND1 . HIS F 3 8   ? 6.676   -52.203 38.355 1.00 69.19  ? 24  HIS F ND1 1 
ATOM   5002 C CD2 . HIS F 3 8   ? 7.539   -50.961 36.775 1.00 68.43  ? 24  HIS F CD2 1 
ATOM   5003 C CE1 . HIS F 3 8   ? 5.915   -51.129 38.244 1.00 70.51  ? 24  HIS F CE1 1 
ATOM   5004 N NE2 . HIS F 3 8   ? 6.416   -50.358 37.291 1.00 70.24  ? 24  HIS F NE2 1 
ATOM   5005 N N   . CYS F 3 9   ? 11.561  -54.843 38.696 1.00 60.93  ? 25  CYS F N   1 
ATOM   5006 C CA  . CYS F 3 9   ? 12.779  -55.472 38.215 1.00 61.91  ? 25  CYS F CA  1 
ATOM   5007 C C   . CYS F 3 9   ? 12.617  -56.920 37.827 1.00 61.72  ? 25  CYS F C   1 
ATOM   5008 O O   . CYS F 3 9   ? 11.831  -57.656 38.415 1.00 62.24  ? 25  CYS F O   1 
ATOM   5009 C CB  . CYS F 3 9   ? 13.940  -55.319 39.195 1.00 62.65  ? 25  CYS F CB  1 
ATOM   5010 S SG  . CYS F 3 9   ? 13.673  -55.919 40.883 1.00 67.32  ? 25  CYS F SG  1 
ATOM   5011 N N   . SER F 3 10  ? 13.366  -57.300 36.801 1.00 63.63  ? 26  SER F N   1 
ATOM   5012 C CA  . SER F 3 10  ? 13.422  -58.665 36.333 1.00 64.03  ? 26  SER F CA  1 
ATOM   5013 C C   . SER F 3 10  ? 14.837  -59.171 36.589 1.00 64.33  ? 26  SER F C   1 
ATOM   5014 O O   . SER F 3 10  ? 15.359  -59.038 37.698 1.00 65.32  ? 26  SER F O   1 
ATOM   5015 C CB  . SER F 3 10  ? 13.078  -58.730 34.849 1.00 63.19  ? 26  SER F CB  1 
ATOM   5016 O OG  . SER F 3 10  ? 13.025  -60.076 34.416 1.00 63.30  ? 26  SER F OG  1 
ATOM   5017 N N   . ASN F 3 11  ? 15.459  -59.728 35.561 1.00 64.99  ? 27  ASN F N   1 
ATOM   5018 C CA  . ASN F 3 11  ? 16.813  -60.243 35.674 1.00 67.13  ? 27  ASN F CA  1 
ATOM   5019 C C   . ASN F 3 11  ? 17.825  -59.113 35.808 1.00 65.76  ? 27  ASN F C   1 
ATOM   5020 O O   . ASN F 3 11  ? 18.354  -58.643 34.806 1.00 68.47  ? 27  ASN F O   1 
ATOM   5021 C CB  . ASN F 3 11  ? 17.140  -61.128 34.461 1.00 68.80  ? 27  ASN F CB  1 
ATOM   5022 C CG  . ASN F 3 11  ? 16.173  -62.296 34.310 1.00 72.60  ? 27  ASN F CG  1 
ATOM   5023 O OD1 . ASN F 3 11  ? 15.080  -62.155 33.745 1.00 76.23  ? 27  ASN F OD1 1 
ATOM   5024 N ND2 . ASN F 3 11  ? 16.569  -63.455 34.823 1.00 73.17  ? 27  ASN F ND2 1 
ATOM   5025 N N   . ARG F 3 12  ? 18.072  -58.677 37.046 1.00 63.74  ? 28  ARG F N   1 
ATOM   5026 C CA  . ARG F 3 12  ? 19.018  -57.584 37.364 1.00 61.42  ? 28  ARG F CA  1 
ATOM   5027 C C   . ARG F 3 12  ? 18.887  -56.285 36.512 1.00 59.44  ? 28  ARG F C   1 
ATOM   5028 O O   . ARG F 3 12  ? 19.829  -55.484 36.391 1.00 57.16  ? 28  ARG F O   1 
ATOM   5029 C CB  . ARG F 3 12  ? 20.462  -58.120 37.377 1.00 61.48  ? 28  ARG F CB  1 
ATOM   5030 C CG  . ARG F 3 12  ? 20.836  -58.834 38.678 1.00 63.10  ? 28  ARG F CG  1 
ATOM   5031 C CD  . ARG F 3 12  ? 22.291  -58.627 39.099 1.00 64.47  ? 28  ARG F CD  1 
ATOM   5032 N NE  . ARG F 3 12  ? 23.212  -59.529 38.401 1.00 67.26  ? 28  ARG F NE  1 
ATOM   5033 C CZ  . ARG F 3 12  ? 24.513  -59.294 38.192 1.00 67.47  ? 28  ARG F CZ  1 
ATOM   5034 N NH1 . ARG F 3 12  ? 25.081  -58.166 38.613 1.00 66.78  ? 28  ARG F NH1 1 
ATOM   5035 N NH2 . ARG F 3 12  ? 25.255  -60.188 37.541 1.00 68.83  ? 28  ARG F NH2 1 
ATOM   5036 N N   . VAL F 3 13  ? 17.706  -56.100 35.942 1.00 55.97  ? 29  VAL F N   1 
ATOM   5037 C CA  . VAL F 3 13  ? 17.382  -54.964 35.102 1.00 53.24  ? 29  VAL F CA  1 
ATOM   5038 C C   . VAL F 3 13  ? 16.213  -54.265 35.762 1.00 53.47  ? 29  VAL F C   1 
ATOM   5039 O O   . VAL F 3 13  ? 15.132  -54.848 35.871 1.00 56.28  ? 29  VAL F O   1 
ATOM   5040 C CB  . VAL F 3 13  ? 16.955  -55.431 33.677 1.00 52.89  ? 29  VAL F CB  1 
ATOM   5041 C CG1 . VAL F 3 13  ? 16.113  -54.378 32.966 1.00 48.38  ? 29  VAL F CG1 1 
ATOM   5042 C CG2 . VAL F 3 13  ? 18.170  -55.830 32.842 1.00 51.95  ? 29  VAL F CG2 1 
ATOM   5043 N N   . PHE F 3 14  ? 16.412  -53.026 36.209 1.00 51.07  ? 30  PHE F N   1 
ATOM   5044 C CA  . PHE F 3 14  ? 15.353  -52.281 36.899 1.00 49.23  ? 30  PHE F CA  1 
ATOM   5045 C C   . PHE F 3 14  ? 14.677  -51.268 36.000 1.00 47.26  ? 30  PHE F C   1 
ATOM   5046 O O   . PHE F 3 14  ? 15.344  -50.505 35.311 1.00 48.90  ? 30  PHE F O   1 
ATOM   5047 C CB  . PHE F 3 14  ? 15.921  -51.573 38.120 1.00 50.48  ? 30  PHE F CB  1 
ATOM   5048 C CG  . PHE F 3 14  ? 16.440  -52.509 39.151 1.00 52.15  ? 30  PHE F CG  1 
ATOM   5049 C CD1 . PHE F 3 14  ? 17.756  -52.955 39.104 1.00 54.14  ? 30  PHE F CD1 1 
ATOM   5050 C CD2 . PHE F 3 14  ? 15.614  -52.966 40.166 1.00 53.84  ? 30  PHE F CD2 1 
ATOM   5051 C CE1 . PHE F 3 14  ? 18.238  -53.837 40.054 1.00 55.65  ? 30  PHE F CE1 1 
ATOM   5052 C CE2 . PHE F 3 14  ? 16.083  -53.847 41.127 1.00 54.86  ? 30  PHE F CE2 1 
ATOM   5053 C CZ  . PHE F 3 14  ? 17.387  -54.291 41.067 1.00 55.33  ? 30  PHE F CZ  1 
ATOM   5054 N N   . LEU F 3 15  ? 13.350  -51.263 36.022 1.00 45.57  ? 31  LEU F N   1 
ATOM   5055 C CA  . LEU F 3 15  ? 12.565  -50.303 35.255 1.00 45.95  ? 31  LEU F CA  1 
ATOM   5056 C C   . LEU F 3 15  ? 11.729  -49.443 36.191 1.00 47.53  ? 31  LEU F C   1 
ATOM   5057 O O   . LEU F 3 15  ? 10.717  -49.912 36.711 1.00 49.62  ? 31  LEU F O   1 
ATOM   5058 C CB  . LEU F 3 15  ? 11.631  -51.013 34.272 1.00 44.64  ? 31  LEU F CB  1 
ATOM   5059 C CG  . LEU F 3 15  ? 10.555  -50.105 33.655 1.00 43.66  ? 31  LEU F CG  1 
ATOM   5060 C CD1 . LEU F 3 15  ? 11.164  -49.167 32.607 1.00 46.36  ? 31  LEU F CD1 1 
ATOM   5061 C CD2 . LEU F 3 15  ? 9.414   -50.882 33.063 1.00 40.91  ? 31  LEU F CD2 1 
ATOM   5062 N N   . CYS F 3 16  ? 12.134  -48.188 36.405 1.00 49.61  ? 32  CYS F N   1 
ATOM   5063 C CA  . CYS F 3 16  ? 11.391  -47.277 37.294 1.00 52.23  ? 32  CYS F CA  1 
ATOM   5064 C C   . CYS F 3 16  ? 10.519  -46.365 36.470 1.00 51.97  ? 32  CYS F C   1 
ATOM   5065 O O   . CYS F 3 16  ? 10.969  -45.322 36.011 1.00 54.77  ? 32  CYS F O   1 
ATOM   5066 C CB  . CYS F 3 16  ? 12.331  -46.443 38.161 1.00 52.91  ? 32  CYS F CB  1 
ATOM   5067 S SG  . CYS F 3 16  ? 13.653  -47.398 38.937 1.00 55.72  ? 32  CYS F SG  1 
ATOM   5068 N N   . GLN F 3 17  ? 9.273   -46.768 36.282 1.00 54.03  ? 33  GLN F N   1 
ATOM   5069 C CA  . GLN F 3 17  ? 8.369   -46.059 35.395 1.00 56.56  ? 33  GLN F CA  1 
ATOM   5070 C C   . GLN F 3 17  ? 7.204   -45.462 36.151 1.00 58.87  ? 33  GLN F C   1 
ATOM   5071 O O   . GLN F 3 17  ? 6.737   -46.041 37.128 1.00 60.64  ? 33  GLN F O   1 
ATOM   5072 C CB  . GLN F 3 17  ? 7.894   -47.030 34.315 1.00 56.15  ? 33  GLN F CB  1 
ATOM   5073 C CG  . GLN F 3 17  ? 6.622   -46.646 33.576 1.00 57.34  ? 33  GLN F CG  1 
ATOM   5074 C CD  . GLN F 3 17  ? 6.436   -47.504 32.340 1.00 60.38  ? 33  GLN F CD  1 
ATOM   5075 O OE1 . GLN F 3 17  ? 6.953   -48.620 32.272 1.00 61.34  ? 33  GLN F OE1 1 
ATOM   5076 N NE2 . GLN F 3 17  ? 5.712   -47.028 31.328 1.00 60.05  ? 33  GLN F NE2 1 
ATOM   5077 N N   . GLU F 3 18  ? 6.744   -44.293 35.696 1.00 62.21  ? 34  GLU F N   1 
ATOM   5078 C CA  . GLU F 3 18  ? 5.555   -43.659 36.249 1.00 66.03  ? 34  GLU F CA  1 
ATOM   5079 C C   . GLU F 3 18  ? 5.794   -43.408 37.721 1.00 68.43  ? 34  GLU F C   1 
ATOM   5080 O O   . GLU F 3 18  ? 5.219   -44.088 38.571 1.00 71.86  ? 34  GLU F O   1 
ATOM   5081 C CB  . GLU F 3 18  ? 4.339   -44.570 36.082 1.00 65.55  ? 34  GLU F CB  1 
ATOM   5082 C CG  . GLU F 3 18  ? 3.050   -43.837 35.785 1.00 67.43  ? 34  GLU F CG  1 
ATOM   5083 C CD  . GLU F 3 18  ? 2.749   -43.797 34.298 1.00 69.48  ? 34  GLU F CD  1 
ATOM   5084 O OE1 . GLU F 3 18  ? 2.980   -44.822 33.612 1.00 68.49  ? 34  GLU F OE1 1 
ATOM   5085 O OE2 . GLU F 3 18  ? 2.275   -42.741 33.818 1.00 70.27  ? 34  GLU F OE2 1 
ATOM   5086 N N   . SER F 3 19  ? 6.638   -42.443 38.049 1.00 71.74  ? 35  SER F N   1 
ATOM   5087 C CA  . SER F 3 19  ? 7.108   -42.373 39.424 1.00 74.56  ? 35  SER F CA  1 
ATOM   5088 C C   . SER F 3 19  ? 6.265   -41.656 40.466 1.00 76.82  ? 35  SER F C   1 
ATOM   5089 O O   . SER F 3 19  ? 5.538   -40.695 40.196 1.00 75.23  ? 35  SER F O   1 
ATOM   5090 C CB  . SER F 3 19  ? 8.557   -41.889 39.476 1.00 74.72  ? 35  SER F CB  1 
ATOM   5091 O OG  . SER F 3 19  ? 9.443   -42.984 39.669 1.00 72.93  ? 35  SER F OG  1 
ATOM   5092 N N   . LYS F 3 20  ? 6.404   -42.195 41.671 1.00 79.81  ? 36  LYS F N   1 
ATOM   5093 C CA  . LYS F 3 20  ? 5.984   -41.571 42.899 1.00 84.15  ? 36  LYS F CA  1 
ATOM   5094 C C   . LYS F 3 20  ? 7.253   -40.890 43.434 1.00 86.33  ? 36  LYS F C   1 
ATOM   5095 O O   . LYS F 3 20  ? 7.315   -40.428 44.580 1.00 87.59  ? 36  LYS F O   1 
ATOM   5096 C CB  . LYS F 3 20  ? 5.423   -42.629 43.863 1.00 84.46  ? 36  LYS F CB  1 
ATOM   5097 C CG  . LYS F 3 20  ? 5.067   -42.155 45.282 1.00 85.58  ? 36  LYS F CG  1 
ATOM   5098 C CD  . LYS F 3 20  ? 4.091   -40.985 45.293 1.00 86.31  ? 36  LYS F CD  1 
ATOM   5099 C CE  . LYS F 3 20  ? 4.021   -40.359 46.679 1.00 86.24  ? 36  LYS F CE  1 
ATOM   5100 N NZ  . LYS F 3 20  ? 3.470   -38.968 46.642 1.00 86.85  ? 36  LYS F NZ  1 
ATOM   5101 N N   . VAL F 3 21  ? 8.263   -40.815 42.557 1.00 87.98  ? 37  VAL F N   1 
ATOM   5102 C CA  . VAL F 3 21  ? 9.584   -40.270 42.905 1.00 88.21  ? 37  VAL F CA  1 
ATOM   5103 C C   . VAL F 3 21  ? 9.789   -38.810 42.515 1.00 87.58  ? 37  VAL F C   1 
ATOM   5104 O O   . VAL F 3 21  ? 8.921   -38.167 41.921 1.00 87.78  ? 37  VAL F O   1 
ATOM   5105 C CB  . VAL F 3 21  ? 10.740  -41.078 42.265 1.00 88.02  ? 37  VAL F CB  1 
ATOM   5106 C CG1 . VAL F 3 21  ? 10.514  -42.576 42.423 1.00 89.38  ? 37  VAL F CG1 1 
ATOM   5107 C CG2 . VAL F 3 21  ? 10.910  -40.700 40.806 1.00 87.06  ? 37  VAL F CG2 1 
ATOM   5108 N N   . THR F 3 22  ? 10.971  -38.331 42.873 1.00 86.25  ? 38  THR F N   1 
ATOM   5109 C CA  . THR F 3 22  ? 11.461  -37.014 42.529 1.00 87.13  ? 38  THR F CA  1 
ATOM   5110 C C   . THR F 3 22  ? 12.957  -37.184 42.349 1.00 85.58  ? 38  THR F C   1 
ATOM   5111 O O   . THR F 3 22  ? 13.647  -36.325 41.776 1.00 85.53  ? 38  THR F O   1 
ATOM   5112 C CB  . THR F 3 22  ? 11.184  -35.996 43.670 1.00 88.80  ? 38  THR F CB  1 
ATOM   5113 O OG1 . THR F 3 22  ? 11.499  -36.589 44.943 1.00 90.01  ? 38  THR F OG1 1 
ATOM   5114 C CG2 . THR F 3 22  ? 9.700   -35.636 43.746 1.00 89.39  ? 38  THR F CG2 1 
ATOM   5115 N N   . GLU F 3 23  ? 13.447  -38.319 42.843 1.00 82.78  ? 39  GLU F N   1 
ATOM   5116 C CA  . GLU F 3 23  ? 14.871  -38.603 42.933 1.00 80.77  ? 39  GLU F CA  1 
ATOM   5117 C C   . GLU F 3 23  ? 15.112  -40.066 42.593 1.00 76.96  ? 39  GLU F C   1 
ATOM   5118 O O   . GLU F 3 23  ? 14.198  -40.892 42.649 1.00 74.73  ? 39  GLU F O   1 
ATOM   5119 C CB  . GLU F 3 23  ? 15.375  -38.307 44.352 1.00 82.52  ? 39  GLU F CB  1 
ATOM   5120 C CG  . GLU F 3 23  ? 16.779  -37.728 44.428 1.00 84.67  ? 39  GLU F CG  1 
ATOM   5121 C CD  . GLU F 3 23  ? 16.805  -36.208 44.332 1.00 85.09  ? 39  GLU F CD  1 
ATOM   5122 O OE1 . GLU F 3 23  ? 15.724  -35.578 44.413 1.00 85.00  ? 39  GLU F OE1 1 
ATOM   5123 O OE2 . GLU F 3 23  ? 17.910  -35.630 44.180 1.00 84.07  ? 39  GLU F OE2 1 
ATOM   5124 N N   . ILE F 3 24  ? 16.351  -40.357 42.220 1.00 73.57  ? 40  ILE F N   1 
ATOM   5125 C CA  . ILE F 3 24  ? 16.797  -41.701 41.923 1.00 69.55  ? 40  ILE F CA  1 
ATOM   5126 C C   . ILE F 3 24  ? 17.015  -42.457 43.226 1.00 68.65  ? 40  ILE F C   1 
ATOM   5127 O O   . ILE F 3 24  ? 17.898  -42.111 44.012 1.00 68.09  ? 40  ILE F O   1 
ATOM   5128 C CB  . ILE F 3 24  ? 18.080  -41.654 41.074 1.00 68.32  ? 40  ILE F CB  1 
ATOM   5129 C CG1 . ILE F 3 24  ? 17.717  -41.487 39.599 1.00 65.72  ? 40  ILE F CG1 1 
ATOM   5130 C CG2 . ILE F 3 24  ? 18.917  -42.912 41.288 1.00 67.21  ? 40  ILE F CG2 1 
ATOM   5131 C CD1 . ILE F 3 24  ? 18.889  -41.248 38.708 1.00 65.31  ? 40  ILE F CD1 1 
ATOM   5132 N N   . PRO F 3 25  ? 16.185  -43.477 43.453 1.00 68.23  ? 41  PRO F N   1 
ATOM   5133 C CA  . PRO F 3 25  ? 16.244  -44.304 44.659 1.00 68.07  ? 41  PRO F CA  1 
ATOM   5134 C C   . PRO F 3 25  ? 17.652  -44.803 45.007 1.00 67.69  ? 41  PRO F C   1 
ATOM   5135 O O   . PRO F 3 25  ? 18.359  -45.334 44.143 1.00 67.14  ? 41  PRO F O   1 
ATOM   5136 C CB  . PRO F 3 25  ? 15.319  -45.466 44.308 1.00 67.93  ? 41  PRO F CB  1 
ATOM   5137 C CG  . PRO F 3 25  ? 14.289  -44.833 43.445 1.00 67.81  ? 41  PRO F CG  1 
ATOM   5138 C CD  . PRO F 3 25  ? 15.073  -43.895 42.576 1.00 68.44  ? 41  PRO F CD  1 
ATOM   5139 N N   . SER F 3 26  ? 18.046  -44.625 46.267 1.00 67.03  ? 42  SER F N   1 
ATOM   5140 C CA  . SER F 3 26  ? 19.370  -45.044 46.733 1.00 67.88  ? 42  SER F CA  1 
ATOM   5141 C C   . SER F 3 26  ? 19.394  -46.512 47.135 1.00 67.96  ? 42  SER F C   1 
ATOM   5142 O O   . SER F 3 26  ? 20.464  -47.113 47.282 1.00 67.85  ? 42  SER F O   1 
ATOM   5143 C CB  . SER F 3 26  ? 19.829  -44.172 47.895 1.00 66.86  ? 42  SER F CB  1 
ATOM   5144 O OG  . SER F 3 26  ? 18.705  -43.771 48.652 1.00 68.45  ? 42  SER F OG  1 
ATOM   5145 N N   . ASP F 3 27  ? 18.201  -47.081 47.287 1.00 67.62  ? 43  ASP F N   1 
ATOM   5146 C CA  . ASP F 3 27  ? 18.040  -48.481 47.656 1.00 67.05  ? 43  ASP F CA  1 
ATOM   5147 C C   . ASP F 3 27  ? 18.086  -49.406 46.439 1.00 66.04  ? 43  ASP F C   1 
ATOM   5148 O O   . ASP F 3 27  ? 17.642  -50.555 46.500 1.00 66.39  ? 43  ASP F O   1 
ATOM   5149 C CB  . ASP F 3 27  ? 16.744  -48.679 48.450 1.00 69.00  ? 43  ASP F CB  1 
ATOM   5150 C CG  . ASP F 3 27  ? 15.522  -48.149 47.722 1.00 70.36  ? 43  ASP F CG  1 
ATOM   5151 O OD1 . ASP F 3 27  ? 15.612  -47.049 47.138 1.00 69.29  ? 43  ASP F OD1 1 
ATOM   5152 O OD2 . ASP F 3 27  ? 14.436  -48.774 47.710 1.00 72.40  ? 43  ASP F OD2 1 
ATOM   5153 N N   . LEU F 3 28  ? 18.627  -48.897 45.334 1.00 64.61  ? 44  LEU F N   1 
ATOM   5154 C CA  . LEU F 3 28  ? 18.824  -49.699 44.131 1.00 61.84  ? 44  LEU F CA  1 
ATOM   5155 C C   . LEU F 3 28  ? 20.079  -50.536 44.344 1.00 60.91  ? 44  LEU F C   1 
ATOM   5156 O O   . LEU F 3 28  ? 21.108  -50.019 44.787 1.00 58.52  ? 44  LEU F O   1 
ATOM   5157 C CB  . LEU F 3 28  ? 18.955  -48.810 42.883 1.00 61.67  ? 44  LEU F CB  1 
ATOM   5158 C CG  . LEU F 3 28  ? 17.705  -48.169 42.257 1.00 58.85  ? 44  LEU F CG  1 
ATOM   5159 C CD1 . LEU F 3 28  ? 18.082  -47.332 41.068 1.00 58.15  ? 44  LEU F CD1 1 
ATOM   5160 C CD2 . LEU F 3 28  ? 16.704  -49.213 41.827 1.00 58.06  ? 44  LEU F CD2 1 
ATOM   5161 N N   . PRO F 3 29  ? 20.000  -51.828 44.019 1.00 61.87  ? 45  PRO F N   1 
ATOM   5162 C CA  . PRO F 3 29  ? 21.091  -52.765 44.264 1.00 62.69  ? 45  PRO F CA  1 
ATOM   5163 C C   . PRO F 3 29  ? 22.355  -52.249 43.633 1.00 64.04  ? 45  PRO F C   1 
ATOM   5164 O O   . PRO F 3 29  ? 22.286  -51.521 42.654 1.00 67.17  ? 45  PRO F O   1 
ATOM   5165 C CB  . PRO F 3 29  ? 20.620  -54.024 43.554 1.00 61.96  ? 45  PRO F CB  1 
ATOM   5166 C CG  . PRO F 3 29  ? 19.162  -53.931 43.621 1.00 61.44  ? 45  PRO F CG  1 
ATOM   5167 C CD  . PRO F 3 29  ? 18.881  -52.485 43.323 1.00 61.98  ? 45  PRO F CD  1 
ATOM   5168 N N   . ARG F 3 30  ? 23.509  -52.600 44.178 1.00 65.00  ? 46  ARG F N   1 
ATOM   5169 C CA  . ARG F 3 30  ? 24.742  -52.079 43.610 1.00 66.60  ? 46  ARG F CA  1 
ATOM   5170 C C   . ARG F 3 30  ? 25.314  -53.044 42.569 1.00 66.62  ? 46  ARG F C   1 
ATOM   5171 O O   . ARG F 3 30  ? 26.407  -52.821 42.026 1.00 68.88  ? 46  ARG F O   1 
ATOM   5172 C CB  . ARG F 3 30  ? 25.747  -51.771 44.722 1.00 67.88  ? 46  ARG F CB  1 
ATOM   5173 C CG  . ARG F 3 30  ? 26.538  -50.495 44.495 1.00 71.57  ? 46  ARG F CG  1 
ATOM   5174 C CD  . ARG F 3 30  ? 26.794  -49.713 45.777 1.00 75.53  ? 46  ARG F CD  1 
ATOM   5175 N NE  . ARG F 3 30  ? 25.956  -48.516 45.874 1.00 78.85  ? 46  ARG F NE  1 
ATOM   5176 C CZ  . ARG F 3 30  ? 24.662  -48.513 46.191 1.00 80.82  ? 46  ARG F CZ  1 
ATOM   5177 N NH1 . ARG F 3 30  ? 24.019  -49.650 46.442 1.00 81.96  ? 46  ARG F NH1 1 
ATOM   5178 N NH2 . ARG F 3 30  ? 24.002  -47.365 46.250 1.00 82.12  ? 46  ARG F NH2 1 
ATOM   5179 N N   . ASN F 3 31  ? 24.548  -54.100 42.285 1.00 64.61  ? 47  ASN F N   1 
ATOM   5180 C CA  . ASN F 3 31  ? 24.941  -55.138 41.331 1.00 62.24  ? 47  ASN F CA  1 
ATOM   5181 C C   . ASN F 3 31  ? 24.056  -55.105 40.084 1.00 59.82  ? 47  ASN F C   1 
ATOM   5182 O O   . ASN F 3 31  ? 24.004  -56.067 39.318 1.00 56.69  ? 47  ASN F O   1 
ATOM   5183 C CB  . ASN F 3 31  ? 24.879  -56.522 41.999 1.00 63.85  ? 47  ASN F CB  1 
ATOM   5184 C CG  . ASN F 3 31  ? 23.455  -56.924 42.417 1.00 65.89  ? 47  ASN F CG  1 
ATOM   5185 O OD1 . ASN F 3 31  ? 22.688  -56.103 42.924 1.00 66.89  ? 47  ASN F OD1 1 
ATOM   5186 N ND2 . ASN F 3 31  ? 23.111  -58.201 42.212 1.00 67.81  ? 47  ASN F ND2 1 
ATOM   5187 N N   . ALA F 3 32  ? 23.365  -53.985 39.887 1.00 57.89  ? 48  ALA F N   1 
ATOM   5188 C CA  . ALA F 3 32  ? 22.475  -53.823 38.735 1.00 56.11  ? 48  ALA F CA  1 
ATOM   5189 C C   . ALA F 3 32  ? 23.248  -53.820 37.426 1.00 53.68  ? 48  ALA F C   1 
ATOM   5190 O O   . ALA F 3 32  ? 24.434  -53.476 37.394 1.00 54.04  ? 48  ALA F O   1 
ATOM   5191 C CB  . ALA F 3 32  ? 21.650  -52.551 38.862 1.00 55.00  ? 48  ALA F CB  1 
ATOM   5192 N N   . ILE F 3 33  ? 22.562  -54.213 36.354 1.00 50.61  ? 49  ILE F N   1 
ATOM   5193 C CA  . ILE F 3 33  ? 23.161  -54.234 35.021 1.00 48.83  ? 49  ILE F CA  1 
ATOM   5194 C C   . ILE F 3 33  ? 22.546  -53.200 34.059 1.00 46.20  ? 49  ILE F C   1 
ATOM   5195 O O   . ILE F 3 33  ? 23.245  -52.655 33.215 1.00 42.85  ? 49  ILE F O   1 
ATOM   5196 C CB  . ILE F 3 33  ? 23.134  -55.680 34.456 1.00 49.77  ? 49  ILE F CB  1 
ATOM   5197 C CG1 . ILE F 3 33  ? 24.326  -56.445 35.022 1.00 47.85  ? 49  ILE F CG1 1 
ATOM   5198 C CG2 . ILE F 3 33  ? 23.207  -55.698 32.929 1.00 50.33  ? 49  ILE F CG2 1 
ATOM   5199 C CD1 . ILE F 3 33  ? 23.987  -57.797 35.468 1.00 48.94  ? 49  ILE F CD1 1 
ATOM   5200 N N   . GLU F 3 34  ? 21.252  -52.929 34.220 1.00 45.85  ? 50  GLU F N   1 
ATOM   5201 C CA  . GLU F 3 34  ? 20.533  -51.949 33.413 1.00 45.20  ? 50  GLU F CA  1 
ATOM   5202 C C   . GLU F 3 34  ? 19.559  -51.142 34.264 1.00 42.84  ? 50  GLU F C   1 
ATOM   5203 O O   . GLU F 3 34  ? 18.723  -51.717 34.958 1.00 43.05  ? 50  GLU F O   1 
ATOM   5204 C CB  . GLU F 3 34  ? 19.776  -52.643 32.270 1.00 47.06  ? 50  GLU F CB  1 
ATOM   5205 C CG  . GLU F 3 34  ? 18.626  -51.820 31.669 1.00 53.29  ? 50  GLU F CG  1 
ATOM   5206 C CD  . GLU F 3 34  ? 18.395  -52.075 30.181 1.00 57.06  ? 50  GLU F CD  1 
ATOM   5207 O OE1 . GLU F 3 34  ? 19.067  -52.960 29.600 1.00 60.06  ? 50  GLU F OE1 1 
ATOM   5208 O OE2 . GLU F 3 34  ? 17.540  -51.380 29.583 1.00 58.73  ? 50  GLU F OE2 1 
ATOM   5209 N N   . LEU F 3 35  ? 19.662  -49.814 34.205 1.00 41.74  ? 51  LEU F N   1 
ATOM   5210 C CA  . LEU F 3 35  ? 18.712  -48.934 34.898 1.00 38.95  ? 51  LEU F CA  1 
ATOM   5211 C C   . LEU F 3 35  ? 17.873  -48.158 33.889 1.00 39.38  ? 51  LEU F C   1 
ATOM   5212 O O   . LEU F 3 35  ? 18.409  -47.516 32.976 1.00 39.62  ? 51  LEU F O   1 
ATOM   5213 C CB  . LEU F 3 35  ? 19.442  -47.983 35.846 1.00 37.47  ? 51  LEU F CB  1 
ATOM   5214 C CG  . LEU F 3 35  ? 20.344  -48.621 36.925 1.00 37.33  ? 51  LEU F CG  1 
ATOM   5215 C CD1 . LEU F 3 35  ? 21.215  -47.580 37.602 1.00 37.79  ? 51  LEU F CD1 1 
ATOM   5216 C CD2 . LEU F 3 35  ? 19.558  -49.393 37.976 1.00 33.16  ? 51  LEU F CD2 1 
ATOM   5217 N N   . ARG F 3 36  ? 16.558  -48.236 34.048 1.00 38.45  ? 52  ARG F N   1 
ATOM   5218 C CA  . ARG F 3 36  ? 15.622  -47.591 33.132 1.00 37.94  ? 52  ARG F CA  1 
ATOM   5219 C C   . ARG F 3 36  ? 14.672  -46.675 33.871 1.00 37.03  ? 52  ARG F C   1 
ATOM   5220 O O   . ARG F 3 36  ? 13.891  -47.138 34.695 1.00 37.75  ? 52  ARG F O   1 
ATOM   5221 C CB  . ARG F 3 36  ? 14.791  -48.639 32.410 1.00 40.27  ? 52  ARG F CB  1 
ATOM   5222 C CG  . ARG F 3 36  ? 15.292  -49.043 31.062 1.00 46.65  ? 52  ARG F CG  1 
ATOM   5223 C CD  . ARG F 3 36  ? 14.274  -49.876 30.271 1.00 54.73  ? 52  ARG F CD  1 
ATOM   5224 N NE  . ARG F 3 36  ? 14.240  -51.290 30.674 1.00 59.73  ? 52  ARG F NE  1 
ATOM   5225 C CZ  . ARG F 3 36  ? 13.271  -52.153 30.343 1.00 61.82  ? 52  ARG F CZ  1 
ATOM   5226 N NH1 . ARG F 3 36  ? 12.234  -51.753 29.610 1.00 62.46  ? 52  ARG F NH1 1 
ATOM   5227 N NH2 . ARG F 3 36  ? 13.328  -53.420 30.749 1.00 61.88  ? 52  ARG F NH2 1 
ATOM   5228 N N   . PHE F 3 37  ? 14.720  -45.384 33.564 1.00 36.54  ? 53  PHE F N   1 
ATOM   5229 C CA  . PHE F 3 37  ? 13.802  -44.409 34.153 1.00 34.89  ? 53  PHE F CA  1 
ATOM   5230 C C   . PHE F 3 37  ? 12.926  -43.856 33.050 1.00 36.65  ? 53  PHE F C   1 
ATOM   5231 O O   . PHE F 3 37  ? 13.409  -43.116 32.175 1.00 38.35  ? 53  PHE F O   1 
ATOM   5232 C CB  . PHE F 3 37  ? 14.579  -43.290 34.827 1.00 33.38  ? 53  PHE F CB  1 
ATOM   5233 C CG  . PHE F 3 37  ? 15.588  -43.784 35.801 1.00 34.57  ? 53  PHE F CG  1 
ATOM   5234 C CD1 . PHE F 3 37  ? 15.224  -44.067 37.104 1.00 33.54  ? 53  PHE F CD1 1 
ATOM   5235 C CD2 . PHE F 3 37  ? 16.897  -44.018 35.405 1.00 33.38  ? 53  PHE F CD2 1 
ATOM   5236 C CE1 . PHE F 3 37  ? 16.158  -44.548 38.003 1.00 34.95  ? 53  PHE F CE1 1 
ATOM   5237 C CE2 . PHE F 3 37  ? 17.834  -44.498 36.298 1.00 32.81  ? 53  PHE F CE2 1 
ATOM   5238 C CZ  . PHE F 3 37  ? 17.471  -44.765 37.596 1.00 34.10  ? 53  PHE F CZ  1 
ATOM   5239 N N   . VAL F 3 38  ? 11.647  -44.235 33.087 1.00 35.41  ? 54  VAL F N   1 
ATOM   5240 C CA  . VAL F 3 38  ? 10.676  -43.867 32.057 1.00 34.30  ? 54  VAL F CA  1 
ATOM   5241 C C   . VAL F 3 38  ? 9.478   -43.217 32.704 1.00 35.07  ? 54  VAL F C   1 
ATOM   5242 O O   . VAL F 3 38  ? 9.078   -43.633 33.774 1.00 37.75  ? 54  VAL F O   1 
ATOM   5243 C CB  . VAL F 3 38  ? 10.183  -45.096 31.304 1.00 32.11  ? 54  VAL F CB  1 
ATOM   5244 C CG1 . VAL F 3 38  ? 9.085   -44.713 30.366 1.00 33.15  ? 54  VAL F CG1 1 
ATOM   5245 C CG2 . VAL F 3 38  ? 11.309  -45.730 30.549 1.00 31.00  ? 54  VAL F CG2 1 
ATOM   5246 N N   . LEU F 3 39  ? 8.910   -42.201 32.060 1.00 37.03  ? 55  LEU F N   1 
ATOM   5247 C CA  . LEU F 3 39  ? 7.739   -41.479 32.580 1.00 37.07  ? 55  LEU F CA  1 
ATOM   5248 C C   . LEU F 3 39  ? 7.838   -41.149 34.062 1.00 37.38  ? 55  LEU F C   1 
ATOM   5249 O O   . LEU F 3 39  ? 6.847   -41.159 34.794 1.00 37.30  ? 55  LEU F O   1 
ATOM   5250 C CB  . LEU F 3 39  ? 6.451   -42.254 32.280 1.00 37.04  ? 55  LEU F CB  1 
ATOM   5251 C CG  . LEU F 3 39  ? 5.846   -41.873 30.929 1.00 38.63  ? 55  LEU F CG  1 
ATOM   5252 C CD1 . LEU F 3 39  ? 4.704   -42.763 30.574 1.00 38.84  ? 55  LEU F CD1 1 
ATOM   5253 C CD2 . LEU F 3 39  ? 5.375   -40.452 30.980 1.00 40.22  ? 55  LEU F CD2 1 
ATOM   5254 N N   . THR F 3 40  ? 9.056   -40.855 34.488 1.00 38.33  ? 56  THR F N   1 
ATOM   5255 C CA  . THR F 3 40  ? 9.340   -40.543 35.870 1.00 41.04  ? 56  THR F CA  1 
ATOM   5256 C C   . THR F 3 40  ? 8.977   -39.102 36.156 1.00 42.17  ? 56  THR F C   1 
ATOM   5257 O O   . THR F 3 40  ? 8.747   -38.321 35.238 1.00 44.30  ? 56  THR F O   1 
ATOM   5258 C CB  . THR F 3 40  ? 10.817  -40.772 36.123 1.00 41.33  ? 56  THR F CB  1 
ATOM   5259 O OG1 . THR F 3 40  ? 11.125  -42.121 35.772 1.00 43.63  ? 56  THR F OG1 1 
ATOM   5260 C CG2 . THR F 3 40  ? 11.124  -40.732 37.581 1.00 43.01  ? 56  THR F CG2 1 
ATOM   5261 N N   . LYS F 3 41  ? 8.897   -38.748 37.430 1.00 42.86  ? 57  LYS F N   1 
ATOM   5262 C CA  . LYS F 3 41  ? 8.684   -37.358 37.764 1.00 44.12  ? 57  LYS F CA  1 
ATOM   5263 C C   . LYS F 3 41  ? 10.001  -36.744 38.203 1.00 43.61  ? 57  LYS F C   1 
ATOM   5264 O O   . LYS F 3 41  ? 10.001  -35.725 38.885 1.00 45.79  ? 57  LYS F O   1 
ATOM   5265 C CB  . LYS F 3 41  ? 7.612   -37.197 38.849 1.00 45.61  ? 57  LYS F CB  1 
ATOM   5266 C CG  . LYS F 3 41  ? 6.571   -36.144 38.497 1.00 48.92  ? 57  LYS F CG  1 
ATOM   5267 C CD  . LYS F 3 41  ? 5.938   -36.464 37.134 1.00 53.00  ? 57  LYS F CD  1 
ATOM   5268 C CE  . LYS F 3 41  ? 4.997   -35.367 36.646 1.00 54.43  ? 57  LYS F CE  1 
ATOM   5269 N NZ  . LYS F 3 41  ? 4.568   -35.611 35.224 1.00 53.49  ? 57  LYS F NZ  1 
ATOM   5270 N N   . LEU F 3 42  ? 11.115  -37.361 37.790 1.00 43.20  ? 58  LEU F N   1 
ATOM   5271 C CA  . LEU F 3 42  ? 12.460  -36.921 38.176 1.00 40.63  ? 58  LEU F CA  1 
ATOM   5272 C C   . LEU F 3 42  ? 12.686  -35.504 37.738 1.00 39.57  ? 58  LEU F C   1 
ATOM   5273 O O   . LEU F 3 42  ? 12.342  -35.149 36.620 1.00 38.79  ? 58  LEU F O   1 
ATOM   5274 C CB  . LEU F 3 42  ? 13.528  -37.812 37.551 1.00 41.96  ? 58  LEU F CB  1 
ATOM   5275 C CG  . LEU F 3 42  ? 13.849  -39.145 38.231 1.00 40.97  ? 58  LEU F CG  1 
ATOM   5276 C CD1 . LEU F 3 42  ? 14.744  -39.994 37.338 1.00 42.99  ? 58  LEU F CD1 1 
ATOM   5277 C CD2 . LEU F 3 42  ? 14.514  -38.899 39.560 1.00 40.91  ? 58  LEU F CD2 1 
ATOM   5278 N N   . ARG F 3 43  ? 13.240  -34.694 38.633 1.00 39.60  ? 59  ARG F N   1 
ATOM   5279 C CA  . ARG F 3 43  ? 13.485  -33.290 38.346 1.00 38.56  ? 59  ARG F CA  1 
ATOM   5280 C C   . ARG F 3 43  ? 14.983  -33.035 38.238 1.00 37.58  ? 59  ARG F C   1 
ATOM   5281 O O   . ARG F 3 43  ? 15.427  -32.295 37.360 1.00 37.91  ? 59  ARG F O   1 
ATOM   5282 C CB  . ARG F 3 43  ? 12.871  -32.410 39.424 1.00 40.09  ? 59  ARG F CB  1 
ATOM   5283 C CG  . ARG F 3 43  ? 12.840  -30.913 39.091 1.00 47.95  ? 59  ARG F CG  1 
ATOM   5284 C CD  . ARG F 3 43  ? 11.463  -30.417 38.670 1.00 54.58  ? 59  ARG F CD  1 
ATOM   5285 N NE  . ARG F 3 43  ? 10.412  -31.150 39.386 1.00 61.08  ? 59  ARG F NE  1 
ATOM   5286 C CZ  . ARG F 3 43  ? 9.104   -30.995 39.193 1.00 62.91  ? 59  ARG F CZ  1 
ATOM   5287 N NH1 . ARG F 3 43  ? 8.643   -30.117 38.298 1.00 62.55  ? 59  ARG F NH1 1 
ATOM   5288 N NH2 . ARG F 3 43  ? 8.246   -31.728 39.902 1.00 63.52  ? 59  ARG F NH2 1 
ATOM   5289 N N   . VAL F 3 44  ? 15.758  -33.659 39.119 1.00 34.34  ? 60  VAL F N   1 
ATOM   5290 C CA  . VAL F 3 44  ? 17.196  -33.493 39.102 1.00 34.13  ? 60  VAL F CA  1 
ATOM   5291 C C   . VAL F 3 44  ? 17.875  -34.832 39.240 1.00 35.99  ? 60  VAL F C   1 
ATOM   5292 O O   . VAL F 3 44  ? 17.531  -35.612 40.133 1.00 38.67  ? 60  VAL F O   1 
ATOM   5293 C CB  . VAL F 3 44  ? 17.650  -32.582 40.266 1.00 33.43  ? 60  VAL F CB  1 
ATOM   5294 C CG1 . VAL F 3 44  ? 19.176  -32.654 40.495 1.00 30.01  ? 60  VAL F CG1 1 
ATOM   5295 C CG2 . VAL F 3 44  ? 17.222  -31.151 39.999 1.00 34.71  ? 60  VAL F CG2 1 
ATOM   5296 N N   . ILE F 3 45  ? 18.836  -35.117 38.366 1.00 37.51  ? 61  ILE F N   1 
ATOM   5297 C CA  . ILE F 3 45  ? 19.662  -36.312 38.575 1.00 39.39  ? 61  ILE F CA  1 
ATOM   5298 C C   . ILE F 3 45  ? 20.914  -35.953 39.384 1.00 41.19  ? 61  ILE F C   1 
ATOM   5299 O O   . ILE F 3 45  ? 21.955  -35.581 38.843 1.00 41.09  ? 61  ILE F O   1 
ATOM   5300 C CB  . ILE F 3 45  ? 19.968  -37.058 37.270 1.00 37.69  ? 61  ILE F CB  1 
ATOM   5301 C CG1 . ILE F 3 45  ? 18.673  -37.684 36.751 1.00 39.33  ? 61  ILE F CG1 1 
ATOM   5302 C CG2 . ILE F 3 45  ? 20.950  -38.172 37.533 1.00 36.92  ? 61  ILE F CG2 1 
ATOM   5303 C CD1 . ILE F 3 45  ? 18.767  -38.308 35.386 1.00 42.87  ? 61  ILE F CD1 1 
ATOM   5304 N N   . GLN F 3 46  ? 20.749  -36.066 40.700 1.00 43.06  ? 62  GLN F N   1 
ATOM   5305 C CA  . GLN F 3 46  ? 21.711  -35.669 41.716 1.00 45.55  ? 62  GLN F CA  1 
ATOM   5306 C C   . GLN F 3 46  ? 23.105  -36.234 41.483 1.00 46.09  ? 62  GLN F C   1 
ATOM   5307 O O   . GLN F 3 46  ? 23.254  -37.268 40.832 1.00 47.12  ? 62  GLN F O   1 
ATOM   5308 C CB  . GLN F 3 46  ? 21.193  -36.127 43.080 1.00 47.49  ? 62  GLN F CB  1 
ATOM   5309 C CG  . GLN F 3 46  ? 20.931  -37.661 43.173 1.00 52.55  ? 62  GLN F CG  1 
ATOM   5310 C CD  . GLN F 3 46  ? 19.479  -38.089 42.845 1.00 55.93  ? 62  GLN F CD  1 
ATOM   5311 O OE1 . GLN F 3 46  ? 19.060  -39.194 43.212 1.00 55.11  ? 62  GLN F OE1 1 
ATOM   5312 N NE2 . GLN F 3 46  ? 18.722  -37.221 42.165 1.00 57.63  ? 62  GLN F NE2 1 
ATOM   5313 N N   . LYS F 3 47  ? 24.120  -35.559 42.015 1.00 45.05  ? 63  LYS F N   1 
ATOM   5314 C CA  . LYS F 3 47  ? 25.492  -36.065 41.953 1.00 44.61  ? 63  LYS F CA  1 
ATOM   5315 C C   . LYS F 3 47  ? 25.648  -37.372 42.732 1.00 43.02  ? 63  LYS F C   1 
ATOM   5316 O O   . LYS F 3 47  ? 25.051  -37.545 43.787 1.00 41.09  ? 63  LYS F O   1 
ATOM   5317 C CB  . LYS F 3 47  ? 26.478  -35.027 42.504 1.00 46.73  ? 63  LYS F CB  1 
ATOM   5318 C CG  . LYS F 3 47  ? 27.726  -35.644 43.125 1.00 46.36  ? 63  LYS F CG  1 
ATOM   5319 C CD  . LYS F 3 47  ? 28.835  -34.665 43.310 1.00 49.06  ? 63  LYS F CD  1 
ATOM   5320 C CE  . LYS F 3 47  ? 30.021  -35.370 43.951 1.00 51.91  ? 63  LYS F CE  1 
ATOM   5321 N NZ  . LYS F 3 47  ? 31.092  -34.403 44.349 1.00 55.89  ? 63  LYS F NZ  1 
ATOM   5322 N N   . GLY F 3 48  ? 26.478  -38.267 42.206 1.00 43.31  ? 64  GLY F N   1 
ATOM   5323 C CA  . GLY F 3 48  ? 26.749  -39.557 42.833 1.00 43.36  ? 64  GLY F CA  1 
ATOM   5324 C C   . GLY F 3 48  ? 25.580  -40.533 42.818 1.00 43.65  ? 64  GLY F C   1 
ATOM   5325 O O   . GLY F 3 48  ? 25.564  -41.512 43.569 1.00 43.50  ? 64  GLY F O   1 
ATOM   5326 N N   . ALA F 3 49  ? 24.600  -40.270 41.962 1.00 42.95  ? 65  ALA F N   1 
ATOM   5327 C CA  . ALA F 3 49  ? 23.440  -41.127 41.863 1.00 43.41  ? 65  ALA F CA  1 
ATOM   5328 C C   . ALA F 3 49  ? 23.850  -42.569 41.582 1.00 44.29  ? 65  ALA F C   1 
ATOM   5329 O O   . ALA F 3 49  ? 23.322  -43.491 42.188 1.00 44.94  ? 65  ALA F O   1 
ATOM   5330 C CB  . ALA F 3 49  ? 22.514  -40.620 40.781 1.00 43.38  ? 65  ALA F CB  1 
ATOM   5331 N N   . PHE F 3 50  ? 24.828  -42.746 40.698 1.00 47.10  ? 66  PHE F N   1 
ATOM   5332 C CA  . PHE F 3 50  ? 25.240  -44.071 40.240 1.00 46.75  ? 66  PHE F CA  1 
ATOM   5333 C C   . PHE F 3 50  ? 26.641  -44.440 40.686 1.00 48.62  ? 66  PHE F C   1 
ATOM   5334 O O   . PHE F 3 50  ? 27.256  -45.341 40.123 1.00 48.00  ? 66  PHE F O   1 
ATOM   5335 C CB  . PHE F 3 50  ? 25.163  -44.130 38.714 1.00 44.16  ? 66  PHE F CB  1 
ATOM   5336 C CG  . PHE F 3 50  ? 23.813  -43.781 38.159 1.00 42.69  ? 66  PHE F CG  1 
ATOM   5337 C CD1 . PHE F 3 50  ? 22.671  -44.476 38.560 1.00 45.36  ? 66  PHE F CD1 1 
ATOM   5338 C CD2 . PHE F 3 50  ? 23.683  -42.788 37.214 1.00 39.18  ? 66  PHE F CD2 1 
ATOM   5339 C CE1 . PHE F 3 50  ? 21.415  -44.168 38.022 1.00 44.06  ? 66  PHE F CE1 1 
ATOM   5340 C CE2 . PHE F 3 50  ? 22.440  -42.481 36.676 1.00 42.02  ? 66  PHE F CE2 1 
ATOM   5341 C CZ  . PHE F 3 50  ? 21.307  -43.173 37.076 1.00 42.90  ? 66  PHE F CZ  1 
ATOM   5342 N N   . SER F 3 51  ? 27.144  -43.743 41.697 1.00 51.68  ? 67  SER F N   1 
ATOM   5343 C CA  . SER F 3 51  ? 28.469  -44.028 42.229 1.00 54.78  ? 67  SER F CA  1 
ATOM   5344 C C   . SER F 3 51  ? 28.537  -45.450 42.795 1.00 54.40  ? 67  SER F C   1 
ATOM   5345 O O   . SER F 3 51  ? 27.705  -45.845 43.621 1.00 53.49  ? 67  SER F O   1 
ATOM   5346 C CB  . SER F 3 51  ? 28.855  -42.991 43.303 1.00 57.21  ? 67  SER F CB  1 
ATOM   5347 O OG  . SER F 3 51  ? 30.157  -43.217 43.838 1.00 59.45  ? 67  SER F OG  1 
ATOM   5348 N N   . GLY F 3 52  ? 29.517  -46.213 42.311 1.00 54.86  ? 68  GLY F N   1 
ATOM   5349 C CA  . GLY F 3 52  ? 29.786  -47.552 42.823 1.00 55.36  ? 68  GLY F CA  1 
ATOM   5350 C C   . GLY F 3 52  ? 29.186  -48.704 42.043 1.00 55.93  ? 68  GLY F C   1 
ATOM   5351 O O   . GLY F 3 52  ? 29.453  -49.866 42.352 1.00 56.51  ? 68  GLY F O   1 
ATOM   5352 N N   . PHE F 3 53  ? 28.371  -48.405 41.035 1.00 56.04  ? 69  PHE F N   1 
ATOM   5353 C CA  . PHE F 3 53  ? 27.753  -49.466 40.248 1.00 55.58  ? 69  PHE F CA  1 
ATOM   5354 C C   . PHE F 3 53  ? 28.808  -50.069 39.324 1.00 57.71  ? 69  PHE F C   1 
ATOM   5355 O O   . PHE F 3 53  ? 28.922  -49.699 38.149 1.00 59.13  ? 69  PHE F O   1 
ATOM   5356 C CB  . PHE F 3 53  ? 26.554  -48.943 39.451 1.00 52.43  ? 69  PHE F CB  1 
ATOM   5357 C CG  . PHE F 3 53  ? 25.319  -48.735 40.274 1.00 48.82  ? 69  PHE F CG  1 
ATOM   5358 C CD1 . PHE F 3 53  ? 25.238  -47.700 41.192 1.00 49.42  ? 69  PHE F CD1 1 
ATOM   5359 C CD2 . PHE F 3 53  ? 24.224  -49.564 40.116 1.00 48.67  ? 69  PHE F CD2 1 
ATOM   5360 C CE1 . PHE F 3 53  ? 24.082  -47.509 41.958 1.00 49.23  ? 69  PHE F CE1 1 
ATOM   5361 C CE2 . PHE F 3 53  ? 23.065  -49.384 40.873 1.00 46.26  ? 69  PHE F CE2 1 
ATOM   5362 C CZ  . PHE F 3 53  ? 22.991  -48.354 41.791 1.00 48.87  ? 69  PHE F CZ  1 
ATOM   5363 N N   . GLY F 3 54  ? 29.597  -50.988 39.874 1.00 57.98  ? 70  GLY F N   1 
ATOM   5364 C CA  . GLY F 3 54  ? 30.640  -51.649 39.109 1.00 57.01  ? 70  GLY F CA  1 
ATOM   5365 C C   . GLY F 3 54  ? 30.113  -52.625 38.067 1.00 57.05  ? 70  GLY F C   1 
ATOM   5366 O O   . GLY F 3 54  ? 30.893  -53.138 37.273 1.00 60.27  ? 70  GLY F O   1 
ATOM   5367 N N   . ASP F 3 55  ? 28.803  -52.882 38.049 1.00 55.18  ? 71  ASP F N   1 
ATOM   5368 C CA  . ASP F 3 55  ? 28.238  -53.885 37.129 1.00 53.65  ? 71  ASP F CA  1 
ATOM   5369 C C   . ASP F 3 55  ? 27.227  -53.345 36.121 1.00 50.64  ? 71  ASP F C   1 
ATOM   5370 O O   . ASP F 3 55  ? 26.781  -54.061 35.228 1.00 49.27  ? 71  ASP F O   1 
ATOM   5371 C CB  . ASP F 3 55  ? 27.621  -55.044 37.920 1.00 55.36  ? 71  ASP F CB  1 
ATOM   5372 C CG  . ASP F 3 55  ? 28.664  -55.845 38.693 1.00 58.17  ? 71  ASP F CG  1 
ATOM   5373 O OD1 . ASP F 3 55  ? 29.853  -55.836 38.285 1.00 58.78  ? 71  ASP F OD1 1 
ATOM   5374 O OD2 . ASP F 3 55  ? 28.366  -56.509 39.716 1.00 58.81  ? 71  ASP F OD2 1 
ATOM   5375 N N   . LEU F 3 56  ? 26.875  -52.079 36.279 1.00 47.67  ? 72  LEU F N   1 
ATOM   5376 C CA  . LEU F 3 56  ? 25.919  -51.413 35.431 1.00 43.17  ? 72  LEU F CA  1 
ATOM   5377 C C   . LEU F 3 56  ? 26.472  -51.305 34.018 1.00 42.80  ? 72  LEU F C   1 
ATOM   5378 O O   . LEU F 3 56  ? 27.625  -50.923 33.821 1.00 42.71  ? 72  LEU F O   1 
ATOM   5379 C CB  . LEU F 3 56  ? 25.659  -50.035 36.008 1.00 43.73  ? 72  LEU F CB  1 
ATOM   5380 C CG  . LEU F 3 56  ? 24.446  -49.249 35.541 1.00 45.67  ? 72  LEU F CG  1 
ATOM   5381 C CD1 . LEU F 3 56  ? 23.172  -50.041 35.728 1.00 46.39  ? 72  LEU F CD1 1 
ATOM   5382 C CD2 . LEU F 3 56  ? 24.392  -47.938 36.308 1.00 47.44  ? 72  LEU F CD2 1 
ATOM   5383 N N   . GLU F 3 57  ? 25.634  -51.647 33.042 1.00 41.67  ? 73  GLU F N   1 
ATOM   5384 C CA  . GLU F 3 57  ? 26.023  -51.668 31.635 1.00 39.59  ? 73  GLU F CA  1 
ATOM   5385 C C   . GLU F 3 57  ? 25.264  -50.649 30.773 1.00 38.03  ? 73  GLU F C   1 
ATOM   5386 O O   . GLU F 3 57  ? 25.814  -50.107 29.809 1.00 37.74  ? 73  GLU F O   1 
ATOM   5387 C CB  . GLU F 3 57  ? 25.821  -53.078 31.071 1.00 39.78  ? 73  GLU F CB  1 
ATOM   5388 C CG  . GLU F 3 57  ? 26.890  -54.062 31.510 1.00 46.13  ? 73  GLU F CG  1 
ATOM   5389 C CD  . GLU F 3 57  ? 26.708  -55.468 30.944 1.00 49.91  ? 73  GLU F CD  1 
ATOM   5390 O OE1 . GLU F 3 57  ? 25.764  -55.702 30.154 1.00 54.00  ? 73  GLU F OE1 1 
ATOM   5391 O OE2 . GLU F 3 57  ? 27.523  -56.351 31.295 1.00 50.50  ? 73  GLU F OE2 1 
ATOM   5392 N N   . LYS F 3 58  ? 24.008  -50.394 31.130 1.00 35.24  ? 74  LYS F N   1 
ATOM   5393 C CA  . LYS F 3 58  ? 23.127  -49.558 30.342 1.00 34.08  ? 74  LYS F CA  1 
ATOM   5394 C C   . LYS F 3 58  ? 22.318  -48.687 31.255 1.00 33.69  ? 74  LYS F C   1 
ATOM   5395 O O   . LYS F 3 58  ? 21.747  -49.183 32.212 1.00 34.90  ? 74  LYS F O   1 
ATOM   5396 C CB  . LYS F 3 58  ? 22.139  -50.424 29.563 1.00 35.99  ? 74  LYS F CB  1 
ATOM   5397 C CG  . LYS F 3 58  ? 22.710  -51.159 28.372 1.00 38.97  ? 74  LYS F CG  1 
ATOM   5398 C CD  . LYS F 3 58  ? 21.619  -51.856 27.598 1.00 40.70  ? 74  LYS F CD  1 
ATOM   5399 C CE  . LYS F 3 58  ? 22.228  -52.911 26.709 1.00 47.95  ? 74  LYS F CE  1 
ATOM   5400 N NZ  . LYS F 3 58  ? 21.447  -53.162 25.464 1.00 53.19  ? 74  LYS F NZ  1 
ATOM   5401 N N   . ILE F 3 59  ? 22.274  -47.391 30.961 1.00 33.71  ? 75  ILE F N   1 
ATOM   5402 C CA  . ILE F 3 59  ? 21.378  -46.475 31.648 1.00 31.71  ? 75  ILE F CA  1 
ATOM   5403 C C   . ILE F 3 59  ? 20.463  -45.816 30.617 1.00 33.48  ? 75  ILE F C   1 
ATOM   5404 O O   . ILE F 3 59  ? 20.918  -45.056 29.747 1.00 34.58  ? 75  ILE F O   1 
ATOM   5405 C CB  . ILE F 3 59  ? 22.150  -45.406 32.417 1.00 30.39  ? 75  ILE F CB  1 
ATOM   5406 C CG1 . ILE F 3 59  ? 23.214  -46.054 33.310 1.00 32.52  ? 75  ILE F CG1 1 
ATOM   5407 C CG2 . ILE F 3 59  ? 21.178  -44.548 33.233 1.00 30.44  ? 75  ILE F CG2 1 
ATOM   5408 C CD1 . ILE F 3 59  ? 23.991  -45.074 34.206 1.00 27.98  ? 75  ILE F CD1 1 
ATOM   5409 N N   . GLU F 3 60  ? 19.174  -46.116 30.700 1.00 33.62  ? 76  GLU F N   1 
ATOM   5410 C CA  . GLU F 3 60  ? 18.206  -45.473 29.820 1.00 35.09  ? 76  GLU F CA  1 
ATOM   5411 C C   . GLU F 3 60  ? 17.394  -44.489 30.657 1.00 32.61  ? 76  GLU F C   1 
ATOM   5412 O O   . GLU F 3 60  ? 16.878  -44.830 31.717 1.00 32.21  ? 76  GLU F O   1 
ATOM   5413 C CB  . GLU F 3 60  ? 17.328  -46.520 29.102 1.00 37.66  ? 76  GLU F CB  1 
ATOM   5414 C CG  . GLU F 3 60  ? 15.987  -46.016 28.547 1.00 48.25  ? 76  GLU F CG  1 
ATOM   5415 C CD  . GLU F 3 60  ? 15.136  -47.139 27.934 1.00 55.90  ? 76  GLU F CD  1 
ATOM   5416 O OE1 . GLU F 3 60  ? 15.747  -48.166 27.529 1.00 60.01  ? 76  GLU F OE1 1 
ATOM   5417 O OE2 . GLU F 3 60  ? 13.872  -47.002 27.848 1.00 54.19  ? 76  GLU F OE2 1 
ATOM   5418 N N   . ILE F 3 61  ? 17.351  -43.246 30.198 1.00 31.55  ? 77  ILE F N   1 
ATOM   5419 C CA  . ILE F 3 61  ? 16.581  -42.192 30.842 1.00 32.82  ? 77  ILE F CA  1 
ATOM   5420 C C   . ILE F 3 61  ? 15.706  -41.682 29.720 1.00 35.84  ? 77  ILE F C   1 
ATOM   5421 O O   . ILE F 3 61  ? 16.171  -40.957 28.832 1.00 36.03  ? 77  ILE F O   1 
ATOM   5422 C CB  . ILE F 3 61  ? 17.506  -41.101 31.379 1.00 30.79  ? 77  ILE F CB  1 
ATOM   5423 C CG1 . ILE F 3 61  ? 18.336  -41.652 32.524 1.00 30.71  ? 77  ILE F CG1 1 
ATOM   5424 C CG2 . ILE F 3 61  ? 16.721  -39.926 31.885 1.00 29.66  ? 77  ILE F CG2 1 
ATOM   5425 C CD1 . ILE F 3 61  ? 19.341  -40.664 33.054 1.00 35.78  ? 77  ILE F CD1 1 
ATOM   5426 N N   . SER F 3 62  ? 14.440  -42.089 29.753 1.00 38.20  ? 78  SER F N   1 
ATOM   5427 C CA  . SER F 3 62  ? 13.565  -41.911 28.612 1.00 40.11  ? 78  SER F CA  1 
ATOM   5428 C C   . SER F 3 62  ? 12.201  -41.380 28.979 1.00 41.45  ? 78  SER F C   1 
ATOM   5429 O O   . SER F 3 62  ? 11.580  -41.864 29.924 1.00 42.14  ? 78  SER F O   1 
ATOM   5430 C CB  . SER F 3 62  ? 13.411  -43.240 27.889 1.00 41.06  ? 78  SER F CB  1 
ATOM   5431 O OG  . SER F 3 62  ? 12.702  -43.042 26.680 1.00 49.92  ? 78  SER F OG  1 
ATOM   5432 N N   . GLN F 3 63  ? 11.755  -40.376 28.221 1.00 43.46  ? 79  GLN F N   1 
ATOM   5433 C CA  . GLN F 3 63  ? 10.436  -39.728 28.381 1.00 44.63  ? 79  GLN F CA  1 
ATOM   5434 C C   . GLN F 3 63  ? 10.182  -39.197 29.802 1.00 45.18  ? 79  GLN F C   1 
ATOM   5435 O O   . GLN F 3 63  ? 9.340   -39.730 30.522 1.00 47.28  ? 79  GLN F O   1 
ATOM   5436 C CB  . GLN F 3 63  ? 9.293   -40.670 27.927 1.00 44.41  ? 79  GLN F CB  1 
ATOM   5437 C CG  . GLN F 3 63  ? 9.477   -41.291 26.525 1.00 47.63  ? 79  GLN F CG  1 
ATOM   5438 C CD  . GLN F 3 63  ? 8.217   -41.954 25.976 1.00 50.65  ? 79  GLN F CD  1 
ATOM   5439 O OE1 . GLN F 3 63  ? 7.130   -41.378 26.027 1.00 54.97  ? 79  GLN F OE1 1 
ATOM   5440 N NE2 . GLN F 3 63  ? 8.364   -43.162 25.439 1.00 51.38  ? 79  GLN F NE2 1 
ATOM   5441 N N   . ASN F 3 64  ? 10.922  -38.162 30.202 1.00 45.20  ? 80  ASN F N   1 
ATOM   5442 C CA  . ASN F 3 64  ? 10.769  -37.549 31.526 1.00 43.48  ? 80  ASN F CA  1 
ATOM   5443 C C   . ASN F 3 64  ? 10.518  -36.051 31.411 1.00 45.69  ? 80  ASN F C   1 
ATOM   5444 O O   . ASN F 3 64  ? 11.433  -35.275 31.126 1.00 44.92  ? 80  ASN F O   1 
ATOM   5445 C CB  . ASN F 3 64  ? 11.996  -37.800 32.384 1.00 42.24  ? 80  ASN F CB  1 
ATOM   5446 C CG  . ASN F 3 64  ? 12.375  -39.248 32.431 1.00 43.04  ? 80  ASN F CG  1 
ATOM   5447 O OD1 . ASN F 3 64  ? 12.056  -39.957 33.386 1.00 42.28  ? 80  ASN F OD1 1 
ATOM   5448 N ND2 . ASN F 3 64  ? 13.059  -39.708 31.393 1.00 44.75  ? 80  ASN F ND2 1 
ATOM   5449 N N   . ASP F 3 65  ? 9.268   -35.668 31.650 1.00 47.43  ? 81  ASP F N   1 
ATOM   5450 C CA  . ASP F 3 65  ? 8.775   -34.307 31.476 1.00 47.59  ? 81  ASP F CA  1 
ATOM   5451 C C   . ASP F 3 65  ? 9.461   -33.217 32.281 1.00 46.85  ? 81  ASP F C   1 
ATOM   5452 O O   . ASP F 3 65  ? 9.544   -32.069 31.844 1.00 47.07  ? 81  ASP F O   1 
ATOM   5453 C CB  . ASP F 3 65  ? 7.286   -34.268 31.828 1.00 51.32  ? 81  ASP F CB  1 
ATOM   5454 C CG  . ASP F 3 65  ? 6.417   -34.722 30.689 1.00 56.94  ? 81  ASP F CG  1 
ATOM   5455 O OD1 . ASP F 3 65  ? 6.990   -35.069 29.633 1.00 62.12  ? 81  ASP F OD1 1 
ATOM   5456 O OD2 . ASP F 3 65  ? 5.166   -34.753 30.762 1.00 59.99  ? 81  ASP F OD2 1 
ATOM   5457 N N   . VAL F 3 66  ? 9.929   -33.551 33.469 1.00 43.82  ? 82  VAL F N   1 
ATOM   5458 C CA  . VAL F 3 66  ? 10.371  -32.496 34.343 1.00 44.11  ? 82  VAL F CA  1 
ATOM   5459 C C   . VAL F 3 66  ? 11.808  -32.634 34.797 1.00 45.10  ? 82  VAL F C   1 
ATOM   5460 O O   . VAL F 3 66  ? 12.222  -32.016 35.785 1.00 46.54  ? 82  VAL F O   1 
ATOM   5461 C CB  . VAL F 3 66  ? 9.405   -32.306 35.540 1.00 44.26  ? 82  VAL F CB  1 
ATOM   5462 C CG1 . VAL F 3 66  ? 8.082   -31.766 35.049 1.00 43.92  ? 82  VAL F CG1 1 
ATOM   5463 C CG2 . VAL F 3 66  ? 9.209   -33.603 36.310 1.00 44.60  ? 82  VAL F CG2 1 
ATOM   5464 N N   . LEU F 3 67  ? 12.569  -33.440 34.059 1.00 42.92  ? 83  LEU F N   1 
ATOM   5465 C CA  . LEU F 3 67  ? 13.992  -33.585 34.315 1.00 42.24  ? 83  LEU F CA  1 
ATOM   5466 C C   . LEU F 3 67  ? 14.675  -32.329 33.769 1.00 42.58  ? 83  LEU F C   1 
ATOM   5467 O O   . LEU F 3 67  ? 14.554  -32.021 32.590 1.00 43.78  ? 83  LEU F O   1 
ATOM   5468 C CB  . LEU F 3 67  ? 14.506  -34.863 33.657 1.00 41.35  ? 83  LEU F CB  1 
ATOM   5469 C CG  . LEU F 3 67  ? 15.993  -35.180 33.770 1.00 41.89  ? 83  LEU F CG  1 
ATOM   5470 C CD1 . LEU F 3 67  ? 16.414  -35.273 35.219 1.00 45.13  ? 83  LEU F CD1 1 
ATOM   5471 C CD2 . LEU F 3 67  ? 16.300  -36.461 33.072 1.00 41.35  ? 83  LEU F CD2 1 
ATOM   5472 N N   . GLU F 3 68  ? 15.365  -31.594 34.634 1.00 43.59  ? 84  GLU F N   1 
ATOM   5473 C CA  . GLU F 3 68  ? 15.929  -30.285 34.261 1.00 44.41  ? 84  GLU F CA  1 
ATOM   5474 C C   . GLU F 3 68  ? 17.443  -30.144 34.497 1.00 43.12  ? 84  GLU F C   1 
ATOM   5475 O O   . GLU F 3 68  ? 18.077  -29.220 33.982 1.00 42.06  ? 84  GLU F O   1 
ATOM   5476 C CB  . GLU F 3 68  ? 15.214  -29.176 35.037 1.00 44.43  ? 84  GLU F CB  1 
ATOM   5477 C CG  . GLU F 3 68  ? 13.863  -28.770 34.487 1.00 48.96  ? 84  GLU F CG  1 
ATOM   5478 C CD  . GLU F 3 68  ? 13.044  -27.956 35.496 1.00 54.66  ? 84  GLU F CD  1 
ATOM   5479 O OE1 . GLU F 3 68  ? 13.567  -27.637 36.594 1.00 55.35  ? 84  GLU F OE1 1 
ATOM   5480 O OE2 . GLU F 3 68  ? 11.867  -27.628 35.194 1.00 56.52  ? 84  GLU F OE2 1 
ATOM   5481 N N   . VAL F 3 69  ? 18.018  -31.055 35.276 1.00 41.43  ? 85  VAL F N   1 
ATOM   5482 C CA  . VAL F 3 69  ? 19.409  -30.936 35.674 1.00 39.20  ? 85  VAL F CA  1 
ATOM   5483 C C   . VAL F 3 69  ? 20.093  -32.288 35.838 1.00 38.46  ? 85  VAL F C   1 
ATOM   5484 O O   . VAL F 3 69  ? 19.578  -33.176 36.515 1.00 40.35  ? 85  VAL F O   1 
ATOM   5485 C CB  . VAL F 3 69  ? 19.526  -30.158 37.018 1.00 37.52  ? 85  VAL F CB  1 
ATOM   5486 C CG1 . VAL F 3 69  ? 20.970  -29.826 37.329 1.00 37.28  ? 85  VAL F CG1 1 
ATOM   5487 C CG2 . VAL F 3 69  ? 18.736  -28.883 36.953 1.00 38.45  ? 85  VAL F CG2 1 
ATOM   5488 N N   . ILE F 3 70  ? 21.244  -32.447 35.200 1.00 37.37  ? 86  ILE F N   1 
ATOM   5489 C CA  . ILE F 3 70  ? 22.122  -33.561 35.529 1.00 37.54  ? 86  ILE F CA  1 
ATOM   5490 C C   . ILE F 3 70  ? 23.370  -32.966 36.165 1.00 38.64  ? 86  ILE F C   1 
ATOM   5491 O O   . ILE F 3 70  ? 24.140  -32.248 35.520 1.00 35.97  ? 86  ILE F O   1 
ATOM   5492 C CB  . ILE F 3 70  ? 22.503  -34.388 34.302 1.00 37.70  ? 86  ILE F CB  1 
ATOM   5493 C CG1 . ILE F 3 70  ? 21.287  -35.159 33.790 1.00 36.05  ? 86  ILE F CG1 1 
ATOM   5494 C CG2 . ILE F 3 70  ? 23.661  -35.341 34.645 1.00 33.35  ? 86  ILE F CG2 1 
ATOM   5495 C CD1 . ILE F 3 70  ? 21.509  -35.770 32.396 1.00 38.87  ? 86  ILE F CD1 1 
ATOM   5496 N N   . GLU F 3 71  ? 23.555  -33.265 37.441 1.00 40.23  ? 87  GLU F N   1 
ATOM   5497 C CA  . GLU F 3 71  ? 24.671  -32.718 38.185 1.00 43.65  ? 87  GLU F CA  1 
ATOM   5498 C C   . GLU F 3 71  ? 25.968  -33.359 37.769 1.00 42.64  ? 87  GLU F C   1 
ATOM   5499 O O   . GLU F 3 71  ? 25.972  -34.254 36.940 1.00 45.40  ? 87  GLU F O   1 
ATOM   5500 C CB  . GLU F 3 71  ? 24.456  -32.929 39.672 1.00 47.21  ? 87  GLU F CB  1 
ATOM   5501 C CG  . GLU F 3 71  ? 23.527  -31.912 40.298 1.00 54.56  ? 87  GLU F CG  1 
ATOM   5502 C CD  . GLU F 3 71  ? 23.329  -32.187 41.769 1.00 59.73  ? 87  GLU F CD  1 
ATOM   5503 O OE1 . GLU F 3 71  ? 24.325  -32.101 42.535 1.00 60.15  ? 87  GLU F OE1 1 
ATOM   5504 O OE2 . GLU F 3 71  ? 22.175  -32.502 42.143 1.00 63.79  ? 87  GLU F OE2 1 
ATOM   5505 N N   . ALA F 3 72  ? 27.065  -32.879 38.348 1.00 43.25  ? 88  ALA F N   1 
ATOM   5506 C CA  . ALA F 3 72  ? 28.393  -33.446 38.143 1.00 44.19  ? 88  ALA F CA  1 
ATOM   5507 C C   . ALA F 3 72  ? 28.530  -34.845 38.757 1.00 45.56  ? 88  ALA F C   1 
ATOM   5508 O O   . ALA F 3 72  ? 27.834  -35.194 39.715 1.00 45.19  ? 88  ALA F O   1 
ATOM   5509 C CB  . ALA F 3 72  ? 29.431  -32.526 38.740 1.00 43.49  ? 88  ALA F CB  1 
ATOM   5510 N N   . ASP F 3 73  ? 29.441  -35.634 38.198 1.00 47.13  ? 89  ASP F N   1 
ATOM   5511 C CA  . ASP F 3 73  ? 29.723  -36.987 38.689 1.00 50.05  ? 89  ASP F CA  1 
ATOM   5512 C C   . ASP F 3 73  ? 28.487  -37.900 38.771 1.00 48.71  ? 89  ASP F C   1 
ATOM   5513 O O   . ASP F 3 73  ? 28.294  -38.597 39.765 1.00 50.13  ? 89  ASP F O   1 
ATOM   5514 C CB  . ASP F 3 73  ? 30.454  -36.941 40.048 1.00 52.68  ? 89  ASP F CB  1 
ATOM   5515 C CG  . ASP F 3 73  ? 31.520  -35.845 40.105 1.00 57.47  ? 89  ASP F CG  1 
ATOM   5516 O OD1 . ASP F 3 73  ? 32.172  -35.583 39.068 1.00 60.05  ? 89  ASP F OD1 1 
ATOM   5517 O OD2 . ASP F 3 73  ? 31.762  -35.197 41.152 1.00 59.18  ? 89  ASP F OD2 1 
ATOM   5518 N N   . VAL F 3 74  ? 27.652  -37.880 37.733 1.00 46.72  ? 90  VAL F N   1 
ATOM   5519 C CA  . VAL F 3 74  ? 26.523  -38.800 37.642 1.00 46.62  ? 90  VAL F CA  1 
ATOM   5520 C C   . VAL F 3 74  ? 26.967  -40.044 36.870 1.00 47.98  ? 90  VAL F C   1 
ATOM   5521 O O   . VAL F 3 74  ? 26.736  -41.174 37.304 1.00 48.22  ? 90  VAL F O   1 
ATOM   5522 C CB  . VAL F 3 74  ? 25.314  -38.139 36.958 1.00 46.38  ? 90  VAL F CB  1 
ATOM   5523 C CG1 . VAL F 3 74  ? 24.233  -39.150 36.627 1.00 42.45  ? 90  VAL F CG1 1 
ATOM   5524 C CG2 . VAL F 3 74  ? 24.756  -37.070 37.861 1.00 48.93  ? 90  VAL F CG2 1 
ATOM   5525 N N   . PHE F 3 75  ? 27.606  -39.816 35.727 1.00 46.96  ? 91  PHE F N   1 
ATOM   5526 C CA  . PHE F 3 75  ? 28.169  -40.876 34.916 1.00 44.58  ? 91  PHE F CA  1 
ATOM   5527 C C   . PHE F 3 75  ? 29.683  -40.848 35.125 1.00 46.26  ? 91  PHE F C   1 
ATOM   5528 O O   . PHE F 3 75  ? 30.452  -40.458 34.246 1.00 43.77  ? 91  PHE F O   1 
ATOM   5529 C CB  . PHE F 3 75  ? 27.779  -40.670 33.446 1.00 43.08  ? 91  PHE F CB  1 
ATOM   5530 C CG  . PHE F 3 75  ? 26.294  -40.483 33.235 1.00 41.01  ? 91  PHE F CG  1 
ATOM   5531 C CD1 . PHE F 3 75  ? 25.399  -41.506 33.529 1.00 38.24  ? 91  PHE F CD1 1 
ATOM   5532 C CD2 . PHE F 3 75  ? 25.790  -39.274 32.764 1.00 39.71  ? 91  PHE F CD2 1 
ATOM   5533 C CE1 . PHE F 3 75  ? 24.029  -41.333 33.354 1.00 33.35  ? 91  PHE F CE1 1 
ATOM   5534 C CE2 . PHE F 3 75  ? 24.420  -39.098 32.579 1.00 35.16  ? 91  PHE F CE2 1 
ATOM   5535 C CZ  . PHE F 3 75  ? 23.540  -40.134 32.883 1.00 32.97  ? 91  PHE F CZ  1 
ATOM   5536 N N   . SER F 3 76  ? 30.095  -41.268 36.317 1.00 48.95  ? 92  SER F N   1 
ATOM   5537 C CA  . SER F 3 76  ? 31.501  -41.230 36.711 1.00 54.11  ? 92  SER F CA  1 
ATOM   5538 C C   . SER F 3 76  ? 31.964  -42.554 37.305 1.00 54.62  ? 92  SER F C   1 
ATOM   5539 O O   . SER F 3 76  ? 31.265  -43.138 38.133 1.00 54.88  ? 92  SER F O   1 
ATOM   5540 C CB  . SER F 3 76  ? 31.728  -40.118 37.741 1.00 56.63  ? 92  SER F CB  1 
ATOM   5541 O OG  . SER F 3 76  ? 31.202  -40.493 39.018 1.00 59.70  ? 92  SER F OG  1 
ATOM   5542 N N   . ASN F 3 77  ? 33.151  -42.997 36.889 1.00 56.10  ? 93  ASN F N   1 
ATOM   5543 C CA  . ASN F 3 77  ? 33.779  -44.233 37.375 1.00 58.69  ? 93  ASN F CA  1 
ATOM   5544 C C   . ASN F 3 77  ? 32.832  -45.436 37.439 1.00 58.38  ? 93  ASN F C   1 
ATOM   5545 O O   . ASN F 3 77  ? 32.495  -45.944 38.521 1.00 58.05  ? 93  ASN F O   1 
ATOM   5546 C CB  . ASN F 3 77  ? 34.468  -43.976 38.725 1.00 61.26  ? 93  ASN F CB  1 
ATOM   5547 C CG  . ASN F 3 77  ? 35.339  -42.725 38.699 1.00 64.31  ? 93  ASN F CG  1 
ATOM   5548 O OD1 . ASN F 3 77  ? 35.055  -41.738 39.389 1.00 66.40  ? 93  ASN F OD1 1 
ATOM   5549 N ND2 . ASN F 3 77  ? 36.394  -42.751 37.879 1.00 64.93  ? 93  ASN F ND2 1 
ATOM   5550 N N   . LEU F 3 78  ? 32.400  -45.872 36.259 1.00 57.55  ? 94  LEU F N   1 
ATOM   5551 C CA  . LEU F 3 78  ? 31.482  -47.004 36.118 1.00 58.06  ? 94  LEU F CA  1 
ATOM   5552 C C   . LEU F 3 78  ? 32.085  -47.925 35.057 1.00 58.03  ? 94  LEU F C   1 
ATOM   5553 O O   . LEU F 3 78  ? 31.664  -47.899 33.896 1.00 61.29  ? 94  LEU F O   1 
ATOM   5554 C CB  . LEU F 3 78  ? 30.119  -46.505 35.657 1.00 57.18  ? 94  LEU F CB  1 
ATOM   5555 C CG  . LEU F 3 78  ? 29.249  -45.704 36.608 1.00 55.33  ? 94  LEU F CG  1 
ATOM   5556 C CD1 . LEU F 3 78  ? 28.178  -45.001 35.821 1.00 56.04  ? 94  LEU F CD1 1 
ATOM   5557 C CD2 . LEU F 3 78  ? 28.623  -46.630 37.598 1.00 57.49  ? 94  LEU F CD2 1 
ATOM   5558 N N   . PRO F 3 79  ? 33.022  -48.783 35.476 1.00 55.91  ? 95  PRO F N   1 
ATOM   5559 C CA  . PRO F 3 79  ? 33.873  -49.524 34.540 1.00 54.24  ? 95  PRO F CA  1 
ATOM   5560 C C   . PRO F 3 79  ? 33.184  -50.460 33.562 1.00 51.94  ? 95  PRO F C   1 
ATOM   5561 O O   . PRO F 3 79  ? 33.805  -50.926 32.615 1.00 51.78  ? 95  PRO F O   1 
ATOM   5562 C CB  . PRO F 3 79  ? 34.817  -50.290 35.472 1.00 54.40  ? 95  PRO F CB  1 
ATOM   5563 C CG  . PRO F 3 79  ? 34.702  -49.593 36.770 1.00 55.02  ? 95  PRO F CG  1 
ATOM   5564 C CD  . PRO F 3 79  ? 33.261  -49.214 36.861 1.00 54.99  ? 95  PRO F CD  1 
ATOM   5565 N N   . LYS F 3 80  ? 31.909  -50.735 33.772 1.00 50.48  ? 96  LYS F N   1 
ATOM   5566 C CA  . LYS F 3 80  ? 31.218  -51.665 32.898 1.00 49.14  ? 96  LYS F CA  1 
ATOM   5567 C C   . LYS F 3 80  ? 30.113  -51.027 32.060 1.00 47.97  ? 96  LYS F C   1 
ATOM   5568 O O   . LYS F 3 80  ? 29.456  -51.712 31.276 1.00 49.66  ? 96  LYS F O   1 
ATOM   5569 C CB  . LYS F 3 80  ? 30.665  -52.833 33.713 1.00 51.36  ? 96  LYS F CB  1 
ATOM   5570 C CG  . LYS F 3 80  ? 31.643  -53.989 33.927 1.00 53.24  ? 96  LYS F CG  1 
ATOM   5571 C CD  . LYS F 3 80  ? 30.925  -55.105 34.659 1.00 55.74  ? 96  LYS F CD  1 
ATOM   5572 C CE  . LYS F 3 80  ? 31.744  -56.363 34.754 1.00 58.17  ? 96  LYS F CE  1 
ATOM   5573 N NZ  . LYS F 3 80  ? 31.172  -57.236 35.819 1.00 60.31  ? 96  LYS F NZ  1 
ATOM   5574 N N   . LEU F 3 81  ? 29.903  -49.725 32.225 1.00 45.68  ? 97  LEU F N   1 
ATOM   5575 C CA  . LEU F 3 81  ? 28.894  -49.008 31.455 1.00 42.23  ? 97  LEU F CA  1 
ATOM   5576 C C   . LEU F 3 81  ? 29.268  -48.953 29.969 1.00 42.50  ? 97  LEU F C   1 
ATOM   5577 O O   . LEU F 3 81  ? 30.366  -48.521 29.616 1.00 40.49  ? 97  LEU F O   1 
ATOM   5578 C CB  . LEU F 3 81  ? 28.713  -47.602 32.034 1.00 41.19  ? 97  LEU F CB  1 
ATOM   5579 C CG  . LEU F 3 81  ? 27.694  -46.627 31.435 1.00 38.24  ? 97  LEU F CG  1 
ATOM   5580 C CD1 . LEU F 3 81  ? 26.285  -47.140 31.620 1.00 36.83  ? 97  LEU F CD1 1 
ATOM   5581 C CD2 . LEU F 3 81  ? 27.855  -45.249 32.071 1.00 34.43  ? 97  LEU F CD2 1 
ATOM   5582 N N   . HIS F 3 82  ? 28.350  -49.409 29.116 1.00 44.30  ? 98  HIS F N   1 
ATOM   5583 C CA  . HIS F 3 82  ? 28.538  -49.409 27.663 1.00 44.42  ? 98  HIS F CA  1 
ATOM   5584 C C   . HIS F 3 82  ? 27.606  -48.429 26.958 1.00 39.48  ? 98  HIS F C   1 
ATOM   5585 O O   . HIS F 3 82  ? 27.967  -47.868 25.927 1.00 37.27  ? 98  HIS F O   1 
ATOM   5586 C CB  . HIS F 3 82  ? 28.342  -50.820 27.081 1.00 47.58  ? 98  HIS F CB  1 
ATOM   5587 C CG  . HIS F 3 82  ? 29.241  -51.872 27.694 1.00 58.70  ? 98  HIS F CG  1 
ATOM   5588 N ND1 . HIS F 3 82  ? 30.620  -51.835 27.593 1.00 62.70  ? 98  HIS F ND1 1 
ATOM   5589 C CD2 . HIS F 3 82  ? 28.951  -52.981 28.424 1.00 62.15  ? 98  HIS F CD2 1 
ATOM   5590 C CE1 . HIS F 3 82  ? 31.137  -52.873 28.233 1.00 62.19  ? 98  HIS F CE1 1 
ATOM   5591 N NE2 . HIS F 3 82  ? 30.147  -53.582 28.745 1.00 62.09  ? 98  HIS F NE2 1 
ATOM   5592 N N   . GLU F 3 83  ? 26.421  -48.204 27.523 1.00 37.64  ? 99  GLU F N   1 
ATOM   5593 C CA  . GLU F 3 83  ? 25.387  -47.410 26.855 1.00 38.62  ? 99  GLU F CA  1 
ATOM   5594 C C   . GLU F 3 83  ? 24.735  -46.385 27.793 1.00 38.05  ? 99  GLU F C   1 
ATOM   5595 O O   . GLU F 3 83  ? 24.337  -46.721 28.907 1.00 37.59  ? 99  GLU F O   1 
ATOM   5596 C CB  . GLU F 3 83  ? 24.333  -48.359 26.258 1.00 40.90  ? 99  GLU F CB  1 
ATOM   5597 C CG  . GLU F 3 83  ? 23.160  -47.706 25.522 1.00 48.65  ? 99  GLU F CG  1 
ATOM   5598 C CD  . GLU F 3 83  ? 22.153  -48.735 24.989 1.00 55.06  ? 99  GLU F CD  1 
ATOM   5599 O OE1 . GLU F 3 83  ? 22.559  -49.628 24.190 1.00 55.88  ? 99  GLU F OE1 1 
ATOM   5600 O OE2 . GLU F 3 83  ? 20.952  -48.652 25.371 1.00 55.31  ? 99  GLU F OE2 1 
ATOM   5601 N N   . ILE F 3 84  ? 24.659  -45.131 27.345 1.00 36.06  ? 100 ILE F N   1 
ATOM   5602 C CA  . ILE F 3 84  ? 23.893  -44.106 28.045 1.00 34.88  ? 100 ILE F CA  1 
ATOM   5603 C C   . ILE F 3 84  ? 22.885  -43.577 27.068 1.00 35.52  ? 100 ILE F C   1 
ATOM   5604 O O   . ILE F 3 84  ? 23.260  -43.153 25.968 1.00 35.34  ? 100 ILE F O   1 
ATOM   5605 C CB  . ILE F 3 84  ? 24.765  -42.926 28.507 1.00 34.34  ? 100 ILE F CB  1 
ATOM   5606 C CG1 . ILE F 3 84  ? 25.854  -43.396 29.471 1.00 32.14  ? 100 ILE F CG1 1 
ATOM   5607 C CG2 . ILE F 3 84  ? 23.888  -41.850 29.144 1.00 28.00  ? 100 ILE F CG2 1 
ATOM   5608 C CD1 . ILE F 3 84  ? 26.786  -42.287 29.927 1.00 33.35  ? 100 ILE F CD1 1 
ATOM   5609 N N   . ARG F 3 85  ? 21.615  -43.566 27.457 1.00 36.01  ? 101 ARG F N   1 
ATOM   5610 C CA  . ARG F 3 85  ? 20.588  -43.114 26.532 1.00 37.69  ? 101 ARG F CA  1 
ATOM   5611 C C   . ARG F 3 85  ? 19.691  -42.098 27.197 1.00 35.72  ? 101 ARG F C   1 
ATOM   5612 O O   . ARG F 3 85  ? 18.961  -42.430 28.126 1.00 39.38  ? 101 ARG F O   1 
ATOM   5613 C CB  . ARG F 3 85  ? 19.768  -44.298 26.050 1.00 38.14  ? 101 ARG F CB  1 
ATOM   5614 C CG  . ARG F 3 85  ? 19.825  -44.491 24.568 1.00 47.63  ? 101 ARG F CG  1 
ATOM   5615 C CD  . ARG F 3 85  ? 19.579  -45.925 24.149 1.00 54.36  ? 101 ARG F CD  1 
ATOM   5616 N NE  . ARG F 3 85  ? 18.205  -46.309 24.426 1.00 62.89  ? 101 ARG F NE  1 
ATOM   5617 C CZ  . ARG F 3 85  ? 17.253  -46.367 23.502 1.00 70.49  ? 101 ARG F CZ  1 
ATOM   5618 N NH1 . ARG F 3 85  ? 17.531  -46.082 22.226 1.00 73.35  ? 101 ARG F NH1 1 
ATOM   5619 N NH2 . ARG F 3 85  ? 16.015  -46.712 23.852 1.00 75.70  ? 101 ARG F NH2 1 
ATOM   5620 N N   . ILE F 3 86  ? 19.753  -40.856 26.747 1.00 34.80  ? 102 ILE F N   1 
ATOM   5621 C CA  . ILE F 3 86  ? 18.893  -39.812 27.280 1.00 34.78  ? 102 ILE F CA  1 
ATOM   5622 C C   . ILE F 3 86  ? 17.967  -39.359 26.175 1.00 36.19  ? 102 ILE F C   1 
ATOM   5623 O O   . ILE F 3 86  ? 18.410  -38.799 25.170 1.00 37.81  ? 102 ILE F O   1 
ATOM   5624 C CB  . ILE F 3 86  ? 19.737  -38.663 27.829 1.00 34.00  ? 102 ILE F CB  1 
ATOM   5625 C CG1 . ILE F 3 86  ? 20.539  -39.168 29.031 1.00 30.90  ? 102 ILE F CG1 1 
ATOM   5626 C CG2 . ILE F 3 86  ? 18.846  -37.481 28.219 1.00 34.05  ? 102 ILE F CG2 1 
ATOM   5627 C CD1 . ILE F 3 86  ? 21.806  -38.396 29.322 1.00 30.64  ? 102 ILE F CD1 1 
ATOM   5628 N N   . GLU F 3 87  ? 16.680  -39.626 26.357 1.00 37.80  ? 103 GLU F N   1 
ATOM   5629 C CA  . GLU F 3 87  ? 15.689  -39.402 25.312 1.00 39.62  ? 103 GLU F CA  1 
ATOM   5630 C C   . GLU F 3 87  ? 14.446  -38.687 25.805 1.00 40.26  ? 103 GLU F C   1 
ATOM   5631 O O   . GLU F 3 87  ? 13.853  -39.060 26.829 1.00 44.10  ? 103 GLU F O   1 
ATOM   5632 C CB  . GLU F 3 87  ? 15.207  -40.730 24.766 1.00 40.85  ? 103 GLU F CB  1 
ATOM   5633 C CG  . GLU F 3 87  ? 16.192  -41.516 23.946 1.00 50.35  ? 103 GLU F CG  1 
ATOM   5634 C CD  . GLU F 3 87  ? 15.503  -42.712 23.306 1.00 58.06  ? 103 GLU F CD  1 
ATOM   5635 O OE1 . GLU F 3 87  ? 14.526  -42.490 22.540 1.00 62.83  ? 103 GLU F OE1 1 
ATOM   5636 O OE2 . GLU F 3 87  ? 15.913  -43.866 23.574 1.00 59.45  ? 103 GLU F OE2 1 
ATOM   5637 N N   . LYS F 3 88  ? 14.025  -37.681 25.056 1.00 38.79  ? 104 LYS F N   1 
ATOM   5638 C CA  . LYS F 3 88  ? 12.755  -37.033 25.321 1.00 38.04  ? 104 LYS F CA  1 
ATOM   5639 C C   . LYS F 3 88  ? 12.743  -36.424 26.717 1.00 37.93  ? 104 LYS F C   1 
ATOM   5640 O O   . LYS F 3 88  ? 11.869  -36.683 27.530 1.00 38.38  ? 104 LYS F O   1 
ATOM   5641 C CB  . LYS F 3 88  ? 11.599  -38.023 25.090 1.00 37.04  ? 104 LYS F CB  1 
ATOM   5642 C CG  . LYS F 3 88  ? 11.400  -38.389 23.613 1.00 37.83  ? 104 LYS F CG  1 
ATOM   5643 C CD  . LYS F 3 88  ? 10.727  -39.740 23.418 1.00 38.88  ? 104 LYS F CD  1 
ATOM   5644 C CE  . LYS F 3 88  ? 11.770  -40.824 23.265 1.00 42.03  ? 104 LYS F CE  1 
ATOM   5645 N NZ  . LYS F 3 88  ? 11.178  -42.185 23.297 1.00 42.96  ? 104 LYS F NZ  1 
ATOM   5646 N N   . ALA F 3 89  ? 13.778  -35.647 26.992 1.00 39.68  ? 105 ALA F N   1 
ATOM   5647 C CA  . ALA F 3 89  ? 13.818  -34.816 28.170 1.00 39.28  ? 105 ALA F CA  1 
ATOM   5648 C C   . ALA F 3 89  ? 13.473  -33.410 27.651 1.00 39.16  ? 105 ALA F C   1 
ATOM   5649 O O   . ALA F 3 89  ? 14.310  -32.535 27.442 1.00 37.62  ? 105 ALA F O   1 
ATOM   5650 C CB  . ALA F 3 89  ? 15.179  -34.882 28.840 1.00 38.66  ? 105 ALA F CB  1 
ATOM   5651 N N   . ASN F 3 90  ? 12.186  -33.278 27.390 1.00 41.41  ? 106 ASN F N   1 
ATOM   5652 C CA  . ASN F 3 90  ? 11.507  -32.077 26.973 1.00 42.29  ? 106 ASN F CA  1 
ATOM   5653 C C   . ASN F 3 90  ? 11.988  -30.800 27.688 1.00 43.28  ? 106 ASN F C   1 
ATOM   5654 O O   . ASN F 3 90  ? 12.151  -29.765 27.048 1.00 43.73  ? 106 ASN F O   1 
ATOM   5655 C CB  . ASN F 3 90  ? 10.017  -32.352 27.210 1.00 44.58  ? 106 ASN F CB  1 
ATOM   5656 C CG  . ASN F 3 90  ? 9.190   -31.122 27.247 1.00 47.71  ? 106 ASN F CG  1 
ATOM   5657 O OD1 . ASN F 3 90  ? 9.519   -30.115 26.630 1.00 55.57  ? 106 ASN F OD1 1 
ATOM   5658 N ND2 . ASN F 3 90  ? 8.081   -31.189 27.968 1.00 50.16  ? 106 ASN F ND2 1 
ATOM   5659 N N   . ASN F 3 91  ? 12.228  -30.876 28.997 1.00 43.20  ? 107 ASN F N   1 
ATOM   5660 C CA  . ASN F 3 91  ? 12.656  -29.718 29.785 1.00 41.72  ? 107 ASN F CA  1 
ATOM   5661 C C   . ASN F 3 91  ? 14.046  -29.844 30.372 1.00 41.05  ? 107 ASN F C   1 
ATOM   5662 O O   . ASN F 3 91  ? 14.389  -29.139 31.321 1.00 39.74  ? 107 ASN F O   1 
ATOM   5663 C CB  . ASN F 3 91  ? 11.683  -29.499 30.930 1.00 45.98  ? 107 ASN F CB  1 
ATOM   5664 C CG  . ASN F 3 91  ? 10.361  -28.949 30.461 1.00 50.70  ? 107 ASN F CG  1 
ATOM   5665 O OD1 . ASN F 3 91  ? 10.305  -27.884 29.839 1.00 54.37  ? 107 ASN F OD1 1 
ATOM   5666 N ND2 . ASN F 3 91  ? 9.283   -29.669 30.754 1.00 52.08  ? 107 ASN F ND2 1 
ATOM   5667 N N   . LEU F 3 92  ? 14.841  -30.777 29.853 1.00 41.64  ? 108 LEU F N   1 
ATOM   5668 C CA  . LEU F 3 92  ? 16.198  -30.933 30.351 1.00 37.37  ? 108 LEU F CA  1 
ATOM   5669 C C   . LEU F 3 92  ? 16.971  -29.804 29.750 1.00 37.09  ? 108 LEU F C   1 
ATOM   5670 O O   . LEU F 3 92  ? 17.185  -29.765 28.543 1.00 37.63  ? 108 LEU F O   1 
ATOM   5671 C CB  . LEU F 3 92  ? 16.810  -32.262 29.938 1.00 34.08  ? 108 LEU F CB  1 
ATOM   5672 C CG  . LEU F 3 92  ? 18.292  -32.473 30.267 1.00 31.38  ? 108 LEU F CG  1 
ATOM   5673 C CD1 . LEU F 3 92  ? 18.547  -32.443 31.764 1.00 31.03  ? 108 LEU F CD1 1 
ATOM   5674 C CD2 . LEU F 3 92  ? 18.754  -33.797 29.711 1.00 34.43  ? 108 LEU F CD2 1 
ATOM   5675 N N   . LEU F 3 93  ? 17.369  -28.857 30.577 1.00 36.90  ? 109 LEU F N   1 
ATOM   5676 C CA  . LEU F 3 93  ? 18.122  -27.763 30.020 1.00 37.38  ? 109 LEU F CA  1 
ATOM   5677 C C   . LEU F 3 93  ? 19.549  -27.591 30.559 1.00 35.79  ? 109 LEU F C   1 
ATOM   5678 O O   . LEU F 3 93  ? 20.274  -26.710 30.094 1.00 37.28  ? 109 LEU F O   1 
ATOM   5679 C CB  . LEU F 3 93  ? 17.305  -26.477 30.089 1.00 37.94  ? 109 LEU F CB  1 
ATOM   5680 C CG  . LEU F 3 93  ? 17.045  -25.939 31.477 1.00 38.52  ? 109 LEU F CG  1 
ATOM   5681 C CD1 . LEU F 3 93  ? 17.418  -24.521 31.386 1.00 41.15  ? 109 LEU F CD1 1 
ATOM   5682 C CD2 . LEU F 3 93  ? 15.578  -26.055 31.825 1.00 41.77  ? 109 LEU F CD2 1 
ATOM   5683 N N   . TYR F 3 94  ? 19.980  -28.446 31.484 1.00 33.65  ? 110 TYR F N   1 
ATOM   5684 C CA  . TYR F 3 94  ? 21.329  -28.307 32.029 1.00 32.85  ? 110 TYR F CA  1 
ATOM   5685 C C   . TYR F 3 94  ? 22.050  -29.606 32.356 1.00 31.50  ? 110 TYR F C   1 
ATOM   5686 O O   . TYR F 3 94  ? 21.677  -30.317 33.288 1.00 32.38  ? 110 TYR F O   1 
ATOM   5687 C CB  . TYR F 3 94  ? 21.298  -27.412 33.272 1.00 31.16  ? 110 TYR F CB  1 
ATOM   5688 C CG  . TYR F 3 94  ? 22.639  -27.215 33.935 1.00 29.44  ? 110 TYR F CG  1 
ATOM   5689 C CD1 . TYR F 3 94  ? 23.727  -26.779 33.215 1.00 30.57  ? 110 TYR F CD1 1 
ATOM   5690 C CD2 . TYR F 3 94  ? 22.811  -27.442 35.296 1.00 30.19  ? 110 TYR F CD2 1 
ATOM   5691 C CE1 . TYR F 3 94  ? 24.969  -26.586 33.828 1.00 31.13  ? 110 TYR F CE1 1 
ATOM   5692 C CE2 . TYR F 3 94  ? 24.047  -27.235 35.923 1.00 27.62  ? 110 TYR F CE2 1 
ATOM   5693 C CZ  . TYR F 3 94  ? 25.116  -26.809 35.176 1.00 29.29  ? 110 TYR F CZ  1 
ATOM   5694 O OH  . TYR F 3 94  ? 26.342  -26.576 35.752 1.00 29.33  ? 110 TYR F OH  1 
ATOM   5695 N N   . ILE F 3 95  ? 23.099  -29.907 31.601 1.00 32.93  ? 111 ILE F N   1 
ATOM   5696 C CA  . ILE F 3 95  ? 23.981  -31.033 31.958 1.00 33.30  ? 111 ILE F CA  1 
ATOM   5697 C C   . ILE F 3 95  ? 25.312  -30.448 32.425 1.00 32.97  ? 111 ILE F C   1 
ATOM   5698 O O   . ILE F 3 95  ? 26.044  -29.843 31.648 1.00 34.26  ? 111 ILE F O   1 
ATOM   5699 C CB  . ILE F 3 95  ? 24.200  -32.029 30.769 1.00 31.72  ? 111 ILE F CB  1 
ATOM   5700 C CG1 . ILE F 3 95  ? 22.859  -32.468 30.175 1.00 29.91  ? 111 ILE F CG1 1 
ATOM   5701 C CG2 . ILE F 3 95  ? 25.014  -33.244 31.223 1.00 27.87  ? 111 ILE F CG2 1 
ATOM   5702 C CD1 . ILE F 3 95  ? 23.006  -33.459 29.018 1.00 29.51  ? 111 ILE F CD1 1 
ATOM   5703 N N   . ASN F 3 96  ? 25.603  -30.611 33.706 1.00 34.97  ? 112 ASN F N   1 
ATOM   5704 C CA  . ASN F 3 96  ? 26.841  -30.116 34.289 1.00 37.19  ? 112 ASN F CA  1 
ATOM   5705 C C   . ASN F 3 96  ? 28.051  -30.680 33.541 1.00 38.15  ? 112 ASN F C   1 
ATOM   5706 O O   . ASN F 3 96  ? 28.117  -31.883 33.282 1.00 38.26  ? 112 ASN F O   1 
ATOM   5707 C CB  . ASN F 3 96  ? 26.882  -30.499 35.767 1.00 37.44  ? 112 ASN F CB  1 
ATOM   5708 C CG  . ASN F 3 96  ? 28.173  -30.109 36.440 1.00 34.79  ? 112 ASN F CG  1 
ATOM   5709 O OD1 . ASN F 3 96  ? 29.213  -30.707 36.203 1.00 37.23  ? 112 ASN F OD1 1 
ATOM   5710 N ND2 . ASN F 3 96  ? 28.108  -29.115 37.308 1.00 35.30  ? 112 ASN F ND2 1 
ATOM   5711 N N   . PRO F 3 97  ? 29.001  -29.816 33.185 1.00 38.42  ? 113 PRO F N   1 
ATOM   5712 C CA  . PRO F 3 97  ? 30.195  -30.217 32.446 1.00 40.80  ? 113 PRO F CA  1 
ATOM   5713 C C   . PRO F 3 97  ? 31.012  -31.343 33.074 1.00 42.54  ? 113 PRO F C   1 
ATOM   5714 O O   . PRO F 3 97  ? 31.913  -31.878 32.432 1.00 45.86  ? 113 PRO F O   1 
ATOM   5715 C CB  . PRO F 3 97  ? 31.014  -28.933 32.386 1.00 39.82  ? 113 PRO F CB  1 
ATOM   5716 C CG  . PRO F 3 97  ? 30.000  -27.885 32.416 1.00 40.91  ? 113 PRO F CG  1 
ATOM   5717 C CD  . PRO F 3 97  ? 28.987  -28.366 33.425 1.00 39.98  ? 113 PRO F CD  1 
ATOM   5718 N N   . GLU F 3 98  ? 30.710  -31.709 34.309 1.00 42.13  ? 114 GLU F N   1 
ATOM   5719 C CA  . GLU F 3 98  ? 31.457  -32.771 34.946 1.00 44.34  ? 114 GLU F CA  1 
ATOM   5720 C C   . GLU F 3 98  ? 30.567  -33.980 35.151 1.00 42.78  ? 114 GLU F C   1 
ATOM   5721 O O   . GLU F 3 98  ? 30.805  -34.797 36.043 1.00 41.73  ? 114 GLU F O   1 
ATOM   5722 C CB  . GLU F 3 98  ? 32.017  -32.285 36.278 1.00 48.94  ? 114 GLU F CB  1 
ATOM   5723 C CG  . GLU F 3 98  ? 32.371  -30.810 36.289 1.00 58.35  ? 114 GLU F CG  1 
ATOM   5724 C CD  . GLU F 3 98  ? 33.672  -30.544 37.020 1.00 67.11  ? 114 GLU F CD  1 
ATOM   5725 O OE1 . GLU F 3 98  ? 34.398  -31.531 37.304 1.00 69.94  ? 114 GLU F OE1 1 
ATOM   5726 O OE2 . GLU F 3 98  ? 33.972  -29.353 37.302 1.00 70.76  ? 114 GLU F OE2 1 
ATOM   5727 N N   . ALA F 3 99  ? 29.538  -34.090 34.316 1.00 43.57  ? 115 ALA F N   1 
ATOM   5728 C CA  . ALA F 3 99  ? 28.581  -35.187 34.424 1.00 42.25  ? 115 ALA F CA  1 
ATOM   5729 C C   . ALA F 3 99  ? 29.197  -36.505 33.947 1.00 42.32  ? 115 ALA F C   1 
ATOM   5730 O O   . ALA F 3 99  ? 28.880  -37.571 34.467 1.00 43.45  ? 115 ALA F O   1 
ATOM   5731 C CB  . ALA F 3 99  ? 27.309  -34.866 33.651 1.00 38.51  ? 115 ALA F CB  1 
ATOM   5732 N N   . PHE F 3 100 ? 30.099  -36.428 32.976 1.00 42.45  ? 116 PHE F N   1 
ATOM   5733 C CA  . PHE F 3 100 ? 30.713  -37.627 32.432 1.00 42.75  ? 116 PHE F CA  1 
ATOM   5734 C C   . PHE F 3 100 ? 32.207  -37.704 32.764 1.00 43.18  ? 116 PHE F C   1 
ATOM   5735 O O   . PHE F 3 100 ? 32.970  -36.800 32.425 1.00 42.87  ? 116 PHE F O   1 
ATOM   5736 C CB  . PHE F 3 100 ? 30.494  -37.683 30.912 1.00 40.60  ? 116 PHE F CB  1 
ATOM   5737 C CG  . PHE F 3 100 ? 29.055  -37.595 30.500 1.00 39.67  ? 116 PHE F CG  1 
ATOM   5738 C CD1 . PHE F 3 100 ? 28.444  -36.372 30.318 1.00 40.05  ? 116 PHE F CD1 1 
ATOM   5739 C CD2 . PHE F 3 100 ? 28.305  -38.739 30.292 1.00 43.06  ? 116 PHE F CD2 1 
ATOM   5740 C CE1 . PHE F 3 100 ? 27.108  -36.293 29.926 1.00 37.02  ? 116 PHE F CE1 1 
ATOM   5741 C CE2 . PHE F 3 100 ? 26.967  -38.663 29.899 1.00 40.31  ? 116 PHE F CE2 1 
ATOM   5742 C CZ  . PHE F 3 100 ? 26.376  -37.442 29.721 1.00 38.83  ? 116 PHE F CZ  1 
ATOM   5743 N N   . GLN F 3 101 ? 32.618  -38.787 33.419 1.00 44.75  ? 117 GLN F N   1 
ATOM   5744 C CA  . GLN F 3 101 ? 34.030  -39.006 33.756 1.00 46.88  ? 117 GLN F CA  1 
ATOM   5745 C C   . GLN F 3 101 ? 34.428  -40.481 33.771 1.00 45.07  ? 117 GLN F C   1 
ATOM   5746 O O   . GLN F 3 101 ? 33.743  -41.315 34.354 1.00 47.03  ? 117 GLN F O   1 
ATOM   5747 C CB  . GLN F 3 101 ? 34.363  -38.408 35.132 1.00 48.37  ? 117 GLN F CB  1 
ATOM   5748 C CG  . GLN F 3 101 ? 34.901  -36.990 35.104 1.00 52.96  ? 117 GLN F CG  1 
ATOM   5749 C CD  . GLN F 3 101 ? 34.619  -36.255 36.402 1.00 56.43  ? 117 GLN F CD  1 
ATOM   5750 O OE1 . GLN F 3 101 ? 34.216  -36.876 37.393 1.00 58.23  ? 117 GLN F OE1 1 
ATOM   5751 N NE2 . GLN F 3 101 ? 34.818  -34.933 36.402 1.00 57.15  ? 117 GLN F NE2 1 
ATOM   5752 N N   . ASN F 3 102 ? 35.548  -40.792 33.139 1.00 43.21  ? 118 ASN F N   1 
ATOM   5753 C CA  . ASN F 3 102 ? 36.144  -42.113 33.252 1.00 42.98  ? 118 ASN F CA  1 
ATOM   5754 C C   . ASN F 3 102 ? 35.148  -43.283 33.093 1.00 42.87  ? 118 ASN F C   1 
ATOM   5755 O O   . ASN F 3 102 ? 34.754  -43.948 34.055 1.00 43.68  ? 118 ASN F O   1 
ATOM   5756 C CB  . ASN F 3 102 ? 36.935  -42.200 34.567 1.00 41.70  ? 118 ASN F CB  1 
ATOM   5757 C CG  . ASN F 3 102 ? 37.768  -43.453 34.666 1.00 41.14  ? 118 ASN F CG  1 
ATOM   5758 O OD1 . ASN F 3 102 ? 37.949  -43.994 35.752 1.00 42.61  ? 118 ASN F OD1 1 
ATOM   5759 N ND2 . ASN F 3 102 ? 38.282  -43.924 33.534 1.00 40.39  ? 118 ASN F ND2 1 
ATOM   5760 N N   . LEU F 3 103 ? 34.744  -43.495 31.846 1.00 41.41  ? 119 LEU F N   1 
ATOM   5761 C CA  . LEU F 3 103 ? 33.918  -44.619 31.448 1.00 39.62  ? 119 LEU F CA  1 
ATOM   5762 C C   . LEU F 3 103 ? 34.730  -45.369 30.383 1.00 39.34  ? 119 LEU F C   1 
ATOM   5763 O O   . LEU F 3 103 ? 34.563  -45.151 29.176 1.00 39.15  ? 119 LEU F O   1 
ATOM   5764 C CB  . LEU F 3 103 ? 32.589  -44.123 30.874 1.00 38.64  ? 119 LEU F CB  1 
ATOM   5765 C CG  . LEU F 3 103 ? 31.868  -43.006 31.639 1.00 34.63  ? 119 LEU F CG  1 
ATOM   5766 C CD1 . LEU F 3 103 ? 30.810  -42.346 30.773 1.00 32.61  ? 119 LEU F CD1 1 
ATOM   5767 C CD2 . LEU F 3 103 ? 31.263  -43.541 32.915 1.00 34.62  ? 119 LEU F CD2 1 
ATOM   5768 N N   . PRO F 3 104 ? 35.627  -46.246 30.827 1.00 37.65  ? 120 PRO F N   1 
ATOM   5769 C CA  . PRO F 3 104 ? 36.515  -46.963 29.924 1.00 37.77  ? 120 PRO F CA  1 
ATOM   5770 C C   . PRO F 3 104 ? 35.804  -47.858 28.893 1.00 38.77  ? 120 PRO F C   1 
ATOM   5771 O O   . PRO F 3 104 ? 36.406  -48.209 27.874 1.00 38.85  ? 120 PRO F O   1 
ATOM   5772 C CB  . PRO F 3 104 ? 37.351  -47.809 30.879 1.00 35.79  ? 120 PRO F CB  1 
ATOM   5773 C CG  . PRO F 3 104 ? 37.249  -47.139 32.127 1.00 35.87  ? 120 PRO F CG  1 
ATOM   5774 C CD  . PRO F 3 104 ? 35.853  -46.652 32.219 1.00 35.96  ? 120 PRO F CD  1 
ATOM   5775 N N   . ASN F 3 105 ? 34.552  -48.230 29.158 1.00 38.27  ? 121 ASN F N   1 
ATOM   5776 C CA  . ASN F 3 105 ? 33.811  -49.119 28.270 1.00 39.47  ? 121 ASN F CA  1 
ATOM   5777 C C   . ASN F 3 105 ? 32.602  -48.507 27.553 1.00 39.73  ? 121 ASN F C   1 
ATOM   5778 O O   . ASN F 3 105 ? 31.800  -49.230 26.964 1.00 40.44  ? 121 ASN F O   1 
ATOM   5779 C CB  . ASN F 3 105 ? 33.338  -50.333 29.059 1.00 43.85  ? 121 ASN F CB  1 
ATOM   5780 C CG  . ASN F 3 105 ? 34.356  -51.448 29.089 1.00 45.89  ? 121 ASN F CG  1 
ATOM   5781 O OD1 . ASN F 3 105 ? 35.199  -51.564 28.197 1.00 51.31  ? 121 ASN F OD1 1 
ATOM   5782 N ND2 . ASN F 3 105 ? 34.272  -52.291 30.109 1.00 46.24  ? 121 ASN F ND2 1 
ATOM   5783 N N   . LEU F 3 106 ? 32.457  -47.188 27.611 1.00 38.48  ? 122 LEU F N   1 
ATOM   5784 C CA  . LEU F 3 106 ? 31.313  -46.533 27.002 1.00 37.06  ? 122 LEU F CA  1 
ATOM   5785 C C   . LEU F 3 106 ? 31.425  -46.675 25.505 1.00 37.16  ? 122 LEU F C   1 
ATOM   5786 O O   . LEU F 3 106 ? 32.455  -46.334 24.933 1.00 39.02  ? 122 LEU F O   1 
ATOM   5787 C CB  . LEU F 3 106 ? 31.270  -45.055 27.370 1.00 35.99  ? 122 LEU F CB  1 
ATOM   5788 C CG  . LEU F 3 106 ? 30.000  -44.343 26.921 1.00 33.87  ? 122 LEU F CG  1 
ATOM   5789 C CD1 . LEU F 3 106 ? 28.925  -44.623 27.926 1.00 35.52  ? 122 LEU F CD1 1 
ATOM   5790 C CD2 . LEU F 3 106 ? 30.226  -42.844 26.830 1.00 37.81  ? 122 LEU F CD2 1 
ATOM   5791 N N   . GLN F 3 107 ? 30.372  -47.189 24.873 1.00 37.13  ? 123 GLN F N   1 
ATOM   5792 C CA  . GLN F 3 107 ? 30.381  -47.415 23.434 1.00 34.71  ? 123 GLN F CA  1 
ATOM   5793 C C   . GLN F 3 107 ? 29.361  -46.532 22.759 1.00 33.00  ? 123 GLN F C   1 
ATOM   5794 O O   . GLN F 3 107 ? 29.561  -46.075 21.625 1.00 28.26  ? 123 GLN F O   1 
ATOM   5795 C CB  . GLN F 3 107 ? 30.069  -48.871 23.127 1.00 35.71  ? 123 GLN F CB  1 
ATOM   5796 C CG  . GLN F 3 107 ? 31.150  -49.821 23.591 1.00 44.65  ? 123 GLN F CG  1 
ATOM   5797 C CD  . GLN F 3 107 ? 30.782  -51.276 23.376 1.00 48.50  ? 123 GLN F CD  1 
ATOM   5798 O OE1 . GLN F 3 107 ? 29.628  -51.597 23.068 1.00 50.55  ? 123 GLN F OE1 1 
ATOM   5799 N NE2 . GLN F 3 107 ? 31.763  -52.166 23.540 1.00 50.27  ? 123 GLN F NE2 1 
ATOM   5800 N N   . TYR F 3 108 ? 28.271  -46.279 23.479 1.00 32.91  ? 124 TYR F N   1 
ATOM   5801 C CA  . TYR F 3 108 ? 27.157  -45.562 22.900 1.00 34.10  ? 124 TYR F CA  1 
ATOM   5802 C C   . TYR F 3 108 ? 26.578  -44.515 23.833 1.00 32.20  ? 124 TYR F C   1 
ATOM   5803 O O   . TYR F 3 108 ? 26.111  -44.822 24.930 1.00 30.58  ? 124 TYR F O   1 
ATOM   5804 C CB  . TYR F 3 108 ? 26.082  -46.548 22.440 1.00 38.16  ? 124 TYR F CB  1 
ATOM   5805 C CG  . TYR F 3 108 ? 24.922  -45.852 21.767 1.00 48.98  ? 124 TYR F CG  1 
ATOM   5806 C CD1 . TYR F 3 108 ? 25.083  -45.212 20.536 1.00 53.54  ? 124 TYR F CD1 1 
ATOM   5807 C CD2 . TYR F 3 108 ? 23.655  -45.814 22.367 1.00 52.69  ? 124 TYR F CD2 1 
ATOM   5808 C CE1 . TYR F 3 108 ? 23.997  -44.550 19.916 1.00 57.83  ? 124 TYR F CE1 1 
ATOM   5809 C CE2 . TYR F 3 108 ? 22.572  -45.155 21.758 1.00 54.79  ? 124 TYR F CE2 1 
ATOM   5810 C CZ  . TYR F 3 108 ? 22.751  -44.526 20.541 1.00 56.80  ? 124 TYR F CZ  1 
ATOM   5811 O OH  . TYR F 3 108 ? 21.685  -43.879 19.947 1.00 60.08  ? 124 TYR F OH  1 
ATOM   5812 N N   . LEU F 3 109 ? 26.632  -43.266 23.394 1.00 29.81  ? 125 LEU F N   1 
ATOM   5813 C CA  . LEU F 3 109 ? 26.095  -42.173 24.184 1.00 31.36  ? 125 LEU F CA  1 
ATOM   5814 C C   . LEU F 3 109 ? 25.068  -41.431 23.352 1.00 32.58  ? 125 LEU F C   1 
ATOM   5815 O O   . LEU F 3 109 ? 25.440  -40.693 22.431 1.00 34.33  ? 125 LEU F O   1 
ATOM   5816 C CB  . LEU F 3 109 ? 27.212  -41.219 24.632 1.00 27.68  ? 125 LEU F CB  1 
ATOM   5817 C CG  . LEU F 3 109 ? 26.837  -39.823 25.182 1.00 26.58  ? 125 LEU F CG  1 
ATOM   5818 C CD1 . LEU F 3 109 ? 25.675  -39.819 26.186 1.00 21.57  ? 125 LEU F CD1 1 
ATOM   5819 C CD2 . LEU F 3 109 ? 28.071  -39.179 25.816 1.00 25.89  ? 125 LEU F CD2 1 
ATOM   5820 N N   . LEU F 3 110 ? 23.790  -41.620 23.673 1.00 31.51  ? 126 LEU F N   1 
ATOM   5821 C CA  . LEU F 3 110 ? 22.716  -41.002 22.918 1.00 32.95  ? 126 LEU F CA  1 
ATOM   5822 C C   . LEU F 3 110 ? 22.050  -39.900 23.707 1.00 32.11  ? 126 LEU F C   1 
ATOM   5823 O O   . LEU F 3 110 ? 21.750  -40.089 24.877 1.00 36.15  ? 126 LEU F O   1 
ATOM   5824 C CB  . LEU F 3 110 ? 21.665  -42.059 22.559 1.00 37.40  ? 126 LEU F CB  1 
ATOM   5825 C CG  . LEU F 3 110 ? 20.277  -41.615 22.034 1.00 43.34  ? 126 LEU F CG  1 
ATOM   5826 C CD1 . LEU F 3 110 ? 20.326  -40.935 20.644 1.00 44.71  ? 126 LEU F CD1 1 
ATOM   5827 C CD2 . LEU F 3 110 ? 19.309  -42.798 22.001 1.00 45.74  ? 126 LEU F CD2 1 
ATOM   5828 N N   . ILE F 3 111 ? 21.799  -38.756 23.072 1.00 32.95  ? 127 ILE F N   1 
ATOM   5829 C CA  . ILE F 3 111 ? 21.031  -37.659 23.698 1.00 31.93  ? 127 ILE F CA  1 
ATOM   5830 C C   . ILE F 3 111 ? 20.063  -37.059 22.671 1.00 32.57  ? 127 ILE F C   1 
ATOM   5831 O O   . ILE F 3 111 ? 20.470  -36.252 21.838 1.00 33.04  ? 127 ILE F O   1 
ATOM   5832 C CB  . ILE F 3 111 ? 21.964  -36.555 24.294 1.00 27.89  ? 127 ILE F CB  1 
ATOM   5833 C CG1 . ILE F 3 111 ? 22.958  -37.181 25.264 1.00 27.71  ? 127 ILE F CG1 1 
ATOM   5834 C CG2 . ILE F 3 111 ? 21.150  -35.524 25.042 1.00 26.70  ? 127 ILE F CG2 1 
ATOM   5835 C CD1 . ILE F 3 111 ? 23.994  -36.260 25.825 1.00 25.52  ? 127 ILE F CD1 1 
ATOM   5836 N N   . SER F 3 112 ? 18.794  -37.462 22.733 1.00 35.99  ? 128 SER F N   1 
ATOM   5837 C CA  . SER F 3 112 ? 17.778  -37.020 21.754 1.00 40.00  ? 128 SER F CA  1 
ATOM   5838 C C   . SER F 3 112 ? 16.651  -36.247 22.393 1.00 40.55  ? 128 SER F C   1 
ATOM   5839 O O   . SER F 3 112 ? 16.279  -36.527 23.536 1.00 43.43  ? 128 SER F O   1 
ATOM   5840 C CB  . SER F 3 112 ? 17.150  -38.216 21.046 1.00 38.83  ? 128 SER F CB  1 
ATOM   5841 O OG  . SER F 3 112 ? 18.152  -39.165 20.724 1.00 47.63  ? 128 SER F OG  1 
ATOM   5842 N N   . ASN F 3 113 ? 16.107  -35.283 21.649 1.00 40.44  ? 129 ASN F N   1 
ATOM   5843 C CA  . ASN F 3 113 ? 14.898  -34.553 22.052 1.00 37.92  ? 129 ASN F CA  1 
ATOM   5844 C C   . ASN F 3 113 ? 14.972  -33.873 23.404 1.00 37.33  ? 129 ASN F C   1 
ATOM   5845 O O   . ASN F 3 113 ? 14.171  -34.139 24.297 1.00 37.08  ? 129 ASN F O   1 
ATOM   5846 C CB  . ASN F 3 113 ? 13.682  -35.476 21.992 1.00 36.26  ? 129 ASN F CB  1 
ATOM   5847 C CG  . ASN F 3 113 ? 12.773  -35.134 20.854 1.00 36.72  ? 129 ASN F CG  1 
ATOM   5848 O OD1 . ASN F 3 113 ? 12.378  -33.979 20.692 1.00 37.99  ? 129 ASN F OD1 1 
ATOM   5849 N ND2 . ASN F 3 113 ? 12.421  -36.128 20.056 1.00 40.71  ? 129 ASN F ND2 1 
ATOM   5850 N N   . THR F 3 114 ? 15.936  -32.968 23.514 1.00 39.37  ? 130 THR F N   1 
ATOM   5851 C CA  . THR F 3 114 ? 16.244  -32.311 24.773 1.00 39.86  ? 130 THR F CA  1 
ATOM   5852 C C   . THR F 3 114 ? 16.382  -30.814 24.628 1.00 39.57  ? 130 THR F C   1 
ATOM   5853 O O   . THR F 3 114 ? 16.565  -30.297 23.527 1.00 42.61  ? 130 THR F O   1 
ATOM   5854 C CB  . THR F 3 114 ? 17.530  -32.903 25.318 1.00 38.80  ? 130 THR F CB  1 
ATOM   5855 O OG1 . THR F 3 114 ? 17.301  -34.288 25.616 1.00 40.94  ? 130 THR F OG1 1 
ATOM   5856 C CG2 . THR F 3 114 ? 17.897  -32.275 26.639 1.00 42.16  ? 130 THR F CG2 1 
ATOM   5857 N N   . GLY F 3 115 ? 16.292  -30.113 25.745 1.00 40.22  ? 131 GLY F N   1 
ATOM   5858 C CA  . GLY F 3 115 ? 16.420  -28.683 25.715 1.00 43.19  ? 131 GLY F CA  1 
ATOM   5859 C C   . GLY F 3 115 ? 17.830  -28.189 25.944 1.00 44.77  ? 131 GLY F C   1 
ATOM   5860 O O   . GLY F 3 115 ? 18.020  -26.988 26.075 1.00 47.71  ? 131 GLY F O   1 
ATOM   5861 N N   . ILE F 3 116 ? 18.821  -29.081 26.005 1.00 45.17  ? 132 ILE F N   1 
ATOM   5862 C CA  . ILE F 3 116 ? 20.206  -28.642 26.230 1.00 46.29  ? 132 ILE F CA  1 
ATOM   5863 C C   . ILE F 3 116 ? 20.606  -27.601 25.204 1.00 47.33  ? 132 ILE F C   1 
ATOM   5864 O O   . ILE F 3 116 ? 20.163  -27.662 24.054 1.00 47.79  ? 132 ILE F O   1 
ATOM   5865 C CB  . ILE F 3 116 ? 21.223  -29.814 26.229 1.00 47.39  ? 132 ILE F CB  1 
ATOM   5866 C CG1 . ILE F 3 116 ? 20.948  -30.802 25.095 1.00 49.08  ? 132 ILE F CG1 1 
ATOM   5867 C CG2 . ILE F 3 116 ? 21.228  -30.521 27.561 1.00 47.33  ? 132 ILE F CG2 1 
ATOM   5868 C CD1 . ILE F 3 116 ? 22.116  -31.755 24.831 1.00 47.01  ? 132 ILE F CD1 1 
ATOM   5869 N N   . LYS F 3 117 ? 21.418  -26.636 25.626 1.00 46.85  ? 133 LYS F N   1 
ATOM   5870 C CA  . LYS F 3 117 ? 21.800  -25.528 24.750 1.00 48.17  ? 133 LYS F CA  1 
ATOM   5871 C C   . LYS F 3 117 ? 23.246  -25.694 24.316 1.00 48.68  ? 133 LYS F C   1 
ATOM   5872 O O   . LYS F 3 117 ? 23.802  -24.849 23.610 1.00 48.85  ? 133 LYS F O   1 
ATOM   5873 C CB  . LYS F 3 117 ? 21.635  -24.179 25.466 1.00 49.43  ? 133 LYS F CB  1 
ATOM   5874 C CG  . LYS F 3 117 ? 20.282  -23.973 26.123 1.00 52.02  ? 133 LYS F CG  1 
ATOM   5875 C CD  . LYS F 3 117 ? 20.123  -22.547 26.594 1.00 55.77  ? 133 LYS F CD  1 
ATOM   5876 C CE  . LYS F 3 117 ? 18.792  -22.311 27.332 1.00 58.63  ? 133 LYS F CE  1 
ATOM   5877 N NZ  . LYS F 3 117 ? 17.557  -22.437 26.480 1.00 57.16  ? 133 LYS F NZ  1 
ATOM   5878 N N   . HIS F 3 118 ? 23.836  -26.797 24.758 1.00 49.10  ? 134 HIS F N   1 
ATOM   5879 C CA  . HIS F 3 118 ? 25.230  -27.076 24.508 1.00 47.46  ? 134 HIS F CA  1 
ATOM   5880 C C   . HIS F 3 118 ? 25.479  -28.570 24.379 1.00 46.56  ? 134 HIS F C   1 
ATOM   5881 O O   . HIS F 3 118 ? 24.734  -29.390 24.948 1.00 46.91  ? 134 HIS F O   1 
ATOM   5882 C CB  . HIS F 3 118 ? 26.085  -26.519 25.638 1.00 49.43  ? 134 HIS F CB  1 
ATOM   5883 C CG  . HIS F 3 118 ? 26.696  -25.182 25.328 1.00 56.44  ? 134 HIS F CG  1 
ATOM   5884 N ND1 . HIS F 3 118 ? 26.261  -24.003 25.897 1.00 58.46  ? 134 HIS F ND1 1 
ATOM   5885 C CD2 . HIS F 3 118 ? 27.704  -24.847 24.482 1.00 57.82  ? 134 HIS F CD2 1 
ATOM   5886 C CE1 . HIS F 3 118 ? 26.986  -22.999 25.426 1.00 59.17  ? 134 HIS F CE1 1 
ATOM   5887 N NE2 . HIS F 3 118 ? 27.866  -23.484 24.564 1.00 57.57  ? 134 HIS F NE2 1 
ATOM   5888 N N   . LEU F 3 119 ? 26.519  -28.917 23.627 1.00 42.38  ? 135 LEU F N   1 
ATOM   5889 C CA  . LEU F 3 119 ? 26.956  -30.297 23.552 1.00 38.04  ? 135 LEU F CA  1 
ATOM   5890 C C   . LEU F 3 119 ? 27.451  -30.726 24.929 1.00 37.00  ? 135 LEU F C   1 
ATOM   5891 O O   . LEU F 3 119 ? 28.010  -29.897 25.659 1.00 36.84  ? 135 LEU F O   1 
ATOM   5892 C CB  . LEU F 3 119 ? 28.097  -30.436 22.549 1.00 34.55  ? 135 LEU F CB  1 
ATOM   5893 C CG  . LEU F 3 119 ? 27.706  -30.398 21.084 1.00 31.61  ? 135 LEU F CG  1 
ATOM   5894 C CD1 . LEU F 3 119 ? 28.962  -30.403 20.264 1.00 31.82  ? 135 LEU F CD1 1 
ATOM   5895 C CD2 . LEU F 3 119 ? 26.845  -31.593 20.738 1.00 33.31  ? 135 LEU F CD2 1 
ATOM   5896 N N   . PRO F 3 120 ? 27.253  -32.006 25.281 1.00 34.06  ? 136 PRO F N   1 
ATOM   5897 C CA  . PRO F 3 120 ? 27.751  -32.554 26.533 1.00 34.01  ? 136 PRO F CA  1 
ATOM   5898 C C   . PRO F 3 120 ? 29.266  -32.421 26.557 1.00 35.30  ? 136 PRO F C   1 
ATOM   5899 O O   . PRO F 3 120 ? 29.925  -32.471 25.510 1.00 32.91  ? 136 PRO F O   1 
ATOM   5900 C CB  . PRO F 3 120 ? 27.413  -34.042 26.458 1.00 32.04  ? 136 PRO F CB  1 
ATOM   5901 C CG  . PRO F 3 120 ? 26.523  -34.193 25.389 1.00 34.08  ? 136 PRO F CG  1 
ATOM   5902 C CD  . PRO F 3 120 ? 26.566  -33.021 24.476 1.00 33.18  ? 136 PRO F CD  1 
ATOM   5903 N N   . ASP F 3 121 ? 29.802  -32.257 27.756 1.00 38.07  ? 137 ASP F N   1 
ATOM   5904 C CA  . ASP F 3 121 ? 31.230  -32.165 27.943 1.00 41.28  ? 137 ASP F CA  1 
ATOM   5905 C C   . ASP F 3 121 ? 31.742  -33.594 28.036 1.00 42.59  ? 137 ASP F C   1 
ATOM   5906 O O   . ASP F 3 121 ? 31.476  -34.288 29.023 1.00 44.52  ? 137 ASP F O   1 
ATOM   5907 C CB  . ASP F 3 121 ? 31.520  -31.408 29.222 1.00 43.03  ? 137 ASP F CB  1 
ATOM   5908 C CG  . ASP F 3 121 ? 32.963  -31.060 29.353 1.00 47.62  ? 137 ASP F CG  1 
ATOM   5909 O OD1 . ASP F 3 121 ? 33.770  -31.998 29.539 1.00 48.99  ? 137 ASP F OD1 1 
ATOM   5910 O OD2 . ASP F 3 121 ? 33.363  -29.876 29.266 1.00 50.75  ? 137 ASP F OD2 1 
ATOM   5911 N N   . VAL F 3 122 ? 32.469  -34.028 27.008 1.00 43.52  ? 138 VAL F N   1 
ATOM   5912 C CA  . VAL F 3 122 ? 32.878  -35.429 26.892 1.00 40.39  ? 138 VAL F CA  1 
ATOM   5913 C C   . VAL F 3 122 ? 34.366  -35.633 27.027 1.00 41.33  ? 138 VAL F C   1 
ATOM   5914 O O   . VAL F 3 122 ? 34.836  -36.752 26.933 1.00 42.44  ? 138 VAL F O   1 
ATOM   5915 C CB  . VAL F 3 122 ? 32.419  -36.062 25.546 1.00 39.11  ? 138 VAL F CB  1 
ATOM   5916 C CG1 . VAL F 3 122 ? 30.901  -36.089 25.462 1.00 36.42  ? 138 VAL F CG1 1 
ATOM   5917 C CG2 . VAL F 3 122 ? 33.033  -35.338 24.345 1.00 36.78  ? 138 VAL F CG2 1 
ATOM   5918 N N   . HIS F 3 123 ? 35.105  -34.556 27.283 1.00 45.54  ? 139 HIS F N   1 
ATOM   5919 C CA  . HIS F 3 123 ? 36.571  -34.616 27.268 1.00 45.09  ? 139 HIS F CA  1 
ATOM   5920 C C   . HIS F 3 123 ? 37.227  -35.484 28.341 1.00 43.14  ? 139 HIS F C   1 
ATOM   5921 O O   . HIS F 3 123 ? 38.380  -35.842 28.211 1.00 47.08  ? 139 HIS F O   1 
ATOM   5922 C CB  . HIS F 3 123 ? 37.167  -33.214 27.276 1.00 46.51  ? 139 HIS F CB  1 
ATOM   5923 C CG  . HIS F 3 123 ? 37.166  -32.570 28.621 1.00 51.76  ? 139 HIS F CG  1 
ATOM   5924 N ND1 . HIS F 3 123 ? 36.104  -31.827 29.089 1.00 55.74  ? 139 HIS F ND1 1 
ATOM   5925 C CD2 . HIS F 3 123 ? 38.102  -32.549 29.601 1.00 53.30  ? 139 HIS F CD2 1 
ATOM   5926 C CE1 . HIS F 3 123 ? 36.381  -31.378 30.301 1.00 57.16  ? 139 HIS F CE1 1 
ATOM   5927 N NE2 . HIS F 3 123 ? 37.590  -31.802 30.635 1.00 56.97  ? 139 HIS F NE2 1 
ATOM   5928 N N   . LYS F 3 124 ? 36.504  -35.840 29.386 1.00 41.24  ? 140 LYS F N   1 
ATOM   5929 C CA  . LYS F 3 124 ? 37.088  -36.687 30.405 1.00 40.20  ? 140 LYS F CA  1 
ATOM   5930 C C   . LYS F 3 124 ? 36.559  -38.120 30.376 1.00 39.58  ? 140 LYS F C   1 
ATOM   5931 O O   . LYS F 3 124 ? 36.801  -38.889 31.303 1.00 38.46  ? 140 LYS F O   1 
ATOM   5932 C CB  . LYS F 3 124 ? 36.821  -36.091 31.777 1.00 42.00  ? 140 LYS F CB  1 
ATOM   5933 C CG  . LYS F 3 124 ? 37.807  -35.044 32.222 1.00 46.49  ? 140 LYS F CG  1 
ATOM   5934 C CD  . LYS F 3 124 ? 37.359  -34.537 33.584 1.00 53.81  ? 140 LYS F CD  1 
ATOM   5935 C CE  . LYS F 3 124 ? 38.193  -33.371 34.097 1.00 55.98  ? 140 LYS F CE  1 
ATOM   5936 N NZ  . LYS F 3 124 ? 37.688  -32.977 35.455 1.00 56.89  ? 140 LYS F NZ  1 
ATOM   5937 N N   . ILE F 3 125 ? 35.835  -38.491 29.327 1.00 39.28  ? 141 ILE F N   1 
ATOM   5938 C CA  . ILE F 3 125 ? 35.178  -39.793 29.339 1.00 38.09  ? 141 ILE F CA  1 
ATOM   5939 C C   . ILE F 3 125 ? 36.194  -40.897 29.174 1.00 38.52  ? 141 ILE F C   1 
ATOM   5940 O O   . ILE F 3 125 ? 36.139  -41.916 29.860 1.00 37.24  ? 141 ILE F O   1 
ATOM   5941 C CB  . ILE F 3 125 ? 34.099  -39.869 28.285 1.00 37.01  ? 141 ILE F CB  1 
ATOM   5942 C CG1 . ILE F 3 125 ? 32.989  -38.885 28.628 1.00 35.83  ? 141 ILE F CG1 1 
ATOM   5943 C CG2 . ILE F 3 125 ? 33.518  -41.273 28.235 1.00 39.81  ? 141 ILE F CG2 1 
ATOM   5944 C CD1 . ILE F 3 125 ? 31.861  -38.882 27.631 1.00 35.93  ? 141 ILE F CD1 1 
ATOM   5945 N N   . HIS F 3 126 ? 37.126  -40.686 28.254 1.00 39.85  ? 142 HIS F N   1 
ATOM   5946 C CA  . HIS F 3 126 ? 38.290  -41.552 28.142 1.00 37.90  ? 142 HIS F CA  1 
ATOM   5947 C C   . HIS F 3 126 ? 37.908  -42.979 27.827 1.00 34.92  ? 142 HIS F C   1 
ATOM   5948 O O   . HIS F 3 126 ? 38.330  -43.893 28.516 1.00 33.78  ? 142 HIS F O   1 
ATOM   5949 C CB  . HIS F 3 126 ? 39.082  -41.517 29.458 1.00 39.95  ? 142 HIS F CB  1 
ATOM   5950 C CG  . HIS F 3 126 ? 39.795  -40.226 29.712 1.00 43.00  ? 142 HIS F CG  1 
ATOM   5951 N ND1 . HIS F 3 126 ? 40.212  -39.392 28.696 1.00 44.63  ? 142 HIS F ND1 1 
ATOM   5952 C CD2 . HIS F 3 126 ? 40.204  -39.648 30.865 1.00 44.71  ? 142 HIS F CD2 1 
ATOM   5953 C CE1 . HIS F 3 126 ? 40.835  -38.348 29.212 1.00 45.98  ? 142 HIS F CE1 1 
ATOM   5954 N NE2 . HIS F 3 126 ? 40.844  -38.479 30.527 1.00 46.57  ? 142 HIS F NE2 1 
ATOM   5955 N N   . SER F 3 127 ? 37.107  -43.187 26.796 1.00 33.13  ? 143 SER F N   1 
ATOM   5956 C CA  . SER F 3 127 ? 36.688  -44.547 26.502 1.00 31.89  ? 143 SER F CA  1 
ATOM   5957 C C   . SER F 3 127 ? 37.799  -45.274 25.786 1.00 29.83  ? 143 SER F C   1 
ATOM   5958 O O   . SER F 3 127 ? 38.510  -44.699 24.968 1.00 28.10  ? 143 SER F O   1 
ATOM   5959 C CB  . SER F 3 127 ? 35.406  -44.575 25.669 1.00 33.26  ? 143 SER F CB  1 
ATOM   5960 O OG  . SER F 3 127 ? 34.976  -45.908 25.448 1.00 32.76  ? 143 SER F OG  1 
ATOM   5961 N N   . LEU F 3 128 ? 37.958  -46.543 26.120 1.00 29.77  ? 144 LEU F N   1 
ATOM   5962 C CA  . LEU F 3 128 ? 38.967  -47.354 25.473 1.00 32.49  ? 144 LEU F CA  1 
ATOM   5963 C C   . LEU F 3 128 ? 38.402  -47.944 24.193 1.00 32.98  ? 144 LEU F C   1 
ATOM   5964 O O   . LEU F 3 128 ? 39.114  -48.582 23.422 1.00 34.80  ? 144 LEU F O   1 
ATOM   5965 C CB  . LEU F 3 128 ? 39.505  -48.438 26.427 1.00 31.78  ? 144 LEU F CB  1 
ATOM   5966 C CG  . LEU F 3 128 ? 40.165  -47.921 27.727 1.00 31.56  ? 144 LEU F CG  1 
ATOM   5967 C CD1 . LEU F 3 128 ? 40.862  -49.020 28.452 1.00 28.61  ? 144 LEU F CD1 1 
ATOM   5968 C CD2 . LEU F 3 128 ? 41.137  -46.777 27.490 1.00 31.53  ? 144 LEU F CD2 1 
ATOM   5969 N N   . GLN F 3 129 ? 37.125  -47.682 23.944 1.00 35.44  ? 145 GLN F N   1 
ATOM   5970 C CA  . GLN F 3 129 ? 36.440  -48.272 22.805 1.00 35.11  ? 145 GLN F CA  1 
ATOM   5971 C C   . GLN F 3 129 ? 35.976  -47.236 21.812 1.00 32.51  ? 145 GLN F C   1 
ATOM   5972 O O   . GLN F 3 129 ? 35.864  -46.054 22.145 1.00 31.32  ? 145 GLN F O   1 
ATOM   5973 C CB  . GLN F 3 129 ? 35.246  -49.085 23.308 1.00 37.24  ? 145 GLN F CB  1 
ATOM   5974 C CG  . GLN F 3 129 ? 35.607  -49.930 24.506 1.00 44.40  ? 145 GLN F CG  1 
ATOM   5975 C CD  . GLN F 3 129 ? 35.004  -51.301 24.454 1.00 48.90  ? 145 GLN F CD  1 
ATOM   5976 O OE1 . GLN F 3 129 ? 34.886  -51.897 23.374 1.00 49.28  ? 145 GLN F OE1 1 
ATOM   5977 N NE2 . GLN F 3 129 ? 34.624  -51.825 25.623 1.00 51.76  ? 145 GLN F NE2 1 
ATOM   5978 N N   . LYS F 3 130 ? 35.708  -47.687 20.588 1.00 31.31  ? 146 LYS F N   1 
ATOM   5979 C CA  . LYS F 3 130 ? 35.067  -46.828 19.597 1.00 33.00  ? 146 LYS F CA  1 
ATOM   5980 C C   . LYS F 3 130 ? 33.759  -46.348 20.184 1.00 29.89  ? 146 LYS F C   1 
ATOM   5981 O O   . LYS F 3 130 ? 33.098  -47.085 20.920 1.00 28.20  ? 146 LYS F O   1 
ATOM   5982 C CB  . LYS F 3 130 ? 34.856  -47.557 18.272 1.00 35.47  ? 146 LYS F CB  1 
ATOM   5983 C CG  . LYS F 3 130 ? 36.190  -47.843 17.587 1.00 44.88  ? 146 LYS F CG  1 
ATOM   5984 C CD  . LYS F 3 130 ? 36.070  -48.645 16.309 1.00 50.89  ? 146 LYS F CD  1 
ATOM   5985 C CE  . LYS F 3 130 ? 37.459  -49.053 15.824 1.00 53.93  ? 146 LYS F CE  1 
ATOM   5986 N NZ  . LYS F 3 130 ? 37.517  -49.088 14.322 1.00 61.81  ? 146 LYS F NZ  1 
ATOM   5987 N N   . VAL F 3 131 ? 33.415  -45.100 19.895 1.00 27.63  ? 147 VAL F N   1 
ATOM   5988 C CA  . VAL F 3 131 ? 32.240  -44.501 20.493 1.00 30.05  ? 147 VAL F CA  1 
ATOM   5989 C C   . VAL F 3 131 ? 31.323  -43.878 19.466 1.00 29.72  ? 147 VAL F C   1 
ATOM   5990 O O   . VAL F 3 131 ? 31.754  -43.102 18.623 1.00 32.82  ? 147 VAL F O   1 
ATOM   5991 C CB  . VAL F 3 131 ? 32.625  -43.436 21.558 1.00 30.70  ? 147 VAL F CB  1 
ATOM   5992 C CG1 . VAL F 3 131 ? 31.442  -42.506 21.850 1.00 30.89  ? 147 VAL F CG1 1 
ATOM   5993 C CG2 . VAL F 3 131 ? 33.111  -44.108 22.834 1.00 30.64  ? 147 VAL F CG2 1 
ATOM   5994 N N   . LEU F 3 132 ? 30.052  -44.234 19.534 1.00 31.12  ? 148 LEU F N   1 
ATOM   5995 C CA  . LEU F 3 132 ? 29.062  -43.632 18.673 1.00 31.97  ? 148 LEU F CA  1 
ATOM   5996 C C   . LEU F 3 132 ? 28.383  -42.611 19.548 1.00 31.21  ? 148 LEU F C   1 
ATOM   5997 O O   . LEU F 3 132 ? 27.753  -42.962 20.549 1.00 33.21  ? 148 LEU F O   1 
ATOM   5998 C CB  . LEU F 3 132 ? 28.065  -44.680 18.173 1.00 33.98  ? 148 LEU F CB  1 
ATOM   5999 C CG  . LEU F 3 132 ? 26.800  -44.153 17.479 1.00 40.47  ? 148 LEU F CG  1 
ATOM   6000 C CD1 . LEU F 3 132 ? 27.128  -43.427 16.185 1.00 43.32  ? 148 LEU F CD1 1 
ATOM   6001 C CD2 . LEU F 3 132 ? 25.830  -45.281 17.187 1.00 44.07  ? 148 LEU F CD2 1 
ATOM   6002 N N   . LEU F 3 133 ? 28.547  -41.346 19.194 1.00 31.60  ? 149 LEU F N   1 
ATOM   6003 C CA  . LEU F 3 133 ? 27.959  -40.246 19.953 1.00 32.31  ? 149 LEU F CA  1 
ATOM   6004 C C   . LEU F 3 133 ? 26.811  -39.732 19.137 1.00 32.11  ? 149 LEU F C   1 
ATOM   6005 O O   . LEU F 3 133 ? 27.013  -39.133 18.074 1.00 35.15  ? 149 LEU F O   1 
ATOM   6006 C CB  . LEU F 3 133 ? 28.967  -39.111 20.192 1.00 31.61  ? 149 LEU F CB  1 
ATOM   6007 C CG  . LEU F 3 133 ? 28.386  -37.898 20.939 1.00 29.22  ? 149 LEU F CG  1 
ATOM   6008 C CD1 . LEU F 3 133 ? 28.147  -38.234 22.394 1.00 29.47  ? 149 LEU F CD1 1 
ATOM   6009 C CD2 . LEU F 3 133 ? 29.296  -36.723 20.854 1.00 27.58  ? 149 LEU F CD2 1 
ATOM   6010 N N   . ASP F 3 134 ? 25.606  -39.955 19.646 1.00 33.22  ? 150 ASP F N   1 
ATOM   6011 C CA  . ASP F 3 134 ? 24.390  -39.715 18.880 1.00 33.70  ? 150 ASP F CA  1 
ATOM   6012 C C   . ASP F 3 134 ? 23.572  -38.627 19.517 1.00 31.40  ? 150 ASP F C   1 
ATOM   6013 O O   . ASP F 3 134 ? 22.873  -38.870 20.489 1.00 31.27  ? 150 ASP F O   1 
ATOM   6014 C CB  . ASP F 3 134 ? 23.583  -41.010 18.835 1.00 36.25  ? 150 ASP F CB  1 
ATOM   6015 C CG  . ASP F 3 134 ? 22.434  -40.945 17.856 1.00 40.48  ? 150 ASP F CG  1 
ATOM   6016 O OD1 . ASP F 3 134 ? 21.947  -39.816 17.569 1.00 44.29  ? 150 ASP F OD1 1 
ATOM   6017 O OD2 . ASP F 3 134 ? 21.952  -41.991 17.343 1.00 43.87  ? 150 ASP F OD2 1 
ATOM   6018 N N   . ILE F 3 135 ? 23.664  -37.429 18.966 1.00 32.58  ? 151 ILE F N   1 
ATOM   6019 C CA  . ILE F 3 135 ? 22.990  -36.272 19.546 1.00 35.71  ? 151 ILE F CA  1 
ATOM   6020 C C   . ILE F 3 135 ? 22.071  -35.655 18.503 1.00 37.44  ? 151 ILE F C   1 
ATOM   6021 O O   . ILE F 3 135 ? 22.525  -34.981 17.587 1.00 40.75  ? 151 ILE F O   1 
ATOM   6022 C CB  . ILE F 3 135 ? 24.047  -35.300 20.108 1.00 36.92  ? 151 ILE F CB  1 
ATOM   6023 C CG1 . ILE F 3 135 ? 24.716  -35.941 21.336 1.00 36.93  ? 151 ILE F CG1 1 
ATOM   6024 C CG2 . ILE F 3 135 ? 23.437  -33.955 20.486 1.00 38.26  ? 151 ILE F CG2 1 
ATOM   6025 C CD1 . ILE F 3 135 ? 25.959  -35.237 21.798 1.00 40.59  ? 151 ILE F CD1 1 
ATOM   6026 N N   . GLN F 3 136 ? 20.772  -35.923 18.663 1.00 42.67  ? 152 GLN F N   1 
ATOM   6027 C CA  . GLN F 3 136 ? 19.735  -35.614 17.673 1.00 43.40  ? 152 GLN F CA  1 
ATOM   6028 C C   . GLN F 3 136 ? 18.595  -34.809 18.263 1.00 40.96  ? 152 GLN F C   1 
ATOM   6029 O O   . GLN F 3 136 ? 18.363  -34.841 19.465 1.00 40.57  ? 152 GLN F O   1 
ATOM   6030 C CB  . GLN F 3 136 ? 19.128  -36.918 17.148 1.00 47.69  ? 152 GLN F CB  1 
ATOM   6031 C CG  . GLN F 3 136 ? 19.633  -37.376 15.774 1.00 55.64  ? 152 GLN F CG  1 
ATOM   6032 C CD  . GLN F 3 136 ? 19.130  -38.779 15.414 1.00 58.64  ? 152 GLN F CD  1 
ATOM   6033 O OE1 . GLN F 3 136 ? 19.934  -39.708 15.259 1.00 58.65  ? 152 GLN F OE1 1 
ATOM   6034 N NE2 . GLN F 3 136 ? 17.809  -38.987 15.264 1.00 58.26  ? 152 GLN F NE2 1 
ATOM   6035 N N   . ASP F 3 137 ? 17.874  -34.103 17.400 1.00 40.04  ? 153 ASP F N   1 
ATOM   6036 C CA  . ASP F 3 137 ? 16.673  -33.353 17.773 1.00 39.88  ? 153 ASP F CA  1 
ATOM   6037 C C   . ASP F 3 137 ? 16.863  -32.459 18.988 1.00 38.51  ? 153 ASP F C   1 
ATOM   6038 O O   . ASP F 3 137 ? 15.966  -32.320 19.819 1.00 38.79  ? 153 ASP F O   1 
ATOM   6039 C CB  . ASP F 3 137 ? 15.481  -34.299 17.977 1.00 40.87  ? 153 ASP F CB  1 
ATOM   6040 C CG  . ASP F 3 137 ? 15.203  -35.133 16.744 1.00 43.69  ? 153 ASP F CG  1 
ATOM   6041 O OD1 . ASP F 3 137 ? 14.600  -34.590 15.798 1.00 47.47  ? 153 ASP F OD1 1 
ATOM   6042 O OD2 . ASP F 3 137 ? 15.580  -36.326 16.639 1.00 48.01  ? 153 ASP F OD2 1 
ATOM   6043 N N   . ASN F 3 138 ? 18.035  -31.851 19.085 1.00 38.10  ? 154 ASN F N   1 
ATOM   6044 C CA  . ASN F 3 138 ? 18.262  -30.876 20.138 1.00 39.61  ? 154 ASN F CA  1 
ATOM   6045 C C   . ASN F 3 138 ? 18.274  -29.477 19.543 1.00 40.42  ? 154 ASN F C   1 
ATOM   6046 O O   . ASN F 3 138 ? 19.324  -28.865 19.330 1.00 42.82  ? 154 ASN F O   1 
ATOM   6047 C CB  . ASN F 3 138 ? 19.535  -31.208 20.893 1.00 38.72  ? 154 ASN F CB  1 
ATOM   6048 C CG  . ASN F 3 138 ? 19.396  -32.476 21.721 1.00 39.20  ? 154 ASN F CG  1 
ATOM   6049 O OD1 . ASN F 3 138 ? 18.607  -32.531 22.671 1.00 35.80  ? 154 ASN F OD1 1 
ATOM   6050 N ND2 . ASN F 3 138 ? 20.168  -33.506 21.363 1.00 39.22  ? 154 ASN F ND2 1 
ATOM   6051 N N   . ILE F 3 139 ? 17.063  -28.998 19.275 1.00 40.40  ? 155 ILE F N   1 
ATOM   6052 C CA  . ILE F 3 139 ? 16.812  -27.758 18.562 1.00 40.25  ? 155 ILE F CA  1 
ATOM   6053 C C   . ILE F 3 139 ? 17.506  -26.529 19.148 1.00 38.82  ? 155 ILE F C   1 
ATOM   6054 O O   . ILE F 3 139 ? 17.610  -25.529 18.461 1.00 40.33  ? 155 ILE F O   1 
ATOM   6055 C CB  . ILE F 3 139 ? 15.268  -27.528 18.475 1.00 43.57  ? 155 ILE F CB  1 
ATOM   6056 C CG1 . ILE F 3 139 ? 14.852  -27.055 17.083 1.00 44.96  ? 155 ILE F CG1 1 
ATOM   6057 C CG2 . ILE F 3 139 ? 14.763  -26.566 19.597 1.00 43.03  ? 155 ILE F CG2 1 
ATOM   6058 C CD1 . ILE F 3 139 ? 13.353  -26.723 16.984 1.00 47.40  ? 155 ILE F CD1 1 
ATOM   6059 N N   . ASN F 3 140 ? 17.967  -26.591 20.400 1.00 37.98  ? 156 ASN F N   1 
ATOM   6060 C CA  . ASN F 3 140 ? 18.640  -25.446 21.046 1.00 38.36  ? 156 ASN F CA  1 
ATOM   6061 C C   . ASN F 3 140 ? 20.173  -25.471 21.012 1.00 38.99  ? 156 ASN F C   1 
ATOM   6062 O O   . ASN F 3 140 ? 20.810  -24.525 21.492 1.00 36.56  ? 156 ASN F O   1 
ATOM   6063 C CB  . ASN F 3 140 ? 18.228  -25.293 22.517 1.00 41.09  ? 156 ASN F CB  1 
ATOM   6064 C CG  . ASN F 3 140 ? 16.764  -24.972 22.699 1.00 42.66  ? 156 ASN F CG  1 
ATOM   6065 O OD1 . ASN F 3 140 ? 16.144  -24.326 21.856 1.00 45.96  ? 156 ASN F OD1 1 
ATOM   6066 N ND2 . ASN F 3 140 ? 16.199  -25.422 23.814 1.00 45.17  ? 156 ASN F ND2 1 
ATOM   6067 N N   . ILE F 3 141 ? 20.773  -26.550 20.503 1.00 39.06  ? 157 ILE F N   1 
ATOM   6068 C CA  . ILE F 3 141 ? 22.235  -26.573 20.368 1.00 39.24  ? 157 ILE F CA  1 
ATOM   6069 C C   . ILE F 3 141 ? 22.632  -25.798 19.116 1.00 39.22  ? 157 ILE F C   1 
ATOM   6070 O O   . ILE F 3 141 ? 22.382  -26.255 18.004 1.00 40.30  ? 157 ILE F O   1 
ATOM   6071 C CB  . ILE F 3 141 ? 22.808  -28.002 20.273 1.00 38.97  ? 157 ILE F CB  1 
ATOM   6072 C CG1 . ILE F 3 141 ? 22.329  -28.882 21.438 1.00 38.03  ? 157 ILE F CG1 1 
ATOM   6073 C CG2 . ILE F 3 141 ? 24.339  -27.920 20.229 1.00 39.53  ? 157 ILE F CG2 1 
ATOM   6074 C CD1 . ILE F 3 141 ? 22.820  -30.329 21.368 1.00 31.96  ? 157 ILE F CD1 1 
ATOM   6075 N N   . HIS F 3 142 ? 23.265  -24.643 19.301 1.00 38.43  ? 158 HIS F N   1 
ATOM   6076 C CA  . HIS F 3 142 ? 23.613  -23.771 18.186 1.00 38.21  ? 158 HIS F CA  1 
ATOM   6077 C C   . HIS F 3 142 ? 25.094  -23.757 17.799 1.00 41.44  ? 158 HIS F C   1 
ATOM   6078 O O   . HIS F 3 142 ? 25.437  -23.447 16.646 1.00 39.41  ? 158 HIS F O   1 
ATOM   6079 C CB  . HIS F 3 142 ? 23.172  -22.356 18.507 1.00 37.76  ? 158 HIS F CB  1 
ATOM   6080 C CG  . HIS F 3 142 ? 21.692  -22.204 18.662 1.00 39.76  ? 158 HIS F CG  1 
ATOM   6081 N ND1 . HIS F 3 142 ? 20.795  -22.628 17.701 1.00 37.52  ? 158 HIS F ND1 1 
ATOM   6082 C CD2 . HIS F 3 142 ? 20.951  -21.650 19.653 1.00 36.75  ? 158 HIS F CD2 1 
ATOM   6083 C CE1 . HIS F 3 142 ? 19.567  -22.348 18.099 1.00 37.09  ? 158 HIS F CE1 1 
ATOM   6084 N NE2 . HIS F 3 142 ? 19.635  -21.757 19.280 1.00 38.10  ? 158 HIS F NE2 1 
ATOM   6085 N N   . THR F 3 143 ? 25.966  -24.095 18.750 1.00 42.67  ? 159 THR F N   1 
ATOM   6086 C CA  . THR F 3 143 ? 27.402  -23.962 18.540 1.00 44.35  ? 159 THR F CA  1 
ATOM   6087 C C   . THR F 3 143 ? 28.223  -25.209 18.847 1.00 44.83  ? 159 THR F C   1 
ATOM   6088 O O   . THR F 3 143 ? 27.843  -26.026 19.690 1.00 49.25  ? 159 THR F O   1 
ATOM   6089 C CB  . THR F 3 143 ? 27.926  -22.795 19.386 1.00 45.22  ? 159 THR F CB  1 
ATOM   6090 O OG1 . THR F 3 143 ? 27.174  -21.618 19.071 1.00 46.76  ? 159 THR F OG1 1 
ATOM   6091 C CG2 . THR F 3 143 ? 29.338  -22.421 18.972 1.00 47.77  ? 159 THR F CG2 1 
ATOM   6092 N N   . ILE F 3 144 ? 29.335  -25.350 18.132 1.00 44.41  ? 160 ILE F N   1 
ATOM   6093 C CA  . ILE F 3 144 ? 30.362  -26.349 18.430 1.00 45.58  ? 160 ILE F CA  1 
ATOM   6094 C C   . ILE F 3 144 ? 31.678  -25.584 18.579 1.00 46.37  ? 160 ILE F C   1 
ATOM   6095 O O   . ILE F 3 144 ? 32.037  -24.780 17.730 1.00 46.96  ? 160 ILE F O   1 
ATOM   6096 C CB  . ILE F 3 144 ? 30.464  -27.418 17.322 1.00 44.28  ? 160 ILE F CB  1 
ATOM   6097 C CG1 . ILE F 3 144 ? 29.153  -28.194 17.204 1.00 42.77  ? 160 ILE F CG1 1 
ATOM   6098 C CG2 . ILE F 3 144 ? 31.584  -28.399 17.626 1.00 44.14  ? 160 ILE F CG2 1 
ATOM   6099 C CD1 . ILE F 3 144 ? 29.138  -29.192 16.054 1.00 40.68  ? 160 ILE F CD1 1 
ATOM   6100 N N   . GLU F 3 145 ? 32.402  -25.848 19.657 1.00 50.11  ? 161 GLU F N   1 
ATOM   6101 C CA  . GLU F 3 145 ? 33.555  -25.030 20.011 1.00 54.79  ? 161 GLU F CA  1 
ATOM   6102 C C   . GLU F 3 145 ? 34.893  -25.755 19.944 1.00 55.14  ? 161 GLU F C   1 
ATOM   6103 O O   . GLU F 3 145 ? 34.932  -26.983 19.815 1.00 55.64  ? 161 GLU F O   1 
ATOM   6104 C CB  . GLU F 3 145 ? 33.344  -24.469 21.411 1.00 56.98  ? 161 GLU F CB  1 
ATOM   6105 C CG  . GLU F 3 145 ? 31.887  -24.210 21.730 1.00 61.60  ? 161 GLU F CG  1 
ATOM   6106 C CD  . GLU F 3 145 ? 31.685  -22.839 22.311 1.00 65.82  ? 161 GLU F CD  1 
ATOM   6107 O OE1 . GLU F 3 145 ? 32.335  -22.547 23.342 1.00 70.38  ? 161 GLU F OE1 1 
ATOM   6108 O OE2 . GLU F 3 145 ? 30.894  -22.055 21.735 1.00 66.96  ? 161 GLU F OE2 1 
ATOM   6109 N N   . ARG F 3 146 ? 35.985  -24.989 20.039 1.00 55.25  ? 162 ARG F N   1 
ATOM   6110 C CA  . ARG F 3 146 ? 37.333  -25.561 20.077 1.00 56.99  ? 162 ARG F CA  1 
ATOM   6111 C C   . ARG F 3 146 ? 37.350  -26.810 20.980 1.00 55.62  ? 162 ARG F C   1 
ATOM   6112 O O   . ARG F 3 146 ? 36.873  -26.772 22.117 1.00 56.25  ? 162 ARG F O   1 
ATOM   6113 C CB  . ARG F 3 146 ? 38.375  -24.532 20.576 1.00 59.03  ? 162 ARG F CB  1 
ATOM   6114 C CG  . ARG F 3 146 ? 38.184  -23.078 20.090 1.00 65.54  ? 162 ARG F CG  1 
ATOM   6115 C CD  . ARG F 3 146 ? 39.181  -22.587 19.005 1.00 68.21  ? 162 ARG F CD  1 
ATOM   6116 N NE  . ARG F 3 146 ? 38.563  -21.595 18.109 1.00 71.14  ? 162 ARG F NE  1 
ATOM   6117 C CZ  . ARG F 3 146 ? 39.206  -20.862 17.193 1.00 71.13  ? 162 ARG F CZ  1 
ATOM   6118 N NH1 . ARG F 3 146 ? 40.525  -20.979 17.030 1.00 71.37  ? 162 ARG F NH1 1 
ATOM   6119 N NH2 . ARG F 3 146 ? 38.523  -20.001 16.436 1.00 68.68  ? 162 ARG F NH2 1 
ATOM   6120 N N   . ASN F 3 147 ? 37.854  -27.918 20.438 1.00 52.62  ? 163 ASN F N   1 
ATOM   6121 C CA  . ASN F 3 147 ? 38.027  -29.177 21.170 1.00 51.54  ? 163 ASN F CA  1 
ATOM   6122 C C   . ASN F 3 147 ? 36.756  -29.710 21.824 1.00 49.67  ? 163 ASN F C   1 
ATOM   6123 O O   . ASN F 3 147 ? 36.697  -29.860 23.051 1.00 48.82  ? 163 ASN F O   1 
ATOM   6124 C CB  . ASN F 3 147 ? 39.136  -29.054 22.242 1.00 52.51  ? 163 ASN F CB  1 
ATOM   6125 C CG  . ASN F 3 147 ? 40.391  -28.334 21.742 1.00 54.57  ? 163 ASN F CG  1 
ATOM   6126 O OD1 . ASN F 3 147 ? 40.871  -28.561 20.624 1.00 56.21  ? 163 ASN F OD1 1 
ATOM   6127 N ND2 . ASN F 3 147 ? 40.939  -27.471 22.595 1.00 53.95  ? 163 ASN F ND2 1 
ATOM   6128 N N   . SER F 3 148 ? 35.747  -30.012 21.013 1.00 47.43  ? 164 SER F N   1 
ATOM   6129 C CA  . SER F 3 148 ? 34.467  -30.493 21.544 1.00 45.30  ? 164 SER F CA  1 
ATOM   6130 C C   . SER F 3 148 ? 34.346  -32.011 21.730 1.00 46.01  ? 164 SER F C   1 
ATOM   6131 O O   . SER F 3 148 ? 33.440  -32.482 22.429 1.00 48.56  ? 164 SER F O   1 
ATOM   6132 C CB  . SER F 3 148 ? 33.325  -29.991 20.675 1.00 44.11  ? 164 SER F CB  1 
ATOM   6133 O OG  . SER F 3 148 ? 33.107  -28.619 20.906 1.00 45.70  ? 164 SER F OG  1 
ATOM   6134 N N   . PHE F 3 149 ? 35.247  -32.775 21.109 1.00 44.76  ? 165 PHE F N   1 
ATOM   6135 C CA  . PHE F 3 149 ? 35.187  -34.237 21.161 1.00 40.85  ? 165 PHE F CA  1 
ATOM   6136 C C   . PHE F 3 149 ? 36.523  -34.891 21.520 1.00 42.31  ? 165 PHE F C   1 
ATOM   6137 O O   . PHE F 3 149 ? 36.656  -36.111 21.437 1.00 43.27  ? 165 PHE F O   1 
ATOM   6138 C CB  . PHE F 3 149 ? 34.622  -34.789 19.846 1.00 37.78  ? 165 PHE F CB  1 
ATOM   6139 C CG  . PHE F 3 149 ? 33.324  -34.162 19.461 1.00 36.54  ? 165 PHE F CG  1 
ATOM   6140 C CD1 . PHE F 3 149 ? 32.122  -34.651 19.966 1.00 37.47  ? 165 PHE F CD1 1 
ATOM   6141 C CD2 . PHE F 3 149 ? 33.297  -33.038 18.656 1.00 32.68  ? 165 PHE F CD2 1 
ATOM   6142 C CE1 . PHE F 3 149 ? 30.920  -34.041 19.661 1.00 34.08  ? 165 PHE F CE1 1 
ATOM   6143 C CE2 . PHE F 3 149 ? 32.093  -32.427 18.351 1.00 33.25  ? 165 PHE F CE2 1 
ATOM   6144 C CZ  . PHE F 3 149 ? 30.907  -32.928 18.862 1.00 33.41  ? 165 PHE F CZ  1 
ATOM   6145 N N   . VAL F 3 150 ? 37.508  -34.089 21.918 1.00 40.25  ? 166 VAL F N   1 
ATOM   6146 C CA  . VAL F 3 150 ? 38.732  -34.654 22.451 1.00 39.13  ? 166 VAL F CA  1 
ATOM   6147 C C   . VAL F 3 150 ? 38.344  -35.350 23.738 1.00 38.41  ? 166 VAL F C   1 
ATOM   6148 O O   . VAL F 3 150 ? 37.406  -34.927 24.412 1.00 37.21  ? 166 VAL F O   1 
ATOM   6149 C CB  . VAL F 3 150 ? 39.772  -33.591 22.821 1.00 39.85  ? 166 VAL F CB  1 
ATOM   6150 C CG1 . VAL F 3 150 ? 41.078  -34.251 23.199 1.00 39.67  ? 166 VAL F CG1 1 
ATOM   6151 C CG2 . VAL F 3 150 ? 40.021  -32.675 21.663 1.00 45.77  ? 166 VAL F CG2 1 
ATOM   6152 N N   . GLY F 3 151 ? 39.061  -36.428 24.053 1.00 36.76  ? 167 GLY F N   1 
ATOM   6153 C CA  . GLY F 3 151 ? 38.912  -37.121 25.326 1.00 34.28  ? 167 GLY F CA  1 
ATOM   6154 C C   . GLY F 3 151 ? 37.690  -38.006 25.447 1.00 32.93  ? 167 GLY F C   1 
ATOM   6155 O O   . GLY F 3 151 ? 37.531  -38.712 26.446 1.00 32.81  ? 167 GLY F O   1 
ATOM   6156 N N   . LEU F 3 152 ? 36.815  -37.967 24.449 1.00 30.42  ? 168 LEU F N   1 
ATOM   6157 C CA  . LEU F 3 152 ? 35.681  -38.865 24.440 1.00 28.74  ? 168 LEU F CA  1 
ATOM   6158 C C   . LEU F 3 152 ? 36.148  -40.310 24.355 1.00 29.73  ? 168 LEU F C   1 
ATOM   6159 O O   . LEU F 3 152 ? 35.669  -41.159 25.097 1.00 31.30  ? 168 LEU F O   1 
ATOM   6160 C CB  . LEU F 3 152 ? 34.747  -38.531 23.285 1.00 27.87  ? 168 LEU F CB  1 
ATOM   6161 C CG  . LEU F 3 152 ? 33.582  -39.467 22.947 1.00 25.84  ? 168 LEU F CG  1 
ATOM   6162 C CD1 . LEU F 3 152 ? 32.593  -39.632 24.109 1.00 17.34  ? 168 LEU F CD1 1 
ATOM   6163 C CD2 . LEU F 3 152 ? 32.917  -38.913 21.701 1.00 21.65  ? 168 LEU F CD2 1 
ATOM   6164 N N   . SER F 3 153 ? 37.102  -40.583 23.475 1.00 30.50  ? 169 SER F N   1 
ATOM   6165 C CA  . SER F 3 153 ? 37.571  -41.938 23.267 1.00 32.55  ? 169 SER F CA  1 
ATOM   6166 C C   . SER F 3 153 ? 38.992  -41.917 22.767 1.00 34.16  ? 169 SER F C   1 
ATOM   6167 O O   . SER F 3 153 ? 39.423  -40.945 22.167 1.00 35.25  ? 169 SER F O   1 
ATOM   6168 C CB  . SER F 3 153 ? 36.662  -42.634 22.248 1.00 35.19  ? 169 SER F CB  1 
ATOM   6169 O OG  . SER F 3 153 ? 37.271  -43.763 21.638 1.00 36.33  ? 169 SER F OG  1 
ATOM   6170 N N   . PHE F 3 154 ? 39.725  -42.991 23.020 1.00 38.13  ? 170 PHE F N   1 
ATOM   6171 C CA  . PHE F 3 154 ? 41.094  -43.092 22.533 1.00 40.70  ? 170 PHE F CA  1 
ATOM   6172 C C   . PHE F 3 154 ? 41.169  -43.825 21.193 1.00 41.17  ? 170 PHE F C   1 
ATOM   6173 O O   . PHE F 3 154 ? 42.253  -44.075 20.662 1.00 40.57  ? 170 PHE F O   1 
ATOM   6174 C CB  . PHE F 3 154 ? 41.981  -43.761 23.583 1.00 42.10  ? 170 PHE F CB  1 
ATOM   6175 C CG  . PHE F 3 154 ? 42.116  -42.965 24.856 1.00 43.55  ? 170 PHE F CG  1 
ATOM   6176 C CD1 . PHE F 3 154 ? 42.363  -41.596 24.818 1.00 42.65  ? 170 PHE F CD1 1 
ATOM   6177 C CD2 . PHE F 3 154 ? 42.005  -43.585 26.097 1.00 43.92  ? 170 PHE F CD2 1 
ATOM   6178 C CE1 . PHE F 3 154 ? 42.486  -40.860 26.001 1.00 41.71  ? 170 PHE F CE1 1 
ATOM   6179 C CE2 . PHE F 3 154 ? 42.132  -42.843 27.287 1.00 41.30  ? 170 PHE F CE2 1 
ATOM   6180 C CZ  . PHE F 3 154 ? 42.373  -41.486 27.233 1.00 38.10  ? 170 PHE F CZ  1 
ATOM   6181 N N   . GLU F 3 155 ? 40.003  -44.148 20.648 1.00 42.08  ? 171 GLU F N   1 
ATOM   6182 C CA  . GLU F 3 155 ? 39.906  -44.834 19.374 1.00 44.27  ? 171 GLU F CA  1 
ATOM   6183 C C   . GLU F 3 155 ? 39.019  -44.045 18.423 1.00 44.74  ? 171 GLU F C   1 
ATOM   6184 O O   . GLU F 3 155 ? 38.752  -42.866 18.634 1.00 48.06  ? 171 GLU F O   1 
ATOM   6185 C CB  . GLU F 3 155 ? 39.310  -46.224 19.570 1.00 45.81  ? 171 GLU F CB  1 
ATOM   6186 C CG  . GLU F 3 155 ? 39.833  -46.975 20.779 1.00 48.11  ? 171 GLU F CG  1 
ATOM   6187 C CD  . GLU F 3 155 ? 41.092  -47.753 20.472 1.00 51.26  ? 171 GLU F CD  1 
ATOM   6188 O OE1 . GLU F 3 155 ? 41.259  -48.165 19.307 1.00 52.01  ? 171 GLU F OE1 1 
ATOM   6189 O OE2 . GLU F 3 155 ? 41.910  -47.962 21.397 1.00 53.93  ? 171 GLU F OE2 1 
ATOM   6190 N N   . SER F 3 156 ? 38.568  -44.708 17.369 1.00 46.08  ? 172 SER F N   1 
ATOM   6191 C CA  . SER F 3 156 ? 37.652  -44.116 16.412 1.00 44.70  ? 172 SER F CA  1 
ATOM   6192 C C   . SER F 3 156 ? 36.339  -43.724 17.096 1.00 43.91  ? 172 SER F C   1 
ATOM   6193 O O   . SER F 3 156 ? 35.883  -44.382 18.036 1.00 42.66  ? 172 SER F O   1 
ATOM   6194 C CB  . SER F 3 156 ? 37.395  -45.109 15.273 1.00 45.30  ? 172 SER F CB  1 
ATOM   6195 O OG  . SER F 3 156 ? 36.013  -45.189 14.973 1.00 51.63  ? 172 SER F OG  1 
ATOM   6196 N N   . VAL F 3 157 ? 35.743  -42.643 16.611 1.00 41.77  ? 173 VAL F N   1 
ATOM   6197 C CA  . VAL F 3 157 ? 34.520  -42.133 17.175 1.00 39.46  ? 173 VAL F CA  1 
ATOM   6198 C C   . VAL F 3 157 ? 33.547  -41.768 16.038 1.00 41.32  ? 173 VAL F C   1 
ATOM   6199 O O   . VAL F 3 157 ? 33.979  -41.287 14.987 1.00 43.90  ? 173 VAL F O   1 
ATOM   6200 C CB  . VAL F 3 157 ? 34.865  -40.925 18.043 1.00 39.66  ? 173 VAL F CB  1 
ATOM   6201 C CG1 . VAL F 3 157 ? 34.323  -39.604 17.453 1.00 39.29  ? 173 VAL F CG1 1 
ATOM   6202 C CG2 . VAL F 3 157 ? 34.370  -41.146 19.446 1.00 41.37  ? 173 VAL F CG2 1 
ATOM   6203 N N   . ILE F 3 158 ? 32.247  -41.999 16.224 1.00 39.09  ? 174 ILE F N   1 
ATOM   6204 C CA  . ILE F 3 158 ? 31.261  -41.628 15.207 1.00 37.69  ? 174 ILE F CA  1 
ATOM   6205 C C   . ILE F 3 158 ? 30.369  -40.513 15.726 1.00 37.81  ? 174 ILE F C   1 
ATOM   6206 O O   . ILE F 3 158 ? 29.646  -40.702 16.701 1.00 40.47  ? 174 ILE F O   1 
ATOM   6207 C CB  . ILE F 3 158 ? 30.383  -42.826 14.834 1.00 38.48  ? 174 ILE F CB  1 
ATOM   6208 C CG1 . ILE F 3 158 ? 31.217  -43.894 14.123 1.00 37.84  ? 174 ILE F CG1 1 
ATOM   6209 C CG2 . ILE F 3 158 ? 29.184  -42.359 13.971 1.00 40.19  ? 174 ILE F CG2 1 
ATOM   6210 C CD1 . ILE F 3 158 ? 30.487  -45.197 13.921 1.00 32.38  ? 174 ILE F CD1 1 
ATOM   6211 N N   . LEU F 3 159 ? 30.380  -39.361 15.077 1.00 35.61  ? 175 LEU F N   1 
ATOM   6212 C CA  . LEU F 3 159 ? 29.579  -38.270 15.594 1.00 37.17  ? 175 LEU F CA  1 
ATOM   6213 C C   . LEU F 3 159 ? 28.325  -38.057 14.765 1.00 39.09  ? 175 LEU F C   1 
ATOM   6214 O O   . LEU F 3 159 ? 28.415  -37.815 13.551 1.00 39.72  ? 175 LEU F O   1 
ATOM   6215 C CB  . LEU F 3 159 ? 30.395  -36.987 15.646 1.00 36.85  ? 175 LEU F CB  1 
ATOM   6216 C CG  . LEU F 3 159 ? 31.698  -37.056 16.431 1.00 38.55  ? 175 LEU F CG  1 
ATOM   6217 C CD1 . LEU F 3 159 ? 32.500  -35.780 16.177 1.00 38.61  ? 175 LEU F CD1 1 
ATOM   6218 C CD2 . LEU F 3 159 ? 31.418  -37.286 17.920 1.00 37.99  ? 175 LEU F CD2 1 
ATOM   6219 N N   . TRP F 3 160 ? 27.160  -38.155 15.413 1.00 37.39  ? 176 TRP F N   1 
ATOM   6220 C CA  . TRP F 3 160 ? 25.897  -37.890 14.736 1.00 37.32  ? 176 TRP F CA  1 
ATOM   6221 C C   . TRP F 3 160 ? 25.244  -36.656 15.350 1.00 38.59  ? 176 TRP F C   1 
ATOM   6222 O O   . TRP F 3 160 ? 24.359  -36.736 16.200 1.00 38.72  ? 176 TRP F O   1 
ATOM   6223 C CB  . TRP F 3 160 ? 24.978  -39.111 14.756 1.00 35.94  ? 176 TRP F CB  1 
ATOM   6224 C CG  . TRP F 3 160 ? 25.418  -40.182 13.829 1.00 35.72  ? 176 TRP F CG  1 
ATOM   6225 C CD1 . TRP F 3 160 ? 26.252  -40.040 12.774 1.00 37.07  ? 176 TRP F CD1 1 
ATOM   6226 C CD2 . TRP F 3 160 ? 25.039  -41.568 13.856 1.00 39.03  ? 176 TRP F CD2 1 
ATOM   6227 N NE1 . TRP F 3 160 ? 26.436  -41.245 12.140 1.00 38.94  ? 176 TRP F NE1 1 
ATOM   6228 C CE2 . TRP F 3 160 ? 25.702  -42.203 12.783 1.00 37.78  ? 176 TRP F CE2 1 
ATOM   6229 C CE3 . TRP F 3 160 ? 24.214  -42.344 14.687 1.00 38.71  ? 176 TRP F CE3 1 
ATOM   6230 C CZ2 . TRP F 3 160 ? 25.564  -43.565 12.509 1.00 37.05  ? 176 TRP F CZ2 1 
ATOM   6231 C CZ3 . TRP F 3 160 ? 24.077  -43.709 14.414 1.00 36.46  ? 176 TRP F CZ3 1 
ATOM   6232 C CH2 . TRP F 3 160 ? 24.746  -44.301 13.337 1.00 37.57  ? 176 TRP F CH2 1 
ATOM   6233 N N   . LEU F 3 161 ? 25.716  -35.499 14.915 1.00 39.38  ? 177 LEU F N   1 
ATOM   6234 C CA  . LEU F 3 161 ? 25.226  -34.258 15.446 1.00 37.67  ? 177 LEU F CA  1 
ATOM   6235 C C   . LEU F 3 161 ? 24.194  -33.717 14.488 1.00 38.36  ? 177 LEU F C   1 
ATOM   6236 O O   . LEU F 3 161 ? 24.135  -32.521 14.249 1.00 40.96  ? 177 LEU F O   1 
ATOM   6237 C CB  . LEU F 3 161 ? 26.380  -33.279 15.630 1.00 36.77  ? 177 LEU F CB  1 
ATOM   6238 C CG  . LEU F 3 161 ? 27.618  -33.810 16.362 1.00 37.55  ? 177 LEU F CG  1 
ATOM   6239 C CD1 . LEU F 3 161 ? 28.641  -32.719 16.410 1.00 42.27  ? 177 LEU F CD1 1 
ATOM   6240 C CD2 . LEU F 3 161 ? 27.338  -34.269 17.778 1.00 38.51  ? 177 LEU F CD2 1 
ATOM   6241 N N   . ASN F 3 162 ? 23.366  -34.606 13.945 1.00 39.22  ? 178 ASN F N   1 
ATOM   6242 C CA  . ASN F 3 162 ? 22.306  -34.198 13.014 1.00 39.48  ? 178 ASN F CA  1 
ATOM   6243 C C   . ASN F 3 162 ? 20.976  -33.839 13.668 1.00 39.24  ? 178 ASN F C   1 
ATOM   6244 O O   . ASN F 3 162 ? 20.690  -34.235 14.804 1.00 37.85  ? 178 ASN F O   1 
ATOM   6245 C CB  . ASN F 3 162 ? 22.046  -35.297 12.002 1.00 39.48  ? 178 ASN F CB  1 
ATOM   6246 C CG  . ASN F 3 162 ? 21.435  -36.489 12.632 1.00 40.40  ? 178 ASN F CG  1 
ATOM   6247 O OD1 . ASN F 3 162 ? 22.066  -37.169 13.451 1.00 43.70  ? 178 ASN F OD1 1 
ATOM   6248 N ND2 . ASN F 3 162 ? 20.181  -36.744 12.296 1.00 43.94  ? 178 ASN F ND2 1 
ATOM   6249 N N   . LYS F 3 163 ? 20.173  -33.098 12.907 1.00 39.91  ? 179 LYS F N   1 
ATOM   6250 C CA  . LYS F 3 163 ? 18.844  -32.639 13.301 1.00 40.52  ? 179 LYS F CA  1 
ATOM   6251 C C   . LYS F 3 163 ? 18.819  -31.793 14.560 1.00 39.68  ? 179 LYS F C   1 
ATOM   6252 O O   . LYS F 3 163 ? 17.825  -31.776 15.266 1.00 38.43  ? 179 LYS F O   1 
ATOM   6253 C CB  . LYS F 3 163 ? 17.879  -33.809 13.464 1.00 42.66  ? 179 LYS F CB  1 
ATOM   6254 C CG  . LYS F 3 163 ? 17.366  -34.405 12.184 1.00 47.03  ? 179 LYS F CG  1 
ATOM   6255 C CD  . LYS F 3 163 ? 16.308  -35.442 12.525 1.00 52.34  ? 179 LYS F CD  1 
ATOM   6256 C CE  . LYS F 3 163 ? 15.616  -36.002 11.287 1.00 56.00  ? 179 LYS F CE  1 
ATOM   6257 N NZ  . LYS F 3 163 ? 16.244  -37.273 10.800 1.00 57.78  ? 179 LYS F NZ  1 
ATOM   6258 N N   . ASN F 3 164 ? 19.903  -31.085 14.842 1.00 41.25  ? 180 ASN F N   1 
ATOM   6259 C CA  . ASN F 3 164 ? 19.897  -30.168 15.976 1.00 42.49  ? 180 ASN F CA  1 
ATOM   6260 C C   . ASN F 3 164 ? 19.636  -28.750 15.477 1.00 44.77  ? 180 ASN F C   1 
ATOM   6261 O O   . ASN F 3 164 ? 18.858  -28.573 14.528 1.00 45.17  ? 180 ASN F O   1 
ATOM   6262 C CB  . ASN F 3 164 ? 21.187  -30.297 16.782 1.00 41.65  ? 180 ASN F CB  1 
ATOM   6263 C CG  . ASN F 3 164 ? 21.555  -31.757 17.045 1.00 41.84  ? 180 ASN F CG  1 
ATOM   6264 O OD1 . ASN F 3 164 ? 20.909  -32.446 17.841 1.00 42.22  ? 180 ASN F OD1 1 
ATOM   6265 N ND2 . ASN F 3 164 ? 22.588  -32.235 16.360 1.00 38.23  ? 180 ASN F ND2 1 
ATOM   6266 N N   . GLY F 3 165 ? 20.246  -27.750 16.112 1.00 45.54  ? 181 GLY F N   1 
ATOM   6267 C CA  . GLY F 3 165 ? 20.070  -26.361 15.688 1.00 44.77  ? 181 GLY F CA  1 
ATOM   6268 C C   . GLY F 3 165 ? 21.392  -25.654 15.441 1.00 45.75  ? 181 GLY F C   1 
ATOM   6269 O O   . GLY F 3 165 ? 21.506  -24.445 15.686 1.00 45.61  ? 181 GLY F O   1 
ATOM   6270 N N   . ILE F 3 166 ? 22.383  -26.402 14.950 1.00 44.53  ? 182 ILE F N   1 
ATOM   6271 C CA  . ILE F 3 166 ? 23.742  -25.878 14.795 1.00 45.94  ? 182 ILE F CA  1 
ATOM   6272 C C   . ILE F 3 166 ? 23.839  -24.765 13.750 1.00 47.68  ? 182 ILE F C   1 
ATOM   6273 O O   . ILE F 3 166 ? 23.271  -24.872 12.660 1.00 49.25  ? 182 ILE F O   1 
ATOM   6274 C CB  . ILE F 3 166 ? 24.746  -27.021 14.501 1.00 44.79  ? 182 ILE F CB  1 
ATOM   6275 C CG1 . ILE F 3 166 ? 24.914  -27.912 15.733 1.00 45.26  ? 182 ILE F CG1 1 
ATOM   6276 C CG2 . ILE F 3 166 ? 26.110  -26.471 14.153 1.00 44.39  ? 182 ILE F CG2 1 
ATOM   6277 C CD1 . ILE F 3 166 ? 25.358  -29.340 15.402 1.00 42.47  ? 182 ILE F CD1 1 
ATOM   6278 N N   . GLN F 3 167 ? 24.548  -23.692 14.110 1.00 48.44  ? 183 GLN F N   1 
ATOM   6279 C CA  . GLN F 3 167 ? 24.742  -22.531 13.244 1.00 48.10  ? 183 GLN F CA  1 
ATOM   6280 C C   . GLN F 3 167 ? 26.221  -22.185 13.086 1.00 48.35  ? 183 GLN F C   1 
ATOM   6281 O O   . GLN F 3 167 ? 26.611  -21.556 12.110 1.00 47.79  ? 183 GLN F O   1 
ATOM   6282 C CB  . GLN F 3 167 ? 24.021  -21.309 13.811 1.00 48.52  ? 183 GLN F CB  1 
ATOM   6283 C CG  . GLN F 3 167 ? 22.503  -21.420 13.931 1.00 50.25  ? 183 GLN F CG  1 
ATOM   6284 C CD  . GLN F 3 167 ? 21.906  -20.274 14.736 1.00 49.68  ? 183 GLN F CD  1 
ATOM   6285 O OE1 . GLN F 3 167 ? 22.511  -19.216 14.864 1.00 52.90  ? 183 GLN F OE1 1 
ATOM   6286 N NE2 . GLN F 3 167 ? 20.723  -20.488 15.281 1.00 51.49  ? 183 GLN F NE2 1 
ATOM   6287 N N   . GLU F 3 168 ? 27.045  -22.559 14.057 1.00 49.89  ? 184 GLU F N   1 
ATOM   6288 C CA  . GLU F 3 168 ? 28.481  -22.305 13.948 1.00 52.47  ? 184 GLU F CA  1 
ATOM   6289 C C   . GLU F 3 168 ? 29.385  -23.402 14.511 1.00 52.36  ? 184 GLU F C   1 
ATOM   6290 O O   . GLU F 3 168 ? 29.295  -23.787 15.680 1.00 51.91  ? 184 GLU F O   1 
ATOM   6291 C CB  . GLU F 3 168 ? 28.859  -20.944 14.546 1.00 54.03  ? 184 GLU F CB  1 
ATOM   6292 C CG  . GLU F 3 168 ? 28.553  -19.781 13.613 1.00 60.36  ? 184 GLU F CG  1 
ATOM   6293 C CD  . GLU F 3 168 ? 29.429  -18.569 13.866 1.00 65.00  ? 184 GLU F CD  1 
ATOM   6294 O OE1 . GLU F 3 168 ? 30.666  -18.676 13.666 1.00 67.02  ? 184 GLU F OE1 1 
ATOM   6295 O OE2 . GLU F 3 168 ? 28.875  -17.511 14.250 1.00 66.46  ? 184 GLU F OE2 1 
ATOM   6296 N N   . ILE F 3 169 ? 30.260  -23.902 13.648 1.00 51.19  ? 185 ILE F N   1 
ATOM   6297 C CA  . ILE F 3 169 ? 31.257  -24.876 14.035 1.00 49.47  ? 185 ILE F CA  1 
ATOM   6298 C C   . ILE F 3 169 ? 32.584  -24.147 14.053 1.00 49.18  ? 185 ILE F C   1 
ATOM   6299 O O   . ILE F 3 169 ? 33.098  -23.797 13.010 1.00 49.94  ? 185 ILE F O   1 
ATOM   6300 C CB  . ILE F 3 169 ? 31.284  -26.028 13.020 1.00 47.43  ? 185 ILE F CB  1 
ATOM   6301 C CG1 . ILE F 3 169 ? 29.961  -26.799 13.083 1.00 45.49  ? 185 ILE F CG1 1 
ATOM   6302 C CG2 . ILE F 3 169 ? 32.484  -26.921 13.273 1.00 46.60  ? 185 ILE F CG2 1 
ATOM   6303 C CD1 . ILE F 3 169 ? 29.723  -27.730 11.941 1.00 42.67  ? 185 ILE F CD1 1 
ATOM   6304 N N   . HIS F 3 170 ? 33.121  -23.895 15.241 1.00 51.19  ? 186 HIS F N   1 
ATOM   6305 C CA  . HIS F 3 170 ? 34.402  -23.200 15.372 1.00 52.99  ? 186 HIS F CA  1 
ATOM   6306 C C   . HIS F 3 170 ? 35.564  -24.046 14.868 1.00 52.12  ? 186 HIS F C   1 
ATOM   6307 O O   . HIS F 3 170 ? 35.435  -25.262 14.725 1.00 52.03  ? 186 HIS F O   1 
ATOM   6308 C CB  . HIS F 3 170 ? 34.643  -22.809 16.833 1.00 55.39  ? 186 HIS F CB  1 
ATOM   6309 C CG  . HIS F 3 170 ? 33.774  -21.690 17.315 1.00 58.39  ? 186 HIS F CG  1 
ATOM   6310 N ND1 . HIS F 3 170 ? 33.883  -21.160 18.582 1.00 61.13  ? 186 HIS F ND1 1 
ATOM   6311 C CD2 . HIS F 3 170 ? 32.795  -20.986 16.696 1.00 60.12  ? 186 HIS F CD2 1 
ATOM   6312 C CE1 . HIS F 3 170 ? 33.000  -20.186 18.729 1.00 61.51  ? 186 HIS F CE1 1 
ATOM   6313 N NE2 . HIS F 3 170 ? 32.330  -20.059 17.597 1.00 61.17  ? 186 HIS F NE2 1 
ATOM   6314 N N   . ASN F 3 171 ? 36.692  -23.391 14.593 1.00 52.02  ? 187 ASN F N   1 
ATOM   6315 C CA  . ASN F 3 171 ? 37.919  -24.080 14.193 1.00 52.39  ? 187 ASN F CA  1 
ATOM   6316 C C   . ASN F 3 171 ? 38.440  -24.931 15.341 1.00 52.22  ? 187 ASN F C   1 
ATOM   6317 O O   . ASN F 3 171 ? 38.328  -24.542 16.509 1.00 51.35  ? 187 ASN F O   1 
ATOM   6318 C CB  . ASN F 3 171 ? 39.000  -23.081 13.772 1.00 53.59  ? 187 ASN F CB  1 
ATOM   6319 C CG  . ASN F 3 171 ? 38.487  -22.044 12.790 1.00 54.61  ? 187 ASN F CG  1 
ATOM   6320 O OD1 . ASN F 3 171 ? 38.340  -22.317 11.592 1.00 53.14  ? 187 ASN F OD1 1 
ATOM   6321 N ND2 . ASN F 3 171 ? 38.203  -20.841 13.298 1.00 53.93  ? 187 ASN F ND2 1 
ATOM   6322 N N   . CYS F 3 172 ? 39.004  -26.088 14.996 1.00 50.89  ? 188 CYS F N   1 
ATOM   6323 C CA  . CYS F 3 172 ? 39.469  -27.060 15.975 1.00 50.57  ? 188 CYS F CA  1 
ATOM   6324 C C   . CYS F 3 172 ? 38.313  -27.610 16.805 1.00 49.05  ? 188 CYS F C   1 
ATOM   6325 O O   . CYS F 3 172 ? 38.468  -27.889 17.990 1.00 49.72  ? 188 CYS F O   1 
ATOM   6326 C CB  . CYS F 3 172 ? 40.533  -26.454 16.893 1.00 51.76  ? 188 CYS F CB  1 
ATOM   6327 S SG  . CYS F 3 172 ? 42.058  -26.018 16.045 1.00 57.49  ? 188 CYS F SG  1 
ATOM   6328 N N   . ALA F 3 173 ? 37.150  -27.749 16.184 1.00 46.27  ? 189 ALA F N   1 
ATOM   6329 C CA  . ALA F 3 173 ? 36.017  -28.379 16.836 1.00 43.19  ? 189 ALA F CA  1 
ATOM   6330 C C   . ALA F 3 173 ? 36.337  -29.848 17.072 1.00 41.25  ? 189 ALA F C   1 
ATOM   6331 O O   . ALA F 3 173 ? 36.120  -30.390 18.155 1.00 40.45  ? 189 ALA F O   1 
ATOM   6332 C CB  . ALA F 3 173 ? 34.803  -28.257 15.965 1.00 44.44  ? 189 ALA F CB  1 
ATOM   6333 N N   . PHE F 3 174 ? 36.880  -30.476 16.042 1.00 40.22  ? 190 PHE F N   1 
ATOM   6334 C CA  . PHE F 3 174 ? 37.168  -31.889 16.075 1.00 40.93  ? 190 PHE F CA  1 
ATOM   6335 C C   . PHE F 3 174 ? 38.654  -32.125 16.312 1.00 42.80  ? 190 PHE F C   1 
ATOM   6336 O O   . PHE F 3 174 ? 39.167  -33.213 16.045 1.00 41.01  ? 190 PHE F O   1 
ATOM   6337 C CB  . PHE F 3 174 ? 36.687  -32.531 14.772 1.00 40.30  ? 190 PHE F CB  1 
ATOM   6338 C CG  . PHE F 3 174 ? 35.301  -32.114 14.378 1.00 40.47  ? 190 PHE F CG  1 
ATOM   6339 C CD1 . PHE F 3 174 ? 34.190  -32.724 14.946 1.00 40.87  ? 190 PHE F CD1 1 
ATOM   6340 C CD2 . PHE F 3 174 ? 35.101  -31.072 13.477 1.00 41.44  ? 190 PHE F CD2 1 
ATOM   6341 C CE1 . PHE F 3 174 ? 32.901  -32.313 14.610 1.00 41.06  ? 190 PHE F CE1 1 
ATOM   6342 C CE2 . PHE F 3 174 ? 33.815  -30.658 13.131 1.00 39.93  ? 190 PHE F CE2 1 
ATOM   6343 C CZ  . PHE F 3 174 ? 32.718  -31.274 13.702 1.00 40.84  ? 190 PHE F CZ  1 
ATOM   6344 N N   . ASN F 3 175 ? 39.339  -31.108 16.836 1.00 43.80  ? 191 ASN F N   1 
ATOM   6345 C CA  . ASN F 3 175 ? 40.756  -31.240 17.148 1.00 46.74  ? 191 ASN F CA  1 
ATOM   6346 C C   . ASN F 3 175 ? 41.037  -32.456 18.014 1.00 46.82  ? 191 ASN F C   1 
ATOM   6347 O O   . ASN F 3 175 ? 40.312  -32.726 18.963 1.00 46.66  ? 191 ASN F O   1 
ATOM   6348 C CB  . ASN F 3 175 ? 41.299  -29.985 17.844 1.00 48.61  ? 191 ASN F CB  1 
ATOM   6349 C CG  . ASN F 3 175 ? 42.750  -30.150 18.309 1.00 51.31  ? 191 ASN F CG  1 
ATOM   6350 O OD1 . ASN F 3 175 ? 43.628  -30.487 17.506 1.00 48.12  ? 191 ASN F OD1 1 
ATOM   6351 N ND2 . ASN F 3 175 ? 42.999  -29.912 19.618 1.00 54.68  ? 191 ASN F ND2 1 
ATOM   6352 N N   . GLY F 3 176 ? 42.086  -33.191 17.656 1.00 46.84  ? 192 GLY F N   1 
ATOM   6353 C CA  . GLY F 3 176 ? 42.569  -34.301 18.462 1.00 46.83  ? 192 GLY F CA  1 
ATOM   6354 C C   . GLY F 3 176 ? 41.537  -35.378 18.629 1.00 47.70  ? 192 GLY F C   1 
ATOM   6355 O O   . GLY F 3 176 ? 41.353  -35.896 19.720 1.00 49.04  ? 192 GLY F O   1 
ATOM   6356 N N   . THR F 3 177 ? 40.872  -35.715 17.534 1.00 47.87  ? 193 THR F N   1 
ATOM   6357 C CA  . THR F 3 177 ? 39.798  -36.680 17.552 1.00 47.86  ? 193 THR F CA  1 
ATOM   6358 C C   . THR F 3 177 ? 39.915  -37.498 16.278 1.00 48.14  ? 193 THR F C   1 
ATOM   6359 O O   . THR F 3 177 ? 40.285  -36.952 15.234 1.00 48.90  ? 193 THR F O   1 
ATOM   6360 C CB  . THR F 3 177 ? 38.433  -35.928 17.640 1.00 48.79  ? 193 THR F CB  1 
ATOM   6361 O OG1 . THR F 3 177 ? 37.514  -36.672 18.442 1.00 53.34  ? 193 THR F OG1 1 
ATOM   6362 C CG2 . THR F 3 177 ? 37.745  -35.846 16.303 1.00 48.98  ? 193 THR F CG2 1 
ATOM   6363 N N   . GLN F 3 178 ? 39.624  -38.799 16.364 1.00 49.28  ? 194 GLN F N   1 
ATOM   6364 C CA  . GLN F 3 178 ? 39.676  -39.698 15.190 1.00 47.85  ? 194 GLN F CA  1 
ATOM   6365 C C   . GLN F 3 178 ? 38.289  -39.901 14.595 1.00 46.07  ? 194 GLN F C   1 
ATOM   6366 O O   . GLN F 3 178 ? 37.536  -40.790 15.015 1.00 46.82  ? 194 GLN F O   1 
ATOM   6367 C CB  . GLN F 3 178 ? 40.311  -41.042 15.542 1.00 48.69  ? 194 GLN F CB  1 
ATOM   6368 C CG  . GLN F 3 178 ? 41.767  -40.938 15.969 1.00 51.70  ? 194 GLN F CG  1 
ATOM   6369 C CD  . GLN F 3 178 ? 42.306  -42.251 16.490 1.00 53.81  ? 194 GLN F CD  1 
ATOM   6370 O OE1 . GLN F 3 178 ? 42.552  -43.178 15.710 1.00 56.33  ? 194 GLN F OE1 1 
ATOM   6371 N NE2 . GLN F 3 178 ? 42.488  -42.344 17.811 1.00 53.56  ? 194 GLN F NE2 1 
ATOM   6372 N N   . LEU F 3 179 ? 37.966  -39.059 13.618 1.00 44.02  ? 195 LEU F N   1 
ATOM   6373 C CA  . LEU F 3 179 ? 36.646  -39.030 13.017 1.00 42.79  ? 195 LEU F CA  1 
ATOM   6374 C C   . LEU F 3 179 ? 36.429  -40.176 12.066 1.00 43.06  ? 195 LEU F C   1 
ATOM   6375 O O   . LEU F 3 179 ? 37.128  -40.316 11.075 1.00 46.62  ? 195 LEU F O   1 
ATOM   6376 C CB  . LEU F 3 179 ? 36.439  -37.712 12.280 1.00 41.09  ? 195 LEU F CB  1 
ATOM   6377 C CG  . LEU F 3 179 ? 35.350  -36.770 12.756 1.00 37.50  ? 195 LEU F CG  1 
ATOM   6378 C CD1 . LEU F 3 179 ? 34.988  -37.023 14.185 1.00 39.18  ? 195 LEU F CD1 1 
ATOM   6379 C CD2 . LEU F 3 179 ? 35.861  -35.362 12.585 1.00 39.67  ? 195 LEU F CD2 1 
ATOM   6380 N N   . ASP F 3 180 ? 35.449  -40.999 12.369 1.00 42.32  ? 196 ASP F N   1 
ATOM   6381 C CA  . ASP F 3 180 ? 35.106  -42.081 11.500 1.00 43.05  ? 196 ASP F CA  1 
ATOM   6382 C C   . ASP F 3 180 ? 34.021  -41.586 10.597 1.00 42.91  ? 196 ASP F C   1 
ATOM   6383 O O   . ASP F 3 180 ? 34.015  -41.834 9.398  1.00 47.60  ? 196 ASP F O   1 
ATOM   6384 C CB  . ASP F 3 180 ? 34.542  -43.216 12.317 1.00 47.24  ? 196 ASP F CB  1 
ATOM   6385 C CG  . ASP F 3 180 ? 35.306  -44.476 12.126 1.00 53.40  ? 196 ASP F CG  1 
ATOM   6386 O OD1 . ASP F 3 180 ? 36.551  -44.384 11.983 1.00 59.24  ? 196 ASP F OD1 1 
ATOM   6387 O OD2 . ASP F 3 180 ? 34.739  -45.595 12.130 1.00 58.04  ? 196 ASP F OD2 1 
ATOM   6388 N N   . GLU F 3 181 ? 33.085  -40.881 11.197 1.00 40.19  ? 197 GLU F N   1 
ATOM   6389 C CA  . GLU F 3 181 ? 31.921  -40.448 10.494 1.00 38.38  ? 197 GLU F CA  1 
ATOM   6390 C C   . GLU F 3 181 ? 31.497  -39.174 11.165 1.00 36.88  ? 197 GLU F C   1 
ATOM   6391 O O   . GLU F 3 181 ? 31.654  -39.014 12.378 1.00 36.70  ? 197 GLU F O   1 
ATOM   6392 C CB  . GLU F 3 181 ? 30.828  -41.501 10.650 1.00 40.37  ? 197 GLU F CB  1 
ATOM   6393 C CG  . GLU F 3 181 ? 29.769  -41.479 9.561  1.00 45.25  ? 197 GLU F CG  1 
ATOM   6394 C CD  . GLU F 3 181 ? 28.649  -42.492 9.800  1.00 49.08  ? 197 GLU F CD  1 
ATOM   6395 O OE1 . GLU F 3 181 ? 28.935  -43.632 10.287 1.00 47.23  ? 197 GLU F OE1 1 
ATOM   6396 O OE2 . GLU F 3 181 ? 27.477  -42.137 9.489  1.00 49.21  ? 197 GLU F OE2 1 
ATOM   6397 N N   . LEU F 3 182 ? 30.995  -38.246 10.373 1.00 34.05  ? 198 LEU F N   1 
ATOM   6398 C CA  . LEU F 3 182 ? 30.423  -37.055 10.944 1.00 35.26  ? 198 LEU F CA  1 
ATOM   6399 C C   . LEU F 3 182 ? 29.113  -36.732 10.228 1.00 36.07  ? 198 LEU F C   1 
ATOM   6400 O O   . LEU F 3 182 ? 29.049  -36.632 8.997  1.00 36.21  ? 198 LEU F O   1 
ATOM   6401 C CB  . LEU F 3 182 ? 31.405  -35.877 10.900 1.00 33.25  ? 198 LEU F CB  1 
ATOM   6402 C CG  . LEU F 3 182 ? 30.787  -34.496 11.158 1.00 33.81  ? 198 LEU F CG  1 
ATOM   6403 C CD1 . LEU F 3 182 ? 30.129  -34.412 12.520 1.00 31.55  ? 198 LEU F CD1 1 
ATOM   6404 C CD2 . LEU F 3 182 ? 31.841  -33.436 11.023 1.00 34.13  ? 198 LEU F CD2 1 
ATOM   6405 N N   . ASN F 3 183 ? 28.058  -36.581 11.012 1.00 35.81  ? 199 ASN F N   1 
ATOM   6406 C CA  . ASN F 3 183 ? 26.779  -36.257 10.442 1.00 34.79  ? 199 ASN F CA  1 
ATOM   6407 C C   . ASN F 3 183 ? 26.215  -34.952 10.969 1.00 35.02  ? 199 ASN F C   1 
ATOM   6408 O O   . ASN F 3 183 ? 25.728  -34.880 12.102 1.00 34.68  ? 199 ASN F O   1 
ATOM   6409 C CB  . ASN F 3 183 ? 25.801  -37.370 10.692 1.00 33.21  ? 199 ASN F CB  1 
ATOM   6410 C CG  . ASN F 3 183 ? 24.698  -37.356 9.717  1.00 31.96  ? 199 ASN F CG  1 
ATOM   6411 O OD1 . ASN F 3 183 ? 24.251  -36.295 9.271  1.00 31.50  ? 199 ASN F OD1 1 
ATOM   6412 N ND2 . ASN F 3 183 ? 24.247  -38.534 9.348  1.00 34.98  ? 199 ASN F ND2 1 
ATOM   6413 N N   . LEU F 3 184 ? 26.290  -33.931 10.124 1.00 34.54  ? 200 LEU F N   1 
ATOM   6414 C CA  . LEU F 3 184 ? 25.805  -32.606 10.444 1.00 36.43  ? 200 LEU F CA  1 
ATOM   6415 C C   . LEU F 3 184 ? 24.592  -32.331 9.584  1.00 39.79  ? 200 LEU F C   1 
ATOM   6416 O O   . LEU F 3 184 ? 24.286  -31.164 9.305  1.00 42.47  ? 200 LEU F O   1 
ATOM   6417 C CB  . LEU F 3 184 ? 26.883  -31.567 10.123 1.00 34.45  ? 200 LEU F CB  1 
ATOM   6418 C CG  . LEU F 3 184 ? 28.246  -31.739 10.802 1.00 34.69  ? 200 LEU F CG  1 
ATOM   6419 C CD1 . LEU F 3 184 ? 29.314  -31.030 10.015 1.00 34.26  ? 200 LEU F CD1 1 
ATOM   6420 C CD2 . LEU F 3 184 ? 28.220  -31.235 12.234 1.00 33.81  ? 200 LEU F CD2 1 
ATOM   6421 N N   . SER F 3 185 ? 23.901  -33.386 9.144  1.00 39.86  ? 201 SER F N   1 
ATOM   6422 C CA  . SER F 3 185 ? 22.773  -33.176 8.245  1.00 39.87  ? 201 SER F CA  1 
ATOM   6423 C C   . SER F 3 185 ? 21.584  -32.603 8.990  1.00 39.96  ? 201 SER F C   1 
ATOM   6424 O O   . SER F 3 185 ? 21.532  -32.632 10.217 1.00 39.28  ? 201 SER F O   1 
ATOM   6425 C CB  . SER F 3 185 ? 22.399  -34.463 7.513  1.00 39.90  ? 201 SER F CB  1 
ATOM   6426 O OG  . SER F 3 185 ? 21.790  -35.377 8.408  1.00 43.67  ? 201 SER F OG  1 
ATOM   6427 N N   . ASP F 3 186 ? 20.642  -32.064 8.233  1.00 41.98  ? 202 ASP F N   1 
ATOM   6428 C CA  . ASP F 3 186 ? 19.419  -31.465 8.771  1.00 44.62  ? 202 ASP F CA  1 
ATOM   6429 C C   . ASP F 3 186 ? 19.587  -30.342 9.796  1.00 45.17  ? 202 ASP F C   1 
ATOM   6430 O O   . ASP F 3 186 ? 18.640  -30.031 10.521 1.00 45.73  ? 202 ASP F O   1 
ATOM   6431 C CB  . ASP F 3 186 ? 18.463  -32.533 9.294  1.00 47.31  ? 202 ASP F CB  1 
ATOM   6432 C CG  . ASP F 3 186 ? 17.802  -33.322 8.173  1.00 51.64  ? 202 ASP F CG  1 
ATOM   6433 O OD1 . ASP F 3 186 ? 16.961  -32.742 7.449  1.00 54.99  ? 202 ASP F OD1 1 
ATOM   6434 O OD2 . ASP F 3 186 ? 18.068  -34.525 7.955  1.00 54.08  ? 202 ASP F OD2 1 
ATOM   6435 N N   . ASN F 3 187 ? 20.777  -29.739 9.849  1.00 44.19  ? 203 ASN F N   1 
ATOM   6436 C CA  . ASN F 3 187 ? 20.979  -28.496 10.593 1.00 44.21  ? 203 ASN F CA  1 
ATOM   6437 C C   . ASN F 3 187 ? 20.792  -27.323 9.622  1.00 45.37  ? 203 ASN F C   1 
ATOM   6438 O O   . ASN F 3 187 ? 21.760  -26.800 9.076  1.00 47.33  ? 203 ASN F O   1 
ATOM   6439 C CB  . ASN F 3 187 ? 22.374  -28.444 11.216 1.00 43.95  ? 203 ASN F CB  1 
ATOM   6440 C CG  . ASN F 3 187 ? 22.539  -29.408 12.375 1.00 43.85  ? 203 ASN F CG  1 
ATOM   6441 O OD1 . ASN F 3 187 ? 22.155  -29.117 13.521 1.00 39.46  ? 203 ASN F OD1 1 
ATOM   6442 N ND2 . ASN F 3 187 ? 23.139  -30.562 12.090 1.00 44.40  ? 203 ASN F ND2 1 
ATOM   6443 N N   . ASN F 3 188 ? 19.544  -26.907 9.426  1.00 47.49  ? 204 ASN F N   1 
ATOM   6444 C CA  . ASN F 3 188 ? 19.184  -25.936 8.375  1.00 47.67  ? 204 ASN F CA  1 
ATOM   6445 C C   . ASN F 3 188 ? 19.863  -24.573 8.367  1.00 47.44  ? 204 ASN F C   1 
ATOM   6446 O O   . ASN F 3 188 ? 19.829  -23.901 7.348  1.00 49.72  ? 204 ASN F O   1 
ATOM   6447 C CB  . ASN F 3 188 ? 17.661  -25.735 8.303  1.00 47.35  ? 204 ASN F CB  1 
ATOM   6448 C CG  . ASN F 3 188 ? 16.909  -27.026 8.009  1.00 48.80  ? 204 ASN F CG  1 
ATOM   6449 O OD1 . ASN F 3 188 ? 17.413  -27.916 7.317  1.00 49.33  ? 204 ASN F OD1 1 
ATOM   6450 N ND2 . ASN F 3 188 ? 15.692  -27.132 8.535  1.00 49.20  ? 204 ASN F ND2 1 
ATOM   6451 N N   . ASN F 3 189 ? 20.464  -24.146 9.473  1.00 47.69  ? 205 ASN F N   1 
ATOM   6452 C CA  . ASN F 3 189 ? 21.129  -22.839 9.487  1.00 47.43  ? 205 ASN F CA  1 
ATOM   6453 C C   . ASN F 3 189 ? 22.651  -22.915 9.526  1.00 48.15  ? 205 ASN F C   1 
ATOM   6454 O O   . ASN F 3 189 ? 23.339  -21.898 9.653  1.00 46.85  ? 205 ASN F O   1 
ATOM   6455 C CB  . ASN F 3 189 ? 20.611  -21.981 10.625 1.00 47.11  ? 205 ASN F CB  1 
ATOM   6456 C CG  . ASN F 3 189 ? 19.113  -21.932 10.664 1.00 47.60  ? 205 ASN F CG  1 
ATOM   6457 O OD1 . ASN F 3 189 ? 18.450  -21.898 9.622  1.00 46.22  ? 205 ASN F OD1 1 
ATOM   6458 N ND2 . ASN F 3 189 ? 18.558  -21.932 11.874 1.00 48.04  ? 205 ASN F ND2 1 
ATOM   6459 N N   . LEU F 3 190 ? 23.170  -24.132 9.427  1.00 48.13  ? 206 LEU F N   1 
ATOM   6460 C CA  . LEU F 3 190 ? 24.593  -24.319 9.297  1.00 48.66  ? 206 LEU F CA  1 
ATOM   6461 C C   . LEU F 3 190 ? 24.922  -24.072 7.832  1.00 51.13  ? 206 LEU F C   1 
ATOM   6462 O O   . LEU F 3 190 ? 24.579  -24.864 6.953  1.00 49.78  ? 206 LEU F O   1 
ATOM   6463 C CB  . LEU F 3 190 ? 24.997  -25.728 9.739  1.00 47.41  ? 206 LEU F CB  1 
ATOM   6464 C CG  . LEU F 3 190 ? 26.444  -26.205 9.521  1.00 45.05  ? 206 LEU F CG  1 
ATOM   6465 C CD1 . LEU F 3 190 ? 27.469  -25.328 10.242 1.00 41.19  ? 206 LEU F CD1 1 
ATOM   6466 C CD2 . LEU F 3 190 ? 26.572  -27.667 9.926  1.00 40.94  ? 206 LEU F CD2 1 
ATOM   6467 N N   . GLU F 3 191 ? 25.579  -22.952 7.568  1.00 54.80  ? 207 GLU F N   1 
ATOM   6468 C CA  . GLU F 3 191 ? 25.921  -22.611 6.202  1.00 59.52  ? 207 GLU F CA  1 
ATOM   6469 C C   . GLU F 3 191 ? 27.404  -22.441 5.943  1.00 60.96  ? 207 GLU F C   1 
ATOM   6470 O O   . GLU F 3 191 ? 27.832  -22.399 4.795  1.00 62.06  ? 207 GLU F O   1 
ATOM   6471 C CB  . GLU F 3 191 ? 25.163  -21.363 5.764  1.00 60.41  ? 207 GLU F CB  1 
ATOM   6472 C CG  . GLU F 3 191 ? 25.221  -20.210 6.742  1.00 62.78  ? 207 GLU F CG  1 
ATOM   6473 C CD  . GLU F 3 191 ? 24.415  -19.037 6.249  1.00 64.35  ? 207 GLU F CD  1 
ATOM   6474 O OE1 . GLU F 3 191 ? 23.181  -19.152 6.213  1.00 67.03  ? 207 GLU F OE1 1 
ATOM   6475 O OE2 . GLU F 3 191 ? 25.013  -18.007 5.881  1.00 64.90  ? 207 GLU F OE2 1 
ATOM   6476 N N   . GLU F 3 192 ? 28.184  -22.370 7.011  1.00 63.87  ? 208 GLU F N   1 
ATOM   6477 C CA  . GLU F 3 192 ? 29.590  -22.045 6.899  1.00 66.16  ? 208 GLU F CA  1 
ATOM   6478 C C   . GLU F 3 192 ? 30.461  -23.022 7.687  1.00 65.96  ? 208 GLU F C   1 
ATOM   6479 O O   . GLU F 3 192 ? 30.406  -23.053 8.916  1.00 67.06  ? 208 GLU F O   1 
ATOM   6480 C CB  . GLU F 3 192 ? 29.805  -20.597 7.390  1.00 67.80  ? 208 GLU F CB  1 
ATOM   6481 C CG  . GLU F 3 192 ? 31.090  -19.925 6.922  1.00 71.69  ? 208 GLU F CG  1 
ATOM   6482 C CD  . GLU F 3 192 ? 32.118  -19.741 8.037  1.00 73.99  ? 208 GLU F CD  1 
ATOM   6483 O OE1 . GLU F 3 192 ? 31.912  -20.267 9.156  1.00 74.22  ? 208 GLU F OE1 1 
ATOM   6484 O OE2 . GLU F 3 192 ? 33.143  -19.063 7.785  1.00 74.28  ? 208 GLU F OE2 1 
ATOM   6485 N N   . LEU F 3 193 ? 31.225  -23.842 6.969  1.00 64.83  ? 209 LEU F N   1 
ATOM   6486 C CA  . LEU F 3 193 ? 32.267  -24.641 7.588  1.00 64.49  ? 209 LEU F CA  1 
ATOM   6487 C C   . LEU F 3 193 ? 33.621  -23.937 7.422  1.00 66.05  ? 209 LEU F C   1 
ATOM   6488 O O   . LEU F 3 193 ? 34.137  -23.848 6.309  1.00 66.45  ? 209 LEU F O   1 
ATOM   6489 C CB  . LEU F 3 193 ? 32.352  -26.033 6.960  1.00 63.38  ? 209 LEU F CB  1 
ATOM   6490 C CG  . LEU F 3 193 ? 31.564  -27.215 7.536  1.00 63.52  ? 209 LEU F CG  1 
ATOM   6491 C CD1 . LEU F 3 193 ? 31.907  -28.493 6.790  1.00 62.26  ? 209 LEU F CD1 1 
ATOM   6492 C CD2 . LEU F 3 193 ? 31.834  -27.403 9.007  1.00 63.84  ? 209 LEU F CD2 1 
ATOM   6493 N N   . PRO F 3 194 ? 34.177  -23.405 8.521  1.00 67.46  ? 210 PRO F N   1 
ATOM   6494 C CA  . PRO F 3 194 ? 35.513  -22.797 8.517  1.00 68.01  ? 210 PRO F CA  1 
ATOM   6495 C C   . PRO F 3 194 ? 36.595  -23.735 7.976  1.00 69.21  ? 210 PRO F C   1 
ATOM   6496 O O   . PRO F 3 194 ? 36.419  -24.955 7.949  1.00 69.30  ? 210 PRO F O   1 
ATOM   6497 C CB  . PRO F 3 194 ? 35.759  -22.505 9.995  1.00 68.07  ? 210 PRO F CB  1 
ATOM   6498 C CG  . PRO F 3 194 ? 34.402  -22.221 10.520 1.00 67.45  ? 210 PRO F CG  1 
ATOM   6499 C CD  . PRO F 3 194 ? 33.531  -23.251 9.839  1.00 67.61  ? 210 PRO F CD  1 
ATOM   6500 N N   . ASN F 3 195 ? 37.712  -23.147 7.563  1.00 70.47  ? 211 ASN F N   1 
ATOM   6501 C CA  . ASN F 3 195 ? 38.777  -23.877 6.888  1.00 71.55  ? 211 ASN F CA  1 
ATOM   6502 C C   . ASN F 3 195 ? 39.496  -24.912 7.735  1.00 70.89  ? 211 ASN F C   1 
ATOM   6503 O O   . ASN F 3 195 ? 39.836  -25.992 7.247  1.00 69.97  ? 211 ASN F O   1 
ATOM   6504 C CB  . ASN F 3 195 ? 39.796  -22.890 6.317  1.00 73.55  ? 211 ASN F CB  1 
ATOM   6505 C CG  . ASN F 3 195 ? 39.225  -22.055 5.191  1.00 75.82  ? 211 ASN F CG  1 
ATOM   6506 O OD1 . ASN F 3 195 ? 39.377  -20.832 5.175  1.00 78.24  ? 211 ASN F OD1 1 
ATOM   6507 N ND2 . ASN F 3 195 ? 38.559  -22.711 4.244  1.00 76.24  ? 211 ASN F ND2 1 
ATOM   6508 N N   . ASP F 3 196 ? 39.731  -24.580 8.998  1.00 69.98  ? 212 ASP F N   1 
ATOM   6509 C CA  . ASP F 3 196 ? 40.500  -25.461 9.862  1.00 69.30  ? 212 ASP F CA  1 
ATOM   6510 C C   . ASP F 3 196 ? 39.621  -26.280 10.801 1.00 68.13  ? 212 ASP F C   1 
ATOM   6511 O O   . ASP F 3 196 ? 39.987  -26.490 11.960 1.00 68.93  ? 212 ASP F O   1 
ATOM   6512 C CB  . ASP F 3 196 ? 41.555  -24.655 10.648 1.00 69.13  ? 212 ASP F CB  1 
ATOM   6513 C CG  . ASP F 3 196 ? 42.871  -24.483 9.874  1.00 69.04  ? 212 ASP F CG  1 
ATOM   6514 O OD1 . ASP F 3 196 ? 43.474  -25.501 9.457  1.00 68.27  ? 212 ASP F OD1 1 
ATOM   6515 O OD2 . ASP F 3 196 ? 43.372  -23.358 9.660  1.00 67.65  ? 212 ASP F OD2 1 
ATOM   6516 N N   . VAL F 3 197 ? 38.478  -26.758 10.294 1.00 66.33  ? 213 VAL F N   1 
ATOM   6517 C CA  . VAL F 3 197 ? 37.531  -27.526 11.123 1.00 64.16  ? 213 VAL F CA  1 
ATOM   6518 C C   . VAL F 3 197 ? 38.071  -28.885 11.487 1.00 63.36  ? 213 VAL F C   1 
ATOM   6519 O O   . VAL F 3 197 ? 37.748  -29.429 12.546 1.00 63.44  ? 213 VAL F O   1 
ATOM   6520 C CB  . VAL F 3 197 ? 36.125  -27.749 10.470 1.00 63.84  ? 213 VAL F CB  1 
ATOM   6521 C CG1 . VAL F 3 197 ? 35.172  -26.618 10.830 1.00 63.19  ? 213 VAL F CG1 1 
ATOM   6522 C CG2 . VAL F 3 197 ? 36.220  -27.967 8.967  1.00 61.33  ? 213 VAL F CG2 1 
ATOM   6523 N N   . PHE F 3 198 ? 38.909  -29.420 10.609 1.00 62.02  ? 214 PHE F N   1 
ATOM   6524 C CA  . PHE F 3 198 ? 39.393  -30.776 10.772 1.00 60.46  ? 214 PHE F CA  1 
ATOM   6525 C C   . PHE F 3 198 ? 40.832  -30.858 11.225 1.00 61.01  ? 214 PHE F C   1 
ATOM   6526 O O   . PHE F 3 198 ? 41.439  -31.929 11.193 1.00 62.37  ? 214 PHE F O   1 
ATOM   6527 C CB  . PHE F 3 198 ? 39.145  -31.553 9.487  1.00 57.87  ? 214 PHE F CB  1 
ATOM   6528 C CG  . PHE F 3 198 ? 37.704  -31.619 9.129  1.00 56.07  ? 214 PHE F CG  1 
ATOM   6529 C CD1 . PHE F 3 198 ? 36.791  -32.178 10.013 1.00 54.93  ? 214 PHE F CD1 1 
ATOM   6530 C CD2 . PHE F 3 198 ? 37.243  -31.093 7.941  1.00 56.11  ? 214 PHE F CD2 1 
ATOM   6531 C CE1 . PHE F 3 198 ? 35.450  -32.232 9.710  1.00 53.56  ? 214 PHE F CE1 1 
ATOM   6532 C CE2 . PHE F 3 198 ? 35.896  -31.143 7.626  1.00 56.45  ? 214 PHE F CE2 1 
ATOM   6533 C CZ  . PHE F 3 198 ? 34.998  -31.714 8.517  1.00 55.70  ? 214 PHE F CZ  1 
ATOM   6534 N N   . HIS F 3 199 ? 41.357  -29.724 11.682 1.00 60.72  ? 215 HIS F N   1 
ATOM   6535 C CA  . HIS F 3 199 ? 42.724  -29.659 12.171 1.00 61.31  ? 215 HIS F CA  1 
ATOM   6536 C C   . HIS F 3 199 ? 42.883  -30.537 13.398 1.00 59.75  ? 215 HIS F C   1 
ATOM   6537 O O   . HIS F 3 199 ? 42.032  -30.535 14.280 1.00 61.00  ? 215 HIS F O   1 
ATOM   6538 C CB  . HIS F 3 199 ? 43.121  -28.217 12.494 1.00 63.50  ? 215 HIS F CB  1 
ATOM   6539 C CG  . HIS F 3 199 ? 44.547  -28.074 12.934 1.00 67.07  ? 215 HIS F CG  1 
ATOM   6540 N ND1 . HIS F 3 199 ? 44.913  -27.376 14.068 1.00 68.12  ? 215 HIS F ND1 1 
ATOM   6541 C CD2 . HIS F 3 199 ? 45.695  -28.557 12.403 1.00 67.42  ? 215 HIS F CD2 1 
ATOM   6542 C CE1 . HIS F 3 199 ? 46.224  -27.431 14.212 1.00 68.02  ? 215 HIS F CE1 1 
ATOM   6543 N NE2 . HIS F 3 199 ? 46.722  -28.143 13.216 1.00 69.49  ? 215 HIS F NE2 1 
ATOM   6544 N N   . GLY F 3 200 ? 43.967  -31.301 13.443 1.00 58.36  ? 216 GLY F N   1 
ATOM   6545 C CA  . GLY F 3 200 ? 44.207  -32.195 14.566 1.00 55.87  ? 216 GLY F CA  1 
ATOM   6546 C C   . GLY F 3 200 ? 43.287  -33.397 14.563 1.00 54.27  ? 216 GLY F C   1 
ATOM   6547 O O   . GLY F 3 200 ? 43.400  -34.277 15.409 1.00 54.75  ? 216 GLY F O   1 
ATOM   6548 N N   . ALA F 3 201 ? 42.369  -33.437 13.610 1.00 53.37  ? 217 ALA F N   1 
ATOM   6549 C CA  . ALA F 3 201 ? 41.463  -34.562 13.483 1.00 53.32  ? 217 ALA F CA  1 
ATOM   6550 C C   . ALA F 3 201 ? 41.954  -35.502 12.400 1.00 54.59  ? 217 ALA F C   1 
ATOM   6551 O O   . ALA F 3 201 ? 42.681  -35.089 11.492 1.00 55.14  ? 217 ALA F O   1 
ATOM   6552 C CB  . ALA F 3 201 ? 40.071  -34.074 13.148 1.00 52.72  ? 217 ALA F CB  1 
ATOM   6553 N N   . SER F 3 202 ? 41.559  -36.770 12.494 1.00 54.51  ? 218 SER F N   1 
ATOM   6554 C CA  . SER F 3 202 ? 41.828  -37.719 11.425 1.00 54.20  ? 218 SER F CA  1 
ATOM   6555 C C   . SER F 3 202 ? 40.779  -37.645 10.302 1.00 54.30  ? 218 SER F C   1 
ATOM   6556 O O   . SER F 3 202 ? 40.638  -38.577 9.517  1.00 56.13  ? 218 SER F O   1 
ATOM   6557 C CB  . SER F 3 202 ? 41.934  -39.133 11.965 1.00 55.09  ? 218 SER F CB  1 
ATOM   6558 O OG  . SER F 3 202 ? 43.215  -39.336 12.514 1.00 53.74  ? 218 SER F OG  1 
ATOM   6559 N N   . GLY F 3 203 ? 40.048  -36.536 10.241 1.00 53.02  ? 219 GLY F N   1 
ATOM   6560 C CA  . GLY F 3 203 ? 39.184  -36.246 9.111  1.00 49.79  ? 219 GLY F CA  1 
ATOM   6561 C C   . GLY F 3 203 ? 38.121  -37.294 8.921  1.00 49.59  ? 219 GLY F C   1 
ATOM   6562 O O   . GLY F 3 203 ? 38.387  -38.488 9.043  1.00 50.47  ? 219 GLY F O   1 
ATOM   6563 N N   . PRO F 3 204 ? 36.904  -36.855 8.622  1.00 47.12  ? 220 PRO F N   1 
ATOM   6564 C CA  . PRO F 3 204 ? 35.775  -37.762 8.470  1.00 45.10  ? 220 PRO F CA  1 
ATOM   6565 C C   . PRO F 3 204 ? 35.984  -38.685 7.284  1.00 44.46  ? 220 PRO F C   1 
ATOM   6566 O O   . PRO F 3 204 ? 36.208  -38.203 6.176  1.00 45.14  ? 220 PRO F O   1 
ATOM   6567 C CB  . PRO F 3 204 ? 34.614  -36.822 8.177  1.00 44.98  ? 220 PRO F CB  1 
ATOM   6568 C CG  . PRO F 3 204 ? 35.058  -35.520 8.680  1.00 45.58  ? 220 PRO F CG  1 
ATOM   6569 C CD  . PRO F 3 204 ? 36.517  -35.445 8.449  1.00 44.98  ? 220 PRO F CD  1 
ATOM   6570 N N   . VAL F 3 205 ? 35.936  -39.994 7.505  1.00 41.64  ? 221 VAL F N   1 
ATOM   6571 C CA  . VAL F 3 205 ? 35.975  -40.916 6.381  1.00 40.41  ? 221 VAL F CA  1 
ATOM   6572 C C   . VAL F 3 205 ? 34.655  -40.796 5.601  1.00 42.09  ? 221 VAL F C   1 
ATOM   6573 O O   . VAL F 3 205 ? 34.628  -40.885 4.370  1.00 40.41  ? 221 VAL F O   1 
ATOM   6574 C CB  . VAL F 3 205 ? 36.210  -42.352 6.839  1.00 39.49  ? 221 VAL F CB  1 
ATOM   6575 C CG1 . VAL F 3 205 ? 36.226  -43.300 5.641  1.00 40.91  ? 221 VAL F CG1 1 
ATOM   6576 C CG2 . VAL F 3 205 ? 37.532  -42.443 7.587  1.00 39.82  ? 221 VAL F CG2 1 
ATOM   6577 N N   . ILE F 3 206 ? 33.571  -40.566 6.340  1.00 44.61  ? 222 ILE F N   1 
ATOM   6578 C CA  . ILE F 3 206 ? 32.232  -40.371 5.782  1.00 44.56  ? 222 ILE F CA  1 
ATOM   6579 C C   . ILE F 3 206 ? 31.673  -39.080 6.343  1.00 43.98  ? 222 ILE F C   1 
ATOM   6580 O O   . ILE F 3 206 ? 31.570  -38.913 7.560  1.00 44.70  ? 222 ILE F O   1 
ATOM   6581 C CB  . ILE F 3 206 ? 31.326  -41.516 6.198  1.00 45.05  ? 222 ILE F CB  1 
ATOM   6582 C CG1 . ILE F 3 206 ? 31.871  -42.825 5.649  1.00 46.20  ? 222 ILE F CG1 1 
ATOM   6583 C CG2 . ILE F 3 206 ? 29.902  -41.263 5.752  1.00 45.71  ? 222 ILE F CG2 1 
ATOM   6584 C CD1 . ILE F 3 206 ? 31.975  -43.864 6.719  1.00 47.89  ? 222 ILE F CD1 1 
ATOM   6585 N N   . LEU F 3 207 ? 31.312  -38.168 5.454  1.00 43.32  ? 223 LEU F N   1 
ATOM   6586 C CA  . LEU F 3 207 ? 30.791  -36.889 5.869  1.00 42.74  ? 223 LEU F CA  1 
ATOM   6587 C C   . LEU F 3 207 ? 29.400  -36.727 5.310  1.00 44.03  ? 223 LEU F C   1 
ATOM   6588 O O   . LEU F 3 207 ? 29.127  -37.144 4.191  1.00 45.14  ? 223 LEU F O   1 
ATOM   6589 C CB  . LEU F 3 207 ? 31.697  -35.775 5.373  1.00 40.55  ? 223 LEU F CB  1 
ATOM   6590 C CG  . LEU F 3 207 ? 31.327  -34.397 5.888  1.00 41.08  ? 223 LEU F CG  1 
ATOM   6591 C CD1 . LEU F 3 207 ? 31.323  -34.414 7.411  1.00 40.50  ? 223 LEU F CD1 1 
ATOM   6592 C CD2 . LEU F 3 207 ? 32.288  -33.361 5.350  1.00 39.04  ? 223 LEU F CD2 1 
ATOM   6593 N N   . ASP F 3 208 ? 28.521  -36.125 6.096  1.00 47.07  ? 224 ASP F N   1 
ATOM   6594 C CA  . ASP F 3 208 ? 27.138  -35.945 5.694  1.00 47.41  ? 224 ASP F CA  1 
ATOM   6595 C C   . ASP F 3 208 ? 26.645  -34.534 6.026  1.00 46.30  ? 224 ASP F C   1 
ATOM   6596 O O   . ASP F 3 208 ? 26.336  -34.209 7.170  1.00 45.06  ? 224 ASP F O   1 
ATOM   6597 C CB  . ASP F 3 208 ? 26.265  -37.005 6.352  1.00 49.66  ? 224 ASP F CB  1 
ATOM   6598 C CG  . ASP F 3 208 ? 24.852  -37.014 5.793  1.00 58.16  ? 224 ASP F CG  1 
ATOM   6599 O OD1 . ASP F 3 208 ? 24.490  -36.058 5.066  1.00 61.18  ? 224 ASP F OD1 1 
ATOM   6600 O OD2 . ASP F 3 208 ? 24.035  -37.936 6.036  1.00 63.92  ? 224 ASP F OD2 1 
ATOM   6601 N N   . ILE F 3 209 ? 26.561  -33.703 4.998  1.00 46.20  ? 225 ILE F N   1 
ATOM   6602 C CA  . ILE F 3 209 ? 26.174  -32.311 5.176  1.00 45.85  ? 225 ILE F CA  1 
ATOM   6603 C C   . ILE F 3 209 ? 24.814  -31.972 4.577  1.00 44.94  ? 225 ILE F C   1 
ATOM   6604 O O   . ILE F 3 209 ? 24.485  -30.804 4.424  1.00 45.38  ? 225 ILE F O   1 
ATOM   6605 C CB  . ILE F 3 209 ? 27.284  -31.382 4.623  1.00 45.89  ? 225 ILE F CB  1 
ATOM   6606 C CG1 . ILE F 3 209 ? 27.656  -31.789 3.198  1.00 48.31  ? 225 ILE F CG1 1 
ATOM   6607 C CG2 . ILE F 3 209 ? 28.503  -31.390 5.543  1.00 46.95  ? 225 ILE F CG2 1 
ATOM   6608 C CD1 . ILE F 3 209 ? 28.536  -30.782 2.490  1.00 50.71  ? 225 ILE F CD1 1 
ATOM   6609 N N   . SER F 3 210 ? 24.017  -32.999 4.279  1.00 44.99  ? 226 SER F N   1 
ATOM   6610 C CA  . SER F 3 210 ? 22.669  -32.846 3.707  1.00 45.00  ? 226 SER F CA  1 
ATOM   6611 C C   . SER F 3 210 ? 21.767  -31.814 4.390  1.00 44.99  ? 226 SER F C   1 
ATOM   6612 O O   . SER F 3 210 ? 21.916  -31.512 5.568  1.00 47.14  ? 226 SER F O   1 
ATOM   6613 C CB  . SER F 3 210 ? 21.965  -34.196 3.686  1.00 44.84  ? 226 SER F CB  1 
ATOM   6614 O OG  . SER F 3 210 ? 22.715  -35.143 2.942  1.00 44.66  ? 226 SER F OG  1 
ATOM   6615 N N   . ARG F 3 211 ? 20.831  -31.272 3.634  1.00 45.91  ? 227 ARG F N   1 
ATOM   6616 C CA  . ARG F 3 211 ? 19.915  -30.242 4.125  1.00 47.40  ? 227 ARG F CA  1 
ATOM   6617 C C   . ARG F 3 211 ? 20.525  -29.212 5.095  1.00 47.03  ? 227 ARG F C   1 
ATOM   6618 O O   . ARG F 3 211 ? 19.978  -28.945 6.160  1.00 47.57  ? 227 ARG F O   1 
ATOM   6619 C CB  . ARG F 3 211 ? 18.662  -30.876 4.736  1.00 48.50  ? 227 ARG F CB  1 
ATOM   6620 C CG  . ARG F 3 211 ? 17.556  -31.164 3.734  1.00 49.44  ? 227 ARG F CG  1 
ATOM   6621 C CD  . ARG F 3 211 ? 16.810  -32.431 4.057  1.00 50.09  ? 227 ARG F CD  1 
ATOM   6622 N NE  . ARG F 3 211 ? 17.755  -33.520 4.264  1.00 54.20  ? 227 ARG F NE  1 
ATOM   6623 C CZ  . ARG F 3 211 ? 17.460  -34.801 4.144  1.00 56.74  ? 227 ARG F CZ  1 
ATOM   6624 N NH1 . ARG F 3 211 ? 16.222  -35.172 3.820  1.00 58.99  ? 227 ARG F NH1 1 
ATOM   6625 N NH2 . ARG F 3 211 ? 18.405  -35.710 4.347  1.00 56.12  ? 227 ARG F NH2 1 
ATOM   6626 N N   . THR F 3 212 ? 21.666  -28.652 4.716  1.00 47.67  ? 228 THR F N   1 
ATOM   6627 C CA  . THR F 3 212 ? 22.201  -27.448 5.354  1.00 48.65  ? 228 THR F CA  1 
ATOM   6628 C C   . THR F 3 212 ? 22.391  -26.389 4.260  1.00 50.60  ? 228 THR F C   1 
ATOM   6629 O O   . THR F 3 212 ? 21.908  -26.562 3.139  1.00 52.19  ? 228 THR F O   1 
ATOM   6630 C CB  . THR F 3 212 ? 23.522  -27.726 6.084  1.00 47.54  ? 228 THR F CB  1 
ATOM   6631 O OG1 . THR F 3 212 ? 24.376  -28.495 5.238  1.00 47.80  ? 228 THR F OG1 1 
ATOM   6632 C CG2 . THR F 3 212 ? 23.283  -28.616 7.285  1.00 48.98  ? 228 THR F CG2 1 
ATOM   6633 N N   . ARG F 3 213 ? 23.080  -25.297 4.584  1.00 52.06  ? 229 ARG F N   1 
ATOM   6634 C CA  . ARG F 3 213 ? 23.361  -24.251 3.608  1.00 52.08  ? 229 ARG F CA  1 
ATOM   6635 C C   . ARG F 3 213 ? 24.866  -24.180 3.356  1.00 53.18  ? 229 ARG F C   1 
ATOM   6636 O O   . ARG F 3 213 ? 25.395  -23.151 2.916  1.00 53.27  ? 229 ARG F O   1 
ATOM   6637 C CB  . ARG F 3 213 ? 22.828  -22.896 4.080  1.00 52.94  ? 229 ARG F CB  1 
ATOM   6638 C CG  . ARG F 3 213 ? 21.313  -22.800 4.214  1.00 56.26  ? 229 ARG F CG  1 
ATOM   6639 C CD  . ARG F 3 213 ? 20.787  -21.377 4.021  1.00 60.59  ? 229 ARG F CD  1 
ATOM   6640 N NE  . ARG F 3 213 ? 19.765  -20.990 4.996  1.00 63.56  ? 229 ARG F NE  1 
ATOM   6641 C CZ  . ARG F 3 213 ? 20.027  -20.456 6.191  1.00 66.72  ? 229 ARG F CZ  1 
ATOM   6642 N NH1 . ARG F 3 213 ? 21.277  -20.253 6.577  1.00 68.64  ? 229 ARG F NH1 1 
ATOM   6643 N NH2 . ARG F 3 213 ? 19.041  -20.126 7.012  1.00 69.20  ? 229 ARG F NH2 1 
ATOM   6644 N N   . ILE F 3 214 ? 25.557  -25.277 3.661  1.00 53.37  ? 230 ILE F N   1 
ATOM   6645 C CA  . ILE F 3 214 ? 26.972  -25.394 3.341  1.00 54.05  ? 230 ILE F CA  1 
ATOM   6646 C C   . ILE F 3 214 ? 27.079  -25.714 1.855  1.00 55.52  ? 230 ILE F C   1 
ATOM   6647 O O   . ILE F 3 214 ? 26.445  -26.646 1.362  1.00 54.35  ? 230 ILE F O   1 
ATOM   6648 C CB  . ILE F 3 214 ? 27.647  -26.496 4.171  1.00 53.24  ? 230 ILE F CB  1 
ATOM   6649 C CG1 . ILE F 3 214 ? 27.656  -26.120 5.652  1.00 53.84  ? 230 ILE F CG1 1 
ATOM   6650 C CG2 . ILE F 3 214 ? 29.074  -26.730 3.679  1.00 52.58  ? 230 ILE F CG2 1 
ATOM   6651 C CD1 . ILE F 3 214 ? 27.986  -27.285 6.571  1.00 51.95  ? 230 ILE F CD1 1 
ATOM   6652 N N   . HIS F 3 215 ? 27.884  -24.940 1.140  1.00 56.95  ? 231 HIS F N   1 
ATOM   6653 C CA  . HIS F 3 215 ? 27.988  -25.135 -0.291 1.00 58.02  ? 231 HIS F CA  1 
ATOM   6654 C C   . HIS F 3 215 ? 29.350  -25.654 -0.729 1.00 60.17  ? 231 HIS F C   1 
ATOM   6655 O O   . HIS F 3 215 ? 29.517  -26.068 -1.876 1.00 61.80  ? 231 HIS F O   1 
ATOM   6656 C CB  . HIS F 3 215 ? 27.587  -23.853 -1.019 1.00 56.59  ? 231 HIS F CB  1 
ATOM   6657 C CG  . HIS F 3 215 ? 26.217  -23.373 -0.650 1.00 56.46  ? 231 HIS F CG  1 
ATOM   6658 N ND1 . HIS F 3 215 ? 25.091  -24.147 -0.822 1.00 56.17  ? 231 HIS F ND1 1 
ATOM   6659 C CD2 . HIS F 3 215 ? 25.793  -22.213 -0.095 1.00 55.88  ? 231 HIS F CD2 1 
ATOM   6660 C CE1 . HIS F 3 215 ? 24.032  -23.484 -0.394 1.00 55.11  ? 231 HIS F CE1 1 
ATOM   6661 N NE2 . HIS F 3 215 ? 24.431  -22.306 0.051  1.00 54.04  ? 231 HIS F NE2 1 
ATOM   6662 N N   . SER F 3 216 ? 30.312  -25.661 0.191  1.00 60.89  ? 232 SER F N   1 
ATOM   6663 C CA  . SER F 3 216 ? 31.654  -26.124 -0.130 1.00 62.29  ? 232 SER F CA  1 
ATOM   6664 C C   . SER F 3 216 ? 32.379  -26.617 1.096  1.00 62.95  ? 232 SER F C   1 
ATOM   6665 O O   . SER F 3 216 ? 32.061  -26.225 2.214  1.00 63.85  ? 232 SER F O   1 
ATOM   6666 C CB  . SER F 3 216 ? 32.467  -25.010 -0.770 1.00 62.60  ? 232 SER F CB  1 
ATOM   6667 O OG  . SER F 3 216 ? 33.606  -25.562 -1.406 1.00 67.72  ? 232 SER F OG  1 
ATOM   6668 N N   . LEU F 3 217 ? 33.372  -27.466 0.877  1.00 63.87  ? 233 LEU F N   1 
ATOM   6669 C CA  . LEU F 3 217 ? 34.133  -28.050 1.971  1.00 66.16  ? 233 LEU F CA  1 
ATOM   6670 C C   . LEU F 3 217 ? 35.575  -27.589 1.953  1.00 67.52  ? 233 LEU F C   1 
ATOM   6671 O O   . LEU F 3 217 ? 36.172  -27.453 0.889  1.00 68.61  ? 233 LEU F O   1 
ATOM   6672 C CB  . LEU F 3 217 ? 34.049  -29.573 1.919  1.00 66.75  ? 233 LEU F CB  1 
ATOM   6673 C CG  . LEU F 3 217 ? 33.557  -30.159 0.595  1.00 68.25  ? 233 LEU F CG  1 
ATOM   6674 C CD1 . LEU F 3 217 ? 34.694  -30.822 -0.186 1.00 68.40  ? 233 LEU F CD1 1 
ATOM   6675 C CD2 . LEU F 3 217 ? 32.446  -31.145 0.887  1.00 67.42  ? 233 LEU F CD2 1 
ATOM   6676 N N   . PRO F 3 218 ? 36.143  -27.349 3.134  1.00 69.05  ? 234 PRO F N   1 
ATOM   6677 C CA  . PRO F 3 218 ? 37.506  -26.825 3.255  1.00 70.19  ? 234 PRO F CA  1 
ATOM   6678 C C   . PRO F 3 218 ? 38.531  -27.670 2.511  1.00 71.23  ? 234 PRO F C   1 
ATOM   6679 O O   . PRO F 3 218 ? 38.222  -28.786 2.080  1.00 71.94  ? 234 PRO F O   1 
ATOM   6680 C CB  . PRO F 3 218 ? 37.756  -26.869 4.757  1.00 70.28  ? 234 PRO F CB  1 
ATOM   6681 C CG  . PRO F 3 218 ? 36.396  -26.736 5.341  1.00 69.28  ? 234 PRO F CG  1 
ATOM   6682 C CD  . PRO F 3 218 ? 35.525  -27.565 4.454  1.00 68.12  ? 234 PRO F CD  1 
ATOM   6683 N N   . SER F 3 219 ? 39.746  -27.147 2.374  1.00 71.75  ? 235 SER F N   1 
ATOM   6684 C CA  . SER F 3 219 ? 40.778  -27.851 1.626  1.00 72.65  ? 235 SER F CA  1 
ATOM   6685 C C   . SER F 3 219 ? 41.502  -28.903 2.458  1.00 73.48  ? 235 SER F C   1 
ATOM   6686 O O   . SER F 3 219 ? 41.668  -30.046 2.025  1.00 74.13  ? 235 SER F O   1 
ATOM   6687 C CB  . SER F 3 219 ? 41.770  -26.859 1.034  1.00 72.20  ? 235 SER F CB  1 
ATOM   6688 O OG  . SER F 3 219 ? 42.294  -27.375 -0.180 1.00 73.43  ? 235 SER F OG  1 
ATOM   6689 N N   . TYR F 3 220 ? 41.935  -28.522 3.650  1.00 74.29  ? 236 TYR F N   1 
ATOM   6690 C CA  . TYR F 3 220 ? 42.624  -29.462 4.510  1.00 76.03  ? 236 TYR F CA  1 
ATOM   6691 C C   . TYR F 3 220 ? 41.631  -30.380 5.213  1.00 74.79  ? 236 TYR F C   1 
ATOM   6692 O O   . TYR F 3 220 ? 40.552  -29.947 5.624  1.00 73.36  ? 236 TYR F O   1 
ATOM   6693 C CB  . TYR F 3 220 ? 43.479  -28.718 5.554  1.00 78.56  ? 236 TYR F CB  1 
ATOM   6694 C CG  . TYR F 3 220 ? 44.477  -29.605 6.284  1.00 82.36  ? 236 TYR F CG  1 
ATOM   6695 C CD1 . TYR F 3 220 ? 45.734  -29.887 5.717  1.00 83.54  ? 236 TYR F CD1 1 
ATOM   6696 C CD2 . TYR F 3 220 ? 44.167  -30.166 7.539  1.00 83.16  ? 236 TYR F CD2 1 
ATOM   6697 C CE1 . TYR F 3 220 ? 46.658  -30.706 6.374  1.00 84.28  ? 236 TYR F CE1 1 
ATOM   6698 C CE2 . TYR F 3 220 ? 45.086  -30.992 8.208  1.00 84.13  ? 236 TYR F CE2 1 
ATOM   6699 C CZ  . TYR F 3 220 ? 46.331  -31.254 7.615  1.00 84.55  ? 236 TYR F CZ  1 
ATOM   6700 O OH  . TYR F 3 220 ? 47.254  -32.061 8.253  1.00 83.85  ? 236 TYR F OH  1 
ATOM   6701 N N   . GLY F 3 221 ? 42.000  -31.654 5.317  1.00 73.97  ? 237 GLY F N   1 
ATOM   6702 C CA  . GLY F 3 221 ? 41.284  -32.587 6.174  1.00 73.22  ? 237 GLY F CA  1 
ATOM   6703 C C   . GLY F 3 221 ? 40.494  -33.669 5.487  1.00 72.47  ? 237 GLY F C   1 
ATOM   6704 O O   . GLY F 3 221 ? 40.247  -34.724 6.070  1.00 73.65  ? 237 GLY F O   1 
ATOM   6705 N N   . LEU F 3 222 ? 40.084  -33.414 4.252  1.00 72.00  ? 238 LEU F N   1 
ATOM   6706 C CA  . LEU F 3 222 ? 39.259  -34.376 3.516  1.00 72.14  ? 238 LEU F CA  1 
ATOM   6707 C C   . LEU F 3 222 ? 40.114  -35.329 2.680  1.00 71.47  ? 238 LEU F C   1 
ATOM   6708 O O   . LEU F 3 222 ? 39.717  -35.801 1.612  1.00 71.56  ? 238 LEU F O   1 
ATOM   6709 C CB  . LEU F 3 222 ? 38.219  -33.642 2.662  1.00 72.72  ? 238 LEU F CB  1 
ATOM   6710 C CG  . LEU F 3 222 ? 37.036  -33.064 3.454  1.00 74.90  ? 238 LEU F CG  1 
ATOM   6711 C CD1 . LEU F 3 222 ? 37.473  -31.905 4.364  1.00 74.92  ? 238 LEU F CD1 1 
ATOM   6712 C CD2 . LEU F 3 222 ? 35.966  -32.580 2.487  1.00 76.22  ? 238 LEU F CD2 1 
ATOM   6713 N N   . GLU F 3 223 ? 41.297  -35.610 3.213  1.00 70.58  ? 239 GLU F N   1 
ATOM   6714 C CA  . GLU F 3 223 ? 42.281  -36.481 2.593  1.00 69.10  ? 239 GLU F CA  1 
ATOM   6715 C C   . GLU F 3 223 ? 41.971  -37.953 2.840  1.00 67.52  ? 239 GLU F C   1 
ATOM   6716 O O   . GLU F 3 223 ? 42.674  -38.829 2.341  1.00 68.03  ? 239 GLU F O   1 
ATOM   6717 C CB  . GLU F 3 223 ? 43.670  -36.122 3.135  1.00 70.29  ? 239 GLU F CB  1 
ATOM   6718 C CG  . GLU F 3 223 ? 43.666  -35.740 4.622  1.00 72.10  ? 239 GLU F CG  1 
ATOM   6719 C CD  . GLU F 3 223 ? 44.472  -34.478 4.900  1.00 74.35  ? 239 GLU F CD  1 
ATOM   6720 O OE1 . GLU F 3 223 ? 44.025  -33.373 4.499  1.00 76.11  ? 239 GLU F OE1 1 
ATOM   6721 O OE2 . GLU F 3 223 ? 45.555  -34.587 5.515  1.00 75.42  ? 239 GLU F OE2 1 
ATOM   6722 N N   . ASN F 3 224 ? 40.925  -38.221 3.616  1.00 65.38  ? 240 ASN F N   1 
ATOM   6723 C CA  . ASN F 3 224 ? 40.537  -39.589 3.939  1.00 62.26  ? 240 ASN F CA  1 
ATOM   6724 C C   . ASN F 3 224 ? 39.093  -39.861 3.557  1.00 60.37  ? 240 ASN F C   1 
ATOM   6725 O O   . ASN F 3 224 ? 38.627  -41.001 3.621  1.00 59.78  ? 240 ASN F O   1 
ATOM   6726 C CB  . ASN F 3 224 ? 40.744  -39.858 5.431  1.00 63.00  ? 240 ASN F CB  1 
ATOM   6727 C CG  . ASN F 3 224 ? 42.175  -39.615 5.878  1.00 64.48  ? 240 ASN F CG  1 
ATOM   6728 O OD1 . ASN F 3 224 ? 42.419  -39.256 7.027  1.00 66.81  ? 240 ASN F OD1 1 
ATOM   6729 N ND2 . ASN F 3 224 ? 43.126  -39.808 4.972  1.00 64.66  ? 240 ASN F ND2 1 
ATOM   6730 N N   . LEU F 3 225 ? 38.396  -38.806 3.145  1.00 57.84  ? 241 LEU F N   1 
ATOM   6731 C CA  . LEU F 3 225 ? 36.981  -38.883 2.804  1.00 56.51  ? 241 LEU F CA  1 
ATOM   6732 C C   . LEU F 3 225 ? 36.690  -39.863 1.673  1.00 56.44  ? 241 LEU F C   1 
ATOM   6733 O O   . LEU F 3 225 ? 37.280  -39.792 0.598  1.00 56.57  ? 241 LEU F O   1 
ATOM   6734 C CB  . LEU F 3 225 ? 36.440  -37.499 2.448  1.00 55.32  ? 241 LEU F CB  1 
ATOM   6735 C CG  . LEU F 3 225 ? 34.931  -37.415 2.248  1.00 54.71  ? 241 LEU F CG  1 
ATOM   6736 C CD1 . LEU F 3 225 ? 34.244  -37.470 3.578  1.00 55.18  ? 241 LEU F CD1 1 
ATOM   6737 C CD2 . LEU F 3 225 ? 34.585  -36.129 1.545  1.00 55.92  ? 241 LEU F CD2 1 
ATOM   6738 N N   . LYS F 3 226 ? 35.766  -40.777 1.935  1.00 56.32  ? 242 LYS F N   1 
ATOM   6739 C CA  . LYS F 3 226 ? 35.365  -41.766 0.957  1.00 55.58  ? 242 LYS F CA  1 
ATOM   6740 C C   . LYS F 3 226 ? 33.888  -41.612 0.624  1.00 55.66  ? 242 LYS F C   1 
ATOM   6741 O O   . LYS F 3 226 ? 33.411  -42.162 -0.361 1.00 56.89  ? 242 LYS F O   1 
ATOM   6742 C CB  . LYS F 3 226 ? 35.639  -43.171 1.486  1.00 55.40  ? 242 LYS F CB  1 
ATOM   6743 C CG  . LYS F 3 226 ? 37.082  -43.422 1.885  1.00 57.70  ? 242 LYS F CG  1 
ATOM   6744 C CD  . LYS F 3 226 ? 38.019  -43.450 0.674  1.00 59.63  ? 242 LYS F CD  1 
ATOM   6745 C CE  . LYS F 3 226 ? 39.143  -44.476 0.857  1.00 60.62  ? 242 LYS F CE  1 
ATOM   6746 N NZ  . LYS F 3 226 ? 38.619  -45.870 1.111  1.00 61.16  ? 242 LYS F NZ  1 
ATOM   6747 N N   . LYS F 3 227 ? 33.164  -40.868 1.452  1.00 56.08  ? 243 LYS F N   1 
ATOM   6748 C CA  . LYS F 3 227 ? 31.741  -40.644 1.213  1.00 55.83  ? 243 LYS F CA  1 
ATOM   6749 C C   . LYS F 3 227 ? 31.276  -39.267 1.627  1.00 53.86  ? 243 LYS F C   1 
ATOM   6750 O O   . LYS F 3 227 ? 31.545  -38.802 2.732  1.00 52.86  ? 243 LYS F O   1 
ATOM   6751 C CB  . LYS F 3 227 ? 30.878  -41.710 1.898  1.00 56.89  ? 243 LYS F CB  1 
ATOM   6752 C CG  . LYS F 3 227 ? 30.410  -42.801 0.948  1.00 61.41  ? 243 LYS F CG  1 
ATOM   6753 C CD  . LYS F 3 227 ? 29.563  -43.858 1.661  1.00 65.26  ? 243 LYS F CD  1 
ATOM   6754 C CE  . LYS F 3 227 ? 29.779  -45.253 1.041  1.00 66.19  ? 243 LYS F CE  1 
ATOM   6755 N NZ  . LYS F 3 227 ? 31.243  -45.582 0.903  1.00 67.84  ? 243 LYS F NZ  1 
ATOM   6756 N N   . LEU F 3 228 ? 30.570  -38.624 0.709  1.00 51.97  ? 244 LEU F N   1 
ATOM   6757 C CA  . LEU F 3 228 ? 29.964  -37.337 0.970  1.00 51.19  ? 244 LEU F CA  1 
ATOM   6758 C C   . LEU F 3 228 ? 28.515  -37.358 0.508  1.00 50.83  ? 244 LEU F C   1 
ATOM   6759 O O   . LEU F 3 228 ? 28.203  -37.780 -0.611 1.00 52.52  ? 244 LEU F O   1 
ATOM   6760 C CB  . LEU F 3 228 ? 30.740  -36.218 0.276  1.00 48.95  ? 244 LEU F CB  1 
ATOM   6761 C CG  . LEU F 3 228 ? 30.192  -34.796 0.352  1.00 48.82  ? 244 LEU F CG  1 
ATOM   6762 C CD1 . LEU F 3 228 ? 30.149  -34.293 1.782  1.00 49.18  ? 244 LEU F CD1 1 
ATOM   6763 C CD2 . LEU F 3 228 ? 31.062  -33.894 -0.493 1.00 50.57  ? 244 LEU F CD2 1 
ATOM   6764 N N   . ARG F 3 229 ? 27.634  -36.920 1.389  1.00 48.31  ? 245 ARG F N   1 
ATOM   6765 C CA  . ARG F 3 229 ? 26.243  -36.842 1.058  1.00 49.08  ? 245 ARG F CA  1 
ATOM   6766 C C   . ARG F 3 229 ? 25.913  -35.364 1.182  1.00 49.87  ? 245 ARG F C   1 
ATOM   6767 O O   . ARG F 3 229 ? 26.246  -34.746 2.197  1.00 49.59  ? 245 ARG F O   1 
ATOM   6768 C CB  . ARG F 3 229 ? 25.440  -37.682 2.048  1.00 50.41  ? 245 ARG F CB  1 
ATOM   6769 C CG  . ARG F 3 229 ? 24.456  -38.630 1.406  1.00 52.10  ? 245 ARG F CG  1 
ATOM   6770 C CD  . ARG F 3 229 ? 23.219  -38.946 2.274  1.00 57.24  ? 245 ARG F CD  1 
ATOM   6771 N NE  . ARG F 3 229 ? 22.285  -37.816 2.465  1.00 57.09  ? 245 ARG F NE  1 
ATOM   6772 C CZ  . ARG F 3 229 ? 21.037  -37.935 2.937  1.00 54.29  ? 245 ARG F CZ  1 
ATOM   6773 N NH1 . ARG F 3 229 ? 20.549  -39.120 3.259  1.00 55.70  ? 245 ARG F NH1 1 
ATOM   6774 N NH2 . ARG F 3 229 ? 20.264  -36.874 3.081  1.00 53.07  ? 245 ARG F NH2 1 
ATOM   6775 N N   . ALA F 3 230 ? 25.296  -34.779 0.155  1.00 49.33  ? 246 ALA F N   1 
ATOM   6776 C CA  . ALA F 3 230 ? 25.011  -33.348 0.211  1.00 49.98  ? 246 ALA F CA  1 
ATOM   6777 C C   . ALA F 3 230 ? 23.673  -32.924 -0.379 1.00 51.67  ? 246 ALA F C   1 
ATOM   6778 O O   . ALA F 3 230 ? 23.528  -31.786 -0.834 1.00 51.36  ? 246 ALA F O   1 
ATOM   6779 C CB  . ALA F 3 230 ? 26.138  -32.574 -0.436 1.00 49.77  ? 246 ALA F CB  1 
ATOM   6780 N N   . ARG F 3 231 ? 22.689  -33.820 -0.338 1.00 54.02  ? 247 ARG F N   1 
ATOM   6781 C CA  . ARG F 3 231 ? 21.391  -33.565 -0.969 1.00 56.01  ? 247 ARG F CA  1 
ATOM   6782 C C   . ARG F 3 231 ? 20.655  -32.360 -0.377 1.00 55.70  ? 247 ARG F C   1 
ATOM   6783 O O   . ARG F 3 231 ? 20.847  -32.015 0.788  1.00 55.55  ? 247 ARG F O   1 
ATOM   6784 C CB  . ARG F 3 231 ? 20.523  -34.833 -0.940 1.00 57.70  ? 247 ARG F CB  1 
ATOM   6785 C CG  . ARG F 3 231 ? 21.095  -35.974 -1.795 1.00 61.73  ? 247 ARG F CG  1 
ATOM   6786 C CD  . ARG F 3 231 ? 20.767  -37.378 -1.284 1.00 66.72  ? 247 ARG F CD  1 
ATOM   6787 N NE  . ARG F 3 231 ? 21.817  -38.347 -1.626 1.00 70.18  ? 247 ARG F NE  1 
ATOM   6788 C CZ  . ARG F 3 231 ? 21.947  -39.557 -1.067 1.00 72.77  ? 247 ARG F CZ  1 
ATOM   6789 N NH1 . ARG F 3 231 ? 21.093  -39.979 -0.126 1.00 75.38  ? 247 ARG F NH1 1 
ATOM   6790 N NH2 . ARG F 3 231 ? 22.946  -40.352 -1.445 1.00 73.27  ? 247 ARG F NH2 1 
ATOM   6791 N N   . SER F 3 232 ? 19.846  -31.709 -1.211 1.00 56.48  ? 248 SER F N   1 
ATOM   6792 C CA  . SER F 3 232 ? 19.038  -30.541 -0.830 1.00 57.26  ? 248 SER F CA  1 
ATOM   6793 C C   . SER F 3 232 ? 19.803  -29.500 -0.007 1.00 57.03  ? 248 SER F C   1 
ATOM   6794 O O   . SER F 3 232 ? 19.559  -29.317 1.184  1.00 55.14  ? 248 SER F O   1 
ATOM   6795 C CB  . SER F 3 232 ? 17.765  -30.985 -0.100 1.00 58.12  ? 248 SER F CB  1 
ATOM   6796 O OG  . SER F 3 232 ? 17.387  -32.294 -0.498 1.00 58.64  ? 248 SER F OG  1 
ATOM   6797 N N   . THR F 3 233 ? 20.728  -28.816 -0.669 1.00 58.11  ? 249 THR F N   1 
ATOM   6798 C CA  . THR F 3 233 ? 21.557  -27.809 -0.026 1.00 59.16  ? 249 THR F CA  1 
ATOM   6799 C C   . THR F 3 233 ? 21.040  -26.402 -0.316 1.00 59.97  ? 249 THR F C   1 
ATOM   6800 O O   . THR F 3 233 ? 21.429  -25.448 0.358  1.00 61.48  ? 249 THR F O   1 
ATOM   6801 C CB  . THR F 3 233 ? 23.015  -27.932 -0.511 1.00 59.06  ? 249 THR F CB  1 
ATOM   6802 O OG1 . THR F 3 233 ? 23.478  -29.266 -0.302 1.00 60.49  ? 249 THR F OG1 1 
ATOM   6803 C CG2 . THR F 3 233 ? 23.932  -27.107 0.341  1.00 58.92  ? 249 THR F CG2 1 
ATOM   6804 N N   . TYR F 3 234 ? 20.167  -26.278 -1.317 1.00 60.84  ? 250 TYR F N   1 
ATOM   6805 C CA  . TYR F 3 234 ? 19.662  -24.974 -1.764 1.00 61.03  ? 250 TYR F CA  1 
ATOM   6806 C C   . TYR F 3 234 ? 18.118  -24.889 -1.725 1.00 62.79  ? 250 TYR F C   1 
ATOM   6807 O O   . TYR F 3 234 ? 17.423  -25.760 -1.178 1.00 64.37  ? 250 TYR F O   1 
ATOM   6808 C CB  . TYR F 3 234 ? 20.165  -24.675 -3.184 1.00 59.47  ? 250 TYR F CB  1 
ATOM   6809 C CG  . TYR F 3 234 ? 21.669  -24.565 -3.361 1.00 59.27  ? 250 TYR F CG  1 
ATOM   6810 C CD1 . TYR F 3 234 ? 22.474  -25.705 -3.425 1.00 59.64  ? 250 TYR F CD1 1 
ATOM   6811 C CD2 . TYR F 3 234 ? 22.284  -23.321 -3.502 1.00 59.35  ? 250 TYR F CD2 1 
ATOM   6812 C CE1 . TYR F 3 234 ? 23.857  -25.607 -3.599 1.00 59.08  ? 250 TYR F CE1 1 
ATOM   6813 C CE2 . TYR F 3 234 ? 23.666  -23.212 -3.686 1.00 59.42  ? 250 TYR F CE2 1 
ATOM   6814 C CZ  . TYR F 3 234 ? 24.445  -24.361 -3.732 1.00 59.42  ? 250 TYR F CZ  1 
ATOM   6815 O OH  . TYR F 3 234 ? 25.809  -24.266 -3.904 1.00 59.64  ? 250 TYR F OH  1 
HETATM 6816 C C1  . NAG G 4 .   ? 34.332  -27.136 62.042 1.00 76.91  ? 1   NAG G C1  1 
HETATM 6817 C C2  . NAG G 4 .   ? 34.449  -28.415 61.189 1.00 80.99  ? 1   NAG G C2  1 
HETATM 6818 C C3  . NAG G 4 .   ? 35.832  -28.528 60.559 1.00 80.70  ? 1   NAG G C3  1 
HETATM 6819 C C4  . NAG G 4 .   ? 36.223  -27.207 59.883 1.00 82.86  ? 1   NAG G C4  1 
HETATM 6820 C C5  . NAG G 4 .   ? 36.170  -26.033 60.866 1.00 82.03  ? 1   NAG G C5  1 
HETATM 6821 C C6  . NAG G 4 .   ? 36.462  -24.733 60.122 1.00 82.73  ? 1   NAG G C6  1 
HETATM 6822 C C7  . NAG G 4 .   ? 33.266  -30.554 61.592 1.00 82.25  ? 1   NAG G C7  1 
HETATM 6823 C C8  . NAG G 4 .   ? 32.501  -31.238 62.692 1.00 81.87  ? 1   NAG G C8  1 
HETATM 6824 N N2  . NAG G 4 .   ? 34.167  -29.624 61.967 1.00 81.46  ? 1   NAG G N2  1 
HETATM 6825 O O3  . NAG G 4 .   ? 35.792  -29.564 59.608 1.00 77.80  ? 1   NAG G O3  1 
HETATM 6826 O O4  . NAG G 4 .   ? 37.487  -27.240 59.231 1.00 86.92  ? 1   NAG G O4  1 
HETATM 6827 O O5  . NAG G 4 .   ? 34.888  -25.945 61.480 1.00 80.26  ? 1   NAG G O5  1 
HETATM 6828 O O6  . NAG G 4 .   ? 36.493  -23.660 61.042 1.00 86.94  ? 1   NAG G O6  1 
HETATM 6829 O O7  . NAG G 4 .   ? 33.037  -30.872 60.420 1.00 81.81  ? 1   NAG G O7  1 
HETATM 6830 C C1  . NAG G 4 .   ? 38.553  -27.954 59.905 1.00 88.41  ? 2   NAG G C1  1 
HETATM 6831 C C2  . NAG G 4 .   ? 38.793  -29.208 59.039 1.00 89.16  ? 2   NAG G C2  1 
HETATM 6832 C C3  . NAG G 4 .   ? 39.850  -29.017 57.945 1.00 87.73  ? 2   NAG G C3  1 
HETATM 6833 C C4  . NAG G 4 .   ? 40.112  -27.535 57.648 1.00 87.56  ? 2   NAG G C4  1 
HETATM 6834 C C5  . NAG G 4 .   ? 40.399  -26.676 58.891 1.00 87.59  ? 2   NAG G C5  1 
HETATM 6835 C C6  . NAG G 4 .   ? 40.088  -25.210 58.574 1.00 86.85  ? 2   NAG G C6  1 
HETATM 6836 C C7  . NAG G 4 .   ? 38.120  -31.422 59.932 1.00 93.21  ? 2   NAG G C7  1 
HETATM 6837 C C8  . NAG G 4 .   ? 38.263  -32.439 61.046 1.00 89.26  ? 2   NAG G C8  1 
HETATM 6838 N N2  . NAG G 4 .   ? 39.022  -30.411 59.858 1.00 91.67  ? 2   NAG G N2  1 
HETATM 6839 O O3  . NAG G 4 .   ? 39.361  -29.605 56.758 1.00 83.64  ? 2   NAG G O3  1 
HETATM 6840 O O4  . NAG G 4 .   ? 41.188  -27.421 56.740 1.00 88.43  ? 2   NAG G O4  1 
HETATM 6841 O O5  . NAG G 4 .   ? 39.699  -27.098 60.072 1.00 88.43  ? 2   NAG G O5  1 
HETATM 6842 O O6  . NAG G 4 .   ? 40.217  -24.434 59.748 1.00 87.56  ? 2   NAG G O6  1 
HETATM 6843 O O7  . NAG G 4 .   ? 37.179  -31.551 59.132 1.00 94.84  ? 2   NAG G O7  1 
HETATM 6844 C C1  . NAG H 5 .   ? 44.338  -30.166 20.107 1.00 59.66  ? 1   NAG H C1  1 
HETATM 6845 C C2  . NAG H 5 .   ? 44.812  -28.956 20.924 1.00 63.87  ? 1   NAG H C2  1 
HETATM 6846 C C3  . NAG H 5 .   ? 46.104  -29.219 21.731 1.00 65.50  ? 1   NAG H C3  1 
HETATM 6847 C C4  . NAG H 5 .   ? 45.973  -30.477 22.592 1.00 65.74  ? 1   NAG H C4  1 
HETATM 6848 C C5  . NAG H 5 .   ? 45.472  -31.633 21.701 1.00 63.69  ? 1   NAG H C5  1 
HETATM 6849 C C6  . NAG H 5 .   ? 45.096  -32.846 22.545 1.00 61.93  ? 1   NAG H C6  1 
HETATM 6850 C C7  . NAG H 5 .   ? 44.253  -26.754 20.072 1.00 68.64  ? 1   NAG H C7  1 
HETATM 6851 C C8  . NAG H 5 .   ? 44.539  -25.670 19.068 1.00 69.07  ? 1   NAG H C8  1 
HETATM 6852 N N2  . NAG H 5 .   ? 45.006  -27.855 20.001 1.00 65.12  ? 1   NAG H N2  1 
HETATM 6853 O O3  . NAG H 5 .   ? 46.515  -28.118 22.537 1.00 65.68  ? 1   NAG H O3  1 
HETATM 6854 O O4  . NAG H 5 .   ? 47.237  -30.748 23.208 1.00 68.20  ? 1   NAG H O4  1 
HETATM 6855 O O5  . NAG H 5 .   ? 44.310  -31.303 20.942 1.00 61.89  ? 1   NAG H O5  1 
HETATM 6856 O O6  . NAG H 5 .   ? 45.240  -34.002 21.756 1.00 61.80  ? 1   NAG H O6  1 
HETATM 6857 O O7  . NAG H 5 .   ? 43.358  -26.597 20.908 1.00 70.09  ? 1   NAG H O7  1 
HETATM 6858 C C1  . NAG H 5 .   ? 47.176  -31.437 24.496 1.00 68.55  ? 2   NAG H C1  1 
HETATM 6859 C C2  . NAG H 5 .   ? 48.425  -32.303 24.681 1.00 68.83  ? 2   NAG H C2  1 
HETATM 6860 C C3  . NAG H 5 .   ? 48.525  -32.913 26.093 1.00 71.81  ? 2   NAG H C3  1 
HETATM 6861 C C4  . NAG H 5 .   ? 48.070  -32.050 27.277 1.00 74.47  ? 2   NAG H C4  1 
HETATM 6862 C C5  . NAG H 5 .   ? 46.873  -31.159 26.888 1.00 72.75  ? 2   NAG H C5  1 
HETATM 6863 C C6  . NAG H 5 .   ? 46.655  -30.024 27.891 1.00 71.83  ? 2   NAG H C6  1 
HETATM 6864 C C7  . NAG H 5 .   ? 49.362  -33.646 22.803 1.00 68.88  ? 2   NAG H C7  1 
HETATM 6865 C C8  . NAG H 5 .   ? 49.178  -34.891 21.976 1.00 70.27  ? 2   NAG H C8  1 
HETATM 6866 N N2  . NAG H 5 .   ? 48.392  -33.366 23.685 1.00 68.29  ? 2   NAG H N2  1 
HETATM 6867 O O3  . NAG H 5 .   ? 49.844  -33.344 26.370 1.00 72.88  ? 2   NAG H O3  1 
HETATM 6868 O O4  . NAG H 5 .   ? 47.761  -32.975 28.322 1.00 79.71  ? 2   NAG H O4  1 
HETATM 6869 O O5  . NAG H 5 .   ? 47.030  -30.561 25.602 1.00 71.14  ? 2   NAG H O5  1 
HETATM 6870 O O6  . NAG H 5 .   ? 45.317  -29.571 27.844 1.00 69.14  ? 2   NAG H O6  1 
HETATM 6871 O O7  . NAG H 5 .   ? 50.370  -32.957 22.639 1.00 71.08  ? 2   NAG H O7  1 
HETATM 6872 C C1  . BMA H 5 .   ? 48.197  -32.745 29.705 1.00 85.49  ? 3   BMA H C1  1 
HETATM 6873 C C2  . BMA H 5 .   ? 49.696  -32.527 29.964 1.00 88.07  ? 3   BMA H C2  1 
HETATM 6874 C C3  . BMA H 5 .   ? 49.982  -32.511 31.484 1.00 89.70  ? 3   BMA H C3  1 
HETATM 6875 C C4  . BMA H 5 .   ? 48.975  -31.668 32.289 1.00 90.20  ? 3   BMA H C4  1 
HETATM 6876 C C5  . BMA H 5 .   ? 47.526  -31.925 31.843 1.00 90.32  ? 3   BMA H C5  1 
HETATM 6877 C C6  . BMA H 5 .   ? 46.546  -30.944 32.493 1.00 90.39  ? 3   BMA H C6  1 
HETATM 6878 O O2  . BMA H 5 .   ? 50.112  -31.313 29.373 1.00 88.98  ? 3   BMA H O2  1 
HETATM 6879 O O3  . BMA H 5 .   ? 51.295  -32.052 31.749 1.00 89.89  ? 3   BMA H O3  1 
HETATM 6880 O O4  . BMA H 5 .   ? 49.124  -31.898 33.680 1.00 88.40  ? 3   BMA H O4  1 
HETATM 6881 O O5  . BMA H 5 .   ? 47.418  -31.804 30.430 1.00 88.96  ? 3   BMA H O5  1 
HETATM 6882 O O6  . BMA H 5 .   ? 45.837  -31.589 33.529 1.00 90.65  ? 3   BMA H O6  1 
HETATM 6883 C C1  . NAG I 6 .   ? -5.577  -12.156 49.473 1.00 64.64  ? 93  NAG A C1  1 
HETATM 6884 C C2  . NAG I 6 .   ? -6.484  -12.570 50.643 1.00 67.22  ? 93  NAG A C2  1 
HETATM 6885 C C3  . NAG I 6 .   ? -7.401  -13.772 50.331 1.00 69.91  ? 93  NAG A C3  1 
HETATM 6886 C C4  . NAG I 6 .   ? -8.075  -13.624 48.959 1.00 70.98  ? 93  NAG A C4  1 
HETATM 6887 C C5  . NAG I 6 .   ? -7.003  -13.341 47.900 1.00 69.66  ? 93  NAG A C5  1 
HETATM 6888 C C6  . NAG I 6 .   ? -7.617  -13.072 46.532 1.00 71.11  ? 93  NAG A C6  1 
HETATM 6889 C C7  . NAG I 6 .   ? -5.732  -12.148 52.908 1.00 64.80  ? 93  NAG A C7  1 
HETATM 6890 C C8  . NAG I 6 .   ? -4.587  -12.298 53.870 1.00 64.52  ? 93  NAG A C8  1 
HETATM 6891 N N2  . NAG I 6 .   ? -5.654  -12.862 51.793 1.00 64.76  ? 93  NAG A N2  1 
HETATM 6892 O O3  . NAG I 6 .   ? -8.397  -13.916 51.332 1.00 70.12  ? 93  NAG A O3  1 
HETATM 6893 O O4  . NAG I 6 .   ? -8.887  -14.751 48.645 1.00 69.98  ? 93  NAG A O4  1 
HETATM 6894 O O5  . NAG I 6 .   ? -6.304  -12.158 48.251 1.00 68.50  ? 93  NAG A O5  1 
HETATM 6895 O O6  . NAG I 6 .   ? -6.600  -12.678 45.628 1.00 72.66  ? 93  NAG A O6  1 
HETATM 6896 O O7  . NAG I 6 .   ? -6.678  -11.402 53.163 1.00 67.26  ? 93  NAG A O7  1 
HETATM 6897 C C1  . NAG J 6 .   ? 34.931  12.701  60.011 1.00 59.06  ? 94  NAG A C1  1 
HETATM 6898 C C2  . NAG J 6 .   ? 36.117  13.400  60.699 1.00 61.30  ? 94  NAG A C2  1 
HETATM 6899 C C3  . NAG J 6 .   ? 36.030  14.921  60.522 1.00 63.10  ? 94  NAG A C3  1 
HETATM 6900 C C4  . NAG J 6 .   ? 35.908  15.327  59.051 1.00 65.45  ? 94  NAG A C4  1 
HETATM 6901 C C5  . NAG J 6 .   ? 34.811  14.496  58.366 1.00 65.43  ? 94  NAG A C5  1 
HETATM 6902 C C6  . NAG J 6 .   ? 34.842  14.730  56.851 1.00 67.25  ? 94  NAG A C6  1 
HETATM 6903 C C7  . NAG J 6 .   ? 37.155  12.269  62.647 1.00 61.85  ? 94  NAG A C7  1 
HETATM 6904 C C8  . NAG J 6 .   ? 36.928  11.764  64.042 1.00 63.41  ? 94  NAG A C8  1 
HETATM 6905 N N2  . NAG J 6 .   ? 36.213  13.071  62.118 1.00 61.31  ? 94  NAG A N2  1 
HETATM 6906 O O3  . NAG J 6 .   ? 37.155  15.559  61.087 1.00 63.29  ? 94  NAG A O3  1 
HETATM 6907 O O4  . NAG J 6 .   ? 35.651  16.729  58.937 1.00 64.50  ? 94  NAG A O4  1 
HETATM 6908 O O5  . NAG J 6 .   ? 34.978  13.106  58.645 1.00 62.65  ? 94  NAG A O5  1 
HETATM 6909 O O6  . NAG J 6 .   ? 33.923  13.899  56.171 1.00 69.22  ? 94  NAG A O6  1 
HETATM 6910 O O7  . NAG J 6 .   ? 38.184  11.926  62.073 1.00 62.80  ? 94  NAG A O7  1 
HETATM 6911 C C1  . NAG K 6 .   ? -9.187  10.749  46.975 1.00 76.97  ? 112 NAG B C1  1 
HETATM 6912 C C2  . NAG K 6 .   ? -9.057  11.772  48.113 1.00 82.42  ? 112 NAG B C2  1 
HETATM 6913 C C3  . NAG K 6 .   ? -10.437 12.136  48.692 1.00 83.39  ? 112 NAG B C3  1 
HETATM 6914 C C4  . NAG K 6 .   ? -11.490 12.394  47.593 1.00 83.94  ? 112 NAG B C4  1 
HETATM 6915 C C5  . NAG K 6 .   ? -11.504 11.326  46.486 1.00 83.46  ? 112 NAG B C5  1 
HETATM 6916 C C6  . NAG K 6 .   ? -12.382 11.814  45.320 1.00 83.62  ? 112 NAG B C6  1 
HETATM 6917 C C7  . NAG K 6 .   ? -7.315  11.920  49.902 1.00 84.63  ? 112 NAG B C7  1 
HETATM 6918 C C8  . NAG K 6 .   ? -6.901  11.251  51.190 1.00 82.07  ? 112 NAG B C8  1 
HETATM 6919 N N2  . NAG K 6 .   ? -8.170  11.217  49.137 1.00 83.31  ? 112 NAG B N2  1 
HETATM 6920 O O3  . NAG K 6 .   ? -10.342 13.260  49.562 1.00 82.26  ? 112 NAG B O3  1 
HETATM 6921 O O4  . NAG K 6 .   ? -12.788 12.521  48.148 1.00 84.02  ? 112 NAG B O4  1 
HETATM 6922 O O5  . NAG K 6 .   ? -10.176 11.107  46.014 1.00 82.00  ? 112 NAG B O5  1 
HETATM 6923 O O6  . NAG K 6 .   ? -12.557 10.828  44.317 1.00 84.55  ? 112 NAG B O6  1 
HETATM 6924 O O7  . NAG K 6 .   ? -6.875  13.044  49.608 1.00 85.15  ? 112 NAG B O7  1 
HETATM 6925 C C1  . NAG L 6 .   ? -9.474  8.925   39.302 1.00 73.70  ? 113 NAG B C1  1 
HETATM 6926 C C2  . NAG L 6 .   ? -10.073 8.773   37.898 1.00 78.76  ? 113 NAG B C2  1 
HETATM 6927 C C3  . NAG L 6 .   ? -9.091  9.294   36.830 1.00 80.31  ? 113 NAG B C3  1 
HETATM 6928 C C4  . NAG L 6 .   ? -8.393  10.619  37.180 1.00 79.89  ? 113 NAG B C4  1 
HETATM 6929 C C5  . NAG L 6 .   ? -8.156  10.854  38.683 1.00 78.38  ? 113 NAG B C5  1 
HETATM 6930 C C6  . NAG L 6 .   ? -7.966  12.356  38.945 1.00 76.10  ? 113 NAG B C6  1 
HETATM 6931 C C7  . NAG L 6 .   ? -11.560 7.012   37.034 1.00 83.04  ? 113 NAG B C7  1 
HETATM 6932 C C8  . NAG L 6 .   ? -11.911 5.550   37.102 1.00 80.60  ? 113 NAG B C8  1 
HETATM 6933 N N2  . NAG L 6 .   ? -10.419 7.380   37.639 1.00 80.62  ? 113 NAG B N2  1 
HETATM 6934 O O3  . NAG L 6 .   ? -9.751  9.480   35.586 1.00 81.75  ? 113 NAG B O3  1 
HETATM 6935 O O4  . NAG L 6 .   ? -7.153  10.658  36.492 1.00 79.60  ? 113 NAG B O4  1 
HETATM 6936 O O5  . NAG L 6 .   ? -9.231  10.323  39.465 1.00 77.84  ? 113 NAG B O5  1 
HETATM 6937 O O6  . NAG L 6 .   ? -8.362  12.705  40.271 1.00 77.18  ? 113 NAG B O6  1 
HETATM 6938 O O7  . NAG L 6 .   ? -12.311 7.802   36.440 1.00 85.14  ? 113 NAG B O7  1 
HETATM 6939 S S   . SO4 M 7 .   ? 3.643   4.128   39.224 1.00 81.17  ? 402 SO4 B S   1 
HETATM 6940 O O1  . SO4 M 7 .   ? 4.871   4.133   38.406 1.00 78.80  ? 402 SO4 B O1  1 
HETATM 6941 O O2  . SO4 M 7 .   ? 3.750   5.135   40.295 1.00 78.83  ? 402 SO4 B O2  1 
HETATM 6942 O O3  . SO4 M 7 .   ? 2.431   4.394   38.427 1.00 82.12  ? 402 SO4 B O3  1 
HETATM 6943 O O4  . SO4 M 7 .   ? 3.504   2.783   39.777 1.00 82.90  ? 402 SO4 B O4  1 
HETATM 6944 S S   . SO4 N 7 .   ? 22.068  5.760   67.309 1.00 84.19  ? 403 SO4 B S   1 
HETATM 6945 O O1  . SO4 N 7 .   ? 21.625  6.740   66.315 1.00 85.36  ? 403 SO4 B O1  1 
HETATM 6946 O O2  . SO4 N 7 .   ? 20.998  4.782   67.579 1.00 82.45  ? 403 SO4 B O2  1 
HETATM 6947 O O3  . SO4 N 7 .   ? 23.270  5.073   66.811 1.00 84.31  ? 403 SO4 B O3  1 
HETATM 6948 O O4  . SO4 N 7 .   ? 22.397  6.523   68.513 1.00 84.82  ? 403 SO4 B O4  1 
HETATM 6949 S S   . SO4 O 7 .   ? 16.160  4.157   39.884 1.00 85.19  ? 401 SO4 C S   1 
HETATM 6950 O O1  . SO4 O 7 .   ? 15.836  5.143   38.841 1.00 82.69  ? 401 SO4 C O1  1 
HETATM 6951 O O2  . SO4 O 7 .   ? 14.983  3.321   40.172 1.00 82.67  ? 401 SO4 C O2  1 
HETATM 6952 O O3  . SO4 O 7 .   ? 17.253  3.298   39.416 1.00 85.28  ? 401 SO4 C O3  1 
HETATM 6953 O O4  . SO4 O 7 .   ? 16.613  4.840   41.103 1.00 83.95  ? 401 SO4 C O4  1 
HETATM 6954 C C1  . NAG P 6 .   ? 35.772  -68.610 17.434 1.00 70.23  ? 93  NAG D C1  1 
HETATM 6955 C C2  . NAG P 6 .   ? 37.094  -69.281 17.006 1.00 72.16  ? 93  NAG D C2  1 
HETATM 6956 C C3  . NAG P 6 .   ? 36.888  -70.708 16.456 1.00 73.27  ? 93  NAG D C3  1 
HETATM 6957 C C4  . NAG P 6 .   ? 36.004  -71.555 17.383 1.00 72.62  ? 93  NAG D C4  1 
HETATM 6958 C C5  . NAG P 6 .   ? 34.696  -70.803 17.641 1.00 72.49  ? 93  NAG D C5  1 
HETATM 6959 C C6  . NAG P 6 .   ? 33.786  -71.592 18.579 1.00 73.15  ? 93  NAG D C6  1 
HETATM 6960 C C7  . NAG P 6 .   ? 39.067  -68.499 15.750 1.00 72.52  ? 93  NAG D C7  1 
HETATM 6961 C C8  . NAG P 6 .   ? 39.532  -67.868 14.473 1.00 73.41  ? 93  NAG D C8  1 
HETATM 6962 N N2  . NAG P 6 .   ? 37.756  -68.459 16.005 1.00 71.90  ? 93  NAG D N2  1 
HETATM 6963 O O3  . NAG P 6 .   ? 38.136  -71.338 16.204 1.00 74.12  ? 93  NAG D O3  1 
HETATM 6964 O O4  . NAG P 6 .   ? 35.743  -72.838 16.843 1.00 71.78  ? 93  NAG D O4  1 
HETATM 6965 O O5  . NAG P 6 .   ? 34.968  -69.517 18.206 1.00 73.61  ? 93  NAG D O5  1 
HETATM 6966 O O6  . NAG P 6 .   ? 32.552  -70.913 18.696 1.00 74.68  ? 93  NAG D O6  1 
HETATM 6967 O O7  . NAG P 6 .   ? 39.894  -69.016 16.497 1.00 75.40  ? 93  NAG D O7  1 
HETATM 6968 C C1  . NAG Q 6 .   ? -8.065  -56.063 10.003 1.00 88.27  ? 112 NAG E C1  1 
HETATM 6969 C C2  . NAG Q 6 .   ? -7.737  -56.594 8.594  1.00 89.75  ? 112 NAG E C2  1 
HETATM 6970 C C3  . NAG Q 6 .   ? -8.183  -55.557 7.546  1.00 89.13  ? 112 NAG E C3  1 
HETATM 6971 C C4  . NAG Q 6 .   ? -9.670  -55.246 7.727  1.00 89.31  ? 112 NAG E C4  1 
HETATM 6972 C C5  . NAG Q 6 .   ? -9.903  -54.740 9.154  1.00 90.31  ? 112 NAG E C5  1 
HETATM 6973 C C6  . NAG Q 6 .   ? -11.378 -54.375 9.364  1.00 89.48  ? 112 NAG E C6  1 
HETATM 6974 C C7  . NAG Q 6 .   ? -5.814  -58.040 7.908  1.00 92.22  ? 112 NAG E C7  1 
HETATM 6975 C C8  . NAG Q 6 .   ? -4.423  -58.438 8.341  1.00 90.15  ? 112 NAG E C8  1 
HETATM 6976 N N2  . NAG Q 6 .   ? -6.317  -56.928 8.484  1.00 90.67  ? 112 NAG E N2  1 
HETATM 6977 O O3  . NAG Q 6 .   ? -7.963  -56.013 6.228  1.00 90.01  ? 112 NAG E O3  1 
HETATM 6978 O O4  . NAG Q 6 .   ? -10.081 -54.274 6.784  1.00 90.75  ? 112 NAG E O4  1 
HETATM 6979 O O5  . NAG Q 6 .   ? -9.461  -55.747 10.080 1.00 90.97  ? 112 NAG E O5  1 
HETATM 6980 O O6  . NAG Q 6 .   ? -11.549 -53.561 10.511 1.00 88.78  ? 112 NAG E O6  1 
HETATM 6981 O O7  . NAG Q 6 .   ? -6.407  -58.726 7.065  1.00 93.86  ? 112 NAG E O7  1 
HETATM 6982 O O   . HOH R 8 .   ? 23.626  6.295   44.000 1.00 19.94  ? 95  HOH A O   1 
HETATM 6983 O O   . HOH R 8 .   ? 14.462  -6.655  58.631 1.00 30.43  ? 96  HOH A O   1 
HETATM 6984 O O   . HOH R 8 .   ? 14.419  -1.207  50.628 1.00 37.51  ? 97  HOH A O   1 
HETATM 6985 O O   . HOH R 8 .   ? 5.226   -7.024  43.834 1.00 43.26  ? 98  HOH A O   1 
HETATM 6986 O O   . HOH S 8 .   ? 5.025   13.132  53.520 1.00 33.29  ? 404 HOH B O   1 
HETATM 6987 O O   . HOH S 8 .   ? -4.415  -5.821  42.169 1.00 36.64  ? 405 HOH B O   1 
HETATM 6988 O O   . HOH S 8 .   ? 18.951  4.274   72.819 1.00 38.25  ? 406 HOH B O   1 
HETATM 6989 O O   . HOH S 8 .   ? 7.490   -10.130 52.443 1.00 26.42  ? 407 HOH B O   1 
HETATM 6990 O O   . HOH S 8 .   ? 3.348   -3.806  55.628 1.00 20.30  ? 408 HOH B O   1 
HETATM 6991 O O   . HOH S 8 .   ? 31.008  -1.451  66.633 1.00 40.99  ? 409 HOH B O   1 
HETATM 6992 O O   . HOH T 8 .   ? 11.929  -7.358  70.331 1.00 25.17  ? 402 HOH C O   1 
HETATM 6993 O O   . HOH T 8 .   ? 21.225  -11.320 80.445 1.00 26.00  ? 403 HOH C O   1 
HETATM 6994 O O   . HOH T 8 .   ? 11.882  -16.613 34.299 1.00 36.32  ? 404 HOH C O   1 
HETATM 6995 O O   . HOH T 8 .   ? 12.698  -28.444 71.359 1.00 30.11  ? 405 HOH C O   1 
HETATM 6996 O O   . HOH T 8 .   ? 8.570   -27.804 57.129 1.00 52.02  ? 406 HOH C O   1 
HETATM 6997 O O   . HOH T 8 .   ? 27.793  -25.355 31.762 1.00 37.28  ? 407 HOH C O   1 
HETATM 6998 O O   . HOH T 8 .   ? 28.191  -21.930 45.151 1.00 56.26  ? 408 HOH C O   1 
HETATM 6999 O O   . HOH T 8 .   ? 16.204  -8.150  54.094 1.00 35.01  ? 409 HOH C O   1 
HETATM 7000 O O   . HOH T 8 .   ? 26.061  -5.545  20.796 1.00 64.09  ? 410 HOH C O   1 
HETATM 7001 O O   . HOH T 8 .   ? 23.542  -4.414  20.903 1.00 51.50  ? 411 HOH C O   1 
HETATM 7002 O O   . HOH T 8 .   ? 27.007  -6.378  56.912 1.00 56.51  ? 412 HOH C O   1 
HETATM 7003 O O   . HOH T 8 .   ? 17.185  -13.560 85.749 1.00 34.79  ? 413 HOH C O   1 
HETATM 7004 O O   . HOH T 8 .   ? 23.801  -21.092 29.031 1.00 39.11  ? 414 HOH C O   1 
HETATM 7005 O O   . HOH U 8 .   ? 4.193   -56.829 20.313 1.00 45.73  ? 94  HOH D O   1 
HETATM 7006 O O   . HOH U 8 .   ? 34.969  -54.191 17.789 1.00 56.40  ? 95  HOH D O   1 
HETATM 7007 O O   . HOH V 8 .   ? -6.843  -34.771 20.460 1.00 47.25  ? 113 HOH E O   1 
HETATM 7008 O O   . HOH V 8 .   ? 14.515  -40.110 4.972  1.00 43.98  ? 114 HOH E O   1 
HETATM 7009 O O   . HOH V 8 .   ? 14.248  -39.084 7.368  1.00 44.83  ? 115 HOH E O   1 
HETATM 7010 O O   . HOH V 8 .   ? -16.599 -37.900 25.232 1.00 50.32  ? 116 HOH E O   1 
HETATM 7011 O O   . HOH W 8 .   ? 13.966  -45.138 24.259 1.00 25.67  ? 272 HOH F O   1 
HETATM 7012 O O   . HOH W 8 .   ? 37.624  -38.164 21.827 1.00 25.73  ? 273 HOH F O   1 
HETATM 7013 O O   . HOH W 8 .   ? 12.415  -32.677 30.514 1.00 51.28  ? 274 HOH F O   1 
HETATM 7014 O O   . HOH W 8 .   ? 10.435  -35.874 34.450 1.00 41.43  ? 275 HOH F O   1 
HETATM 7015 O O   . HOH W 8 .   ? 21.215  -46.246 44.624 1.00 51.91  ? 276 HOH F O   1 
HETATM 7016 O O   . HOH W 8 .   ? 39.641  -44.716 31.347 1.00 22.93  ? 277 HOH F O   1 
HETATM 7017 O O   . HOH W 8 .   ? 29.810  -50.125 35.617 1.00 39.42  ? 278 HOH F O   1 
HETATM 7018 O O   . HOH W 8 .   ? 12.698  -54.850 34.307 1.00 39.14  ? 279 HOH F O   1 
HETATM 7019 O O   . HOH W 8 .   ? 23.029  -57.010 45.881 1.00 41.21  ? 280 HOH F O   1 
HETATM 7020 O O   . HOH W 8 .   ? 27.840  -30.283 29.750 1.00 30.21  ? 281 HOH F O   1 
HETATM 7021 O O   . HOH W 8 .   ? 6.850   -52.323 43.548 1.00 36.74  ? 282 HOH F O   1 
HETATM 7022 O O   . HOH W 8 .   ? 28.980  -40.302 -1.451 1.00 50.22  ? 283 HOH F O   1 
HETATM 7023 O O   . HOH W 8 .   ? 35.670  -50.592 20.573 1.00 30.76  ? 284 HOH F O   1 
HETATM 7024 O O   . HOH W 8 .   ? 13.245  -51.829 51.258 1.00 46.12  ? 285 HOH F O   1 
HETATM 7025 O O   . HOH W 8 .   ? 23.248  -52.725 23.637 1.00 38.73  ? 286 HOH F O   1 
HETATM 7026 O O   . HOH W 8 .   ? 11.274  -61.365 39.318 1.00 35.83  ? 287 HOH F O   1 
HETATM 7027 O O   . HOH W 8 .   ? 24.632  -23.942 21.497 1.00 38.56  ? 288 HOH F O   1 
HETATM 7028 O O   . HOH W 8 .   ? 20.749  -54.830 30.478 1.00 38.52  ? 289 HOH F O   1 
HETATM 7029 O O   . HOH W 8 .   ? 40.590  -38.362 22.483 1.00 46.94  ? 290 HOH F O   1 
HETATM 7030 O O   . HOH W 8 .   ? 25.129  -29.771 28.192 1.00 33.48  ? 291 HOH F O   1 
HETATM 7031 O O   . HOH W 8 .   ? 13.327  -62.235 37.852 1.00 46.82  ? 292 HOH F O   1 
# 
loop_
_database_PDB_caveat.id 
_database_PDB_caveat.text 
1 'NAG B 113 HAS WRONG CHIRALITY AT ATOM C1' 
2 'NAG E 112 HAS WRONG CHIRALITY AT ATOM C1' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   ?   ?   ?   A . n 
A 1 3   ASP 3   3   3   ASP ASP A . n 
A 1 4   VAL 4   4   4   VAL VAL A . n 
A 1 5   GLN 5   5   5   GLN GLN A . n 
A 1 6   ASP 6   6   6   ASP ASP A . n 
A 1 7   CYS 7   7   7   CYS CYS A . n 
A 1 8   PRO 8   8   8   PRO PRO A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  CYS 10  10  10  CYS CYS A . n 
A 1 11  THR 11  11  11  THR THR A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  GLN 13  13  13  GLN GLN A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  ASN 15  15  15  ASN ASN A . n 
A 1 16  PRO 16  16  16  PRO PRO A . n 
A 1 17  PHE 17  17  17  PHE PHE A . n 
A 1 18  PHE 18  18  18  PHE PHE A . n 
A 1 19  SER 19  19  19  SER SER A . n 
A 1 20  GLN 20  20  20  GLN GLN A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  ALA 23  23  23  ALA ALA A . n 
A 1 24  PRO 24  24  24  PRO PRO A . n 
A 1 25  ILE 25  25  25  ILE ILE A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  GLN 27  27  27  GLN GLN A . n 
A 1 28  CYS 28  28  28  CYS CYS A . n 
A 1 29  MET 29  29  29  MET MET A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  CYS 31  31  31  CYS CYS A . n 
A 1 32  CYS 32  32  32  CYS CYS A . n 
A 1 33  PHE 33  33  33  PHE PHE A . n 
A 1 34  SER 34  34  34  SER SER A . n 
A 1 35  ARG 35  35  35  ARG ARG A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  TYR 37  37  37  TYR TYR A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  THR 39  39  39  THR THR A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  ARG 42  42  42  ARG ARG A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  THR 46  46  46  THR THR A . n 
A 1 47  MET 47  47  47  MET MET A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  GLN 50  50  50  GLN GLN A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  ASN 52  52  52  ASN ASN A . n 
A 1 53  VAL 53  53  53  VAL VAL A . n 
A 1 54  THR 54  54  54  THR THR A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLU 56  56  56  GLU GLU A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  CYS 59  59  59  CYS CYS A . n 
A 1 60  CYS 60  60  60  CYS CYS A . n 
A 1 61  VAL 61  61  61  VAL VAL A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  TYR 65  65  65  TYR TYR A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  ARG 67  67  67  ARG ARG A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  MET 71  71  71  MET MET A . n 
A 1 72  GLY 72  72  72  GLY GLY A . n 
A 1 73  GLY 73  73  73  GLY GLY A . n 
A 1 74  PHE 74  74  74  PHE PHE A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  VAL 76  76  76  VAL VAL A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  ASN 78  78  78  ASN ASN A . n 
A 1 79  HIS 79  79  79  HIS HIS A . n 
A 1 80  THR 80  80  80  THR THR A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  CYS 82  82  82  CYS CYS A . n 
A 1 83  HIS 83  83  83  HIS HIS A . n 
A 1 84  CYS 84  84  84  CYS CYS A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  THR 86  86  86  THR THR A . n 
A 1 87  CYS 87  87  87  CYS CYS A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  TYR 89  89  89  TYR TYR A . n 
A 1 90  HIS 90  90  90  HIS HIS A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  SER 92  92  92  SER SER A . n 
B 2 1   ASN 1   1   ?   ?   ?   B . n 
B 2 2   SER 2   2   ?   ?   ?   B . n 
B 2 3   CYS 3   3   3   CYS CYS B . n 
B 2 4   GLU 4   4   4   GLU GLU B . n 
B 2 5   LEU 5   5   5   LEU LEU B . n 
B 2 6   THR 6   6   6   THR THR B . n 
B 2 7   ASN 7   7   7   ASN ASN B . n 
B 2 8   ILE 8   8   8   ILE ILE B . n 
B 2 9   THR 9   9   9   THR THR B . n 
B 2 10  ILE 10  10  10  ILE ILE B . n 
B 2 11  ALA 11  11  11  ALA ALA B . n 
B 2 12  ILE 12  12  12  ILE ILE B . n 
B 2 13  GLU 13  13  13  GLU GLU B . n 
B 2 14  LYS 14  14  14  LYS LYS B . n 
B 2 15  GLU 15  15  15  GLU GLU B . n 
B 2 16  GLU 16  16  16  GLU GLU B . n 
B 2 17  CYS 17  17  17  CYS CYS B . n 
B 2 18  ARG 18  18  18  ARG ARG B . n 
B 2 19  PHE 19  19  19  PHE PHE B . n 
B 2 20  CYS 20  20  20  CYS CYS B . n 
B 2 21  ILE 21  21  21  ILE ILE B . n 
B 2 22  SER 22  22  22  SER SER B . n 
B 2 23  ILE 23  23  23  ILE ILE B . n 
B 2 24  ASN 24  24  24  ASN ASN B . n 
B 2 25  THR 25  25  25  THR THR B . n 
B 2 26  THR 26  26  26  THR THR B . n 
B 2 27  TRP 27  27  27  TRP TRP B . n 
B 2 28  CYS 28  28  28  CYS CYS B . n 
B 2 29  ALA 29  29  29  ALA ALA B . n 
B 2 30  GLY 30  30  30  GLY GLY B . n 
B 2 31  TYR 31  31  31  TYR TYR B . n 
B 2 32  CYS 32  32  32  CYS CYS B . n 
B 2 33  TYR 33  33  33  TYR TYR B . n 
B 2 34  THR 34  34  34  THR THR B . n 
B 2 35  ARG 35  35  35  ARG ARG B . n 
B 2 36  ASP 36  36  36  ASP ASP B . n 
B 2 37  LEU 37  37  37  LEU LEU B . n 
B 2 38  VAL 38  38  38  VAL VAL B . n 
B 2 39  TYR 39  39  39  TYR TYR B . n 
B 2 40  LYS 40  40  40  LYS LYS B . n 
B 2 41  ASP 41  41  41  ASP ASP B . n 
B 2 42  PRO 42  42  42  PRO PRO B . n 
B 2 43  ALA 43  43  43  ALA ALA B . n 
B 2 44  ARG 44  44  44  ARG ARG B . n 
B 2 45  PRO 45  45  45  PRO PRO B . n 
B 2 46  LYS 46  46  46  LYS LYS B . n 
B 2 47  ILE 47  47  47  ILE ILE B . n 
B 2 48  GLN 48  48  48  GLN GLN B . n 
B 2 49  LYS 49  49  49  LYS LYS B . n 
B 2 50  THR 50  50  50  THR THR B . n 
B 2 51  CYS 51  51  51  CYS CYS B . n 
B 2 52  THR 52  52  52  THR THR B . n 
B 2 53  PHE 53  53  53  PHE PHE B . n 
B 2 54  LYS 54  54  54  LYS LYS B . n 
B 2 55  GLU 55  55  55  GLU GLU B . n 
B 2 56  LEU 56  56  56  LEU LEU B . n 
B 2 57  VAL 57  57  57  VAL VAL B . n 
B 2 58  TYR 58  58  58  TYR TYR B . n 
B 2 59  GLU 59  59  59  GLU GLU B . n 
B 2 60  THR 60  60  60  THR THR B . n 
B 2 61  VAL 61  61  61  VAL VAL B . n 
B 2 62  ARG 62  62  62  ARG ARG B . n 
B 2 63  VAL 63  63  63  VAL VAL B . n 
B 2 64  PRO 64  64  64  PRO PRO B . n 
B 2 65  GLY 65  65  65  GLY GLY B . n 
B 2 66  CYS 66  66  66  CYS CYS B . n 
B 2 67  ALA 67  67  67  ALA ALA B . n 
B 2 68  HIS 68  68  68  HIS HIS B . n 
B 2 69  HIS 69  69  69  HIS HIS B . n 
B 2 70  ALA 70  70  70  ALA ALA B . n 
B 2 71  ASP 71  71  71  ASP ASP B . n 
B 2 72  SER 72  72  72  SER SER B . n 
B 2 73  LEU 73  73  73  LEU LEU B . n 
B 2 74  TYR 74  74  74  TYR TYR B . n 
B 2 75  THR 75  75  75  THR THR B . n 
B 2 76  TYR 76  76  76  TYR TYR B . n 
B 2 77  PRO 77  77  77  PRO PRO B . n 
B 2 78  VAL 78  78  78  VAL VAL B . n 
B 2 79  ALA 79  79  79  ALA ALA B . n 
B 2 80  THR 80  80  80  THR THR B . n 
B 2 81  GLN 81  81  81  GLN GLN B . n 
B 2 82  CYS 82  82  82  CYS CYS B . n 
B 2 83  HIS 83  83  83  HIS HIS B . n 
B 2 84  CYS 84  84  84  CYS CYS B . n 
B 2 85  GLY 85  85  85  GLY GLY B . n 
B 2 86  LYS 86  86  86  LYS LYS B . n 
B 2 87  CYS 87  87  87  CYS CYS B . n 
B 2 88  ASP 88  88  88  ASP ASP B . n 
B 2 89  SER 89  89  89  SER SER B . n 
B 2 90  ASP 90  90  90  ASP ASP B . n 
B 2 91  SER 91  91  91  SER SER B . n 
B 2 92  THR 92  92  92  THR THR B . n 
B 2 93  ASP 93  93  93  ASP ASP B . n 
B 2 94  CYS 94  94  94  CYS CYS B . n 
B 2 95  THR 95  95  95  THR THR B . n 
B 2 96  VAL 96  96  96  VAL VAL B . n 
B 2 97  ARG 97  97  97  ARG ARG B . n 
B 2 98  GLY 98  98  98  GLY GLY B . n 
B 2 99  LEU 99  99  99  LEU LEU B . n 
B 2 100 GLY 100 100 100 GLY GLY B . n 
B 2 101 PRO 101 101 101 PRO PRO B . n 
B 2 102 SER 102 102 102 SER SER B . n 
B 2 103 TYR 103 103 103 TYR TYR B . n 
B 2 104 CYS 104 104 104 CYS CYS B . n 
B 2 105 SER 105 105 105 SER SER B . n 
B 2 106 PHE 106 106 106 PHE PHE B . n 
B 2 107 GLY 107 107 107 GLY GLY B . n 
B 2 108 GLU 108 108 ?   ?   ?   B . n 
B 2 109 MET 109 109 ?   ?   ?   B . n 
B 2 110 LYS 110 110 ?   ?   ?   B . n 
B 2 111 GLU 111 111 ?   ?   ?   B . n 
C 3 1   GLY 1   17  ?   ?   ?   C . n 
C 3 2   CYS 2   18  18  CYS CYS C . n 
C 3 3   HIS 3   19  19  HIS HIS C . n 
C 3 4   HIS 4   20  20  HIS HIS C . n 
C 3 5   ARG 5   21  21  ARG ARG C . n 
C 3 6   ILE 6   22  22  ILE ILE C . n 
C 3 7   CYS 7   23  23  CYS CYS C . n 
C 3 8   HIS 8   24  24  HIS HIS C . n 
C 3 9   CYS 9   25  25  CYS CYS C . n 
C 3 10  SER 10  26  26  SER SER C . n 
C 3 11  ASN 11  27  27  ASN ASN C . n 
C 3 12  ARG 12  28  28  ARG ARG C . n 
C 3 13  VAL 13  29  29  VAL VAL C . n 
C 3 14  PHE 14  30  30  PHE PHE C . n 
C 3 15  LEU 15  31  31  LEU LEU C . n 
C 3 16  CYS 16  32  32  CYS CYS C . n 
C 3 17  GLN 17  33  33  GLN GLN C . n 
C 3 18  GLU 18  34  34  GLU GLU C . n 
C 3 19  SER 19  35  35  SER SER C . n 
C 3 20  LYS 20  36  36  LYS LYS C . n 
C 3 21  VAL 21  37  37  VAL VAL C . n 
C 3 22  THR 22  38  38  THR THR C . n 
C 3 23  GLU 23  39  39  GLU GLU C . n 
C 3 24  ILE 24  40  40  ILE ILE C . n 
C 3 25  PRO 25  41  41  PRO PRO C . n 
C 3 26  SER 26  42  42  SER SER C . n 
C 3 27  ASP 27  43  43  ASP ASP C . n 
C 3 28  LEU 28  44  44  LEU LEU C . n 
C 3 29  PRO 29  45  45  PRO PRO C . n 
C 3 30  ARG 30  46  46  ARG ARG C . n 
C 3 31  ASN 31  47  47  ASN ASN C . n 
C 3 32  ALA 32  48  48  ALA ALA C . n 
C 3 33  ILE 33  49  49  ILE ILE C . n 
C 3 34  GLU 34  50  50  GLU GLU C . n 
C 3 35  LEU 35  51  51  LEU LEU C . n 
C 3 36  ARG 36  52  52  ARG ARG C . n 
C 3 37  PHE 37  53  53  PHE PHE C . n 
C 3 38  VAL 38  54  54  VAL VAL C . n 
C 3 39  LEU 39  55  55  LEU LEU C . n 
C 3 40  THR 40  56  56  THR THR C . n 
C 3 41  LYS 41  57  57  LYS LYS C . n 
C 3 42  LEU 42  58  58  LEU LEU C . n 
C 3 43  ARG 43  59  59  ARG ARG C . n 
C 3 44  VAL 44  60  60  VAL VAL C . n 
C 3 45  ILE 45  61  61  ILE ILE C . n 
C 3 46  GLN 46  62  62  GLN GLN C . n 
C 3 47  LYS 47  63  63  LYS LYS C . n 
C 3 48  GLY 48  64  64  GLY GLY C . n 
C 3 49  ALA 49  65  65  ALA ALA C . n 
C 3 50  PHE 50  66  66  PHE PHE C . n 
C 3 51  SER 51  67  67  SER SER C . n 
C 3 52  GLY 52  68  68  GLY GLY C . n 
C 3 53  PHE 53  69  69  PHE PHE C . n 
C 3 54  GLY 54  70  70  GLY GLY C . n 
C 3 55  ASP 55  71  71  ASP ASP C . n 
C 3 56  LEU 56  72  72  LEU LEU C . n 
C 3 57  GLU 57  73  73  GLU GLU C . n 
C 3 58  LYS 58  74  74  LYS LYS C . n 
C 3 59  ILE 59  75  75  ILE ILE C . n 
C 3 60  GLU 60  76  76  GLU GLU C . n 
C 3 61  ILE 61  77  77  ILE ILE C . n 
C 3 62  SER 62  78  78  SER SER C . n 
C 3 63  GLN 63  79  79  GLN GLN C . n 
C 3 64  ASN 64  80  80  ASN ASN C . n 
C 3 65  ASP 65  81  81  ASP ASP C . n 
C 3 66  VAL 66  82  82  VAL VAL C . n 
C 3 67  LEU 67  83  83  LEU LEU C . n 
C 3 68  GLU 68  84  84  GLU GLU C . n 
C 3 69  VAL 69  85  85  VAL VAL C . n 
C 3 70  ILE 70  86  86  ILE ILE C . n 
C 3 71  GLU 71  87  87  GLU GLU C . n 
C 3 72  ALA 72  88  88  ALA ALA C . n 
C 3 73  ASP 73  89  89  ASP ASP C . n 
C 3 74  VAL 74  90  90  VAL VAL C . n 
C 3 75  PHE 75  91  91  PHE PHE C . n 
C 3 76  SER 76  92  92  SER SER C . n 
C 3 77  ASN 77  93  93  ASN ASN C . n 
C 3 78  LEU 78  94  94  LEU LEU C . n 
C 3 79  PRO 79  95  95  PRO PRO C . n 
C 3 80  LYS 80  96  96  LYS LYS C . n 
C 3 81  LEU 81  97  97  LEU LEU C . n 
C 3 82  HIS 82  98  98  HIS HIS C . n 
C 3 83  GLU 83  99  99  GLU GLU C . n 
C 3 84  ILE 84  100 100 ILE ILE C . n 
C 3 85  ARG 85  101 101 ARG ARG C . n 
C 3 86  ILE 86  102 102 ILE ILE C . n 
C 3 87  GLU 87  103 103 GLU GLU C . n 
C 3 88  LYS 88  104 104 LYS LYS C . n 
C 3 89  ALA 89  105 105 ALA ALA C . n 
C 3 90  ASN 90  106 106 ASN ASN C . n 
C 3 91  ASN 91  107 107 ASN ASN C . n 
C 3 92  LEU 92  108 108 LEU LEU C . n 
C 3 93  LEU 93  109 109 LEU LEU C . n 
C 3 94  TYR 94  110 110 TYR TYR C . n 
C 3 95  ILE 95  111 111 ILE ILE C . n 
C 3 96  ASN 96  112 112 ASN ASN C . n 
C 3 97  PRO 97  113 113 PRO PRO C . n 
C 3 98  GLU 98  114 114 GLU GLU C . n 
C 3 99  ALA 99  115 115 ALA ALA C . n 
C 3 100 PHE 100 116 116 PHE PHE C . n 
C 3 101 GLN 101 117 117 GLN GLN C . n 
C 3 102 ASN 102 118 118 ASN ASN C . n 
C 3 103 LEU 103 119 119 LEU LEU C . n 
C 3 104 PRO 104 120 120 PRO PRO C . n 
C 3 105 ASN 105 121 121 ASN ASN C . n 
C 3 106 LEU 106 122 122 LEU LEU C . n 
C 3 107 GLN 107 123 123 GLN GLN C . n 
C 3 108 TYR 108 124 124 TYR TYR C . n 
C 3 109 LEU 109 125 125 LEU LEU C . n 
C 3 110 LEU 110 126 126 LEU LEU C . n 
C 3 111 ILE 111 127 127 ILE ILE C . n 
C 3 112 SER 112 128 128 SER SER C . n 
C 3 113 ASN 113 129 129 ASN ASN C . n 
C 3 114 THR 114 130 130 THR THR C . n 
C 3 115 GLY 115 131 131 GLY GLY C . n 
C 3 116 ILE 116 132 132 ILE ILE C . n 
C 3 117 LYS 117 133 133 LYS LYS C . n 
C 3 118 HIS 118 134 134 HIS HIS C . n 
C 3 119 LEU 119 135 135 LEU LEU C . n 
C 3 120 PRO 120 136 136 PRO PRO C . n 
C 3 121 ASP 121 137 137 ASP ASP C . n 
C 3 122 VAL 122 138 138 VAL VAL C . n 
C 3 123 HIS 123 139 139 HIS HIS C . n 
C 3 124 LYS 124 140 140 LYS LYS C . n 
C 3 125 ILE 125 141 141 ILE ILE C . n 
C 3 126 HIS 126 142 142 HIS HIS C . n 
C 3 127 SER 127 143 143 SER SER C . n 
C 3 128 LEU 128 144 144 LEU LEU C . n 
C 3 129 GLN 129 145 145 GLN GLN C . n 
C 3 130 LYS 130 146 146 LYS LYS C . n 
C 3 131 VAL 131 147 147 VAL VAL C . n 
C 3 132 LEU 132 148 148 LEU LEU C . n 
C 3 133 LEU 133 149 149 LEU LEU C . n 
C 3 134 ASP 134 150 150 ASP ASP C . n 
C 3 135 ILE 135 151 151 ILE ILE C . n 
C 3 136 GLN 136 152 152 GLN GLN C . n 
C 3 137 ASP 137 153 153 ASP ASP C . n 
C 3 138 ASN 138 154 154 ASN ASN C . n 
C 3 139 ILE 139 155 155 ILE ILE C . n 
C 3 140 ASN 140 156 156 ASN ASN C . n 
C 3 141 ILE 141 157 157 ILE ILE C . n 
C 3 142 HIS 142 158 158 HIS HIS C . n 
C 3 143 THR 143 159 159 THR THR C . n 
C 3 144 ILE 144 160 160 ILE ILE C . n 
C 3 145 GLU 145 161 161 GLU GLU C . n 
C 3 146 ARG 146 162 162 ARG ARG C . n 
C 3 147 ASN 147 163 163 ASN ASN C . n 
C 3 148 SER 148 164 164 SER SER C . n 
C 3 149 PHE 149 165 165 PHE PHE C . n 
C 3 150 VAL 150 166 166 VAL VAL C . n 
C 3 151 GLY 151 167 167 GLY GLY C . n 
C 3 152 LEU 152 168 168 LEU LEU C . n 
C 3 153 SER 153 169 169 SER SER C . n 
C 3 154 PHE 154 170 170 PHE PHE C . n 
C 3 155 GLU 155 171 171 GLU GLU C . n 
C 3 156 SER 156 172 172 SER SER C . n 
C 3 157 VAL 157 173 173 VAL VAL C . n 
C 3 158 ILE 158 174 174 ILE ILE C . n 
C 3 159 LEU 159 175 175 LEU LEU C . n 
C 3 160 TRP 160 176 176 TRP TRP C . n 
C 3 161 LEU 161 177 177 LEU LEU C . n 
C 3 162 ASN 162 178 178 ASN ASN C . n 
C 3 163 LYS 163 179 179 LYS LYS C . n 
C 3 164 ASN 164 180 180 ASN ASN C . n 
C 3 165 GLY 165 181 181 GLY GLY C . n 
C 3 166 ILE 166 182 182 ILE ILE C . n 
C 3 167 GLN 167 183 183 GLN GLN C . n 
C 3 168 GLU 168 184 184 GLU GLU C . n 
C 3 169 ILE 169 185 185 ILE ILE C . n 
C 3 170 HIS 170 186 186 HIS HIS C . n 
C 3 171 ASN 171 187 187 ASN ASN C . n 
C 3 172 CYS 172 188 188 CYS CYS C . n 
C 3 173 ALA 173 189 189 ALA ALA C . n 
C 3 174 PHE 174 190 190 PHE PHE C . n 
C 3 175 ASN 175 191 191 ASN ASN C . n 
C 3 176 GLY 176 192 192 GLY GLY C . n 
C 3 177 THR 177 193 193 THR THR C . n 
C 3 178 GLN 178 194 194 GLN GLN C . n 
C 3 179 LEU 179 195 195 LEU LEU C . n 
C 3 180 ASP 180 196 196 ASP ASP C . n 
C 3 181 GLU 181 197 197 GLU GLU C . n 
C 3 182 LEU 182 198 198 LEU LEU C . n 
C 3 183 ASN 183 199 199 ASN ASN C . n 
C 3 184 LEU 184 200 200 LEU LEU C . n 
C 3 185 SER 185 201 201 SER SER C . n 
C 3 186 ASP 186 202 202 ASP ASP C . n 
C 3 187 ASN 187 203 203 ASN ASN C . n 
C 3 188 ASN 188 204 204 ASN ASN C . n 
C 3 189 ASN 189 205 205 ASN ASN C . n 
C 3 190 LEU 190 206 206 LEU LEU C . n 
C 3 191 GLU 191 207 207 GLU GLU C . n 
C 3 192 GLU 192 208 208 GLU GLU C . n 
C 3 193 LEU 193 209 209 LEU LEU C . n 
C 3 194 PRO 194 210 210 PRO PRO C . n 
C 3 195 ASN 195 211 211 ASN ASN C . n 
C 3 196 ASP 196 212 212 ASP ASP C . n 
C 3 197 VAL 197 213 213 VAL VAL C . n 
C 3 198 PHE 198 214 214 PHE PHE C . n 
C 3 199 HIS 199 215 215 HIS HIS C . n 
C 3 200 GLY 200 216 216 GLY GLY C . n 
C 3 201 ALA 201 217 217 ALA ALA C . n 
C 3 202 SER 202 218 218 SER SER C . n 
C 3 203 GLY 203 219 219 GLY GLY C . n 
C 3 204 PRO 204 220 220 PRO PRO C . n 
C 3 205 VAL 205 221 221 VAL VAL C . n 
C 3 206 ILE 206 222 222 ILE ILE C . n 
C 3 207 LEU 207 223 223 LEU LEU C . n 
C 3 208 ASP 208 224 224 ASP ASP C . n 
C 3 209 ILE 209 225 225 ILE ILE C . n 
C 3 210 SER 210 226 226 SER SER C . n 
C 3 211 ARG 211 227 227 ARG ARG C . n 
C 3 212 THR 212 228 228 THR THR C . n 
C 3 213 ARG 213 229 229 ARG ARG C . n 
C 3 214 ILE 214 230 230 ILE ILE C . n 
C 3 215 HIS 215 231 231 HIS HIS C . n 
C 3 216 SER 216 232 232 SER SER C . n 
C 3 217 LEU 217 233 233 LEU LEU C . n 
C 3 218 PRO 218 234 234 PRO PRO C . n 
C 3 219 SER 219 235 235 SER SER C . n 
C 3 220 TYR 220 236 236 TYR TYR C . n 
C 3 221 GLY 221 237 237 GLY GLY C . n 
C 3 222 LEU 222 238 238 LEU LEU C . n 
C 3 223 GLU 223 239 239 GLU GLU C . n 
C 3 224 ASN 224 240 240 ASN ASN C . n 
C 3 225 LEU 225 241 241 LEU LEU C . n 
C 3 226 LYS 226 242 242 LYS LYS C . n 
C 3 227 LYS 227 243 243 LYS LYS C . n 
C 3 228 LEU 228 244 244 LEU LEU C . n 
C 3 229 ARG 229 245 245 ARG ARG C . n 
C 3 230 ALA 230 246 246 ALA ALA C . n 
C 3 231 ARG 231 247 247 ARG ARG C . n 
C 3 232 SER 232 248 248 SER SER C . n 
C 3 233 THR 233 249 249 THR THR C . n 
C 3 234 TYR 234 250 250 TYR TYR C . n 
C 3 235 ASN 235 251 251 ASN ASN C . n 
C 3 236 LEU 236 252 252 LEU LEU C . n 
C 3 237 LYS 237 253 253 LYS LYS C . n 
C 3 238 LYS 238 254 254 LYS LYS C . n 
C 3 239 LEU 239 255 255 LEU LEU C . n 
C 3 240 PRO 240 256 256 PRO PRO C . n 
C 3 241 THR 241 257 257 THR THR C . n 
C 3 242 LEU 242 258 258 LEU LEU C . n 
C 3 243 GLU 243 259 259 GLU GLU C . n 
C 3 244 LYS 244 260 ?   ?   ?   C . n 
C 3 245 LEU 245 261 ?   ?   ?   C . n 
C 3 246 VAL 246 262 ?   ?   ?   C . n 
C 3 247 ALA 247 263 ?   ?   ?   C . n 
C 3 248 LEU 248 264 ?   ?   ?   C . n 
C 3 249 MET 249 265 ?   ?   ?   C . n 
C 3 250 GLU 250 266 ?   ?   ?   C . n 
C 3 251 ALA 251 267 ?   ?   ?   C . n 
C 3 252 SER 252 268 ?   ?   ?   C . n 
D 1 1   ALA 1   1   ?   ?   ?   D . n 
D 1 2   PRO 2   2   ?   ?   ?   D . n 
D 1 3   ASP 3   3   ?   ?   ?   D . n 
D 1 4   VAL 4   4   ?   ?   ?   D . n 
D 1 5   GLN 5   5   ?   ?   ?   D . n 
D 1 6   ASP 6   6   6   ASP ASP D . n 
D 1 7   CYS 7   7   7   CYS CYS D . n 
D 1 8   PRO 8   8   8   PRO PRO D . n 
D 1 9   GLU 9   9   9   GLU GLU D . n 
D 1 10  CYS 10  10  10  CYS CYS D . n 
D 1 11  THR 11  11  11  THR THR D . n 
D 1 12  LEU 12  12  12  LEU LEU D . n 
D 1 13  GLN 13  13  13  GLN GLN D . n 
D 1 14  GLU 14  14  14  GLU GLU D . n 
D 1 15  ASN 15  15  15  ASN ASN D . n 
D 1 16  PRO 16  16  16  PRO PRO D . n 
D 1 17  PHE 17  17  17  PHE PHE D . n 
D 1 18  PHE 18  18  18  PHE PHE D . n 
D 1 19  SER 19  19  19  SER SER D . n 
D 1 20  GLN 20  20  20  GLN GLN D . n 
D 1 21  PRO 21  21  21  PRO PRO D . n 
D 1 22  GLY 22  22  22  GLY GLY D . n 
D 1 23  ALA 23  23  23  ALA ALA D . n 
D 1 24  PRO 24  24  24  PRO PRO D . n 
D 1 25  ILE 25  25  25  ILE ILE D . n 
D 1 26  LEU 26  26  26  LEU LEU D . n 
D 1 27  GLN 27  27  27  GLN GLN D . n 
D 1 28  CYS 28  28  28  CYS CYS D . n 
D 1 29  MET 29  29  29  MET MET D . n 
D 1 30  GLY 30  30  30  GLY GLY D . n 
D 1 31  CYS 31  31  31  CYS CYS D . n 
D 1 32  CYS 32  32  32  CYS CYS D . n 
D 1 33  PHE 33  33  33  PHE PHE D . n 
D 1 34  SER 34  34  34  SER SER D . n 
D 1 35  ARG 35  35  35  ARG ARG D . n 
D 1 36  ALA 36  36  36  ALA ALA D . n 
D 1 37  TYR 37  37  37  TYR TYR D . n 
D 1 38  PRO 38  38  38  PRO PRO D . n 
D 1 39  THR 39  39  39  THR THR D . n 
D 1 40  PRO 40  40  40  PRO PRO D . n 
D 1 41  LEU 41  41  41  LEU LEU D . n 
D 1 42  ARG 42  42  42  ARG ARG D . n 
D 1 43  SER 43  43  43  SER SER D . n 
D 1 44  LYS 44  44  44  LYS LYS D . n 
D 1 45  LYS 45  45  45  LYS LYS D . n 
D 1 46  THR 46  46  46  THR THR D . n 
D 1 47  MET 47  47  47  MET MET D . n 
D 1 48  LEU 48  48  48  LEU LEU D . n 
D 1 49  VAL 49  49  49  VAL VAL D . n 
D 1 50  GLN 50  50  50  GLN GLN D . n 
D 1 51  LYS 51  51  51  LYS LYS D . n 
D 1 52  ASN 52  52  52  ASN ASN D . n 
D 1 53  VAL 53  53  53  VAL VAL D . n 
D 1 54  THR 54  54  54  THR THR D . n 
D 1 55  SER 55  55  55  SER SER D . n 
D 1 56  GLU 56  56  56  GLU GLU D . n 
D 1 57  SER 57  57  57  SER SER D . n 
D 1 58  THR 58  58  58  THR THR D . n 
D 1 59  CYS 59  59  59  CYS CYS D . n 
D 1 60  CYS 60  60  60  CYS CYS D . n 
D 1 61  VAL 61  61  61  VAL VAL D . n 
D 1 62  ALA 62  62  62  ALA ALA D . n 
D 1 63  LYS 63  63  63  LYS LYS D . n 
D 1 64  SER 64  64  64  SER SER D . n 
D 1 65  TYR 65  65  65  TYR TYR D . n 
D 1 66  ASN 66  66  66  ASN ASN D . n 
D 1 67  ARG 67  67  67  ARG ARG D . n 
D 1 68  VAL 68  68  68  VAL VAL D . n 
D 1 69  THR 69  69  69  THR THR D . n 
D 1 70  VAL 70  70  70  VAL VAL D . n 
D 1 71  MET 71  71  71  MET MET D . n 
D 1 72  GLY 72  72  72  GLY GLY D . n 
D 1 73  GLY 73  73  73  GLY GLY D . n 
D 1 74  PHE 74  74  74  PHE PHE D . n 
D 1 75  LYS 75  75  75  LYS LYS D . n 
D 1 76  VAL 76  76  76  VAL VAL D . n 
D 1 77  GLU 77  77  77  GLU GLU D . n 
D 1 78  ASN 78  78  78  ASN ASN D . n 
D 1 79  HIS 79  79  79  HIS HIS D . n 
D 1 80  THR 80  80  80  THR THR D . n 
D 1 81  ALA 81  81  81  ALA ALA D . n 
D 1 82  CYS 82  82  82  CYS CYS D . n 
D 1 83  HIS 83  83  83  HIS HIS D . n 
D 1 84  CYS 84  84  84  CYS CYS D . n 
D 1 85  SER 85  85  85  SER SER D . n 
D 1 86  THR 86  86  86  THR THR D . n 
D 1 87  CYS 87  87  87  CYS CYS D . n 
D 1 88  TYR 88  88  88  TYR TYR D . n 
D 1 89  TYR 89  89  89  TYR TYR D . n 
D 1 90  HIS 90  90  90  HIS HIS D . n 
D 1 91  LYS 91  91  91  LYS LYS D . n 
D 1 92  SER 92  92  92  SER SER D . n 
E 2 1   ASN 1   1   ?   ?   ?   E . n 
E 2 2   SER 2   2   ?   ?   ?   E . n 
E 2 3   CYS 3   3   3   CYS CYS E . n 
E 2 4   GLU 4   4   4   GLU GLU E . n 
E 2 5   LEU 5   5   5   LEU LEU E . n 
E 2 6   THR 6   6   6   THR THR E . n 
E 2 7   ASN 7   7   7   ASN ASN E . n 
E 2 8   ILE 8   8   8   ILE ILE E . n 
E 2 9   THR 9   9   9   THR THR E . n 
E 2 10  ILE 10  10  10  ILE ILE E . n 
E 2 11  ALA 11  11  11  ALA ALA E . n 
E 2 12  ILE 12  12  12  ILE ILE E . n 
E 2 13  GLU 13  13  13  GLU GLU E . n 
E 2 14  LYS 14  14  14  LYS LYS E . n 
E 2 15  GLU 15  15  15  GLU GLU E . n 
E 2 16  GLU 16  16  16  GLU GLU E . n 
E 2 17  CYS 17  17  17  CYS CYS E . n 
E 2 18  ARG 18  18  18  ARG ARG E . n 
E 2 19  PHE 19  19  19  PHE PHE E . n 
E 2 20  CYS 20  20  20  CYS CYS E . n 
E 2 21  ILE 21  21  21  ILE ILE E . n 
E 2 22  SER 22  22  22  SER SER E . n 
E 2 23  ILE 23  23  23  ILE ILE E . n 
E 2 24  ASN 24  24  24  ASN ASN E . n 
E 2 25  THR 25  25  25  THR THR E . n 
E 2 26  THR 26  26  26  THR THR E . n 
E 2 27  TRP 27  27  27  TRP TRP E . n 
E 2 28  CYS 28  28  28  CYS CYS E . n 
E 2 29  ALA 29  29  29  ALA ALA E . n 
E 2 30  GLY 30  30  30  GLY GLY E . n 
E 2 31  TYR 31  31  31  TYR TYR E . n 
E 2 32  CYS 32  32  32  CYS CYS E . n 
E 2 33  TYR 33  33  33  TYR TYR E . n 
E 2 34  THR 34  34  34  THR THR E . n 
E 2 35  ARG 35  35  35  ARG ARG E . n 
E 2 36  ASP 36  36  36  ASP ASP E . n 
E 2 37  LEU 37  37  37  LEU LEU E . n 
E 2 38  VAL 38  38  38  VAL VAL E . n 
E 2 39  TYR 39  39  39  TYR TYR E . n 
E 2 40  LYS 40  40  40  LYS LYS E . n 
E 2 41  ASP 41  41  41  ASP ASP E . n 
E 2 42  PRO 42  42  42  PRO PRO E . n 
E 2 43  ALA 43  43  43  ALA ALA E . n 
E 2 44  ARG 44  44  44  ARG ARG E . n 
E 2 45  PRO 45  45  45  PRO PRO E . n 
E 2 46  LYS 46  46  46  LYS LYS E . n 
E 2 47  ILE 47  47  47  ILE ILE E . n 
E 2 48  GLN 48  48  48  GLN GLN E . n 
E 2 49  LYS 49  49  49  LYS LYS E . n 
E 2 50  THR 50  50  50  THR THR E . n 
E 2 51  CYS 51  51  51  CYS CYS E . n 
E 2 52  THR 52  52  52  THR THR E . n 
E 2 53  PHE 53  53  53  PHE PHE E . n 
E 2 54  LYS 54  54  54  LYS LYS E . n 
E 2 55  GLU 55  55  55  GLU GLU E . n 
E 2 56  LEU 56  56  56  LEU LEU E . n 
E 2 57  VAL 57  57  57  VAL VAL E . n 
E 2 58  TYR 58  58  58  TYR TYR E . n 
E 2 59  GLU 59  59  59  GLU GLU E . n 
E 2 60  THR 60  60  60  THR THR E . n 
E 2 61  VAL 61  61  61  VAL VAL E . n 
E 2 62  ARG 62  62  62  ARG ARG E . n 
E 2 63  VAL 63  63  63  VAL VAL E . n 
E 2 64  PRO 64  64  64  PRO PRO E . n 
E 2 65  GLY 65  65  65  GLY GLY E . n 
E 2 66  CYS 66  66  66  CYS CYS E . n 
E 2 67  ALA 67  67  67  ALA ALA E . n 
E 2 68  HIS 68  68  68  HIS HIS E . n 
E 2 69  HIS 69  69  69  HIS HIS E . n 
E 2 70  ALA 70  70  70  ALA ALA E . n 
E 2 71  ASP 71  71  71  ASP ASP E . n 
E 2 72  SER 72  72  72  SER SER E . n 
E 2 73  LEU 73  73  73  LEU LEU E . n 
E 2 74  TYR 74  74  74  TYR TYR E . n 
E 2 75  THR 75  75  75  THR THR E . n 
E 2 76  TYR 76  76  76  TYR TYR E . n 
E 2 77  PRO 77  77  77  PRO PRO E . n 
E 2 78  VAL 78  78  78  VAL VAL E . n 
E 2 79  ALA 79  79  79  ALA ALA E . n 
E 2 80  THR 80  80  80  THR THR E . n 
E 2 81  GLN 81  81  81  GLN GLN E . n 
E 2 82  CYS 82  82  82  CYS CYS E . n 
E 2 83  HIS 83  83  83  HIS HIS E . n 
E 2 84  CYS 84  84  84  CYS CYS E . n 
E 2 85  GLY 85  85  85  GLY GLY E . n 
E 2 86  LYS 86  86  86  LYS LYS E . n 
E 2 87  CYS 87  87  87  CYS CYS E . n 
E 2 88  ASP 88  88  88  ASP ASP E . n 
E 2 89  SER 89  89  89  SER SER E . n 
E 2 90  ASP 90  90  90  ASP ASP E . n 
E 2 91  SER 91  91  91  SER SER E . n 
E 2 92  THR 92  92  92  THR THR E . n 
E 2 93  ASP 93  93  93  ASP ASP E . n 
E 2 94  CYS 94  94  94  CYS CYS E . n 
E 2 95  THR 95  95  95  THR THR E . n 
E 2 96  VAL 96  96  96  VAL VAL E . n 
E 2 97  ARG 97  97  97  ARG ARG E . n 
E 2 98  GLY 98  98  98  GLY GLY E . n 
E 2 99  LEU 99  99  99  LEU LEU E . n 
E 2 100 GLY 100 100 100 GLY GLY E . n 
E 2 101 PRO 101 101 101 PRO PRO E . n 
E 2 102 SER 102 102 102 SER SER E . n 
E 2 103 TYR 103 103 103 TYR TYR E . n 
E 2 104 CYS 104 104 104 CYS CYS E . n 
E 2 105 SER 105 105 105 SER SER E . n 
E 2 106 PHE 106 106 106 PHE PHE E . n 
E 2 107 GLY 107 107 107 GLY GLY E . n 
E 2 108 GLU 108 108 ?   ?   ?   E . n 
E 2 109 MET 109 109 ?   ?   ?   E . n 
E 2 110 LYS 110 110 ?   ?   ?   E . n 
E 2 111 GLU 111 111 ?   ?   ?   E . n 
F 3 1   GLY 1   17  ?   ?   ?   F . n 
F 3 2   CYS 2   18  18  CYS CYS F . n 
F 3 3   HIS 3   19  19  HIS HIS F . n 
F 3 4   HIS 4   20  20  HIS HIS F . n 
F 3 5   ARG 5   21  21  ARG ARG F . n 
F 3 6   ILE 6   22  22  ILE ILE F . n 
F 3 7   CYS 7   23  23  CYS CYS F . n 
F 3 8   HIS 8   24  24  HIS HIS F . n 
F 3 9   CYS 9   25  25  CYS CYS F . n 
F 3 10  SER 10  26  26  SER SER F . n 
F 3 11  ASN 11  27  27  ASN ASN F . n 
F 3 12  ARG 12  28  28  ARG ARG F . n 
F 3 13  VAL 13  29  29  VAL VAL F . n 
F 3 14  PHE 14  30  30  PHE PHE F . n 
F 3 15  LEU 15  31  31  LEU LEU F . n 
F 3 16  CYS 16  32  32  CYS CYS F . n 
F 3 17  GLN 17  33  33  GLN GLN F . n 
F 3 18  GLU 18  34  34  GLU GLU F . n 
F 3 19  SER 19  35  35  SER SER F . n 
F 3 20  LYS 20  36  36  LYS LYS F . n 
F 3 21  VAL 21  37  37  VAL VAL F . n 
F 3 22  THR 22  38  38  THR THR F . n 
F 3 23  GLU 23  39  39  GLU GLU F . n 
F 3 24  ILE 24  40  40  ILE ILE F . n 
F 3 25  PRO 25  41  41  PRO PRO F . n 
F 3 26  SER 26  42  42  SER SER F . n 
F 3 27  ASP 27  43  43  ASP ASP F . n 
F 3 28  LEU 28  44  44  LEU LEU F . n 
F 3 29  PRO 29  45  45  PRO PRO F . n 
F 3 30  ARG 30  46  46  ARG ARG F . n 
F 3 31  ASN 31  47  47  ASN ASN F . n 
F 3 32  ALA 32  48  48  ALA ALA F . n 
F 3 33  ILE 33  49  49  ILE ILE F . n 
F 3 34  GLU 34  50  50  GLU GLU F . n 
F 3 35  LEU 35  51  51  LEU LEU F . n 
F 3 36  ARG 36  52  52  ARG ARG F . n 
F 3 37  PHE 37  53  53  PHE PHE F . n 
F 3 38  VAL 38  54  54  VAL VAL F . n 
F 3 39  LEU 39  55  55  LEU LEU F . n 
F 3 40  THR 40  56  56  THR THR F . n 
F 3 41  LYS 41  57  57  LYS LYS F . n 
F 3 42  LEU 42  58  58  LEU LEU F . n 
F 3 43  ARG 43  59  59  ARG ARG F . n 
F 3 44  VAL 44  60  60  VAL VAL F . n 
F 3 45  ILE 45  61  61  ILE ILE F . n 
F 3 46  GLN 46  62  62  GLN GLN F . n 
F 3 47  LYS 47  63  63  LYS LYS F . n 
F 3 48  GLY 48  64  64  GLY GLY F . n 
F 3 49  ALA 49  65  65  ALA ALA F . n 
F 3 50  PHE 50  66  66  PHE PHE F . n 
F 3 51  SER 51  67  67  SER SER F . n 
F 3 52  GLY 52  68  68  GLY GLY F . n 
F 3 53  PHE 53  69  69  PHE PHE F . n 
F 3 54  GLY 54  70  70  GLY GLY F . n 
F 3 55  ASP 55  71  71  ASP ASP F . n 
F 3 56  LEU 56  72  72  LEU LEU F . n 
F 3 57  GLU 57  73  73  GLU GLU F . n 
F 3 58  LYS 58  74  74  LYS LYS F . n 
F 3 59  ILE 59  75  75  ILE ILE F . n 
F 3 60  GLU 60  76  76  GLU GLU F . n 
F 3 61  ILE 61  77  77  ILE ILE F . n 
F 3 62  SER 62  78  78  SER SER F . n 
F 3 63  GLN 63  79  79  GLN GLN F . n 
F 3 64  ASN 64  80  80  ASN ASN F . n 
F 3 65  ASP 65  81  81  ASP ASP F . n 
F 3 66  VAL 66  82  82  VAL VAL F . n 
F 3 67  LEU 67  83  83  LEU LEU F . n 
F 3 68  GLU 68  84  84  GLU GLU F . n 
F 3 69  VAL 69  85  85  VAL VAL F . n 
F 3 70  ILE 70  86  86  ILE ILE F . n 
F 3 71  GLU 71  87  87  GLU GLU F . n 
F 3 72  ALA 72  88  88  ALA ALA F . n 
F 3 73  ASP 73  89  89  ASP ASP F . n 
F 3 74  VAL 74  90  90  VAL VAL F . n 
F 3 75  PHE 75  91  91  PHE PHE F . n 
F 3 76  SER 76  92  92  SER SER F . n 
F 3 77  ASN 77  93  93  ASN ASN F . n 
F 3 78  LEU 78  94  94  LEU LEU F . n 
F 3 79  PRO 79  95  95  PRO PRO F . n 
F 3 80  LYS 80  96  96  LYS LYS F . n 
F 3 81  LEU 81  97  97  LEU LEU F . n 
F 3 82  HIS 82  98  98  HIS HIS F . n 
F 3 83  GLU 83  99  99  GLU GLU F . n 
F 3 84  ILE 84  100 100 ILE ILE F . n 
F 3 85  ARG 85  101 101 ARG ARG F . n 
F 3 86  ILE 86  102 102 ILE ILE F . n 
F 3 87  GLU 87  103 103 GLU GLU F . n 
F 3 88  LYS 88  104 104 LYS LYS F . n 
F 3 89  ALA 89  105 105 ALA ALA F . n 
F 3 90  ASN 90  106 106 ASN ASN F . n 
F 3 91  ASN 91  107 107 ASN ASN F . n 
F 3 92  LEU 92  108 108 LEU LEU F . n 
F 3 93  LEU 93  109 109 LEU LEU F . n 
F 3 94  TYR 94  110 110 TYR TYR F . n 
F 3 95  ILE 95  111 111 ILE ILE F . n 
F 3 96  ASN 96  112 112 ASN ASN F . n 
F 3 97  PRO 97  113 113 PRO PRO F . n 
F 3 98  GLU 98  114 114 GLU GLU F . n 
F 3 99  ALA 99  115 115 ALA ALA F . n 
F 3 100 PHE 100 116 116 PHE PHE F . n 
F 3 101 GLN 101 117 117 GLN GLN F . n 
F 3 102 ASN 102 118 118 ASN ASN F . n 
F 3 103 LEU 103 119 119 LEU LEU F . n 
F 3 104 PRO 104 120 120 PRO PRO F . n 
F 3 105 ASN 105 121 121 ASN ASN F . n 
F 3 106 LEU 106 122 122 LEU LEU F . n 
F 3 107 GLN 107 123 123 GLN GLN F . n 
F 3 108 TYR 108 124 124 TYR TYR F . n 
F 3 109 LEU 109 125 125 LEU LEU F . n 
F 3 110 LEU 110 126 126 LEU LEU F . n 
F 3 111 ILE 111 127 127 ILE ILE F . n 
F 3 112 SER 112 128 128 SER SER F . n 
F 3 113 ASN 113 129 129 ASN ASN F . n 
F 3 114 THR 114 130 130 THR THR F . n 
F 3 115 GLY 115 131 131 GLY GLY F . n 
F 3 116 ILE 116 132 132 ILE ILE F . n 
F 3 117 LYS 117 133 133 LYS LYS F . n 
F 3 118 HIS 118 134 134 HIS HIS F . n 
F 3 119 LEU 119 135 135 LEU LEU F . n 
F 3 120 PRO 120 136 136 PRO PRO F . n 
F 3 121 ASP 121 137 137 ASP ASP F . n 
F 3 122 VAL 122 138 138 VAL VAL F . n 
F 3 123 HIS 123 139 139 HIS HIS F . n 
F 3 124 LYS 124 140 140 LYS LYS F . n 
F 3 125 ILE 125 141 141 ILE ILE F . n 
F 3 126 HIS 126 142 142 HIS HIS F . n 
F 3 127 SER 127 143 143 SER SER F . n 
F 3 128 LEU 128 144 144 LEU LEU F . n 
F 3 129 GLN 129 145 145 GLN GLN F . n 
F 3 130 LYS 130 146 146 LYS LYS F . n 
F 3 131 VAL 131 147 147 VAL VAL F . n 
F 3 132 LEU 132 148 148 LEU LEU F . n 
F 3 133 LEU 133 149 149 LEU LEU F . n 
F 3 134 ASP 134 150 150 ASP ASP F . n 
F 3 135 ILE 135 151 151 ILE ILE F . n 
F 3 136 GLN 136 152 152 GLN GLN F . n 
F 3 137 ASP 137 153 153 ASP ASP F . n 
F 3 138 ASN 138 154 154 ASN ASN F . n 
F 3 139 ILE 139 155 155 ILE ILE F . n 
F 3 140 ASN 140 156 156 ASN ASN F . n 
F 3 141 ILE 141 157 157 ILE ILE F . n 
F 3 142 HIS 142 158 158 HIS HIS F . n 
F 3 143 THR 143 159 159 THR THR F . n 
F 3 144 ILE 144 160 160 ILE ILE F . n 
F 3 145 GLU 145 161 161 GLU GLU F . n 
F 3 146 ARG 146 162 162 ARG ARG F . n 
F 3 147 ASN 147 163 163 ASN ASN F . n 
F 3 148 SER 148 164 164 SER SER F . n 
F 3 149 PHE 149 165 165 PHE PHE F . n 
F 3 150 VAL 150 166 166 VAL VAL F . n 
F 3 151 GLY 151 167 167 GLY GLY F . n 
F 3 152 LEU 152 168 168 LEU LEU F . n 
F 3 153 SER 153 169 169 SER SER F . n 
F 3 154 PHE 154 170 170 PHE PHE F . n 
F 3 155 GLU 155 171 171 GLU GLU F . n 
F 3 156 SER 156 172 172 SER SER F . n 
F 3 157 VAL 157 173 173 VAL VAL F . n 
F 3 158 ILE 158 174 174 ILE ILE F . n 
F 3 159 LEU 159 175 175 LEU LEU F . n 
F 3 160 TRP 160 176 176 TRP TRP F . n 
F 3 161 LEU 161 177 177 LEU LEU F . n 
F 3 162 ASN 162 178 178 ASN ASN F . n 
F 3 163 LYS 163 179 179 LYS LYS F . n 
F 3 164 ASN 164 180 180 ASN ASN F . n 
F 3 165 GLY 165 181 181 GLY GLY F . n 
F 3 166 ILE 166 182 182 ILE ILE F . n 
F 3 167 GLN 167 183 183 GLN GLN F . n 
F 3 168 GLU 168 184 184 GLU GLU F . n 
F 3 169 ILE 169 185 185 ILE ILE F . n 
F 3 170 HIS 170 186 186 HIS HIS F . n 
F 3 171 ASN 171 187 187 ASN ASN F . n 
F 3 172 CYS 172 188 188 CYS CYS F . n 
F 3 173 ALA 173 189 189 ALA ALA F . n 
F 3 174 PHE 174 190 190 PHE PHE F . n 
F 3 175 ASN 175 191 191 ASN ASN F . n 
F 3 176 GLY 176 192 192 GLY GLY F . n 
F 3 177 THR 177 193 193 THR THR F . n 
F 3 178 GLN 178 194 194 GLN GLN F . n 
F 3 179 LEU 179 195 195 LEU LEU F . n 
F 3 180 ASP 180 196 196 ASP ASP F . n 
F 3 181 GLU 181 197 197 GLU GLU F . n 
F 3 182 LEU 182 198 198 LEU LEU F . n 
F 3 183 ASN 183 199 199 ASN ASN F . n 
F 3 184 LEU 184 200 200 LEU LEU F . n 
F 3 185 SER 185 201 201 SER SER F . n 
F 3 186 ASP 186 202 202 ASP ASP F . n 
F 3 187 ASN 187 203 203 ASN ASN F . n 
F 3 188 ASN 188 204 204 ASN ASN F . n 
F 3 189 ASN 189 205 205 ASN ASN F . n 
F 3 190 LEU 190 206 206 LEU LEU F . n 
F 3 191 GLU 191 207 207 GLU GLU F . n 
F 3 192 GLU 192 208 208 GLU GLU F . n 
F 3 193 LEU 193 209 209 LEU LEU F . n 
F 3 194 PRO 194 210 210 PRO PRO F . n 
F 3 195 ASN 195 211 211 ASN ASN F . n 
F 3 196 ASP 196 212 212 ASP ASP F . n 
F 3 197 VAL 197 213 213 VAL VAL F . n 
F 3 198 PHE 198 214 214 PHE PHE F . n 
F 3 199 HIS 199 215 215 HIS HIS F . n 
F 3 200 GLY 200 216 216 GLY GLY F . n 
F 3 201 ALA 201 217 217 ALA ALA F . n 
F 3 202 SER 202 218 218 SER SER F . n 
F 3 203 GLY 203 219 219 GLY GLY F . n 
F 3 204 PRO 204 220 220 PRO PRO F . n 
F 3 205 VAL 205 221 221 VAL VAL F . n 
F 3 206 ILE 206 222 222 ILE ILE F . n 
F 3 207 LEU 207 223 223 LEU LEU F . n 
F 3 208 ASP 208 224 224 ASP ASP F . n 
F 3 209 ILE 209 225 225 ILE ILE F . n 
F 3 210 SER 210 226 226 SER SER F . n 
F 3 211 ARG 211 227 227 ARG ARG F . n 
F 3 212 THR 212 228 228 THR THR F . n 
F 3 213 ARG 213 229 229 ARG ARG F . n 
F 3 214 ILE 214 230 230 ILE ILE F . n 
F 3 215 HIS 215 231 231 HIS HIS F . n 
F 3 216 SER 216 232 232 SER SER F . n 
F 3 217 LEU 217 233 233 LEU LEU F . n 
F 3 218 PRO 218 234 234 PRO PRO F . n 
F 3 219 SER 219 235 235 SER SER F . n 
F 3 220 TYR 220 236 236 TYR TYR F . n 
F 3 221 GLY 221 237 237 GLY GLY F . n 
F 3 222 LEU 222 238 238 LEU LEU F . n 
F 3 223 GLU 223 239 239 GLU GLU F . n 
F 3 224 ASN 224 240 240 ASN ASN F . n 
F 3 225 LEU 225 241 241 LEU LEU F . n 
F 3 226 LYS 226 242 242 LYS LYS F . n 
F 3 227 LYS 227 243 243 LYS LYS F . n 
F 3 228 LEU 228 244 244 LEU LEU F . n 
F 3 229 ARG 229 245 245 ARG ARG F . n 
F 3 230 ALA 230 246 246 ALA ALA F . n 
F 3 231 ARG 231 247 247 ARG ARG F . n 
F 3 232 SER 232 248 248 SER SER F . n 
F 3 233 THR 233 249 249 THR THR F . n 
F 3 234 TYR 234 250 250 TYR TYR F . n 
F 3 235 ASN 235 251 ?   ?   ?   F . n 
F 3 236 LEU 236 252 ?   ?   ?   F . n 
F 3 237 LYS 237 253 ?   ?   ?   F . n 
F 3 238 LYS 238 254 ?   ?   ?   F . n 
F 3 239 LEU 239 255 ?   ?   ?   F . n 
F 3 240 PRO 240 256 ?   ?   ?   F . n 
F 3 241 THR 241 257 ?   ?   ?   F . n 
F 3 242 LEU 242 258 ?   ?   ?   F . n 
F 3 243 GLU 243 259 ?   ?   ?   F . n 
F 3 244 LYS 244 260 ?   ?   ?   F . n 
F 3 245 LEU 245 261 ?   ?   ?   F . n 
F 3 246 VAL 246 262 ?   ?   ?   F . n 
F 3 247 ALA 247 263 ?   ?   ?   F . n 
F 3 248 LEU 248 264 ?   ?   ?   F . n 
F 3 249 MET 249 265 ?   ?   ?   F . n 
F 3 250 GLU 250 266 ?   ?   ?   F . n 
F 3 251 ALA 251 267 ?   ?   ?   F . n 
F 3 252 SER 252 268 ?   ?   ?   F . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
I 6 NAG 1  93  52  NAG NAG A . 
J 6 NAG 1  94  78  NAG NAG A . 
K 6 NAG 1  112 7   NAG NAG B . 
L 6 NAG 1  113 24  NAG NAG B . 
M 7 SO4 1  402 402 SO4 SO4 B . 
N 7 SO4 1  403 403 SO4 SO4 B . 
O 7 SO4 1  401 401 SO4 SO4 C . 
P 6 NAG 1  93  78  NAG NAG D . 
Q 6 NAG 1  112 7   NAG NAG E . 
R 8 HOH 1  95  1   HOH HOH A . 
R 8 HOH 2  96  10  HOH HOH A . 
R 8 HOH 3  97  11  HOH HOH A . 
R 8 HOH 4  98  47  HOH HOH A . 
S 8 HOH 1  404 9   HOH HOH B . 
S 8 HOH 2  405 19  HOH HOH B . 
S 8 HOH 3  406 24  HOH HOH B . 
S 8 HOH 4  407 28  HOH HOH B . 
S 8 HOH 5  408 30  HOH HOH B . 
S 8 HOH 6  409 37  HOH HOH B . 
T 8 HOH 1  402 2   HOH HOH C . 
T 8 HOH 2  403 3   HOH HOH C . 
T 8 HOH 3  404 6   HOH HOH C . 
T 8 HOH 4  405 7   HOH HOH C . 
T 8 HOH 5  406 13  HOH HOH C . 
T 8 HOH 6  407 15  HOH HOH C . 
T 8 HOH 7  408 18  HOH HOH C . 
T 8 HOH 8  409 23  HOH HOH C . 
T 8 HOH 9  410 36  HOH HOH C . 
T 8 HOH 10 411 42  HOH HOH C . 
T 8 HOH 11 412 45  HOH HOH C . 
T 8 HOH 12 413 48  HOH HOH C . 
T 8 HOH 13 414 49  HOH HOH C . 
U 8 HOH 1  94  14  HOH HOH D . 
U 8 HOH 2  95  41  HOH HOH D . 
V 8 HOH 1  113 17  HOH HOH E . 
V 8 HOH 2  114 34  HOH HOH E . 
V 8 HOH 3  115 43  HOH HOH E . 
V 8 HOH 4  116 44  HOH HOH E . 
W 8 HOH 1  272 4   HOH HOH F . 
W 8 HOH 2  273 5   HOH HOH F . 
W 8 HOH 3  274 8   HOH HOH F . 
W 8 HOH 4  275 12  HOH HOH F . 
W 8 HOH 5  276 16  HOH HOH F . 
W 8 HOH 6  277 20  HOH HOH F . 
W 8 HOH 7  278 21  HOH HOH F . 
W 8 HOH 8  279 22  HOH HOH F . 
W 8 HOH 9  280 25  HOH HOH F . 
W 8 HOH 10 281 26  HOH HOH F . 
W 8 HOH 11 282 27  HOH HOH F . 
W 8 HOH 12 283 29  HOH HOH F . 
W 8 HOH 13 284 31  HOH HOH F . 
W 8 HOH 14 285 32  HOH HOH F . 
W 8 HOH 15 286 33  HOH HOH F . 
W 8 HOH 16 287 35  HOH HOH F . 
W 8 HOH 17 288 38  HOH HOH F . 
W 8 HOH 18 289 39  HOH HOH F . 
W 8 HOH 19 290 40  HOH HOH F . 
W 8 HOH 20 291 46  HOH HOH F . 
W 8 HOH 21 292 50  HOH HOH F . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 52  A ASN 52  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 78  A ASN 78  ? ASN 'GLYCOSYLATION SITE' 
3 B ASN 7   B ASN 7   ? ASN 'GLYCOSYLATION SITE' 
4 B ASN 24  B ASN 24  ? ASN 'GLYCOSYLATION SITE' 
5 C ASN 175 C ASN 191 ? ASN 'GLYCOSYLATION SITE' 
6 D ASN 78  D ASN 78  ? ASN 'GLYCOSYLATION SITE' 
7 E ASN 7   E ASN 7   ? ASN 'GLYCOSYLATION SITE' 
8 F ASN 175 F ASN 191 ? ASN 'GLYCOSYLATION SITE' 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? trimeric 3 
2 author_defined_assembly ? trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,G,I,J,K,L,M,N,O,R,S,T 
2 1 D,E,F,H,P,Q,U,V,W           
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-01-25 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' Advisory                    
5 4 'Structure model' 'Atomic model'              
6 4 'Structure model' 'Data collection'           
7 4 'Structure model' 'Derived calculations'      
8 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                     
2  4 'Structure model' chem_comp                     
3  4 'Structure model' database_PDB_caveat           
4  4 'Structure model' entity                        
5  4 'Structure model' pdbx_branch_scheme            
6  4 'Structure model' pdbx_chem_comp_identifier     
7  4 'Structure model' pdbx_entity_branch            
8  4 'Structure model' pdbx_entity_branch_descriptor 
9  4 'Structure model' pdbx_entity_branch_link       
10 4 'Structure model' pdbx_entity_branch_list       
11 4 'Structure model' pdbx_entity_nonpoly           
12 4 'Structure model' pdbx_nonpoly_scheme           
13 4 'Structure model' pdbx_struct_assembly_gen      
14 4 'Structure model' struct_asym                   
15 4 'Structure model' struct_conn                   
16 4 'Structure model' struct_site                   
17 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.B_iso_or_equiv'              
2  4 'Structure model' '_atom_site.Cartn_x'                     
3  4 'Structure model' '_atom_site.Cartn_y'                     
4  4 'Structure model' '_atom_site.Cartn_z'                     
5  4 'Structure model' '_atom_site.auth_asym_id'                
6  4 'Structure model' '_atom_site.auth_atom_id'                
7  4 'Structure model' '_atom_site.auth_comp_id'                
8  4 'Structure model' '_atom_site.auth_seq_id'                 
9  4 'Structure model' '_atom_site.label_asym_id'               
10 4 'Structure model' '_atom_site.label_atom_id'               
11 4 'Structure model' '_atom_site.label_comp_id'               
12 4 'Structure model' '_atom_site.label_entity_id'             
13 4 'Structure model' '_atom_site.type_symbol'                 
14 4 'Structure model' '_chem_comp.name'                        
15 4 'Structure model' '_chem_comp.type'                        
16 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 
17 4 'Structure model' '_struct_conn.pdbx_dist_value'           
18 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'    
19 4 'Structure model' '_struct_conn.pdbx_role'                 
20 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'        
21 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'        
22 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'         
23 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'       
24 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'       
25 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'       
26 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'        
27 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'        
28 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'        
29 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'         
30 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'       
31 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'       
32 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'       
33 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'        
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 15.6897 -8.8262  51.2914 -0.0210 -0.0824 -0.0387 -0.0261 -0.0480 -0.0136 0.4631 0.8966 1.8794 -0.2297 0.4158  0.0986 
0.0367 0.0033 -0.0242 0.0644 0.0248  -0.0550 0.1184 0.1811  -0.0615 'X-RAY DIFFRACTION' 
2 ? refined 19.4870 -43.3557 20.0938 -0.1665 -0.0380 -0.0448 0.0035  0.0194  -0.0058 1.0599 1.9714 2.4145 -0.1860 -0.4899 1.1100 
0.0470 0.2397 -0.0193 0.1828 -0.1388 0.1307  0.0829 -0.1850 0.0918  'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 3 3  A 92  92  ? A A 'X-RAY DIFFRACTION' ? 
2 1 B 3 3  B 107 107 ? B B 'X-RAY DIFFRACTION' ? 
3 1 C 2 18 C 243 259 ? C C 'X-RAY DIFFRACTION' ? 
4 2 D 6 6  D 92  92  ? D D 'X-RAY DIFFRACTION' ? 
5 2 E 3 3  E 107 107 ? E E 'X-RAY DIFFRACTION' ? 
6 2 F 2 18 F 234 250 ? F F 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.2.0003 ? 1 
DENZO     'data reduction' .        ? 2 
SCALEPACK 'data scaling'   .        ? 3 
AMoRE     phasing          .        ? 4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_1              93 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_2              93 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             OD2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_3              93 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                123.81 
_pdbx_validate_rmsd_angle.angle_target_value         118.30 
_pdbx_validate_rmsd_angle.angle_deviation            5.51 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.90 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 MET A 71  ? ? 4.86    -91.51  
2  1 PRO B 45  ? ? -48.16  164.53  
3  1 CYS B 66  ? ? -174.93 -172.50 
4  1 ALA B 67  ? ? 3.70    -86.30  
5  1 ASP B 71  ? ? -43.74  158.30  
6  1 SER B 102 ? ? -87.86  37.55   
7  1 SER C 26  ? ? -78.04  -155.57 
8  1 LYS C 36  ? ? -106.98 41.29   
9  1 ASP C 43  ? ? -82.99  36.55   
10 1 ASN C 47  ? ? -111.13 52.01   
11 1 PHE C 66  ? ? -99.24  37.54   
12 1 GLU C 87  ? ? -64.59  -177.88 
13 1 PRO C 113 ? ? -51.36  -4.89   
14 1 ASN C 118 ? ? 36.56   90.78   
15 1 ASP C 153 ? ? 48.12   23.06   
16 1 ASN C 163 ? ? 73.72   46.08   
17 1 SER C 172 ? ? -29.33  126.35  
18 1 ASN C 180 ? ? -122.07 -140.65 
19 1 SER C 218 ? ? -64.24  8.61    
20 1 ALA C 246 ? ? -128.12 -100.64 
21 1 ASN C 251 ? ? -168.31 -69.54  
22 1 PRO C 256 ? ? -65.71  23.77   
23 1 THR C 257 ? ? -70.56  40.82   
24 1 PRO D 8   ? ? -54.18  -162.31 
25 1 CYS D 10  ? ? -60.79  96.64   
26 1 LYS D 44  ? ? -58.86  -5.32   
27 1 ALA E 29  ? ? -175.04 145.17  
28 1 CYS E 66  ? ? -142.18 -119.88 
29 1 ALA E 67  ? ? -55.04  -70.63  
30 1 SER E 102 ? ? -103.80 62.94   
31 1 SER F 26  ? ? -114.22 -128.78 
32 1 ARG F 28  ? ? 47.91   22.48   
33 1 GLU F 34  ? ? 59.56   72.44   
34 1 THR F 38  ? ? -146.10 -15.26  
35 1 PHE F 91  ? ? -104.55 71.45   
36 1 ALA F 105 ? ? -101.33 75.60   
37 1 ASN F 118 ? ? 46.19   74.25   
38 1 ASN F 154 ? ? -106.62 77.83   
39 1 GLU F 171 ? ? -125.38 -163.20 
40 1 LEU F 177 ? ? -98.47  39.91   
41 1 ASN F 180 ? ? -98.59  -145.27 
42 1 ASP F 202 ? ? 56.23   18.29   
43 1 SER F 226 ? ? -47.30  153.44  
44 1 ARG F 227 ? ? 37.44   49.04   
45 1 THR F 228 ? ? -123.12 -168.81 
46 1 LEU F 238 ? ? -91.89  32.37   
47 1 ALA F 246 ? ? -141.59 28.68   
48 1 SER F 248 ? ? 45.18   70.40   
# 
loop_
_pdbx_validate_chiral.id 
_pdbx_validate_chiral.PDB_model_num 
_pdbx_validate_chiral.auth_atom_id 
_pdbx_validate_chiral.label_alt_id 
_pdbx_validate_chiral.auth_asym_id 
_pdbx_validate_chiral.auth_comp_id 
_pdbx_validate_chiral.auth_seq_id 
_pdbx_validate_chiral.PDB_ins_code 
_pdbx_validate_chiral.details 
_pdbx_validate_chiral.omega 
1 1 C1 ? B NAG 113 ? PLANAR . 
2 1 C1 ? E NAG 112 ? PLANAR . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 1   ? A ALA 1   
2  1 Y 1 A PRO 2   ? A PRO 2   
3  1 Y 1 B ASN 1   ? B ASN 1   
4  1 Y 1 B SER 2   ? B SER 2   
5  1 Y 1 B GLU 108 ? B GLU 108 
6  1 Y 1 B MET 109 ? B MET 109 
7  1 Y 1 B LYS 110 ? B LYS 110 
8  1 Y 1 B GLU 111 ? B GLU 111 
9  1 Y 1 C GLY 17  ? C GLY 1   
10 1 Y 1 C LYS 260 ? C LYS 244 
11 1 Y 1 C LEU 261 ? C LEU 245 
12 1 Y 1 C VAL 262 ? C VAL 246 
13 1 Y 1 C ALA 263 ? C ALA 247 
14 1 Y 1 C LEU 264 ? C LEU 248 
15 1 Y 1 C MET 265 ? C MET 249 
16 1 Y 1 C GLU 266 ? C GLU 250 
17 1 Y 1 C ALA 267 ? C ALA 251 
18 1 Y 1 C SER 268 ? C SER 252 
19 1 Y 1 D ALA 1   ? D ALA 1   
20 1 Y 1 D PRO 2   ? D PRO 2   
21 1 Y 1 D ASP 3   ? D ASP 3   
22 1 Y 1 D VAL 4   ? D VAL 4   
23 1 Y 1 D GLN 5   ? D GLN 5   
24 1 Y 1 E ASN 1   ? E ASN 1   
25 1 Y 1 E SER 2   ? E SER 2   
26 1 Y 1 E GLU 108 ? E GLU 108 
27 1 Y 1 E MET 109 ? E MET 109 
28 1 Y 1 E LYS 110 ? E LYS 110 
29 1 Y 1 E GLU 111 ? E GLU 111 
30 1 Y 1 F GLY 17  ? F GLY 1   
31 1 Y 1 F ASN 251 ? F ASN 235 
32 1 Y 1 F LEU 252 ? F LEU 236 
33 1 Y 1 F LYS 253 ? F LYS 237 
34 1 Y 1 F LYS 254 ? F LYS 238 
35 1 Y 1 F LEU 255 ? F LEU 239 
36 1 Y 1 F PRO 256 ? F PRO 240 
37 1 Y 1 F THR 257 ? F THR 241 
38 1 Y 1 F LEU 258 ? F LEU 242 
39 1 Y 1 F GLU 259 ? F GLU 243 
40 1 Y 1 F LYS 260 ? F LYS 244 
41 1 Y 1 F LEU 261 ? F LEU 245 
42 1 Y 1 F VAL 262 ? F VAL 246 
43 1 Y 1 F ALA 263 ? F ALA 247 
44 1 Y 1 F LEU 264 ? F LEU 248 
45 1 Y 1 F MET 265 ? F MET 249 
46 1 Y 1 F GLU 266 ? F GLU 250 
47 1 Y 1 F ALA 267 ? F ALA 251 
48 1 Y 1 F SER 268 ? F SER 252 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
G 4 NAG 1 G NAG 1 J NAG 191 n 
G 4 NAG 2 G NAG 2 J NAG 192 n 
H 5 NAG 1 H NAG 1 M NAG 191 n 
H 5 NAG 2 H NAG 2 M NAG 192 n 
H 5 BMA 3 H BMA 3 M MAN 193 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
BMA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpb                         
BMA 'COMMON NAME'                         GMML     1.0 b-D-mannopyranose              
BMA 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Manp                       
BMA 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_branch.entity_id 
_pdbx_entity_branch.type 
4 oligosaccharide 
5 oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 4 DGlcpNAcb1-4DGlcpNAcb1-                                                      'Glycam Condensed Sequence' GMML       1.0   
2 4 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1'                        WURCS                       PDB2Glycan 1.1.0 
3 4 '[]{[(4+1)][b-D-Manp]{[(2+?)][]{[(?+2)][b-D-Manp]{}}}}'                      LINUCS                      PDB-CARE   ?     
4 5 DManpb1-4DGlcpNAcb1-4DGlcpNAcb1-                                             'Glycam Condensed Sequence' GMML       1.0   
5 5 'WURCS=2.0/2,3,2/[a2122h-1b_1-5_2*NCC/3=O][a1122h-1b_1-5]/1-1-2/a4-b1_b4-c1' WURCS                       PDB2Glycan 1.1.0 
6 5 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-Manp]{}}}}'        LINUCS                      PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 4 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 5 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
3 5 3 BMA C1 O1 2 NAG O4 HO4 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
4 NAG 1 n 
4 NAG 2 n 
5 NAG 1 n 
5 NAG 2 n 
5 BMA 3 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
6 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
7 'SULFATE ION'                            SO4 
8 water                                    HOH 
#