data_1XZ9
# 
_entry.id   1XZ9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1XZ9         
RCSB  RCSB030929   
WWPDB D_1000030929 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1XZ9 
_pdbx_database_status.recvd_initial_deposition_date   2004-11-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Joshi, M.'          1 
'Boisguerin, P.'     2 
'Leitner, D.'        3 
'Volkmer-Engert, R.' 4 
'Moelling, K.'       5 
'Schade, M.'         6 
'Schmieder, P.'      7 
'Krause, G.'         8 
'Oschkinat, H.'      9 
# 
_citation.id                        primary 
_citation.title                     'Discovery of low-molecular-weight ligands for the AF6 PDZ domain.' 
_citation.journal_abbrev            Angew.Chem.Int.Ed.Engl. 
_citation.journal_volume            45 
_citation.page_first                3790 
_citation.page_last                 3795 
_citation.year                      2006 
_citation.journal_id_ASTM           ? 
_citation.country                   GE 
_citation.journal_id_ISSN           1433-7851 
_citation.journal_id_CSD            9999 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16671149 
_citation.pdbx_database_id_DOI      10.1002/anie.200503965 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Joshi, M.'      1  
primary 'Vargas, C.'     2  
primary 'Boisguerin, P.' 3  
primary 'Diehl, A.'      4  
primary 'Krause, G.'     5  
primary 'Schmieder, P.'  6  
primary 'Moelling, K.'   7  
primary 'Hagen, V.'      8  
primary 'Schade, M.'     9  
primary 'Oschkinat, H.'  10 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           Afadin 
_entity.formula_weight             10392.987 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'AF-6 PDZ domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'AF-6 protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPLGSLRKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAA
ELMTRTSSVVTLEVAKQGAIY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLGSLRKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAA
ELMTRTSSVVTLEVAKQGAIY
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   LEU n 
1 7   ARG n 
1 8   LYS n 
1 9   GLU n 
1 10  PRO n 
1 11  GLU n 
1 12  ILE n 
1 13  ILE n 
1 14  THR n 
1 15  VAL n 
1 16  THR n 
1 17  LEU n 
1 18  LYS n 
1 19  LYS n 
1 20  GLN n 
1 21  ASN n 
1 22  GLY n 
1 23  MET n 
1 24  GLY n 
1 25  LEU n 
1 26  SER n 
1 27  ILE n 
1 28  VAL n 
1 29  ALA n 
1 30  ALA n 
1 31  LYS n 
1 32  GLY n 
1 33  ALA n 
1 34  GLY n 
1 35  GLN n 
1 36  ASP n 
1 37  LYS n 
1 38  LEU n 
1 39  GLY n 
1 40  ILE n 
1 41  TYR n 
1 42  VAL n 
1 43  LYS n 
1 44  SER n 
1 45  VAL n 
1 46  VAL n 
1 47  LYS n 
1 48  GLY n 
1 49  GLY n 
1 50  ALA n 
1 51  ALA n 
1 52  ASP n 
1 53  VAL n 
1 54  ASP n 
1 55  GLY n 
1 56  ARG n 
1 57  LEU n 
1 58  ALA n 
1 59  ALA n 
1 60  GLY n 
1 61  ASP n 
1 62  GLN n 
1 63  LEU n 
1 64  LEU n 
1 65  SER n 
1 66  VAL n 
1 67  ASP n 
1 68  GLY n 
1 69  ARG n 
1 70  SER n 
1 71  LEU n 
1 72  VAL n 
1 73  GLY n 
1 74  LEU n 
1 75  SER n 
1 76  GLN n 
1 77  GLU n 
1 78  ARG n 
1 79  ALA n 
1 80  ALA n 
1 81  GLU n 
1 82  LEU n 
1 83  MET n 
1 84  THR n 
1 85  ARG n 
1 86  THR n 
1 87  SER n 
1 88  SER n 
1 89  VAL n 
1 90  VAL n 
1 91  THR n 
1 92  LEU n 
1 93  GLU n 
1 94  VAL n 
1 95  ALA n 
1 96  LYS n 
1 97  GLN n 
1 98  GLY n 
1 99  ALA n 
1 100 ILE n 
1 101 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q5TIG6_HUMAN 
_struct_ref.pdbx_db_accession          Q5TIG6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;LRKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRT
SSVVTLEVAKQGAIY
;
_struct_ref.pdbx_align_begin           985 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1XZ9 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 6 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 101 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q5TIG6 
_struct_ref_seq.db_align_beg                  985 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1079 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       6 
_struct_ref_seq.pdbx_auth_seq_align_end       101 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1XZ9 GLY A 1  ? UNP Q5TIG6 ? ? 'CLONING ARTIFACT' 1  1 
1 1XZ9 PRO A 2  ? UNP Q5TIG6 ? ? 'CLONING ARTIFACT' 2  2 
1 1XZ9 LEU A 3  ? UNP Q5TIG6 ? ? 'CLONING ARTIFACT' 3  3 
1 1XZ9 GLY A 4  ? UNP Q5TIG6 ? ? 'CLONING ARTIFACT' 4  4 
1 1XZ9 SER A 5  ? UNP Q5TIG6 ? ? 'CLONING ARTIFACT' 5  5 
1 1XZ9 VAL A 53 ? UNP Q5TIG6 ? ? 'SEE REMARK 999'   53 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_15N-separated_NOESY 
2 2 1 3D_13C-separated_NOESY 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         295 
_pdbx_nmr_exptl_sample_conditions.pressure            Ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '20mM Phosphate, 50mM Sodium Chloride' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '1.25mM PDZ domain U-15N; 20mM phosphate buffer; 50mM Sodium chloride; 90% H2O, 10% D2O' '90% H2O/10% D2O' 
2 '1.25mM PDZ domain U-15N, 13C; 20mM phosphate buffer; 50mM Sodium chloride; 100% D2O'    '100% D2O'        
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             DRX 
_pdbx_nmr_spectrometer.field_strength    600 
# 
_pdbx_nmr_refine.entry_id           1XZ9 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1XZ9 
_pdbx_nmr_details.text       'The structure was determined using triple-resonance NMR spectroscopy' 
# 
_pdbx_nmr_ensemble.entry_id                                      1XZ9 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1XZ9 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XWINNMR 3.5   collection           Bruker         1 
XWINNMR 3.5   processing           Bruker         2 
Sparky  3.1   'data analysis'      ?              3 
DYANA   1.0.6 'structure solution' 'Guentert, P.' 4 
DYANA   1.0.6 refinement           'Guentert, P.' 5 
# 
_exptl.entry_id          1XZ9 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1XZ9 
_struct.title                     'Structure of AF-6 PDZ domain' 
_struct.pdbx_descriptor           Afadin 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1XZ9 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            'PDZ, AF-6, Cell adhesion' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 49 ? ASP A 54 ? GLY A 49 ASP A 54 1 ? 6  
HELX_P HELX_P2 2 SER A 75 ? ARG A 85 ? SER A 75 ARG A 85 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 11 ? VAL A 15 ? GLU A 11 VAL A 15 
A 2 VAL A 90 ? ALA A 95 ? VAL A 90 ALA A 95 
A 3 GLN A 62 ? VAL A 66 ? GLN A 62 VAL A 66 
A 4 ARG A 69 ? SER A 70 ? ARG A 69 SER A 70 
B 1 LEU A 25 ? VAL A 28 ? LEU A 25 VAL A 28 
B 2 TYR A 41 ? VAL A 45 ? TYR A 41 VAL A 45 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 15 ? N VAL A 15 O VAL A 90 ? O VAL A 90 
A 2 3 O GLU A 93 ? O GLU A 93 N LEU A 64 ? N LEU A 64 
A 3 4 N VAL A 66 ? N VAL A 66 O ARG A 69 ? O ARG A 69 
B 1 2 N SER A 26 ? N SER A 26 O SER A 44 ? O SER A 44 
# 
_database_PDB_matrix.entry_id          1XZ9 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1XZ9 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? 13.862  0.031   -4.425  1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? 14.712  -1.144  -4.516  1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? 14.089  -2.202  -5.428  1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? 13.240  -1.887  -6.261  1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? 12.999  -0.031  -4.927  1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? 15.692  -0.859  -4.899  1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? 14.867  -1.562  -3.521  1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . PRO A 1 2   ? 14.546  -3.468  -5.236  1.00 0.00 ? 2   PRO A N    1  
ATOM 9     C CA   . PRO A 1 2   ? 14.043  -4.575  -6.032  1.00 0.00 ? 2   PRO A CA   1  
ATOM 10    C C    . PRO A 1 2   ? 12.636  -4.977  -5.584  1.00 0.00 ? 2   PRO A C    1  
ATOM 11    O O    . PRO A 1 2   ? 12.363  -5.063  -4.388  1.00 0.00 ? 2   PRO A O    1  
ATOM 12    C CB   . PRO A 1 2   ? 15.065  -5.686  -5.852  1.00 0.00 ? 2   PRO A CB   1  
ATOM 13    C CG   . PRO A 1 2   ? 15.853  -5.328  -4.602  1.00 0.00 ? 2   PRO A CG   1  
ATOM 14    C CD   . PRO A 1 2   ? 15.550  -3.879  -4.259  1.00 0.00 ? 2   PRO A CD   1  
ATOM 15    H HA   . PRO A 1 2   ? 13.957  -4.302  -6.990  1.00 0.00 ? 2   PRO A HA   1  
ATOM 16    H HB2  . PRO A 1 2   ? 14.574  -6.653  -5.741  1.00 0.00 ? 2   PRO A HB2  1  
ATOM 17    H HB3  . PRO A 1 2   ? 15.720  -5.758  -6.720  1.00 0.00 ? 2   PRO A HB3  1  
ATOM 18    H HG2  . PRO A 1 2   ? 15.575  -5.982  -3.776  1.00 0.00 ? 2   PRO A HG2  1  
ATOM 19    H HG3  . PRO A 1 2   ? 16.921  -5.465  -4.773  1.00 0.00 ? 2   PRO A HG3  1  
ATOM 20    H HD2  . PRO A 1 2   ? 15.174  -3.783  -3.240  1.00 0.00 ? 2   PRO A HD2  1  
ATOM 21    H HD3  . PRO A 1 2   ? 16.445  -3.260  -4.328  1.00 0.00 ? 2   PRO A HD3  1  
ATOM 22    N N    . LEU A 1 3   ? 11.782  -5.215  -6.568  1.00 0.00 ? 3   LEU A N    1  
ATOM 23    C CA   . LEU A 1 3   ? 10.410  -5.606  -6.291  1.00 0.00 ? 3   LEU A CA   1  
ATOM 24    C C    . LEU A 1 3   ? 10.339  -7.127  -6.141  1.00 0.00 ? 3   LEU A C    1  
ATOM 25    O O    . LEU A 1 3   ? 11.225  -7.843  -6.606  1.00 0.00 ? 3   LEU A O    1  
ATOM 26    C CB   . LEU A 1 3   ? 9.467   -5.049  -7.359  1.00 0.00 ? 3   LEU A CB   1  
ATOM 27    C CG   . LEU A 1 3   ? 9.665   -5.590  -8.776  1.00 0.00 ? 3   LEU A CG   1  
ATOM 28    C CD1  . LEU A 1 3   ? 8.835   -6.856  -9.000  1.00 0.00 ? 3   LEU A CD1  1  
ATOM 29    C CD2  . LEU A 1 3   ? 9.362   -4.514  -9.821  1.00 0.00 ? 3   LEU A CD2  1  
ATOM 30    H H    . LEU A 1 3   ? 12.012  -5.143  -7.539  1.00 0.00 ? 3   LEU A H    1  
ATOM 31    H HA   . LEU A 1 3   ? 10.127  -5.152  -5.341  1.00 0.00 ? 3   LEU A HA   1  
ATOM 32    H HB2  . LEU A 1 3   ? 8.441   -5.255  -7.052  1.00 0.00 ? 3   LEU A HB2  1  
ATOM 33    H HB3  . LEU A 1 3   ? 9.581   -3.965  -7.386  1.00 0.00 ? 3   LEU A HB3  1  
ATOM 34    H HG   . LEU A 1 3   ? 10.712  -5.867  -8.893  1.00 0.00 ? 3   LEU A HG   1  
ATOM 35    H HD11 . LEU A 1 3   ? 8.984   -7.212  -10.020 1.00 0.00 ? 3   LEU A HD11 1  
ATOM 36    H HD12 . LEU A 1 3   ? 9.151   -7.627  -8.297  1.00 0.00 ? 3   LEU A HD12 1  
ATOM 37    H HD13 . LEU A 1 3   ? 7.780   -6.632  -8.844  1.00 0.00 ? 3   LEU A HD13 1  
ATOM 38    H HD21 . LEU A 1 3   ? 10.270  -4.281  -10.376 1.00 0.00 ? 3   LEU A HD21 1  
ATOM 39    H HD22 . LEU A 1 3   ? 8.600   -4.880  -10.509 1.00 0.00 ? 3   LEU A HD22 1  
ATOM 40    H HD23 . LEU A 1 3   ? 9.000   -3.615  -9.322  1.00 0.00 ? 3   LEU A HD23 1  
ATOM 41    N N    . GLY A 1 4   ? 9.277   -7.577  -5.488  1.00 0.00 ? 4   GLY A N    1  
ATOM 42    C CA   . GLY A 1 4   ? 9.079   -9.000  -5.271  1.00 0.00 ? 4   GLY A CA   1  
ATOM 43    C C    . GLY A 1 4   ? 9.864   -9.482  -4.049  1.00 0.00 ? 4   GLY A C    1  
ATOM 44    O O    . GLY A 1 4   ? 11.027  -9.122  -3.872  1.00 0.00 ? 4   GLY A O    1  
ATOM 45    H H    . GLY A 1 4   ? 8.562   -6.988  -5.112  1.00 0.00 ? 4   GLY A H    1  
ATOM 46    H HA2  . GLY A 1 4   ? 8.018   -9.206  -5.130  1.00 0.00 ? 4   GLY A HA2  1  
ATOM 47    H HA3  . GLY A 1 4   ? 9.397   -9.554  -6.154  1.00 0.00 ? 4   GLY A HA3  1  
ATOM 48    N N    . SER A 1 5   ? 9.197   -10.291 -3.239  1.00 0.00 ? 5   SER A N    1  
ATOM 49    C CA   . SER A 1 5   ? 9.818   -10.826 -2.039  1.00 0.00 ? 5   SER A CA   1  
ATOM 50    C C    . SER A 1 5   ? 9.248   -12.212 -1.729  1.00 0.00 ? 5   SER A C    1  
ATOM 51    O O    . SER A 1 5   ? 9.962   -13.211 -1.799  1.00 0.00 ? 5   SER A O    1  
ATOM 52    C CB   . SER A 1 5   ? 9.613   -9.889  -0.847  1.00 0.00 ? 5   SER A CB   1  
ATOM 53    O OG   . SER A 1 5   ? 10.839  -9.590  -0.187  1.00 0.00 ? 5   SER A OG   1  
ATOM 54    H H    . SER A 1 5   ? 8.252   -10.579 -3.390  1.00 0.00 ? 5   SER A H    1  
ATOM 55    H HA   . SER A 1 5   ? 10.881  -10.893 -2.270  1.00 0.00 ? 5   SER A HA   1  
ATOM 56    H HB2  . SER A 1 5   ? 9.150   -8.963  -1.190  1.00 0.00 ? 5   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 5   ? 8.922   -10.348 -0.140  1.00 0.00 ? 5   SER A HB3  1  
ATOM 58    H HG   . SER A 1 5   ? 11.425  -9.041  -0.784  1.00 0.00 ? 5   SER A HG   1  
ATOM 59    N N    . LEU A 1 6   ? 7.966   -12.227 -1.393  1.00 0.00 ? 6   LEU A N    1  
ATOM 60    C CA   . LEU A 1 6   ? 7.292   -13.474 -1.072  1.00 0.00 ? 6   LEU A CA   1  
ATOM 61    C C    . LEU A 1 6   ? 6.032   -13.603 -1.931  1.00 0.00 ? 6   LEU A C    1  
ATOM 62    O O    . LEU A 1 6   ? 5.678   -12.680 -2.662  1.00 0.00 ? 6   LEU A O    1  
ATOM 63    C CB   . LEU A 1 6   ? 7.023   -13.566 0.432   1.00 0.00 ? 6   LEU A CB   1  
ATOM 64    C CG   . LEU A 1 6   ? 8.254   -13.500 1.338   1.00 0.00 ? 6   LEU A CG   1  
ATOM 65    C CD1  . LEU A 1 6   ? 8.421   -12.101 1.935   1.00 0.00 ? 6   LEU A CD1  1  
ATOM 66    C CD2  . LEU A 1 6   ? 8.197   -14.581 2.419   1.00 0.00 ? 6   LEU A CD2  1  
ATOM 67    H H    . LEU A 1 6   ? 7.392   -11.410 -1.338  1.00 0.00 ? 6   LEU A H    1  
ATOM 68    H HA   . LEU A 1 6   ? 7.970   -14.288 -1.328  1.00 0.00 ? 6   LEU A HA   1  
ATOM 69    H HB2  . LEU A 1 6   ? 6.347   -12.757 0.710   1.00 0.00 ? 6   LEU A HB2  1  
ATOM 70    H HB3  . LEU A 1 6   ? 6.500   -14.501 0.631   1.00 0.00 ? 6   LEU A HB3  1  
ATOM 71    H HG   . LEU A 1 6   ? 9.137   -13.698 0.731   1.00 0.00 ? 6   LEU A HG   1  
ATOM 72    H HD11 . LEU A 1 6   ? 7.553   -11.492 1.682   1.00 0.00 ? 6   LEU A HD11 1  
ATOM 73    H HD12 . LEU A 1 6   ? 8.509   -12.176 3.019   1.00 0.00 ? 6   LEU A HD12 1  
ATOM 74    H HD13 . LEU A 1 6   ? 9.320   -11.638 1.529   1.00 0.00 ? 6   LEU A HD13 1  
ATOM 75    H HD21 . LEU A 1 6   ? 8.499   -15.537 1.993   1.00 0.00 ? 6   LEU A HD21 1  
ATOM 76    H HD22 . LEU A 1 6   ? 8.872   -14.316 3.233   1.00 0.00 ? 6   LEU A HD22 1  
ATOM 77    H HD23 . LEU A 1 6   ? 7.179   -14.659 2.802   1.00 0.00 ? 6   LEU A HD23 1  
ATOM 78    N N    . ARG A 1 7   ? 5.390   -14.756 -1.813  1.00 0.00 ? 7   ARG A N    1  
ATOM 79    C CA   . ARG A 1 7   ? 4.178   -15.018 -2.569  1.00 0.00 ? 7   ARG A CA   1  
ATOM 80    C C    . ARG A 1 7   ? 2.971   -14.383 -1.875  1.00 0.00 ? 7   ARG A C    1  
ATOM 81    O O    . ARG A 1 7   ? 2.275   -13.557 -2.463  1.00 0.00 ? 7   ARG A O    1  
ATOM 82    C CB   . ARG A 1 7   ? 3.937   -16.521 -2.721  1.00 0.00 ? 7   ARG A CB   1  
ATOM 83    C CG   . ARG A 1 7   ? 4.855   -17.118 -3.790  1.00 0.00 ? 7   ARG A CG   1  
ATOM 84    C CD   . ARG A 1 7   ? 4.042   -17.754 -4.919  1.00 0.00 ? 7   ARG A CD   1  
ATOM 85    N NE   . ARG A 1 7   ? 4.815   -17.721 -6.180  1.00 0.00 ? 7   ARG A NE   1  
ATOM 86    C CZ   . ARG A 1 7   ? 5.906   -18.464 -6.412  1.00 0.00 ? 7   ARG A CZ   1  
ATOM 87    N NH1  . ARG A 1 7   ? 6.359   -19.302 -5.470  1.00 0.00 ? 7   ARG A NH1  1  
ATOM 88    N NH2  . ARG A 1 7   ? 6.544   -18.369 -7.587  1.00 0.00 ? 7   ARG A NH2  1  
ATOM 89    H H    . ARG A 1 7   ? 5.685   -15.502 -1.215  1.00 0.00 ? 7   ARG A H    1  
ATOM 90    H HA   . ARG A 1 7   ? 4.353   -14.563 -3.544  1.00 0.00 ? 7   ARG A HA   1  
ATOM 91    H HB2  . ARG A 1 7   ? 4.112   -17.019 -1.768  1.00 0.00 ? 7   ARG A HB2  1  
ATOM 92    H HB3  . ARG A 1 7   ? 2.896   -16.702 -2.989  1.00 0.00 ? 7   ARG A HB3  1  
ATOM 93    H HG2  . ARG A 1 7   ? 5.501   -16.339 -4.196  1.00 0.00 ? 7   ARG A HG2  1  
ATOM 94    H HG3  . ARG A 1 7   ? 5.505   -17.868 -3.339  1.00 0.00 ? 7   ARG A HG3  1  
ATOM 95    H HD2  . ARG A 1 7   ? 3.791   -18.783 -4.663  1.00 0.00 ? 7   ARG A HD2  1  
ATOM 96    H HD3  . ARG A 1 7   ? 3.101   -17.219 -5.046  1.00 0.00 ? 7   ARG A HD3  1  
ATOM 97    H HE   . ARG A 1 7   ? 4.504   -17.106 -6.905  1.00 0.00 ? 7   ARG A HE   1  
ATOM 98    H HH11 . ARG A 1 7   ? 5.882   -19.373 -4.593  1.00 0.00 ? 7   ARG A HH11 1  
ATOM 99    H HH12 . ARG A 1 7   ? 7.173   -19.857 -5.642  1.00 0.00 ? 7   ARG A HH12 1  
ATOM 100   H HH21 . ARG A 1 7   ? 6.207   -17.744 -8.290  1.00 0.00 ? 7   ARG A HH21 1  
ATOM 101   H HH22 . ARG A 1 7   ? 7.358   -18.924 -7.760  1.00 0.00 ? 7   ARG A HH22 1  
ATOM 102   N N    . LYS A 1 8   ? 2.760   -14.794 -0.633  1.00 0.00 ? 8   LYS A N    1  
ATOM 103   C CA   . LYS A 1 8   ? 1.650   -14.275 0.148   1.00 0.00 ? 8   LYS A CA   1  
ATOM 104   C C    . LYS A 1 8   ? 0.350   -14.455 -0.639  1.00 0.00 ? 8   LYS A C    1  
ATOM 105   O O    . LYS A 1 8   ? 0.373   -14.881 -1.793  1.00 0.00 ? 8   LYS A O    1  
ATOM 106   C CB   . LYS A 1 8   ? 1.919   -12.829 0.568   1.00 0.00 ? 8   LYS A CB   1  
ATOM 107   C CG   . LYS A 1 8   ? 3.241   -12.717 1.331   1.00 0.00 ? 8   LYS A CG   1  
ATOM 108   C CD   . LYS A 1 8   ? 3.052   -13.065 2.809   1.00 0.00 ? 8   LYS A CD   1  
ATOM 109   C CE   . LYS A 1 8   ? 4.378   -13.484 3.447   1.00 0.00 ? 8   LYS A CE   1  
ATOM 110   N NZ   . LYS A 1 8   ? 4.194   -14.698 4.275   1.00 0.00 ? 8   LYS A NZ   1  
ATOM 111   H H    . LYS A 1 8   ? 3.331   -15.466 -0.162  1.00 0.00 ? 8   LYS A H    1  
ATOM 112   H HA   . LYS A 1 8   ? 1.586   -14.869 1.060   1.00 0.00 ? 8   LYS A HA   1  
ATOM 113   H HB2  . LYS A 1 8   ? 1.949   -12.189 -0.314  1.00 0.00 ? 8   LYS A HB2  1  
ATOM 114   H HB3  . LYS A 1 8   ? 1.102   -12.470 1.194   1.00 0.00 ? 8   LYS A HB3  1  
ATOM 115   H HG2  . LYS A 1 8   ? 3.978   -13.386 0.888   1.00 0.00 ? 8   LYS A HG2  1  
ATOM 116   H HG3  . LYS A 1 8   ? 3.633   -11.704 1.240   1.00 0.00 ? 8   LYS A HG3  1  
ATOM 117   H HD2  . LYS A 1 8   ? 2.645   -12.204 3.340   1.00 0.00 ? 8   LYS A HD2  1  
ATOM 118   H HD3  . LYS A 1 8   ? 2.326   -13.872 2.907   1.00 0.00 ? 8   LYS A HD3  1  
ATOM 119   H HE2  . LYS A 1 8   ? 5.118   -13.675 2.670   1.00 0.00 ? 8   LYS A HE2  1  
ATOM 120   H HE3  . LYS A 1 8   ? 4.764   -12.672 4.063   1.00 0.00 ? 8   LYS A HE3  1  
ATOM 121   H HZ1  . LYS A 1 8   ? 4.835   -15.405 3.976   1.00 0.00 ? 8   LYS A HZ1  1  
ATOM 122   H HZ2  . LYS A 1 8   ? 4.366   -14.476 5.234   1.00 0.00 ? 8   LYS A HZ2  1  
ATOM 123   H HZ3  . LYS A 1 8   ? 3.257   -15.032 4.172   1.00 0.00 ? 8   LYS A HZ3  1  
ATOM 124   N N    . GLU A 1 9   ? -0.752  -14.121 0.015   1.00 0.00 ? 9   GLU A N    1  
ATOM 125   C CA   . GLU A 1 9   ? -2.058  -14.240 -0.609  1.00 0.00 ? 9   GLU A CA   1  
ATOM 126   C C    . GLU A 1 9   ? -2.285  -13.088 -1.591  1.00 0.00 ? 9   GLU A C    1  
ATOM 127   O O    . GLU A 1 9   ? -2.597  -13.315 -2.759  1.00 0.00 ? 9   GLU A O    1  
ATOM 128   C CB   . GLU A 1 9   ? -3.167  -14.289 0.444   1.00 0.00 ? 9   GLU A CB   1  
ATOM 129   C CG   . GLU A 1 9   ? -4.006  -15.560 0.298   1.00 0.00 ? 9   GLU A CG   1  
ATOM 130   C CD   . GLU A 1 9   ? -4.584  -15.992 1.647   1.00 0.00 ? 9   GLU A CD   1  
ATOM 131   O OE1  . GLU A 1 9   ? -4.099  -15.461 2.669   1.00 0.00 ? 9   GLU A OE1  1  
ATOM 132   O OE2  . GLU A 1 9   ? -5.498  -16.845 1.626   1.00 0.00 ? 9   GLU A OE2  1  
ATOM 133   H H    . GLU A 1 9   ? -0.762  -13.775 0.953   1.00 0.00 ? 9   GLU A H    1  
ATOM 134   H HA   . GLU A 1 9   ? -2.037  -15.186 -1.149  1.00 0.00 ? 9   GLU A HA   1  
ATOM 135   H HB2  . GLU A 1 9   ? -2.729  -14.250 1.441   1.00 0.00 ? 9   GLU A HB2  1  
ATOM 136   H HB3  . GLU A 1 9   ? -3.808  -13.412 0.343   1.00 0.00 ? 9   GLU A HB3  1  
ATOM 137   H HG2  . GLU A 1 9   ? -4.816  -15.386 -0.410  1.00 0.00 ? 9   GLU A HG2  1  
ATOM 138   H HG3  . GLU A 1 9   ? -3.391  -16.361 -0.111  1.00 0.00 ? 9   GLU A HG3  1  
ATOM 139   N N    . PRO A 1 10  ? -2.114  -11.844 -1.067  1.00 0.00 ? 10  PRO A N    1  
ATOM 140   C CA   . PRO A 1 10  ? -2.296  -10.657 -1.883  1.00 0.00 ? 10  PRO A CA   1  
ATOM 141   C C    . PRO A 1 10  ? -1.113  -10.457 -2.832  1.00 0.00 ? 10  PRO A C    1  
ATOM 142   O O    . PRO A 1 10  ? -1.124  -10.952 -3.958  1.00 0.00 ? 10  PRO A O    1  
ATOM 143   C CB   . PRO A 1 10  ? -2.461  -9.518  -0.890  1.00 0.00 ? 10  PRO A CB   1  
ATOM 144   C CG   . PRO A 1 10  ? -1.903  -10.030 0.428   1.00 0.00 ? 10  PRO A CG   1  
ATOM 145   C CD   . PRO A 1 10  ? -1.745  -11.538 0.312   1.00 0.00 ? 10  PRO A CD   1  
ATOM 146   H HA   . PRO A 1 10  ? -3.101  -10.757 -2.468  1.00 0.00 ? 10  PRO A HA   1  
ATOM 147   H HB2  . PRO A 1 10  ? -1.923  -8.629  -1.222  1.00 0.00 ? 10  PRO A HB2  1  
ATOM 148   H HB3  . PRO A 1 10  ? -3.509  -9.237  -0.788  1.00 0.00 ? 10  PRO A HB3  1  
ATOM 149   H HG2  . PRO A 1 10  ? -0.944  -9.561  0.645   1.00 0.00 ? 10  PRO A HG2  1  
ATOM 150   H HG3  . PRO A 1 10  ? -2.574  -9.779  1.250   1.00 0.00 ? 10  PRO A HG3  1  
ATOM 151   H HD2  . PRO A 1 10  ? -0.722  -11.846 0.526   1.00 0.00 ? 10  PRO A HD2  1  
ATOM 152   H HD3  . PRO A 1 10  ? -2.389  -12.059 1.020   1.00 0.00 ? 10  PRO A HD3  1  
ATOM 153   N N    . GLU A 1 11  ? -0.119  -9.730  -2.342  1.00 0.00 ? 11  GLU A N    1  
ATOM 154   C CA   . GLU A 1 11  ? 1.070   -9.458  -3.132  1.00 0.00 ? 11  GLU A CA   1  
ATOM 155   C C    . GLU A 1 11  ? 0.821   -8.282  -4.078  1.00 0.00 ? 11  GLU A C    1  
ATOM 156   O O    . GLU A 1 11  ? 1.323   -7.182  -3.853  1.00 0.00 ? 11  GLU A O    1  
ATOM 157   C CB   . GLU A 1 11  ? 1.509   -10.702 -3.907  1.00 0.00 ? 11  GLU A CB   1  
ATOM 158   C CG   . GLU A 1 11  ? 3.032   -10.753 -4.045  1.00 0.00 ? 11  GLU A CG   1  
ATOM 159   C CD   . GLU A 1 11  ? 3.441   -11.094 -5.480  1.00 0.00 ? 11  GLU A CD   1  
ATOM 160   O OE1  . GLU A 1 11  ? 2.750   -10.605 -6.399  1.00 0.00 ? 11  GLU A OE1  1  
ATOM 161   O OE2  . GLU A 1 11  ? 4.436   -11.837 -5.624  1.00 0.00 ? 11  GLU A OE2  1  
ATOM 162   H H    . GLU A 1 11  ? -0.118  -9.330  -1.425  1.00 0.00 ? 11  GLU A H    1  
ATOM 163   H HA   . GLU A 1 11  ? 1.843   -9.196  -2.410  1.00 0.00 ? 11  GLU A HA   1  
ATOM 164   H HB2  . GLU A 1 11  ? 1.157   -11.597 -3.395  1.00 0.00 ? 11  GLU A HB2  1  
ATOM 165   H HB3  . GLU A 1 11  ? 1.050   -10.700 -4.896  1.00 0.00 ? 11  GLU A HB3  1  
ATOM 166   H HG2  . GLU A 1 11  ? 3.458   -9.791  -3.761  1.00 0.00 ? 11  GLU A HG2  1  
ATOM 167   H HG3  . GLU A 1 11  ? 3.438   -11.497 -3.361  1.00 0.00 ? 11  GLU A HG3  1  
ATOM 168   N N    . ILE A 1 12  ? 0.046   -8.554  -5.118  1.00 0.00 ? 12  ILE A N    1  
ATOM 169   C CA   . ILE A 1 12  ? -0.276  -7.532  -6.099  1.00 0.00 ? 12  ILE A CA   1  
ATOM 170   C C    . ILE A 1 12  ? -1.735  -7.105  -5.925  1.00 0.00 ? 12  ILE A C    1  
ATOM 171   O O    . ILE A 1 12  ? -2.649  -7.837  -6.301  1.00 0.00 ? 12  ILE A O    1  
ATOM 172   C CB   . ILE A 1 12  ? 0.058   -8.020  -7.510  1.00 0.00 ? 12  ILE A CB   1  
ATOM 173   C CG1  . ILE A 1 12  ? -0.001  -6.869  -8.517  1.00 0.00 ? 12  ILE A CG1  1  
ATOM 174   C CG2  . ILE A 1 12  ? -0.848  -9.184  -7.916  1.00 0.00 ? 12  ILE A CG2  1  
ATOM 175   C CD1  . ILE A 1 12  ? 0.998   -7.085  -9.655  1.00 0.00 ? 12  ILE A CD1  1  
ATOM 176   H H    . ILE A 1 12  ? -0.359  -9.451  -5.294  1.00 0.00 ? 12  ILE A H    1  
ATOM 177   H HA   . ILE A 1 12  ? 0.363   -6.672  -5.896  1.00 0.00 ? 12  ILE A HA   1  
ATOM 178   H HB   . ILE A 1 12  ? 1.082   -8.394  -7.509  1.00 0.00 ? 12  ILE A HB   1  
ATOM 179   H HG12 . ILE A 1 12  ? -1.009  -6.789  -8.924  1.00 0.00 ? 12  ILE A HG12 1  
ATOM 180   H HG13 . ILE A 1 12  ? 0.214   -5.928  -8.012  1.00 0.00 ? 12  ILE A HG13 1  
ATOM 181   H HG21 . ILE A 1 12  ? -1.855  -8.812  -8.104  1.00 0.00 ? 12  ILE A HG21 1  
ATOM 182   H HG22 . ILE A 1 12  ? -0.458  -9.650  -8.822  1.00 0.00 ? 12  ILE A HG22 1  
ATOM 183   H HG23 . ILE A 1 12  ? -0.876  -9.920  -7.113  1.00 0.00 ? 12  ILE A HG23 1  
ATOM 184   H HD11 . ILE A 1 12  ? 0.480   -7.495  -10.522 1.00 0.00 ? 12  ILE A HD11 1  
ATOM 185   H HD12 . ILE A 1 12  ? 1.454   -6.131  -9.923  1.00 0.00 ? 12  ILE A HD12 1  
ATOM 186   H HD13 . ILE A 1 12  ? 1.773   -7.780  -9.332  1.00 0.00 ? 12  ILE A HD13 1  
ATOM 187   N N    . ILE A 1 13  ? -1.907  -5.921  -5.356  1.00 0.00 ? 13  ILE A N    1  
ATOM 188   C CA   . ILE A 1 13  ? -3.239  -5.387  -5.128  1.00 0.00 ? 13  ILE A CA   1  
ATOM 189   C C    . ILE A 1 13  ? -3.493  -4.230  -6.095  1.00 0.00 ? 13  ILE A C    1  
ATOM 190   O O    . ILE A 1 13  ? -2.687  -3.306  -6.189  1.00 0.00 ? 13  ILE A O    1  
ATOM 191   C CB   . ILE A 1 13  ? -3.420  -5.010  -3.656  1.00 0.00 ? 13  ILE A CB   1  
ATOM 192   C CG1  . ILE A 1 13  ? -3.505  -6.258  -2.776  1.00 0.00 ? 13  ILE A CG1  1  
ATOM 193   C CG2  . ILE A 1 13  ? -4.632  -4.094  -3.470  1.00 0.00 ? 13  ILE A CG2  1  
ATOM 194   C CD1  . ILE A 1 13  ? -4.721  -7.110  -3.148  1.00 0.00 ? 13  ILE A CD1  1  
ATOM 195   H H    . ILE A 1 13  ? -1.158  -5.331  -5.054  1.00 0.00 ? 13  ILE A H    1  
ATOM 196   H HA   . ILE A 1 13  ? -3.952  -6.183  -5.346  1.00 0.00 ? 13  ILE A HA   1  
ATOM 197   H HB   . ILE A 1 13  ? -2.542  -4.450  -3.337  1.00 0.00 ? 13  ILE A HB   1  
ATOM 198   H HG12 . ILE A 1 13  ? -2.596  -6.849  -2.888  1.00 0.00 ? 13  ILE A HG12 1  
ATOM 199   H HG13 . ILE A 1 13  ? -3.568  -5.966  -1.728  1.00 0.00 ? 13  ILE A HG13 1  
ATOM 200   H HG21 . ILE A 1 13  ? -4.879  -4.029  -2.410  1.00 0.00 ? 13  ILE A HG21 1  
ATOM 201   H HG22 . ILE A 1 13  ? -4.397  -3.100  -3.850  1.00 0.00 ? 13  ILE A HG22 1  
ATOM 202   H HG23 . ILE A 1 13  ? -5.482  -4.501  -4.017  1.00 0.00 ? 13  ILE A HG23 1  
ATOM 203   H HD11 . ILE A 1 13  ? -5.318  -7.300  -2.255  1.00 0.00 ? 13  ILE A HD11 1  
ATOM 204   H HD12 . ILE A 1 13  ? -5.326  -6.578  -3.883  1.00 0.00 ? 13  ILE A HD12 1  
ATOM 205   H HD13 . ILE A 1 13  ? -4.386  -8.057  -3.569  1.00 0.00 ? 13  ILE A HD13 1  
ATOM 206   N N    . THR A 1 14  ? -4.617  -4.318  -6.791  1.00 0.00 ? 14  THR A N    1  
ATOM 207   C CA   . THR A 1 14  ? -4.988  -3.289  -7.748  1.00 0.00 ? 14  THR A CA   1  
ATOM 208   C C    . THR A 1 14  ? -6.506  -3.099  -7.766  1.00 0.00 ? 14  THR A C    1  
ATOM 209   O O    . THR A 1 14  ? -7.256  -4.072  -7.827  1.00 0.00 ? 14  THR A O    1  
ATOM 210   C CB   . THR A 1 14  ? -4.408  -3.680  -9.109  1.00 0.00 ? 14  THR A CB   1  
ATOM 211   O OG1  . THR A 1 14  ? -4.942  -2.708  -10.005 1.00 0.00 ? 14  THR A OG1  1  
ATOM 212   C CG2  . THR A 1 14  ? -4.966  -5.008  -9.625  1.00 0.00 ? 14  THR A CG2  1  
ATOM 213   H H    . THR A 1 14  ? -5.268  -5.073  -6.709  1.00 0.00 ? 14  THR A H    1  
ATOM 214   H HA   . THR A 1 14  ? -4.551  -2.345  -7.424  1.00 0.00 ? 14  THR A HA   1  
ATOM 215   H HB   . THR A 1 14  ? -3.319  -3.701  -9.077  1.00 0.00 ? 14  THR A HB   1  
ATOM 216   H HG1  . THR A 1 14  ? -4.792  -1.789  -9.642  1.00 0.00 ? 14  THR A HG1  1  
ATOM 217   H HG21 . THR A 1 14  ? -5.893  -4.826  -10.169 1.00 0.00 ? 14  THR A HG21 1  
ATOM 218   H HG22 . THR A 1 14  ? -4.240  -5.473  -10.290 1.00 0.00 ? 14  THR A HG22 1  
ATOM 219   H HG23 . THR A 1 14  ? -5.164  -5.670  -8.782  1.00 0.00 ? 14  THR A HG23 1  
ATOM 220   N N    . VAL A 1 15  ? -6.913  -1.839  -7.712  1.00 0.00 ? 15  VAL A N    1  
ATOM 221   C CA   . VAL A 1 15  ? -8.327  -1.509  -7.721  1.00 0.00 ? 15  VAL A CA   1  
ATOM 222   C C    . VAL A 1 15  ? -8.524  -0.146  -8.387  1.00 0.00 ? 15  VAL A C    1  
ATOM 223   O O    . VAL A 1 15  ? -7.682  0.741   -8.255  1.00 0.00 ? 15  VAL A O    1  
ATOM 224   C CB   . VAL A 1 15  ? -8.887  -1.565  -6.298  1.00 0.00 ? 15  VAL A CB   1  
ATOM 225   C CG1  . VAL A 1 15  ? -8.769  -2.976  -5.718  1.00 0.00 ? 15  VAL A CG1  1  
ATOM 226   C CG2  . VAL A 1 15  ? -8.196  -0.542  -5.396  1.00 0.00 ? 15  VAL A CG2  1  
ATOM 227   H H    . VAL A 1 15  ? -6.296  -1.054  -7.662  1.00 0.00 ? 15  VAL A H    1  
ATOM 228   H HA   . VAL A 1 15  ? -8.838  -2.267  -8.315  1.00 0.00 ? 15  VAL A HA   1  
ATOM 229   H HB   . VAL A 1 15  ? -9.946  -1.310  -6.344  1.00 0.00 ? 15  VAL A HB   1  
ATOM 230   H HG11 . VAL A 1 15  ? -9.401  -3.060  -4.834  1.00 0.00 ? 15  VAL A HG11 1  
ATOM 231   H HG12 . VAL A 1 15  ? -9.090  -3.704  -6.464  1.00 0.00 ? 15  VAL A HG12 1  
ATOM 232   H HG13 . VAL A 1 15  ? -7.732  -3.170  -5.444  1.00 0.00 ? 15  VAL A HG13 1  
ATOM 233   H HG21 . VAL A 1 15  ? -7.123  -0.737  -5.380  1.00 0.00 ? 15  VAL A HG21 1  
ATOM 234   H HG22 . VAL A 1 15  ? -8.376  0.462   -5.780  1.00 0.00 ? 15  VAL A HG22 1  
ATOM 235   H HG23 . VAL A 1 15  ? -8.594  -0.621  -4.384  1.00 0.00 ? 15  VAL A HG23 1  
ATOM 236   N N    . THR A 1 16  ? -9.641  -0.021  -9.089  1.00 0.00 ? 16  THR A N    1  
ATOM 237   C CA   . THR A 1 16  ? -9.959  1.219   -9.776  1.00 0.00 ? 16  THR A CA   1  
ATOM 238   C C    . THR A 1 16  ? -10.461 2.267   -8.780  1.00 0.00 ? 16  THR A C    1  
ATOM 239   O O    . THR A 1 16  ? -11.561 2.142   -8.244  1.00 0.00 ? 16  THR A O    1  
ATOM 240   C CB   . THR A 1 16  ? -10.966 0.901   -10.883 1.00 0.00 ? 16  THR A CB   1  
ATOM 241   O OG1  . THR A 1 16  ? -11.990 0.164   -10.220 1.00 0.00 ? 16  THR A OG1  1  
ATOM 242   C CG2  . THR A 1 16  ? -10.410 -0.080  -11.917 1.00 0.00 ? 16  THR A CG2  1  
ATOM 243   H H    . THR A 1 16  ? -10.321 -0.748  -9.191  1.00 0.00 ? 16  THR A H    1  
ATOM 244   H HA   . THR A 1 16  ? -9.043  1.611   -10.218 1.00 0.00 ? 16  THR A HA   1  
ATOM 245   H HB   . THR A 1 16  ? -11.318 1.815   -11.363 1.00 0.00 ? 16  THR A HB   1  
ATOM 246   H HG1  . THR A 1 16  ? -12.410 0.726   -9.508  1.00 0.00 ? 16  THR A HG1  1  
ATOM 247   H HG21 . THR A 1 16  ? -9.413  -0.399  -11.615 1.00 0.00 ? 16  THR A HG21 1  
ATOM 248   H HG22 . THR A 1 16  ? -11.065 -0.949  -11.982 1.00 0.00 ? 16  THR A HG22 1  
ATOM 249   H HG23 . THR A 1 16  ? -10.357 0.409   -12.890 1.00 0.00 ? 16  THR A HG23 1  
ATOM 250   N N    . LEU A 1 17  ? -9.630  3.276   -8.563  1.00 0.00 ? 17  LEU A N    1  
ATOM 251   C CA   . LEU A 1 17  ? -9.975  4.344   -7.641  1.00 0.00 ? 17  LEU A CA   1  
ATOM 252   C C    . LEU A 1 17  ? -11.160 5.133   -8.203  1.00 0.00 ? 17  LEU A C    1  
ATOM 253   O O    . LEU A 1 17  ? -12.005 4.577   -8.903  1.00 0.00 ? 17  LEU A O    1  
ATOM 254   C CB   . LEU A 1 17  ? -8.749  5.209   -7.339  1.00 0.00 ? 17  LEU A CB   1  
ATOM 255   C CG   . LEU A 1 17  ? -8.764  5.949   -6.001  1.00 0.00 ? 17  LEU A CG   1  
ATOM 256   C CD1  . LEU A 1 17  ? -8.529  7.448   -6.200  1.00 0.00 ? 17  LEU A CD1  1  
ATOM 257   C CD2  . LEU A 1 17  ? -10.058 5.669   -5.234  1.00 0.00 ? 17  LEU A CD2  1  
ATOM 258   H H    . LEU A 1 17  ? -8.737  3.369   -9.003  1.00 0.00 ? 17  LEU A H    1  
ATOM 259   H HA   . LEU A 1 17  ? -10.282 3.881   -6.704  1.00 0.00 ? 17  LEU A HA   1  
ATOM 260   H HB2  . LEU A 1 17  ? -7.865  4.573   -7.370  1.00 0.00 ? 17  LEU A HB2  1  
ATOM 261   H HB3  . LEU A 1 17  ? -8.642  5.943   -8.137  1.00 0.00 ? 17  LEU A HB3  1  
ATOM 262   H HG   . LEU A 1 17  ? -7.942  5.572   -5.392  1.00 0.00 ? 17  LEU A HG   1  
ATOM 263   H HD11 . LEU A 1 17  ? -9.473  7.982   -6.090  1.00 0.00 ? 17  LEU A HD11 1  
ATOM 264   H HD12 . LEU A 1 17  ? -7.819  7.807   -5.455  1.00 0.00 ? 17  LEU A HD12 1  
ATOM 265   H HD13 . LEU A 1 17  ? -8.127  7.622   -7.198  1.00 0.00 ? 17  LEU A HD13 1  
ATOM 266   H HD21 . LEU A 1 17  ? -10.311 6.534   -4.620  1.00 0.00 ? 17  LEU A HD21 1  
ATOM 267   H HD22 . LEU A 1 17  ? -10.865 5.477   -5.940  1.00 0.00 ? 17  LEU A HD22 1  
ATOM 268   H HD23 . LEU A 1 17  ? -9.920  4.798   -4.593  1.00 0.00 ? 17  LEU A HD23 1  
ATOM 269   N N    . LYS A 1 18  ? -11.185 6.416   -7.874  1.00 0.00 ? 18  LYS A N    1  
ATOM 270   C CA   . LYS A 1 18  ? -12.252 7.287   -8.336  1.00 0.00 ? 18  LYS A CA   1  
ATOM 271   C C    . LYS A 1 18  ? -13.581 6.820   -7.738  1.00 0.00 ? 18  LYS A C    1  
ATOM 272   O O    . LYS A 1 18  ? -14.640 7.336   -8.092  1.00 0.00 ? 18  LYS A O    1  
ATOM 273   C CB   . LYS A 1 18  ? -12.259 7.362   -9.865  1.00 0.00 ? 18  LYS A CB   1  
ATOM 274   C CG   . LYS A 1 18  ? -13.142 8.511   -10.354 1.00 0.00 ? 18  LYS A CG   1  
ATOM 275   C CD   . LYS A 1 18  ? -14.349 7.983   -11.132 1.00 0.00 ? 18  LYS A CD   1  
ATOM 276   C CE   . LYS A 1 18  ? -15.389 9.084   -11.344 1.00 0.00 ? 18  LYS A CE   1  
ATOM 277   N NZ   . LYS A 1 18  ? -15.527 9.397   -12.784 1.00 0.00 ? 18  LYS A NZ   1  
ATOM 278   H H    . LYS A 1 18  ? -10.494 6.861   -7.304  1.00 0.00 ? 18  LYS A H    1  
ATOM 279   H HA   . LYS A 1 18  ? -12.040 8.290   -7.966  1.00 0.00 ? 18  LYS A HA   1  
ATOM 280   H HB2  . LYS A 1 18  ? -11.241 7.499   -10.230 1.00 0.00 ? 18  LYS A HB2  1  
ATOM 281   H HB3  . LYS A 1 18  ? -12.620 6.420   -10.277 1.00 0.00 ? 18  LYS A HB3  1  
ATOM 282   H HG2  . LYS A 1 18  ? -13.483 9.100   -9.502  1.00 0.00 ? 18  LYS A HG2  1  
ATOM 283   H HG3  . LYS A 1 18  ? -12.558 9.178   -10.989 1.00 0.00 ? 18  LYS A HG3  1  
ATOM 284   H HD2  . LYS A 1 18  ? -14.022 7.595   -12.097 1.00 0.00 ? 18  LYS A HD2  1  
ATOM 285   H HD3  . LYS A 1 18  ? -14.799 7.151   -10.590 1.00 0.00 ? 18  LYS A HD3  1  
ATOM 286   H HE2  . LYS A 1 18  ? -16.351 8.767   -10.941 1.00 0.00 ? 18  LYS A HE2  1  
ATOM 287   H HE3  . LYS A 1 18  ? -15.095 9.981   -10.797 1.00 0.00 ? 18  LYS A HE3  1  
ATOM 288   H HZ1  . LYS A 1 18  ? -14.701 9.863   -13.104 1.00 0.00 ? 18  LYS A HZ1  1  
ATOM 289   H HZ2  . LYS A 1 18  ? -15.652 8.549   -13.299 1.00 0.00 ? 18  LYS A HZ2  1  
ATOM 290   H HZ3  . LYS A 1 18  ? -16.319 9.991   -12.922 1.00 0.00 ? 18  LYS A HZ3  1  
ATOM 291   N N    . LYS A 1 19  ? -13.481 5.849   -6.842  1.00 0.00 ? 19  LYS A N    1  
ATOM 292   C CA   . LYS A 1 19  ? -14.662 5.307   -6.192  1.00 0.00 ? 19  LYS A CA   1  
ATOM 293   C C    . LYS A 1 19  ? -15.381 6.426   -5.436  1.00 0.00 ? 19  LYS A C    1  
ATOM 294   O O    . LYS A 1 19  ? -15.889 7.365   -6.046  1.00 0.00 ? 19  LYS A O    1  
ATOM 295   C CB   . LYS A 1 19  ? -14.288 4.112   -5.312  1.00 0.00 ? 19  LYS A CB   1  
ATOM 296   C CG   . LYS A 1 19  ? -15.538 3.430   -4.754  1.00 0.00 ? 19  LYS A CG   1  
ATOM 297   C CD   . LYS A 1 19  ? -15.503 1.923   -5.015  1.00 0.00 ? 19  LYS A CD   1  
ATOM 298   C CE   . LYS A 1 19  ? -15.643 1.621   -6.508  1.00 0.00 ? 19  LYS A CE   1  
ATOM 299   N NZ   . LYS A 1 19  ? -15.672 0.160   -6.742  1.00 0.00 ? 19  LYS A NZ   1  
ATOM 300   H H    . LYS A 1 19  ? -12.616 5.435   -6.560  1.00 0.00 ? 19  LYS A H    1  
ATOM 301   H HA   . LYS A 1 19  ? -15.324 4.936   -6.974  1.00 0.00 ? 19  LYS A HA   1  
ATOM 302   H HB2  . LYS A 1 19  ? -13.706 3.396   -5.892  1.00 0.00 ? 19  LYS A HB2  1  
ATOM 303   H HB3  . LYS A 1 19  ? -13.653 4.445   -4.491  1.00 0.00 ? 19  LYS A HB3  1  
ATOM 304   H HG2  . LYS A 1 19  ? -15.610 3.615   -3.682  1.00 0.00 ? 19  LYS A HG2  1  
ATOM 305   H HG3  . LYS A 1 19  ? -16.428 3.861   -5.212  1.00 0.00 ? 19  LYS A HG3  1  
ATOM 306   H HD2  . LYS A 1 19  ? -14.567 1.507   -4.642  1.00 0.00 ? 19  LYS A HD2  1  
ATOM 307   H HD3  . LYS A 1 19  ? -16.309 1.436   -4.465  1.00 0.00 ? 19  LYS A HD3  1  
ATOM 308   H HE2  . LYS A 1 19  ? -16.555 2.076   -6.893  1.00 0.00 ? 19  LYS A HE2  1  
ATOM 309   H HE3  . LYS A 1 19  ? -14.811 2.066   -7.054  1.00 0.00 ? 19  LYS A HE3  1  
ATOM 310   H HZ1  . LYS A 1 19  ? -16.578 -0.106  -7.072  1.00 0.00 ? 19  LYS A HZ1  1  
ATOM 311   H HZ2  . LYS A 1 19  ? -14.984 -0.082  -7.426  1.00 0.00 ? 19  LYS A HZ2  1  
ATOM 312   H HZ3  . LYS A 1 19  ? -15.475 -0.318  -5.886  1.00 0.00 ? 19  LYS A HZ3  1  
ATOM 313   N N    . GLN A 1 20  ? -15.402 6.288   -4.118  1.00 0.00 ? 20  GLN A N    1  
ATOM 314   C CA   . GLN A 1 20  ? -16.051 7.276   -3.273  1.00 0.00 ? 20  GLN A CA   1  
ATOM 315   C C    . GLN A 1 20  ? -15.244 8.576   -3.260  1.00 0.00 ? 20  GLN A C    1  
ATOM 316   O O    . GLN A 1 20  ? -15.718 9.599   -2.769  1.00 0.00 ? 20  GLN A O    1  
ATOM 317   C CB   . GLN A 1 20  ? -16.248 6.738   -1.854  1.00 0.00 ? 20  GLN A CB   1  
ATOM 318   C CG   . GLN A 1 20  ? -17.511 5.879   -1.764  1.00 0.00 ? 20  GLN A CG   1  
ATOM 319   C CD   . GLN A 1 20  ? -17.759 5.419   -0.325  1.00 0.00 ? 20  GLN A CD   1  
ATOM 320   O OE1  . GLN A 1 20  ? -17.900 4.242   -0.038  1.00 0.00 ? 20  GLN A OE1  1  
ATOM 321   N NE2  . GLN A 1 20  ? -17.805 6.411   0.559   1.00 0.00 ? 20  GLN A NE2  1  
ATOM 322   H H    . GLN A 1 20  ? -14.986 5.521   -3.630  1.00 0.00 ? 20  GLN A H    1  
ATOM 323   H HA   . GLN A 1 20  ? -17.026 7.450   -3.727  1.00 0.00 ? 20  GLN A HA   1  
ATOM 324   H HB2  . GLN A 1 20  ? -15.380 6.147   -1.561  1.00 0.00 ? 20  GLN A HB2  1  
ATOM 325   H HB3  . GLN A 1 20  ? -16.319 7.570   -1.153  1.00 0.00 ? 20  GLN A HB3  1  
ATOM 326   H HG2  . GLN A 1 20  ? -18.369 6.448   -2.121  1.00 0.00 ? 20  GLN A HG2  1  
ATOM 327   H HG3  . GLN A 1 20  ? -17.411 5.010   -2.415  1.00 0.00 ? 20  GLN A HG3  1  
ATOM 328   H HE21 . GLN A 1 20  ? -17.682 7.357   0.257   1.00 0.00 ? 20  GLN A HE21 1  
ATOM 329   H HE22 . GLN A 1 20  ? -17.963 6.212   1.526   1.00 0.00 ? 20  GLN A HE22 1  
ATOM 330   N N    . ASN A 1 21  ? -14.039 8.492   -3.804  1.00 0.00 ? 21  ASN A N    1  
ATOM 331   C CA   . ASN A 1 21  ? -13.162 9.649   -3.861  1.00 0.00 ? 21  ASN A CA   1  
ATOM 332   C C    . ASN A 1 21  ? -11.715 9.180   -4.023  1.00 0.00 ? 21  ASN A C    1  
ATOM 333   O O    . ASN A 1 21  ? -11.136 9.303   -5.101  1.00 0.00 ? 21  ASN A O    1  
ATOM 334   C CB   . ASN A 1 21  ? -13.251 10.472  -2.574  1.00 0.00 ? 21  ASN A CB   1  
ATOM 335   C CG   . ASN A 1 21  ? -14.081 11.739  -2.789  1.00 0.00 ? 21  ASN A CG   1  
ATOM 336   O OD1  . ASN A 1 21  ? -14.706 11.936  -3.818  1.00 0.00 ? 21  ASN A OD1  1  
ATOM 337   N ND2  . ASN A 1 21  ? -14.052 12.585  -1.763  1.00 0.00 ? 21  ASN A ND2  1  
ATOM 338   H H    . ASN A 1 21  ? -13.661 7.656   -4.201  1.00 0.00 ? 21  ASN A H    1  
ATOM 339   H HA   . ASN A 1 21  ? -13.510 10.231  -4.715  1.00 0.00 ? 21  ASN A HA   1  
ATOM 340   H HB2  . ASN A 1 21  ? -13.698 9.869   -1.783  1.00 0.00 ? 21  ASN A HB2  1  
ATOM 341   H HB3  . ASN A 1 21  ? -12.249 10.741  -2.240  1.00 0.00 ? 21  ASN A HB3  1  
ATOM 342   H HD21 . ASN A 1 21  ? -13.519 12.363  -0.947  1.00 0.00 ? 21  ASN A HD21 1  
ATOM 343   H HD22 . ASN A 1 21  ? -14.564 13.443  -1.808  1.00 0.00 ? 21  ASN A HD22 1  
ATOM 344   N N    . GLY A 1 22  ? -11.173 8.650   -2.936  1.00 0.00 ? 22  GLY A N    1  
ATOM 345   C CA   . GLY A 1 22  ? -9.805  8.162   -2.944  1.00 0.00 ? 22  GLY A CA   1  
ATOM 346   C C    . GLY A 1 22  ? -9.734  6.722   -2.431  1.00 0.00 ? 22  GLY A C    1  
ATOM 347   O O    . GLY A 1 22  ? -10.678 5.952   -2.599  1.00 0.00 ? 22  GLY A O    1  
ATOM 348   H H    . GLY A 1 22  ? -11.651 8.554   -2.063  1.00 0.00 ? 22  GLY A H    1  
ATOM 349   H HA2  . GLY A 1 22  ? -9.403  8.211   -3.956  1.00 0.00 ? 22  GLY A HA2  1  
ATOM 350   H HA3  . GLY A 1 22  ? -9.182  8.804   -2.322  1.00 0.00 ? 22  GLY A HA3  1  
ATOM 351   N N    . MET A 1 23  ? -8.605  6.402   -1.816  1.00 0.00 ? 23  MET A N    1  
ATOM 352   C CA   . MET A 1 23  ? -8.398  5.068   -1.278  1.00 0.00 ? 23  MET A CA   1  
ATOM 353   C C    . MET A 1 23  ? -8.666  5.037   0.228   1.00 0.00 ? 23  MET A C    1  
ATOM 354   O O    . MET A 1 23  ? -8.618  3.976   0.849   1.00 0.00 ? 23  MET A O    1  
ATOM 355   C CB   . MET A 1 23  ? -6.959  4.624   -1.550  1.00 0.00 ? 23  MET A CB   1  
ATOM 356   C CG   . MET A 1 23  ? -5.979  5.345   -0.623  1.00 0.00 ? 23  MET A CG   1  
ATOM 357   S SD   . MET A 1 23  ? -4.326  5.252   -1.291  1.00 0.00 ? 23  MET A SD   1  
ATOM 358   C CE   . MET A 1 23  ? -4.453  6.458   -2.601  1.00 0.00 ? 23  MET A CE   1  
ATOM 359   H H    . MET A 1 23  ? -7.841  7.034   -1.684  1.00 0.00 ? 23  MET A H    1  
ATOM 360   H HA   . MET A 1 23  ? -9.115  4.429   -1.794  1.00 0.00 ? 23  MET A HA   1  
ATOM 361   H HB2  . MET A 1 23  ? -6.874  3.547   -1.409  1.00 0.00 ? 23  MET A HB2  1  
ATOM 362   H HB3  . MET A 1 23  ? -6.702  4.831   -2.589  1.00 0.00 ? 23  MET A HB3  1  
ATOM 363   H HG2  . MET A 1 23  ? -6.275  6.387   -0.506  1.00 0.00 ? 23  MET A HG2  1  
ATOM 364   H HG3  . MET A 1 23  ? -6.005  4.894   0.369   1.00 0.00 ? 23  MET A HG3  1  
ATOM 365   H HE1  . MET A 1 23  ? -5.405  6.334   -3.118  1.00 0.00 ? 23  MET A HE1  1  
ATOM 366   H HE2  . MET A 1 23  ? -4.397  7.461   -2.178  1.00 0.00 ? 23  MET A HE2  1  
ATOM 367   H HE3  . MET A 1 23  ? -3.635  6.315   -3.307  1.00 0.00 ? 23  MET A HE3  1  
ATOM 368   N N    . GLY A 1 24  ? -8.941  6.214   0.772   1.00 0.00 ? 24  GLY A N    1  
ATOM 369   C CA   . GLY A 1 24  ? -9.216  6.335   2.194   1.00 0.00 ? 24  GLY A CA   1  
ATOM 370   C C    . GLY A 1 24  ? -8.493  5.244   2.987   1.00 0.00 ? 24  GLY A C    1  
ATOM 371   O O    . GLY A 1 24  ? -9.129  4.449   3.676   1.00 0.00 ? 24  GLY A O    1  
ATOM 372   H H    . GLY A 1 24  ? -8.978  7.072   0.260   1.00 0.00 ? 24  GLY A H    1  
ATOM 373   H HA2  . GLY A 1 24  ? -8.900  7.317   2.546   1.00 0.00 ? 24  GLY A HA2  1  
ATOM 374   H HA3  . GLY A 1 24  ? -10.290 6.265   2.367   1.00 0.00 ? 24  GLY A HA3  1  
ATOM 375   N N    . LEU A 1 25  ? -7.174  5.243   2.863   1.00 0.00 ? 25  LEU A N    1  
ATOM 376   C CA   . LEU A 1 25  ? -6.358  4.263   3.560   1.00 0.00 ? 25  LEU A CA   1  
ATOM 377   C C    . LEU A 1 25  ? -5.312  4.989   4.409   1.00 0.00 ? 25  LEU A C    1  
ATOM 378   O O    . LEU A 1 25  ? -4.633  5.893   3.925   1.00 0.00 ? 25  LEU A O    1  
ATOM 379   C CB   . LEU A 1 25  ? -5.760  3.263   2.569   1.00 0.00 ? 25  LEU A CB   1  
ATOM 380   C CG   . LEU A 1 25  ? -4.269  2.963   2.737   1.00 0.00 ? 25  LEU A CG   1  
ATOM 381   C CD1  . LEU A 1 25  ? -3.415  4.131   2.239   1.00 0.00 ? 25  LEU A CD1  1  
ATOM 382   C CD2  . LEU A 1 25  ? -3.943  2.592   4.185   1.00 0.00 ? 25  LEU A CD2  1  
ATOM 383   H H    . LEU A 1 25  ? -6.665  5.894   2.300   1.00 0.00 ? 25  LEU A H    1  
ATOM 384   H HA   . LEU A 1 25  ? -7.016  3.704   4.225   1.00 0.00 ? 25  LEU A HA   1  
ATOM 385   H HB2  . LEU A 1 25  ? -6.310  2.325   2.653   1.00 0.00 ? 25  LEU A HB2  1  
ATOM 386   H HB3  . LEU A 1 25  ? -5.923  3.639   1.560   1.00 0.00 ? 25  LEU A HB3  1  
ATOM 387   H HG   . LEU A 1 25  ? -4.023  2.098   2.120   1.00 0.00 ? 25  LEU A HG   1  
ATOM 388   H HD11 . LEU A 1 25  ? -2.943  4.624   3.088   1.00 0.00 ? 25  LEU A HD11 1  
ATOM 389   H HD12 . LEU A 1 25  ? -2.647  3.757   1.562   1.00 0.00 ? 25  LEU A HD12 1  
ATOM 390   H HD13 . LEU A 1 25  ? -4.048  4.844   1.711   1.00 0.00 ? 25  LEU A HD13 1  
ATOM 391   H HD21 . LEU A 1 25  ? -3.415  1.639   4.206   1.00 0.00 ? 25  LEU A HD21 1  
ATOM 392   H HD22 . LEU A 1 25  ? -3.315  3.366   4.626   1.00 0.00 ? 25  LEU A HD22 1  
ATOM 393   H HD23 . LEU A 1 25  ? -4.869  2.507   4.755   1.00 0.00 ? 25  LEU A HD23 1  
ATOM 394   N N    . SER A 1 26  ? -5.215  4.565   5.660   1.00 0.00 ? 26  SER A N    1  
ATOM 395   C CA   . SER A 1 26  ? -4.264  5.163   6.581   1.00 0.00 ? 26  SER A CA   1  
ATOM 396   C C    . SER A 1 26  ? -3.019  4.281   6.693   1.00 0.00 ? 26  SER A C    1  
ATOM 397   O O    . SER A 1 26  ? -3.081  3.179   7.236   1.00 0.00 ? 26  SER A O    1  
ATOM 398   C CB   . SER A 1 26  ? -4.890  5.374   7.961   1.00 0.00 ? 26  SER A CB   1  
ATOM 399   O OG   . SER A 1 26  ? -5.822  6.452   7.965   1.00 0.00 ? 26  SER A OG   1  
ATOM 400   H H    . SER A 1 26  ? -5.772  3.829   6.046   1.00 0.00 ? 26  SER A H    1  
ATOM 401   H HA   . SER A 1 26  ? -4.010  6.130   6.146   1.00 0.00 ? 26  SER A HA   1  
ATOM 402   H HB2  . SER A 1 26  ? -5.393  4.459   8.275   1.00 0.00 ? 26  SER A HB2  1  
ATOM 403   H HB3  . SER A 1 26  ? -4.104  5.572   8.690   1.00 0.00 ? 26  SER A HB3  1  
ATOM 404   H HG   . SER A 1 26  ? -6.583  6.248   7.349   1.00 0.00 ? 26  SER A HG   1  
ATOM 405   N N    . ILE A 1 27  ? -1.917  4.798   6.170   1.00 0.00 ? 27  ILE A N    1  
ATOM 406   C CA   . ILE A 1 27  ? -0.659  4.071   6.205   1.00 0.00 ? 27  ILE A CA   1  
ATOM 407   C C    . ILE A 1 27  ? 0.074   4.389   7.510   1.00 0.00 ? 27  ILE A C    1  
ATOM 408   O O    . ILE A 1 27  ? -0.295  5.323   8.221   1.00 0.00 ? 27  ILE A O    1  
ATOM 409   C CB   . ILE A 1 27  ? 0.164   4.365   4.949   1.00 0.00 ? 27  ILE A CB   1  
ATOM 410   C CG1  . ILE A 1 27  ? 0.699   5.799   4.968   1.00 0.00 ? 27  ILE A CG1  1  
ATOM 411   C CG2  . ILE A 1 27  ? -0.642  4.071   3.683   1.00 0.00 ? 27  ILE A CG2  1  
ATOM 412   C CD1  . ILE A 1 27  ? 1.835   5.973   3.957   1.00 0.00 ? 27  ILE A CD1  1  
ATOM 413   H H    . ILE A 1 27  ? -1.874  5.695   5.730   1.00 0.00 ? 27  ILE A H    1  
ATOM 414   H HA   . ILE A 1 27  ? -0.896  3.007   6.193   1.00 0.00 ? 27  ILE A HA   1  
ATOM 415   H HB   . ILE A 1 27  ? 1.027   3.699   4.943   1.00 0.00 ? 27  ILE A HB   1  
ATOM 416   H HG12 . ILE A 1 27  ? -0.108  6.494   4.738   1.00 0.00 ? 27  ILE A HG12 1  
ATOM 417   H HG13 . ILE A 1 27  ? 1.057   6.044   5.968   1.00 0.00 ? 27  ILE A HG13 1  
ATOM 418   H HG21 . ILE A 1 27  ? -1.009  5.006   3.260   1.00 0.00 ? 27  ILE A HG21 1  
ATOM 419   H HG22 . ILE A 1 27  ? -0.005  3.568   2.955   1.00 0.00 ? 27  ILE A HG22 1  
ATOM 420   H HG23 . ILE A 1 27  ? -1.487  3.428   3.931   1.00 0.00 ? 27  ILE A HG23 1  
ATOM 421   H HD11 . ILE A 1 27  ? 2.724   6.341   4.470   1.00 0.00 ? 27  ILE A HD11 1  
ATOM 422   H HD12 . ILE A 1 27  ? 2.056   5.014   3.490   1.00 0.00 ? 27  ILE A HD12 1  
ATOM 423   H HD13 . ILE A 1 27  ? 1.534   6.689   3.193   1.00 0.00 ? 27  ILE A HD13 1  
ATOM 424   N N    . VAL A 1 28  ? 1.098   3.595   7.785   1.00 0.00 ? 28  VAL A N    1  
ATOM 425   C CA   . VAL A 1 28  ? 1.885   3.781   8.992   1.00 0.00 ? 28  VAL A CA   1  
ATOM 426   C C    . VAL A 1 28  ? 3.322   3.321   8.734   1.00 0.00 ? 28  VAL A C    1  
ATOM 427   O O    . VAL A 1 28  ? 3.572   2.132   8.542   1.00 0.00 ? 28  VAL A O    1  
ATOM 428   C CB   . VAL A 1 28  ? 1.226   3.052   10.164  1.00 0.00 ? 28  VAL A CB   1  
ATOM 429   C CG1  . VAL A 1 28  ? 2.092   1.884   10.641  1.00 0.00 ? 28  VAL A CG1  1  
ATOM 430   C CG2  . VAL A 1 28  ? 0.928   4.018   11.313  1.00 0.00 ? 28  VAL A CG2  1  
ATOM 431   H H    . VAL A 1 28  ? 1.391   2.838   7.201   1.00 0.00 ? 28  VAL A H    1  
ATOM 432   H HA   . VAL A 1 28  ? 1.893   4.847   9.218   1.00 0.00 ? 28  VAL A HA   1  
ATOM 433   H HB   . VAL A 1 28  ? 0.277   2.645   9.815   1.00 0.00 ? 28  VAL A HB   1  
ATOM 434   H HG11 . VAL A 1 28  ? 3.104   2.239   10.838  1.00 0.00 ? 28  VAL A HG11 1  
ATOM 435   H HG12 . VAL A 1 28  ? 1.668   1.467   11.554  1.00 0.00 ? 28  VAL A HG12 1  
ATOM 436   H HG13 . VAL A 1 28  ? 2.121   1.115   9.869   1.00 0.00 ? 28  VAL A HG13 1  
ATOM 437   H HG21 . VAL A 1 28  ? 1.556   4.904   11.214  1.00 0.00 ? 28  VAL A HG21 1  
ATOM 438   H HG22 . VAL A 1 28  ? -0.121  4.311   11.278  1.00 0.00 ? 28  VAL A HG22 1  
ATOM 439   H HG23 . VAL A 1 28  ? 1.137   3.528   12.263  1.00 0.00 ? 28  VAL A HG23 1  
ATOM 440   N N    . ALA A 1 29  ? 4.228   4.288   8.737   1.00 0.00 ? 29  ALA A N    1  
ATOM 441   C CA   . ALA A 1 29  ? 5.633   3.997   8.506   1.00 0.00 ? 29  ALA A CA   1  
ATOM 442   C C    . ALA A 1 29  ? 6.345   5.273   8.054   1.00 0.00 ? 29  ALA A C    1  
ATOM 443   O O    . ALA A 1 29  ? 5.799   6.369   8.172   1.00 0.00 ? 29  ALA A O    1  
ATOM 444   C CB   . ALA A 1 29  ? 5.759   2.866   7.483   1.00 0.00 ? 29  ALA A CB   1  
ATOM 445   H H    . ALA A 1 29  ? 4.016   5.252   8.893   1.00 0.00 ? 29  ALA A H    1  
ATOM 446   H HA   . ALA A 1 29  ? 6.063   3.666   9.451   1.00 0.00 ? 29  ALA A HA   1  
ATOM 447   H HB1  . ALA A 1 29  ? 6.715   2.947   6.967   1.00 0.00 ? 29  ALA A HB1  1  
ATOM 448   H HB2  . ALA A 1 29  ? 5.703   1.905   7.996   1.00 0.00 ? 29  ALA A HB2  1  
ATOM 449   H HB3  . ALA A 1 29  ? 4.947   2.939   6.759   1.00 0.00 ? 29  ALA A HB3  1  
ATOM 450   N N    . ALA A 1 30  ? 7.555   5.089   7.545   1.00 0.00 ? 30  ALA A N    1  
ATOM 451   C CA   . ALA A 1 30  ? 8.348   6.212   7.075   1.00 0.00 ? 30  ALA A CA   1  
ATOM 452   C C    . ALA A 1 30  ? 9.666   5.694   6.496   1.00 0.00 ? 30  ALA A C    1  
ATOM 453   O O    . ALA A 1 30  ? 9.707   4.614   5.907   1.00 0.00 ? 30  ALA A O    1  
ATOM 454   C CB   . ALA A 1 30  ? 8.565   7.201   8.222   1.00 0.00 ? 30  ALA A CB   1  
ATOM 455   H H    . ALA A 1 30  ? 7.992   4.195   7.452   1.00 0.00 ? 30  ALA A H    1  
ATOM 456   H HA   . ALA A 1 30  ? 7.784   6.709   6.285   1.00 0.00 ? 30  ALA A HA   1  
ATOM 457   H HB1  . ALA A 1 30  ? 9.546   7.034   8.665   1.00 0.00 ? 30  ALA A HB1  1  
ATOM 458   H HB2  . ALA A 1 30  ? 8.507   8.220   7.840   1.00 0.00 ? 30  ALA A HB2  1  
ATOM 459   H HB3  . ALA A 1 30  ? 7.794   7.053   8.979   1.00 0.00 ? 30  ALA A HB3  1  
ATOM 460   N N    . LYS A 1 31  ? 10.710  6.487   6.682   1.00 0.00 ? 31  LYS A N    1  
ATOM 461   C CA   . LYS A 1 31  ? 12.026  6.121   6.186   1.00 0.00 ? 31  LYS A CA   1  
ATOM 462   C C    . LYS A 1 31  ? 13.059  7.124   6.704   1.00 0.00 ? 31  LYS A C    1  
ATOM 463   O O    . LYS A 1 31  ? 13.085  8.274   6.268   1.00 0.00 ? 31  LYS A O    1  
ATOM 464   C CB   . LYS A 1 31  ? 12.006  5.990   4.662   1.00 0.00 ? 31  LYS A CB   1  
ATOM 465   C CG   . LYS A 1 31  ? 13.424  5.842   4.105   1.00 0.00 ? 31  LYS A CG   1  
ATOM 466   C CD   . LYS A 1 31  ? 13.464  6.172   2.612   1.00 0.00 ? 31  LYS A CD   1  
ATOM 467   C CE   . LYS A 1 31  ? 14.499  7.260   2.319   1.00 0.00 ? 31  LYS A CE   1  
ATOM 468   N NZ   . LYS A 1 31  ? 13.934  8.600   2.593   1.00 0.00 ? 31  LYS A NZ   1  
ATOM 469   H H    . LYS A 1 31  ? 10.668  7.363   7.162   1.00 0.00 ? 31  LYS A H    1  
ATOM 470   H HA   . LYS A 1 31  ? 12.266  5.138   6.590   1.00 0.00 ? 31  LYS A HA   1  
ATOM 471   H HB2  . LYS A 1 31  ? 11.406  5.127   4.374   1.00 0.00 ? 31  LYS A HB2  1  
ATOM 472   H HB3  . LYS A 1 31  ? 11.530  6.868   4.224   1.00 0.00 ? 31  LYS A HB3  1  
ATOM 473   H HG2  . LYS A 1 31  ? 14.101  6.502   4.646   1.00 0.00 ? 31  LYS A HG2  1  
ATOM 474   H HG3  . LYS A 1 31  ? 13.776  4.823   4.266   1.00 0.00 ? 31  LYS A HG3  1  
ATOM 475   H HD2  . LYS A 1 31  ? 13.705  5.274   2.044   1.00 0.00 ? 31  LYS A HD2  1  
ATOM 476   H HD3  . LYS A 1 31  ? 12.480  6.503   2.282   1.00 0.00 ? 31  LYS A HD3  1  
ATOM 477   H HE2  . LYS A 1 31  ? 15.387  7.101   2.932   1.00 0.00 ? 31  LYS A HE2  1  
ATOM 478   H HE3  . LYS A 1 31  ? 14.816  7.198   1.278   1.00 0.00 ? 31  LYS A HE3  1  
ATOM 479   H HZ1  . LYS A 1 31  ? 13.858  8.734   3.581   1.00 0.00 ? 31  LYS A HZ1  1  
ATOM 480   H HZ2  . LYS A 1 31  ? 14.534  9.300   2.207   1.00 0.00 ? 31  LYS A HZ2  1  
ATOM 481   H HZ3  . LYS A 1 31  ? 13.028  8.671   2.177   1.00 0.00 ? 31  LYS A HZ3  1  
ATOM 482   N N    . GLY A 1 32  ? 13.885  6.652   7.626   1.00 0.00 ? 32  GLY A N    1  
ATOM 483   C CA   . GLY A 1 32  ? 14.917  7.493   8.208   1.00 0.00 ? 32  GLY A CA   1  
ATOM 484   C C    . GLY A 1 32  ? 15.137  7.151   9.682   1.00 0.00 ? 32  GLY A C    1  
ATOM 485   O O    . GLY A 1 32  ? 14.288  6.520   10.310  1.00 0.00 ? 32  GLY A O    1  
ATOM 486   H H    . GLY A 1 32  ? 13.857  5.715   7.975   1.00 0.00 ? 32  GLY A H    1  
ATOM 487   H HA2  . GLY A 1 32  ? 15.849  7.365   7.658   1.00 0.00 ? 32  GLY A HA2  1  
ATOM 488   H HA3  . GLY A 1 32  ? 14.633  8.542   8.113   1.00 0.00 ? 32  GLY A HA3  1  
ATOM 489   N N    . ALA A 1 33  ? 16.281  7.582   10.193  1.00 0.00 ? 33  ALA A N    1  
ATOM 490   C CA   . ALA A 1 33  ? 16.623  7.328   11.582  1.00 0.00 ? 33  ALA A CA   1  
ATOM 491   C C    . ALA A 1 33  ? 16.596  5.821   11.843  1.00 0.00 ? 33  ALA A C    1  
ATOM 492   O O    . ALA A 1 33  ? 16.123  5.377   12.887  1.00 0.00 ? 33  ALA A O    1  
ATOM 493   C CB   . ALA A 1 33  ? 15.662  8.095   12.493  1.00 0.00 ? 33  ALA A CB   1  
ATOM 494   H H    . ALA A 1 33  ? 16.966  8.094   9.675   1.00 0.00 ? 33  ALA A H    1  
ATOM 495   H HA   . ALA A 1 33  ? 17.635  7.699   11.747  1.00 0.00 ? 33  ALA A HA   1  
ATOM 496   H HB1  . ALA A 1 33  ? 14.905  7.413   12.878  1.00 0.00 ? 33  ALA A HB1  1  
ATOM 497   H HB2  . ALA A 1 33  ? 16.218  8.528   13.324  1.00 0.00 ? 33  ALA A HB2  1  
ATOM 498   H HB3  . ALA A 1 33  ? 15.180  8.890   11.925  1.00 0.00 ? 33  ALA A HB3  1  
ATOM 499   N N    . GLY A 1 34  ? 17.110  5.076   10.875  1.00 0.00 ? 34  GLY A N    1  
ATOM 500   C CA   . GLY A 1 34  ? 17.151  3.628   10.987  1.00 0.00 ? 34  GLY A CA   1  
ATOM 501   C C    . GLY A 1 34  ? 18.050  3.020   9.908   1.00 0.00 ? 34  GLY A C    1  
ATOM 502   O O    . GLY A 1 34  ? 19.274  3.093   10.001  1.00 0.00 ? 34  GLY A O    1  
ATOM 503   H H    . GLY A 1 34  ? 17.494  5.445   10.028  1.00 0.00 ? 34  GLY A H    1  
ATOM 504   H HA2  . GLY A 1 34  ? 17.519  3.346   11.973  1.00 0.00 ? 34  GLY A HA2  1  
ATOM 505   H HA3  . GLY A 1 34  ? 16.143  3.224   10.896  1.00 0.00 ? 34  GLY A HA3  1  
ATOM 506   N N    . GLN A 1 35  ? 17.406  2.433   8.909   1.00 0.00 ? 35  GLN A N    1  
ATOM 507   C CA   . GLN A 1 35  ? 18.132  1.812   7.814   1.00 0.00 ? 35  GLN A CA   1  
ATOM 508   C C    . GLN A 1 35  ? 17.794  2.506   6.493   1.00 0.00 ? 35  GLN A C    1  
ATOM 509   O O    . GLN A 1 35  ? 18.049  1.962   5.419   1.00 0.00 ? 35  GLN A O    1  
ATOM 510   C CB   . GLN A 1 35  ? 17.834  0.313   7.739   1.00 0.00 ? 35  GLN A CB   1  
ATOM 511   C CG   . GLN A 1 35  ? 19.126  -0.505  7.791   1.00 0.00 ? 35  GLN A CG   1  
ATOM 512   C CD   . GLN A 1 35  ? 19.485  -0.872  9.232   1.00 0.00 ? 35  GLN A CD   1  
ATOM 513   O OE1  . GLN A 1 35  ? 18.642  -0.936  10.112  1.00 0.00 ? 35  GLN A OE1  1  
ATOM 514   N NE2  . GLN A 1 35  ? 20.779  -1.108  9.424   1.00 0.00 ? 35  GLN A NE2  1  
ATOM 515   H H    . GLN A 1 35  ? 16.410  2.378   8.841   1.00 0.00 ? 35  GLN A H    1  
ATOM 516   H HA   . GLN A 1 35  ? 19.187  1.956   8.047   1.00 0.00 ? 35  GLN A HA   1  
ATOM 517   H HB2  . GLN A 1 35  ? 17.184  0.026   8.565   1.00 0.00 ? 35  GLN A HB2  1  
ATOM 518   H HB3  . GLN A 1 35  ? 17.296  0.092   6.817   1.00 0.00 ? 35  GLN A HB3  1  
ATOM 519   H HG2  . GLN A 1 35  ? 19.009  -1.413  7.199   1.00 0.00 ? 35  GLN A HG2  1  
ATOM 520   H HG3  . GLN A 1 35  ? 19.940  0.064   7.343   1.00 0.00 ? 35  GLN A HG3  1  
ATOM 521   H HE21 . GLN A 1 35  ? 21.419  -1.038  8.659   1.00 0.00 ? 35  GLN A HE21 1  
ATOM 522   H HE22 . GLN A 1 35  ? 21.113  -1.356  10.334  1.00 0.00 ? 35  GLN A HE22 1  
ATOM 523   N N    . ASP A 1 36  ? 17.224  3.696   6.615   1.00 0.00 ? 36  ASP A N    1  
ATOM 524   C CA   . ASP A 1 36  ? 16.848  4.469   5.443   1.00 0.00 ? 36  ASP A CA   1  
ATOM 525   C C    . ASP A 1 36  ? 15.839  3.673   4.614   1.00 0.00 ? 36  ASP A C    1  
ATOM 526   O O    . ASP A 1 36  ? 15.902  3.673   3.386   1.00 0.00 ? 36  ASP A O    1  
ATOM 527   C CB   . ASP A 1 36  ? 18.064  4.757   4.560   1.00 0.00 ? 36  ASP A CB   1  
ATOM 528   C CG   . ASP A 1 36  ? 18.914  5.951   4.999   1.00 0.00 ? 36  ASP A CG   1  
ATOM 529   O OD1  . ASP A 1 36  ? 18.386  6.765   5.787   1.00 0.00 ? 36  ASP A OD1  1  
ATOM 530   O OD2  . ASP A 1 36  ? 20.073  6.023   4.536   1.00 0.00 ? 36  ASP A OD2  1  
ATOM 531   H H    . ASP A 1 36  ? 17.020  4.131   7.492   1.00 0.00 ? 36  ASP A H    1  
ATOM 532   H HA   . ASP A 1 36  ? 16.428  5.396   5.835   1.00 0.00 ? 36  ASP A HA   1  
ATOM 533   H HB2  . ASP A 1 36  ? 18.696  3.869   4.537   1.00 0.00 ? 36  ASP A HB2  1  
ATOM 534   H HB3  . ASP A 1 36  ? 17.720  4.930   3.540   1.00 0.00 ? 36  ASP A HB3  1  
ATOM 535   N N    . LYS A 1 37  ? 14.932  3.013   5.319   1.00 0.00 ? 37  LYS A N    1  
ATOM 536   C CA   . LYS A 1 37  ? 13.910  2.214   4.663   1.00 0.00 ? 37  LYS A CA   1  
ATOM 537   C C    . LYS A 1 37  ? 13.030  1.549   5.724   1.00 0.00 ? 37  LYS A C    1  
ATOM 538   O O    . LYS A 1 37  ? 13.339  0.455   6.194   1.00 0.00 ? 37  LYS A O    1  
ATOM 539   C CB   . LYS A 1 37  ? 14.549  1.225   3.686   1.00 0.00 ? 37  LYS A CB   1  
ATOM 540   C CG   . LYS A 1 37  ? 15.616  0.378   4.382   1.00 0.00 ? 37  LYS A CG   1  
ATOM 541   C CD   . LYS A 1 37  ? 16.648  -0.138  3.377   1.00 0.00 ? 37  LYS A CD   1  
ATOM 542   C CE   . LYS A 1 37  ? 17.725  -0.970  4.076   1.00 0.00 ? 37  LYS A CE   1  
ATOM 543   N NZ   . LYS A 1 37  ? 17.270  -2.368  4.248   1.00 0.00 ? 37  LYS A NZ   1  
ATOM 544   H H    . LYS A 1 37  ? 14.887  3.018   6.318   1.00 0.00 ? 37  LYS A H    1  
ATOM 545   H HA   . LYS A 1 37  ? 13.291  2.893   4.077   1.00 0.00 ? 37  LYS A HA   1  
ATOM 546   H HB2  . LYS A 1 37  ? 13.781  0.576   3.265   1.00 0.00 ? 37  LYS A HB2  1  
ATOM 547   H HB3  . LYS A 1 37  ? 14.997  1.769   2.854   1.00 0.00 ? 37  LYS A HB3  1  
ATOM 548   H HG2  . LYS A 1 37  ? 16.115  0.972   5.148   1.00 0.00 ? 37  LYS A HG2  1  
ATOM 549   H HG3  . LYS A 1 37  ? 15.144  -0.464  4.888   1.00 0.00 ? 37  LYS A HG3  1  
ATOM 550   H HD2  . LYS A 1 37  ? 16.151  -0.743  2.618   1.00 0.00 ? 37  LYS A HD2  1  
ATOM 551   H HD3  . LYS A 1 37  ? 17.111  0.703   2.862   1.00 0.00 ? 37  LYS A HD3  1  
ATOM 552   H HE2  . LYS A 1 37  ? 18.645  -0.951  3.491   1.00 0.00 ? 37  LYS A HE2  1  
ATOM 553   H HE3  . LYS A 1 37  ? 17.956  -0.535  5.048   1.00 0.00 ? 37  LYS A HE3  1  
ATOM 554   H HZ1  . LYS A 1 37  ? 17.159  -2.796  3.351   1.00 0.00 ? 37  LYS A HZ1  1  
ATOM 555   H HZ2  . LYS A 1 37  ? 17.947  -2.877  4.779   1.00 0.00 ? 37  LYS A HZ2  1  
ATOM 556   H HZ3  . LYS A 1 37  ? 16.394  -2.376  4.731   1.00 0.00 ? 37  LYS A HZ3  1  
ATOM 557   N N    . LEU A 1 38  ? 11.952  2.238   6.069   1.00 0.00 ? 38  LEU A N    1  
ATOM 558   C CA   . LEU A 1 38  ? 11.026  1.727   7.065   1.00 0.00 ? 38  LEU A CA   1  
ATOM 559   C C    . LEU A 1 38  ? 9.947   0.893   6.372   1.00 0.00 ? 38  LEU A C    1  
ATOM 560   O O    . LEU A 1 38  ? 9.492   1.240   5.283   1.00 0.00 ? 38  LEU A O    1  
ATOM 561   C CB   . LEU A 1 38  ? 10.467  2.872   7.913   1.00 0.00 ? 38  LEU A CB   1  
ATOM 562   C CG   . LEU A 1 38  ? 10.155  2.535   9.372   1.00 0.00 ? 38  LEU A CG   1  
ATOM 563   C CD1  . LEU A 1 38  ? 10.446  3.728   10.285  1.00 0.00 ? 38  LEU A CD1  1  
ATOM 564   C CD2  . LEU A 1 38  ? 8.717   2.034   9.524   1.00 0.00 ? 38  LEU A CD2  1  
ATOM 565   H H    . LEU A 1 38  ? 11.709  3.127   5.682   1.00 0.00 ? 38  LEU A H    1  
ATOM 566   H HA   . LEU A 1 38  ? 11.590  1.077   7.733   1.00 0.00 ? 38  LEU A HA   1  
ATOM 567   H HB2  . LEU A 1 38  ? 11.183  3.694   7.896   1.00 0.00 ? 38  LEU A HB2  1  
ATOM 568   H HB3  . LEU A 1 38  ? 9.554   3.235   7.441   1.00 0.00 ? 38  LEU A HB3  1  
ATOM 569   H HG   . LEU A 1 38  ? 10.813  1.723   9.684   1.00 0.00 ? 38  LEU A HG   1  
ATOM 570   H HD11 . LEU A 1 38  ? 11.401  4.173   10.007  1.00 0.00 ? 38  LEU A HD11 1  
ATOM 571   H HD12 . LEU A 1 38  ? 9.655   4.469   10.177  1.00 0.00 ? 38  LEU A HD12 1  
ATOM 572   H HD13 . LEU A 1 38  ? 10.490  3.391   11.321  1.00 0.00 ? 38  LEU A HD13 1  
ATOM 573   H HD21 . LEU A 1 38  ? 8.432   1.472   8.635   1.00 0.00 ? 38  LEU A HD21 1  
ATOM 574   H HD22 . LEU A 1 38  ? 8.647   1.390   10.400  1.00 0.00 ? 38  LEU A HD22 1  
ATOM 575   H HD23 . LEU A 1 38  ? 8.047   2.886   9.645   1.00 0.00 ? 38  LEU A HD23 1  
ATOM 576   N N    . GLY A 1 39  ? 9.570   -0.193  7.031   1.00 0.00 ? 39  GLY A N    1  
ATOM 577   C CA   . GLY A 1 39  ? 8.553   -1.080  6.491   1.00 0.00 ? 39  GLY A CA   1  
ATOM 578   C C    . GLY A 1 39  ? 7.176   -0.415  6.516   1.00 0.00 ? 39  GLY A C    1  
ATOM 579   O O    . GLY A 1 39  ? 6.651   -0.107  7.585   1.00 0.00 ? 39  GLY A O    1  
ATOM 580   H H    . GLY A 1 39  ? 9.945   -0.469  7.916   1.00 0.00 ? 39  GLY A H    1  
ATOM 581   H HA2  . GLY A 1 39  ? 8.810   -1.354  5.468   1.00 0.00 ? 39  GLY A HA2  1  
ATOM 582   H HA3  . GLY A 1 39  ? 8.526   -2.003  7.071   1.00 0.00 ? 39  GLY A HA3  1  
ATOM 583   N N    . ILE A 1 40  ? 6.629   -0.214  5.326   1.00 0.00 ? 40  ILE A N    1  
ATOM 584   C CA   . ILE A 1 40  ? 5.323   0.409   5.198   1.00 0.00 ? 40  ILE A CA   1  
ATOM 585   C C    . ILE A 1 40  ? 4.245   -0.579  5.649   1.00 0.00 ? 40  ILE A C    1  
ATOM 586   O O    . ILE A 1 40  ? 4.245   -1.736  5.232   1.00 0.00 ? 40  ILE A O    1  
ATOM 587   C CB   . ILE A 1 40  ? 5.118   0.936   3.776   1.00 0.00 ? 40  ILE A CB   1  
ATOM 588   C CG1  . ILE A 1 40  ? 5.938   2.206   3.538   1.00 0.00 ? 40  ILE A CG1  1  
ATOM 589   C CG2  . ILE A 1 40  ? 3.632   1.150   3.480   1.00 0.00 ? 40  ILE A CG2  1  
ATOM 590   C CD1  . ILE A 1 40  ? 7.316   2.099   4.194   1.00 0.00 ? 40  ILE A CD1  1  
ATOM 591   H H    . ILE A 1 40  ? 7.063   -0.468  4.461   1.00 0.00 ? 40  ILE A H    1  
ATOM 592   H HA   . ILE A 1 40  ? 5.304   1.270   5.866   1.00 0.00 ? 40  ILE A HA   1  
ATOM 593   H HB   . ILE A 1 40  ? 5.480   0.183   3.077   1.00 0.00 ? 40  ILE A HB   1  
ATOM 594   H HG12 . ILE A 1 40  ? 6.052   2.374   2.468   1.00 0.00 ? 40  ILE A HG12 1  
ATOM 595   H HG13 . ILE A 1 40  ? 5.406   3.067   3.941   1.00 0.00 ? 40  ILE A HG13 1  
ATOM 596   H HG21 . ILE A 1 40  ? 3.524   1.834   2.639   1.00 0.00 ? 40  ILE A HG21 1  
ATOM 597   H HG22 . ILE A 1 40  ? 3.170   0.194   3.232   1.00 0.00 ? 40  ILE A HG22 1  
ATOM 598   H HG23 . ILE A 1 40  ? 3.143   1.573   4.357   1.00 0.00 ? 40  ILE A HG23 1  
ATOM 599   H HD11 . ILE A 1 40  ? 7.904   2.983   3.949   1.00 0.00 ? 40  ILE A HD11 1  
ATOM 600   H HD12 . ILE A 1 40  ? 7.200   2.027   5.275   1.00 0.00 ? 40  ILE A HD12 1  
ATOM 601   H HD13 . ILE A 1 40  ? 7.826   1.209   3.824   1.00 0.00 ? 40  ILE A HD13 1  
ATOM 602   N N    . TYR A 1 41  ? 3.352   -0.086  6.495   1.00 0.00 ? 41  TYR A N    1  
ATOM 603   C CA   . TYR A 1 41  ? 2.271   -0.911  7.007   1.00 0.00 ? 41  TYR A CA   1  
ATOM 604   C C    . TYR A 1 41  ? 1.029   -0.068  7.298   1.00 0.00 ? 41  TYR A C    1  
ATOM 605   O O    . TYR A 1 41  ? 1.107   0.936   8.005   1.00 0.00 ? 41  TYR A O    1  
ATOM 606   C CB   . TYR A 1 41  ? 2.784   -1.512  8.317   1.00 0.00 ? 41  TYR A CB   1  
ATOM 607   C CG   . TYR A 1 41  ? 2.927   -3.035  8.289   1.00 0.00 ? 41  TYR A CG   1  
ATOM 608   C CD1  . TYR A 1 41  ? 1.804   -3.835  8.345   1.00 0.00 ? 41  TYR A CD1  1  
ATOM 609   C CD2  . TYR A 1 41  ? 4.180   -3.609  8.208   1.00 0.00 ? 41  TYR A CD2  1  
ATOM 610   C CE1  . TYR A 1 41  ? 1.939   -5.268  8.318   1.00 0.00 ? 41  TYR A CE1  1  
ATOM 611   C CE2  . TYR A 1 41  ? 4.315   -5.042  8.181   1.00 0.00 ? 41  TYR A CE2  1  
ATOM 612   C CZ   . TYR A 1 41  ? 3.188   -5.801  8.238   1.00 0.00 ? 41  TYR A CZ   1  
ATOM 613   O OH   . TYR A 1 41  ? 3.315   -7.155  8.213   1.00 0.00 ? 41  TYR A OH   1  
ATOM 614   H H    . TYR A 1 41  ? 3.359   0.856   6.829   1.00 0.00 ? 41  TYR A H    1  
ATOM 615   H HA   . TYR A 1 41  ? 2.027   -1.654  6.248   1.00 0.00 ? 41  TYR A HA   1  
ATOM 616   H HB2  . TYR A 1 41  ? 3.752   -1.071  8.553   1.00 0.00 ? 41  TYR A HB2  1  
ATOM 617   H HB3  . TYR A 1 41  ? 2.103   -1.236  9.122   1.00 0.00 ? 41  TYR A HB3  1  
ATOM 618   H HD1  . TYR A 1 41  ? 0.815   -3.382  8.409   1.00 0.00 ? 41  TYR A HD1  1  
ATOM 619   H HD2  . TYR A 1 41  ? 5.067   -2.977  8.164   1.00 0.00 ? 41  TYR A HD2  1  
ATOM 620   H HE1  . TYR A 1 41  ? 1.060   -5.912  8.362   1.00 0.00 ? 41  TYR A HE1  1  
ATOM 621   H HE2  . TYR A 1 41  ? 5.298   -5.509  8.117   1.00 0.00 ? 41  TYR A HE2  1  
ATOM 622   H HH   . TYR A 1 41  ? 3.942   -7.426  7.483   1.00 0.00 ? 41  TYR A HH   1  
ATOM 623   N N    . VAL A 1 42  ? -0.089  -0.506  6.739   1.00 0.00 ? 42  VAL A N    1  
ATOM 624   C CA   . VAL A 1 42  ? -1.347  0.196   6.930   1.00 0.00 ? 42  VAL A CA   1  
ATOM 625   C C    . VAL A 1 42  ? -1.763  0.097   8.399   1.00 0.00 ? 42  VAL A C    1  
ATOM 626   O O    . VAL A 1 42  ? -1.798  -0.994  8.966   1.00 0.00 ? 42  VAL A O    1  
ATOM 627   C CB   . VAL A 1 42  ? -2.405  -0.354  5.971   1.00 0.00 ? 42  VAL A CB   1  
ATOM 628   C CG1  . VAL A 1 42  ? -3.762  0.308   6.213   1.00 0.00 ? 42  VAL A CG1  1  
ATOM 629   C CG2  . VAL A 1 42  ? -1.965  -0.187  4.515   1.00 0.00 ? 42  VAL A CG2  1  
ATOM 630   H H    . VAL A 1 42  ? -0.145  -1.324  6.165   1.00 0.00 ? 42  VAL A H    1  
ATOM 631   H HA   . VAL A 1 42  ? -1.180  1.244   6.682   1.00 0.00 ? 42  VAL A HA   1  
ATOM 632   H HB   . VAL A 1 42  ? -2.513  -1.421  6.168   1.00 0.00 ? 42  VAL A HB   1  
ATOM 633   H HG11 . VAL A 1 42  ? -4.462  -0.003  5.437   1.00 0.00 ? 42  VAL A HG11 1  
ATOM 634   H HG12 . VAL A 1 42  ? -4.144  0.009   7.189   1.00 0.00 ? 42  VAL A HG12 1  
ATOM 635   H HG13 . VAL A 1 42  ? -3.648  1.392   6.185   1.00 0.00 ? 42  VAL A HG13 1  
ATOM 636   H HG21 . VAL A 1 42  ? -1.631  0.837   4.352   1.00 0.00 ? 42  VAL A HG21 1  
ATOM 637   H HG22 . VAL A 1 42  ? -1.145  -0.874  4.302   1.00 0.00 ? 42  VAL A HG22 1  
ATOM 638   H HG23 . VAL A 1 42  ? -2.803  -0.407  3.855   1.00 0.00 ? 42  VAL A HG23 1  
ATOM 639   N N    . LYS A 1 43  ? -2.068  1.252   8.973   1.00 0.00 ? 43  LYS A N    1  
ATOM 640   C CA   . LYS A 1 43  ? -2.481  1.309   10.365  1.00 0.00 ? 43  LYS A CA   1  
ATOM 641   C C    . LYS A 1 43  ? -4.005  1.201   10.446  1.00 0.00 ? 43  LYS A C    1  
ATOM 642   O O    . LYS A 1 43  ? -4.541  0.638   11.400  1.00 0.00 ? 43  LYS A O    1  
ATOM 643   C CB   . LYS A 1 43  ? -1.916  2.561   11.040  1.00 0.00 ? 43  LYS A CB   1  
ATOM 644   C CG   . LYS A 1 43  ? -2.101  3.793   10.152  1.00 0.00 ? 43  LYS A CG   1  
ATOM 645   C CD   . LYS A 1 43  ? -2.363  5.042   10.995  1.00 0.00 ? 43  LYS A CD   1  
ATOM 646   C CE   . LYS A 1 43  ? -1.627  6.255   10.423  1.00 0.00 ? 43  LYS A CE   1  
ATOM 647   N NZ   . LYS A 1 43  ? -1.755  7.416   11.332  1.00 0.00 ? 43  LYS A NZ   1  
ATOM 648   H H    . LYS A 1 43  ? -2.037  2.135   8.505   1.00 0.00 ? 43  LYS A H    1  
ATOM 649   H HA   . LYS A 1 43  ? -2.046  0.447   10.871  1.00 0.00 ? 43  LYS A HA   1  
ATOM 650   H HB2  . LYS A 1 43  ? -2.415  2.719   11.997  1.00 0.00 ? 43  LYS A HB2  1  
ATOM 651   H HB3  . LYS A 1 43  ? -0.857  2.417   11.254  1.00 0.00 ? 43  LYS A HB3  1  
ATOM 652   H HG2  . LYS A 1 43  ? -1.210  3.942   9.542   1.00 0.00 ? 43  LYS A HG2  1  
ATOM 653   H HG3  . LYS A 1 43  ? -2.933  3.631   9.467   1.00 0.00 ? 43  LYS A HG3  1  
ATOM 654   H HD2  . LYS A 1 43  ? -3.434  5.245   11.029  1.00 0.00 ? 43  LYS A HD2  1  
ATOM 655   H HD3  . LYS A 1 43  ? -2.040  4.867   12.022  1.00 0.00 ? 43  LYS A HD3  1  
ATOM 656   H HE2  . LYS A 1 43  ? -0.574  6.013   10.277  1.00 0.00 ? 43  LYS A HE2  1  
ATOM 657   H HE3  . LYS A 1 43  ? -2.034  6.506   9.443   1.00 0.00 ? 43  LYS A HE3  1  
ATOM 658   H HZ1  . LYS A 1 43  ? -0.926  7.499   11.884  1.00 0.00 ? 43  LYS A HZ1  1  
ATOM 659   H HZ2  . LYS A 1 43  ? -1.881  8.249   10.793  1.00 0.00 ? 43  LYS A HZ2  1  
ATOM 660   H HZ3  . LYS A 1 43  ? -2.544  7.284   11.932  1.00 0.00 ? 43  LYS A HZ3  1  
ATOM 661   N N    . SER A 1 44  ? -4.659  1.749   9.433   1.00 0.00 ? 44  SER A N    1  
ATOM 662   C CA   . SER A 1 44  ? -6.111  1.721   9.378   1.00 0.00 ? 44  SER A CA   1  
ATOM 663   C C    . SER A 1 44  ? -6.591  2.187   8.002   1.00 0.00 ? 44  SER A C    1  
ATOM 664   O O    . SER A 1 44  ? -5.794  2.319   7.074   1.00 0.00 ? 44  SER A O    1  
ATOM 665   C CB   . SER A 1 44  ? -6.721  2.594   10.476  1.00 0.00 ? 44  SER A CB   1  
ATOM 666   O OG   . SER A 1 44  ? -6.492  3.981   10.245  1.00 0.00 ? 44  SER A OG   1  
ATOM 667   H H    . SER A 1 44  ? -4.216  2.205   8.662   1.00 0.00 ? 44  SER A H    1  
ATOM 668   H HA   . SER A 1 44  ? -6.387  0.680   9.547   1.00 0.00 ? 44  SER A HA   1  
ATOM 669   H HB2  . SER A 1 44  ? -7.794  2.408   10.533  1.00 0.00 ? 44  SER A HB2  1  
ATOM 670   H HB3  . SER A 1 44  ? -6.297  2.313   11.440  1.00 0.00 ? 44  SER A HB3  1  
ATOM 671   H HG   . SER A 1 44  ? -7.287  4.513   10.537  1.00 0.00 ? 44  SER A HG   1  
ATOM 672   N N    . VAL A 1 45  ? -7.892  2.423   7.913   1.00 0.00 ? 45  VAL A N    1  
ATOM 673   C CA   . VAL A 1 45  ? -8.488  2.872   6.666   1.00 0.00 ? 45  VAL A CA   1  
ATOM 674   C C    . VAL A 1 45  ? -9.456  4.021   6.952   1.00 0.00 ? 45  VAL A C    1  
ATOM 675   O O    . VAL A 1 45  ? -10.231 3.962   7.905   1.00 0.00 ? 45  VAL A O    1  
ATOM 676   C CB   . VAL A 1 45  ? -9.153  1.694   5.951   1.00 0.00 ? 45  VAL A CB   1  
ATOM 677   C CG1  . VAL A 1 45  ? -8.211  1.079   4.914   1.00 0.00 ? 45  VAL A CG1  1  
ATOM 678   C CG2  . VAL A 1 45  ? -9.627  0.640   6.954   1.00 0.00 ? 45  VAL A CG2  1  
ATOM 679   H H    . VAL A 1 45  ? -8.533  2.313   8.672   1.00 0.00 ? 45  VAL A H    1  
ATOM 680   H HA   . VAL A 1 45  ? -7.683  3.241   6.031   1.00 0.00 ? 45  VAL A HA   1  
ATOM 681   H HB   . VAL A 1 45  ? -10.029 2.073   5.425   1.00 0.00 ? 45  VAL A HB   1  
ATOM 682   H HG11 . VAL A 1 45  ? -7.229  0.925   5.361   1.00 0.00 ? 45  VAL A HG11 1  
ATOM 683   H HG12 . VAL A 1 45  ? -8.613  0.122   4.580   1.00 0.00 ? 45  VAL A HG12 1  
ATOM 684   H HG13 . VAL A 1 45  ? -8.121  1.752   4.061   1.00 0.00 ? 45  VAL A HG13 1  
ATOM 685   H HG21 . VAL A 1 45  ? -10.232 1.119   7.724   1.00 0.00 ? 45  VAL A HG21 1  
ATOM 686   H HG22 . VAL A 1 45  ? -10.225 -0.110  6.437   1.00 0.00 ? 45  VAL A HG22 1  
ATOM 687   H HG23 . VAL A 1 45  ? -8.763  0.163   7.415   1.00 0.00 ? 45  VAL A HG23 1  
ATOM 688   N N    . VAL A 1 46  ? -9.379  5.041   6.110   1.00 0.00 ? 46  VAL A N    1  
ATOM 689   C CA   . VAL A 1 46  ? -10.238 6.203   6.261   1.00 0.00 ? 46  VAL A CA   1  
ATOM 690   C C    . VAL A 1 46  ? -11.699 5.749   6.307   1.00 0.00 ? 46  VAL A C    1  
ATOM 691   O O    . VAL A 1 46  ? -12.574 6.502   6.731   1.00 0.00 ? 46  VAL A O    1  
ATOM 692   C CB   . VAL A 1 46  ? -9.960  7.209   5.142   1.00 0.00 ? 46  VAL A CB   1  
ATOM 693   C CG1  . VAL A 1 46  ? -11.103 8.218   5.015   1.00 0.00 ? 46  VAL A CG1  1  
ATOM 694   C CG2  . VAL A 1 46  ? -8.623  7.919   5.364   1.00 0.00 ? 46  VAL A CG2  1  
ATOM 695   H H    . VAL A 1 46  ? -8.745  5.082   5.338   1.00 0.00 ? 46  VAL A H    1  
ATOM 696   H HA   . VAL A 1 46  ? -9.988  6.676   7.210   1.00 0.00 ? 46  VAL A HA   1  
ATOM 697   H HB   . VAL A 1 46  ? -9.894  6.657   4.204   1.00 0.00 ? 46  VAL A HB   1  
ATOM 698   H HG11 . VAL A 1 46  ? -11.109 8.872   5.886   1.00 0.00 ? 46  VAL A HG11 1  
ATOM 699   H HG12 . VAL A 1 46  ? -10.962 8.814   4.113   1.00 0.00 ? 46  VAL A HG12 1  
ATOM 700   H HG13 . VAL A 1 46  ? -12.052 7.685   4.954   1.00 0.00 ? 46  VAL A HG13 1  
ATOM 701   H HG21 . VAL A 1 46  ? -8.750  8.990   5.202   1.00 0.00 ? 46  VAL A HG21 1  
ATOM 702   H HG22 . VAL A 1 46  ? -8.284  7.744   6.385   1.00 0.00 ? 46  VAL A HG22 1  
ATOM 703   H HG23 . VAL A 1 46  ? -7.884  7.531   4.663   1.00 0.00 ? 46  VAL A HG23 1  
ATOM 704   N N    . LYS A 1 47  ? -11.917 4.519   5.865   1.00 0.00 ? 47  LYS A N    1  
ATOM 705   C CA   . LYS A 1 47  ? -13.256 3.956   5.850   1.00 0.00 ? 47  LYS A CA   1  
ATOM 706   C C    . LYS A 1 47  ? -14.154 4.809   4.952   1.00 0.00 ? 47  LYS A C    1  
ATOM 707   O O    . LYS A 1 47  ? -15.310 5.062   5.285   1.00 0.00 ? 47  LYS A O    1  
ATOM 708   C CB   . LYS A 1 47  ? -13.786 3.797   7.276   1.00 0.00 ? 47  LYS A CB   1  
ATOM 709   C CG   . LYS A 1 47  ? -14.983 2.845   7.314   1.00 0.00 ? 47  LYS A CG   1  
ATOM 710   C CD   . LYS A 1 47  ? -15.260 2.368   8.741   1.00 0.00 ? 47  LYS A CD   1  
ATOM 711   C CE   . LYS A 1 47  ? -14.582 1.023   9.010   1.00 0.00 ? 47  LYS A CE   1  
ATOM 712   N NZ   . LYS A 1 47  ? -14.496 0.768   10.465  1.00 0.00 ? 47  LYS A NZ   1  
ATOM 713   H H    . LYS A 1 47  ? -11.199 3.913   5.522   1.00 0.00 ? 47  LYS A H    1  
ATOM 714   H HA   . LYS A 1 47  ? -13.186 2.957   5.420   1.00 0.00 ? 47  LYS A HA   1  
ATOM 715   H HB2  . LYS A 1 47  ? -12.995 3.418   7.923   1.00 0.00 ? 47  LYS A HB2  1  
ATOM 716   H HB3  . LYS A 1 47  ? -14.079 4.771   7.670   1.00 0.00 ? 47  LYS A HB3  1  
ATOM 717   H HG2  . LYS A 1 47  ? -15.865 3.349   6.918   1.00 0.00 ? 47  LYS A HG2  1  
ATOM 718   H HG3  . LYS A 1 47  ? -14.790 1.987   6.670   1.00 0.00 ? 47  LYS A HG3  1  
ATOM 719   H HD2  . LYS A 1 47  ? -14.899 3.110   9.453   1.00 0.00 ? 47  LYS A HD2  1  
ATOM 720   H HD3  . LYS A 1 47  ? -16.335 2.274   8.895   1.00 0.00 ? 47  LYS A HD3  1  
ATOM 721   H HE2  . LYS A 1 47  ? -15.144 0.223   8.527   1.00 0.00 ? 47  LYS A HE2  1  
ATOM 722   H HE3  . LYS A 1 47  ? -13.583 1.019   8.574   1.00 0.00 ? 47  LYS A HE3  1  
ATOM 723   H HZ1  . LYS A 1 47  ? -14.096 1.564   10.920  1.00 0.00 ? 47  LYS A HZ1  1  
ATOM 724   H HZ2  . LYS A 1 47  ? -15.412 0.601   10.829  1.00 0.00 ? 47  LYS A HZ2  1  
ATOM 725   H HZ3  . LYS A 1 47  ? -13.921 -0.034  10.630  1.00 0.00 ? 47  LYS A HZ3  1  
ATOM 726   N N    . GLY A 1 48  ? -13.587 5.229   3.830   1.00 0.00 ? 48  GLY A N    1  
ATOM 727   C CA   . GLY A 1 48  ? -14.321 6.048   2.881   1.00 0.00 ? 48  GLY A CA   1  
ATOM 728   C C    . GLY A 1 48  ? -13.591 6.120   1.539   1.00 0.00 ? 48  GLY A C    1  
ATOM 729   O O    . GLY A 1 48  ? -13.723 7.101   0.808   1.00 0.00 ? 48  GLY A O    1  
ATOM 730   H H    . GLY A 1 48  ? -12.645 5.018   3.567   1.00 0.00 ? 48  GLY A H    1  
ATOM 731   H HA2  . GLY A 1 48  ? -15.319 5.635   2.735   1.00 0.00 ? 48  GLY A HA2  1  
ATOM 732   H HA3  . GLY A 1 48  ? -14.448 7.052   3.285   1.00 0.00 ? 48  GLY A HA3  1  
ATOM 733   N N    . GLY A 1 49  ? -12.836 5.069   1.254   1.00 0.00 ? 49  GLY A N    1  
ATOM 734   C CA   . GLY A 1 49  ? -12.085 5.001   0.013   1.00 0.00 ? 49  GLY A CA   1  
ATOM 735   C C    . GLY A 1 49  ? -12.116 3.587   -0.570  1.00 0.00 ? 49  GLY A C    1  
ATOM 736   O O    . GLY A 1 49  ? -12.392 2.623   0.143   1.00 0.00 ? 49  GLY A O    1  
ATOM 737   H H    . GLY A 1 49  ? -12.734 4.275   1.854   1.00 0.00 ? 49  GLY A H    1  
ATOM 738   H HA2  . GLY A 1 49  ? -12.502 5.705   -0.708  1.00 0.00 ? 49  GLY A HA2  1  
ATOM 739   H HA3  . GLY A 1 49  ? -11.052 5.302   0.191   1.00 0.00 ? 49  GLY A HA3  1  
ATOM 740   N N    . ALA A 1 50  ? -11.829 3.507   -1.861  1.00 0.00 ? 50  ALA A N    1  
ATOM 741   C CA   . ALA A 1 50  ? -11.820 2.227   -2.548  1.00 0.00 ? 50  ALA A CA   1  
ATOM 742   C C    . ALA A 1 50  ? -11.203 1.166   -1.634  1.00 0.00 ? 50  ALA A C    1  
ATOM 743   O O    . ALA A 1 50  ? -11.663 0.026   -1.602  1.00 0.00 ? 50  ALA A O    1  
ATOM 744   C CB   . ALA A 1 50  ? -11.068 2.363   -3.873  1.00 0.00 ? 50  ALA A CB   1  
ATOM 745   H H    . ALA A 1 50  ? -11.605 4.296   -2.434  1.00 0.00 ? 50  ALA A H    1  
ATOM 746   H HA   . ALA A 1 50  ? -12.855 1.956   -2.758  1.00 0.00 ? 50  ALA A HA   1  
ATOM 747   H HB1  . ALA A 1 50  ? -10.036 2.654   -3.677  1.00 0.00 ? 50  ALA A HB1  1  
ATOM 748   H HB2  . ALA A 1 50  ? -11.082 1.409   -4.399  1.00 0.00 ? 50  ALA A HB2  1  
ATOM 749   H HB3  . ALA A 1 50  ? -11.549 3.124   -4.488  1.00 0.00 ? 50  ALA A HB3  1  
ATOM 750   N N    . ALA A 1 51  ? -10.171 1.580   -0.913  1.00 0.00 ? 51  ALA A N    1  
ATOM 751   C CA   . ALA A 1 51  ? -9.486  0.680   -0.001  1.00 0.00 ? 51  ALA A CA   1  
ATOM 752   C C    . ALA A 1 51  ? -10.509 0.040   0.940   1.00 0.00 ? 51  ALA A C    1  
ATOM 753   O O    . ALA A 1 51  ? -10.879 -1.120  0.764   1.00 0.00 ? 51  ALA A O    1  
ATOM 754   C CB   . ALA A 1 51  ? -8.400  1.448   0.754   1.00 0.00 ? 51  ALA A CB   1  
ATOM 755   H H    . ALA A 1 51  ? -9.803  2.510   -0.945  1.00 0.00 ? 51  ALA A H    1  
ATOM 756   H HA   . ALA A 1 51  ? -9.015  -0.101  -0.597  1.00 0.00 ? 51  ALA A HA   1  
ATOM 757   H HB1  . ALA A 1 51  ? -8.854  2.022   1.562   1.00 0.00 ? 51  ALA A HB1  1  
ATOM 758   H HB2  . ALA A 1 51  ? -7.679  0.744   1.170   1.00 0.00 ? 51  ALA A HB2  1  
ATOM 759   H HB3  . ALA A 1 51  ? -7.891  2.126   0.069   1.00 0.00 ? 51  ALA A HB3  1  
ATOM 760   N N    . ASP A 1 52  ? -10.936 0.823   1.920   1.00 0.00 ? 52  ASP A N    1  
ATOM 761   C CA   . ASP A 1 52  ? -11.908 0.348   2.889   1.00 0.00 ? 52  ASP A CA   1  
ATOM 762   C C    . ASP A 1 52  ? -13.248 0.113   2.188   1.00 0.00 ? 52  ASP A C    1  
ATOM 763   O O    . ASP A 1 52  ? -14.181 -0.417  2.788   1.00 0.00 ? 52  ASP A O    1  
ATOM 764   C CB   . ASP A 1 52  ? -12.129 1.377   3.999   1.00 0.00 ? 52  ASP A CB   1  
ATOM 765   C CG   . ASP A 1 52  ? -12.174 0.801   5.415   1.00 0.00 ? 52  ASP A CG   1  
ATOM 766   O OD1  . ASP A 1 52  ? -12.461 -0.410  5.527   1.00 0.00 ? 52  ASP A OD1  1  
ATOM 767   O OD2  . ASP A 1 52  ? -11.920 1.586   6.355   1.00 0.00 ? 52  ASP A OD2  1  
ATOM 768   H H    . ASP A 1 52  ? -10.629 1.766   2.056   1.00 0.00 ? 52  ASP A H    1  
ATOM 769   H HA   . ASP A 1 52  ? -11.483 -0.571  3.294   1.00 0.00 ? 52  ASP A HA   1  
ATOM 770   H HB2  . ASP A 1 52  ? -11.332 2.119   3.949   1.00 0.00 ? 52  ASP A HB2  1  
ATOM 771   H HB3  . ASP A 1 52  ? -13.065 1.902   3.806   1.00 0.00 ? 52  ASP A HB3  1  
ATOM 772   N N    . VAL A 1 53  ? -13.299 0.520   0.928   1.00 0.00 ? 53  VAL A N    1  
ATOM 773   C CA   . VAL A 1 53  ? -14.509 0.361   0.139   1.00 0.00 ? 53  VAL A CA   1  
ATOM 774   C C    . VAL A 1 53  ? -14.465 -0.984  -0.589  1.00 0.00 ? 53  VAL A C    1  
ATOM 775   O O    . VAL A 1 53  ? -15.506 -1.557  -0.905  1.00 0.00 ? 53  VAL A O    1  
ATOM 776   C CB   . VAL A 1 53  ? -14.675 1.550   -0.810  1.00 0.00 ? 53  VAL A CB   1  
ATOM 777   C CG1  . VAL A 1 53  ? -15.263 1.103   -2.150  1.00 0.00 ? 53  VAL A CG1  1  
ATOM 778   C CG2  . VAL A 1 53  ? -15.532 2.645   -0.172  1.00 0.00 ? 53  VAL A CG2  1  
ATOM 779   H H    . VAL A 1 53  ? -12.535 0.951   0.448   1.00 0.00 ? 53  VAL A H    1  
ATOM 780   H HA   . VAL A 1 53  ? -15.353 0.359   0.829   1.00 0.00 ? 53  VAL A HA   1  
ATOM 781   H HB   . VAL A 1 53  ? -13.686 1.967   -1.000  1.00 0.00 ? 53  VAL A HB   1  
ATOM 782   H HG11 . VAL A 1 53  ? -15.778 1.942   -2.618  1.00 0.00 ? 53  VAL A HG11 1  
ATOM 783   H HG12 . VAL A 1 53  ? -14.460 0.759   -2.802  1.00 0.00 ? 53  VAL A HG12 1  
ATOM 784   H HG13 . VAL A 1 53  ? -15.970 0.291   -1.984  1.00 0.00 ? 53  VAL A HG13 1  
ATOM 785   H HG21 . VAL A 1 53  ? -16.427 2.802   -0.774  1.00 0.00 ? 53  VAL A HG21 1  
ATOM 786   H HG22 . VAL A 1 53  ? -15.820 2.341   0.835   1.00 0.00 ? 53  VAL A HG22 1  
ATOM 787   H HG23 . VAL A 1 53  ? -14.960 3.571   -0.122  1.00 0.00 ? 53  VAL A HG23 1  
ATOM 788   N N    . ASP A 1 54  ? -13.248 -1.448  -0.834  1.00 0.00 ? 54  ASP A N    1  
ATOM 789   C CA   . ASP A 1 54  ? -13.054 -2.715  -1.519  1.00 0.00 ? 54  ASP A CA   1  
ATOM 790   C C    . ASP A 1 54  ? -13.148 -3.857  -0.506  1.00 0.00 ? 54  ASP A C    1  
ATOM 791   O O    . ASP A 1 54  ? -12.854 -5.006  -0.832  1.00 0.00 ? 54  ASP A O    1  
ATOM 792   C CB   . ASP A 1 54  ? -11.675 -2.779  -2.179  1.00 0.00 ? 54  ASP A CB   1  
ATOM 793   C CG   . ASP A 1 54  ? -11.420 -4.029  -3.022  1.00 0.00 ? 54  ASP A CG   1  
ATOM 794   O OD1  . ASP A 1 54  ? -11.957 -4.072  -4.150  1.00 0.00 ? 54  ASP A OD1  1  
ATOM 795   O OD2  . ASP A 1 54  ? -10.693 -4.914  -2.520  1.00 0.00 ? 54  ASP A OD2  1  
ATOM 796   H H    . ASP A 1 54  ? -12.406 -0.975  -0.573  1.00 0.00 ? 54  ASP A H    1  
ATOM 797   H HA   . ASP A 1 54  ? -13.843 -2.758  -2.270  1.00 0.00 ? 54  ASP A HA   1  
ATOM 798   H HB2  . ASP A 1 54  ? -11.551 -1.900  -2.811  1.00 0.00 ? 54  ASP A HB2  1  
ATOM 799   H HB3  . ASP A 1 54  ? -10.914 -2.722  -1.401  1.00 0.00 ? 54  ASP A HB3  1  
ATOM 800   N N    . GLY A 1 55  ? -13.557 -3.501  0.703   1.00 0.00 ? 55  GLY A N    1  
ATOM 801   C CA   . GLY A 1 55  ? -13.693 -4.483  1.766   1.00 0.00 ? 55  GLY A CA   1  
ATOM 802   C C    . GLY A 1 55  ? -12.521 -5.467  1.756   1.00 0.00 ? 55  GLY A C    1  
ATOM 803   O O    . GLY A 1 55  ? -12.725 -6.679  1.706   1.00 0.00 ? 55  GLY A O    1  
ATOM 804   H H    . GLY A 1 55  ? -13.794 -2.564  0.960   1.00 0.00 ? 55  GLY A H    1  
ATOM 805   H HA2  . GLY A 1 55  ? -13.738 -3.976  2.730   1.00 0.00 ? 55  GLY A HA2  1  
ATOM 806   H HA3  . GLY A 1 55  ? -14.630 -5.026  1.647   1.00 0.00 ? 55  GLY A HA3  1  
ATOM 807   N N    . ARG A 1 56  ? -11.321 -4.909  1.805   1.00 0.00 ? 56  ARG A N    1  
ATOM 808   C CA   . ARG A 1 56  ? -10.117 -5.722  1.803   1.00 0.00 ? 56  ARG A CA   1  
ATOM 809   C C    . ARG A 1 56  ? -8.960  -4.961  2.453   1.00 0.00 ? 56  ARG A C    1  
ATOM 810   O O    . ARG A 1 56  ? -8.183  -5.536  3.214   1.00 0.00 ? 56  ARG A O    1  
ATOM 811   C CB   . ARG A 1 56  ? -9.722  -6.117  0.378   1.00 0.00 ? 56  ARG A CB   1  
ATOM 812   C CG   . ARG A 1 56  ? -10.021 -7.594  0.115   1.00 0.00 ? 56  ARG A CG   1  
ATOM 813   C CD   . ARG A 1 56  ? -9.201  -8.118  -1.066  1.00 0.00 ? 56  ARG A CD   1  
ATOM 814   N NE   . ARG A 1 56  ? -9.471  -9.559  -1.269  1.00 0.00 ? 56  ARG A NE   1  
ATOM 815   C CZ   . ARG A 1 56  ? -9.087  -10.250 -2.351  1.00 0.00 ? 56  ARG A CZ   1  
ATOM 816   N NH1  . ARG A 1 56  ? -8.415  -9.635  -3.334  1.00 0.00 ? 56  ARG A NH1  1  
ATOM 817   N NH2  . ARG A 1 56  ? -9.375  -11.555 -2.450  1.00 0.00 ? 56  ARG A NH2  1  
ATOM 818   H H    . ARG A 1 56  ? -11.164 -3.922  1.846   1.00 0.00 ? 56  ARG A H    1  
ATOM 819   H HA   . ARG A 1 56  ? -10.378 -6.608  2.382   1.00 0.00 ? 56  ARG A HA   1  
ATOM 820   H HB2  . ARG A 1 56  ? -10.264 -5.499  -0.338  1.00 0.00 ? 56  ARG A HB2  1  
ATOM 821   H HB3  . ARG A 1 56  ? -8.660  -5.925  0.225   1.00 0.00 ? 56  ARG A HB3  1  
ATOM 822   H HG2  . ARG A 1 56  ? -9.796  -8.179  1.007   1.00 0.00 ? 56  ARG A HG2  1  
ATOM 823   H HG3  . ARG A 1 56  ? -11.084 -7.722  -0.090  1.00 0.00 ? 56  ARG A HG3  1  
ATOM 824   H HD2  . ARG A 1 56  ? -9.452  -7.562  -1.968  1.00 0.00 ? 56  ARG A HD2  1  
ATOM 825   H HD3  . ARG A 1 56  ? -8.139  -7.961  -0.879  1.00 0.00 ? 56  ARG A HD3  1  
ATOM 826   H HE   . ARG A 1 56  ? -9.971  -10.048 -0.554  1.00 0.00 ? 56  ARG A HE   1  
ATOM 827   H HH11 . ARG A 1 56  ? -8.200  -8.662  -3.260  1.00 0.00 ? 56  ARG A HH11 1  
ATOM 828   H HH12 . ARG A 1 56  ? -8.128  -10.151 -4.142  1.00 0.00 ? 56  ARG A HH12 1  
ATOM 829   H HH21 . ARG A 1 56  ? -9.877  -12.013 -1.717  1.00 0.00 ? 56  ARG A HH21 1  
ATOM 830   H HH22 . ARG A 1 56  ? -9.089  -12.070 -3.258  1.00 0.00 ? 56  ARG A HH22 1  
ATOM 831   N N    . LEU A 1 57  ? -8.882  -3.678  2.129   1.00 0.00 ? 57  LEU A N    1  
ATOM 832   C CA   . LEU A 1 57  ? -7.833  -2.832  2.672   1.00 0.00 ? 57  LEU A CA   1  
ATOM 833   C C    . LEU A 1 57  ? -8.085  -2.609  4.165   1.00 0.00 ? 57  LEU A C    1  
ATOM 834   O O    . LEU A 1 57  ? -9.224  -2.682  4.623   1.00 0.00 ? 57  LEU A O    1  
ATOM 835   C CB   . LEU A 1 57  ? -7.721  -1.535  1.868   1.00 0.00 ? 57  LEU A CB   1  
ATOM 836   C CG   . LEU A 1 57  ? -6.540  -1.448  0.898   1.00 0.00 ? 57  LEU A CG   1  
ATOM 837   C CD1  . LEU A 1 57  ? -5.268  -1.001  1.622   1.00 0.00 ? 57  LEU A CD1  1  
ATOM 838   C CD2  . LEU A 1 57  ? -6.342  -2.770  0.154   1.00 0.00 ? 57  LEU A CD2  1  
ATOM 839   H H    . LEU A 1 57  ? -9.518  -3.218  1.509   1.00 0.00 ? 57  LEU A H    1  
ATOM 840   H HA   . LEU A 1 57  ? -6.890  -3.366  2.557   1.00 0.00 ? 57  LEU A HA   1  
ATOM 841   H HB2  . LEU A 1 57  ? -8.642  -1.402  1.300   1.00 0.00 ? 57  LEU A HB2  1  
ATOM 842   H HB3  . LEU A 1 57  ? -7.653  -0.702  2.567   1.00 0.00 ? 57  LEU A HB3  1  
ATOM 843   H HG   . LEU A 1 57  ? -6.768  -0.689  0.150   1.00 0.00 ? 57  LEU A HG   1  
ATOM 844   H HD11 . LEU A 1 57  ? -4.493  -0.777  0.889   1.00 0.00 ? 57  LEU A HD11 1  
ATOM 845   H HD12 . LEU A 1 57  ? -5.480  -0.110  2.212   1.00 0.00 ? 57  LEU A HD12 1  
ATOM 846   H HD13 . LEU A 1 57  ? -4.925  -1.800  2.280   1.00 0.00 ? 57  LEU A HD13 1  
ATOM 847   H HD21 . LEU A 1 57  ? -5.998  -2.569  -0.860  1.00 0.00 ? 57  LEU A HD21 1  
ATOM 848   H HD22 . LEU A 1 57  ? -5.600  -3.374  0.677   1.00 0.00 ? 57  LEU A HD22 1  
ATOM 849   H HD23 . LEU A 1 57  ? -7.288  -3.310  0.116   1.00 0.00 ? 57  LEU A HD23 1  
ATOM 850   N N    . ALA A 1 58  ? -7.003  -2.343  4.882   1.00 0.00 ? 58  ALA A N    1  
ATOM 851   C CA   . ALA A 1 58  ? -7.092  -2.109  6.313   1.00 0.00 ? 58  ALA A CA   1  
ATOM 852   C C    . ALA A 1 58  ? -5.685  -2.112  6.914   1.00 0.00 ? 58  ALA A C    1  
ATOM 853   O O    . ALA A 1 58  ? -4.695  -2.107  6.185   1.00 0.00 ? 58  ALA A O    1  
ATOM 854   C CB   . ALA A 1 58  ? -7.999  -3.165  6.947   1.00 0.00 ? 58  ALA A CB   1  
ATOM 855   H H    . ALA A 1 58  ? -6.080  -2.285  4.501   1.00 0.00 ? 58  ALA A H    1  
ATOM 856   H HA   . ALA A 1 58  ? -7.540  -1.127  6.462   1.00 0.00 ? 58  ALA A HA   1  
ATOM 857   H HB1  . ALA A 1 58  ? -7.720  -3.305  7.991   1.00 0.00 ? 58  ALA A HB1  1  
ATOM 858   H HB2  . ALA A 1 58  ? -9.037  -2.835  6.890   1.00 0.00 ? 58  ALA A HB2  1  
ATOM 859   H HB3  . ALA A 1 58  ? -7.888  -4.108  6.412   1.00 0.00 ? 58  ALA A HB3  1  
ATOM 860   N N    . ALA A 1 59  ? -5.643  -2.119  8.239   1.00 0.00 ? 59  ALA A N    1  
ATOM 861   C CA   . ALA A 1 59  ? -4.374  -2.122  8.946   1.00 0.00 ? 59  ALA A CA   1  
ATOM 862   C C    . ALA A 1 59  ? -3.682  -3.471  8.738   1.00 0.00 ? 59  ALA A C    1  
ATOM 863   O O    . ALA A 1 59  ? -4.154  -4.497  9.225   1.00 0.00 ? 59  ALA A O    1  
ATOM 864   C CB   . ALA A 1 59  ? -4.613  -1.812  10.425  1.00 0.00 ? 59  ALA A CB   1  
ATOM 865   H H    . ALA A 1 59  ? -6.453  -2.123  8.824   1.00 0.00 ? 59  ALA A H    1  
ATOM 866   H HA   . ALA A 1 59  ? -3.753  -1.335  8.519   1.00 0.00 ? 59  ALA A HA   1  
ATOM 867   H HB1  . ALA A 1 59  ? -4.753  -2.744  10.974  1.00 0.00 ? 59  ALA A HB1  1  
ATOM 868   H HB2  . ALA A 1 59  ? -3.752  -1.279  10.829  1.00 0.00 ? 59  ALA A HB2  1  
ATOM 869   H HB3  . ALA A 1 59  ? -5.504  -1.193  10.527  1.00 0.00 ? 59  ALA A HB3  1  
ATOM 870   N N    . GLY A 1 60  ? -2.574  -3.426  8.013   1.00 0.00 ? 60  GLY A N    1  
ATOM 871   C CA   . GLY A 1 60  ? -1.812  -4.631  7.734   1.00 0.00 ? 60  GLY A CA   1  
ATOM 872   C C    . GLY A 1 60  ? -1.653  -4.843  6.227   1.00 0.00 ? 60  GLY A C    1  
ATOM 873   O O    . GLY A 1 60  ? -1.801  -5.960  5.735   1.00 0.00 ? 60  GLY A O    1  
ATOM 874   H H    . GLY A 1 60  ? -2.196  -2.587  7.620   1.00 0.00 ? 60  GLY A H    1  
ATOM 875   H HA2  . GLY A 1 60  ? -0.830  -4.561  8.201   1.00 0.00 ? 60  GLY A HA2  1  
ATOM 876   H HA3  . GLY A 1 60  ? -2.314  -5.493  8.175   1.00 0.00 ? 60  GLY A HA3  1  
ATOM 877   N N    . ASP A 1 61  ? -1.352  -3.752  5.538   1.00 0.00 ? 61  ASP A N    1  
ATOM 878   C CA   . ASP A 1 61  ? -1.171  -3.804  4.097   1.00 0.00 ? 61  ASP A CA   1  
ATOM 879   C C    . ASP A 1 61  ? 0.199   -3.226  3.738   1.00 0.00 ? 61  ASP A C    1  
ATOM 880   O O    . ASP A 1 61  ? 0.301   -2.073  3.322   1.00 0.00 ? 61  ASP A O    1  
ATOM 881   C CB   . ASP A 1 61  ? -2.237  -2.975  3.377   1.00 0.00 ? 61  ASP A CB   1  
ATOM 882   C CG   . ASP A 1 61  ? -3.014  -3.723  2.293   1.00 0.00 ? 61  ASP A CG   1  
ATOM 883   O OD1  . ASP A 1 61  ? -3.928  -4.486  2.673   1.00 0.00 ? 61  ASP A OD1  1  
ATOM 884   O OD2  . ASP A 1 61  ? -2.677  -3.515  1.107   1.00 0.00 ? 61  ASP A OD2  1  
ATOM 885   H H    . ASP A 1 61  ? -1.233  -2.847  5.946   1.00 0.00 ? 61  ASP A H    1  
ATOM 886   H HA   . ASP A 1 61  ? -1.260  -4.858  3.835   1.00 0.00 ? 61  ASP A HA   1  
ATOM 887   H HB2  . ASP A 1 61  ? -2.944  -2.600  4.117   1.00 0.00 ? 61  ASP A HB2  1  
ATOM 888   H HB3  . ASP A 1 61  ? -1.757  -2.107  2.926   1.00 0.00 ? 61  ASP A HB3  1  
ATOM 889   N N    . GLN A 1 62  ? 1.219   -4.053  3.913   1.00 0.00 ? 62  GLN A N    1  
ATOM 890   C CA   . GLN A 1 62  ? 2.579   -3.639  3.613   1.00 0.00 ? 62  GLN A CA   1  
ATOM 891   C C    . GLN A 1 62  ? 2.785   -3.549  2.099   1.00 0.00 ? 62  GLN A C    1  
ATOM 892   O O    . GLN A 1 62  ? 2.820   -4.569  1.413   1.00 0.00 ? 62  GLN A O    1  
ATOM 893   C CB   . GLN A 1 62  ? 3.595   -4.589  4.249   1.00 0.00 ? 62  GLN A CB   1  
ATOM 894   C CG   . GLN A 1 62  ? 5.025   -4.093  4.026   1.00 0.00 ? 62  GLN A CG   1  
ATOM 895   C CD   . GLN A 1 62  ? 5.870   -5.154  3.317   1.00 0.00 ? 62  GLN A CD   1  
ATOM 896   O OE1  . GLN A 1 62  ? 5.462   -5.756  2.338   1.00 0.00 ? 62  GLN A OE1  1  
ATOM 897   N NE2  . GLN A 1 62  ? 7.066   -5.348  3.866   1.00 0.00 ? 62  GLN A NE2  1  
ATOM 898   H H    . GLN A 1 62  ? 1.128   -4.990  4.252   1.00 0.00 ? 62  GLN A H    1  
ATOM 899   H HA   . GLN A 1 62  ? 2.686   -2.650  4.060   1.00 0.00 ? 62  GLN A HA   1  
ATOM 900   H HB2  . GLN A 1 62  ? 3.399   -4.675  5.318   1.00 0.00 ? 62  GLN A HB2  1  
ATOM 901   H HB3  . GLN A 1 62  ? 3.482   -5.586  3.824   1.00 0.00 ? 62  GLN A HB3  1  
ATOM 902   H HG2  . GLN A 1 62  ? 5.008   -3.179  3.431   1.00 0.00 ? 62  GLN A HG2  1  
ATOM 903   H HG3  . GLN A 1 62  ? 5.480   -3.841  4.984   1.00 0.00 ? 62  GLN A HG3  1  
ATOM 904   H HE21 . GLN A 1 62  ? 7.339   -4.821  4.670   1.00 0.00 ? 62  GLN A HE21 1  
ATOM 905   H HE22 . GLN A 1 62  ? 7.692   -6.023  3.474   1.00 0.00 ? 62  GLN A HE22 1  
ATOM 906   N N    . LEU A 1 63  ? 2.917   -2.319  1.624   1.00 0.00 ? 63  LEU A N    1  
ATOM 907   C CA   . LEU A 1 63  ? 3.119   -2.083  0.205   1.00 0.00 ? 63  LEU A CA   1  
ATOM 908   C C    . LEU A 1 63  ? 4.616   -2.119  -0.106  1.00 0.00 ? 63  LEU A C    1  
ATOM 909   O O    . LEU A 1 63  ? 5.377   -1.290  0.392   1.00 0.00 ? 63  LEU A O    1  
ATOM 910   C CB   . LEU A 1 63  ? 2.432   -0.786  -0.226  1.00 0.00 ? 63  LEU A CB   1  
ATOM 911   C CG   . LEU A 1 63  ? 1.033   -0.545  0.346   1.00 0.00 ? 63  LEU A CG   1  
ATOM 912   C CD1  . LEU A 1 63  ? 1.095   0.342   1.591   1.00 0.00 ? 63  LEU A CD1  1  
ATOM 913   C CD2  . LEU A 1 63  ? 0.095   0.025   -0.719  1.00 0.00 ? 63  LEU A CD2  1  
ATOM 914   H H    . LEU A 1 63  ? 2.888   -1.495  2.190   1.00 0.00 ? 63  LEU A H    1  
ATOM 915   H HA   . LEU A 1 63  ? 2.635   -2.898  -0.334  1.00 0.00 ? 63  LEU A HA   1  
ATOM 916   H HB2  . LEU A 1 63  ? 3.068   0.051   0.061   1.00 0.00 ? 63  LEU A HB2  1  
ATOM 917   H HB3  . LEU A 1 63  ? 2.364   -0.777  -1.314  1.00 0.00 ? 63  LEU A HB3  1  
ATOM 918   H HG   . LEU A 1 63  ? 0.621   -1.506  0.656   1.00 0.00 ? 63  LEU A HG   1  
ATOM 919   H HD11 . LEU A 1 63  ? 1.379   -0.260  2.453   1.00 0.00 ? 63  LEU A HD11 1  
ATOM 920   H HD12 . LEU A 1 63  ? 1.832   1.131   1.438   1.00 0.00 ? 63  LEU A HD12 1  
ATOM 921   H HD13 . LEU A 1 63  ? 0.116   0.790   1.767   1.00 0.00 ? 63  LEU A HD13 1  
ATOM 922   H HD21 . LEU A 1 63  ? -0.810  -0.579  -0.768  1.00 0.00 ? 63  LEU A HD21 1  
ATOM 923   H HD22 . LEU A 1 63  ? -0.166  1.051   -0.461  1.00 0.00 ? 63  LEU A HD22 1  
ATOM 924   H HD23 . LEU A 1 63  ? 0.595   0.010   -1.688  1.00 0.00 ? 63  LEU A HD23 1  
ATOM 925   N N    . LEU A 1 64  ? 4.995   -3.087  -0.928  1.00 0.00 ? 64  LEU A N    1  
ATOM 926   C CA   . LEU A 1 64  ? 6.388   -3.241  -1.311  1.00 0.00 ? 64  LEU A CA   1  
ATOM 927   C C    . LEU A 1 64  ? 6.716   -2.253  -2.432  1.00 0.00 ? 64  LEU A C    1  
ATOM 928   O O    . LEU A 1 64  ? 7.877   -1.897  -2.631  1.00 0.00 ? 64  LEU A O    1  
ATOM 929   C CB   . LEU A 1 64  ? 6.688   -4.698  -1.668  1.00 0.00 ? 64  LEU A CB   1  
ATOM 930   C CG   . LEU A 1 64  ? 7.622   -5.444  -0.713  1.00 0.00 ? 64  LEU A CG   1  
ATOM 931   C CD1  . LEU A 1 64  ? 7.019   -6.785  -0.292  1.00 0.00 ? 64  LEU A CD1  1  
ATOM 932   C CD2  . LEU A 1 64  ? 9.014   -5.609  -1.325  1.00 0.00 ? 64  LEU A CD2  1  
ATOM 933   H H    . LEU A 1 64  ? 4.370   -3.756  -1.329  1.00 0.00 ? 64  LEU A H    1  
ATOM 934   H HA   . LEU A 1 64  ? 6.996   -2.990  -0.441  1.00 0.00 ? 64  LEU A HA   1  
ATOM 935   H HB2  . LEU A 1 64  ? 5.744   -5.240  -1.718  1.00 0.00 ? 64  LEU A HB2  1  
ATOM 936   H HB3  . LEU A 1 64  ? 7.124   -4.725  -2.666  1.00 0.00 ? 64  LEU A HB3  1  
ATOM 937   H HG   . LEU A 1 64  ? 7.737   -4.845  0.191   1.00 0.00 ? 64  LEU A HG   1  
ATOM 938   H HD11 . LEU A 1 64  ? 7.815   -7.459  0.023   1.00 0.00 ? 64  LEU A HD11 1  
ATOM 939   H HD12 . LEU A 1 64  ? 6.327   -6.629  0.536   1.00 0.00 ? 64  LEU A HD12 1  
ATOM 940   H HD13 . LEU A 1 64  ? 6.484   -7.224  -1.134  1.00 0.00 ? 64  LEU A HD13 1  
ATOM 941   H HD21 . LEU A 1 64  ? 9.529   -4.648  -1.320  1.00 0.00 ? 64  LEU A HD21 1  
ATOM 942   H HD22 . LEU A 1 64  ? 9.585   -6.330  -0.741  1.00 0.00 ? 64  LEU A HD22 1  
ATOM 943   H HD23 . LEU A 1 64  ? 8.920   -5.965  -2.351  1.00 0.00 ? 64  LEU A HD23 1  
ATOM 944   N N    . SER A 1 65  ? 5.674   -1.838  -3.136  1.00 0.00 ? 65  SER A N    1  
ATOM 945   C CA   . SER A 1 65  ? 5.837   -0.898  -4.232  1.00 0.00 ? 65  SER A CA   1  
ATOM 946   C C    . SER A 1 65  ? 4.482   -0.296  -4.611  1.00 0.00 ? 65  SER A C    1  
ATOM 947   O O    . SER A 1 65  ? 3.438   -0.883  -4.332  1.00 0.00 ? 65  SER A O    1  
ATOM 948   C CB   . SER A 1 65  ? 6.475   -1.575  -5.447  1.00 0.00 ? 65  SER A CB   1  
ATOM 949   O OG   . SER A 1 65  ? 5.989   -2.901  -5.637  1.00 0.00 ? 65  SER A OG   1  
ATOM 950   H H    . SER A 1 65  ? 4.733   -2.132  -2.968  1.00 0.00 ? 65  SER A H    1  
ATOM 951   H HA   . SER A 1 65  ? 6.506   -0.126  -3.854  1.00 0.00 ? 65  SER A HA   1  
ATOM 952   H HB2  . SER A 1 65  ? 6.271   -0.983  -6.340  1.00 0.00 ? 65  SER A HB2  1  
ATOM 953   H HB3  . SER A 1 65  ? 7.557   -1.600  -5.321  1.00 0.00 ? 65  SER A HB3  1  
ATOM 954   H HG   . SER A 1 65  ? 6.751   -3.548  -5.639  1.00 0.00 ? 65  SER A HG   1  
ATOM 955   N N    . VAL A 1 66  ? 4.543   0.868   -5.240  1.00 0.00 ? 66  VAL A N    1  
ATOM 956   C CA   . VAL A 1 66  ? 3.335   1.557   -5.660  1.00 0.00 ? 66  VAL A CA   1  
ATOM 957   C C    . VAL A 1 66  ? 3.580   2.231   -7.011  1.00 0.00 ? 66  VAL A C    1  
ATOM 958   O O    . VAL A 1 66  ? 4.512   3.022   -7.155  1.00 0.00 ? 66  VAL A O    1  
ATOM 959   C CB   . VAL A 1 66  ? 2.888   2.538   -4.575  1.00 0.00 ? 66  VAL A CB   1  
ATOM 960   C CG1  . VAL A 1 66  ? 2.738   1.832   -3.225  1.00 0.00 ? 66  VAL A CG1  1  
ATOM 961   C CG2  . VAL A 1 66  ? 3.854   3.719   -4.471  1.00 0.00 ? 66  VAL A CG2  1  
ATOM 962   H H    . VAL A 1 66  ? 5.397   1.339   -5.463  1.00 0.00 ? 66  VAL A H    1  
ATOM 963   H HA   . VAL A 1 66  ? 2.553   0.806   -5.779  1.00 0.00 ? 66  VAL A HA   1  
ATOM 964   H HB   . VAL A 1 66  ? 1.910   2.929   -4.858  1.00 0.00 ? 66  VAL A HB   1  
ATOM 965   H HG11 . VAL A 1 66  ? 2.374   0.817   -3.385  1.00 0.00 ? 66  VAL A HG11 1  
ATOM 966   H HG12 . VAL A 1 66  ? 3.706   1.796   -2.725  1.00 0.00 ? 66  VAL A HG12 1  
ATOM 967   H HG13 . VAL A 1 66  ? 2.028   2.380   -2.606  1.00 0.00 ? 66  VAL A HG13 1  
ATOM 968   H HG21 . VAL A 1 66  ? 3.694   4.238   -3.526  1.00 0.00 ? 66  VAL A HG21 1  
ATOM 969   H HG22 . VAL A 1 66  ? 4.880   3.354   -4.516  1.00 0.00 ? 66  VAL A HG22 1  
ATOM 970   H HG23 . VAL A 1 66  ? 3.677   4.407   -5.298  1.00 0.00 ? 66  VAL A HG23 1  
ATOM 971   N N    . ASP A 1 67  ? 2.728   1.894   -7.968  1.00 0.00 ? 67  ASP A N    1  
ATOM 972   C CA   . ASP A 1 67  ? 2.841   2.457   -9.303  1.00 0.00 ? 67  ASP A CA   1  
ATOM 973   C C    . ASP A 1 67  ? 4.260   2.233   -9.828  1.00 0.00 ? 67  ASP A C    1  
ATOM 974   O O    . ASP A 1 67  ? 4.799   3.072   -10.548 1.00 0.00 ? 67  ASP A O    1  
ATOM 975   C CB   . ASP A 1 67  ? 2.574   3.964   -9.289  1.00 0.00 ? 67  ASP A CB   1  
ATOM 976   C CG   . ASP A 1 67  ? 1.097   4.360   -9.342  1.00 0.00 ? 67  ASP A CG   1  
ATOM 977   O OD1  . ASP A 1 67  ? 0.367   3.725   -10.135 1.00 0.00 ? 67  ASP A OD1  1  
ATOM 978   O OD2  . ASP A 1 67  ? 0.731   5.287   -8.589  1.00 0.00 ? 67  ASP A OD2  1  
ATOM 979   H H    . ASP A 1 67  ? 1.973   1.251   -7.844  1.00 0.00 ? 67  ASP A H    1  
ATOM 980   H HA   . ASP A 1 67  ? 2.089   1.938   -9.897  1.00 0.00 ? 67  ASP A HA   1  
ATOM 981   H HB2  . ASP A 1 67  ? 3.016   4.388   -8.388  1.00 0.00 ? 67  ASP A HB2  1  
ATOM 982   H HB3  . ASP A 1 67  ? 3.086   4.416   -10.139 1.00 0.00 ? 67  ASP A HB3  1  
ATOM 983   N N    . GLY A 1 68  ? 4.825   1.097   -9.448  1.00 0.00 ? 68  GLY A N    1  
ATOM 984   C CA   . GLY A 1 68  ? 6.171   0.752   -9.871  1.00 0.00 ? 68  GLY A CA   1  
ATOM 985   C C    . GLY A 1 68  ? 7.208   1.244   -8.859  1.00 0.00 ? 68  GLY A C    1  
ATOM 986   O O    . GLY A 1 68  ? 8.250   0.617   -8.677  1.00 0.00 ? 68  GLY A O    1  
ATOM 987   H H    . GLY A 1 68  ? 4.380   0.420   -8.862  1.00 0.00 ? 68  GLY A H    1  
ATOM 988   H HA2  . GLY A 1 68  ? 6.255   -0.329  -9.986  1.00 0.00 ? 68  GLY A HA2  1  
ATOM 989   H HA3  . GLY A 1 68  ? 6.373   1.193   -10.848 1.00 0.00 ? 68  GLY A HA3  1  
ATOM 990   N N    . ARG A 1 69  ? 6.886   2.364   -8.228  1.00 0.00 ? 69  ARG A N    1  
ATOM 991   C CA   . ARG A 1 69  ? 7.776   2.947   -7.239  1.00 0.00 ? 69  ARG A CA   1  
ATOM 992   C C    . ARG A 1 69  ? 7.785   2.099   -5.966  1.00 0.00 ? 69  ARG A C    1  
ATOM 993   O O    . ARG A 1 69  ? 6.752   1.936   -5.317  1.00 0.00 ? 69  ARG A O    1  
ATOM 994   C CB   . ARG A 1 69  ? 7.350   4.375   -6.889  1.00 0.00 ? 69  ARG A CB   1  
ATOM 995   C CG   . ARG A 1 69  ? 8.479   5.368   -7.170  1.00 0.00 ? 69  ARG A CG   1  
ATOM 996   C CD   . ARG A 1 69  ? 9.443   5.452   -5.985  1.00 0.00 ? 69  ARG A CD   1  
ATOM 997   N NE   . ARG A 1 69  ? 10.498  6.453   -6.261  1.00 0.00 ? 69  ARG A NE   1  
ATOM 998   C CZ   . ARG A 1 69  ? 11.659  6.524   -5.596  1.00 0.00 ? 69  ARG A CZ   1  
ATOM 999   N NH1  . ARG A 1 69  ? 11.921  5.654   -4.611  1.00 0.00 ? 69  ARG A NH1  1  
ATOM 1000  N NH2  . ARG A 1 69  ? 12.558  7.466   -5.914  1.00 0.00 ? 69  ARG A NH2  1  
ATOM 1001  H H    . ARG A 1 69  ? 6.036   2.868   -8.382  1.00 0.00 ? 69  ARG A H    1  
ATOM 1002  H HA   . ARG A 1 69  ? 8.756   2.951   -7.714  1.00 0.00 ? 69  ARG A HA   1  
ATOM 1003  H HB2  . ARG A 1 69  ? 6.468   4.647   -7.468  1.00 0.00 ? 69  ARG A HB2  1  
ATOM 1004  H HB3  . ARG A 1 69  ? 7.069   4.427   -5.837  1.00 0.00 ? 69  ARG A HB3  1  
ATOM 1005  H HG2  . ARG A 1 69  ? 9.022   5.063   -8.065  1.00 0.00 ? 69  ARG A HG2  1  
ATOM 1006  H HG3  . ARG A 1 69  ? 8.059   6.354   -7.373  1.00 0.00 ? 69  ARG A HG3  1  
ATOM 1007  H HD2  . ARG A 1 69  ? 8.899   5.725   -5.081  1.00 0.00 ? 69  ARG A HD2  1  
ATOM 1008  H HD3  . ARG A 1 69  ? 9.895   4.477   -5.803  1.00 0.00 ? 69  ARG A HD3  1  
ATOM 1009  H HE   . ARG A 1 69  ? 10.334  7.118   -6.990  1.00 0.00 ? 69  ARG A HE   1  
ATOM 1010  H HH11 . ARG A 1 69  ? 11.251  4.951   -4.373  1.00 0.00 ? 69  ARG A HH11 1  
ATOM 1011  H HH12 . ARG A 1 69  ? 12.788  5.707   -4.115  1.00 0.00 ? 69  ARG A HH12 1  
ATOM 1012  H HH21 . ARG A 1 69  ? 12.362  8.115   -6.649  1.00 0.00 ? 69  ARG A HH21 1  
ATOM 1013  H HH22 . ARG A 1 69  ? 13.424  7.519   -5.418  1.00 0.00 ? 69  ARG A HH22 1  
ATOM 1014  N N    . SER A 1 70  ? 8.961   1.580   -5.646  1.00 0.00 ? 70  SER A N    1  
ATOM 1015  C CA   . SER A 1 70  ? 9.118   0.752   -4.463  1.00 0.00 ? 70  SER A CA   1  
ATOM 1016  C C    . SER A 1 70  ? 8.666   1.524   -3.221  1.00 0.00 ? 70  SER A C    1  
ATOM 1017  O O    . SER A 1 70  ? 8.962   2.710   -3.081  1.00 0.00 ? 70  SER A O    1  
ATOM 1018  C CB   . SER A 1 70  ? 10.568  0.290   -4.302  1.00 0.00 ? 70  SER A CB   1  
ATOM 1019  O OG   . SER A 1 70  ? 10.652  -1.083  -3.928  1.00 0.00 ? 70  SER A OG   1  
ATOM 1020  H H    . SER A 1 70  ? 9.796   1.717   -6.180  1.00 0.00 ? 70  SER A H    1  
ATOM 1021  H HA   . SER A 1 70  ? 8.477   -0.114  -4.629  1.00 0.00 ? 70  SER A HA   1  
ATOM 1022  H HB2  . SER A 1 70  ? 11.103  0.444   -5.239  1.00 0.00 ? 70  SER A HB2  1  
ATOM 1023  H HB3  . SER A 1 70  ? 11.062  0.902   -3.548  1.00 0.00 ? 70  SER A HB3  1  
ATOM 1024  H HG   . SER A 1 70  ? 10.056  -1.634  -4.513  1.00 0.00 ? 70  SER A HG   1  
ATOM 1025  N N    . LEU A 1 71  ? 7.957   0.819   -2.351  1.00 0.00 ? 71  LEU A N    1  
ATOM 1026  C CA   . LEU A 1 71  ? 7.462   1.423   -1.126  1.00 0.00 ? 71  LEU A CA   1  
ATOM 1027  C C    . LEU A 1 71  ? 8.015   0.655   0.076   1.00 0.00 ? 71  LEU A C    1  
ATOM 1028  O O    . LEU A 1 71  ? 7.795   1.045   1.221   1.00 0.00 ? 71  LEU A O    1  
ATOM 1029  C CB   . LEU A 1 71  ? 5.934   1.509   -1.151  1.00 0.00 ? 71  LEU A CB   1  
ATOM 1030  C CG   . LEU A 1 71  ? 5.323   2.766   -0.529  1.00 0.00 ? 71  LEU A CG   1  
ATOM 1031  C CD1  . LEU A 1 71  ? 5.057   3.831   -1.594  1.00 0.00 ? 71  LEU A CD1  1  
ATOM 1032  C CD2  . LEU A 1 71  ? 4.063   2.426   0.270   1.00 0.00 ? 71  LEU A CD2  1  
ATOM 1033  H H    . LEU A 1 71  ? 7.721   -0.145  -2.473  1.00 0.00 ? 71  LEU A H    1  
ATOM 1034  H HA   . LEU A 1 71  ? 7.842   2.444   -1.088  1.00 0.00 ? 71  LEU A HA   1  
ATOM 1035  H HB2  . LEU A 1 71  ? 5.603   1.443   -2.187  1.00 0.00 ? 71  LEU A HB2  1  
ATOM 1036  H HB3  . LEU A 1 71  ? 5.533   0.639   -0.632  1.00 0.00 ? 71  LEU A HB3  1  
ATOM 1037  H HG   . LEU A 1 71  ? 6.045   3.186   0.172   1.00 0.00 ? 71  LEU A HG   1  
ATOM 1038  H HD11 . LEU A 1 71  ? 5.679   4.705   -1.399  1.00 0.00 ? 71  LEU A HD11 1  
ATOM 1039  H HD12 . LEU A 1 71  ? 5.295   3.428   -2.578  1.00 0.00 ? 71  LEU A HD12 1  
ATOM 1040  H HD13 . LEU A 1 71  ? 4.006   4.120   -1.564  1.00 0.00 ? 71  LEU A HD13 1  
ATOM 1041  H HD21 . LEU A 1 71  ? 3.857   3.226   0.981   1.00 0.00 ? 71  LEU A HD21 1  
ATOM 1042  H HD22 . LEU A 1 71  ? 3.219   2.319   -0.412  1.00 0.00 ? 71  LEU A HD22 1  
ATOM 1043  H HD23 . LEU A 1 71  ? 4.216   1.491   0.809   1.00 0.00 ? 71  LEU A HD23 1  
ATOM 1044  N N    . VAL A 1 72  ? 8.723   -0.423  -0.226  1.00 0.00 ? 72  VAL A N    1  
ATOM 1045  C CA   . VAL A 1 72  ? 9.310   -1.250  0.815   1.00 0.00 ? 72  VAL A CA   1  
ATOM 1046  C C    . VAL A 1 72  ? 10.439  -0.476  1.499   1.00 0.00 ? 72  VAL A C    1  
ATOM 1047  O O    . VAL A 1 72  ? 11.572  -0.950  1.561   1.00 0.00 ? 72  VAL A O    1  
ATOM 1048  C CB   . VAL A 1 72  ? 9.771   -2.584  0.226   1.00 0.00 ? 72  VAL A CB   1  
ATOM 1049  C CG1  . VAL A 1 72  ? 11.002  -2.395  -0.663  1.00 0.00 ? 72  VAL A CG1  1  
ATOM 1050  C CG2  . VAL A 1 72  ? 10.045  -3.606  1.332   1.00 0.00 ? 72  VAL A CG2  1  
ATOM 1051  H H    . VAL A 1 72  ? 8.898   -0.734  -1.161  1.00 0.00 ? 72  VAL A H    1  
ATOM 1052  H HA   . VAL A 1 72  ? 8.531   -1.456  1.549   1.00 0.00 ? 72  VAL A HA   1  
ATOM 1053  H HB   . VAL A 1 72  ? 8.965   -2.973  -0.396  1.00 0.00 ? 72  VAL A HB   1  
ATOM 1054  H HG11 . VAL A 1 72  ? 10.745  -2.637  -1.695  1.00 0.00 ? 72  VAL A HG11 1  
ATOM 1055  H HG12 . VAL A 1 72  ? 11.336  -1.359  -0.605  1.00 0.00 ? 72  VAL A HG12 1  
ATOM 1056  H HG13 . VAL A 1 72  ? 11.800  -3.054  -0.324  1.00 0.00 ? 72  VAL A HG13 1  
ATOM 1057  H HG21 . VAL A 1 72  ? 9.110   -4.079  1.629   1.00 0.00 ? 72  VAL A HG21 1  
ATOM 1058  H HG22 . VAL A 1 72  ? 10.735  -4.364  0.962   1.00 0.00 ? 72  VAL A HG22 1  
ATOM 1059  H HG23 . VAL A 1 72  ? 10.487  -3.101  2.191   1.00 0.00 ? 72  VAL A HG23 1  
ATOM 1060  N N    . GLY A 1 73  ? 10.090  0.702   1.994   1.00 0.00 ? 73  GLY A N    1  
ATOM 1061  C CA   . GLY A 1 73  ? 11.060  1.546   2.671   1.00 0.00 ? 73  GLY A CA   1  
ATOM 1062  C C    . GLY A 1 73  ? 10.962  2.994   2.184   1.00 0.00 ? 73  GLY A C    1  
ATOM 1063  O O    . GLY A 1 73  ? 11.979  3.644   1.950   1.00 0.00 ? 73  GLY A O    1  
ATOM 1064  H H    . GLY A 1 73  ? 9.166   1.081   1.940   1.00 0.00 ? 73  GLY A H    1  
ATOM 1065  H HA2  . GLY A 1 73  ? 10.891  1.509   3.748   1.00 0.00 ? 73  GLY A HA2  1  
ATOM 1066  H HA3  . GLY A 1 73  ? 12.065  1.166   2.493   1.00 0.00 ? 73  GLY A HA3  1  
ATOM 1067  N N    . LEU A 1 74  ? 9.727   3.455   2.045   1.00 0.00 ? 74  LEU A N    1  
ATOM 1068  C CA   . LEU A 1 74  ? 9.483   4.813   1.590   1.00 0.00 ? 74  LEU A CA   1  
ATOM 1069  C C    . LEU A 1 74  ? 9.003   5.663   2.768   1.00 0.00 ? 74  LEU A C    1  
ATOM 1070  O O    . LEU A 1 74  ? 8.788   5.146   3.864   1.00 0.00 ? 74  LEU A O    1  
ATOM 1071  C CB   . LEU A 1 74  ? 8.523   4.815   0.399   1.00 0.00 ? 74  LEU A CB   1  
ATOM 1072  C CG   . LEU A 1 74  ? 9.172   4.755   -0.985  1.00 0.00 ? 74  LEU A CG   1  
ATOM 1073  C CD1  . LEU A 1 74  ? 8.132   4.966   -2.088  1.00 0.00 ? 74  LEU A CD1  1  
ATOM 1074  C CD2  . LEU A 1 74  ? 10.330  5.749   -1.092  1.00 0.00 ? 74  LEU A CD2  1  
ATOM 1075  H H    . LEU A 1 74  ? 8.905   2.920   2.237   1.00 0.00 ? 74  LEU A H    1  
ATOM 1076  H HA   . LEU A 1 74  ? 10.433  5.216   1.239   1.00 0.00 ? 74  LEU A HA   1  
ATOM 1077  H HB2  . LEU A 1 74  ? 7.849   3.964   0.500   1.00 0.00 ? 74  LEU A HB2  1  
ATOM 1078  H HB3  . LEU A 1 74  ? 7.911   5.715   0.453   1.00 0.00 ? 74  LEU A HB3  1  
ATOM 1079  H HG   . LEU A 1 74  ? 9.589   3.757   -1.124  1.00 0.00 ? 74  LEU A HG   1  
ATOM 1080  H HD11 . LEU A 1 74  ? 8.638   5.101   -3.044  1.00 0.00 ? 74  LEU A HD11 1  
ATOM 1081  H HD12 . LEU A 1 74  ? 7.478   4.095   -2.142  1.00 0.00 ? 74  LEU A HD12 1  
ATOM 1082  H HD13 . LEU A 1 74  ? 7.538   5.852   -1.862  1.00 0.00 ? 74  LEU A HD13 1  
ATOM 1083  H HD21 . LEU A 1 74  ? 10.518  5.976   -2.141  1.00 0.00 ? 74  LEU A HD21 1  
ATOM 1084  H HD22 . LEU A 1 74  ? 10.072  6.666   -0.562  1.00 0.00 ? 74  LEU A HD22 1  
ATOM 1085  H HD23 . LEU A 1 74  ? 11.225  5.312   -0.649  1.00 0.00 ? 74  LEU A HD23 1  
ATOM 1086  N N    . SER A 1 75  ? 8.849   6.952   2.503   1.00 0.00 ? 75  SER A N    1  
ATOM 1087  C CA   . SER A 1 75  ? 8.398   7.878   3.528   1.00 0.00 ? 75  SER A CA   1  
ATOM 1088  C C    . SER A 1 75  ? 6.976   8.351   3.217   1.00 0.00 ? 75  SER A C    1  
ATOM 1089  O O    . SER A 1 75  ? 6.674   8.716   2.082   1.00 0.00 ? 75  SER A O    1  
ATOM 1090  C CB   . SER A 1 75  ? 9.343   9.076   3.642   1.00 0.00 ? 75  SER A CB   1  
ATOM 1091  O OG   . SER A 1 75  ? 9.023   9.904   4.757   1.00 0.00 ? 75  SER A OG   1  
ATOM 1092  H H    . SER A 1 75  ? 9.026   7.364   1.609   1.00 0.00 ? 75  SER A H    1  
ATOM 1093  H HA   . SER A 1 75  ? 8.417   7.311   4.458   1.00 0.00 ? 75  SER A HA   1  
ATOM 1094  H HB2  . SER A 1 75  ? 10.369  8.721   3.737   1.00 0.00 ? 75  SER A HB2  1  
ATOM 1095  H HB3  . SER A 1 75  ? 9.293   9.665   2.726   1.00 0.00 ? 75  SER A HB3  1  
ATOM 1096  H HG   . SER A 1 75  ? 9.826   10.431  5.033   1.00 0.00 ? 75  SER A HG   1  
ATOM 1097  N N    . GLN A 1 76  ? 6.141   8.329   4.245   1.00 0.00 ? 76  GLN A N    1  
ATOM 1098  C CA   . GLN A 1 76  ? 4.759   8.751   4.096   1.00 0.00 ? 76  GLN A CA   1  
ATOM 1099  C C    . GLN A 1 76  ? 4.668   9.945   3.144   1.00 0.00 ? 76  GLN A C    1  
ATOM 1100  O O    . GLN A 1 76  ? 3.686   10.092  2.419   1.00 0.00 ? 76  GLN A O    1  
ATOM 1101  C CB   . GLN A 1 76  ? 4.138   9.084   5.454   1.00 0.00 ? 76  GLN A CB   1  
ATOM 1102  C CG   . GLN A 1 76  ? 4.786   10.328  6.063   1.00 0.00 ? 76  GLN A CG   1  
ATOM 1103  C CD   . GLN A 1 76  ? 4.630   10.339  7.585   1.00 0.00 ? 76  GLN A CD   1  
ATOM 1104  O OE1  . GLN A 1 76  ? 4.373   9.326   8.216   1.00 0.00 ? 76  GLN A OE1  1  
ATOM 1105  N NE2  . GLN A 1 76  ? 4.799   11.537  8.138   1.00 0.00 ? 76  GLN A NE2  1  
ATOM 1106  H H    . GLN A 1 76  ? 6.395   8.030   5.165   1.00 0.00 ? 76  GLN A H    1  
ATOM 1107  H HA   . GLN A 1 76  ? 4.239   7.894   3.666   1.00 0.00 ? 76  GLN A HA   1  
ATOM 1108  H HB2  . GLN A 1 76  ? 3.066   9.247   5.338   1.00 0.00 ? 76  GLN A HB2  1  
ATOM 1109  H HB3  . GLN A 1 76  ? 4.259   8.238   6.131   1.00 0.00 ? 76  GLN A HB3  1  
ATOM 1110  H HG2  . GLN A 1 76  ? 5.844   10.357  5.802   1.00 0.00 ? 76  GLN A HG2  1  
ATOM 1111  H HG3  . GLN A 1 76  ? 4.329   11.224  5.641   1.00 0.00 ? 76  GLN A HG3  1  
ATOM 1112  H HE21 . GLN A 1 76  ? 5.008   12.328  7.563   1.00 0.00 ? 76  GLN A HE21 1  
ATOM 1113  H HE22 . GLN A 1 76  ? 4.716   11.646  9.129   1.00 0.00 ? 76  GLN A HE22 1  
ATOM 1114  N N    . GLU A 1 77  ? 5.707   10.767  3.177   1.00 0.00 ? 77  GLU A N    1  
ATOM 1115  C CA   . GLU A 1 77  ? 5.757   11.944  2.326   1.00 0.00 ? 77  GLU A CA   1  
ATOM 1116  C C    . GLU A 1 77  ? 5.728   11.535  0.852   1.00 0.00 ? 77  GLU A C    1  
ATOM 1117  O O    . GLU A 1 77  ? 4.831   11.933  0.111   1.00 0.00 ? 77  GLU A O    1  
ATOM 1118  C CB   . GLU A 1 77  ? 6.992   12.792  2.635   1.00 0.00 ? 77  GLU A CB   1  
ATOM 1119  C CG   . GLU A 1 77  ? 6.798   14.235  2.165   1.00 0.00 ? 77  GLU A CG   1  
ATOM 1120  C CD   . GLU A 1 77  ? 6.856   15.209  3.343   1.00 0.00 ? 77  GLU A CD   1  
ATOM 1121  O OE1  . GLU A 1 77  ? 7.903   15.213  4.025   1.00 0.00 ? 77  GLU A OE1  1  
ATOM 1122  O OE2  . GLU A 1 77  ? 5.851   15.927  3.536   1.00 0.00 ? 77  GLU A OE2  1  
ATOM 1123  H H    . GLU A 1 77  ? 6.502   10.640  3.770   1.00 0.00 ? 77  GLU A H    1  
ATOM 1124  H HA   . GLU A 1 77  ? 4.861   12.515  2.569   1.00 0.00 ? 77  GLU A HA   1  
ATOM 1125  H HB2  . GLU A 1 77  ? 7.187   12.779  3.708   1.00 0.00 ? 77  GLU A HB2  1  
ATOM 1126  H HB3  . GLU A 1 77  ? 7.865   12.361  2.147   1.00 0.00 ? 77  GLU A HB3  1  
ATOM 1127  H HG2  . GLU A 1 77  ? 7.569   14.491  1.438   1.00 0.00 ? 77  GLU A HG2  1  
ATOM 1128  H HG3  . GLU A 1 77  ? 5.838   14.330  1.657   1.00 0.00 ? 77  GLU A HG3  1  
ATOM 1129  N N    . ARG A 1 78  ? 6.720   10.744  0.471   1.00 0.00 ? 78  ARG A N    1  
ATOM 1130  C CA   . ARG A 1 78  ? 6.820   10.276  -0.901  1.00 0.00 ? 78  ARG A CA   1  
ATOM 1131  C C    . ARG A 1 78  ? 5.706   9.272   -1.202  1.00 0.00 ? 78  ARG A C    1  
ATOM 1132  O O    . ARG A 1 78  ? 5.009   9.394   -2.208  1.00 0.00 ? 78  ARG A O    1  
ATOM 1133  C CB   . ARG A 1 78  ? 8.176   9.617   -1.161  1.00 0.00 ? 78  ARG A CB   1  
ATOM 1134  C CG   . ARG A 1 78  ? 8.337   9.260   -2.640  1.00 0.00 ? 78  ARG A CG   1  
ATOM 1135  C CD   . ARG A 1 78  ? 9.750   9.581   -3.131  1.00 0.00 ? 78  ARG A CD   1  
ATOM 1136  N NE   . ARG A 1 78  ? 9.834   11.001  -3.539  1.00 0.00 ? 78  ARG A NE   1  
ATOM 1137  C CZ   . ARG A 1 78  ? 10.820  11.510  -4.308  1.00 0.00 ? 78  ARG A CZ   1  
ATOM 1138  N NH1  . ARG A 1 78  ? 11.816  10.718  -4.759  1.00 0.00 ? 78  ARG A NH1  1  
ATOM 1139  N NH2  . ARG A 1 78  ? 10.795  12.795  -4.612  1.00 0.00 ? 78  ARG A NH2  1  
ATOM 1140  H H    . ARG A 1 78  ? 7.446   10.424  1.080   1.00 0.00 ? 78  ARG A H    1  
ATOM 1141  H HA   . ARG A 1 78  ? 6.713   11.174  -1.510  1.00 0.00 ? 78  ARG A HA   1  
ATOM 1142  H HB2  . ARG A 1 78  ? 8.976   10.291  -0.857  1.00 0.00 ? 78  ARG A HB2  1  
ATOM 1143  H HB3  . ARG A 1 78  ? 8.269   8.716   -0.554  1.00 0.00 ? 78  ARG A HB3  1  
ATOM 1144  H HG2  . ARG A 1 78  ? 8.129   8.200   -2.787  1.00 0.00 ? 78  ARG A HG2  1  
ATOM 1145  H HG3  . ARG A 1 78  ? 7.608   9.812   -3.233  1.00 0.00 ? 78  ARG A HG3  1  
ATOM 1146  H HD2  . ARG A 1 78  ? 10.473  9.378   -2.341  1.00 0.00 ? 78  ARG A HD2  1  
ATOM 1147  H HD3  . ARG A 1 78  ? 10.008  8.936   -3.971  1.00 0.00 ? 78  ARG A HD3  1  
ATOM 1148  H HE   . ARG A 1 78  ? 9.116   11.622  -3.226  1.00 0.00 ? 78  ARG A HE   1  
ATOM 1149  H HH11 . ARG A 1 78  ? 11.827  9.746   -4.524  1.00 0.00 ? 78  ARG A HH11 1  
ATOM 1150  H HH12 . ARG A 1 78  ? 12.542  11.104  -5.328  1.00 0.00 ? 78  ARG A HH12 1  
ATOM 1151  H HH21 . ARG A 1 78  ? 11.486  13.249  -5.175  1.00 0.00 ? 78  ARG A HH21 1  
ATOM 1152  N N    . ALA A 1 79  ? 5.572   8.301   -0.310  1.00 0.00 ? 79  ALA A N    1  
ATOM 1153  C CA   . ALA A 1 79  ? 4.554   7.275   -0.468  1.00 0.00 ? 79  ALA A CA   1  
ATOM 1154  C C    . ALA A 1 79  ? 3.198   7.942   -0.707  1.00 0.00 ? 79  ALA A C    1  
ATOM 1155  O O    . ALA A 1 79  ? 2.467   7.560   -1.619  1.00 0.00 ? 79  ALA A O    1  
ATOM 1156  C CB   . ALA A 1 79  ? 4.549   6.368   0.764   1.00 0.00 ? 79  ALA A CB   1  
ATOM 1157  H H    . ALA A 1 79  ? 6.142   8.208   0.506   1.00 0.00 ? 79  ALA A H    1  
ATOM 1158  H HA   . ALA A 1 79  ? 4.816   6.679   -1.342  1.00 0.00 ? 79  ALA A HA   1  
ATOM 1159  H HB1  . ALA A 1 79  ? 5.508   5.856   0.842   1.00 0.00 ? 79  ALA A HB1  1  
ATOM 1160  H HB2  . ALA A 1 79  ? 4.384   6.970   1.658   1.00 0.00 ? 79  ALA A HB2  1  
ATOM 1161  H HB3  . ALA A 1 79  ? 3.750   5.632   0.670   1.00 0.00 ? 79  ALA A HB3  1  
ATOM 1162  N N    . ALA A 1 80  ? 2.902   8.926   0.129   1.00 0.00 ? 80  ALA A N    1  
ATOM 1163  C CA   . ALA A 1 80  ? 1.647   9.649   0.020   1.00 0.00 ? 80  ALA A CA   1  
ATOM 1164  C C    . ALA A 1 80  ? 1.566   10.318  -1.353  1.00 0.00 ? 80  ALA A C    1  
ATOM 1165  O O    . ALA A 1 80  ? 0.540   10.239  -2.027  1.00 0.00 ? 80  ALA A O    1  
ATOM 1166  C CB   . ALA A 1 80  ? 1.536   10.656  1.167   1.00 0.00 ? 80  ALA A CB   1  
ATOM 1167  H H    . ALA A 1 80  ? 3.502   9.231   0.869   1.00 0.00 ? 80  ALA A H    1  
ATOM 1168  H HA   . ALA A 1 80  ? 0.838   8.925   0.111   1.00 0.00 ? 80  ALA A HA   1  
ATOM 1169  H HB1  . ALA A 1 80  ? 2.395   11.327  1.145   1.00 0.00 ? 80  ALA A HB1  1  
ATOM 1170  H HB2  . ALA A 1 80  ? 0.620   11.236  1.055   1.00 0.00 ? 80  ALA A HB2  1  
ATOM 1171  H HB3  . ALA A 1 80  ? 1.515   10.124  2.118   1.00 0.00 ? 80  ALA A HB3  1  
ATOM 1172  N N    . GLU A 1 81  ? 2.662   10.962  -1.728  1.00 0.00 ? 81  GLU A N    1  
ATOM 1173  C CA   . GLU A 1 81  ? 2.728   11.644  -3.009  1.00 0.00 ? 81  GLU A CA   1  
ATOM 1174  C C    . GLU A 1 81  ? 2.436   10.664  -4.148  1.00 0.00 ? 81  GLU A C    1  
ATOM 1175  O O    . GLU A 1 81  ? 1.771   11.018  -5.120  1.00 0.00 ? 81  GLU A O    1  
ATOM 1176  C CB   . GLU A 1 81  ? 4.087   12.319  -3.201  1.00 0.00 ? 81  GLU A CB   1  
ATOM 1177  C CG   . GLU A 1 81  ? 3.962   13.841  -3.101  1.00 0.00 ? 81  GLU A CG   1  
ATOM 1178  C CD   . GLU A 1 81  ? 4.555   14.354  -1.787  1.00 0.00 ? 81  GLU A CD   1  
ATOM 1179  O OE1  . GLU A 1 81  ? 5.624   13.831  -1.404  1.00 0.00 ? 81  GLU A OE1  1  
ATOM 1180  O OE2  . GLU A 1 81  ? 3.927   15.258  -1.196  1.00 0.00 ? 81  GLU A OE2  1  
ATOM 1181  H H    . GLU A 1 81  ? 3.492   11.021  -1.174  1.00 0.00 ? 81  GLU A H    1  
ATOM 1182  H HA   . GLU A 1 81  ? 1.951   12.408  -2.971  1.00 0.00 ? 81  GLU A HA   1  
ATOM 1183  H HB2  . GLU A 1 81  ? 4.787   11.958  -2.448  1.00 0.00 ? 81  GLU A HB2  1  
ATOM 1184  H HB3  . GLU A 1 81  ? 4.498   12.048  -4.174  1.00 0.00 ? 81  GLU A HB3  1  
ATOM 1185  H HG2  . GLU A 1 81  ? 4.475   14.308  -3.942  1.00 0.00 ? 81  GLU A HG2  1  
ATOM 1186  H HG3  . GLU A 1 81  ? 2.913   14.129  -3.167  1.00 0.00 ? 81  GLU A HG3  1  
ATOM 1187  N N    . LEU A 1 82  ? 2.949   9.453   -3.989  1.00 0.00 ? 82  LEU A N    1  
ATOM 1188  C CA   . LEU A 1 82  ? 2.752   8.420   -4.992  1.00 0.00 ? 82  LEU A CA   1  
ATOM 1189  C C    . LEU A 1 82  ? 1.289   7.972   -4.975  1.00 0.00 ? 82  LEU A C    1  
ATOM 1190  O O    . LEU A 1 82  ? 0.662   7.847   -6.026  1.00 0.00 ? 82  LEU A O    1  
ATOM 1191  C CB   . LEU A 1 82  ? 3.748   7.277   -4.786  1.00 0.00 ? 82  LEU A CB   1  
ATOM 1192  C CG   . LEU A 1 82  ? 5.071   7.395   -5.545  1.00 0.00 ? 82  LEU A CG   1  
ATOM 1193  C CD1  . LEU A 1 82  ? 6.253   7.021   -4.649  1.00 0.00 ? 82  LEU A CD1  1  
ATOM 1194  C CD2  . LEU A 1 82  ? 5.041   6.566   -6.831  1.00 0.00 ? 82  LEU A CD2  1  
ATOM 1195  H H    . LEU A 1 82  ? 3.489   9.174   -3.195  1.00 0.00 ? 82  LEU A H    1  
ATOM 1196  H HA   . LEU A 1 82  ? 2.966   8.863   -5.964  1.00 0.00 ? 82  LEU A HA   1  
ATOM 1197  H HB2  . LEU A 1 82  ? 3.968   7.201   -3.721  1.00 0.00 ? 82  LEU A HB2  1  
ATOM 1198  H HB3  . LEU A 1 82  ? 3.266   6.344   -5.079  1.00 0.00 ? 82  LEU A HB3  1  
ATOM 1199  H HG   . LEU A 1 82  ? 5.205   8.437   -5.837  1.00 0.00 ? 82  LEU A HG   1  
ATOM 1200  H HD11 . LEU A 1 82  ? 7.016   6.520   -5.245  1.00 0.00 ? 82  LEU A HD11 1  
ATOM 1201  H HD12 . LEU A 1 82  ? 6.672   7.923   -4.204  1.00 0.00 ? 82  LEU A HD12 1  
ATOM 1202  H HD13 . LEU A 1 82  ? 5.912   6.351   -3.859  1.00 0.00 ? 82  LEU A HD13 1  
ATOM 1203  H HD21 . LEU A 1 82  ? 6.025   6.586   -7.299  1.00 0.00 ? 82  LEU A HD21 1  
ATOM 1204  H HD22 . LEU A 1 82  ? 4.772   5.537   -6.593  1.00 0.00 ? 82  LEU A HD22 1  
ATOM 1205  H HD23 . LEU A 1 82  ? 4.304   6.985   -7.516  1.00 0.00 ? 82  LEU A HD23 1  
ATOM 1206  N N    . MET A 1 83  ? 0.787   7.741   -3.771  1.00 0.00 ? 83  MET A N    1  
ATOM 1207  C CA   . MET A 1 83  ? -0.590  7.309   -3.604  1.00 0.00 ? 83  MET A CA   1  
ATOM 1208  C C    . MET A 1 83  ? -1.564  8.439   -3.944  1.00 0.00 ? 83  MET A C    1  
ATOM 1209  O O    . MET A 1 83  ? -2.760  8.203   -4.109  1.00 0.00 ? 83  MET A O    1  
ATOM 1210  C CB   . MET A 1 83  ? -0.813  6.861   -2.158  1.00 0.00 ? 83  MET A CB   1  
ATOM 1211  C CG   . MET A 1 83  ? -0.825  5.335   -2.052  1.00 0.00 ? 83  MET A CG   1  
ATOM 1212  S SD   . MET A 1 83  ? 0.309   4.802   -0.781  1.00 0.00 ? 83  MET A SD   1  
ATOM 1213  C CE   . MET A 1 83  ? -0.645  5.204   0.674   1.00 0.00 ? 83  MET A CE   1  
ATOM 1214  H H    . MET A 1 83  ? 1.304   7.844   -2.921  1.00 0.00 ? 83  MET A H    1  
ATOM 1215  H HA   . MET A 1 83  ? -0.724  6.482   -4.300  1.00 0.00 ? 83  MET A HA   1  
ATOM 1216  H HB2  . MET A 1 83  ? -0.026  7.267   -1.522  1.00 0.00 ? 83  MET A HB2  1  
ATOM 1217  H HB3  . MET A 1 83  ? -1.757  7.262   -1.791  1.00 0.00 ? 83  MET A HB3  1  
ATOM 1218  H HG2  . MET A 1 83  ? -1.832  4.986   -1.822  1.00 0.00 ? 83  MET A HG2  1  
ATOM 1219  H HG3  . MET A 1 83  ? -0.545  4.894   -3.009  1.00 0.00 ? 83  MET A HG3  1  
ATOM 1220  H HE1  . MET A 1 83  ? -0.762  4.312   1.289   1.00 0.00 ? 83  MET A HE1  1  
ATOM 1221  H HE2  . MET A 1 83  ? -0.128  5.974   1.245   1.00 0.00 ? 83  MET A HE2  1  
ATOM 1222  H HE3  . MET A 1 83  ? -1.627  5.570   0.374   1.00 0.00 ? 83  MET A HE3  1  
ATOM 1223  N N    . THR A 1 84  ? -1.015  9.641   -4.041  1.00 0.00 ? 84  THR A N    1  
ATOM 1224  C CA   . THR A 1 84  ? -1.821  10.807  -4.359  1.00 0.00 ? 84  THR A CA   1  
ATOM 1225  C C    . THR A 1 84  ? -2.312  10.738  -5.806  1.00 0.00 ? 84  THR A C    1  
ATOM 1226  O O    . THR A 1 84  ? -3.481  10.446  -6.055  1.00 0.00 ? 84  THR A O    1  
ATOM 1227  C CB   . THR A 1 84  ? -0.986  12.054  -4.061  1.00 0.00 ? 84  THR A CB   1  
ATOM 1228  O OG1  . THR A 1 84  ? -0.871  12.064  -2.640  1.00 0.00 ? 84  THR A OG1  1  
ATOM 1229  C CG2  . THR A 1 84  ? -1.733  13.350  -4.383  1.00 0.00 ? 84  THR A CG2  1  
ATOM 1230  H H    . THR A 1 84  ? -0.041  9.824   -3.906  1.00 0.00 ? 84  THR A H    1  
ATOM 1231  H HA   . THR A 1 84  ? -2.704  10.800  -3.721  1.00 0.00 ? 84  THR A HA   1  
ATOM 1232  H HB   . THR A 1 84  ? -0.029  12.016  -4.582  1.00 0.00 ? 84  THR A HB   1  
ATOM 1233  H HG1  . THR A 1 84  ? -0.542  11.176  -2.318  1.00 0.00 ? 84  THR A HG1  1  
ATOM 1234  H HG21 . THR A 1 84  ? -1.735  13.510  -5.461  1.00 0.00 ? 84  THR A HG21 1  
ATOM 1235  H HG22 . THR A 1 84  ? -2.759  13.276  -4.024  1.00 0.00 ? 84  THR A HG22 1  
ATOM 1236  H HG23 . THR A 1 84  ? -1.236  14.187  -3.892  1.00 0.00 ? 84  THR A HG23 1  
ATOM 1237  N N    . ARG A 1 85  ? -1.395  11.010  -6.723  1.00 0.00 ? 85  ARG A N    1  
ATOM 1238  C CA   . ARG A 1 85  ? -1.720  10.981  -8.139  1.00 0.00 ? 85  ARG A CA   1  
ATOM 1239  C C    . ARG A 1 85  ? -1.813  9.536   -8.633  1.00 0.00 ? 85  ARG A C    1  
ATOM 1240  O O    . ARG A 1 85  ? -1.169  9.170   -9.615  1.00 0.00 ? 85  ARG A O    1  
ATOM 1241  C CB   . ARG A 1 85  ? -0.668  11.728  -8.961  1.00 0.00 ? 85  ARG A CB   1  
ATOM 1242  C CG   . ARG A 1 85  ? -1.224  12.130  -10.328 1.00 0.00 ? 85  ARG A CG   1  
ATOM 1243  C CD   . ARG A 1 85  ? -0.134  12.754  -11.202 1.00 0.00 ? 85  ARG A CD   1  
ATOM 1244  N NE   . ARG A 1 85  ? -0.519  14.130  -11.587 1.00 0.00 ? 85  ARG A NE   1  
ATOM 1245  C CZ   . ARG A 1 85  ? 0.087   14.838  -12.550 1.00 0.00 ? 85  ARG A CZ   1  
ATOM 1246  N NH1  . ARG A 1 85  ? 1.110   14.304  -13.230 1.00 0.00 ? 85  ARG A NH1  1  
ATOM 1247  N NH2  . ARG A 1 85  ? -0.331  16.080  -12.832 1.00 0.00 ? 85  ARG A NH2  1  
ATOM 1248  H H    . ARG A 1 85  ? -0.446  11.246  -6.512  1.00 0.00 ? 85  ARG A H    1  
ATOM 1249  H HA   . ARG A 1 85  ? -2.685  11.484  -8.213  1.00 0.00 ? 85  ARG A HA   1  
ATOM 1250  H HB2  . ARG A 1 85  ? -0.343  12.617  -8.421  1.00 0.00 ? 85  ARG A HB2  1  
ATOM 1251  H HB3  . ARG A 1 85  ? 0.211   11.097  -9.093  1.00 0.00 ? 85  ARG A HB3  1  
ATOM 1252  H HG2  . ARG A 1 85  ? -1.639  11.254  -10.828 1.00 0.00 ? 85  ARG A HG2  1  
ATOM 1253  H HG3  . ARG A 1 85  ? -2.041  12.840  -10.198 1.00 0.00 ? 85  ARG A HG3  1  
ATOM 1254  H HD2  . ARG A 1 85  ? 0.812   12.770  -10.661 1.00 0.00 ? 85  ARG A HD2  1  
ATOM 1255  H HD3  . ARG A 1 85  ? 0.020   12.147  -12.094 1.00 0.00 ? 85  ARG A HD3  1  
ATOM 1256  H HE   . ARG A 1 85  ? -1.280  14.557  -11.099 1.00 0.00 ? 85  ARG A HE   1  
ATOM 1257  H HH11 . ARG A 1 85  ? 1.422   13.378  -13.020 1.00 0.00 ? 85  ARG A HH11 1  
ATOM 1258  H HH12 . ARG A 1 85  ? 1.563   14.833  -13.949 1.00 0.00 ? 85  ARG A HH12 1  
ATOM 1259  H HH21 . ARG A 1 85  ? -1.095  16.478  -12.324 1.00 0.00 ? 85  ARG A HH21 1  
ATOM 1260  H HH22 . ARG A 1 85  ? 0.122   16.608  -13.550 1.00 0.00 ? 85  ARG A HH22 1  
ATOM 1261  N N    . THR A 1 86  ? -2.619  8.754   -7.930  1.00 0.00 ? 86  THR A N    1  
ATOM 1262  C CA   . THR A 1 86  ? -2.804  7.358   -8.285  1.00 0.00 ? 86  THR A CA   1  
ATOM 1263  C C    . THR A 1 86  ? -3.780  7.230   -9.457  1.00 0.00 ? 86  THR A C    1  
ATOM 1264  O O    . THR A 1 86  ? -3.671  6.307   -10.263 1.00 0.00 ? 86  THR A O    1  
ATOM 1265  C CB   . THR A 1 86  ? -3.259  6.607   -7.032  1.00 0.00 ? 86  THR A CB   1  
ATOM 1266  O OG1  . THR A 1 86  ? -3.780  7.629   -6.186  1.00 0.00 ? 86  THR A OG1  1  
ATOM 1267  C CG2  . THR A 1 86  ? -2.085  6.029   -6.238  1.00 0.00 ? 86  THR A CG2  1  
ATOM 1268  H H    . THR A 1 86  ? -3.139  9.060   -7.133  1.00 0.00 ? 86  THR A H    1  
ATOM 1269  H HA   . THR A 1 86  ? -1.847  6.959   -8.621  1.00 0.00 ? 86  THR A HA   1  
ATOM 1270  H HB   . THR A 1 86  ? -3.980  5.830   -7.284  1.00 0.00 ? 86  THR A HB   1  
ATOM 1271  H HG1  . THR A 1 86  ? -4.709  7.866   -6.468  1.00 0.00 ? 86  THR A HG1  1  
ATOM 1272  H HG21 . THR A 1 86  ? -1.689  5.157   -6.759  1.00 0.00 ? 86  THR A HG21 1  
ATOM 1273  H HG22 . THR A 1 86  ? -1.303  6.782   -6.144  1.00 0.00 ? 86  THR A HG22 1  
ATOM 1274  H HG23 . THR A 1 86  ? -2.428  5.734   -5.246  1.00 0.00 ? 86  THR A HG23 1  
ATOM 1275  N N    . SER A 1 87  ? -4.711  8.171   -9.515  1.00 0.00 ? 87  SER A N    1  
ATOM 1276  C CA   . SER A 1 87  ? -5.705  8.175   -10.575 1.00 0.00 ? 87  SER A CA   1  
ATOM 1277  C C    . SER A 1 87  ? -6.850  7.223   -10.222 1.00 0.00 ? 87  SER A C    1  
ATOM 1278  O O    . SER A 1 87  ? -6.845  6.608   -9.157  1.00 0.00 ? 87  SER A O    1  
ATOM 1279  C CB   . SER A 1 87  ? -5.082  7.783   -11.916 1.00 0.00 ? 87  SER A CB   1  
ATOM 1280  O OG   . SER A 1 87  ? -5.601  8.558   -12.993 1.00 0.00 ? 87  SER A OG   1  
ATOM 1281  H H    . SER A 1 87  ? -4.793  8.918   -8.856  1.00 0.00 ? 87  SER A H    1  
ATOM 1282  H HA   . SER A 1 87  ? -6.065  9.203   -10.629 1.00 0.00 ? 87  SER A HA   1  
ATOM 1283  H HB2  . SER A 1 87  ? -4.001  7.911   -11.865 1.00 0.00 ? 87  SER A HB2  1  
ATOM 1284  H HB3  . SER A 1 87  ? -5.269  6.726   -12.107 1.00 0.00 ? 87  SER A HB3  1  
ATOM 1285  H HG   . SER A 1 87  ? -5.719  9.508   -12.704 1.00 0.00 ? 87  SER A HG   1  
ATOM 1286  N N    . SER A 1 88  ? -7.804  7.132   -11.137 1.00 0.00 ? 88  SER A N    1  
ATOM 1287  C CA   . SER A 1 88  ? -8.953  6.265   -10.937 1.00 0.00 ? 88  SER A CA   1  
ATOM 1288  C C    . SER A 1 88  ? -8.509  4.801   -10.929 1.00 0.00 ? 88  SER A C    1  
ATOM 1289  O O    . SER A 1 88  ? -9.342  3.896   -10.918 1.00 0.00 ? 88  SER A O    1  
ATOM 1290  C CB   . SER A 1 88  ? -10.011 6.494   -12.018 1.00 0.00 ? 88  SER A CB   1  
ATOM 1291  O OG   . SER A 1 88  ? -9.618  5.944   -13.273 1.00 0.00 ? 88  SER A OG   1  
ATOM 1292  H H    . SER A 1 88  ? -7.800  7.636   -12.001 1.00 0.00 ? 88  SER A H    1  
ATOM 1293  H HA   . SER A 1 88  ? -9.360  6.546   -9.965  1.00 0.00 ? 88  SER A HA   1  
ATOM 1294  H HB2  . SER A 1 88  ? -10.953 6.044   -11.704 1.00 0.00 ? 88  SER A HB2  1  
ATOM 1295  H HB3  . SER A 1 88  ? -10.190 7.563   -12.130 1.00 0.00 ? 88  SER A HB3  1  
ATOM 1296  H HG   . SER A 1 88  ? -8.852  6.465   -13.650 1.00 0.00 ? 88  SER A HG   1  
ATOM 1297  N N    . VAL A 1 89  ? -7.197  4.613   -10.935 1.00 0.00 ? 89  VAL A N    1  
ATOM 1298  C CA   . VAL A 1 89  ? -6.633  3.275   -10.930 1.00 0.00 ? 89  VAL A CA   1  
ATOM 1299  C C    . VAL A 1 89  ? -5.377  3.259   -10.056 1.00 0.00 ? 89  VAL A C    1  
ATOM 1300  O O    . VAL A 1 89  ? -4.483  4.085   -10.233 1.00 0.00 ? 89  VAL A O    1  
ATOM 1301  C CB   . VAL A 1 89  ? -6.368  2.812   -12.364 1.00 0.00 ? 89  VAL A CB   1  
ATOM 1302  C CG1  . VAL A 1 89  ? -5.890  3.975   -13.236 1.00 0.00 ? 89  VAL A CG1  1  
ATOM 1303  C CG2  . VAL A 1 89  ? -5.365  1.657   -12.391 1.00 0.00 ? 89  VAL A CG2  1  
ATOM 1304  H H    . VAL A 1 89  ? -6.526  5.355   -10.944 1.00 0.00 ? 89  VAL A H    1  
ATOM 1305  H HA   . VAL A 1 89  ? -7.374  2.607   -10.491 1.00 0.00 ? 89  VAL A HA   1  
ATOM 1306  H HB   . VAL A 1 89  ? -7.309  2.448   -12.777 1.00 0.00 ? 89  VAL A HB   1  
ATOM 1307  H HG11 . VAL A 1 89  ? -6.723  4.348   -13.832 1.00 0.00 ? 89  VAL A HG11 1  
ATOM 1308  H HG12 . VAL A 1 89  ? -5.512  4.774   -12.599 1.00 0.00 ? 89  VAL A HG12 1  
ATOM 1309  H HG13 . VAL A 1 89  ? -5.096  3.630   -13.898 1.00 0.00 ? 89  VAL A HG13 1  
ATOM 1310  H HG21 . VAL A 1 89  ? -5.822  0.769   -11.955 1.00 0.00 ? 89  VAL A HG21 1  
ATOM 1311  H HG22 . VAL A 1 89  ? -5.078  1.450   -13.422 1.00 0.00 ? 89  VAL A HG22 1  
ATOM 1312  H HG23 . VAL A 1 89  ? -4.480  1.931   -11.816 1.00 0.00 ? 89  VAL A HG23 1  
ATOM 1313  N N    . VAL A 1 90  ? -5.350  2.311   -9.131  1.00 0.00 ? 90  VAL A N    1  
ATOM 1314  C CA   . VAL A 1 90  ? -4.219  2.177   -8.228  1.00 0.00 ? 90  VAL A CA   1  
ATOM 1315  C C    . VAL A 1 90  ? -3.662  0.755   -8.324  1.00 0.00 ? 90  VAL A C    1  
ATOM 1316  O O    . VAL A 1 90  ? -4.362  -0.211  -8.025  1.00 0.00 ? 90  VAL A O    1  
ATOM 1317  C CB   . VAL A 1 90  ? -4.635  2.562   -6.807  1.00 0.00 ? 90  VAL A CB   1  
ATOM 1318  C CG1  . VAL A 1 90  ? -3.543  3.384   -6.120  1.00 0.00 ? 90  VAL A CG1  1  
ATOM 1319  C CG2  . VAL A 1 90  ? -5.967  3.314   -6.810  1.00 0.00 ? 90  VAL A CG2  1  
ATOM 1320  H H    . VAL A 1 90  ? -6.082  1.643   -8.993  1.00 0.00 ? 90  VAL A H    1  
ATOM 1321  H HA   . VAL A 1 90  ? -3.452  2.877   -8.557  1.00 0.00 ? 90  VAL A HA   1  
ATOM 1322  H HB   . VAL A 1 90  ? -4.771  1.643   -6.237  1.00 0.00 ? 90  VAL A HB   1  
ATOM 1323  H HG11 . VAL A 1 90  ? -3.912  4.392   -5.931  1.00 0.00 ? 90  VAL A HG11 1  
ATOM 1324  H HG12 . VAL A 1 90  ? -3.273  2.913   -5.176  1.00 0.00 ? 90  VAL A HG12 1  
ATOM 1325  H HG13 . VAL A 1 90  ? -2.666  3.434   -6.766  1.00 0.00 ? 90  VAL A HG13 1  
ATOM 1326  H HG21 . VAL A 1 90  ? -5.991  4.007   -7.651  1.00 0.00 ? 90  VAL A HG21 1  
ATOM 1327  H HG22 . VAL A 1 90  ? -6.787  2.601   -6.904  1.00 0.00 ? 90  VAL A HG22 1  
ATOM 1328  H HG23 . VAL A 1 90  ? -6.074  3.869   -5.879  1.00 0.00 ? 90  VAL A HG23 1  
ATOM 1329  N N    . THR A 1 91  ? -2.407  0.672   -8.741  1.00 0.00 ? 91  THR A N    1  
ATOM 1330  C CA   . THR A 1 91  ? -1.748  -0.615  -8.879  1.00 0.00 ? 91  THR A CA   1  
ATOM 1331  C C    . THR A 1 91  ? -0.486  -0.664  -8.015  1.00 0.00 ? 91  THR A C    1  
ATOM 1332  O O    . THR A 1 91  ? 0.566   -0.172  -8.418  1.00 0.00 ? 91  THR A O    1  
ATOM 1333  C CB   . THR A 1 91  ? -1.475  -0.849  -10.366 1.00 0.00 ? 91  THR A CB   1  
ATOM 1334  O OG1  . THR A 1 91  ? -1.179  -2.241  -10.450 1.00 0.00 ? 91  THR A OG1  1  
ATOM 1335  C CG2  . THR A 1 91  ? -0.191  -0.166  -10.840 1.00 0.00 ? 91  THR A CG2  1  
ATOM 1336  H H    . THR A 1 91  ? -1.845  1.463   -8.981  1.00 0.00 ? 91  THR A H    1  
ATOM 1337  H HA   . THR A 1 91  ? -2.421  -1.388  -8.507  1.00 0.00 ? 91  THR A HA   1  
ATOM 1338  H HB   . THR A 1 91  ? -2.327  -0.540  -10.972 1.00 0.00 ? 91  THR A HB   1  
ATOM 1339  H HG1  . THR A 1 91  ? -1.999  -2.777  -10.249 1.00 0.00 ? 91  THR A HG1  1  
ATOM 1340  H HG21 . THR A 1 91  ? -0.100  0.809   -10.362 1.00 0.00 ? 91  THR A HG21 1  
ATOM 1341  H HG22 . THR A 1 91  ? 0.668   -0.782  -10.574 1.00 0.00 ? 91  THR A HG22 1  
ATOM 1342  H HG23 . THR A 1 91  ? -0.225  -0.039  -11.922 1.00 0.00 ? 91  THR A HG23 1  
ATOM 1343  N N    . LEU A 1 92  ? -0.635  -1.261  -6.841  1.00 0.00 ? 92  LEU A N    1  
ATOM 1344  C CA   . LEU A 1 92  ? 0.480   -1.381  -5.917  1.00 0.00 ? 92  LEU A CA   1  
ATOM 1345  C C    . LEU A 1 92  ? 0.551   -2.817  -5.394  1.00 0.00 ? 92  LEU A C    1  
ATOM 1346  O O    . LEU A 1 92  ? -0.433  -3.552  -5.453  1.00 0.00 ? 92  LEU A O    1  
ATOM 1347  C CB   . LEU A 1 92  ? 0.374   -0.328  -4.811  1.00 0.00 ? 92  LEU A CB   1  
ATOM 1348  C CG   . LEU A 1 92  ? -1.000  -0.182  -4.154  1.00 0.00 ? 92  LEU A CG   1  
ATOM 1349  C CD1  . LEU A 1 92  ? -2.019  0.400   -5.136  1.00 0.00 ? 92  LEU A CD1  1  
ATOM 1350  C CD2  . LEU A 1 92  ? -1.470  -1.513  -3.563  1.00 0.00 ? 92  LEU A CD2  1  
ATOM 1351  H H    . LEU A 1 92  ? -1.494  -1.659  -6.521  1.00 0.00 ? 92  LEU A H    1  
ATOM 1352  H HA   . LEU A 1 92  ? 1.392   -1.171  -6.475  1.00 0.00 ? 92  LEU A HA   1  
ATOM 1353  H HB2  . LEU A 1 92  ? 1.101   -0.569  -4.036  1.00 0.00 ? 92  LEU A HB2  1  
ATOM 1354  H HB3  . LEU A 1 92  ? 0.660   0.638   -5.228  1.00 0.00 ? 92  LEU A HB3  1  
ATOM 1355  H HG   . LEU A 1 92  ? -0.910  0.523   -3.328  1.00 0.00 ? 92  LEU A HG   1  
ATOM 1356  H HD11 . LEU A 1 92  ? -1.494  0.912   -5.943  1.00 0.00 ? 92  LEU A HD11 1  
ATOM 1357  H HD12 . LEU A 1 92  ? -2.625  -0.406  -5.551  1.00 0.00 ? 92  LEU A HD12 1  
ATOM 1358  H HD13 . LEU A 1 92  ? -2.663  1.108   -4.615  1.00 0.00 ? 92  LEU A HD13 1  
ATOM 1359  H HD21 . LEU A 1 92  ? -0.623  -2.026  -3.106  1.00 0.00 ? 92  LEU A HD21 1  
ATOM 1360  H HD22 . LEU A 1 92  ? -2.232  -1.325  -2.806  1.00 0.00 ? 92  LEU A HD22 1  
ATOM 1361  H HD23 . LEU A 1 92  ? -1.888  -2.135  -4.354  1.00 0.00 ? 92  LEU A HD23 1  
ATOM 1362  N N    . GLU A 1 93  ? 1.725   -3.173  -4.893  1.00 0.00 ? 93  GLU A N    1  
ATOM 1363  C CA   . GLU A 1 93  ? 1.938   -4.508  -4.361  1.00 0.00 ? 93  GLU A CA   1  
ATOM 1364  C C    . GLU A 1 93  ? 1.956   -4.472  -2.831  1.00 0.00 ? 93  GLU A C    1  
ATOM 1365  O O    . GLU A 1 93  ? 2.809   -3.818  -2.232  1.00 0.00 ? 93  GLU A O    1  
ATOM 1366  C CB   . GLU A 1 93  ? 3.229   -5.118  -4.910  1.00 0.00 ? 93  GLU A CB   1  
ATOM 1367  C CG   . GLU A 1 93  ? 3.500   -4.636  -6.337  1.00 0.00 ? 93  GLU A CG   1  
ATOM 1368  C CD   . GLU A 1 93  ? 2.400   -5.104  -7.292  1.00 0.00 ? 93  GLU A CD   1  
ATOM 1369  O OE1  . GLU A 1 93  ? 2.319   -6.333  -7.504  1.00 0.00 ? 93  GLU A OE1  1  
ATOM 1370  O OE2  . GLU A 1 93  ? 1.666   -4.223  -7.788  1.00 0.00 ? 93  GLU A OE2  1  
ATOM 1371  H H    . GLU A 1 93  ? 2.521   -2.568  -4.849  1.00 0.00 ? 93  GLU A H    1  
ATOM 1372  H HA   . GLU A 1 93  ? 1.089   -5.097  -4.707  1.00 0.00 ? 93  GLU A HA   1  
ATOM 1373  H HB2  . GLU A 1 93  ? 4.066   -4.848  -4.266  1.00 0.00 ? 93  GLU A HB2  1  
ATOM 1374  H HB3  . GLU A 1 93  ? 3.155   -6.206  -4.898  1.00 0.00 ? 93  GLU A HB3  1  
ATOM 1375  H HG2  . GLU A 1 93  ? 3.559   -3.547  -6.351  1.00 0.00 ? 93  GLU A HG2  1  
ATOM 1376  H HG3  . GLU A 1 93  ? 4.465   -5.013  -6.675  1.00 0.00 ? 93  GLU A HG3  1  
ATOM 1377  N N    . VAL A 1 94  ? 1.005   -5.183  -2.243  1.00 0.00 ? 94  VAL A N    1  
ATOM 1378  C CA   . VAL A 1 94  ? 0.901   -5.240  -0.795  1.00 0.00 ? 94  VAL A CA   1  
ATOM 1379  C C    . VAL A 1 94  ? 1.100   -6.685  -0.331  1.00 0.00 ? 94  VAL A C    1  
ATOM 1380  O O    . VAL A 1 94  ? 0.965   -7.618  -1.120  1.00 0.00 ? 94  VAL A O    1  
ATOM 1381  C CB   . VAL A 1 94  ? -0.433  -4.645  -0.342  1.00 0.00 ? 94  VAL A CB   1  
ATOM 1382  C CG1  . VAL A 1 94  ? -0.819  -3.443  -1.207  1.00 0.00 ? 94  VAL A CG1  1  
ATOM 1383  C CG2  . VAL A 1 94  ? -1.537  -5.704  -0.351  1.00 0.00 ? 94  VAL A CG2  1  
ATOM 1384  H H    . VAL A 1 94  ? 0.316   -5.711  -2.738  1.00 0.00 ? 94  VAL A H    1  
ATOM 1385  H HA   . VAL A 1 94  ? 1.702   -4.626  -0.383  1.00 0.00 ? 94  VAL A HA   1  
ATOM 1386  H HB   . VAL A 1 94  ? -0.313  -4.295  0.684   1.00 0.00 ? 94  VAL A HB   1  
ATOM 1387  H HG11 . VAL A 1 94  ? 0.010   -2.737  -1.238  1.00 0.00 ? 94  VAL A HG11 1  
ATOM 1388  H HG12 . VAL A 1 94  ? -1.046  -3.782  -2.218  1.00 0.00 ? 94  VAL A HG12 1  
ATOM 1389  H HG13 . VAL A 1 94  ? -1.696  -2.956  -0.781  1.00 0.00 ? 94  VAL A HG13 1  
ATOM 1390  H HG21 . VAL A 1 94  ? -1.377  -6.402  0.471   1.00 0.00 ? 94  VAL A HG21 1  
ATOM 1391  H HG22 . VAL A 1 94  ? -2.506  -5.220  -0.232  1.00 0.00 ? 94  VAL A HG22 1  
ATOM 1392  H HG23 . VAL A 1 94  ? -1.514  -6.245  -1.296  1.00 0.00 ? 94  VAL A HG23 1  
ATOM 1393  N N    . ALA A 1 95  ? 1.418   -6.823  0.948   1.00 0.00 ? 95  ALA A N    1  
ATOM 1394  C CA   . ALA A 1 95  ? 1.637   -8.138  1.527   1.00 0.00 ? 95  ALA A CA   1  
ATOM 1395  C C    . ALA A 1 95  ? 1.278   -8.102  3.013   1.00 0.00 ? 95  ALA A C    1  
ATOM 1396  O O    . ALA A 1 95  ? 1.236   -7.033  3.620   1.00 0.00 ? 95  ALA A O    1  
ATOM 1397  C CB   . ALA A 1 95  ? 3.085   -8.567  1.287   1.00 0.00 ? 95  ALA A CB   1  
ATOM 1398  H H    . ALA A 1 95  ? 1.526   -6.059  1.583   1.00 0.00 ? 95  ALA A H    1  
ATOM 1399  H HA   . ALA A 1 95  ? 0.974   -8.839  1.018   1.00 0.00 ? 95  ALA A HA   1  
ATOM 1400  H HB1  . ALA A 1 95  ? 3.266   -8.655  0.215   1.00 0.00 ? 95  ALA A HB1  1  
ATOM 1401  H HB2  . ALA A 1 95  ? 3.760   -7.822  1.709   1.00 0.00 ? 95  ALA A HB2  1  
ATOM 1402  H HB3  . ALA A 1 95  ? 3.263   -9.530  1.766   1.00 0.00 ? 95  ALA A HB3  1  
ATOM 1403  N N    . LYS A 1 96  ? 1.028   -9.284  3.558   1.00 0.00 ? 96  LYS A N    1  
ATOM 1404  C CA   . LYS A 1 96  ? 0.674   -9.402  4.962   1.00 0.00 ? 96  LYS A CA   1  
ATOM 1405  C C    . LYS A 1 96  ? 1.789   -10.140 5.705   1.00 0.00 ? 96  LYS A C    1  
ATOM 1406  O O    . LYS A 1 96  ? 2.806   -10.495 5.111   1.00 0.00 ? 96  LYS A O    1  
ATOM 1407  C CB   . LYS A 1 96  ? -0.702  -10.053 5.115   1.00 0.00 ? 96  LYS A CB   1  
ATOM 1408  C CG   . LYS A 1 96  ? -1.815  -9.089  4.696   1.00 0.00 ? 96  LYS A CG   1  
ATOM 1409  C CD   . LYS A 1 96  ? -3.185  -9.766  4.773   1.00 0.00 ? 96  LYS A CD   1  
ATOM 1410  C CE   . LYS A 1 96  ? -3.431  -10.646 3.545   1.00 0.00 ? 96  LYS A CE   1  
ATOM 1411  N NZ   . LYS A 1 96  ? -4.219  -11.842 3.915   1.00 0.00 ? 96  LYS A NZ   1  
ATOM 1412  H H    . LYS A 1 96  ? 1.064   -10.149 3.057   1.00 0.00 ? 96  LYS A H    1  
ATOM 1413  H HA   . LYS A 1 96  ? 0.599   -8.392  5.366   1.00 0.00 ? 96  LYS A HA   1  
ATOM 1414  H HB2  . LYS A 1 96  ? -0.751  -10.956 4.507   1.00 0.00 ? 96  LYS A HB2  1  
ATOM 1415  H HB3  . LYS A 1 96  ? -0.851  -10.358 6.151   1.00 0.00 ? 96  LYS A HB3  1  
ATOM 1416  H HG2  . LYS A 1 96  ? -1.802  -8.211  5.342   1.00 0.00 ? 96  LYS A HG2  1  
ATOM 1417  H HG3  . LYS A 1 96  ? -1.634  -8.739  3.680   1.00 0.00 ? 96  LYS A HG3  1  
ATOM 1418  H HD2  . LYS A 1 96  ? -3.244  -10.372 5.677   1.00 0.00 ? 96  LYS A HD2  1  
ATOM 1419  H HD3  . LYS A 1 96  ? -3.965  -9.009  4.845   1.00 0.00 ? 96  LYS A HD3  1  
ATOM 1420  H HE2  . LYS A 1 96  ? -3.960  -10.075 2.782   1.00 0.00 ? 96  LYS A HE2  1  
ATOM 1421  H HE3  . LYS A 1 96  ? -2.478  -10.950 3.112   1.00 0.00 ? 96  LYS A HE3  1  
ATOM 1422  H HZ1  . LYS A 1 96  ? -4.344  -12.421 3.109   1.00 0.00 ? 96  LYS A HZ1  1  
ATOM 1423  H HZ2  . LYS A 1 96  ? -3.734  -12.356 4.622   1.00 0.00 ? 96  LYS A HZ2  1  
ATOM 1424  H HZ3  . LYS A 1 96  ? -5.113  -11.558 4.263   1.00 0.00 ? 96  LYS A HZ3  1  
ATOM 1425  N N    . GLN A 1 97  ? 1.561   -10.348 6.993   1.00 0.00 ? 97  GLN A N    1  
ATOM 1426  C CA   . GLN A 1 97  ? 2.535   -11.037 7.823   1.00 0.00 ? 97  GLN A CA   1  
ATOM 1427  C C    . GLN A 1 97  ? 2.062   -12.461 8.124   1.00 0.00 ? 97  GLN A C    1  
ATOM 1428  O O    . GLN A 1 97  ? 2.878   -13.360 8.326   1.00 0.00 ? 97  GLN A O    1  
ATOM 1429  C CB   . GLN A 1 97  ? 2.799   -10.263 9.116   1.00 0.00 ? 97  GLN A CB   1  
ATOM 1430  C CG   . GLN A 1 97  ? 1.662   -10.468 10.120  1.00 0.00 ? 97  GLN A CG   1  
ATOM 1431  C CD   . GLN A 1 97  ? 1.495   -9.239  11.016  1.00 0.00 ? 97  GLN A CD   1  
ATOM 1432  O OE1  . GLN A 1 97  ? 1.512   -9.320  12.234  1.00 0.00 ? 97  GLN A OE1  1  
ATOM 1433  N NE2  . GLN A 1 97  ? 1.332   -8.100  10.349  1.00 0.00 ? 97  GLN A NE2  1  
ATOM 1434  H H    . GLN A 1 97  ? 0.732   -10.055 7.469   1.00 0.00 ? 97  GLN A H    1  
ATOM 1435  H HA   . GLN A 1 97  ? 3.450   -11.068 7.232   1.00 0.00 ? 97  GLN A HA   1  
ATOM 1436  H HB2  . GLN A 1 97  ? 3.741   -10.592 9.555   1.00 0.00 ? 97  GLN A HB2  1  
ATOM 1437  H HB3  . GLN A 1 97  ? 2.905   -9.201  8.893   1.00 0.00 ? 97  GLN A HB3  1  
ATOM 1438  H HG2  . GLN A 1 97  ? 0.732   -10.663 9.587   1.00 0.00 ? 97  GLN A HG2  1  
ATOM 1439  H HG3  . GLN A 1 97  ? 1.868   -11.345 10.734  1.00 0.00 ? 97  GLN A HG3  1  
ATOM 1440  H HE21 . GLN A 1 97  ? 1.327   -8.103  9.349   1.00 0.00 ? 97  GLN A HE21 1  
ATOM 1441  H HE22 . GLN A 1 97  ? 1.214   -7.241  10.847  1.00 0.00 ? 97  GLN A HE22 1  
ATOM 1442  N N    . GLY A 1 98  ? 0.748   -12.622 8.144   1.00 0.00 ? 98  GLY A N    1  
ATOM 1443  C CA   . GLY A 1 98  ? 0.157   -13.922 8.416   1.00 0.00 ? 98  GLY A CA   1  
ATOM 1444  C C    . GLY A 1 98  ? -1.229  -13.773 9.047   1.00 0.00 ? 98  GLY A C    1  
ATOM 1445  O O    . GLY A 1 98  ? -1.355  -13.288 10.171  1.00 0.00 ? 98  GLY A O    1  
ATOM 1446  H H    . GLY A 1 98  ? 0.091   -11.886 7.979   1.00 0.00 ? 98  GLY A H    1  
ATOM 1447  H HA2  . GLY A 1 98  ? 0.080   -14.491 7.490   1.00 0.00 ? 98  GLY A HA2  1  
ATOM 1448  H HA3  . GLY A 1 98  ? 0.806   -14.487 9.085   1.00 0.00 ? 98  GLY A HA3  1  
ATOM 1449  N N    . ALA A 1 99  ? -2.234  -14.198 8.296   1.00 0.00 ? 99  ALA A N    1  
ATOM 1450  C CA   . ALA A 1 99  ? -3.606  -14.118 8.768   1.00 0.00 ? 99  ALA A CA   1  
ATOM 1451  C C    . ALA A 1 99  ? -4.522  -14.853 7.787   1.00 0.00 ? 99  ALA A C    1  
ATOM 1452  O O    . ALA A 1 99  ? -4.057  -15.393 6.784   1.00 0.00 ? 99  ALA A O    1  
ATOM 1453  C CB   . ALA A 1 99  ? -4.001  -12.651 8.946   1.00 0.00 ? 99  ALA A CB   1  
ATOM 1454  H H    . ALA A 1 99  ? -2.123  -14.591 7.384   1.00 0.00 ? 99  ALA A H    1  
ATOM 1455  H HA   . ALA A 1 99  ? -3.654  -14.615 9.737   1.00 0.00 ? 99  ALA A HA   1  
ATOM 1456  H HB1  . ALA A 1 99  ? -3.334  -12.181 9.669   1.00 0.00 ? 99  ALA A HB1  1  
ATOM 1457  H HB2  . ALA A 1 99  ? -3.921  -12.135 7.989   1.00 0.00 ? 99  ALA A HB2  1  
ATOM 1458  H HB3  . ALA A 1 99  ? -5.028  -12.592 9.306   1.00 0.00 ? 99  ALA A HB3  1  
ATOM 1459  N N    . ILE A 1 100 ? -5.807  -14.850 8.110   1.00 0.00 ? 100 ILE A N    1  
ATOM 1460  C CA   . ILE A 1 100 ? -6.792  -15.510 7.270   1.00 0.00 ? 100 ILE A CA   1  
ATOM 1461  C C    . ILE A 1 100 ? -6.146  -16.716 6.585   1.00 0.00 ? 100 ILE A C    1  
ATOM 1462  O O    . ILE A 1 100 ? -5.931  -16.705 5.374   1.00 0.00 ? 100 ILE A O    1  
ATOM 1463  C CB   . ILE A 1 100 ? -7.418  -14.511 6.294   1.00 0.00 ? 100 ILE A CB   1  
ATOM 1464  C CG1  . ILE A 1 100 ? -8.780  -15.006 5.803   1.00 0.00 ? 100 ILE A CG1  1  
ATOM 1465  C CG2  . ILE A 1 100 ? -6.467  -14.207 5.135   1.00 0.00 ? 100 ILE A CG2  1  
ATOM 1466  C CD1  . ILE A 1 100 ? -9.853  -14.811 6.876   1.00 0.00 ? 100 ILE A CD1  1  
ATOM 1467  H H    . ILE A 1 100 ? -6.177  -14.409 8.928   1.00 0.00 ? 100 ILE A H    1  
ATOM 1468  H HA   . ILE A 1 100 ? -7.589  -15.868 7.921   1.00 0.00 ? 100 ILE A HA   1  
ATOM 1469  H HB   . ILE A 1 100 ? -7.588  -13.575 6.825   1.00 0.00 ? 100 ILE A HB   1  
ATOM 1470  H HG12 . ILE A 1 100 ? -9.062  -14.466 4.899   1.00 0.00 ? 100 ILE A HG12 1  
ATOM 1471  H HG13 . ILE A 1 100 ? -8.714  -16.061 5.537   1.00 0.00 ? 100 ILE A HG13 1  
ATOM 1472  H HG21 . ILE A 1 100 ? -6.523  -13.147 4.887   1.00 0.00 ? 100 ILE A HG21 1  
ATOM 1473  H HG22 . ILE A 1 100 ? -5.447  -14.458 5.426   1.00 0.00 ? 100 ILE A HG22 1  
ATOM 1474  H HG23 . ILE A 1 100 ? -6.752  -14.799 4.266   1.00 0.00 ? 100 ILE A HG23 1  
ATOM 1475  H HD11 . ILE A 1 100 ? -9.447  -14.215 7.693   1.00 0.00 ? 100 ILE A HD11 1  
ATOM 1476  H HD12 . ILE A 1 100 ? -10.711 -14.296 6.443   1.00 0.00 ? 100 ILE A HD12 1  
ATOM 1477  H HD13 . ILE A 1 100 ? -10.167 -15.783 7.256   1.00 0.00 ? 100 ILE A HD13 1  
ATOM 1478  N N    . TYR A 1 101 ? -5.854  -17.727 7.390   1.00 0.00 ? 101 TYR A N    1  
ATOM 1479  C CA   . TYR A 1 101 ? -5.237  -18.938 6.877   1.00 0.00 ? 101 TYR A CA   1  
ATOM 1480  C C    . TYR A 1 101 ? -4.007  -18.610 6.030   1.00 0.00 ? 101 TYR A C    1  
ATOM 1481  O O    . TYR A 1 101 ? -3.000  -19.315 6.091   1.00 0.00 ? 101 TYR A O    1  
ATOM 1482  C CB   . TYR A 1 101 ? -6.290  -19.604 5.989   1.00 0.00 ? 101 TYR A CB   1  
ATOM 1483  C CG   . TYR A 1 101 ? -6.015  -21.081 5.698   1.00 0.00 ? 101 TYR A CG   1  
ATOM 1484  C CD1  . TYR A 1 101 ? -5.152  -21.434 4.681   1.00 0.00 ? 101 TYR A CD1  1  
ATOM 1485  C CD2  . TYR A 1 101 ? -6.630  -22.059 6.453   1.00 0.00 ? 101 TYR A CD2  1  
ATOM 1486  C CE1  . TYR A 1 101 ? -4.893  -22.824 4.407   1.00 0.00 ? 101 TYR A CE1  1  
ATOM 1487  C CE2  . TYR A 1 101 ? -6.370  -23.449 6.179   1.00 0.00 ? 101 TYR A CE2  1  
ATOM 1488  C CZ   . TYR A 1 101 ? -5.515  -23.763 5.169   1.00 0.00 ? 101 TYR A CZ   1  
ATOM 1489  O OH   . TYR A 1 101 ? -5.270  -25.076 4.910   1.00 0.00 ? 101 TYR A OH   1  
ATOM 1490  H H    . TYR A 1 101 ? -6.033  -17.728 8.374   1.00 0.00 ? 101 TYR A H    1  
ATOM 1491  H HA   . TYR A 1 101 ? -4.932  -19.547 7.728   1.00 0.00 ? 101 TYR A HA   1  
ATOM 1492  H HB2  . TYR A 1 101 ? -7.265  -19.515 6.469   1.00 0.00 ? 101 TYR A HB2  1  
ATOM 1493  H HB3  . TYR A 1 101 ? -6.349  -19.063 5.045   1.00 0.00 ? 101 TYR A HB3  1  
ATOM 1494  H HD1  . TYR A 1 101 ? -4.667  -20.662 4.084   1.00 0.00 ? 101 TYR A HD1  1  
ATOM 1495  H HD2  . TYR A 1 101 ? -7.311  -21.780 7.256   1.00 0.00 ? 101 TYR A HD2  1  
ATOM 1496  H HE1  . TYR A 1 101 ? -4.214  -23.117 3.606   1.00 0.00 ? 101 TYR A HE1  1  
ATOM 1497  H HE2  . TYR A 1 101 ? -6.849  -24.232 6.767   1.00 0.00 ? 101 TYR A HE2  1  
ATOM 1498  H HH   . TYR A 1 101 ? -4.304  -25.206 4.689   1.00 0.00 ? 101 TYR A HH   1  
ATOM 1499  N N    . GLY A 1 1   ? 0.042   -3.224  -17.411 1.00 0.00 ? 1   GLY A N    2  
ATOM 1500  C CA   . GLY A 1 1   ? 0.904   -4.382  -17.575 1.00 0.00 ? 1   GLY A CA   2  
ATOM 1501  C C    . GLY A 1 1   ? 0.084   -5.638  -17.874 1.00 0.00 ? 1   GLY A C    2  
ATOM 1502  O O    . GLY A 1 1   ? -0.034  -6.047  -19.028 1.00 0.00 ? 1   GLY A O    2  
ATOM 1503  H H1   . GLY A 1 1   ? -0.829  -3.272  -17.901 1.00 0.00 ? 1   GLY A H1   2  
ATOM 1504  H HA2  . GLY A 1 1   ? 1.610   -4.202  -18.386 1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1505  H HA3  . GLY A 1 1   ? 1.491   -4.533  -16.669 1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1506  N N    . PRO A 1 2   ? -0.477  -6.231  -16.786 1.00 0.00 ? 2   PRO A N    2  
ATOM 1507  C CA   . PRO A 1 2   ? -1.283  -7.433  -16.921 1.00 0.00 ? 2   PRO A CA   2  
ATOM 1508  C C    . PRO A 1 2   ? -2.662  -7.106  -17.497 1.00 0.00 ? 2   PRO A C    2  
ATOM 1509  O O    . PRO A 1 2   ? -3.621  -6.914  -16.750 1.00 0.00 ? 2   PRO A O    2  
ATOM 1510  C CB   . PRO A 1 2   ? -1.348  -8.022  -15.521 1.00 0.00 ? 2   PRO A CB   2  
ATOM 1511  C CG   . PRO A 1 2   ? -0.972  -6.892  -14.576 1.00 0.00 ? 2   PRO A CG   2  
ATOM 1512  C CD   . PRO A 1 2   ? -0.359  -5.775  -15.404 1.00 0.00 ? 2   PRO A CD   2  
ATOM 1513  H HA   . PRO A 1 2   ? -0.858  -8.064  -17.570 1.00 0.00 ? 2   PRO A HA   2  
ATOM 1514  H HB2  . PRO A 1 2   ? -2.347  -8.399  -15.302 1.00 0.00 ? 2   PRO A HB2  2  
ATOM 1515  H HB3  . PRO A 1 2   ? -0.660  -8.862  -15.419 1.00 0.00 ? 2   PRO A HB3  2  
ATOM 1516  H HG2  . PRO A 1 2   ? -1.852  -6.533  -14.042 1.00 0.00 ? 2   PRO A HG2  2  
ATOM 1517  H HG3  . PRO A 1 2   ? -0.265  -7.243  -13.824 1.00 0.00 ? 2   PRO A HG3  2  
ATOM 1518  H HD2  . PRO A 1 2   ? -0.886  -4.834  -15.252 1.00 0.00 ? 2   PRO A HD2  2  
ATOM 1519  H HD3  . PRO A 1 2   ? 0.682   -5.606  -15.131 1.00 0.00 ? 2   PRO A HD3  2  
ATOM 1520  N N    . LEU A 1 3   ? -2.719  -7.053  -18.819 1.00 0.00 ? 3   LEU A N    2  
ATOM 1521  C CA   . LEU A 1 3   ? -3.965  -6.753  -19.504 1.00 0.00 ? 3   LEU A CA   2  
ATOM 1522  C C    . LEU A 1 3   ? -4.840  -8.007  -19.533 1.00 0.00 ? 3   LEU A C    2  
ATOM 1523  O O    . LEU A 1 3   ? -5.151  -8.527  -20.603 1.00 0.00 ? 3   LEU A O    2  
ATOM 1524  C CB   . LEU A 1 3   ? -3.687  -6.165  -20.889 1.00 0.00 ? 3   LEU A CB   2  
ATOM 1525  C CG   . LEU A 1 3   ? -4.675  -5.104  -21.377 1.00 0.00 ? 3   LEU A CG   2  
ATOM 1526  C CD1  . LEU A 1 3   ? -4.250  -3.707  -20.919 1.00 0.00 ? 3   LEU A CD1  2  
ATOM 1527  C CD2  . LEU A 1 3   ? -4.854  -5.179  -22.895 1.00 0.00 ? 3   LEU A CD2  2  
ATOM 1528  H H    . LEU A 1 3   ? -1.934  -7.211  -19.419 1.00 0.00 ? 3   LEU A H    2  
ATOM 1529  H HA   . LEU A 1 3   ? -4.479  -5.986  -18.925 1.00 0.00 ? 3   LEU A HA   2  
ATOM 1530  H HB2  . LEU A 1 3   ? -2.688  -5.728  -20.883 1.00 0.00 ? 3   LEU A HB2  2  
ATOM 1531  H HB3  . LEU A 1 3   ? -3.674  -6.981  -21.612 1.00 0.00 ? 3   LEU A HB3  2  
ATOM 1532  H HG   . LEU A 1 3   ? -5.646  -5.309  -20.928 1.00 0.00 ? 3   LEU A HG   2  
ATOM 1533  H HD11 . LEU A 1 3   ? -4.337  -3.010  -21.751 1.00 0.00 ? 3   LEU A HD11 2  
ATOM 1534  H HD12 . LEU A 1 3   ? -4.896  -3.381  -20.103 1.00 0.00 ? 3   LEU A HD12 2  
ATOM 1535  H HD13 . LEU A 1 3   ? -3.216  -3.737  -20.575 1.00 0.00 ? 3   LEU A HD13 2  
ATOM 1536  H HD21 . LEU A 1 3   ? -4.413  -6.103  -23.268 1.00 0.00 ? 3   LEU A HD21 2  
ATOM 1537  H HD22 . LEU A 1 3   ? -5.917  -5.161  -23.136 1.00 0.00 ? 3   LEU A HD22 2  
ATOM 1538  H HD23 . LEU A 1 3   ? -4.361  -4.326  -23.362 1.00 0.00 ? 3   LEU A HD23 2  
ATOM 1539  N N    . GLY A 1 4   ? -5.214  -8.457  -18.344 1.00 0.00 ? 4   GLY A N    2  
ATOM 1540  C CA   . GLY A 1 4   ? -6.047  -9.641  -18.219 1.00 0.00 ? 4   GLY A CA   2  
ATOM 1541  C C    . GLY A 1 4   ? -6.064  -10.150 -16.776 1.00 0.00 ? 4   GLY A C    2  
ATOM 1542  O O    . GLY A 1 4   ? -5.415  -11.145 -16.458 1.00 0.00 ? 4   GLY A O    2  
ATOM 1543  H H    . GLY A 1 4   ? -4.956  -8.029  -17.478 1.00 0.00 ? 4   GLY A H    2  
ATOM 1544  H HA2  . GLY A 1 4   ? -7.063  -9.409  -18.539 1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1545  H HA3  . GLY A 1 4   ? -5.676  -10.423 -18.880 1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1546  N N    . SER A 1 5   ? -6.814  -9.444  -15.942 1.00 0.00 ? 5   SER A N    2  
ATOM 1547  C CA   . SER A 1 5   ? -6.924  -9.813  -14.541 1.00 0.00 ? 5   SER A CA   2  
ATOM 1548  C C    . SER A 1 5   ? -8.376  -9.676  -14.077 1.00 0.00 ? 5   SER A C    2  
ATOM 1549  O O    . SER A 1 5   ? -8.982  -8.616  -14.225 1.00 0.00 ? 5   SER A O    2  
ATOM 1550  C CB   . SER A 1 5   ? -6.006  -8.952  -13.671 1.00 0.00 ? 5   SER A CB   2  
ATOM 1551  O OG   . SER A 1 5   ? -5.283  -9.732  -12.723 1.00 0.00 ? 5   SER A OG   2  
ATOM 1552  H H    . SER A 1 5   ? -7.339  -8.636  -16.209 1.00 0.00 ? 5   SER A H    2  
ATOM 1553  H HA   . SER A 1 5   ? -6.602  -10.853 -14.490 1.00 0.00 ? 5   SER A HA   2  
ATOM 1554  H HB2  . SER A 1 5   ? -5.304  -8.414  -14.308 1.00 0.00 ? 5   SER A HB2  2  
ATOM 1555  H HB3  . SER A 1 5   ? -6.600  -8.203  -13.148 1.00 0.00 ? 5   SER A HB3  2  
ATOM 1556  H HG   . SER A 1 5   ? -5.266  -10.690 -13.010 1.00 0.00 ? 5   SER A HG   2  
ATOM 1557  N N    . LEU A 1 6   ? -8.891  -10.765 -13.524 1.00 0.00 ? 6   LEU A N    2  
ATOM 1558  C CA   . LEU A 1 6   ? -10.260 -10.780 -13.037 1.00 0.00 ? 6   LEU A CA   2  
ATOM 1559  C C    . LEU A 1 6   ? -10.341 -11.650 -11.781 1.00 0.00 ? 6   LEU A C    2  
ATOM 1560  O O    . LEU A 1 6   ? -11.027 -12.670 -11.771 1.00 0.00 ? 6   LEU A O    2  
ATOM 1561  C CB   . LEU A 1 6   ? -11.219 -11.214 -14.148 1.00 0.00 ? 6   LEU A CB   2  
ATOM 1562  C CG   . LEU A 1 6   ? -12.681 -11.404 -13.736 1.00 0.00 ? 6   LEU A CG   2  
ATOM 1563  C CD1  . LEU A 1 6   ? -13.550 -10.256 -14.254 1.00 0.00 ? 6   LEU A CD1  2  
ATOM 1564  C CD2  . LEU A 1 6   ? -13.204 -12.769 -14.187 1.00 0.00 ? 6   LEU A CD2  2  
ATOM 1565  H H    . LEU A 1 6   ? -8.392  -11.623 -13.407 1.00 0.00 ? 6   LEU A H    2  
ATOM 1566  H HA   . LEU A 1 6   ? -10.522 -9.757  -12.767 1.00 0.00 ? 6   LEU A HA   2  
ATOM 1567  H HB2  . LEU A 1 6   ? -11.181 -10.471 -14.945 1.00 0.00 ? 6   LEU A HB2  2  
ATOM 1568  H HB3  . LEU A 1 6   ? -10.856 -12.151 -14.568 1.00 0.00 ? 6   LEU A HB3  2  
ATOM 1569  H HG   . LEU A 1 6   ? -12.734 -11.382 -12.647 1.00 0.00 ? 6   LEU A HG   2  
ATOM 1570  H HD11 . LEU A 1 6   ? -14.588 -10.430 -13.971 1.00 0.00 ? 6   LEU A HD11 2  
ATOM 1571  H HD12 . LEU A 1 6   ? -13.207 -9.317  -13.821 1.00 0.00 ? 6   LEU A HD12 2  
ATOM 1572  H HD13 . LEU A 1 6   ? -13.474 -10.205 -15.340 1.00 0.00 ? 6   LEU A HD13 2  
ATOM 1573  H HD21 . LEU A 1 6   ? -13.745 -12.658 -15.127 1.00 0.00 ? 6   LEU A HD21 2  
ATOM 1574  H HD22 . LEU A 1 6   ? -12.366 -13.451 -14.328 1.00 0.00 ? 6   LEU A HD22 2  
ATOM 1575  H HD23 . LEU A 1 6   ? -13.875 -13.170 -13.427 1.00 0.00 ? 6   LEU A HD23 2  
ATOM 1576  N N    . ARG A 1 7   ? -9.629  -11.214 -10.752 1.00 0.00 ? 7   ARG A N    2  
ATOM 1577  C CA   . ARG A 1 7   ? -9.611  -11.940 -9.494  1.00 0.00 ? 7   ARG A CA   2  
ATOM 1578  C C    . ARG A 1 7   ? -8.940  -11.099 -8.405  1.00 0.00 ? 7   ARG A C    2  
ATOM 1579  O O    . ARG A 1 7   ? -7.826  -10.613 -8.590  1.00 0.00 ? 7   ARG A O    2  
ATOM 1580  C CB   . ARG A 1 7   ? -8.864  -13.268 -9.635  1.00 0.00 ? 7   ARG A CB   2  
ATOM 1581  C CG   . ARG A 1 7   ? -9.094  -14.159 -8.412  1.00 0.00 ? 7   ARG A CG   2  
ATOM 1582  C CD   . ARG A 1 7   ? -8.624  -15.590 -8.680  1.00 0.00 ? 7   ARG A CD   2  
ATOM 1583  N NE   . ARG A 1 7   ? -7.173  -15.705 -8.413  1.00 0.00 ? 7   ARG A NE   2  
ATOM 1584  C CZ   . ARG A 1 7   ? -6.452  -16.811 -8.641  1.00 0.00 ? 7   ARG A CZ   2  
ATOM 1585  N NH1  . ARG A 1 7   ? -7.043  -17.904 -9.142  1.00 0.00 ? 7   ARG A NH1  2  
ATOM 1586  N NH2  . ARG A 1 7   ? -5.140  -16.824 -8.368  1.00 0.00 ? 7   ARG A NH2  2  
ATOM 1587  H H    . ARG A 1 7   ? -9.073  -10.383 -10.768 1.00 0.00 ? 7   ARG A H    2  
ATOM 1588  H HA   . ARG A 1 7   ? -10.660 -12.119 -9.260  1.00 0.00 ? 7   ARG A HA   2  
ATOM 1589  H HB2  . ARG A 1 7   ? -9.201  -13.785 -10.534 1.00 0.00 ? 7   ARG A HB2  2  
ATOM 1590  H HB3  . ARG A 1 7   ? -7.798  -13.079 -9.756  1.00 0.00 ? 7   ARG A HB3  2  
ATOM 1591  H HG2  . ARG A 1 7   ? -8.559  -13.751 -7.555  1.00 0.00 ? 7   ARG A HG2  2  
ATOM 1592  H HG3  . ARG A 1 7   ? -10.153 -14.162 -8.154  1.00 0.00 ? 7   ARG A HG3  2  
ATOM 1593  H HD2  . ARG A 1 7   ? -9.174  -16.287 -8.048  1.00 0.00 ? 7   ARG A HD2  2  
ATOM 1594  H HD3  . ARG A 1 7   ? -8.834  -15.863 -9.714  1.00 0.00 ? 7   ARG A HD3  2  
ATOM 1595  H HE   . ARG A 1 7   ? -6.701  -14.906 -8.038  1.00 0.00 ? 7   ARG A HE   2  
ATOM 1596  H HH11 . ARG A 1 7   ? -8.022  -17.895 -9.345  1.00 0.00 ? 7   ARG A HH11 2  
ATOM 1597  H HH12 . ARG A 1 7   ? -6.505  -18.730 -9.312  1.00 0.00 ? 7   ARG A HH12 2  
ATOM 1598  H HH21 . ARG A 1 7   ? -4.699  -16.008 -7.994  1.00 0.00 ? 7   ARG A HH21 2  
ATOM 1599  H HH22 . ARG A 1 7   ? -4.602  -17.649 -8.538  1.00 0.00 ? 7   ARG A HH22 2  
ATOM 1600  N N    . LYS A 1 8   ? -9.648  -10.954 -7.295  1.00 0.00 ? 8   LYS A N    2  
ATOM 1601  C CA   . LYS A 1 8   ? -9.136  -10.180 -6.176  1.00 0.00 ? 8   LYS A CA   2  
ATOM 1602  C C    . LYS A 1 8   ? -8.253  -11.076 -5.304  1.00 0.00 ? 8   LYS A C    2  
ATOM 1603  O O    . LYS A 1 8   ? -8.756  -11.943 -4.591  1.00 0.00 ? 8   LYS A O    2  
ATOM 1604  C CB   . LYS A 1 8   ? -10.283 -9.517  -5.413  1.00 0.00 ? 8   LYS A CB   2  
ATOM 1605  C CG   . LYS A 1 8   ? -10.670 -8.183  -6.055  1.00 0.00 ? 8   LYS A CG   2  
ATOM 1606  C CD   . LYS A 1 8   ? -12.113 -8.217  -6.564  1.00 0.00 ? 8   LYS A CD   2  
ATOM 1607  C CE   . LYS A 1 8   ? -12.547 -6.842  -7.074  1.00 0.00 ? 8   LYS A CE   2  
ATOM 1608  N NZ   . LYS A 1 8   ? -13.787 -6.405  -6.394  1.00 0.00 ? 8   LYS A NZ   2  
ATOM 1609  H H    . LYS A 1 8   ? -10.554 -11.352 -7.153  1.00 0.00 ? 8   LYS A H    2  
ATOM 1610  H HA   . LYS A 1 8   ? -8.518  -9.382  -6.588  1.00 0.00 ? 8   LYS A HA   2  
ATOM 1611  H HB2  . LYS A 1 8   ? -11.147 -10.181 -5.398  1.00 0.00 ? 8   LYS A HB2  2  
ATOM 1612  H HB3  . LYS A 1 8   ? -9.989  -9.354  -4.376  1.00 0.00 ? 8   LYS A HB3  2  
ATOM 1613  H HG2  . LYS A 1 8   ? -10.556 -7.379  -5.328  1.00 0.00 ? 8   LYS A HG2  2  
ATOM 1614  H HG3  . LYS A 1 8   ? -9.995  -7.963  -6.881  1.00 0.00 ? 8   LYS A HG3  2  
ATOM 1615  H HD2  . LYS A 1 8   ? -12.202 -8.951  -7.365  1.00 0.00 ? 8   LYS A HD2  2  
ATOM 1616  H HD3  . LYS A 1 8   ? -12.778 -8.538  -5.762  1.00 0.00 ? 8   LYS A HD3  2  
ATOM 1617  H HE2  . LYS A 1 8   ? -11.754 -6.115  -6.898  1.00 0.00 ? 8   LYS A HE2  2  
ATOM 1618  H HE3  . LYS A 1 8   ? -12.711 -6.881  -8.150  1.00 0.00 ? 8   LYS A HE3  2  
ATOM 1619  H HZ1  . LYS A 1 8   ? -13.559 -6.021  -5.499  1.00 0.00 ? 8   LYS A HZ1  2  
ATOM 1620  H HZ2  . LYS A 1 8   ? -14.244 -5.709  -6.948  1.00 0.00 ? 8   LYS A HZ2  2  
ATOM 1621  H HZ3  . LYS A 1 8   ? -14.396 -7.189  -6.275  1.00 0.00 ? 8   LYS A HZ3  2  
ATOM 1622  N N    . GLU A 1 9   ? -6.953  -10.835 -5.390  1.00 0.00 ? 9   GLU A N    2  
ATOM 1623  C CA   . GLU A 1 9   ? -5.996  -11.608 -4.617  1.00 0.00 ? 9   GLU A CA   2  
ATOM 1624  C C    . GLU A 1 9   ? -5.004  -10.678 -3.917  1.00 0.00 ? 9   GLU A C    2  
ATOM 1625  O O    . GLU A 1 9   ? -4.875  -9.512  -4.285  1.00 0.00 ? 9   GLU A O    2  
ATOM 1626  C CB   . GLU A 1 9   ? -5.267  -12.621 -5.503  1.00 0.00 ? 9   GLU A CB   2  
ATOM 1627  C CG   . GLU A 1 9   ? -5.842  -14.026 -5.317  1.00 0.00 ? 9   GLU A CG   2  
ATOM 1628  C CD   . GLU A 1 9   ? -4.727  -15.072 -5.257  1.00 0.00 ? 9   GLU A CD   2  
ATOM 1629  O OE1  . GLU A 1 9   ? -3.824  -14.988 -6.117  1.00 0.00 ? 9   GLU A OE1  2  
ATOM 1630  O OE2  . GLU A 1 9   ? -4.802  -15.931 -4.352  1.00 0.00 ? 9   GLU A OE2  2  
ATOM 1631  H H    . GLU A 1 9   ? -6.553  -10.127 -5.972  1.00 0.00 ? 9   GLU A H    2  
ATOM 1632  H HA   . GLU A 1 9   ? -6.588  -12.144 -3.875  1.00 0.00 ? 9   GLU A HA   2  
ATOM 1633  H HB2  . GLU A 1 9   ? -5.354  -12.324 -6.548  1.00 0.00 ? 9   GLU A HB2  2  
ATOM 1634  H HB3  . GLU A 1 9   ? -4.205  -12.623 -5.260  1.00 0.00 ? 9   GLU A HB3  2  
ATOM 1635  H HG2  . GLU A 1 9   ? -6.430  -14.064 -4.400  1.00 0.00 ? 9   GLU A HG2  2  
ATOM 1636  H HG3  . GLU A 1 9   ? -6.519  -14.258 -6.139  1.00 0.00 ? 9   GLU A HG3  2  
ATOM 1637  N N    . PRO A 1 10  ? -4.310  -11.244 -2.893  1.00 0.00 ? 10  PRO A N    2  
ATOM 1638  C CA   . PRO A 1 10  ? -3.333  -10.478 -2.137  1.00 0.00 ? 10  PRO A CA   2  
ATOM 1639  C C    . PRO A 1 10  ? -2.048  -10.281 -2.945  1.00 0.00 ? 10  PRO A C    2  
ATOM 1640  O O    . PRO A 1 10  ? -1.935  -10.770 -4.067  1.00 0.00 ? 10  PRO A O    2  
ATOM 1641  C CB   . PRO A 1 10  ? -3.115  -11.271 -0.859  1.00 0.00 ? 10  PRO A CB   2  
ATOM 1642  C CG   . PRO A 1 10  ? -3.620  -12.675 -1.148  1.00 0.00 ? 10  PRO A CG   2  
ATOM 1643  C CD   . PRO A 1 10  ? -4.437  -12.623 -2.429  1.00 0.00 ? 10  PRO A CD   2  
ATOM 1644  H HA   . PRO A 1 10  ? -3.682  -9.560  -1.950  1.00 0.00 ? 10  PRO A HA   2  
ATOM 1645  H HB2  . PRO A 1 10  ? -2.061  -11.284 -0.582  1.00 0.00 ? 10  PRO A HB2  2  
ATOM 1646  H HB3  . PRO A 1 10  ? -3.658  -10.825 -0.025  1.00 0.00 ? 10  PRO A HB3  2  
ATOM 1647  H HG2  . PRO A 1 10  ? -2.784  -13.367 -1.256  1.00 0.00 ? 10  PRO A HG2  2  
ATOM 1648  H HG3  . PRO A 1 10  ? -4.230  -13.039 -0.321  1.00 0.00 ? 10  PRO A HG3  2  
ATOM 1649  H HD2  . PRO A 1 10  ? -4.057  -13.326 -3.170  1.00 0.00 ? 10  PRO A HD2  2  
ATOM 1650  H HD3  . PRO A 1 10  ? -5.479  -12.885 -2.246  1.00 0.00 ? 10  PRO A HD3  2  
ATOM 1651  N N    . GLU A 1 11  ? -1.113  -9.561  -2.341  1.00 0.00 ? 11  GLU A N    2  
ATOM 1652  C CA   . GLU A 1 11  ? 0.159   -9.293  -2.990  1.00 0.00 ? 11  GLU A CA   2  
ATOM 1653  C C    . GLU A 1 11  ? 0.006   -8.166  -4.013  1.00 0.00 ? 11  GLU A C    2  
ATOM 1654  O O    . GLU A 1 11  ? 0.451   -7.044  -3.777  1.00 0.00 ? 11  GLU A O    2  
ATOM 1655  C CB   . GLU A 1 11  ? 0.717   -10.557 -3.646  1.00 0.00 ? 11  GLU A CB   2  
ATOM 1656  C CG   . GLU A 1 11  ? 2.222   -10.429 -3.890  1.00 0.00 ? 11  GLU A CG   2  
ATOM 1657  C CD   . GLU A 1 11  ? 2.952   -11.717 -3.500  1.00 0.00 ? 11  GLU A CD   2  
ATOM 1658  O OE1  . GLU A 1 11  ? 2.609   -12.261 -2.428  1.00 0.00 ? 11  GLU A OE1  2  
ATOM 1659  O OE2  . GLU A 1 11  ? 3.835   -12.127 -4.283  1.00 0.00 ? 11  GLU A OE2  2  
ATOM 1660  H H    . GLU A 1 11  ? -1.214  -9.166  -1.428  1.00 0.00 ? 11  GLU A H    2  
ATOM 1661  H HA   . GLU A 1 11  ? 0.831   -8.979  -2.191  1.00 0.00 ? 11  GLU A HA   2  
ATOM 1662  H HB2  . GLU A 1 11  ? 0.520   -11.419 -3.010  1.00 0.00 ? 11  GLU A HB2  2  
ATOM 1663  H HB3  . GLU A 1 11  ? 0.206   -10.736 -4.593  1.00 0.00 ? 11  GLU A HB3  2  
ATOM 1664  H HG2  . GLU A 1 11  ? 2.407   -10.206 -4.940  1.00 0.00 ? 11  GLU A HG2  2  
ATOM 1665  H HG3  . GLU A 1 11  ? 2.618   -9.594  -3.312  1.00 0.00 ? 11  GLU A HG3  2  
ATOM 1666  N N    . ILE A 1 12  ? -0.627  -8.503  -5.127  1.00 0.00 ? 12  ILE A N    2  
ATOM 1667  C CA   . ILE A 1 12  ? -0.845  -7.533  -6.187  1.00 0.00 ? 12  ILE A CA   2  
ATOM 1668  C C    . ILE A 1 12  ? -2.268  -6.981  -6.083  1.00 0.00 ? 12  ILE A C    2  
ATOM 1669  O O    . ILE A 1 12  ? -3.220  -7.624  -6.522  1.00 0.00 ? 12  ILE A O    2  
ATOM 1670  C CB   . ILE A 1 12  ? -0.522  -8.148  -7.550  1.00 0.00 ? 12  ILE A CB   2  
ATOM 1671  C CG1  . ILE A 1 12  ? -0.969  -7.227  -8.687  1.00 0.00 ? 12  ILE A CG1  2  
ATOM 1672  C CG2  . ILE A 1 12  ? -1.124  -9.549  -7.677  1.00 0.00 ? 12  ILE A CG2  2  
ATOM 1673  C CD1  . ILE A 1 12  ? 0.049   -7.230  -9.829  1.00 0.00 ? 12  ILE A CD1  2  
ATOM 1674  H H    . ILE A 1 12  ? -0.987  -9.418  -5.311  1.00 0.00 ? 12  ILE A H    2  
ATOM 1675  H HA   . ILE A 1 12  ? -0.144  -6.713  -6.029  1.00 0.00 ? 12  ILE A HA   2  
ATOM 1676  H HB   . ILE A 1 12  ? 0.560   -8.254  -7.629  1.00 0.00 ? 12  ILE A HB   2  
ATOM 1677  H HG12 . ILE A 1 12  ? -1.941  -7.550  -9.061  1.00 0.00 ? 12  ILE A HG12 2  
ATOM 1678  H HG13 . ILE A 1 12  ? -1.094  -6.212  -8.310  1.00 0.00 ? 12  ILE A HG13 2  
ATOM 1679  H HG21 . ILE A 1 12  ? -1.316  -9.768  -8.727  1.00 0.00 ? 12  ILE A HG21 2  
ATOM 1680  H HG22 . ILE A 1 12  ? -0.425  -10.282 -7.275  1.00 0.00 ? 12  ILE A HG22 2  
ATOM 1681  H HG23 . ILE A 1 12  ? -2.059  -9.594  -7.119  1.00 0.00 ? 12  ILE A HG23 2  
ATOM 1682  H HD11 . ILE A 1 12  ? 0.618   -8.159  -9.806  1.00 0.00 ? 12  ILE A HD11 2  
ATOM 1683  H HD12 . ILE A 1 12  ? -0.473  -7.148  -10.782 1.00 0.00 ? 12  ILE A HD12 2  
ATOM 1684  H HD13 . ILE A 1 12  ? 0.728   -6.385  -9.713  1.00 0.00 ? 12  ILE A HD13 2  
ATOM 1685  N N    . ILE A 1 13  ? -2.367  -5.796  -5.499  1.00 0.00 ? 13  ILE A N    2  
ATOM 1686  C CA   . ILE A 1 13  ? -3.658  -5.150  -5.332  1.00 0.00 ? 13  ILE A CA   2  
ATOM 1687  C C    . ILE A 1 13  ? -3.769  -3.980  -6.311  1.00 0.00 ? 13  ILE A C    2  
ATOM 1688  O O    . ILE A 1 13  ? -2.882  -3.130  -6.372  1.00 0.00 ? 13  ILE A O    2  
ATOM 1689  C CB   . ILE A 1 13  ? -3.872  -4.751  -3.871  1.00 0.00 ? 13  ILE A CB   2  
ATOM 1690  C CG1  . ILE A 1 13  ? -4.200  -5.974  -3.011  1.00 0.00 ? 13  ILE A CG1  2  
ATOM 1691  C CG2  . ILE A 1 13  ? -4.941  -3.663  -3.750  1.00 0.00 ? 13  ILE A CG2  2  
ATOM 1692  C CD1  . ILE A 1 13  ? -3.048  -6.980  -3.027  1.00 0.00 ? 13  ILE A CD1  2  
ATOM 1693  H H    . ILE A 1 13  ? -1.588  -5.280  -5.145  1.00 0.00 ? 13  ILE A H    2  
ATOM 1694  H HA   . ILE A 1 13  ? -4.425  -5.883  -5.582  1.00 0.00 ? 13  ILE A HA   2  
ATOM 1695  H HB   . ILE A 1 13  ? -2.941  -4.331  -3.491  1.00 0.00 ? 13  ILE A HB   2  
ATOM 1696  H HG12 . ILE A 1 13  ? -4.399  -5.660  -1.987  1.00 0.00 ? 13  ILE A HG12 2  
ATOM 1697  H HG13 . ILE A 1 13  ? -5.109  -6.450  -3.381  1.00 0.00 ? 13  ILE A HG13 2  
ATOM 1698  H HG21 . ILE A 1 13  ? -4.566  -2.736  -4.185  1.00 0.00 ? 13  ILE A HG21 2  
ATOM 1699  H HG22 . ILE A 1 13  ? -5.840  -3.976  -4.281  1.00 0.00 ? 13  ILE A HG22 2  
ATOM 1700  H HG23 . ILE A 1 13  ? -5.178  -3.501  -2.699  1.00 0.00 ? 13  ILE A HG23 2  
ATOM 1701  H HD11 . ILE A 1 13  ? -3.253  -7.756  -3.765  1.00 0.00 ? 13  ILE A HD11 2  
ATOM 1702  H HD12 . ILE A 1 13  ? -2.122  -6.468  -3.286  1.00 0.00 ? 13  ILE A HD12 2  
ATOM 1703  H HD13 . ILE A 1 13  ? -2.949  -7.434  -2.041  1.00 0.00 ? 13  ILE A HD13 2  
ATOM 1704  N N    . THR A 1 14  ? -4.866  -3.973  -7.054  1.00 0.00 ? 14  THR A N    2  
ATOM 1705  C CA   . THR A 1 14  ? -5.105  -2.921  -8.028  1.00 0.00 ? 14  THR A CA   2  
ATOM 1706  C C    . THR A 1 14  ? -6.605  -2.755  -8.277  1.00 0.00 ? 14  THR A C    2  
ATOM 1707  O O    . THR A 1 14  ? -7.301  -3.727  -8.567  1.00 0.00 ? 14  THR A O    2  
ATOM 1708  C CB   . THR A 1 14  ? -4.312  -3.259  -9.292  1.00 0.00 ? 14  THR A CB   2  
ATOM 1709  O OG1  . THR A 1 14  ? -4.787  -2.326  -10.259 1.00 0.00 ? 14  THR A OG1  2  
ATOM 1710  C CG2  . THR A 1 14  ? -4.690  -4.623  -9.873  1.00 0.00 ? 14  THR A CG2  2  
ATOM 1711  H H    . THR A 1 14  ? -5.583  -4.668  -6.998  1.00 0.00 ? 14  THR A H    2  
ATOM 1712  H HA   . THR A 1 14  ? -4.744  -1.980  -7.612  1.00 0.00 ? 14  THR A HA   2  
ATOM 1713  H HB   . THR A 1 14  ? -3.240  -3.198  -9.107  1.00 0.00 ? 14  THR A HB   2  
ATOM 1714  H HG1  . THR A 1 14  ? -4.651  -1.392  -9.929  1.00 0.00 ? 14  THR A HG1  2  
ATOM 1715  H HG21 . THR A 1 14  ? -4.879  -5.324  -9.060  1.00 0.00 ? 14  THR A HG21 2  
ATOM 1716  H HG22 . THR A 1 14  ? -5.588  -4.522  -10.482 1.00 0.00 ? 14  THR A HG22 2  
ATOM 1717  H HG23 . THR A 1 14  ? -3.872  -4.994  -10.491 1.00 0.00 ? 14  THR A HG23 2  
ATOM 1718  N N    . VAL A 1 15  ? -7.059  -1.517  -8.155  1.00 0.00 ? 15  VAL A N    2  
ATOM 1719  C CA   . VAL A 1 15  ? -8.464  -1.211  -8.363  1.00 0.00 ? 15  VAL A CA   2  
ATOM 1720  C C    . VAL A 1 15  ? -8.598  0.220   -8.889  1.00 0.00 ? 15  VAL A C    2  
ATOM 1721  O O    . VAL A 1 15  ? -7.809  1.093   -8.530  1.00 0.00 ? 15  VAL A O    2  
ATOM 1722  C CB   . VAL A 1 15  ? -9.249  -1.449  -7.072  1.00 0.00 ? 15  VAL A CB   2  
ATOM 1723  C CG1  . VAL A 1 15  ? -9.468  -0.137  -6.314  1.00 0.00 ? 15  VAL A CG1  2  
ATOM 1724  C CG2  . VAL A 1 15  ? -10.580 -2.145  -7.359  1.00 0.00 ? 15  VAL A CG2  2  
ATOM 1725  H H    . VAL A 1 15  ? -6.486  -0.732  -7.919  1.00 0.00 ? 15  VAL A H    2  
ATOM 1726  H HA   . VAL A 1 15  ? -8.842  -1.899  -9.119  1.00 0.00 ? 15  VAL A HA   2  
ATOM 1727  H HB   . VAL A 1 15  ? -8.657  -2.107  -6.436  1.00 0.00 ? 15  VAL A HB   2  
ATOM 1728  H HG11 . VAL A 1 15  ? -8.505  0.274   -6.014  1.00 0.00 ? 15  VAL A HG11 2  
ATOM 1729  H HG12 . VAL A 1 15  ? -9.982  0.574   -6.961  1.00 0.00 ? 15  VAL A HG12 2  
ATOM 1730  H HG13 . VAL A 1 15  ? -10.075 -0.327  -5.428  1.00 0.00 ? 15  VAL A HG13 2  
ATOM 1731  H HG21 . VAL A 1 15  ? -11.171 -2.193  -6.444  1.00 0.00 ? 15  VAL A HG21 2  
ATOM 1732  H HG22 . VAL A 1 15  ? -11.128 -1.584  -8.116  1.00 0.00 ? 15  VAL A HG22 2  
ATOM 1733  H HG23 . VAL A 1 15  ? -10.391 -3.155  -7.723  1.00 0.00 ? 15  VAL A HG23 2  
ATOM 1734  N N    . THR A 1 16  ? -9.602  0.416   -9.731  1.00 0.00 ? 16  THR A N    2  
ATOM 1735  C CA   . THR A 1 16  ? -9.849  1.725   -10.310 1.00 0.00 ? 16  THR A CA   2  
ATOM 1736  C C    . THR A 1 16  ? -10.405 2.680   -9.252  1.00 0.00 ? 16  THR A C    2  
ATOM 1737  O O    . THR A 1 16  ? -11.489 2.455   -8.716  1.00 0.00 ? 16  THR A O    2  
ATOM 1738  C CB   . THR A 1 16  ? -10.777 1.543   -11.512 1.00 0.00 ? 16  THR A CB   2  
ATOM 1739  O OG1  . THR A 1 16  ? -10.976 2.867   -12.001 1.00 0.00 ? 16  THR A OG1  2  
ATOM 1740  C CG2  . THR A 1 16  ? -12.179 1.083   -11.106 1.00 0.00 ? 16  THR A CG2  2  
ATOM 1741  H H    . THR A 1 16  ? -10.239 -0.300  -10.018 1.00 0.00 ? 16  THR A H    2  
ATOM 1742  H HA   . THR A 1 16  ? -8.897  2.138   -10.644 1.00 0.00 ? 16  THR A HA   2  
ATOM 1743  H HB   . THR A 1 16  ? -10.340 0.862   -12.242 1.00 0.00 ? 16  THR A HB   2  
ATOM 1744  H HG1  . THR A 1 16  ? -10.171 3.166   -12.515 1.00 0.00 ? 16  THR A HG1  2  
ATOM 1745  H HG21 . THR A 1 16  ? -12.685 1.887   -10.571 1.00 0.00 ? 16  THR A HG21 2  
ATOM 1746  H HG22 . THR A 1 16  ? -12.749 0.824   -11.997 1.00 0.00 ? 16  THR A HG22 2  
ATOM 1747  H HG23 . THR A 1 16  ? -12.100 0.209   -10.458 1.00 0.00 ? 16  THR A HG23 2  
ATOM 1748  N N    . LEU A 1 17  ? -9.637  3.725   -8.981  1.00 0.00 ? 17  LEU A N    2  
ATOM 1749  C CA   . LEU A 1 17  ? -10.039 4.715   -7.997  1.00 0.00 ? 17  LEU A CA   2  
ATOM 1750  C C    . LEU A 1 17  ? -11.368 5.342   -8.423  1.00 0.00 ? 17  LEU A C    2  
ATOM 1751  O O    . LEU A 1 17  ? -12.176 4.698   -9.091  1.00 0.00 ? 17  LEU A O    2  
ATOM 1752  C CB   . LEU A 1 17  ? -8.921  5.735   -7.775  1.00 0.00 ? 17  LEU A CB   2  
ATOM 1753  C CG   . LEU A 1 17  ? -8.905  6.426   -6.409  1.00 0.00 ? 17  LEU A CG   2  
ATOM 1754  C CD1  . LEU A 1 17  ? -8.945  7.947   -6.564  1.00 0.00 ? 17  LEU A CD1  2  
ATOM 1755  C CD2  . LEU A 1 17  ? -10.038 5.911   -5.521  1.00 0.00 ? 17  LEU A CD2  2  
ATOM 1756  H H    . LEU A 1 17  ? -8.756  3.901   -9.422  1.00 0.00 ? 17  LEU A H    2  
ATOM 1757  H HA   . LEU A 1 17  ? -10.191 4.193   -7.052  1.00 0.00 ? 17  LEU A HA   2  
ATOM 1758  H HB2  . LEU A 1 17  ? -7.964  5.233   -7.917  1.00 0.00 ? 17  LEU A HB2  2  
ATOM 1759  H HB3  . LEU A 1 17  ? -8.997  6.501   -8.546  1.00 0.00 ? 17  LEU A HB3  2  
ATOM 1760  H HG   . LEU A 1 17  ? -7.967  6.177   -5.912  1.00 0.00 ? 17  LEU A HG   2  
ATOM 1761  H HD11 . LEU A 1 17  ? -8.205  8.399   -5.904  1.00 0.00 ? 17  LEU A HD11 2  
ATOM 1762  H HD12 . LEU A 1 17  ? -8.720  8.213   -7.597  1.00 0.00 ? 17  LEU A HD12 2  
ATOM 1763  H HD13 . LEU A 1 17  ? -9.937  8.314   -6.303  1.00 0.00 ? 17  LEU A HD13 2  
ATOM 1764  H HD21 . LEU A 1 17  ? -10.264 6.651   -4.753  1.00 0.00 ? 17  LEU A HD21 2  
ATOM 1765  H HD22 . LEU A 1 17  ? -10.926 5.736   -6.129  1.00 0.00 ? 17  LEU A HD22 2  
ATOM 1766  H HD23 . LEU A 1 17  ? -9.733  4.978   -5.047  1.00 0.00 ? 17  LEU A HD23 2  
ATOM 1767  N N    . LYS A 1 18  ? -11.553 6.590   -8.021  1.00 0.00 ? 18  LYS A N    2  
ATOM 1768  C CA   . LYS A 1 18  ? -12.770 7.311   -8.353  1.00 0.00 ? 18  LYS A CA   2  
ATOM 1769  C C    . LYS A 1 18  ? -13.977 6.546   -7.806  1.00 0.00 ? 18  LYS A C    2  
ATOM 1770  O O    . LYS A 1 18  ? -15.117 6.843   -8.160  1.00 0.00 ? 18  LYS A O    2  
ATOM 1771  C CB   . LYS A 1 18  ? -12.841 7.577   -9.858  1.00 0.00 ? 18  LYS A CB   2  
ATOM 1772  C CG   . LYS A 1 18  ? -14.210 8.135   -10.252 1.00 0.00 ? 18  LYS A CG   2  
ATOM 1773  C CD   . LYS A 1 18  ? -14.134 8.886   -11.583 1.00 0.00 ? 18  LYS A CD   2  
ATOM 1774  C CE   . LYS A 1 18  ? -13.896 10.380  -11.357 1.00 0.00 ? 18  LYS A CE   2  
ATOM 1775  N NZ   . LYS A 1 18  ? -12.468 10.713  -11.551 1.00 0.00 ? 18  LYS A NZ   2  
ATOM 1776  H H    . LYS A 1 18  ? -10.891 7.107   -7.478  1.00 0.00 ? 18  LYS A H    2  
ATOM 1777  H HA   . LYS A 1 18  ? -12.721 8.281   -7.857  1.00 0.00 ? 18  LYS A HA   2  
ATOM 1778  H HB2  . LYS A 1 18  ? -12.061 8.282   -10.145 1.00 0.00 ? 18  LYS A HB2  2  
ATOM 1779  H HB3  . LYS A 1 18  ? -12.650 6.653   -10.404 1.00 0.00 ? 18  LYS A HB3  2  
ATOM 1780  H HG2  . LYS A 1 18  ? -14.930 7.320   -10.331 1.00 0.00 ? 18  LYS A HG2  2  
ATOM 1781  H HG3  . LYS A 1 18  ? -14.572 8.805   -9.473  1.00 0.00 ? 18  LYS A HG3  2  
ATOM 1782  H HD2  . LYS A 1 18  ? -13.329 8.474   -12.192 1.00 0.00 ? 18  LYS A HD2  2  
ATOM 1783  H HD3  . LYS A 1 18  ? -15.060 8.741   -12.140 1.00 0.00 ? 18  LYS A HD3  2  
ATOM 1784  H HE2  . LYS A 1 18  ? -14.509 10.960  -12.047 1.00 0.00 ? 18  LYS A HE2  2  
ATOM 1785  H HE3  . LYS A 1 18  ? -14.206 10.655  -10.348 1.00 0.00 ? 18  LYS A HE3  2  
ATOM 1786  H HZ1  . LYS A 1 18  ? -11.963 10.524  -10.709 1.00 0.00 ? 18  LYS A HZ1  2  
ATOM 1787  H HZ2  . LYS A 1 18  ? -12.094 10.158  -12.295 1.00 0.00 ? 18  LYS A HZ2  2  
ATOM 1788  H HZ3  . LYS A 1 18  ? -12.380 11.682  -11.782 1.00 0.00 ? 18  LYS A HZ3  2  
ATOM 1789  N N    . LYS A 1 19  ? -13.684 5.577   -6.951  1.00 0.00 ? 19  LYS A N    2  
ATOM 1790  C CA   . LYS A 1 19  ? -14.731 4.767   -6.351  1.00 0.00 ? 19  LYS A CA   2  
ATOM 1791  C C    . LYS A 1 19  ? -15.583 5.643   -5.431  1.00 0.00 ? 19  LYS A C    2  
ATOM 1792  O O    . LYS A 1 19  ? -16.483 6.344   -5.893  1.00 0.00 ? 19  LYS A O    2  
ATOM 1793  C CB   . LYS A 1 19  ? -14.130 3.545   -5.654  1.00 0.00 ? 19  LYS A CB   2  
ATOM 1794  C CG   . LYS A 1 19  ? -13.820 2.437   -6.661  1.00 0.00 ? 19  LYS A CG   2  
ATOM 1795  C CD   . LYS A 1 19  ? -14.055 1.055   -6.046  1.00 0.00 ? 19  LYS A CD   2  
ATOM 1796  C CE   . LYS A 1 19  ? -13.496 -0.048  -6.947  1.00 0.00 ? 19  LYS A CE   2  
ATOM 1797  N NZ   . LYS A 1 19  ? -14.206 -1.324  -6.705  1.00 0.00 ? 19  LYS A NZ   2  
ATOM 1798  H H    . LYS A 1 19  ? -12.754 5.343   -6.668  1.00 0.00 ? 19  LYS A H    2  
ATOM 1799  H HA   . LYS A 1 19  ? -15.363 4.399   -7.160  1.00 0.00 ? 19  LYS A HA   2  
ATOM 1800  H HB2  . LYS A 1 19  ? -13.218 3.832   -5.131  1.00 0.00 ? 19  LYS A HB2  2  
ATOM 1801  H HB3  . LYS A 1 19  ? -14.825 3.174   -4.901  1.00 0.00 ? 19  LYS A HB3  2  
ATOM 1802  H HG2  . LYS A 1 19  ? -14.447 2.557   -7.544  1.00 0.00 ? 19  LYS A HG2  2  
ATOM 1803  H HG3  . LYS A 1 19  ? -12.784 2.520   -6.992  1.00 0.00 ? 19  LYS A HG3  2  
ATOM 1804  H HD2  . LYS A 1 19  ? -13.581 1.005   -5.066  1.00 0.00 ? 19  LYS A HD2  2  
ATOM 1805  H HD3  . LYS A 1 19  ? -15.122 0.899   -5.893  1.00 0.00 ? 19  LYS A HD3  2  
ATOM 1806  H HE2  . LYS A 1 19  ? -13.600 0.240   -7.993  1.00 0.00 ? 19  LYS A HE2  2  
ATOM 1807  H HE3  . LYS A 1 19  ? -12.430 -0.176  -6.756  1.00 0.00 ? 19  LYS A HE3  2  
ATOM 1808  H HZ1  . LYS A 1 19  ? -13.539 -2.061  -6.595  1.00 0.00 ? 19  LYS A HZ1  2  
ATOM 1809  H HZ2  . LYS A 1 19  ? -14.756 -1.246  -5.874  1.00 0.00 ? 19  LYS A HZ2  2  
ATOM 1810  H HZ3  . LYS A 1 19  ? -14.801 -1.526  -7.482  1.00 0.00 ? 19  LYS A HZ3  2  
ATOM 1811  N N    . GLN A 1 20  ? -15.270 5.575   -4.145  1.00 0.00 ? 20  GLN A N    2  
ATOM 1812  C CA   . GLN A 1 20  ? -15.996 6.353   -3.156  1.00 0.00 ? 20  GLN A CA   2  
ATOM 1813  C C    . GLN A 1 20  ? -15.663 7.840   -3.300  1.00 0.00 ? 20  GLN A C    2  
ATOM 1814  O O    . GLN A 1 20  ? -16.517 8.696   -3.078  1.00 0.00 ? 20  GLN A O    2  
ATOM 1815  C CB   . GLN A 1 20  ? -15.694 5.859   -1.740  1.00 0.00 ? 20  GLN A CB   2  
ATOM 1816  C CG   . GLN A 1 20  ? -16.615 6.529   -0.717  1.00 0.00 ? 20  GLN A CG   2  
ATOM 1817  C CD   . GLN A 1 20  ? -17.805 5.629   -0.379  1.00 0.00 ? 20  GLN A CD   2  
ATOM 1818  O OE1  . GLN A 1 20  ? -18.539 5.176   -1.242  1.00 0.00 ? 20  GLN A OE1  2  
ATOM 1819  N NE2  . GLN A 1 20  ? -17.954 5.396   0.922   1.00 0.00 ? 20  GLN A NE2  2  
ATOM 1820  H H    . GLN A 1 20  ? -14.537 5.003   -3.778  1.00 0.00 ? 20  GLN A H    2  
ATOM 1821  H HA   . GLN A 1 20  ? -17.051 6.188   -3.375  1.00 0.00 ? 20  GLN A HA   2  
ATOM 1822  H HB2  . GLN A 1 20  ? -15.820 4.777   -1.694  1.00 0.00 ? 20  GLN A HB2  2  
ATOM 1823  H HB3  . GLN A 1 20  ? -14.654 6.070   -1.491  1.00 0.00 ? 20  GLN A HB3  2  
ATOM 1824  H HG2  . GLN A 1 20  ? -16.054 6.753   0.190   1.00 0.00 ? 20  GLN A HG2  2  
ATOM 1825  H HG3  . GLN A 1 20  ? -16.973 7.479   -1.113  1.00 0.00 ? 20  GLN A HG3  2  
ATOM 1826  H HE21 . GLN A 1 20  ? -17.317 5.799   1.578   1.00 0.00 ? 20  GLN A HE21 2  
ATOM 1827  H HE22 . GLN A 1 20  ? -18.705 4.819   1.244   1.00 0.00 ? 20  GLN A HE22 2  
ATOM 1828  N N    . ASN A 1 21  ? -14.418 8.100   -3.672  1.00 0.00 ? 21  ASN A N    2  
ATOM 1829  C CA   . ASN A 1 21  ? -13.960 9.468   -3.849  1.00 0.00 ? 21  ASN A CA   2  
ATOM 1830  C C    . ASN A 1 21  ? -12.433 9.506   -3.765  1.00 0.00 ? 21  ASN A C    2  
ATOM 1831  O O    . ASN A 1 21  ? -11.795 10.357  -4.382  1.00 0.00 ? 21  ASN A O    2  
ATOM 1832  C CB   . ASN A 1 21  ? -14.516 10.381  -2.754  1.00 0.00 ? 21  ASN A CB   2  
ATOM 1833  C CG   . ASN A 1 21  ? -15.604 11.303  -3.308  1.00 0.00 ? 21  ASN A CG   2  
ATOM 1834  O OD1  . ASN A 1 21  ? -16.788 11.114  -3.085  1.00 0.00 ? 21  ASN A OD1  2  
ATOM 1835  N ND2  . ASN A 1 21  ? -15.136 12.310  -4.042  1.00 0.00 ? 21  ASN A ND2  2  
ATOM 1836  H H    . ASN A 1 21  ? -13.729 7.398   -3.850  1.00 0.00 ? 21  ASN A H    2  
ATOM 1837  H HA   . ASN A 1 21  ? -14.332 9.770   -4.828  1.00 0.00 ? 21  ASN A HA   2  
ATOM 1838  H HB2  . ASN A 1 21  ? -14.926 9.776   -1.944  1.00 0.00 ? 21  ASN A HB2  2  
ATOM 1839  H HB3  . ASN A 1 21  ? -13.710 10.978  -2.328  1.00 0.00 ? 21  ASN A HB3  2  
ATOM 1840  H HD21 . ASN A 1 21  ? -14.152 12.408  -4.186  1.00 0.00 ? 21  ASN A HD21 2  
ATOM 1841  H HD22 . ASN A 1 21  ? -15.770 12.968  -4.448  1.00 0.00 ? 21  ASN A HD22 2  
ATOM 1842  N N    . GLY A 1 22  ? -11.891 8.572   -2.997  1.00 0.00 ? 22  GLY A N    2  
ATOM 1843  C CA   . GLY A 1 22  ? -10.451 8.487   -2.825  1.00 0.00 ? 22  GLY A CA   2  
ATOM 1844  C C    . GLY A 1 22  ? -10.028 7.070   -2.434  1.00 0.00 ? 22  GLY A C    2  
ATOM 1845  O O    . GLY A 1 22  ? -10.693 6.099   -2.791  1.00 0.00 ? 22  GLY A O    2  
ATOM 1846  H H    . GLY A 1 22  ? -12.418 7.883   -2.499  1.00 0.00 ? 22  GLY A H    2  
ATOM 1847  H HA2  . GLY A 1 22  ? -9.953  8.778   -3.750  1.00 0.00 ? 22  GLY A HA2  2  
ATOM 1848  H HA3  . GLY A 1 22  ? -10.131 9.191   -2.056  1.00 0.00 ? 22  GLY A HA3  2  
ATOM 1849  N N    . MET A 1 23  ? -8.923  6.996   -1.707  1.00 0.00 ? 23  MET A N    2  
ATOM 1850  C CA   . MET A 1 23  ? -8.403  5.713   -1.264  1.00 0.00 ? 23  MET A CA   2  
ATOM 1851  C C    . MET A 1 23  ? -8.792  5.436   0.190   1.00 0.00 ? 23  MET A C    2  
ATOM 1852  O O    . MET A 1 23  ? -9.036  4.290   0.563   1.00 0.00 ? 23  MET A O    2  
ATOM 1853  C CB   . MET A 1 23  ? -6.878  5.708   -1.395  1.00 0.00 ? 23  MET A CB   2  
ATOM 1854  C CG   . MET A 1 23  ? -6.359  4.299   -1.689  1.00 0.00 ? 23  MET A CG   2  
ATOM 1855  S SD   . MET A 1 23  ? -4.629  4.365   -2.124  1.00 0.00 ? 23  MET A SD   2  
ATOM 1856  C CE   . MET A 1 23  ? -4.657  5.706   -3.302  1.00 0.00 ? 23  MET A CE   2  
ATOM 1857  H H    . MET A 1 23  ? -8.387  7.791   -1.421  1.00 0.00 ? 23  MET A H    2  
ATOM 1858  H HA   . MET A 1 23  ? -8.860  4.971   -1.918  1.00 0.00 ? 23  MET A HA   2  
ATOM 1859  H HB2  . MET A 1 23  ? -6.576  6.385   -2.193  1.00 0.00 ? 23  MET A HB2  2  
ATOM 1860  H HB3  . MET A 1 23  ? -6.429  6.080   -0.474  1.00 0.00 ? 23  MET A HB3  2  
ATOM 1861  H HG2  . MET A 1 23  ? -6.498  3.661   -0.816  1.00 0.00 ? 23  MET A HG2  2  
ATOM 1862  H HG3  . MET A 1 23  ? -6.930  3.854   -2.503  1.00 0.00 ? 23  MET A HG3  2  
ATOM 1863  H HE1  . MET A 1 23  ? -4.565  6.655   -2.775  1.00 0.00 ? 23  MET A HE1  2  
ATOM 1864  H HE2  . MET A 1 23  ? -3.825  5.595   -3.999  1.00 0.00 ? 23  MET A HE2  2  
ATOM 1865  H HE3  . MET A 1 23  ? -5.597  5.686   -3.853  1.00 0.00 ? 23  MET A HE3  2  
ATOM 1866  N N    . GLY A 1 24  ? -8.837  6.506   0.971   1.00 0.00 ? 24  GLY A N    2  
ATOM 1867  C CA   . GLY A 1 24  ? -9.192  6.392   2.375   1.00 0.00 ? 24  GLY A CA   2  
ATOM 1868  C C    . GLY A 1 24  ? -8.406  5.266   3.050   1.00 0.00 ? 24  GLY A C    2  
ATOM 1869  O O    . GLY A 1 24  ? -8.991  4.292   3.522   1.00 0.00 ? 24  GLY A O    2  
ATOM 1870  H H    . GLY A 1 24  ? -8.637  7.435   0.659   1.00 0.00 ? 24  GLY A H    2  
ATOM 1871  H HA2  . GLY A 1 24  ? -8.991  7.336   2.882   1.00 0.00 ? 24  GLY A HA2  2  
ATOM 1872  H HA3  . GLY A 1 24  ? -10.261 6.201   2.469   1.00 0.00 ? 24  GLY A HA3  2  
ATOM 1873  N N    . LEU A 1 25  ? -7.092  5.437   3.075   1.00 0.00 ? 25  LEU A N    2  
ATOM 1874  C CA   . LEU A 1 25  ? -6.220  4.448   3.684   1.00 0.00 ? 25  LEU A CA   2  
ATOM 1875  C C    . LEU A 1 25  ? -5.207  5.154   4.587   1.00 0.00 ? 25  LEU A C    2  
ATOM 1876  O O    . LEU A 1 25  ? -4.528  6.085   4.155   1.00 0.00 ? 25  LEU A O    2  
ATOM 1877  C CB   . LEU A 1 25  ? -5.578  3.567   2.611   1.00 0.00 ? 25  LEU A CB   2  
ATOM 1878  C CG   . LEU A 1 25  ? -4.205  2.985   2.954   1.00 0.00 ? 25  LEU A CG   2  
ATOM 1879  C CD1  . LEU A 1 25  ? -4.130  2.592   4.431   1.00 0.00 ? 25  LEU A CD1  2  
ATOM 1880  C CD2  . LEU A 1 25  ? -3.859  1.814   2.032   1.00 0.00 ? 25  LEU A CD2  2  
ATOM 1881  H H    . LEU A 1 25  ? -6.625  6.232   2.689   1.00 0.00 ? 25  LEU A H    2  
ATOM 1882  H HA   . LEU A 1 25  ? -6.842  3.801   4.302   1.00 0.00 ? 25  LEU A HA   2  
ATOM 1883  H HB2  . LEU A 1 25  ? -6.256  2.742   2.392   1.00 0.00 ? 25  LEU A HB2  2  
ATOM 1884  H HB3  . LEU A 1 25  ? -5.483  4.152   1.697   1.00 0.00 ? 25  LEU A HB3  2  
ATOM 1885  H HG   . LEU A 1 25  ? -3.455  3.758   2.789   1.00 0.00 ? 25  LEU A HG   2  
ATOM 1886  H HD11 . LEU A 1 25  ? -5.122  2.664   4.877   1.00 0.00 ? 25  LEU A HD11 2  
ATOM 1887  H HD12 . LEU A 1 25  ? -3.767  1.567   4.517   1.00 0.00 ? 25  LEU A HD12 2  
ATOM 1888  H HD13 . LEU A 1 25  ? -3.448  3.264   4.952   1.00 0.00 ? 25  LEU A HD13 2  
ATOM 1889  H HD21 . LEU A 1 25  ? -3.379  1.025   2.610   1.00 0.00 ? 25  LEU A HD21 2  
ATOM 1890  H HD22 . LEU A 1 25  ? -4.772  1.428   1.577   1.00 0.00 ? 25  LEU A HD22 2  
ATOM 1891  H HD23 . LEU A 1 25  ? -3.181  2.156   1.250   1.00 0.00 ? 25  LEU A HD23 2  
ATOM 1892  N N    . SER A 1 26  ? -5.137  4.686   5.824   1.00 0.00 ? 26  SER A N    2  
ATOM 1893  C CA   . SER A 1 26  ? -4.219  5.261   6.792   1.00 0.00 ? 26  SER A CA   2  
ATOM 1894  C C    . SER A 1 26  ? -2.969  4.386   6.912   1.00 0.00 ? 26  SER A C    2  
ATOM 1895  O O    . SER A 1 26  ? -3.017  3.306   7.499   1.00 0.00 ? 26  SER A O    2  
ATOM 1896  C CB   . SER A 1 26  ? -4.887  5.421   8.159   1.00 0.00 ? 26  SER A CB   2  
ATOM 1897  O OG   . SER A 1 26  ? -5.767  6.542   8.194   1.00 0.00 ? 26  SER A OG   2  
ATOM 1898  H H    . SER A 1 26  ? -5.693  3.928   6.167   1.00 0.00 ? 26  SER A H    2  
ATOM 1899  H HA   . SER A 1 26  ? -3.961  6.243   6.397   1.00 0.00 ? 26  SER A HA   2  
ATOM 1900  H HB2  . SER A 1 26  ? -5.444  4.515   8.398   1.00 0.00 ? 26  SER A HB2  2  
ATOM 1901  H HB3  . SER A 1 26  ? -4.122  5.537   8.925   1.00 0.00 ? 26  SER A HB3  2  
ATOM 1902  H HG   . SER A 1 26  ? -5.371  7.270   8.753   1.00 0.00 ? 26  SER A HG   2  
ATOM 1903  N N    . ILE A 1 27  ? -1.880  4.885   6.346   1.00 0.00 ? 27  ILE A N    2  
ATOM 1904  C CA   . ILE A 1 27  ? -0.620  4.162   6.382   1.00 0.00 ? 27  ILE A CA   2  
ATOM 1905  C C    . ILE A 1 27  ? 0.096   4.460   7.701   1.00 0.00 ? 27  ILE A C    2  
ATOM 1906  O O    . ILE A 1 27  ? -0.346  5.308   8.474   1.00 0.00 ? 27  ILE A O    2  
ATOM 1907  C CB   . ILE A 1 27  ? 0.217   4.481   5.142   1.00 0.00 ? 27  ILE A CB   2  
ATOM 1908  C CG1  . ILE A 1 27  ? 0.738   5.919   5.187   1.00 0.00 ? 27  ILE A CG1  2  
ATOM 1909  C CG2  . ILE A 1 27  ? -0.570  4.197   3.861   1.00 0.00 ? 27  ILE A CG2  2  
ATOM 1910  C CD1  . ILE A 1 27  ? 1.881   6.120   4.191   1.00 0.00 ? 27  ILE A CD1  2  
ATOM 1911  H H    . ILE A 1 27  ? -1.849  5.764   5.871   1.00 0.00 ? 27  ILE A H    2  
ATOM 1912  H HA   . ILE A 1 27  ? -0.853  3.097   6.348   1.00 0.00 ? 27  ILE A HA   2  
ATOM 1913  H HB   . ILE A 1 27  ? 1.087   3.824   5.138   1.00 0.00 ? 27  ILE A HB   2  
ATOM 1914  H HG12 . ILE A 1 27  ? -0.074  6.611   4.959   1.00 0.00 ? 27  ILE A HG12 2  
ATOM 1915  H HG13 . ILE A 1 27  ? 1.082   6.154   6.194   1.00 0.00 ? 27  ILE A HG13 2  
ATOM 1916  H HG21 . ILE A 1 27  ? -1.572  4.617   3.949   1.00 0.00 ? 27  ILE A HG21 2  
ATOM 1917  H HG22 . ILE A 1 27  ? -0.059  4.651   3.012   1.00 0.00 ? 27  ILE A HG22 2  
ATOM 1918  H HG23 . ILE A 1 27  ? -0.640  3.119   3.709   1.00 0.00 ? 27  ILE A HG23 2  
ATOM 1919  H HD11 . ILE A 1 27  ? 1.536   6.735   3.360   1.00 0.00 ? 27  ILE A HD11 2  
ATOM 1920  H HD12 . ILE A 1 27  ? 2.714   6.617   4.690   1.00 0.00 ? 27  ILE A HD12 2  
ATOM 1921  H HD13 . ILE A 1 27  ? 2.209   5.151   3.814   1.00 0.00 ? 27  ILE A HD13 2  
ATOM 1922  N N    . VAL A 1 28  ? 1.192   3.746   7.917   1.00 0.00 ? 28  VAL A N    2  
ATOM 1923  C CA   . VAL A 1 28  ? 1.974   3.923   9.129   1.00 0.00 ? 28  VAL A CA   2  
ATOM 1924  C C    . VAL A 1 28  ? 3.386   3.380   8.903   1.00 0.00 ? 28  VAL A C    2  
ATOM 1925  O O    . VAL A 1 28  ? 3.584   2.168   8.830   1.00 0.00 ? 28  VAL A O    2  
ATOM 1926  C CB   . VAL A 1 28  ? 1.261   3.265   10.312  1.00 0.00 ? 28  VAL A CB   2  
ATOM 1927  C CG1  . VAL A 1 28  ? 2.112   2.141   10.907  1.00 0.00 ? 28  VAL A CG1  2  
ATOM 1928  C CG2  . VAL A 1 28  ? 0.898   4.300   11.378  1.00 0.00 ? 28  VAL A CG2  2  
ATOM 1929  H H    . VAL A 1 28  ? 1.545   3.058   7.283   1.00 0.00 ? 28  VAL A H    2  
ATOM 1930  H HA   . VAL A 1 28  ? 2.036   4.994   9.326   1.00 0.00 ? 28  VAL A HA   2  
ATOM 1931  H HB   . VAL A 1 28  ? 0.335   2.825   9.943   1.00 0.00 ? 28  VAL A HB   2  
ATOM 1932  H HG11 . VAL A 1 28  ? 1.670   1.810   11.847  1.00 0.00 ? 28  VAL A HG11 2  
ATOM 1933  H HG12 . VAL A 1 28  ? 2.149   1.305   10.209  1.00 0.00 ? 28  VAL A HG12 2  
ATOM 1934  H HG13 . VAL A 1 28  ? 3.122   2.507   11.090  1.00 0.00 ? 28  VAL A HG13 2  
ATOM 1935  H HG21 . VAL A 1 28  ? -0.113  4.667   11.198  1.00 0.00 ? 28  VAL A HG21 2  
ATOM 1936  H HG22 . VAL A 1 28  ? 0.947   3.839   12.364  1.00 0.00 ? 28  VAL A HG22 2  
ATOM 1937  H HG23 . VAL A 1 28  ? 1.600   5.132   11.331  1.00 0.00 ? 28  VAL A HG23 2  
ATOM 1938  N N    . ALA A 1 29  ? 4.331   4.303   8.799   1.00 0.00 ? 29  ALA A N    2  
ATOM 1939  C CA   . ALA A 1 29  ? 5.719   3.932   8.584   1.00 0.00 ? 29  ALA A CA   2  
ATOM 1940  C C    . ALA A 1 29  ? 6.481   5.132   8.018   1.00 0.00 ? 29  ALA A C    2  
ATOM 1941  O O    . ALA A 1 29  ? 6.003   6.263   8.085   1.00 0.00 ? 29  ALA A O    2  
ATOM 1942  C CB   . ALA A 1 29  ? 5.784   2.712   7.662   1.00 0.00 ? 29  ALA A CB   2  
ATOM 1943  H H    . ALA A 1 29  ? 4.161   5.287   8.860   1.00 0.00 ? 29  ALA A H    2  
ATOM 1944  H HA   . ALA A 1 29  ? 6.145   3.664   9.551   1.00 0.00 ? 29  ALA A HA   2  
ATOM 1945  H HB1  . ALA A 1 29  ? 4.834   2.600   7.140   1.00 0.00 ? 29  ALA A HB1  2  
ATOM 1946  H HB2  . ALA A 1 29  ? 6.584   2.849   6.935   1.00 0.00 ? 29  ALA A HB2  2  
ATOM 1947  H HB3  . ALA A 1 29  ? 5.981   1.819   8.255   1.00 0.00 ? 29  ALA A HB3  2  
ATOM 1948  N N    . ALA A 1 30  ? 7.654   4.844   7.474   1.00 0.00 ? 30  ALA A N    2  
ATOM 1949  C CA   . ALA A 1 30  ? 8.488   5.885   6.897   1.00 0.00 ? 30  ALA A CA   2  
ATOM 1950  C C    . ALA A 1 30  ? 9.783   5.263   6.371   1.00 0.00 ? 30  ALA A C    2  
ATOM 1951  O O    . ALA A 1 30  ? 9.777   4.141   5.866   1.00 0.00 ? 30  ALA A O    2  
ATOM 1952  C CB   . ALA A 1 30  ? 8.745   6.971   7.942   1.00 0.00 ? 30  ALA A CB   2  
ATOM 1953  H H    . ALA A 1 30  ? 8.036   3.921   7.423   1.00 0.00 ? 30  ALA A H    2  
ATOM 1954  H HA   . ALA A 1 30  ? 7.940   6.323   6.062   1.00 0.00 ? 30  ALA A HA   2  
ATOM 1955  H HB1  . ALA A 1 30  ? 8.707   7.951   7.466   1.00 0.00 ? 30  ALA A HB1  2  
ATOM 1956  H HB2  . ALA A 1 30  ? 7.982   6.916   8.719   1.00 0.00 ? 30  ALA A HB2  2  
ATOM 1957  H HB3  . ALA A 1 30  ? 9.728   6.822   8.388   1.00 0.00 ? 30  ALA A HB3  2  
ATOM 1958  N N    . LYS A 1 31  ? 10.863  6.019   6.508   1.00 0.00 ? 31  LYS A N    2  
ATOM 1959  C CA   . LYS A 1 31  ? 12.163  5.556   6.054   1.00 0.00 ? 31  LYS A CA   2  
ATOM 1960  C C    . LYS A 1 31  ? 13.200  6.656   6.284   1.00 0.00 ? 31  LYS A C    2  
ATOM 1961  O O    . LYS A 1 31  ? 13.193  7.676   5.596   1.00 0.00 ? 31  LYS A O    2  
ATOM 1962  C CB   . LYS A 1 31  ? 12.084  5.078   4.603   1.00 0.00 ? 31  LYS A CB   2  
ATOM 1963  C CG   . LYS A 1 31  ? 13.466  5.096   3.944   1.00 0.00 ? 31  LYS A CG   2  
ATOM 1964  C CD   . LYS A 1 31  ? 13.636  6.333   3.060   1.00 0.00 ? 31  LYS A CD   2  
ATOM 1965  C CE   . LYS A 1 31  ? 15.057  6.889   3.163   1.00 0.00 ? 31  LYS A CE   2  
ATOM 1966  N NZ   . LYS A 1 31  ? 15.633  7.093   1.815   1.00 0.00 ? 31  LYS A NZ   2  
ATOM 1967  H H    . LYS A 1 31  ? 10.859  6.930   6.920   1.00 0.00 ? 31  LYS A H    2  
ATOM 1968  H HA   . LYS A 1 31  ? 12.433  4.693   6.663   1.00 0.00 ? 31  LYS A HA   2  
ATOM 1969  H HB2  . LYS A 1 31  ? 11.674  4.069   4.569   1.00 0.00 ? 31  LYS A HB2  2  
ATOM 1970  H HB3  . LYS A 1 31  ? 11.402  5.718   4.042   1.00 0.00 ? 31  LYS A HB3  2  
ATOM 1971  H HG2  . LYS A 1 31  ? 14.239  5.085   4.713   1.00 0.00 ? 31  LYS A HG2  2  
ATOM 1972  H HG3  . LYS A 1 31  ? 13.598  4.195   3.345   1.00 0.00 ? 31  LYS A HG3  2  
ATOM 1973  H HD2  . LYS A 1 31  ? 13.416  6.076   2.023   1.00 0.00 ? 31  LYS A HD2  2  
ATOM 1974  H HD3  . LYS A 1 31  ? 12.919  7.098   3.357   1.00 0.00 ? 31  LYS A HD3  2  
ATOM 1975  H HE2  . LYS A 1 31  ? 15.046  7.834   3.707   1.00 0.00 ? 31  LYS A HE2  2  
ATOM 1976  H HE3  . LYS A 1 31  ? 15.683  6.201   3.732   1.00 0.00 ? 31  LYS A HE3  2  
ATOM 1977  H HZ1  . LYS A 1 31  ? 15.502  6.266   1.268   1.00 0.00 ? 31  LYS A HZ1  2  
ATOM 1978  H HZ2  . LYS A 1 31  ? 15.177  7.863   1.371   1.00 0.00 ? 31  LYS A HZ2  2  
ATOM 1979  H HZ3  . LYS A 1 31  ? 16.611  7.287   1.897   1.00 0.00 ? 31  LYS A HZ3  2  
ATOM 1980  N N    . GLY A 1 32  ? 14.069  6.413   7.255   1.00 0.00 ? 32  GLY A N    2  
ATOM 1981  C CA   . GLY A 1 32  ? 15.110  7.371   7.585   1.00 0.00 ? 32  GLY A CA   2  
ATOM 1982  C C    . GLY A 1 32  ? 15.204  7.581   9.097   1.00 0.00 ? 32  GLY A C    2  
ATOM 1983  O O    . GLY A 1 32  ? 14.257  7.291   9.827   1.00 0.00 ? 32  GLY A O    2  
ATOM 1984  H H    . GLY A 1 32  ? 14.068  5.581   7.810   1.00 0.00 ? 32  GLY A H    2  
ATOM 1985  H HA2  . GLY A 1 32  ? 16.068  7.017   7.203   1.00 0.00 ? 32  GLY A HA2  2  
ATOM 1986  H HA3  . GLY A 1 32  ? 14.904  8.322   7.094   1.00 0.00 ? 32  GLY A HA3  2  
ATOM 1987  N N    . ALA A 1 33  ? 16.353  8.083   9.523   1.00 0.00 ? 33  ALA A N    2  
ATOM 1988  C CA   . ALA A 1 33  ? 16.582  8.335   10.936  1.00 0.00 ? 33  ALA A CA   2  
ATOM 1989  C C    . ALA A 1 33  ? 16.435  7.026   11.713  1.00 0.00 ? 33  ALA A C    2  
ATOM 1990  O O    . ALA A 1 33  ? 15.813  6.997   12.775  1.00 0.00 ? 33  ALA A O    2  
ATOM 1991  C CB   . ALA A 1 33  ? 15.616  9.416   11.425  1.00 0.00 ? 33  ALA A CB   2  
ATOM 1992  H H    . ALA A 1 33  ? 17.118  8.316   8.923   1.00 0.00 ? 33  ALA A H    2  
ATOM 1993  H HA   . ALA A 1 33  ? 17.603  8.701   11.046  1.00 0.00 ? 33  ALA A HA   2  
ATOM 1994  H HB1  . ALA A 1 33  ? 16.179  10.212  11.913  1.00 0.00 ? 33  ALA A HB1  2  
ATOM 1995  H HB2  . ALA A 1 33  ? 15.069  9.826   10.576  1.00 0.00 ? 33  ALA A HB2  2  
ATOM 1996  H HB3  . ALA A 1 33  ? 14.913  8.981   12.135  1.00 0.00 ? 33  ALA A HB3  2  
ATOM 1997  N N    . GLY A 1 34  ? 17.016  5.974   11.155  1.00 0.00 ? 34  GLY A N    2  
ATOM 1998  C CA   . GLY A 1 34  ? 16.957  4.665   11.783  1.00 0.00 ? 34  GLY A CA   2  
ATOM 1999  C C    . GLY A 1 34  ? 17.670  3.615   10.930  1.00 0.00 ? 34  GLY A C    2  
ATOM 2000  O O    . GLY A 1 34  ? 18.867  3.383   11.097  1.00 0.00 ? 34  GLY A O    2  
ATOM 2001  H H    . GLY A 1 34  ? 17.519  6.006   10.292  1.00 0.00 ? 34  GLY A H    2  
ATOM 2002  H HA2  . GLY A 1 34  ? 17.416  4.711   12.771  1.00 0.00 ? 34  GLY A HA2  2  
ATOM 2003  H HA3  . GLY A 1 34  ? 15.916  4.375   11.929  1.00 0.00 ? 34  GLY A HA3  2  
ATOM 2004  N N    . GLN A 1 35  ? 16.906  3.008   10.034  1.00 0.00 ? 35  GLN A N    2  
ATOM 2005  C CA   . GLN A 1 35  ? 17.450  1.988   9.154   1.00 0.00 ? 35  GLN A CA   2  
ATOM 2006  C C    . GLN A 1 35  ? 17.432  2.473   7.703   1.00 0.00 ? 35  GLN A C    2  
ATOM 2007  O O    . GLN A 1 35  ? 17.851  1.753   6.798   1.00 0.00 ? 35  GLN A O    2  
ATOM 2008  C CB   . GLN A 1 35  ? 16.685  0.672   9.302   1.00 0.00 ? 35  GLN A CB   2  
ATOM 2009  C CG   . GLN A 1 35  ? 15.229  0.831   8.858   1.00 0.00 ? 35  GLN A CG   2  
ATOM 2010  C CD   . GLN A 1 35  ? 14.384  -0.361  9.313   1.00 0.00 ? 35  GLN A CD   2  
ATOM 2011  O OE1  . GLN A 1 35  ? 14.650  -1.505  8.984   1.00 0.00 ? 35  GLN A OE1  2  
ATOM 2012  N NE2  . GLN A 1 35  ? 13.353  -0.030  10.085  1.00 0.00 ? 35  GLN A NE2  2  
ATOM 2013  H H    . GLN A 1 35  ? 15.934  3.203   9.904   1.00 0.00 ? 35  GLN A H    2  
ATOM 2014  H HA   . GLN A 1 35  ? 18.479  1.842   9.482   1.00 0.00 ? 35  GLN A HA   2  
ATOM 2015  H HB2  . GLN A 1 35  ? 17.168  -0.103  8.705   1.00 0.00 ? 35  GLN A HB2  2  
ATOM 2016  H HB3  . GLN A 1 35  ? 16.719  0.341   10.340  1.00 0.00 ? 35  GLN A HB3  2  
ATOM 2017  H HG2  . GLN A 1 35  ? 14.818  1.752   9.272   1.00 0.00 ? 35  GLN A HG2  2  
ATOM 2018  H HG3  . GLN A 1 35  ? 15.184  0.921   7.773   1.00 0.00 ? 35  GLN A HG3  2  
ATOM 2019  H HE21 . GLN A 1 35  ? 13.191  0.929   10.318  1.00 0.00 ? 35  GLN A HE21 2  
ATOM 2020  H HE22 . GLN A 1 35  ? 12.741  -0.740  10.434  1.00 0.00 ? 35  GLN A HE22 2  
ATOM 2021  N N    . ASP A 1 36  ? 16.941  3.691   7.526   1.00 0.00 ? 36  ASP A N    2  
ATOM 2022  C CA   . ASP A 1 36  ? 16.862  4.281   6.201   1.00 0.00 ? 36  ASP A CA   2  
ATOM 2023  C C    . ASP A 1 36  ? 16.013  3.385   5.298   1.00 0.00 ? 36  ASP A C    2  
ATOM 2024  O O    . ASP A 1 36  ? 16.283  3.266   4.104   1.00 0.00 ? 36  ASP A O    2  
ATOM 2025  C CB   . ASP A 1 36  ? 18.251  4.407   5.570   1.00 0.00 ? 36  ASP A CB   2  
ATOM 2026  C CG   . ASP A 1 36  ? 18.559  5.771   4.951   1.00 0.00 ? 36  ASP A CG   2  
ATOM 2027  O OD1  . ASP A 1 36  ? 17.612  6.582   4.865   1.00 0.00 ? 36  ASP A OD1  2  
ATOM 2028  O OD2  . ASP A 1 36  ? 19.735  5.973   4.577   1.00 0.00 ? 36  ASP A OD2  2  
ATOM 2029  H H    . ASP A 1 36  ? 16.602  4.271   8.268   1.00 0.00 ? 36  ASP A H    2  
ATOM 2030  H HA   . ASP A 1 36  ? 16.417  5.265   6.351   1.00 0.00 ? 36  ASP A HA   2  
ATOM 2031  H HB2  . ASP A 1 36  ? 19.000  4.193   6.333   1.00 0.00 ? 36  ASP A HB2  2  
ATOM 2032  H HB3  . ASP A 1 36  ? 18.354  3.643   4.800   1.00 0.00 ? 36  ASP A HB3  2  
ATOM 2033  N N    . LYS A 1 37  ? 15.003  2.777   5.903   1.00 0.00 ? 37  LYS A N    2  
ATOM 2034  C CA   . LYS A 1 37  ? 14.112  1.896   5.169   1.00 0.00 ? 37  LYS A CA   2  
ATOM 2035  C C    . LYS A 1 37  ? 13.119  1.256   6.141   1.00 0.00 ? 37  LYS A C    2  
ATOM 2036  O O    . LYS A 1 37  ? 13.309  0.118   6.569   1.00 0.00 ? 37  LYS A O    2  
ATOM 2037  C CB   . LYS A 1 37  ? 14.915  0.880   4.353   1.00 0.00 ? 37  LYS A CB   2  
ATOM 2038  C CG   . LYS A 1 37  ? 14.452  0.860   2.895   1.00 0.00 ? 37  LYS A CG   2  
ATOM 2039  C CD   . LYS A 1 37  ? 15.646  0.767   1.942   1.00 0.00 ? 37  LYS A CD   2  
ATOM 2040  C CE   . LYS A 1 37  ? 15.331  -0.147  0.756   1.00 0.00 ? 37  LYS A CE   2  
ATOM 2041  N NZ   . LYS A 1 37  ? 15.651  -1.554  1.086   1.00 0.00 ? 37  LYS A NZ   2  
ATOM 2042  H H    . LYS A 1 37  ? 14.790  2.880   6.875   1.00 0.00 ? 37  LYS A H    2  
ATOM 2043  H HA   . LYS A 1 37  ? 13.555  2.509   4.461   1.00 0.00 ? 37  LYS A HA   2  
ATOM 2044  H HB2  . LYS A 1 37  ? 15.975  1.129   4.398   1.00 0.00 ? 37  LYS A HB2  2  
ATOM 2045  H HB3  . LYS A 1 37  ? 14.802  -0.112  4.788   1.00 0.00 ? 37  LYS A HB3  2  
ATOM 2046  H HG2  . LYS A 1 37  ? 13.786  0.012   2.733   1.00 0.00 ? 37  LYS A HG2  2  
ATOM 2047  H HG3  . LYS A 1 37  ? 13.879  1.761   2.679   1.00 0.00 ? 37  LYS A HG3  2  
ATOM 2048  H HD2  . LYS A 1 37  ? 15.905  1.762   1.581   1.00 0.00 ? 37  LYS A HD2  2  
ATOM 2049  H HD3  . LYS A 1 37  ? 16.515  0.386   2.478   1.00 0.00 ? 37  LYS A HD3  2  
ATOM 2050  H HE2  . LYS A 1 37  ? 14.277  -0.060  0.492   1.00 0.00 ? 37  LYS A HE2  2  
ATOM 2051  H HE3  . LYS A 1 37  ? 15.905  0.168   -0.116  1.00 0.00 ? 37  LYS A HE3  2  
ATOM 2052  H HZ1  . LYS A 1 37  ? 14.848  -2.126  0.922   1.00 0.00 ? 37  LYS A HZ1  2  
ATOM 2053  H HZ2  . LYS A 1 37  ? 16.407  -1.867  0.511   1.00 0.00 ? 37  LYS A HZ2  2  
ATOM 2054  H HZ3  . LYS A 1 37  ? 15.915  -1.618  2.049   1.00 0.00 ? 37  LYS A HZ3  2  
ATOM 2055  N N    . LEU A 1 38  ? 12.081  2.014   6.461   1.00 0.00 ? 38  LEU A N    2  
ATOM 2056  C CA   . LEU A 1 38  ? 11.058  1.535   7.376   1.00 0.00 ? 38  LEU A CA   2  
ATOM 2057  C C    . LEU A 1 38  ? 9.959   0.828   6.579   1.00 0.00 ? 38  LEU A C    2  
ATOM 2058  O O    . LEU A 1 38  ? 9.469   1.359   5.584   1.00 0.00 ? 38  LEU A O    2  
ATOM 2059  C CB   . LEU A 1 38  ? 10.543  2.679   8.251   1.00 0.00 ? 38  LEU A CB   2  
ATOM 2060  C CG   . LEU A 1 38  ? 10.074  2.291   9.655   1.00 0.00 ? 38  LEU A CG   2  
ATOM 2061  C CD1  . LEU A 1 38  ? 10.406  3.390   10.667  1.00 0.00 ? 38  LEU A CD1  2  
ATOM 2062  C CD2  . LEU A 1 38  ? 8.586   1.939   9.658   1.00 0.00 ? 38  LEU A CD2  2  
ATOM 2063  H H    . LEU A 1 38  ? 11.933  2.938   6.109   1.00 0.00 ? 38  LEU A H    2  
ATOM 2064  H HA   . LEU A 1 38  ? 11.526  0.808   8.038   1.00 0.00 ? 38  LEU A HA   2  
ATOM 2065  H HB2  . LEU A 1 38  ? 11.335  3.422   8.346   1.00 0.00 ? 38  LEU A HB2  2  
ATOM 2066  H HB3  . LEU A 1 38  ? 9.714   3.162   7.733   1.00 0.00 ? 38  LEU A HB3  2  
ATOM 2067  H HG   . LEU A 1 38  ? 10.617  1.397   9.962   1.00 0.00 ? 38  LEU A HG   2  
ATOM 2068  H HD11 . LEU A 1 38  ? 11.408  3.772   10.474  1.00 0.00 ? 38  LEU A HD11 2  
ATOM 2069  H HD12 . LEU A 1 38  ? 9.684   4.201   10.572  1.00 0.00 ? 38  LEU A HD12 2  
ATOM 2070  H HD13 . LEU A 1 38  ? 10.361  2.980   11.676  1.00 0.00 ? 38  LEU A HD13 2  
ATOM 2071  H HD21 . LEU A 1 38  ? 8.019   2.759   10.101  1.00 0.00 ? 38  LEU A HD21 2  
ATOM 2072  H HD22 . LEU A 1 38  ? 8.249   1.776   8.634   1.00 0.00 ? 38  LEU A HD22 2  
ATOM 2073  H HD23 . LEU A 1 38  ? 8.428   1.032   10.241  1.00 0.00 ? 38  LEU A HD23 2  
ATOM 2074  N N    . GLY A 1 39  ? 9.604   -0.360  7.048   1.00 0.00 ? 39  GLY A N    2  
ATOM 2075  C CA   . GLY A 1 39  ? 8.573   -1.145  6.392   1.00 0.00 ? 39  GLY A CA   2  
ATOM 2076  C C    . GLY A 1 39  ? 7.230   -0.412  6.412   1.00 0.00 ? 39  GLY A C    2  
ATOM 2077  O O    . GLY A 1 39  ? 6.689   -0.128  7.480   1.00 0.00 ? 39  GLY A O    2  
ATOM 2078  H H    . GLY A 1 39  ? 10.008  -0.785  7.858   1.00 0.00 ? 39  GLY A H    2  
ATOM 2079  H HA2  . GLY A 1 39  ? 8.865   -1.348  5.361   1.00 0.00 ? 39  GLY A HA2  2  
ATOM 2080  H HA3  . GLY A 1 39  ? 8.472   -2.109  6.890   1.00 0.00 ? 39  GLY A HA3  2  
ATOM 2081  N N    . ILE A 1 40  ? 6.730   -0.126  5.218   1.00 0.00 ? 40  ILE A N    2  
ATOM 2082  C CA   . ILE A 1 40  ? 5.461   0.568   5.085   1.00 0.00 ? 40  ILE A CA   2  
ATOM 2083  C C    . ILE A 1 40  ? 4.329   -0.353  5.545   1.00 0.00 ? 40  ILE A C    2  
ATOM 2084  O O    . ILE A 1 40  ? 4.058   -1.372  4.912   1.00 0.00 ? 40  ILE A O    2  
ATOM 2085  C CB   . ILE A 1 40  ? 5.284   1.094   3.659   1.00 0.00 ? 40  ILE A CB   2  
ATOM 2086  C CG1  . ILE A 1 40  ? 6.311   2.184   3.346   1.00 0.00 ? 40  ILE A CG1  2  
ATOM 2087  C CG2  . ILE A 1 40  ? 3.850   1.573   3.425   1.00 0.00 ? 40  ILE A CG2  2  
ATOM 2088  C CD1  . ILE A 1 40  ? 5.967   3.486   4.071   1.00 0.00 ? 40  ILE A CD1  2  
ATOM 2089  H H    . ILE A 1 40  ? 7.176   -0.360  4.355   1.00 0.00 ? 40  ILE A H    2  
ATOM 2090  H HA   . ILE A 1 40  ? 5.491   1.434   5.747   1.00 0.00 ? 40  ILE A HA   2  
ATOM 2091  H HB   . ILE A 1 40  ? 5.466   0.272   2.967   1.00 0.00 ? 40  ILE A HB   2  
ATOM 2092  H HG12 . ILE A 1 40  ? 7.305   1.849   3.644   1.00 0.00 ? 40  ILE A HG12 2  
ATOM 2093  H HG13 . ILE A 1 40  ? 6.344   2.360   2.271   1.00 0.00 ? 40  ILE A HG13 2  
ATOM 2094  H HG21 . ILE A 1 40  ? 3.179   0.715   3.404   1.00 0.00 ? 40  ILE A HG21 2  
ATOM 2095  H HG22 . ILE A 1 40  ? 3.555   2.245   4.231   1.00 0.00 ? 40  ILE A HG22 2  
ATOM 2096  H HG23 . ILE A 1 40  ? 3.795   2.102   2.473   1.00 0.00 ? 40  ILE A HG23 2  
ATOM 2097  H HD11 . ILE A 1 40  ? 6.885   4.031   4.294   1.00 0.00 ? 40  ILE A HD11 2  
ATOM 2098  H HD12 . ILE A 1 40  ? 5.327   4.098   3.435   1.00 0.00 ? 40  ILE A HD12 2  
ATOM 2099  H HD13 . ILE A 1 40  ? 5.445   3.258   5.000   1.00 0.00 ? 40  ILE A HD13 2  
ATOM 2100  N N    . TYR A 1 41  ? 3.700   0.038   6.644   1.00 0.00 ? 41  TYR A N    2  
ATOM 2101  C CA   . TYR A 1 41  ? 2.604   -0.740  7.196   1.00 0.00 ? 41  TYR A CA   2  
ATOM 2102  C C    . TYR A 1 41  ? 1.387   0.145   7.471   1.00 0.00 ? 41  TYR A C    2  
ATOM 2103  O O    . TYR A 1 41  ? 1.495   1.159   8.158   1.00 0.00 ? 41  TYR A O    2  
ATOM 2104  C CB   . TYR A 1 41  ? 3.116   -1.309  8.521   1.00 0.00 ? 41  TYR A CB   2  
ATOM 2105  C CG   . TYR A 1 41  ? 2.080   -2.135  9.285   1.00 0.00 ? 41  TYR A CG   2  
ATOM 2106  C CD1  . TYR A 1 41  ? 0.980   -1.516  9.844   1.00 0.00 ? 41  TYR A CD1  2  
ATOM 2107  C CD2  . TYR A 1 41  ? 2.245   -3.499  9.416   1.00 0.00 ? 41  TYR A CD2  2  
ATOM 2108  C CE1  . TYR A 1 41  ? 0.005   -2.294  10.564  1.00 0.00 ? 41  TYR A CE1  2  
ATOM 2109  C CE2  . TYR A 1 41  ? 1.270   -4.276  10.136  1.00 0.00 ? 41  TYR A CE2  2  
ATOM 2110  C CZ   . TYR A 1 41  ? 0.198   -3.635  10.674  1.00 0.00 ? 41  TYR A CZ   2  
ATOM 2111  O OH   . TYR A 1 41  ? -0.723  -4.370  11.354  1.00 0.00 ? 41  TYR A OH   2  
ATOM 2112  H H    . TYR A 1 41  ? 3.927   0.868   7.153   1.00 0.00 ? 41  TYR A H    2  
ATOM 2113  H HA   . TYR A 1 41  ? 2.332   -1.503  6.466   1.00 0.00 ? 41  TYR A HA   2  
ATOM 2114  H HB2  . TYR A 1 41  ? 3.989   -1.932  8.324   1.00 0.00 ? 41  TYR A HB2  2  
ATOM 2115  H HB3  . TYR A 1 41  ? 3.448   -0.486  9.153   1.00 0.00 ? 41  TYR A HB3  2  
ATOM 2116  H HD1  . TYR A 1 41  ? 0.850   -0.439  9.741   1.00 0.00 ? 41  TYR A HD1  2  
ATOM 2117  H HD2  . TYR A 1 41  ? 3.114   -3.988  8.975   1.00 0.00 ? 41  TYR A HD2  2  
ATOM 2118  H HE1  . TYR A 1 41  ? -0.868  -1.818  11.010  1.00 0.00 ? 41  TYR A HE1  2  
ATOM 2119  H HE2  . TYR A 1 41  ? 1.388   -5.354  10.247  1.00 0.00 ? 41  TYR A HE2  2  
ATOM 2120  H HH   . TYR A 1 41  ? -1.473  -4.627  10.744  1.00 0.00 ? 41  TYR A HH   2  
ATOM 2121  N N    . VAL A 1 42  ? 0.256   -0.271  6.920   1.00 0.00 ? 42  VAL A N    2  
ATOM 2122  C CA   . VAL A 1 42  ? -0.981  0.471   7.097   1.00 0.00 ? 42  VAL A CA   2  
ATOM 2123  C C    . VAL A 1 42  ? -1.432  0.360   8.555   1.00 0.00 ? 42  VAL A C    2  
ATOM 2124  O O    . VAL A 1 42  ? -1.424  -0.727  9.130   1.00 0.00 ? 42  VAL A O    2  
ATOM 2125  C CB   . VAL A 1 42  ? -2.035  -0.024  6.105   1.00 0.00 ? 42  VAL A CB   2  
ATOM 2126  C CG1  . VAL A 1 42  ? -3.437  0.422   6.527   1.00 0.00 ? 42  VAL A CG1  2  
ATOM 2127  C CG2  . VAL A 1 42  ? -1.714  0.445   4.685   1.00 0.00 ? 42  VAL A CG2  2  
ATOM 2128  H H    . VAL A 1 42  ? 0.176   -1.097  6.362   1.00 0.00 ? 42  VAL A H    2  
ATOM 2129  H HA   . VAL A 1 42  ? -0.771  1.517   6.873   1.00 0.00 ? 42  VAL A HA   2  
ATOM 2130  H HB   . VAL A 1 42  ? -2.015  -1.114  6.111   1.00 0.00 ? 42  VAL A HB   2  
ATOM 2131  H HG11 . VAL A 1 42  ? -3.515  1.506   6.438   1.00 0.00 ? 42  VAL A HG11 2  
ATOM 2132  H HG12 . VAL A 1 42  ? -4.178  -0.050  5.882   1.00 0.00 ? 42  VAL A HG12 2  
ATOM 2133  H HG13 . VAL A 1 42  ? -3.615  0.129   7.561   1.00 0.00 ? 42  VAL A HG13 2  
ATOM 2134  H HG21 . VAL A 1 42  ? -2.384  -0.047  3.980   1.00 0.00 ? 42  VAL A HG21 2  
ATOM 2135  H HG22 . VAL A 1 42  ? -1.848  1.525   4.620   1.00 0.00 ? 42  VAL A HG22 2  
ATOM 2136  H HG23 . VAL A 1 42  ? -0.682  0.192   4.443   1.00 0.00 ? 42  VAL A HG23 2  
ATOM 2137  N N    . LYS A 1 43  ? -1.816  1.500   9.110   1.00 0.00 ? 43  LYS A N    2  
ATOM 2138  C CA   . LYS A 1 43  ? -2.270  1.545   10.490  1.00 0.00 ? 43  LYS A CA   2  
ATOM 2139  C C    . LYS A 1 43  ? -3.788  1.358   10.528  1.00 0.00 ? 43  LYS A C    2  
ATOM 2140  O O    . LYS A 1 43  ? -4.320  0.762   11.464  1.00 0.00 ? 43  LYS A O    2  
ATOM 2141  C CB   . LYS A 1 43  ? -1.792  2.829   11.170  1.00 0.00 ? 43  LYS A CB   2  
ATOM 2142  C CG   . LYS A 1 43  ? -2.762  3.261   12.272  1.00 0.00 ? 43  LYS A CG   2  
ATOM 2143  C CD   . LYS A 1 43  ? -3.758  4.299   11.750  1.00 0.00 ? 43  LYS A CD   2  
ATOM 2144  C CE   . LYS A 1 43  ? -4.237  5.214   12.878  1.00 0.00 ? 43  LYS A CE   2  
ATOM 2145  N NZ   . LYS A 1 43  ? -3.477  6.484   12.873  1.00 0.00 ? 43  LYS A NZ   2  
ATOM 2146  H H    . LYS A 1 43  ? -1.820  2.380   8.635   1.00 0.00 ? 43  LYS A H    2  
ATOM 2147  H HA   . LYS A 1 43  ? -1.806  0.710   11.014  1.00 0.00 ? 43  LYS A HA   2  
ATOM 2148  H HB2  . LYS A 1 43  ? -0.800  2.673   11.595  1.00 0.00 ? 43  LYS A HB2  2  
ATOM 2149  H HB3  . LYS A 1 43  ? -1.699  3.624   10.430  1.00 0.00 ? 43  LYS A HB3  2  
ATOM 2150  H HG2  . LYS A 1 43  ? -3.301  2.391   12.647  1.00 0.00 ? 43  LYS A HG2  2  
ATOM 2151  H HG3  . LYS A 1 43  ? -2.204  3.676   13.110  1.00 0.00 ? 43  LYS A HG3  2  
ATOM 2152  H HD2  . LYS A 1 43  ? -3.290  4.895   10.967  1.00 0.00 ? 43  LYS A HD2  2  
ATOM 2153  H HD3  . LYS A 1 43  ? -4.612  3.794   11.299  1.00 0.00 ? 43  LYS A HD3  2  
ATOM 2154  H HE2  . LYS A 1 43  ? -5.301  5.420   12.761  1.00 0.00 ? 43  LYS A HE2  2  
ATOM 2155  H HE3  . LYS A 1 43  ? -4.113  4.713   13.838  1.00 0.00 ? 43  LYS A HE3  2  
ATOM 2156  H HZ1  . LYS A 1 43  ? -2.710  6.416   13.511  1.00 0.00 ? 43  LYS A HZ1  2  
ATOM 2157  H HZ2  . LYS A 1 43  ? -3.130  6.662   11.952  1.00 0.00 ? 43  LYS A HZ2  2  
ATOM 2158  H HZ3  . LYS A 1 43  ? -4.078  7.233   13.154  1.00 0.00 ? 43  LYS A HZ3  2  
ATOM 2159  N N    . SER A 1 44  ? -4.443  1.876   9.500   1.00 0.00 ? 44  SER A N    2  
ATOM 2160  C CA   . SER A 1 44  ? -5.890  1.774   9.405   1.00 0.00 ? 44  SER A CA   2  
ATOM 2161  C C    . SER A 1 44  ? -6.360  2.261   8.033   1.00 0.00 ? 44  SER A C    2  
ATOM 2162  O O    . SER A 1 44  ? -5.566  2.356   7.098   1.00 0.00 ? 44  SER A O    2  
ATOM 2163  C CB   . SER A 1 44  ? -6.573  2.574   10.516  1.00 0.00 ? 44  SER A CB   2  
ATOM 2164  O OG   . SER A 1 44  ? -6.536  3.976   10.264  1.00 0.00 ? 44  SER A OG   2  
ATOM 2165  H H    . SER A 1 44  ? -4.003  2.359   8.743   1.00 0.00 ? 44  SER A H    2  
ATOM 2166  H HA   . SER A 1 44  ? -6.112  0.714   9.531   1.00 0.00 ? 44  SER A HA   2  
ATOM 2167  H HB2  . SER A 1 44  ? -7.609  2.250   10.611  1.00 0.00 ? 44  SER A HB2  2  
ATOM 2168  H HB3  . SER A 1 44  ? -6.085  2.363   11.467  1.00 0.00 ? 44  SER A HB3  2  
ATOM 2169  H HG   . SER A 1 44  ? -7.444  4.300   9.999   1.00 0.00 ? 44  SER A HG   2  
ATOM 2170  N N    . VAL A 1 45  ? -7.649  2.558   7.956   1.00 0.00 ? 45  VAL A N    2  
ATOM 2171  C CA   . VAL A 1 45  ? -8.234  3.034   6.714   1.00 0.00 ? 45  VAL A CA   2  
ATOM 2172  C C    . VAL A 1 45  ? -9.343  4.039   7.030   1.00 0.00 ? 45  VAL A C    2  
ATOM 2173  O O    . VAL A 1 45  ? -10.103 3.852   7.979   1.00 0.00 ? 45  VAL A O    2  
ATOM 2174  C CB   . VAL A 1 45  ? -8.721  1.849   5.878   1.00 0.00 ? 45  VAL A CB   2  
ATOM 2175  C CG1  . VAL A 1 45  ? -7.554  1.165   5.163   1.00 0.00 ? 45  VAL A CG1  2  
ATOM 2176  C CG2  . VAL A 1 45  ? -9.497  0.851   6.740   1.00 0.00 ? 45  VAL A CG2  2  
ATOM 2177  H H    . VAL A 1 45  ? -8.288  2.478   8.721   1.00 0.00 ? 45  VAL A H    2  
ATOM 2178  H HA   . VAL A 1 45  ? -7.449  3.542   6.154   1.00 0.00 ? 45  VAL A HA   2  
ATOM 2179  H HB   . VAL A 1 45  ? -9.401  2.233   5.117   1.00 0.00 ? 45  VAL A HB   2  
ATOM 2180  H HG11 . VAL A 1 45  ? -6.817  0.841   5.899   1.00 0.00 ? 45  VAL A HG11 2  
ATOM 2181  H HG12 . VAL A 1 45  ? -7.922  0.299   4.613   1.00 0.00 ? 45  VAL A HG12 2  
ATOM 2182  H HG13 . VAL A 1 45  ? -7.091  1.867   4.470   1.00 0.00 ? 45  VAL A HG13 2  
ATOM 2183  H HG21 . VAL A 1 45  ? -8.814  0.090   7.118   1.00 0.00 ? 45  VAL A HG21 2  
ATOM 2184  H HG22 . VAL A 1 45  ? -9.956  1.375   7.578   1.00 0.00 ? 45  VAL A HG22 2  
ATOM 2185  H HG23 . VAL A 1 45  ? -10.273 0.377   6.139   1.00 0.00 ? 45  VAL A HG23 2  
ATOM 2186  N N    . VAL A 1 46  ? -9.402  5.083   6.217   1.00 0.00 ? 46  VAL A N    2  
ATOM 2187  C CA   . VAL A 1 46  ? -10.406 6.118   6.398   1.00 0.00 ? 46  VAL A CA   2  
ATOM 2188  C C    . VAL A 1 46  ? -11.794 5.476   6.423   1.00 0.00 ? 46  VAL A C    2  
ATOM 2189  O O    . VAL A 1 46  ? -12.756 6.087   6.885   1.00 0.00 ? 46  VAL A O    2  
ATOM 2190  C CB   . VAL A 1 46  ? -10.259 7.184   5.311   1.00 0.00 ? 46  VAL A CB   2  
ATOM 2191  C CG1  . VAL A 1 46  ? -11.524 8.039   5.208   1.00 0.00 ? 46  VAL A CG1  2  
ATOM 2192  C CG2  . VAL A 1 46  ? -9.027  8.056   5.560   1.00 0.00 ? 46  VAL A CG2  2  
ATOM 2193  H H    . VAL A 1 46  ? -8.780  5.227   5.447   1.00 0.00 ? 46  VAL A H    2  
ATOM 2194  H HA   . VAL A 1 46  ? -10.220 6.591   7.362   1.00 0.00 ? 46  VAL A HA   2  
ATOM 2195  H HB   . VAL A 1 46  ? -10.122 6.674   4.357   1.00 0.00 ? 46  VAL A HB   2  
ATOM 2196  H HG11 . VAL A 1 46  ? -11.608 8.671   6.093   1.00 0.00 ? 46  VAL A HG11 2  
ATOM 2197  H HG12 . VAL A 1 46  ? -11.468 8.666   4.318   1.00 0.00 ? 46  VAL A HG12 2  
ATOM 2198  H HG13 . VAL A 1 46  ? -12.397 7.390   5.141   1.00 0.00 ? 46  VAL A HG13 2  
ATOM 2199  H HG21 . VAL A 1 46  ? -8.707  7.944   6.596   1.00 0.00 ? 46  VAL A HG21 2  
ATOM 2200  H HG22 . VAL A 1 46  ? -8.221  7.744   4.895   1.00 0.00 ? 46  VAL A HG22 2  
ATOM 2201  H HG23 . VAL A 1 46  ? -9.274  9.099   5.366   1.00 0.00 ? 46  VAL A HG23 2  
ATOM 2202  N N    . LYS A 1 47  ? -11.855 4.252   5.920   1.00 0.00 ? 47  LYS A N    2  
ATOM 2203  C CA   . LYS A 1 47  ? -13.110 3.521   5.878   1.00 0.00 ? 47  LYS A CA   2  
ATOM 2204  C C    . LYS A 1 47  ? -14.118 4.295   5.027   1.00 0.00 ? 47  LYS A C    2  
ATOM 2205  O O    . LYS A 1 47  ? -15.294 4.381   5.377   1.00 0.00 ? 47  LYS A O    2  
ATOM 2206  C CB   . LYS A 1 47  ? -13.603 3.222   7.296   1.00 0.00 ? 47  LYS A CB   2  
ATOM 2207  C CG   . LYS A 1 47  ? -12.853 2.032   7.898   1.00 0.00 ? 47  LYS A CG   2  
ATOM 2208  C CD   . LYS A 1 47  ? -12.410 2.331   9.332   1.00 0.00 ? 47  LYS A CD   2  
ATOM 2209  C CE   . LYS A 1 47  ? -13.388 1.731   10.344  1.00 0.00 ? 47  LYS A CE   2  
ATOM 2210  N NZ   . LYS A 1 47  ? -13.008 2.114   11.722  1.00 0.00 ? 47  LYS A NZ   2  
ATOM 2211  H H    . LYS A 1 47  ? -11.068 3.762   5.545   1.00 0.00 ? 47  LYS A H    2  
ATOM 2212  H HA   . LYS A 1 47  ? -12.914 2.563   5.397   1.00 0.00 ? 47  LYS A HA   2  
ATOM 2213  H HB2  . LYS A 1 47  ? -13.464 4.100   7.926   1.00 0.00 ? 47  LYS A HB2  2  
ATOM 2214  H HB3  . LYS A 1 47  ? -14.672 3.011   7.276   1.00 0.00 ? 47  LYS A HB3  2  
ATOM 2215  H HG2  . LYS A 1 47  ? -13.494 1.151   7.888   1.00 0.00 ? 47  LYS A HG2  2  
ATOM 2216  H HG3  . LYS A 1 47  ? -11.981 1.799   7.285   1.00 0.00 ? 47  LYS A HG3  2  
ATOM 2217  H HD2  . LYS A 1 47  ? -11.412 1.926   9.500   1.00 0.00 ? 47  LYS A HD2  2  
ATOM 2218  H HD3  . LYS A 1 47  ? -12.345 3.409   9.479   1.00 0.00 ? 47  LYS A HD3  2  
ATOM 2219  H HE2  . LYS A 1 47  ? -14.399 2.075   10.130  1.00 0.00 ? 47  LYS A HE2  2  
ATOM 2220  H HE3  . LYS A 1 47  ? -13.395 0.645   10.251  1.00 0.00 ? 47  LYS A HE3  2  
ATOM 2221  H HZ1  . LYS A 1 47  ? -12.231 1.558   12.020  1.00 0.00 ? 47  LYS A HZ1  2  
ATOM 2222  H HZ2  . LYS A 1 47  ? -12.753 3.080   11.741  1.00 0.00 ? 47  LYS A HZ2  2  
ATOM 2223  H HZ3  . LYS A 1 47  ? -13.782 1.961   12.336  1.00 0.00 ? 47  LYS A HZ3  2  
ATOM 2224  N N    . GLY A 1 48  ? -13.621 4.838   3.926   1.00 0.00 ? 48  GLY A N    2  
ATOM 2225  C CA   . GLY A 1 48  ? -14.464 5.602   3.022   1.00 0.00 ? 48  GLY A CA   2  
ATOM 2226  C C    . GLY A 1 48  ? -13.761 5.836   1.683   1.00 0.00 ? 48  GLY A C    2  
ATOM 2227  O O    . GLY A 1 48  ? -14.008 6.839   1.015   1.00 0.00 ? 48  GLY A O    2  
ATOM 2228  H H    . GLY A 1 48  ? -12.663 4.763   3.649   1.00 0.00 ? 48  GLY A H    2  
ATOM 2229  H HA2  . GLY A 1 48  ? -15.401 5.071   2.857   1.00 0.00 ? 48  GLY A HA2  2  
ATOM 2230  H HA3  . GLY A 1 48  ? -14.716 6.560   3.476   1.00 0.00 ? 48  GLY A HA3  2  
ATOM 2231  N N    . GLY A 1 49  ? -12.900 4.893   1.330   1.00 0.00 ? 49  GLY A N    2  
ATOM 2232  C CA   . GLY A 1 49  ? -12.160 4.983   0.083   1.00 0.00 ? 49  GLY A CA   2  
ATOM 2233  C C    . GLY A 1 49  ? -11.988 3.603   -0.554  1.00 0.00 ? 49  GLY A C    2  
ATOM 2234  O O    . GLY A 1 49  ? -12.187 2.582   0.104   1.00 0.00 ? 49  GLY A O    2  
ATOM 2235  H H    . GLY A 1 49  ? -12.705 4.080   1.879   1.00 0.00 ? 49  GLY A H    2  
ATOM 2236  H HA2  . GLY A 1 49  ? -12.684 5.644   -0.607  1.00 0.00 ? 49  GLY A HA2  2  
ATOM 2237  H HA3  . GLY A 1 49  ? -11.182 5.426   0.268   1.00 0.00 ? 49  GLY A HA3  2  
ATOM 2238  N N    . ALA A 1 50  ? -11.621 3.615   -1.827  1.00 0.00 ? 50  ALA A N    2  
ATOM 2239  C CA   . ALA A 1 50  ? -11.421 2.377   -2.560  1.00 0.00 ? 50  ALA A CA   2  
ATOM 2240  C C    . ALA A 1 50  ? -10.737 1.355   -1.650  1.00 0.00 ? 50  ALA A C    2  
ATOM 2241  O O    . ALA A 1 50  ? -11.051 0.167   -1.698  1.00 0.00 ? 50  ALA A O    2  
ATOM 2242  C CB   . ALA A 1 50  ? -10.613 2.660   -3.829  1.00 0.00 ? 50  ALA A CB   2  
ATOM 2243  H H    . ALA A 1 50  ? -11.462 4.450   -2.355  1.00 0.00 ? 50  ALA A H    2  
ATOM 2244  H HA   . ALA A 1 50  ? -12.402 1.998   -2.846  1.00 0.00 ? 50  ALA A HA   2  
ATOM 2245  H HB1  . ALA A 1 50  ? -11.278 3.037   -4.606  1.00 0.00 ? 50  ALA A HB1  2  
ATOM 2246  H HB2  . ALA A 1 50  ? -9.847  3.404   -3.613  1.00 0.00 ? 50  ALA A HB2  2  
ATOM 2247  H HB3  . ALA A 1 50  ? -10.140 1.739   -4.171  1.00 0.00 ? 50  ALA A HB3  2  
ATOM 2248  N N    . ALA A 1 51  ? -9.814  1.855   -0.841  1.00 0.00 ? 51  ALA A N    2  
ATOM 2249  C CA   . ALA A 1 51  ? -9.083  1.000   0.080   1.00 0.00 ? 51  ALA A CA   2  
ATOM 2250  C C    . ALA A 1 51  ? -10.076 0.165   0.890   1.00 0.00 ? 51  ALA A C    2  
ATOM 2251  O O    . ALA A 1 51  ? -10.381 -0.969  0.526   1.00 0.00 ? 51  ALA A O    2  
ATOM 2252  C CB   . ALA A 1 51  ? -8.182  1.860   0.968   1.00 0.00 ? 51  ALA A CB   2  
ATOM 2253  H H    . ALA A 1 51  ? -9.564  2.823   -0.808  1.00 0.00 ? 51  ALA A H    2  
ATOM 2254  H HA   . ALA A 1 51  ? -8.458  0.333   -0.513  1.00 0.00 ? 51  ALA A HA   2  
ATOM 2255  H HB1  . ALA A 1 51  ? -8.798  2.461   1.638   1.00 0.00 ? 51  ALA A HB1  2  
ATOM 2256  H HB2  . ALA A 1 51  ? -7.529  1.215   1.556   1.00 0.00 ? 51  ALA A HB2  2  
ATOM 2257  H HB3  . ALA A 1 51  ? -7.576  2.517   0.344   1.00 0.00 ? 51  ALA A HB3  2  
ATOM 2258  N N    . ASP A 1 52  ? -10.552 0.758   1.975   1.00 0.00 ? 52  ASP A N    2  
ATOM 2259  C CA   . ASP A 1 52  ? -11.503 0.082   2.841   1.00 0.00 ? 52  ASP A CA   2  
ATOM 2260  C C    . ASP A 1 52  ? -12.767 -0.246  2.044   1.00 0.00 ? 52  ASP A C    2  
ATOM 2261  O O    . ASP A 1 52  ? -13.644 -0.960  2.529   1.00 0.00 ? 52  ASP A O    2  
ATOM 2262  C CB   . ASP A 1 52  ? -11.905 0.973   4.019   1.00 0.00 ? 52  ASP A CB   2  
ATOM 2263  C CG   . ASP A 1 52  ? -12.794 0.298   5.065   1.00 0.00 ? 52  ASP A CG   2  
ATOM 2264  O OD1  . ASP A 1 52  ? -12.258 -0.564  5.794   1.00 0.00 ? 52  ASP A OD1  2  
ATOM 2265  O OD2  . ASP A 1 52  ? -13.990 0.660   5.113   1.00 0.00 ? 52  ASP A OD2  2  
ATOM 2266  H H    . ASP A 1 52  ? -10.298 1.681   2.265   1.00 0.00 ? 52  ASP A H    2  
ATOM 2267  H HA   . ASP A 1 52  ? -10.987 -0.811  3.192   1.00 0.00 ? 52  ASP A HA   2  
ATOM 2268  H HB2  . ASP A 1 52  ? -11.000 1.331   4.509   1.00 0.00 ? 52  ASP A HB2  2  
ATOM 2269  H HB3  . ASP A 1 52  ? -12.426 1.848   3.632   1.00 0.00 ? 52  ASP A HB3  2  
ATOM 2270  N N    . VAL A 1 53  ? -12.821 0.291   0.834   1.00 0.00 ? 53  VAL A N    2  
ATOM 2271  C CA   . VAL A 1 53  ? -13.963 0.063   -0.035  1.00 0.00 ? 53  VAL A CA   2  
ATOM 2272  C C    . VAL A 1 53  ? -13.742 -1.221  -0.836  1.00 0.00 ? 53  VAL A C    2  
ATOM 2273  O O    . VAL A 1 53  ? -14.700 -1.861  -1.268  1.00 0.00 ? 53  VAL A O    2  
ATOM 2274  C CB   . VAL A 1 53  ? -14.198 1.288   -0.923  1.00 0.00 ? 53  VAL A CB   2  
ATOM 2275  C CG1  . VAL A 1 53  ? -14.794 0.881   -2.272  1.00 0.00 ? 53  VAL A CG1  2  
ATOM 2276  C CG2  . VAL A 1 53  ? -15.086 2.314   -0.217  1.00 0.00 ? 53  VAL A CG2  2  
ATOM 2277  H H    . VAL A 1 53  ? -12.104 0.870   0.446   1.00 0.00 ? 53  VAL A H    2  
ATOM 2278  H HA   . VAL A 1 53  ? -14.840 -0.065  0.600   1.00 0.00 ? 53  VAL A HA   2  
ATOM 2279  H HB   . VAL A 1 53  ? -13.231 1.755   -1.111  1.00 0.00 ? 53  VAL A HB   2  
ATOM 2280  H HG11 . VAL A 1 53  ? -15.205 1.761   -2.767  1.00 0.00 ? 53  VAL A HG11 2  
ATOM 2281  H HG12 . VAL A 1 53  ? -14.015 0.443   -2.896  1.00 0.00 ? 53  VAL A HG12 2  
ATOM 2282  H HG13 . VAL A 1 53  ? -15.587 0.150   -2.113  1.00 0.00 ? 53  VAL A HG13 2  
ATOM 2283  H HG21 . VAL A 1 53  ? -14.732 3.319   -0.446  1.00 0.00 ? 53  VAL A HG21 2  
ATOM 2284  H HG22 . VAL A 1 53  ? -16.114 2.203   -0.562  1.00 0.00 ? 53  VAL A HG22 2  
ATOM 2285  H HG23 . VAL A 1 53  ? -15.045 2.151   0.860   1.00 0.00 ? 53  VAL A HG23 2  
ATOM 2286  N N    . ASP A 1 54  ? -12.473 -1.562  -1.009  1.00 0.00 ? 54  ASP A N    2  
ATOM 2287  C CA   . ASP A 1 54  ? -12.114 -2.759  -1.750  1.00 0.00 ? 54  ASP A CA   2  
ATOM 2288  C C    . ASP A 1 54  ? -12.248 -3.978  -0.836  1.00 0.00 ? 54  ASP A C    2  
ATOM 2289  O O    . ASP A 1 54  ? -11.926 -5.096  -1.236  1.00 0.00 ? 54  ASP A O    2  
ATOM 2290  C CB   . ASP A 1 54  ? -10.666 -2.690  -2.239  1.00 0.00 ? 54  ASP A CB   2  
ATOM 2291  C CG   . ASP A 1 54  ? -10.432 -1.776  -3.443  1.00 0.00 ? 54  ASP A CG   2  
ATOM 2292  O OD1  . ASP A 1 54  ? -11.444 -1.273  -3.978  1.00 0.00 ? 54  ASP A OD1  2  
ATOM 2293  O OD2  . ASP A 1 54  ? -9.248  -1.601  -3.802  1.00 0.00 ? 54  ASP A OD2  2  
ATOM 2294  H H    . ASP A 1 54  ? -11.700 -1.036  -0.655  1.00 0.00 ? 54  ASP A H    2  
ATOM 2295  H HA   . ASP A 1 54  ? -12.804 -2.792  -2.593  1.00 0.00 ? 54  ASP A HA   2  
ATOM 2296  H HB2  . ASP A 1 54  ? -10.037 -2.351  -1.416  1.00 0.00 ? 54  ASP A HB2  2  
ATOM 2297  H HB3  . ASP A 1 54  ? -10.337 -3.697  -2.497  1.00 0.00 ? 54  ASP A HB3  2  
ATOM 2298  N N    . GLY A 1 55  ? -12.723 -3.722  0.374   1.00 0.00 ? 55  GLY A N    2  
ATOM 2299  C CA   . GLY A 1 55  ? -12.903 -4.785  1.348   1.00 0.00 ? 55  GLY A CA   2  
ATOM 2300  C C    . GLY A 1 55  ? -11.653 -5.662  1.439   1.00 0.00 ? 55  GLY A C    2  
ATOM 2301  O O    . GLY A 1 55  ? -11.740 -6.886  1.348   1.00 0.00 ? 55  GLY A O    2  
ATOM 2302  H H    . GLY A 1 55  ? -12.982 -2.810  0.691   1.00 0.00 ? 55  GLY A H    2  
ATOM 2303  H HA2  . GLY A 1 55  ? -13.122 -4.355  2.325   1.00 0.00 ? 55  GLY A HA2  2  
ATOM 2304  H HA3  . GLY A 1 55  ? -13.761 -5.397  1.069   1.00 0.00 ? 55  GLY A HA3  2  
ATOM 2305  N N    . ARG A 1 56  ? -10.518 -5.002  1.618   1.00 0.00 ? 56  ARG A N    2  
ATOM 2306  C CA   . ARG A 1 56  ? -9.251  -5.707  1.723   1.00 0.00 ? 56  ARG A CA   2  
ATOM 2307  C C    . ARG A 1 56  ? -8.215  -4.833  2.433   1.00 0.00 ? 56  ARG A C    2  
ATOM 2308  O O    . ARG A 1 56  ? -7.459  -5.318  3.273   1.00 0.00 ? 56  ARG A O    2  
ATOM 2309  C CB   . ARG A 1 56  ? -8.720  -6.095  0.342   1.00 0.00 ? 56  ARG A CB   2  
ATOM 2310  C CG   . ARG A 1 56  ? -8.083  -7.485  0.370   1.00 0.00 ? 56  ARG A CG   2  
ATOM 2311  C CD   . ARG A 1 56  ? -6.560  -7.388  0.478   1.00 0.00 ? 56  ARG A CD   2  
ATOM 2312  N NE   . ARG A 1 56  ? -6.079  -8.210  1.611   1.00 0.00 ? 56  ARG A NE   2  
ATOM 2313  C CZ   . ARG A 1 56  ? -4.808  -8.237  2.033   1.00 0.00 ? 56  ARG A CZ   2  
ATOM 2314  N NH1  . ARG A 1 56  ? -3.882  -7.489  1.418   1.00 0.00 ? 56  ARG A NH1  2  
ATOM 2315  N NH2  . ARG A 1 56  ? -4.462  -9.014  3.069   1.00 0.00 ? 56  ARG A NH2  2  
ATOM 2316  H H    . ARG A 1 56  ? -10.455 -4.007  1.691   1.00 0.00 ? 56  ARG A H    2  
ATOM 2317  H HA   . ARG A 1 56  ? -9.476  -6.600  2.306   1.00 0.00 ? 56  ARG A HA   2  
ATOM 2318  H HB2  . ARG A 1 56  ? -9.535  -6.079  -0.382  1.00 0.00 ? 56  ARG A HB2  2  
ATOM 2319  H HB3  . ARG A 1 56  ? -7.986  -5.360  0.011   1.00 0.00 ? 56  ARG A HB3  2  
ATOM 2320  H HG2  . ARG A 1 56  ? -8.475  -8.052  1.214   1.00 0.00 ? 56  ARG A HG2  2  
ATOM 2321  H HG3  . ARG A 1 56  ? -8.353  -8.031  -0.534  1.00 0.00 ? 56  ARG A HG3  2  
ATOM 2322  H HD2  . ARG A 1 56  ? -6.099  -7.727  -0.450  1.00 0.00 ? 56  ARG A HD2  2  
ATOM 2323  H HD3  . ARG A 1 56  ? -6.263  -6.349  0.620   1.00 0.00 ? 56  ARG A HD3  2  
ATOM 2324  H HE   . ARG A 1 56  ? -6.745  -8.781  2.091   1.00 0.00 ? 56  ARG A HE   2  
ATOM 2325  H HH11 . ARG A 1 56  ? -4.139  -6.910  0.645   1.00 0.00 ? 56  ARG A HH11 2  
ATOM 2326  H HH12 . ARG A 1 56  ? -2.933  -7.510  1.733   1.00 0.00 ? 56  ARG A HH12 2  
ATOM 2327  H HH21 . ARG A 1 56  ? -5.153  -9.572  3.527   1.00 0.00 ? 56  ARG A HH21 2  
ATOM 2328  H HH22 . ARG A 1 56  ? -3.513  -9.034  3.384   1.00 0.00 ? 56  ARG A HH22 2  
ATOM 2329  N N    . LEU A 1 57  ? -8.213  -3.559  2.069   1.00 0.00 ? 57  LEU A N    2  
ATOM 2330  C CA   . LEU A 1 57  ? -7.283  -2.613  2.660   1.00 0.00 ? 57  LEU A CA   2  
ATOM 2331  C C    . LEU A 1 57  ? -7.570  -2.489  4.158   1.00 0.00 ? 57  LEU A C    2  
ATOM 2332  O O    . LEU A 1 57  ? -8.703  -2.688  4.595   1.00 0.00 ? 57  LEU A O    2  
ATOM 2333  C CB   . LEU A 1 57  ? -7.328  -1.278  1.914   1.00 0.00 ? 57  LEU A CB   2  
ATOM 2334  C CG   . LEU A 1 57  ? -6.219  -1.047  0.886   1.00 0.00 ? 57  LEU A CG   2  
ATOM 2335  C CD1  . LEU A 1 57  ? -4.839  -1.105  1.546   1.00 0.00 ? 57  LEU A CD1  2  
ATOM 2336  C CD2  . LEU A 1 57  ? -6.338  -2.029  -0.281  1.00 0.00 ? 57  LEU A CD2  2  
ATOM 2337  H H    . LEU A 1 57  ? -8.832  -3.172  1.385   1.00 0.00 ? 57  LEU A H    2  
ATOM 2338  H HA   . LEU A 1 57  ? -6.279  -3.019  2.534   1.00 0.00 ? 57  LEU A HA   2  
ATOM 2339  H HB2  . LEU A 1 57  ? -8.289  -1.202  1.405   1.00 0.00 ? 57  LEU A HB2  2  
ATOM 2340  H HB3  . LEU A 1 57  ? -7.291  -0.473  2.647   1.00 0.00 ? 57  LEU A HB3  2  
ATOM 2341  H HG   . LEU A 1 57  ? -6.337  -0.044  0.476   1.00 0.00 ? 57  LEU A HG   2  
ATOM 2342  H HD11 . LEU A 1 57  ? -4.077  -0.822  0.820   1.00 0.00 ? 57  LEU A HD11 2  
ATOM 2343  H HD12 . LEU A 1 57  ? -4.811  -0.416  2.390   1.00 0.00 ? 57  LEU A HD12 2  
ATOM 2344  H HD13 . LEU A 1 57  ? -4.648  -2.119  1.897   1.00 0.00 ? 57  LEU A HD13 2  
ATOM 2345  H HD21 . LEU A 1 57  ? -5.624  -2.841  -0.147  1.00 0.00 ? 57  LEU A HD21 2  
ATOM 2346  H HD22 . LEU A 1 57  ? -7.349  -2.435  -0.311  1.00 0.00 ? 57  LEU A HD22 2  
ATOM 2347  H HD23 . LEU A 1 57  ? -6.127  -1.510  -1.216  1.00 0.00 ? 57  LEU A HD23 2  
ATOM 2348  N N    . ALA A 1 58  ? -6.525  -2.162  4.904   1.00 0.00 ? 58  ALA A N    2  
ATOM 2349  C CA   . ALA A 1 58  ? -6.651  -2.010  6.343   1.00 0.00 ? 58  ALA A CA   2  
ATOM 2350  C C    . ALA A 1 58  ? -5.268  -2.127  6.987   1.00 0.00 ? 58  ALA A C    2  
ATOM 2351  O O    . ALA A 1 58  ? -4.271  -2.318  6.294   1.00 0.00 ? 58  ALA A O    2  
ATOM 2352  C CB   . ALA A 1 58  ? -7.635  -3.051  6.883   1.00 0.00 ? 58  ALA A CB   2  
ATOM 2353  H H    . ALA A 1 58  ? -5.607  -2.003  4.541   1.00 0.00 ? 58  ALA A H    2  
ATOM 2354  H HA   . ALA A 1 58  ? -7.051  -1.015  6.538   1.00 0.00 ? 58  ALA A HA   2  
ATOM 2355  H HB1  . ALA A 1 58  ? -7.582  -3.952  6.272   1.00 0.00 ? 58  ALA A HB1  2  
ATOM 2356  H HB2  . ALA A 1 58  ? -7.377  -3.295  7.913   1.00 0.00 ? 58  ALA A HB2  2  
ATOM 2357  H HB3  . ALA A 1 58  ? -8.647  -2.647  6.847   1.00 0.00 ? 58  ALA A HB3  2  
ATOM 2358  N N    . ALA A 1 59  ? -5.253  -2.005  8.307   1.00 0.00 ? 59  ALA A N    2  
ATOM 2359  C CA   . ALA A 1 59  ? -4.009  -2.095  9.052   1.00 0.00 ? 59  ALA A CA   2  
ATOM 2360  C C    . ALA A 1 59  ? -3.382  -3.472  8.826   1.00 0.00 ? 59  ALA A C    2  
ATOM 2361  O O    . ALA A 1 59  ? -4.019  -4.495  9.069   1.00 0.00 ? 59  ALA A O    2  
ATOM 2362  C CB   . ALA A 1 59  ? -4.278  -1.812  10.531  1.00 0.00 ? 59  ALA A CB   2  
ATOM 2363  H H    . ALA A 1 59  ? -6.069  -1.850  8.864   1.00 0.00 ? 59  ALA A H    2  
ATOM 2364  H HA   . ALA A 1 59  ? -3.335  -1.330  8.665   1.00 0.00 ? 59  ALA A HA   2  
ATOM 2365  H HB1  . ALA A 1 59  ? -4.289  -2.751  11.084  1.00 0.00 ? 59  ALA A HB1  2  
ATOM 2366  H HB2  . ALA A 1 59  ? -3.493  -1.167  10.927  1.00 0.00 ? 59  ALA A HB2  2  
ATOM 2367  H HB3  . ALA A 1 59  ? -5.243  -1.316  10.637  1.00 0.00 ? 59  ALA A HB3  2  
ATOM 2368  N N    . GLY A 1 60  ? -2.140  -3.453  8.364   1.00 0.00 ? 60  GLY A N    2  
ATOM 2369  C CA   . GLY A 1 60  ? -1.420  -4.688  8.103   1.00 0.00 ? 60  GLY A CA   2  
ATOM 2370  C C    . GLY A 1 60  ? -1.180  -4.875  6.603   1.00 0.00 ? 60  GLY A C    2  
ATOM 2371  O O    . GLY A 1 60  ? -0.859  -5.975  6.156   1.00 0.00 ? 60  GLY A O    2  
ATOM 2372  H H    . GLY A 1 60  ? -1.629  -2.616  8.169   1.00 0.00 ? 60  GLY A H    2  
ATOM 2373  H HA2  . GLY A 1 60  ? -0.465  -4.674  8.629   1.00 0.00 ? 60  GLY A HA2  2  
ATOM 2374  H HA3  . GLY A 1 60  ? -1.987  -5.533  8.493   1.00 0.00 ? 60  GLY A HA3  2  
ATOM 2375  N N    . ASP A 1 61  ? -1.344  -3.785  5.869   1.00 0.00 ? 61  ASP A N    2  
ATOM 2376  C CA   . ASP A 1 61  ? -1.149  -3.816  4.429   1.00 0.00 ? 61  ASP A CA   2  
ATOM 2377  C C    . ASP A 1 61  ? 0.244   -3.278  4.096   1.00 0.00 ? 61  ASP A C    2  
ATOM 2378  O O    . ASP A 1 61  ? 0.436   -2.069  3.982   1.00 0.00 ? 61  ASP A O    2  
ATOM 2379  C CB   . ASP A 1 61  ? -2.178  -2.938  3.715   1.00 0.00 ? 61  ASP A CB   2  
ATOM 2380  C CG   . ASP A 1 61  ? -2.854  -3.587  2.506   1.00 0.00 ? 61  ASP A CG   2  
ATOM 2381  O OD1  . ASP A 1 61  ? -3.552  -4.601  2.722   1.00 0.00 ? 61  ASP A OD1  2  
ATOM 2382  O OD2  . ASP A 1 61  ? -2.658  -3.054  1.392   1.00 0.00 ? 61  ASP A OD2  2  
ATOM 2383  H H    . ASP A 1 61  ? -1.605  -2.894  6.241   1.00 0.00 ? 61  ASP A H    2  
ATOM 2384  H HA   . ASP A 1 61  ? -1.271  -4.861  4.146   1.00 0.00 ? 61  ASP A HA   2  
ATOM 2385  H HB2  . ASP A 1 61  ? -2.948  -2.650  4.432   1.00 0.00 ? 61  ASP A HB2  2  
ATOM 2386  H HB3  . ASP A 1 61  ? -1.687  -2.020  3.389   1.00 0.00 ? 61  ASP A HB3  2  
ATOM 2387  N N    . GLN A 1 62  ? 1.181   -4.204  3.949   1.00 0.00 ? 62  GLN A N    2  
ATOM 2388  C CA   . GLN A 1 62  ? 2.551   -3.838  3.631   1.00 0.00 ? 62  GLN A CA   2  
ATOM 2389  C C    . GLN A 1 62  ? 2.713   -3.650  2.122   1.00 0.00 ? 62  GLN A C    2  
ATOM 2390  O O    . GLN A 1 62  ? 2.671   -4.618  1.364   1.00 0.00 ? 62  GLN A O    2  
ATOM 2391  C CB   . GLN A 1 62  ? 3.535   -4.882  4.163   1.00 0.00 ? 62  GLN A CB   2  
ATOM 2392  C CG   . GLN A 1 62  ? 4.084   -4.472  5.531   1.00 0.00 ? 62  GLN A CG   2  
ATOM 2393  C CD   . GLN A 1 62  ? 5.184   -5.431  5.990   1.00 0.00 ? 62  GLN A CD   2  
ATOM 2394  O OE1  . GLN A 1 62  ? 5.233   -6.589  5.608   1.00 0.00 ? 62  GLN A OE1  2  
ATOM 2395  N NE2  . GLN A 1 62  ? 6.060   -4.887  6.830   1.00 0.00 ? 62  GLN A NE2  2  
ATOM 2396  H H    . GLN A 1 62  ? 1.017   -5.186  4.044   1.00 0.00 ? 62  GLN A H    2  
ATOM 2397  H HA   . GLN A 1 62  ? 2.724   -2.891  4.143   1.00 0.00 ? 62  GLN A HA   2  
ATOM 2398  H HB2  . GLN A 1 62  ? 3.037   -5.849  4.242   1.00 0.00 ? 62  GLN A HB2  2  
ATOM 2399  H HB3  . GLN A 1 62  ? 4.357   -5.004  3.458   1.00 0.00 ? 62  GLN A HB3  2  
ATOM 2400  H HG2  . GLN A 1 62  ? 4.480   -3.457  5.478   1.00 0.00 ? 62  GLN A HG2  2  
ATOM 2401  H HG3  . GLN A 1 62  ? 3.276   -4.461  6.262   1.00 0.00 ? 62  GLN A HG3  2  
ATOM 2402  H HE21 . GLN A 1 62  ? 5.962   -3.930  7.104   1.00 0.00 ? 62  GLN A HE21 2  
ATOM 2403  H HE22 . GLN A 1 62  ? 6.817   -5.435  7.186   1.00 0.00 ? 62  GLN A HE22 2  
ATOM 2404  N N    . LEU A 1 63  ? 2.895   -2.397  1.730   1.00 0.00 ? 63  LEU A N    2  
ATOM 2405  C CA   . LEU A 1 63  ? 3.064   -2.070  0.324   1.00 0.00 ? 63  LEU A CA   2  
ATOM 2406  C C    . LEU A 1 63  ? 4.535   -2.240  -0.062  1.00 0.00 ? 63  LEU A C    2  
ATOM 2407  O O    . LEU A 1 63  ? 5.396   -1.503  0.418   1.00 0.00 ? 63  LEU A O    2  
ATOM 2408  C CB   . LEU A 1 63  ? 2.509   -0.676  0.028   1.00 0.00 ? 63  LEU A CB   2  
ATOM 2409  C CG   . LEU A 1 63  ? 1.063   -0.423  0.463   1.00 0.00 ? 63  LEU A CG   2  
ATOM 2410  C CD1  . LEU A 1 63  ? 1.015   0.373   1.768   1.00 0.00 ? 63  LEU A CD1  2  
ATOM 2411  C CD2  . LEU A 1 63  ? 0.266   0.255   -0.653  1.00 0.00 ? 63  LEU A CD2  2  
ATOM 2412  H H    . LEU A 1 63  ? 2.929   -1.616  2.353   1.00 0.00 ? 63  LEU A H    2  
ATOM 2413  H HA   . LEU A 1 63  ? 2.472   -2.782  -0.251  1.00 0.00 ? 63  LEU A HA   2  
ATOM 2414  H HB2  . LEU A 1 63  ? 3.148   0.060   0.517   1.00 0.00 ? 63  LEU A HB2  2  
ATOM 2415  H HB3  . LEU A 1 63  ? 2.581   -0.498  -1.045  1.00 0.00 ? 63  LEU A HB3  2  
ATOM 2416  H HG   . LEU A 1 63  ? 0.592   -1.387  0.656   1.00 0.00 ? 63  LEU A HG   2  
ATOM 2417  H HD11 . LEU A 1 63  ? 1.703   1.216   1.706   1.00 0.00 ? 63  LEU A HD11 2  
ATOM 2418  H HD12 . LEU A 1 63  ? 0.002   0.743   1.931   1.00 0.00 ? 63  LEU A HD12 2  
ATOM 2419  H HD13 . LEU A 1 63  ? 1.304   -0.271  2.598   1.00 0.00 ? 63  LEU A HD13 2  
ATOM 2420  H HD21 . LEU A 1 63  ? -0.138  -0.503  -1.323  1.00 0.00 ? 63  LEU A HD21 2  
ATOM 2421  H HD22 . LEU A 1 63  ? -0.553  0.828   -0.217  1.00 0.00 ? 63  LEU A HD22 2  
ATOM 2422  H HD23 . LEU A 1 63  ? 0.920   0.924   -1.212  1.00 0.00 ? 63  LEU A HD23 2  
ATOM 2423  N N    . LEU A 1 64  ? 4.778   -3.217  -0.924  1.00 0.00 ? 64  LEU A N    2  
ATOM 2424  C CA   . LEU A 1 64  ? 6.130   -3.493  -1.379  1.00 0.00 ? 64  LEU A CA   2  
ATOM 2425  C C    . LEU A 1 64  ? 6.494   -2.520  -2.503  1.00 0.00 ? 64  LEU A C    2  
ATOM 2426  O O    . LEU A 1 64  ? 7.656   -2.147  -2.653  1.00 0.00 ? 64  LEU A O    2  
ATOM 2427  C CB   . LEU A 1 64  ? 6.273   -4.965  -1.770  1.00 0.00 ? 64  LEU A CB   2  
ATOM 2428  C CG   . LEU A 1 64  ? 7.192   -5.809  -0.883  1.00 0.00 ? 64  LEU A CG   2  
ATOM 2429  C CD1  . LEU A 1 64  ? 8.630   -5.784  -1.403  1.00 0.00 ? 64  LEU A CD1  2  
ATOM 2430  C CD2  . LEU A 1 64  ? 7.103   -5.363  0.578   1.00 0.00 ? 64  LEU A CD2  2  
ATOM 2431  H H    . LEU A 1 64  ? 4.073   -3.811  -1.309  1.00 0.00 ? 64  LEU A H    2  
ATOM 2432  H HA   . LEU A 1 64  ? 6.801   -3.316  -0.538  1.00 0.00 ? 64  LEU A HA   2  
ATOM 2433  H HB2  . LEU A 1 64  ? 5.282   -5.419  -1.768  1.00 0.00 ? 64  LEU A HB2  2  
ATOM 2434  H HB3  . LEU A 1 64  ? 6.644   -5.014  -2.794  1.00 0.00 ? 64  LEU A HB3  2  
ATOM 2435  H HG   . LEU A 1 64  ? 6.852   -6.843  -0.926  1.00 0.00 ? 64  LEU A HG   2  
ATOM 2436  H HD11 . LEU A 1 64  ? 9.081   -6.768  -1.272  1.00 0.00 ? 64  LEU A HD11 2  
ATOM 2437  H HD12 . LEU A 1 64  ? 8.629   -5.523  -2.462  1.00 0.00 ? 64  LEU A HD12 2  
ATOM 2438  H HD13 . LEU A 1 64  ? 9.205   -5.044  -0.847  1.00 0.00 ? 64  LEU A HD13 2  
ATOM 2439  H HD21 . LEU A 1 64  ? 6.090   -5.024  0.793   1.00 0.00 ? 64  LEU A HD21 2  
ATOM 2440  H HD22 . LEU A 1 64  ? 7.352   -6.201  1.229   1.00 0.00 ? 64  LEU A HD22 2  
ATOM 2441  H HD23 . LEU A 1 64  ? 7.804   -4.547  0.752   1.00 0.00 ? 64  LEU A HD23 2  
ATOM 2442  N N    . SER A 1 65  ? 5.479   -2.138  -3.263  1.00 0.00 ? 65  SER A N    2  
ATOM 2443  C CA   . SER A 1 65  ? 5.677   -1.216  -4.369  1.00 0.00 ? 65  SER A CA   2  
ATOM 2444  C C    . SER A 1 65  ? 4.341   -0.590  -4.774  1.00 0.00 ? 65  SER A C    2  
ATOM 2445  O O    . SER A 1 65  ? 3.283   -1.175  -4.547  1.00 0.00 ? 65  SER A O    2  
ATOM 2446  C CB   . SER A 1 65  ? 6.319   -1.921  -5.565  1.00 0.00 ? 65  SER A CB   2  
ATOM 2447  O OG   . SER A 1 65  ? 5.759   -3.213  -5.787  1.00 0.00 ? 65  SER A OG   2  
ATOM 2448  H H    . SER A 1 65  ? 4.536   -2.446  -3.134  1.00 0.00 ? 65  SER A H    2  
ATOM 2449  H HA   . SER A 1 65  ? 6.357   -0.453  -3.990  1.00 0.00 ? 65  SER A HA   2  
ATOM 2450  H HB2  . SER A 1 65  ? 6.187   -1.311  -6.459  1.00 0.00 ? 65  SER A HB2  2  
ATOM 2451  H HB3  . SER A 1 65  ? 7.392   -2.014  -5.399  1.00 0.00 ? 65  SER A HB3  2  
ATOM 2452  H HG   . SER A 1 65  ? 5.794   -3.749  -4.944  1.00 0.00 ? 65  SER A HG   2  
ATOM 2453  N N    . VAL A 1 66  ? 4.434   0.590   -5.369  1.00 0.00 ? 66  VAL A N    2  
ATOM 2454  C CA   . VAL A 1 66  ? 3.245   1.302   -5.808  1.00 0.00 ? 66  VAL A CA   2  
ATOM 2455  C C    . VAL A 1 66  ? 3.527   1.975   -7.153  1.00 0.00 ? 66  VAL A C    2  
ATOM 2456  O O    . VAL A 1 66  ? 4.480   2.742   -7.279  1.00 0.00 ? 66  VAL A O    2  
ATOM 2457  C CB   . VAL A 1 66  ? 2.796   2.288   -4.729  1.00 0.00 ? 66  VAL A CB   2  
ATOM 2458  C CG1  . VAL A 1 66  ? 2.499   1.564   -3.414  1.00 0.00 ? 66  VAL A CG1  2  
ATOM 2459  C CG2  . VAL A 1 66  ? 3.838   3.390   -4.525  1.00 0.00 ? 66  VAL A CG2  2  
ATOM 2460  H H    . VAL A 1 66  ? 5.298   1.059   -5.550  1.00 0.00 ? 66  VAL A H    2  
ATOM 2461  H HA   . VAL A 1 66  ? 2.453   0.566   -5.944  1.00 0.00 ? 66  VAL A HA   2  
ATOM 2462  H HB   . VAL A 1 66  ? 1.873   2.759   -5.068  1.00 0.00 ? 66  VAL A HB   2  
ATOM 2463  H HG11 . VAL A 1 66  ? 1.974   0.632   -3.623  1.00 0.00 ? 66  VAL A HG11 2  
ATOM 2464  H HG12 . VAL A 1 66  ? 3.435   1.346   -2.900  1.00 0.00 ? 66  VAL A HG12 2  
ATOM 2465  H HG13 . VAL A 1 66  ? 1.877   2.198   -2.782  1.00 0.00 ? 66  VAL A HG13 2  
ATOM 2466  H HG21 . VAL A 1 66  ? 4.838   2.961   -4.596  1.00 0.00 ? 66  VAL A HG21 2  
ATOM 2467  H HG22 . VAL A 1 66  ? 3.714   4.153   -5.293  1.00 0.00 ? 66  VAL A HG22 2  
ATOM 2468  H HG23 . VAL A 1 66  ? 3.704   3.839   -3.541  1.00 0.00 ? 66  VAL A HG23 2  
ATOM 2469  N N    . ASP A 1 67  ? 2.682   1.663   -8.124  1.00 0.00 ? 67  ASP A N    2  
ATOM 2470  C CA   . ASP A 1 67  ? 2.828   2.228   -9.454  1.00 0.00 ? 67  ASP A CA   2  
ATOM 2471  C C    . ASP A 1 67  ? 4.219   1.891   -9.997  1.00 0.00 ? 67  ASP A C    2  
ATOM 2472  O O    . ASP A 1 67  ? 4.817   2.688   -10.718 1.00 0.00 ? 67  ASP A O    2  
ATOM 2473  C CB   . ASP A 1 67  ? 2.689   3.751   -9.424  1.00 0.00 ? 67  ASP A CB   2  
ATOM 2474  C CG   . ASP A 1 67  ? 2.616   4.421   -10.798 1.00 0.00 ? 67  ASP A CG   2  
ATOM 2475  O OD1  . ASP A 1 67  ? 1.573   4.242   -11.462 1.00 0.00 ? 67  ASP A OD1  2  
ATOM 2476  O OD2  . ASP A 1 67  ? 3.606   5.098   -11.152 1.00 0.00 ? 67  ASP A OD2  2  
ATOM 2477  H H    . ASP A 1 67  ? 1.909   1.038   -8.013  1.00 0.00 ? 67  ASP A H    2  
ATOM 2478  H HA   . ASP A 1 67  ? 2.030   1.779   -10.046 1.00 0.00 ? 67  ASP A HA   2  
ATOM 2479  H HB2  . ASP A 1 67  ? 1.790   4.008   -8.864  1.00 0.00 ? 67  ASP A HB2  2  
ATOM 2480  H HB3  . ASP A 1 67  ? 3.535   4.168   -8.877  1.00 0.00 ? 67  ASP A HB3  2  
ATOM 2481  N N    . GLY A 1 68  ? 4.692   0.710   -9.629  1.00 0.00 ? 68  GLY A N    2  
ATOM 2482  C CA   . GLY A 1 68  ? 6.001   0.258   -10.069 1.00 0.00 ? 68  GLY A CA   2  
ATOM 2483  C C    . GLY A 1 68  ? 7.095   0.727   -9.108  1.00 0.00 ? 68  GLY A C    2  
ATOM 2484  O O    . GLY A 1 68  ? 8.123   0.068   -8.963  1.00 0.00 ? 68  GLY A O    2  
ATOM 2485  H H    . GLY A 1 68  ? 4.199   0.068   -9.042  1.00 0.00 ? 68  GLY A H    2  
ATOM 2486  H HA2  . GLY A 1 68  ? 6.011   -0.830  -10.134 1.00 0.00 ? 68  GLY A HA2  2  
ATOM 2487  H HA3  . GLY A 1 68  ? 6.203   0.639   -11.070 1.00 0.00 ? 68  GLY A HA3  2  
ATOM 2488  N N    . ARG A 1 69  ? 6.836   1.863   -8.477  1.00 0.00 ? 69  ARG A N    2  
ATOM 2489  C CA   . ARG A 1 69  ? 7.786   2.428   -7.534  1.00 0.00 ? 69  ARG A CA   2  
ATOM 2490  C C    . ARG A 1 69  ? 7.741   1.661   -6.211  1.00 0.00 ? 69  ARG A C    2  
ATOM 2491  O O    . ARG A 1 69  ? 6.694   1.582   -5.570  1.00 0.00 ? 69  ARG A O    2  
ATOM 2492  C CB   . ARG A 1 69  ? 7.488   3.905   -7.270  1.00 0.00 ? 69  ARG A CB   2  
ATOM 2493  C CG   . ARG A 1 69  ? 8.659   4.582   -6.555  1.00 0.00 ? 69  ARG A CG   2  
ATOM 2494  C CD   . ARG A 1 69  ? 8.757   6.059   -6.940  1.00 0.00 ? 69  ARG A CD   2  
ATOM 2495  N NE   . ARG A 1 69  ? 10.156  6.402   -7.280  1.00 0.00 ? 69  ARG A NE   2  
ATOM 2496  C CZ   . ARG A 1 69  ? 10.759  6.051   -8.423  1.00 0.00 ? 69  ARG A CZ   2  
ATOM 2497  N NH1  . ARG A 1 69  ? 10.089  5.344   -9.344  1.00 0.00 ? 69  ARG A NH1  2  
ATOM 2498  N NH2  . ARG A 1 69  ? 12.032  6.406   -8.646  1.00 0.00 ? 69  ARG A NH2  2  
ATOM 2499  H H    . ARG A 1 69  ? 5.997   2.393   -8.601  1.00 0.00 ? 69  ARG A H    2  
ATOM 2500  H HA   . ARG A 1 69  ? 8.757   2.319   -8.017  1.00 0.00 ? 69  ARG A HA   2  
ATOM 2501  H HB2  . ARG A 1 69  ? 7.290   4.414   -8.213  1.00 0.00 ? 69  ARG A HB2  2  
ATOM 2502  H HB3  . ARG A 1 69  ? 6.586   3.995   -6.664  1.00 0.00 ? 69  ARG A HB3  2  
ATOM 2503  H HG2  . ARG A 1 69  ? 8.532   4.491   -5.476  1.00 0.00 ? 69  ARG A HG2  2  
ATOM 2504  H HG3  . ARG A 1 69  ? 9.589   4.074   -6.810  1.00 0.00 ? 69  ARG A HG3  2  
ATOM 2505  H HD2  . ARG A 1 69  ? 8.106   6.266   -7.790  1.00 0.00 ? 69  ARG A HD2  2  
ATOM 2506  H HD3  . ARG A 1 69  ? 8.411   6.683   -6.115  1.00 0.00 ? 69  ARG A HD3  2  
ATOM 2507  H HE   . ARG A 1 69  ? 10.684  6.930   -6.614  1.00 0.00 ? 69  ARG A HE   2  
ATOM 2508  H HH11 . ARG A 1 69  ? 9.140   5.079   -9.178  1.00 0.00 ? 69  ARG A HH11 2  
ATOM 2509  H HH12 . ARG A 1 69  ? 10.540  5.081   -10.198 1.00 0.00 ? 69  ARG A HH12 2  
ATOM 2510  H HH21 . ARG A 1 69  ? 12.531  6.933   -7.959  1.00 0.00 ? 69  ARG A HH21 2  
ATOM 2511  H HH22 . ARG A 1 69  ? 12.482  6.143   -9.500  1.00 0.00 ? 69  ARG A HH22 2  
ATOM 2512  N N    . SER A 1 70  ? 8.890   1.115   -5.840  1.00 0.00 ? 70  SER A N    2  
ATOM 2513  C CA   . SER A 1 70  ? 8.995   0.358   -4.605  1.00 0.00 ? 70  SER A CA   2  
ATOM 2514  C C    . SER A 1 70  ? 8.500   1.203   -3.429  1.00 0.00 ? 70  SER A C    2  
ATOM 2515  O O    . SER A 1 70  ? 8.798   2.393   -3.347  1.00 0.00 ? 70  SER A O    2  
ATOM 2516  C CB   . SER A 1 70  ? 10.433  -0.102  -4.360  1.00 0.00 ? 70  SER A CB   2  
ATOM 2517  O OG   . SER A 1 70  ? 10.872  -1.031  -5.348  1.00 0.00 ? 70  SER A OG   2  
ATOM 2518  H H    . SER A 1 70  ? 9.737   1.184   -6.367  1.00 0.00 ? 70  SER A H    2  
ATOM 2519  H HA   . SER A 1 70  ? 8.355   -0.514  -4.746  1.00 0.00 ? 70  SER A HA   2  
ATOM 2520  H HB2  . SER A 1 70  ? 11.095  0.765   -4.359  1.00 0.00 ? 70  SER A HB2  2  
ATOM 2521  H HB3  . SER A 1 70  ? 10.505  -0.560  -3.374  1.00 0.00 ? 70  SER A HB3  2  
ATOM 2522  H HG   . SER A 1 70  ? 10.194  -1.758  -5.458  1.00 0.00 ? 70  SER A HG   2  
ATOM 2523  N N    . LEU A 1 71  ? 7.753   0.554   -2.548  1.00 0.00 ? 71  LEU A N    2  
ATOM 2524  C CA   . LEU A 1 71  ? 7.215   1.231   -1.380  1.00 0.00 ? 71  LEU A CA   2  
ATOM 2525  C C    . LEU A 1 71  ? 7.710   0.527   -0.115  1.00 0.00 ? 71  LEU A C    2  
ATOM 2526  O O    . LEU A 1 71  ? 7.405   0.956   0.997   1.00 0.00 ? 71  LEU A O    2  
ATOM 2527  C CB   . LEU A 1 71  ? 5.691   1.329   -1.473  1.00 0.00 ? 71  LEU A CB   2  
ATOM 2528  C CG   . LEU A 1 71  ? 5.062   2.589   -0.875  1.00 0.00 ? 71  LEU A CG   2  
ATOM 2529  C CD1  . LEU A 1 71  ? 5.300   3.802   -1.776  1.00 0.00 ? 71  LEU A CD1  2  
ATOM 2530  C CD2  . LEU A 1 71  ? 3.576   2.374   -0.583  1.00 0.00 ? 71  LEU A CD2  2  
ATOM 2531  H H    . LEU A 1 71  ? 7.516   -0.415  -2.622  1.00 0.00 ? 71  LEU A H    2  
ATOM 2532  H HA   . LEU A 1 71  ? 7.604   2.249   -1.385  1.00 0.00 ? 71  LEU A HA   2  
ATOM 2533  H HB2  . LEU A 1 71  ? 5.406   1.269   -2.524  1.00 0.00 ? 71  LEU A HB2  2  
ATOM 2534  H HB3  . LEU A 1 71  ? 5.260   0.460   -0.976  1.00 0.00 ? 71  LEU A HB3  2  
ATOM 2535  H HG   . LEU A 1 71  ? 5.551   2.795   0.078   1.00 0.00 ? 71  LEU A HG   2  
ATOM 2536  H HD11 . LEU A 1 71  ? 5.521   3.464   -2.789  1.00 0.00 ? 71  LEU A HD11 2  
ATOM 2537  H HD12 . LEU A 1 71  ? 4.407   4.426   -1.788  1.00 0.00 ? 71  LEU A HD12 2  
ATOM 2538  H HD13 . LEU A 1 71  ? 6.142   4.379   -1.394  1.00 0.00 ? 71  LEU A HD13 2  
ATOM 2539  H HD21 . LEU A 1 71  ? 2.990   3.129   -1.107  1.00 0.00 ? 71  LEU A HD21 2  
ATOM 2540  H HD22 . LEU A 1 71  ? 3.278   1.382   -0.923  1.00 0.00 ? 71  LEU A HD22 2  
ATOM 2541  H HD23 . LEU A 1 71  ? 3.400   2.458   0.490   1.00 0.00 ? 71  LEU A HD23 2  
ATOM 2542  N N    . VAL A 1 72  ? 8.465   -0.541  -0.327  1.00 0.00 ? 72  VAL A N    2  
ATOM 2543  C CA   . VAL A 1 72  ? 9.004   -1.308  0.783   1.00 0.00 ? 72  VAL A CA   2  
ATOM 2544  C C    . VAL A 1 72  ? 10.052  -0.468  1.516   1.00 0.00 ? 72  VAL A C    2  
ATOM 2545  O O    . VAL A 1 72  ? 11.193  -0.897  1.680   1.00 0.00 ? 72  VAL A O    2  
ATOM 2546  C CB   . VAL A 1 72  ? 9.555   -2.643  0.278   1.00 0.00 ? 72  VAL A CB   2  
ATOM 2547  C CG1  . VAL A 1 72  ? 10.764  -2.427  -0.635  1.00 0.00 ? 72  VAL A CG1  2  
ATOM 2548  C CG2  . VAL A 1 72  ? 9.907   -3.568  1.444   1.00 0.00 ? 72  VAL A CG2  2  
ATOM 2549  H H    . VAL A 1 72  ? 8.708   -0.883  -1.235  1.00 0.00 ? 72  VAL A H    2  
ATOM 2550  H HA   . VAL A 1 72  ? 8.183   -1.519  1.467   1.00 0.00 ? 72  VAL A HA   2  
ATOM 2551  H HB   . VAL A 1 72  ? 8.775   -3.126  -0.310  1.00 0.00 ? 72  VAL A HB   2  
ATOM 2552  H HG11 . VAL A 1 72  ? 10.610  -1.531  -1.236  1.00 0.00 ? 72  VAL A HG11 2  
ATOM 2553  H HG12 . VAL A 1 72  ? 11.661  -2.306  -0.027  1.00 0.00 ? 72  VAL A HG12 2  
ATOM 2554  H HG13 . VAL A 1 72  ? 10.883  -3.289  -1.290  1.00 0.00 ? 72  VAL A HG13 2  
ATOM 2555  H HG21 . VAL A 1 72  ? 10.067  -4.579  1.071   1.00 0.00 ? 72  VAL A HG21 2  
ATOM 2556  H HG22 . VAL A 1 72  ? 10.815  -3.211  1.930   1.00 0.00 ? 72  VAL A HG22 2  
ATOM 2557  H HG23 . VAL A 1 72  ? 9.088   -3.572  2.164   1.00 0.00 ? 72  VAL A HG23 2  
ATOM 2558  N N    . GLY A 1 73  ? 9.628   0.715   1.936   1.00 0.00 ? 73  GLY A N    2  
ATOM 2559  C CA   . GLY A 1 73  ? 10.516  1.619   2.647   1.00 0.00 ? 73  GLY A CA   2  
ATOM 2560  C C    . GLY A 1 73  ? 10.780  2.885   1.829   1.00 0.00 ? 73  GLY A C    2  
ATOM 2561  O O    . GLY A 1 73  ? 11.889  3.092   1.341   1.00 0.00 ? 73  GLY A O    2  
ATOM 2562  H H    . GLY A 1 73  ? 8.698   1.057   1.798   1.00 0.00 ? 73  GLY A H    2  
ATOM 2563  H HA2  . GLY A 1 73  ? 10.074  1.888   3.607   1.00 0.00 ? 73  GLY A HA2  2  
ATOM 2564  H HA3  . GLY A 1 73  ? 11.459  1.116   2.860   1.00 0.00 ? 73  GLY A HA3  2  
ATOM 2565  N N    . LEU A 1 74  ? 9.741   3.698   1.705   1.00 0.00 ? 74  LEU A N    2  
ATOM 2566  C CA   . LEU A 1 74  ? 9.847   4.938   0.954   1.00 0.00 ? 74  LEU A CA   2  
ATOM 2567  C C    . LEU A 1 74  ? 9.780   6.122   1.921   1.00 0.00 ? 74  LEU A C    2  
ATOM 2568  O O    . LEU A 1 74  ? 10.801  6.735   2.229   1.00 0.00 ? 74  LEU A O    2  
ATOM 2569  C CB   . LEU A 1 74  ? 8.791   4.986   -0.152  1.00 0.00 ? 74  LEU A CB   2  
ATOM 2570  C CG   . LEU A 1 74  ? 9.221   4.437   -1.514  1.00 0.00 ? 74  LEU A CG   2  
ATOM 2571  C CD1  . LEU A 1 74  ? 8.217   4.824   -2.602  1.00 0.00 ? 74  LEU A CD1  2  
ATOM 2572  C CD2  . LEU A 1 74  ? 10.643  4.882   -1.861  1.00 0.00 ? 74  LEU A CD2  2  
ATOM 2573  H H    . LEU A 1 74  ? 8.842   3.522   2.105   1.00 0.00 ? 74  LEU A H    2  
ATOM 2574  H HA   . LEU A 1 74  ? 10.823  4.943   0.468   1.00 0.00 ? 74  LEU A HA   2  
ATOM 2575  H HB2  . LEU A 1 74  ? 7.917   4.428   0.183   1.00 0.00 ? 74  LEU A HB2  2  
ATOM 2576  H HB3  . LEU A 1 74  ? 8.478   6.022   -0.282  1.00 0.00 ? 74  LEU A HB3  2  
ATOM 2577  H HG   . LEU A 1 74  ? 9.229   3.349   -1.456  1.00 0.00 ? 74  LEU A HG   2  
ATOM 2578  H HD11 . LEU A 1 74  ? 8.748   5.017   -3.534  1.00 0.00 ? 74  LEU A HD11 2  
ATOM 2579  H HD12 . LEU A 1 74  ? 7.509   4.008   -2.750  1.00 0.00 ? 74  LEU A HD12 2  
ATOM 2580  H HD13 . LEU A 1 74  ? 7.679   5.721   -2.298  1.00 0.00 ? 74  LEU A HD13 2  
ATOM 2581  H HD21 . LEU A 1 74  ? 10.856  5.832   -1.370  1.00 0.00 ? 74  LEU A HD21 2  
ATOM 2582  H HD22 . LEU A 1 74  ? 11.353  4.129   -1.520  1.00 0.00 ? 74  LEU A HD22 2  
ATOM 2583  H HD23 . LEU A 1 74  ? 10.732  5.004   -2.941  1.00 0.00 ? 74  LEU A HD23 2  
ATOM 2584  N N    . SER A 1 75  ? 8.568   6.408   2.373   1.00 0.00 ? 75  SER A N    2  
ATOM 2585  C CA   . SER A 1 75  ? 8.354   7.507   3.298   1.00 0.00 ? 75  SER A CA   2  
ATOM 2586  C C    . SER A 1 75  ? 6.932   8.051   3.145   1.00 0.00 ? 75  SER A C    2  
ATOM 2587  O O    . SER A 1 75  ? 6.503   8.373   2.038   1.00 0.00 ? 75  SER A O    2  
ATOM 2588  C CB   . SER A 1 75  ? 9.376   8.623   3.073   1.00 0.00 ? 75  SER A CB   2  
ATOM 2589  O OG   . SER A 1 75  ? 8.891   9.889   3.512   1.00 0.00 ? 75  SER A OG   2  
ATOM 2590  H H    . SER A 1 75  ? 7.743   5.904   2.117   1.00 0.00 ? 75  SER A H    2  
ATOM 2591  H HA   . SER A 1 75  ? 8.496   7.081   4.291   1.00 0.00 ? 75  SER A HA   2  
ATOM 2592  H HB2  . SER A 1 75  ? 10.298  8.384   3.604   1.00 0.00 ? 75  SER A HB2  2  
ATOM 2593  H HB3  . SER A 1 75  ? 9.625   8.678   2.013   1.00 0.00 ? 75  SER A HB3  2  
ATOM 2594  H HG   . SER A 1 75  ? 8.290   10.285  2.818   1.00 0.00 ? 75  SER A HG   2  
ATOM 2595  N N    . GLN A 1 76  ? 6.242   8.137   4.272   1.00 0.00 ? 76  GLN A N    2  
ATOM 2596  C CA   . GLN A 1 76  ? 4.877   8.637   4.278   1.00 0.00 ? 76  GLN A CA   2  
ATOM 2597  C C    . GLN A 1 76  ? 4.741   9.820   3.317   1.00 0.00 ? 76  GLN A C    2  
ATOM 2598  O O    . GLN A 1 76  ? 3.710   9.980   2.665   1.00 0.00 ? 76  GLN A O    2  
ATOM 2599  C CB   . GLN A 1 76  ? 4.441   9.026   5.691   1.00 0.00 ? 76  GLN A CB   2  
ATOM 2600  C CG   . GLN A 1 76  ? 2.930   9.255   5.756   1.00 0.00 ? 76  GLN A CG   2  
ATOM 2601  C CD   . GLN A 1 76  ? 2.608   10.629  6.345   1.00 0.00 ? 76  GLN A CD   2  
ATOM 2602  O OE1  . GLN A 1 76  ? 3.083   11.656  5.888   1.00 0.00 ? 76  GLN A OE1  2  
ATOM 2603  N NE2  . GLN A 1 76  ? 1.777   10.592  7.383   1.00 0.00 ? 76  GLN A NE2  2  
ATOM 2604  H H    . GLN A 1 76  ? 6.598   7.874   5.168   1.00 0.00 ? 76  GLN A H    2  
ATOM 2605  H HA   . GLN A 1 76  ? 4.263   7.806   3.930   1.00 0.00 ? 76  GLN A HA   2  
ATOM 2606  H HB2  . GLN A 1 76  ? 4.723   8.240   6.392   1.00 0.00 ? 76  GLN A HB2  2  
ATOM 2607  H HB3  . GLN A 1 76  ? 4.963   9.931   6.001   1.00 0.00 ? 76  GLN A HB3  2  
ATOM 2608  H HG2  . GLN A 1 76  ? 2.503   9.175   4.756   1.00 0.00 ? 76  GLN A HG2  2  
ATOM 2609  H HG3  . GLN A 1 76  ? 2.466   8.477   6.362   1.00 0.00 ? 76  GLN A HG3  2  
ATOM 2610  H HE21 . GLN A 1 76  ? 1.423   9.715   7.709   1.00 0.00 ? 76  GLN A HE21 2  
ATOM 2611  H HE22 . GLN A 1 76  ? 1.506   11.440  7.838   1.00 0.00 ? 76  GLN A HE22 2  
ATOM 2612  N N    . GLU A 1 77  ? 5.797   10.619  3.260   1.00 0.00 ? 77  GLU A N    2  
ATOM 2613  C CA   . GLU A 1 77  ? 5.808   11.783  2.390   1.00 0.00 ? 77  GLU A CA   2  
ATOM 2614  C C    . GLU A 1 77  ? 5.730   11.350  0.924   1.00 0.00 ? 77  GLU A C    2  
ATOM 2615  O O    . GLU A 1 77  ? 4.865   11.814  0.182   1.00 0.00 ? 77  GLU A O    2  
ATOM 2616  C CB   . GLU A 1 77  ? 7.048   12.643  2.642   1.00 0.00 ? 77  GLU A CB   2  
ATOM 2617  C CG   . GLU A 1 77  ? 6.664   13.987  3.265   1.00 0.00 ? 77  GLU A CG   2  
ATOM 2618  C CD   . GLU A 1 77  ? 5.920   13.786  4.587   1.00 0.00 ? 77  GLU A CD   2  
ATOM 2619  O OE1  . GLU A 1 77  ? 6.591   13.378  5.559   1.00 0.00 ? 77  GLU A OE1  2  
ATOM 2620  O OE2  . GLU A 1 77  ? 4.698   14.046  4.595   1.00 0.00 ? 77  GLU A OE2  2  
ATOM 2621  H H    . GLU A 1 77  ? 6.631   10.482  3.793   1.00 0.00 ? 77  GLU A H    2  
ATOM 2622  H HA   . GLU A 1 77  ? 4.918   12.352  2.656   1.00 0.00 ? 77  GLU A HA   2  
ATOM 2623  H HB2  . GLU A 1 77  ? 7.734   12.114  3.303   1.00 0.00 ? 77  GLU A HB2  2  
ATOM 2624  H HB3  . GLU A 1 77  ? 7.576   12.811  1.703   1.00 0.00 ? 77  GLU A HB3  2  
ATOM 2625  H HG2  . GLU A 1 77  ? 7.562   14.582  3.435   1.00 0.00 ? 77  GLU A HG2  2  
ATOM 2626  H HG3  . GLU A 1 77  ? 6.037   14.548  2.572   1.00 0.00 ? 77  GLU A HG3  2  
ATOM 2627  N N    . ARG A 1 78  ? 6.644   10.467  0.551   1.00 0.00 ? 78  ARG A N    2  
ATOM 2628  C CA   . ARG A 1 78  ? 6.689   9.967   -0.812  1.00 0.00 ? 78  ARG A CA   2  
ATOM 2629  C C    . ARG A 1 78  ? 5.501   9.041   -1.078  1.00 0.00 ? 78  ARG A C    2  
ATOM 2630  O O    . ARG A 1 78  ? 4.700   9.294   -1.976  1.00 0.00 ? 78  ARG A O    2  
ATOM 2631  C CB   . ARG A 1 78  ? 7.989   9.206   -1.077  1.00 0.00 ? 78  ARG A CB   2  
ATOM 2632  C CG   . ARG A 1 78  ? 8.557   9.552   -2.455  1.00 0.00 ? 78  ARG A CG   2  
ATOM 2633  C CD   . ARG A 1 78  ? 9.282   10.899  -2.427  1.00 0.00 ? 78  ARG A CD   2  
ATOM 2634  N NE   . ARG A 1 78  ? 9.279   11.504  -3.778  1.00 0.00 ? 78  ARG A NE   2  
ATOM 2635  C CZ   . ARG A 1 78  ? 10.104  12.500  -4.163  1.00 0.00 ? 78  ARG A CZ   2  
ATOM 2636  N NH1  . ARG A 1 78  ? 11.007  13.014  -3.301  1.00 0.00 ? 78  ARG A NH1  2  
ATOM 2637  N NH2  . ARG A 1 78  ? 10.014  12.966  -5.395  1.00 0.00 ? 78  ARG A NH2  2  
ATOM 2638  H H    . ARG A 1 78  ? 7.344   10.095  1.161   1.00 0.00 ? 78  ARG A H    2  
ATOM 2639  H HA   . ARG A 1 78  ? 6.639   10.858  -1.438  1.00 0.00 ? 78  ARG A HA   2  
ATOM 2640  H HB2  . ARG A 1 78  ? 8.721   9.450   -0.307  1.00 0.00 ? 78  ARG A HB2  2  
ATOM 2641  H HB3  . ARG A 1 78  ? 7.806   8.133   -1.014  1.00 0.00 ? 78  ARG A HB3  2  
ATOM 2642  H HG2  . ARG A 1 78  ? 9.246   8.771   -2.776  1.00 0.00 ? 78  ARG A HG2  2  
ATOM 2643  H HG3  . ARG A 1 78  ? 7.749   9.585   -3.187  1.00 0.00 ? 78  ARG A HG3  2  
ATOM 2644  H HD2  . ARG A 1 78  ? 8.795   11.569  -1.718  1.00 0.00 ? 78  ARG A HD2  2  
ATOM 2645  H HD3  . ARG A 1 78  ? 10.307  10.762  -2.084  1.00 0.00 ? 78  ARG A HD3  2  
ATOM 2646  H HE   . ARG A 1 78  ? 8.624   11.152  -4.447  1.00 0.00 ? 78  ARG A HE   2  
ATOM 2647  H HH11 . ARG A 1 78  ? 11.069  12.655  -2.369  1.00 0.00 ? 78  ARG A HH11 2  
ATOM 2648  H HH12 . ARG A 1 78  ? 11.615  13.752  -3.594  1.00 0.00 ? 78  ARG A HH12 2  
ATOM 2649  H HH21 . ARG A 1 78  ? 10.587  13.701  -5.758  1.00 0.00 ? 78  ARG A HH21 2  
ATOM 2650  N N    . ALA A 1 79  ? 5.424   7.986   -0.280  1.00 0.00 ? 79  ALA A N    2  
ATOM 2651  C CA   . ALA A 1 79  ? 4.347   7.020   -0.417  1.00 0.00 ? 79  ALA A CA   2  
ATOM 2652  C C    . ALA A 1 79  ? 3.021   7.763   -0.593  1.00 0.00 ? 79  ALA A C    2  
ATOM 2653  O O    . ALA A 1 79  ? 2.192   7.375   -1.415  1.00 0.00 ? 79  ALA A O    2  
ATOM 2654  C CB   . ALA A 1 79  ? 4.337   6.090   0.798   1.00 0.00 ? 79  ALA A CB   2  
ATOM 2655  H H    . ALA A 1 79  ? 6.080   7.787   0.449   1.00 0.00 ? 79  ALA A H    2  
ATOM 2656  H HA   . ALA A 1 79  ? 4.544   6.428   -1.311  1.00 0.00 ? 79  ALA A HA   2  
ATOM 2657  H HB1  . ALA A 1 79  ? 4.712   6.627   1.669   1.00 0.00 ? 79  ALA A HB1  2  
ATOM 2658  H HB2  . ALA A 1 79  ? 3.318   5.753   0.989   1.00 0.00 ? 79  ALA A HB2  2  
ATOM 2659  H HB3  . ALA A 1 79  ? 4.974   5.228   0.600   1.00 0.00 ? 79  ALA A HB3  2  
ATOM 2660  N N    . ALA A 1 80  ? 2.862   8.818   0.192   1.00 0.00 ? 80  ALA A N    2  
ATOM 2661  C CA   . ALA A 1 80  ? 1.651   9.619   0.133   1.00 0.00 ? 80  ALA A CA   2  
ATOM 2662  C C    . ALA A 1 80  ? 1.557   10.294  -1.237  1.00 0.00 ? 80  ALA A C    2  
ATOM 2663  O O    . ALA A 1 80  ? 0.513   10.246  -1.886  1.00 0.00 ? 80  ALA A O    2  
ATOM 2664  C CB   . ALA A 1 80  ? 1.651   10.630  1.281   1.00 0.00 ? 80  ALA A CB   2  
ATOM 2665  H H    . ALA A 1 80  ? 3.541   9.128   0.858   1.00 0.00 ? 80  ALA A H    2  
ATOM 2666  H HA   . ALA A 1 80  ? 0.802   8.947   0.256   1.00 0.00 ? 80  ALA A HA   2  
ATOM 2667  H HB1  . ALA A 1 80  ? 1.564   10.101  2.231   1.00 0.00 ? 80  ALA A HB1  2  
ATOM 2668  H HB2  . ALA A 1 80  ? 2.581   11.198  1.266   1.00 0.00 ? 80  ALA A HB2  2  
ATOM 2669  H HB3  . ALA A 1 80  ? 0.807   11.310  1.166   1.00 0.00 ? 80  ALA A HB3  2  
ATOM 2670  N N    . GLU A 1 81  ? 2.662   10.906  -1.637  1.00 0.00 ? 81  GLU A N    2  
ATOM 2671  C CA   . GLU A 1 81  ? 2.717   11.589  -2.918  1.00 0.00 ? 81  GLU A CA   2  
ATOM 2672  C C    . GLU A 1 81  ? 2.348   10.627  -4.049  1.00 0.00 ? 81  GLU A C    2  
ATOM 2673  O O    . GLU A 1 81  ? 1.613   10.993  -4.965  1.00 0.00 ? 81  GLU A O    2  
ATOM 2674  C CB   . GLU A 1 81  ? 4.098   12.206  -3.151  1.00 0.00 ? 81  GLU A CB   2  
ATOM 2675  C CG   . GLU A 1 81  ? 4.267   13.495  -2.344  1.00 0.00 ? 81  GLU A CG   2  
ATOM 2676  C CD   . GLU A 1 81  ? 5.676   13.593  -1.756  1.00 0.00 ? 81  GLU A CD   2  
ATOM 2677  O OE1  . GLU A 1 81  ? 6.616   13.166  -2.461  1.00 0.00 ? 81  GLU A OE1  2  
ATOM 2678  O OE2  . GLU A 1 81  ? 5.781   14.094  -0.616  1.00 0.00 ? 81  GLU A OE2  2  
ATOM 2679  H H    . GLU A 1 81  ? 3.507   10.940  -1.103  1.00 0.00 ? 81  GLU A H    2  
ATOM 2680  H HA   . GLU A 1 81  ? 1.977   12.386  -2.854  1.00 0.00 ? 81  GLU A HA   2  
ATOM 2681  H HB2  . GLU A 1 81  ? 4.872   11.492  -2.869  1.00 0.00 ? 81  GLU A HB2  2  
ATOM 2682  H HB3  . GLU A 1 81  ? 4.232   12.417  -4.212  1.00 0.00 ? 81  GLU A HB3  2  
ATOM 2683  H HG2  . GLU A 1 81  ? 4.074   14.356  -2.983  1.00 0.00 ? 81  GLU A HG2  2  
ATOM 2684  H HG3  . GLU A 1 81  ? 3.531   13.523  -1.541  1.00 0.00 ? 81  GLU A HG3  2  
ATOM 2685  N N    . LEU A 1 82  ? 2.876   9.416   -3.949  1.00 0.00 ? 82  LEU A N    2  
ATOM 2686  C CA   . LEU A 1 82  ? 2.612   8.399   -4.952  1.00 0.00 ? 82  LEU A CA   2  
ATOM 2687  C C    . LEU A 1 82  ? 1.138   7.993   -4.884  1.00 0.00 ? 82  LEU A C    2  
ATOM 2688  O O    . LEU A 1 82  ? 0.427   8.054   -5.886  1.00 0.00 ? 82  LEU A O    2  
ATOM 2689  C CB   . LEU A 1 82  ? 3.581   7.225   -4.794  1.00 0.00 ? 82  LEU A CB   2  
ATOM 2690  C CG   . LEU A 1 82  ? 4.606   7.047   -5.915  1.00 0.00 ? 82  LEU A CG   2  
ATOM 2691  C CD1  . LEU A 1 82  ? 3.916   6.761   -7.250  1.00 0.00 ? 82  LEU A CD1  2  
ATOM 2692  C CD2  . LEU A 1 82  ? 5.542   8.255   -6.000  1.00 0.00 ? 82  LEU A CD2  2  
ATOM 2693  H H    . LEU A 1 82  ? 3.474   9.127   -3.201  1.00 0.00 ? 82  LEU A H    2  
ATOM 2694  H HA   . LEU A 1 82  ? 2.802   8.845   -5.928  1.00 0.00 ? 82  LEU A HA   2  
ATOM 2695  H HB2  . LEU A 1 82  ? 4.117   7.347   -3.853  1.00 0.00 ? 82  LEU A HB2  2  
ATOM 2696  H HB3  . LEU A 1 82  ? 2.998   6.308   -4.711  1.00 0.00 ? 82  LEU A HB3  2  
ATOM 2697  H HG   . LEU A 1 82  ? 5.223   6.179   -5.679  1.00 0.00 ? 82  LEU A HG   2  
ATOM 2698  H HD11 . LEU A 1 82  ? 2.837   6.728   -7.100  1.00 0.00 ? 82  LEU A HD11 2  
ATOM 2699  H HD12 . LEU A 1 82  ? 4.160   7.550   -7.961  1.00 0.00 ? 82  LEU A HD12 2  
ATOM 2700  H HD13 . LEU A 1 82  ? 4.259   5.802   -7.638  1.00 0.00 ? 82  LEU A HD13 2  
ATOM 2701  H HD21 . LEU A 1 82  ? 6.477   7.958   -6.474  1.00 0.00 ? 82  LEU A HD21 2  
ATOM 2702  H HD22 . LEU A 1 82  ? 5.068   9.040   -6.590  1.00 0.00 ? 82  LEU A HD22 2  
ATOM 2703  H HD23 . LEU A 1 82  ? 5.746   8.628   -4.996  1.00 0.00 ? 82  LEU A HD23 2  
ATOM 2704  N N    . MET A 1 83  ? 0.723   7.587   -3.693  1.00 0.00 ? 83  MET A N    2  
ATOM 2705  C CA   . MET A 1 83  ? -0.653  7.172   -3.481  1.00 0.00 ? 83  MET A CA   2  
ATOM 2706  C C    . MET A 1 83  ? -1.629  8.273   -3.899  1.00 0.00 ? 83  MET A C    2  
ATOM 2707  O O    . MET A 1 83  ? -2.772  7.992   -4.255  1.00 0.00 ? 83  MET A O    2  
ATOM 2708  C CB   . MET A 1 83  ? -0.863  6.836   -2.003  1.00 0.00 ? 83  MET A CB   2  
ATOM 2709  C CG   . MET A 1 83  ? -1.139  5.343   -1.814  1.00 0.00 ? 83  MET A CG   2  
ATOM 2710  S SD   . MET A 1 83  ? -0.223  4.726   -0.411  1.00 0.00 ? 83  MET A SD   2  
ATOM 2711  C CE   . MET A 1 83  ? -1.133  5.496   0.917   1.00 0.00 ? 83  MET A CE   2  
ATOM 2712  H H    . MET A 1 83  ? 1.308   7.541   -2.883  1.00 0.00 ? 83  MET A H    2  
ATOM 2713  H HA   . MET A 1 83  ? -0.794  6.294   -4.111  1.00 0.00 ? 83  MET A HA   2  
ATOM 2714  H HB2  . MET A 1 83  ? 0.020   7.122   -1.432  1.00 0.00 ? 83  MET A HB2  2  
ATOM 2715  H HB3  . MET A 1 83  ? -1.698  7.416   -1.610  1.00 0.00 ? 83  MET A HB3  2  
ATOM 2716  H HG2  . MET A 1 83  ? -2.205  5.178   -1.663  1.00 0.00 ? 83  MET A HG2  2  
ATOM 2717  H HG3  . MET A 1 83  ? -0.856  4.796   -2.713  1.00 0.00 ? 83  MET A HG3  2  
ATOM 2718  H HE1  . MET A 1 83  ? -1.672  4.733   1.479   1.00 0.00 ? 83  MET A HE1  2  
ATOM 2719  H HE2  . MET A 1 83  ? -0.441  6.015   1.580   1.00 0.00 ? 83  MET A HE2  2  
ATOM 2720  H HE3  . MET A 1 83  ? -1.844  6.212   0.503   1.00 0.00 ? 83  MET A HE3  2  
ATOM 2721  N N    . THR A 1 84  ? -1.142  9.504   -3.841  1.00 0.00 ? 84  THR A N    2  
ATOM 2722  C CA   . THR A 1 84  ? -1.957  10.649  -4.209  1.00 0.00 ? 84  THR A CA   2  
ATOM 2723  C C    . THR A 1 84  ? -2.277  10.618  -5.705  1.00 0.00 ? 84  THR A C    2  
ATOM 2724  O O    . THR A 1 84  ? -3.367  10.208  -6.101  1.00 0.00 ? 84  THR A O    2  
ATOM 2725  C CB   . THR A 1 84  ? -1.218  11.916  -3.773  1.00 0.00 ? 84  THR A CB   2  
ATOM 2726  O OG1  . THR A 1 84  ? -1.326  11.909  -2.352  1.00 0.00 ? 84  THR A OG1  2  
ATOM 2727  C CG2  . THR A 1 84  ? -1.945  13.194  -4.196  1.00 0.00 ? 84  THR A CG2  2  
ATOM 2728  H H    . THR A 1 84  ? -0.211  9.724   -3.550  1.00 0.00 ? 84  THR A H    2  
ATOM 2729  H HA   . THR A 1 84  ? -2.906  10.581  -3.677  1.00 0.00 ? 84  THR A HA   2  
ATOM 2730  H HB   . THR A 1 84  ? -0.191  11.913  -4.138  1.00 0.00 ? 84  THR A HB   2  
ATOM 2731  H HG1  . THR A 1 84  ? -0.765  12.639  -1.962  1.00 0.00 ? 84  THR A HG1  2  
ATOM 2732  H HG21 . THR A 1 84  ? -1.783  13.969  -3.447  1.00 0.00 ? 84  THR A HG21 2  
ATOM 2733  H HG22 . THR A 1 84  ? -1.557  13.531  -5.157  1.00 0.00 ? 84  THR A HG22 2  
ATOM 2734  H HG23 . THR A 1 84  ? -3.012  12.992  -4.285  1.00 0.00 ? 84  THR A HG23 2  
ATOM 2735  N N    . ARG A 1 85  ? -1.308  11.055  -6.494  1.00 0.00 ? 85  ARG A N    2  
ATOM 2736  C CA   . ARG A 1 85  ? -1.472  11.082  -7.938  1.00 0.00 ? 85  ARG A CA   2  
ATOM 2737  C C    . ARG A 1 85  ? -1.543  9.657   -8.491  1.00 0.00 ? 85  ARG A C    2  
ATOM 2738  O O    . ARG A 1 85  ? -0.705  9.259   -9.298  1.00 0.00 ? 85  ARG A O    2  
ATOM 2739  C CB   . ARG A 1 85  ? -0.317  11.826  -8.610  1.00 0.00 ? 85  ARG A CB   2  
ATOM 2740  C CG   . ARG A 1 85  ? -0.680  13.291  -8.861  1.00 0.00 ? 85  ARG A CG   2  
ATOM 2741  C CD   . ARG A 1 85  ? 0.310   14.229  -8.168  1.00 0.00 ? 85  ARG A CD   2  
ATOM 2742  N NE   . ARG A 1 85  ? -0.420  15.313  -7.474  1.00 0.00 ? 85  ARG A NE   2  
ATOM 2743  C CZ   . ARG A 1 85  ? 0.174   16.326  -6.829  1.00 0.00 ? 85  ARG A CZ   2  
ATOM 2744  N NH1  . ARG A 1 85  ? 1.511   16.399  -6.784  1.00 0.00 ? 85  ARG A NH1  2  
ATOM 2745  N NH2  . ARG A 1 85  ? -0.569  17.266  -6.228  1.00 0.00 ? 85  ARG A NH2  2  
ATOM 2746  H H    . ARG A 1 85  ? -0.424  11.387  -6.164  1.00 0.00 ? 85  ARG A H    2  
ATOM 2747  H HA   . ARG A 1 85  ? -2.410  11.613  -8.101  1.00 0.00 ? 85  ARG A HA   2  
ATOM 2748  H HB2  . ARG A 1 85  ? 0.571   11.771  -7.981  1.00 0.00 ? 85  ARG A HB2  2  
ATOM 2749  H HB3  . ARG A 1 85  ? -0.069  11.342  -9.555  1.00 0.00 ? 85  ARG A HB3  2  
ATOM 2750  H HG2  . ARG A 1 85  ? -0.685  13.490  -9.933  1.00 0.00 ? 85  ARG A HG2  2  
ATOM 2751  H HG3  . ARG A 1 85  ? -1.689  13.487  -8.497  1.00 0.00 ? 85  ARG A HG3  2  
ATOM 2752  H HD2  . ARG A 1 85  ? 0.912   13.669  -7.452  1.00 0.00 ? 85  ARG A HD2  2  
ATOM 2753  H HD3  . ARG A 1 85  ? 0.997   14.652  -8.900  1.00 0.00 ? 85  ARG A HD3  2  
ATOM 2754  H HE   . ARG A 1 85  ? -1.420  15.289  -7.488  1.00 0.00 ? 85  ARG A HE   2  
ATOM 2755  H HH11 . ARG A 1 85  ? 2.066   15.698  -7.233  1.00 0.00 ? 85  ARG A HH11 2  
ATOM 2756  H HH12 . ARG A 1 85  ? 1.955   17.155  -6.303  1.00 0.00 ? 85  ARG A HH12 2  
ATOM 2757  H HH21 . ARG A 1 85  ? -1.567  17.211  -6.261  1.00 0.00 ? 85  ARG A HH21 2  
ATOM 2758  H HH22 . ARG A 1 85  ? -0.125  18.022  -5.747  1.00 0.00 ? 85  ARG A HH22 2  
ATOM 2759  N N    . THR A 1 86  ? -2.551  8.929   -8.034  1.00 0.00 ? 86  THR A N    2  
ATOM 2760  C CA   . THR A 1 86  ? -2.741  7.557   -8.472  1.00 0.00 ? 86  THR A CA   2  
ATOM 2761  C C    . THR A 1 86  ? -3.687  7.508   -9.674  1.00 0.00 ? 86  THR A C    2  
ATOM 2762  O O    . THR A 1 86  ? -3.560  6.637   -10.534 1.00 0.00 ? 86  THR A O    2  
ATOM 2763  C CB   . THR A 1 86  ? -3.236  6.742   -7.276  1.00 0.00 ? 86  THR A CB   2  
ATOM 2764  O OG1  . THR A 1 86  ? -3.767  7.720   -6.385  1.00 0.00 ? 86  THR A OG1  2  
ATOM 2765  C CG2  . THR A 1 86  ? -2.091  6.103   -6.488  1.00 0.00 ? 86  THR A CG2  2  
ATOM 2766  H H    . THR A 1 86  ? -3.228  9.260   -7.377  1.00 0.00 ? 86  THR A H    2  
ATOM 2767  H HA   . THR A 1 86  ? -1.780  7.166   -8.806  1.00 0.00 ? 86  THR A HA   2  
ATOM 2768  H HB   . THR A 1 86  ? -3.960  5.990   -7.590  1.00 0.00 ? 86  THR A HB   2  
ATOM 2769  H HG1  . THR A 1 86  ? -4.686  7.984   -6.676  1.00 0.00 ? 86  THR A HG1  2  
ATOM 2770  H HG21 . THR A 1 86  ? -1.220  6.757   -6.519  1.00 0.00 ? 86  THR A HG21 2  
ATOM 2771  H HG22 . THR A 1 86  ? -2.399  5.957   -5.453  1.00 0.00 ? 86  THR A HG22 2  
ATOM 2772  H HG23 . THR A 1 86  ? -1.838  5.140   -6.932  1.00 0.00 ? 86  THR A HG23 2  
ATOM 2773  N N    . SER A 1 87  ? -4.615  8.454   -9.695  1.00 0.00 ? 87  SER A N    2  
ATOM 2774  C CA   . SER A 1 87  ? -5.582  8.529   -10.777 1.00 0.00 ? 87  SER A CA   2  
ATOM 2775  C C    . SER A 1 87  ? -6.722  7.540   -10.530 1.00 0.00 ? 87  SER A C    2  
ATOM 2776  O O    . SER A 1 87  ? -6.738  6.846   -9.514  1.00 0.00 ? 87  SER A O    2  
ATOM 2777  C CB   . SER A 1 87  ? -4.920  8.249   -12.128 1.00 0.00 ? 87  SER A CB   2  
ATOM 2778  O OG   . SER A 1 87  ? -5.361  9.155   -13.136 1.00 0.00 ? 87  SER A OG   2  
ATOM 2779  H H    . SER A 1 87  ? -4.711  9.158   -8.992  1.00 0.00 ? 87  SER A H    2  
ATOM 2780  H HA   . SER A 1 87  ? -5.954  9.554   -10.761 1.00 0.00 ? 87  SER A HA   2  
ATOM 2781  H HB2  . SER A 1 87  ? -3.838  8.323   -12.023 1.00 0.00 ? 87  SER A HB2  2  
ATOM 2782  H HB3  . SER A 1 87  ? -5.142  7.228   -12.436 1.00 0.00 ? 87  SER A HB3  2  
ATOM 2783  H HG   . SER A 1 87  ? -6.171  8.788   -13.594 1.00 0.00 ? 87  SER A HG   2  
ATOM 2784  N N    . SER A 1 88  ? -7.649  7.506   -11.476 1.00 0.00 ? 88  SER A N    2  
ATOM 2785  C CA   . SER A 1 88  ? -8.791  6.613   -11.373 1.00 0.00 ? 88  SER A CA   2  
ATOM 2786  C C    . SER A 1 88  ? -8.317  5.159   -11.345 1.00 0.00 ? 88  SER A C    2  
ATOM 2787  O O    . SER A 1 88  ? -9.131  4.237   -11.326 1.00 0.00 ? 88  SER A O    2  
ATOM 2788  C CB   . SER A 1 88  ? -9.767  6.831   -12.531 1.00 0.00 ? 88  SER A CB   2  
ATOM 2789  O OG   . SER A 1 88  ? -9.110  6.801   -13.796 1.00 0.00 ? 88  SER A OG   2  
ATOM 2790  H H    . SER A 1 88  ? -7.629  8.073   -12.299 1.00 0.00 ? 88  SER A H    2  
ATOM 2791  H HA   . SER A 1 88  ? -9.279  6.875   -10.434 1.00 0.00 ? 88  SER A HA   2  
ATOM 2792  H HB2  . SER A 1 88  ? -10.538 6.062   -12.505 1.00 0.00 ? 88  SER A HB2  2  
ATOM 2793  H HB3  . SER A 1 88  ? -10.269 7.790   -12.407 1.00 0.00 ? 88  SER A HB3  2  
ATOM 2794  H HG   . SER A 1 88  ? -8.441  6.058   -13.816 1.00 0.00 ? 88  SER A HG   2  
ATOM 2795  N N    . VAL A 1 89  ? -7.002  4.998   -11.344 1.00 0.00 ? 89  VAL A N    2  
ATOM 2796  C CA   . VAL A 1 89  ? -6.410  3.672   -11.318 1.00 0.00 ? 89  VAL A CA   2  
ATOM 2797  C C    . VAL A 1 89  ? -5.291  3.637   -10.275 1.00 0.00 ? 89  VAL A C    2  
ATOM 2798  O O    . VAL A 1 89  ? -4.402  4.487   -10.284 1.00 0.00 ? 89  VAL A O    2  
ATOM 2799  C CB   . VAL A 1 89  ? -5.932  3.285   -12.720 1.00 0.00 ? 89  VAL A CB   2  
ATOM 2800  C CG1  . VAL A 1 89  ? -4.954  2.109   -12.661 1.00 0.00 ? 89  VAL A CG1  2  
ATOM 2801  C CG2  . VAL A 1 89  ? -7.116  2.968   -13.635 1.00 0.00 ? 89  VAL A CG2  2  
ATOM 2802  H H    . VAL A 1 89  ? -6.346  5.753   -11.359 1.00 0.00 ? 89  VAL A H    2  
ATOM 2803  H HA   . VAL A 1 89  ? -7.189  2.969   -11.022 1.00 0.00 ? 89  VAL A HA   2  
ATOM 2804  H HB   . VAL A 1 89  ? -5.403  4.140   -13.141 1.00 0.00 ? 89  VAL A HB   2  
ATOM 2805  H HG11 . VAL A 1 89  ? -4.168  2.327   -11.937 1.00 0.00 ? 89  VAL A HG11 2  
ATOM 2806  H HG12 . VAL A 1 89  ? -5.488  1.208   -12.358 1.00 0.00 ? 89  VAL A HG12 2  
ATOM 2807  H HG13 . VAL A 1 89  ? -4.511  1.956   -13.644 1.00 0.00 ? 89  VAL A HG13 2  
ATOM 2808  H HG21 . VAL A 1 89  ? -7.879  3.739   -13.522 1.00 0.00 ? 89  VAL A HG21 2  
ATOM 2809  H HG22 . VAL A 1 89  ? -6.778  2.940   -14.670 1.00 0.00 ? 89  VAL A HG22 2  
ATOM 2810  H HG23 . VAL A 1 89  ? -7.536  1.999   -13.363 1.00 0.00 ? 89  VAL A HG23 2  
ATOM 2811  N N    . VAL A 1 90  ? -5.373  2.645   -9.400  1.00 0.00 ? 90  VAL A N    2  
ATOM 2812  C CA   . VAL A 1 90  ? -4.379  2.489   -8.352  1.00 0.00 ? 90  VAL A CA   2  
ATOM 2813  C C    . VAL A 1 90  ? -3.852  1.052   -8.365  1.00 0.00 ? 90  VAL A C    2  
ATOM 2814  O O    . VAL A 1 90  ? -4.607  0.108   -8.137  1.00 0.00 ? 90  VAL A O    2  
ATOM 2815  C CB   . VAL A 1 90  ? -4.973  2.895   -7.002  1.00 0.00 ? 90  VAL A CB   2  
ATOM 2816  C CG1  . VAL A 1 90  ? -3.903  3.502   -6.092  1.00 0.00 ? 90  VAL A CG1  2  
ATOM 2817  C CG2  . VAL A 1 90  ? -6.146  3.859   -7.187  1.00 0.00 ? 90  VAL A CG2  2  
ATOM 2818  H H    . VAL A 1 90  ? -6.099  1.958   -9.399  1.00 0.00 ? 90  VAL A H    2  
ATOM 2819  H HA   . VAL A 1 90  ? -3.555  3.166   -8.576  1.00 0.00 ? 90  VAL A HA   2  
ATOM 2820  H HB   . VAL A 1 90  ? -5.353  1.995   -6.518  1.00 0.00 ? 90  VAL A HB   2  
ATOM 2821  H HG11 . VAL A 1 90  ? -3.913  4.587   -6.193  1.00 0.00 ? 90  VAL A HG11 2  
ATOM 2822  H HG12 . VAL A 1 90  ? -4.111  3.231   -5.056  1.00 0.00 ? 90  VAL A HG12 2  
ATOM 2823  H HG13 . VAL A 1 90  ? -2.923  3.119   -6.378  1.00 0.00 ? 90  VAL A HG13 2  
ATOM 2824  H HG21 . VAL A 1 90  ? -7.032  3.300   -7.489  1.00 0.00 ? 90  VAL A HG21 2  
ATOM 2825  H HG22 . VAL A 1 90  ? -6.345  4.375   -6.247  1.00 0.00 ? 90  VAL A HG22 2  
ATOM 2826  H HG23 . VAL A 1 90  ? -5.898  4.590   -7.957  1.00 0.00 ? 90  VAL A HG23 2  
ATOM 2827  N N    . THR A 1 91  ? -2.560  0.932   -8.634  1.00 0.00 ? 91  THR A N    2  
ATOM 2828  C CA   . THR A 1 91  ? -1.923  -0.373  -8.680  1.00 0.00 ? 91  THR A CA   2  
ATOM 2829  C C    . THR A 1 91  ? -0.747  -0.428  -7.703  1.00 0.00 ? 91  THR A C    2  
ATOM 2830  O O    . THR A 1 91  ? 0.327   0.098   -7.990  1.00 0.00 ? 91  THR A O    2  
ATOM 2831  C CB   . THR A 1 91  ? -1.523  -0.653  -10.130 1.00 0.00 ? 91  THR A CB   2  
ATOM 2832  O OG1  . THR A 1 91  ? -1.073  -2.005  -10.111 1.00 0.00 ? 91  THR A OG1  2  
ATOM 2833  C CG2  . THR A 1 91  ? -0.290  0.144   -10.561 1.00 0.00 ? 91  THR A CG2  2  
ATOM 2834  H H    . THR A 1 91  ? -1.953  1.705   -8.818  1.00 0.00 ? 91  THR A H    2  
ATOM 2835  H HA   . THR A 1 91  ? -2.646  -1.120  -8.351  1.00 0.00 ? 91  THR A HA   2  
ATOM 2836  H HB   . THR A 1 91  ? -2.359  -0.474  -10.806 1.00 0.00 ? 91  THR A HB   2  
ATOM 2837  H HG1  . THR A 1 91  ? -0.269  -2.090  -9.522  1.00 0.00 ? 91  THR A HG1  2  
ATOM 2838  H HG21 . THR A 1 91  ? 0.602   -0.297  -10.116 1.00 0.00 ? 91  THR A HG21 2  
ATOM 2839  H HG22 . THR A 1 91  ? -0.204  0.121   -11.647 1.00 0.00 ? 91  THR A HG22 2  
ATOM 2840  H HG23 . THR A 1 91  ? -0.390  1.177   -10.226 1.00 0.00 ? 91  THR A HG23 2  
ATOM 2841  N N    . LEU A 1 92  ? -0.990  -1.069  -6.569  1.00 0.00 ? 92  LEU A N    2  
ATOM 2842  C CA   . LEU A 1 92  ? 0.036   -1.199  -5.548  1.00 0.00 ? 92  LEU A CA   2  
ATOM 2843  C C    . LEU A 1 92  ? 0.097   -2.653  -5.075  1.00 0.00 ? 92  LEU A C    2  
ATOM 2844  O O    . LEU A 1 92  ? -0.915  -3.352  -5.075  1.00 0.00 ? 92  LEU A O    2  
ATOM 2845  C CB   . LEU A 1 92  ? -0.202  -0.194  -4.419  1.00 0.00 ? 92  LEU A CB   2  
ATOM 2846  C CG   . LEU A 1 92  ? -1.664  0.079   -4.061  1.00 0.00 ? 92  LEU A CG   2  
ATOM 2847  C CD1  . LEU A 1 92  ? -2.367  0.854   -5.177  1.00 0.00 ? 92  LEU A CD1  2  
ATOM 2848  C CD2  . LEU A 1 92  ? -2.396  -1.220  -3.717  1.00 0.00 ? 92  LEU A CD2  2  
ATOM 2849  H H    . LEU A 1 92  ? -1.867  -1.494  -6.344  1.00 0.00 ? 92  LEU A H    2  
ATOM 2850  H HA   . LEU A 1 92  ? 0.990   -0.945  -6.010  1.00 0.00 ? 92  LEU A HA   2  
ATOM 2851  H HB2  . LEU A 1 92  ? 0.309   -0.554  -3.526  1.00 0.00 ? 92  LEU A HB2  2  
ATOM 2852  H HB3  . LEU A 1 92  ? 0.266   0.750   -4.696  1.00 0.00 ? 92  LEU A HB3  2  
ATOM 2853  H HG   . LEU A 1 92  ? -1.686  0.707   -3.170  1.00 0.00 ? 92  LEU A HG   2  
ATOM 2854  H HD11 . LEU A 1 92  ? -3.139  1.491   -4.746  1.00 0.00 ? 92  LEU A HD11 2  
ATOM 2855  H HD12 . LEU A 1 92  ? -1.639  1.471   -5.705  1.00 0.00 ? 92  LEU A HD12 2  
ATOM 2856  H HD13 . LEU A 1 92  ? -2.822  0.152   -5.876  1.00 0.00 ? 92  LEU A HD13 2  
ATOM 2857  H HD21 . LEU A 1 92  ? -1.668  -1.991  -3.463  1.00 0.00 ? 92  LEU A HD21 2  
ATOM 2858  H HD22 . LEU A 1 92  ? -3.056  -1.050  -2.866  1.00 0.00 ? 92  LEU A HD22 2  
ATOM 2859  H HD23 . LEU A 1 92  ? -2.984  -1.544  -4.575  1.00 0.00 ? 92  LEU A HD23 2  
ATOM 2860  N N    . GLU A 1 93  ? 1.294   -3.064  -4.685  1.00 0.00 ? 93  GLU A N    2  
ATOM 2861  C CA   . GLU A 1 93  ? 1.501   -4.422  -4.210  1.00 0.00 ? 93  GLU A CA   2  
ATOM 2862  C C    . GLU A 1 93  ? 1.532   -4.451  -2.681  1.00 0.00 ? 93  GLU A C    2  
ATOM 2863  O O    . GLU A 1 93  ? 2.469   -3.945  -2.065  1.00 0.00 ? 93  GLU A O    2  
ATOM 2864  C CB   . GLU A 1 93  ? 2.782   -5.018  -4.796  1.00 0.00 ? 93  GLU A CB   2  
ATOM 2865  C CG   . GLU A 1 93  ? 2.644   -5.242  -6.303  1.00 0.00 ? 93  GLU A CG   2  
ATOM 2866  C CD   . GLU A 1 93  ? 3.799   -6.090  -6.840  1.00 0.00 ? 93  GLU A CD   2  
ATOM 2867  O OE1  . GLU A 1 93  ? 3.642   -7.330  -6.837  1.00 0.00 ? 93  GLU A OE1  2  
ATOM 2868  O OE2  . GLU A 1 93  ? 4.813   -5.479  -7.241  1.00 0.00 ? 93  GLU A OE2  2  
ATOM 2869  H H    . GLU A 1 93  ? 2.112   -2.489  -4.688  1.00 0.00 ? 93  GLU A H    2  
ATOM 2870  H HA   . GLU A 1 93  ? 0.644   -4.989  -4.574  1.00 0.00 ? 93  GLU A HA   2  
ATOM 2871  H HB2  . GLU A 1 93  ? 3.621   -4.351  -4.599  1.00 0.00 ? 93  GLU A HB2  2  
ATOM 2872  H HB3  . GLU A 1 93  ? 3.006   -5.965  -4.303  1.00 0.00 ? 93  GLU A HB3  2  
ATOM 2873  H HG2  . GLU A 1 93  ? 1.696   -5.737  -6.515  1.00 0.00 ? 93  GLU A HG2  2  
ATOM 2874  H HG3  . GLU A 1 93  ? 2.624   -4.281  -6.817  1.00 0.00 ? 93  GLU A HG3  2  
ATOM 2875  N N    . VAL A 1 94  ? 0.495   -5.049  -2.111  1.00 0.00 ? 94  VAL A N    2  
ATOM 2876  C CA   . VAL A 1 94  ? 0.392   -5.150  -0.665  1.00 0.00 ? 94  VAL A CA   2  
ATOM 2877  C C    . VAL A 1 94  ? 0.341   -6.626  -0.265  1.00 0.00 ? 94  VAL A C    2  
ATOM 2878  O O    . VAL A 1 94  ? -0.275  -7.439  -0.953  1.00 0.00 ? 94  VAL A O    2  
ATOM 2879  C CB   . VAL A 1 94  ? -0.817  -4.354  -0.170  1.00 0.00 ? 94  VAL A CB   2  
ATOM 2880  C CG1  . VAL A 1 94  ? -1.007  -3.078  -0.992  1.00 0.00 ? 94  VAL A CG1  2  
ATOM 2881  C CG2  . VAL A 1 94  ? -2.083  -5.211  -0.188  1.00 0.00 ? 94  VAL A CG2  2  
ATOM 2882  H H    . VAL A 1 94  ? -0.263  -5.458  -2.619  1.00 0.00 ? 94  VAL A H    2  
ATOM 2883  H HA   . VAL A 1 94  ? 1.289   -4.702  -0.239  1.00 0.00 ? 94  VAL A HA   2  
ATOM 2884  H HB   . VAL A 1 94  ? -0.625  -4.061  0.862   1.00 0.00 ? 94  VAL A HB   2  
ATOM 2885  H HG11 . VAL A 1 94  ? -1.146  -3.339  -2.041  1.00 0.00 ? 94  VAL A HG11 2  
ATOM 2886  H HG12 . VAL A 1 94  ? -1.884  -2.541  -0.632  1.00 0.00 ? 94  VAL A HG12 2  
ATOM 2887  H HG13 . VAL A 1 94  ? -0.126  -2.444  -0.890  1.00 0.00 ? 94  VAL A HG13 2  
ATOM 2888  H HG21 . VAL A 1 94  ? -2.961  -4.564  -0.180  1.00 0.00 ? 94  VAL A HG21 2  
ATOM 2889  H HG22 . VAL A 1 94  ? -2.093  -5.826  -1.088  1.00 0.00 ? 94  VAL A HG22 2  
ATOM 2890  H HG23 . VAL A 1 94  ? -2.099  -5.855  0.692   1.00 0.00 ? 94  VAL A HG23 2  
ATOM 2891  N N    . ALA A 1 95  ? 0.995   -6.927  0.847   1.00 0.00 ? 95  ALA A N    2  
ATOM 2892  C CA   . ALA A 1 95  ? 1.032   -8.291  1.348   1.00 0.00 ? 95  ALA A CA   2  
ATOM 2893  C C    . ALA A 1 95  ? 1.104   -8.267  2.876   1.00 0.00 ? 95  ALA A C    2  
ATOM 2894  O O    . ALA A 1 95  ? 1.173   -7.198  3.481   1.00 0.00 ? 95  ALA A O    2  
ATOM 2895  C CB   . ALA A 1 95  ? 2.212   -9.034  0.720   1.00 0.00 ? 95  ALA A CB   2  
ATOM 2896  H H    . ALA A 1 95  ? 1.493   -6.260  1.401   1.00 0.00 ? 95  ALA A H    2  
ATOM 2897  H HA   . ALA A 1 95  ? 0.107   -8.781  1.044   1.00 0.00 ? 95  ALA A HA   2  
ATOM 2898  H HB1  . ALA A 1 95  ? 1.853   -9.670  -0.090  1.00 0.00 ? 95  ALA A HB1  2  
ATOM 2899  H HB2  . ALA A 1 95  ? 2.927   -8.312  0.325   1.00 0.00 ? 95  ALA A HB2  2  
ATOM 2900  H HB3  . ALA A 1 95  ? 2.698   -9.650  1.477   1.00 0.00 ? 95  ALA A HB3  2  
ATOM 2901  N N    . LYS A 1 96  ? 1.085   -9.458  3.456   1.00 0.00 ? 96  LYS A N    2  
ATOM 2902  C CA   . LYS A 1 96  ? 1.148   -9.587  4.902   1.00 0.00 ? 96  LYS A CA   2  
ATOM 2903  C C    . LYS A 1 96  ? 1.130   -11.070 5.279   1.00 0.00 ? 96  LYS A C    2  
ATOM 2904  O O    . LYS A 1 96  ? 2.094   -11.581 5.847   1.00 0.00 ? 96  LYS A O    2  
ATOM 2905  C CB   . LYS A 1 96  ? 0.034   -8.771  5.562   1.00 0.00 ? 96  LYS A CB   2  
ATOM 2906  C CG   . LYS A 1 96  ? 0.020   -8.987  7.076   1.00 0.00 ? 96  LYS A CG   2  
ATOM 2907  C CD   . LYS A 1 96  ? -1.414  -9.052  7.607   1.00 0.00 ? 96  LYS A CD   2  
ATOM 2908  C CE   . LYS A 1 96  ? -2.053  -10.407 7.298   1.00 0.00 ? 96  LYS A CE   2  
ATOM 2909  N NZ   . LYS A 1 96  ? -3.112  -10.259 6.274   1.00 0.00 ? 96  LYS A NZ   2  
ATOM 2910  H H    . LYS A 1 96  ? 1.029   -10.322 2.957   1.00 0.00 ? 96  LYS A H    2  
ATOM 2911  H HA   . LYS A 1 96  ? 2.096   -9.159  5.227   1.00 0.00 ? 96  LYS A HA   2  
ATOM 2912  H HB2  . LYS A 1 96  ? 0.175   -7.713  5.343   1.00 0.00 ? 96  LYS A HB2  2  
ATOM 2913  H HB3  . LYS A 1 96  ? -0.929  -9.058  5.140   1.00 0.00 ? 96  LYS A HB3  2  
ATOM 2914  H HG2  . LYS A 1 96  ? 0.543   -9.912  7.320   1.00 0.00 ? 96  LYS A HG2  2  
ATOM 2915  H HG3  . LYS A 1 96  ? 0.558   -8.177  7.568   1.00 0.00 ? 96  LYS A HG3  2  
ATOM 2916  H HD2  . LYS A 1 96  ? -1.414  -8.883  8.684   1.00 0.00 ? 96  LYS A HD2  2  
ATOM 2917  H HD3  . LYS A 1 96  ? -2.007  -8.255  7.159   1.00 0.00 ? 96  LYS A HD3  2  
ATOM 2918  H HE2  . LYS A 1 96  ? -1.292  -11.102 6.944   1.00 0.00 ? 96  LYS A HE2  2  
ATOM 2919  H HE3  . LYS A 1 96  ? -2.476  -10.832 8.208   1.00 0.00 ? 96  LYS A HE3  2  
ATOM 2920  H HZ1  . LYS A 1 96  ? -3.315  -9.289  6.142   1.00 0.00 ? 96  LYS A HZ1  2  
ATOM 2921  H HZ2  . LYS A 1 96  ? -2.798  -10.654 5.411   1.00 0.00 ? 96  LYS A HZ2  2  
ATOM 2922  H HZ3  . LYS A 1 96  ? -3.937  -10.734 6.577   1.00 0.00 ? 96  LYS A HZ3  2  
ATOM 2923  N N    . GLN A 1 97  ? 0.024   -11.718 4.946   1.00 0.00 ? 97  GLN A N    2  
ATOM 2924  C CA   . GLN A 1 97  ? -0.132  -13.132 5.243   1.00 0.00 ? 97  GLN A CA   2  
ATOM 2925  C C    . GLN A 1 97  ? -0.280  -13.346 6.751   1.00 0.00 ? 97  GLN A C    2  
ATOM 2926  O O    . GLN A 1 97  ? 0.678   -13.169 7.503   1.00 0.00 ? 97  GLN A O    2  
ATOM 2927  C CB   . GLN A 1 97  ? 1.041   -13.942 4.687   1.00 0.00 ? 97  GLN A CB   2  
ATOM 2928  C CG   . GLN A 1 97  ? 0.568   -14.930 3.619   1.00 0.00 ? 97  GLN A CG   2  
ATOM 2929  C CD   . GLN A 1 97  ? 1.141   -16.326 3.872   1.00 0.00 ? 97  GLN A CD   2  
ATOM 2930  O OE1  . GLN A 1 97  ? 1.453   -16.705 4.989   1.00 0.00 ? 97  GLN A OE1  2  
ATOM 2931  N NE2  . GLN A 1 97  ? 1.263   -17.068 2.774   1.00 0.00 ? 97  GLN A NE2  2  
ATOM 2932  H H    . GLN A 1 97  ? -0.755  -11.295 4.484   1.00 0.00 ? 97  GLN A H    2  
ATOM 2933  H HA   . GLN A 1 97  ? -1.048  -13.435 4.735   1.00 0.00 ? 97  GLN A HA   2  
ATOM 2934  H HB2  . GLN A 1 97  ? 1.783   -13.267 4.260   1.00 0.00 ? 97  GLN A HB2  2  
ATOM 2935  H HB3  . GLN A 1 97  ? 1.531   -14.482 5.497   1.00 0.00 ? 97  GLN A HB3  2  
ATOM 2936  H HG2  . GLN A 1 97  ? -0.521  -14.976 3.617   1.00 0.00 ? 97  GLN A HG2  2  
ATOM 2937  H HG3  . GLN A 1 97  ? 0.874   -14.580 2.633   1.00 0.00 ? 97  GLN A HG3  2  
ATOM 2938  H HE21 . GLN A 1 97  ? 0.988   -16.697 1.887   1.00 0.00 ? 97  GLN A HE21 2  
ATOM 2939  H HE22 . GLN A 1 97  ? 1.629   -17.996 2.836   1.00 0.00 ? 97  GLN A HE22 2  
ATOM 2940  N N    . GLY A 1 98  ? -1.486  -13.722 7.148   1.00 0.00 ? 98  GLY A N    2  
ATOM 2941  C CA   . GLY A 1 98  ? -1.771  -13.961 8.552   1.00 0.00 ? 98  GLY A CA   2  
ATOM 2942  C C    . GLY A 1 98  ? -3.261  -14.233 8.771   1.00 0.00 ? 98  GLY A C    2  
ATOM 2943  O O    . GLY A 1 98  ? -4.040  -13.305 8.986   1.00 0.00 ? 98  GLY A O    2  
ATOM 2944  H H    . GLY A 1 98  ? -2.260  -13.863 6.529   1.00 0.00 ? 98  GLY A H    2  
ATOM 2945  H HA2  . GLY A 1 98  ? -1.187  -14.811 8.906   1.00 0.00 ? 98  GLY A HA2  2  
ATOM 2946  H HA3  . GLY A 1 98  ? -1.466  -13.097 9.141   1.00 0.00 ? 98  GLY A HA3  2  
ATOM 2947  N N    . ALA A 1 99  ? -3.613  -15.509 8.708   1.00 0.00 ? 99  ALA A N    2  
ATOM 2948  C CA   . ALA A 1 99  ? -4.995  -15.914 8.896   1.00 0.00 ? 99  ALA A CA   2  
ATOM 2949  C C    . ALA A 1 99  ? -5.876  -15.200 7.870   1.00 0.00 ? 99  ALA A C    2  
ATOM 2950  O O    . ALA A 1 99  ? -6.137  -14.004 7.996   1.00 0.00 ? 99  ALA A O    2  
ATOM 2951  C CB   . ALA A 1 99  ? -5.422  -15.620 10.336  1.00 0.00 ? 99  ALA A CB   2  
ATOM 2952  H H    . ALA A 1 99  ? -2.973  -16.257 8.533   1.00 0.00 ? 99  ALA A H    2  
ATOM 2953  H HA   . ALA A 1 99  ? -5.052  -16.989 8.726   1.00 0.00 ? 99  ALA A HA   2  
ATOM 2954  H HB1  . ALA A 1 99  ? -4.562  -15.722 10.998  1.00 0.00 ? 99  ALA A HB1  2  
ATOM 2955  H HB2  . ALA A 1 99  ? -5.811  -14.604 10.399  1.00 0.00 ? 99  ALA A HB2  2  
ATOM 2956  H HB3  . ALA A 1 99  ? -6.197  -16.326 10.637  1.00 0.00 ? 99  ALA A HB3  2  
ATOM 2957  N N    . ILE A 1 100 ? -6.310  -15.962 6.877   1.00 0.00 ? 100 ILE A N    2  
ATOM 2958  C CA   . ILE A 1 100 ? -7.157  -15.417 5.829   1.00 0.00 ? 100 ILE A CA   2  
ATOM 2959  C C    . ILE A 1 100 ? -8.398  -16.297 5.672   1.00 0.00 ? 100 ILE A C    2  
ATOM 2960  O O    . ILE A 1 100 ? -8.346  -17.500 5.923   1.00 0.00 ? 100 ILE A O    2  
ATOM 2961  C CB   . ILE A 1 100 ? -6.360  -15.240 4.535   1.00 0.00 ? 100 ILE A CB   2  
ATOM 2962  C CG1  . ILE A 1 100 ? -5.139  -14.346 4.760   1.00 0.00 ? 100 ILE A CG1  2  
ATOM 2963  C CG2  . ILE A 1 100 ? -7.254  -14.718 3.408   1.00 0.00 ? 100 ILE A CG2  2  
ATOM 2964  C CD1  . ILE A 1 100 ? -5.508  -12.868 4.616   1.00 0.00 ? 100 ILE A CD1  2  
ATOM 2965  H H    . ILE A 1 100 ? -6.093  -16.934 6.782   1.00 0.00 ? 100 ILE A H    2  
ATOM 2966  H HA   . ILE A 1 100 ? -7.475  -14.425 6.150   1.00 0.00 ? 100 ILE A HA   2  
ATOM 2967  H HB   . ILE A 1 100 ? -5.991  -16.218 4.225   1.00 0.00 ? 100 ILE A HB   2  
ATOM 2968  H HG12 . ILE A 1 100 ? -4.729  -14.528 5.753   1.00 0.00 ? 100 ILE A HG12 2  
ATOM 2969  H HG13 . ILE A 1 100 ? -4.360  -14.601 4.042   1.00 0.00 ? 100 ILE A HG13 2  
ATOM 2970  H HG21 . ILE A 1 100 ? -6.680  -14.669 2.483   1.00 0.00 ? 100 ILE A HG21 2  
ATOM 2971  H HG22 . ILE A 1 100 ? -8.102  -15.390 3.275   1.00 0.00 ? 100 ILE A HG22 2  
ATOM 2972  H HG23 . ILE A 1 100 ? -7.616  -13.722 3.664   1.00 0.00 ? 100 ILE A HG23 2  
ATOM 2973  H HD11 . ILE A 1 100 ? -4.784  -12.259 5.157   1.00 0.00 ? 100 ILE A HD11 2  
ATOM 2974  H HD12 . ILE A 1 100 ? -5.500  -12.592 3.562   1.00 0.00 ? 100 ILE A HD12 2  
ATOM 2975  H HD13 . ILE A 1 100 ? -6.504  -12.701 5.028   1.00 0.00 ? 100 ILE A HD13 2  
ATOM 2976  N N    . TYR A 1 101 ? -9.485  -15.663 5.258   1.00 0.00 ? 101 TYR A N    2  
ATOM 2977  C CA   . TYR A 1 101 ? -10.738 -16.374 5.065   1.00 0.00 ? 101 TYR A CA   2  
ATOM 2978  C C    . TYR A 1 101 ? -11.419 -15.941 3.765   1.00 0.00 ? 101 TYR A C    2  
ATOM 2979  O O    . TYR A 1 101 ? -11.009 -14.963 3.141   1.00 0.00 ? 101 TYR A O    2  
ATOM 2980  C CB   . TYR A 1 101 ? -11.629 -15.986 6.247   1.00 0.00 ? 101 TYR A CB   2  
ATOM 2981  C CG   . TYR A 1 101 ? -11.938 -14.490 6.329   1.00 0.00 ? 101 TYR A CG   2  
ATOM 2982  C CD1  . TYR A 1 101 ? -12.918 -13.943 5.527   1.00 0.00 ? 101 TYR A CD1  2  
ATOM 2983  C CD2  . TYR A 1 101 ? -11.236 -13.688 7.206   1.00 0.00 ? 101 TYR A CD2  2  
ATOM 2984  C CE1  . TYR A 1 101 ? -13.209 -12.535 5.604   1.00 0.00 ? 101 TYR A CE1  2  
ATOM 2985  C CE2  . TYR A 1 101 ? -11.527 -12.280 7.284   1.00 0.00 ? 101 TYR A CE2  2  
ATOM 2986  C CZ   . TYR A 1 101 ? -12.499 -11.772 6.479   1.00 0.00 ? 101 TYR A CZ   2  
ATOM 2987  O OH   . TYR A 1 101 ? -12.773 -10.442 6.552   1.00 0.00 ? 101 TYR A OH   2  
ATOM 2988  H H    . TYR A 1 101 ? -9.519  -14.684 5.056   1.00 0.00 ? 101 TYR A H    2  
ATOM 2989  H HA   . TYR A 1 101 ? -10.516 -17.439 5.013   1.00 0.00 ? 101 TYR A HA   2  
ATOM 2990  H HB2  . TYR A 1 101 ? -12.567 -16.537 6.177   1.00 0.00 ? 101 TYR A HB2  2  
ATOM 2991  H HB3  . TYR A 1 101 ? -11.144 -16.298 7.172   1.00 0.00 ? 101 TYR A HB3  2  
ATOM 2992  H HD1  . TYR A 1 101 ? -13.473 -14.576 4.834   1.00 0.00 ? 101 TYR A HD1  2  
ATOM 2993  H HD2  . TYR A 1 101 ? -10.462 -14.120 7.840   1.00 0.00 ? 101 TYR A HD2  2  
ATOM 2994  H HE1  . TYR A 1 101 ? -13.981 -12.089 4.976   1.00 0.00 ? 101 TYR A HE1  2  
ATOM 2995  H HE2  . TYR A 1 101 ? -10.980 -11.635 7.972   1.00 0.00 ? 101 TYR A HE2  2  
ATOM 2996  H HH   . TYR A 1 101 ? -13.715 -10.304 6.859   1.00 0.00 ? 101 TYR A HH   2  
ATOM 2997  N N    . GLY A 1 1   ? 13.962  0.198   -4.608  1.00 0.00 ? 1   GLY A N    3  
ATOM 2998  C CA   . GLY A 1 1   ? 13.824  -0.771  -3.534  1.00 0.00 ? 1   GLY A CA   3  
ATOM 2999  C C    . GLY A 1 1   ? 13.944  -2.200  -4.066  1.00 0.00 ? 1   GLY A C    3  
ATOM 3000  O O    . GLY A 1 1   ? 13.754  -2.442  -5.257  1.00 0.00 ? 1   GLY A O    3  
ATOM 3001  H H1   . GLY A 1 1   ? 13.102  0.501   -5.017  1.00 0.00 ? 1   GLY A H1   3  
ATOM 3002  H HA2  . GLY A 1 1   ? 14.590  -0.594  -2.779  1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3003  H HA3  . GLY A 1 1   ? 12.858  -0.641  -3.045  1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3004  N N    . PRO A 1 2   ? 14.268  -3.135  -3.132  1.00 0.00 ? 2   PRO A N    3  
ATOM 3005  C CA   . PRO A 1 2   ? 14.416  -4.534  -3.495  1.00 0.00 ? 2   PRO A CA   3  
ATOM 3006  C C    . PRO A 1 2   ? 13.052  -5.188  -3.726  1.00 0.00 ? 2   PRO A C    3  
ATOM 3007  O O    . PRO A 1 2   ? 12.407  -5.639  -2.781  1.00 0.00 ? 2   PRO A O    3  
ATOM 3008  C CB   . PRO A 1 2   ? 15.186  -5.160  -2.343  1.00 0.00 ? 2   PRO A CB   3  
ATOM 3009  C CG   . PRO A 1 2   ? 15.036  -4.202  -1.173  1.00 0.00 ? 2   PRO A CG   3  
ATOM 3010  C CD   . PRO A 1 2   ? 14.501  -2.886  -1.713  1.00 0.00 ? 2   PRO A CD   3  
ATOM 3011  H HA   . PRO A 1 2   ? 14.909  -4.619  -4.360  1.00 0.00 ? 2   PRO A HA   3  
ATOM 3012  H HB2  . PRO A 1 2   ? 14.788  -6.144  -2.096  1.00 0.00 ? 2   PRO A HB2  3  
ATOM 3013  H HB3  . PRO A 1 2   ? 16.235  -5.297  -2.604  1.00 0.00 ? 2   PRO A HB3  3  
ATOM 3014  H HG2  . PRO A 1 2   ? 14.356  -4.613  -0.427  1.00 0.00 ? 2   PRO A HG2  3  
ATOM 3015  H HG3  . PRO A 1 2   ? 15.996  -4.049  -0.679  1.00 0.00 ? 2   PRO A HG3  3  
ATOM 3016  H HD2  . PRO A 1 2   ? 13.581  -2.594  -1.206  1.00 0.00 ? 2   PRO A HD2  3  
ATOM 3017  H HD3  . PRO A 1 2   ? 15.216  -2.077  -1.565  1.00 0.00 ? 2   PRO A HD3  3  
ATOM 3018  N N    . LEU A 1 3   ? 12.653  -5.218  -4.990  1.00 0.00 ? 3   LEU A N    3  
ATOM 3019  C CA   . LEU A 1 3   ? 11.377  -5.809  -5.357  1.00 0.00 ? 3   LEU A CA   3  
ATOM 3020  C C    . LEU A 1 3   ? 11.405  -7.307  -5.046  1.00 0.00 ? 3   LEU A C    3  
ATOM 3021  O O    . LEU A 1 3   ? 12.025  -8.084  -5.770  1.00 0.00 ? 3   LEU A O    3  
ATOM 3022  C CB   . LEU A 1 3   ? 11.040  -5.490  -6.815  1.00 0.00 ? 3   LEU A CB   3  
ATOM 3023  C CG   . LEU A 1 3   ? 9.578   -5.685  -7.223  1.00 0.00 ? 3   LEU A CG   3  
ATOM 3024  C CD1  . LEU A 1 3   ? 9.140   -4.612  -8.221  1.00 0.00 ? 3   LEU A CD1  3  
ATOM 3025  C CD2  . LEU A 1 3   ? 9.343   -7.098  -7.761  1.00 0.00 ? 3   LEU A CD2  3  
ATOM 3026  H H    . LEU A 1 3   ? 13.183  -4.849  -5.753  1.00 0.00 ? 3   LEU A H    3  
ATOM 3027  H HA   . LEU A 1 3   ? 10.610  -5.342  -4.740  1.00 0.00 ? 3   LEU A HA   3  
ATOM 3028  H HB2  . LEU A 1 3   ? 11.317  -4.455  -7.014  1.00 0.00 ? 3   LEU A HB2  3  
ATOM 3029  H HB3  . LEU A 1 3   ? 11.662  -6.115  -7.456  1.00 0.00 ? 3   LEU A HB3  3  
ATOM 3030  H HG   . LEU A 1 3   ? 8.957   -5.571  -6.335  1.00 0.00 ? 3   LEU A HG   3  
ATOM 3031  H HD11 . LEU A 1 3   ? 8.078   -4.405  -8.090  1.00 0.00 ? 3   LEU A HD11 3  
ATOM 3032  H HD12 . LEU A 1 3   ? 9.711   -3.700  -8.049  1.00 0.00 ? 3   LEU A HD12 3  
ATOM 3033  H HD13 . LEU A 1 3   ? 9.318   -4.965  -9.237  1.00 0.00 ? 3   LEU A HD13 3  
ATOM 3034  H HD21 . LEU A 1 3   ? 8.378   -7.465  -7.409  1.00 0.00 ? 3   LEU A HD21 3  
ATOM 3035  H HD22 . LEU A 1 3   ? 9.348   -7.078  -8.851  1.00 0.00 ? 3   LEU A HD22 3  
ATOM 3036  H HD23 . LEU A 1 3   ? 10.134  -7.758  -7.406  1.00 0.00 ? 3   LEU A HD23 3  
ATOM 3037  N N    . GLY A 1 4   ? 10.725  -7.667  -3.967  1.00 0.00 ? 4   GLY A N    3  
ATOM 3038  C CA   . GLY A 1 4   ? 10.664  -9.058  -3.551  1.00 0.00 ? 4   GLY A CA   3  
ATOM 3039  C C    . GLY A 1 4   ? 9.413   -9.742  -4.106  1.00 0.00 ? 4   GLY A C    3  
ATOM 3040  O O    . GLY A 1 4   ? 8.506   -10.091 -3.352  1.00 0.00 ? 4   GLY A O    3  
ATOM 3041  H H    . GLY A 1 4   ? 10.224  -7.029  -3.383  1.00 0.00 ? 4   GLY A H    3  
ATOM 3042  H HA2  . GLY A 1 4   ? 11.554  -9.584  -3.896  1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3043  H HA3  . GLY A 1 4   ? 10.662  -9.116  -2.463  1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3044  N N    . SER A 1 5   ? 9.404   -9.913  -5.420  1.00 0.00 ? 5   SER A N    3  
ATOM 3045  C CA   . SER A 1 5   ? 8.279   -10.548 -6.084  1.00 0.00 ? 5   SER A CA   3  
ATOM 3046  C C    . SER A 1 5   ? 8.175   -12.012 -5.650  1.00 0.00 ? 5   SER A C    3  
ATOM 3047  O O    . SER A 1 5   ? 9.183   -12.710 -5.561  1.00 0.00 ? 5   SER A O    3  
ATOM 3048  C CB   . SER A 1 5   ? 8.413   -10.454 -7.605  1.00 0.00 ? 5   SER A CB   3  
ATOM 3049  O OG   . SER A 1 5   ? 9.596   -11.092 -8.078  1.00 0.00 ? 5   SER A OG   3  
ATOM 3050  H H    . SER A 1 5   ? 10.146  -9.626  -6.026  1.00 0.00 ? 5   SER A H    3  
ATOM 3051  H HA   . SER A 1 5   ? 7.401   -9.990  -5.762  1.00 0.00 ? 5   SER A HA   3  
ATOM 3052  H HB2  . SER A 1 5   ? 7.542   -10.911 -8.075  1.00 0.00 ? 5   SER A HB2  3  
ATOM 3053  H HB3  . SER A 1 5   ? 8.423   -9.406  -7.904  1.00 0.00 ? 5   SER A HB3  3  
ATOM 3054  H HG   . SER A 1 5   ? 9.495   -11.326 -9.045  1.00 0.00 ? 5   SER A HG   3  
ATOM 3055  N N    . LEU A 1 6   ? 6.945   -12.433 -5.392  1.00 0.00 ? 6   LEU A N    3  
ATOM 3056  C CA   . LEU A 1 6   ? 6.696   -13.801 -4.970  1.00 0.00 ? 6   LEU A CA   3  
ATOM 3057  C C    . LEU A 1 6   ? 7.416   -14.061 -3.646  1.00 0.00 ? 6   LEU A C    3  
ATOM 3058  O O    . LEU A 1 6   ? 8.334   -14.877 -3.584  1.00 0.00 ? 6   LEU A O    3  
ATOM 3059  C CB   . LEU A 1 6   ? 7.077   -14.782 -6.081  1.00 0.00 ? 6   LEU A CB   3  
ATOM 3060  C CG   . LEU A 1 6   ? 6.646   -16.235 -5.869  1.00 0.00 ? 6   LEU A CG   3  
ATOM 3061  C CD1  . LEU A 1 6   ? 5.333   -16.529 -6.598  1.00 0.00 ? 6   LEU A CD1  3  
ATOM 3062  C CD2  . LEU A 1 6   ? 7.758   -17.202 -6.278  1.00 0.00 ? 6   LEU A CD2  3  
ATOM 3063  H H    . LEU A 1 6   ? 6.130   -11.858 -5.467  1.00 0.00 ? 6   LEU A H    3  
ATOM 3064  H HA   . LEU A 1 6   ? 5.623   -13.901 -4.806  1.00 0.00 ? 6   LEU A HA   3  
ATOM 3065  H HB2  . LEU A 1 6   ? 6.643   -14.428 -7.016  1.00 0.00 ? 6   LEU A HB2  3  
ATOM 3066  H HB3  . LEU A 1 6   ? 8.160   -14.759 -6.202  1.00 0.00 ? 6   LEU A HB3  3  
ATOM 3067  H HG   . LEU A 1 6   ? 6.463   -16.385 -4.805  1.00 0.00 ? 6   LEU A HG   3  
ATOM 3068  H HD11 . LEU A 1 6   ? 5.379   -16.121 -7.608  1.00 0.00 ? 6   LEU A HD11 3  
ATOM 3069  H HD12 . LEU A 1 6   ? 5.180   -17.607 -6.649  1.00 0.00 ? 6   LEU A HD12 3  
ATOM 3070  H HD13 . LEU A 1 6   ? 4.506   -16.069 -6.057  1.00 0.00 ? 6   LEU A HD13 3  
ATOM 3071  H HD21 . LEU A 1 6   ? 8.576   -16.643 -6.734  1.00 0.00 ? 6   LEU A HD21 3  
ATOM 3072  H HD22 . LEU A 1 6   ? 8.125   -17.728 -5.397  1.00 0.00 ? 6   LEU A HD22 3  
ATOM 3073  H HD23 . LEU A 1 6   ? 7.367   -17.924 -6.995  1.00 0.00 ? 6   LEU A HD23 3  
ATOM 3074  N N    . ARG A 1 7   ? 6.973   -13.351 -2.619  1.00 0.00 ? 7   ARG A N    3  
ATOM 3075  C CA   . ARG A 1 7   ? 7.564   -13.495 -1.299  1.00 0.00 ? 7   ARG A CA   3  
ATOM 3076  C C    . ARG A 1 7   ? 6.571   -14.158 -0.342  1.00 0.00 ? 7   ARG A C    3  
ATOM 3077  O O    . ARG A 1 7   ? 5.718   -13.486 0.237   1.00 0.00 ? 7   ARG A O    3  
ATOM 3078  C CB   . ARG A 1 7   ? 7.980   -12.136 -0.731  1.00 0.00 ? 7   ARG A CB   3  
ATOM 3079  C CG   . ARG A 1 7   ? 9.052   -12.298 0.348   1.00 0.00 ? 7   ARG A CG   3  
ATOM 3080  C CD   . ARG A 1 7   ? 8.418   -12.457 1.732   1.00 0.00 ? 7   ARG A CD   3  
ATOM 3081  N NE   . ARG A 1 7   ? 8.563   -11.202 2.502   1.00 0.00 ? 7   ARG A NE   3  
ATOM 3082  C CZ   . ARG A 1 7   ? 9.741   -10.678 2.869   1.00 0.00 ? 7   ARG A CZ   3  
ATOM 3083  N NH1  . ARG A 1 7   ? 10.882  -11.297 2.538   1.00 0.00 ? 7   ARG A NH1  3  
ATOM 3084  N NH2  . ARG A 1 7   ? 9.777   -9.535  3.568   1.00 0.00 ? 7   ARG A NH2  3  
ATOM 3085  H H    . ARG A 1 7   ? 6.226   -12.689 -2.677  1.00 0.00 ? 7   ARG A H    3  
ATOM 3086  H HA   . ARG A 1 7   ? 8.440   -14.124 -1.453  1.00 0.00 ? 7   ARG A HA   3  
ATOM 3087  H HB2  . ARG A 1 7   ? 8.359   -11.503 -1.533  1.00 0.00 ? 7   ARG A HB2  3  
ATOM 3088  H HB3  . ARG A 1 7   ? 7.110   -11.632 -0.311  1.00 0.00 ? 7   ARG A HB3  3  
ATOM 3089  H HG2  . ARG A 1 7   ? 9.669   -13.169 0.125   1.00 0.00 ? 7   ARG A HG2  3  
ATOM 3090  H HG3  . ARG A 1 7   ? 9.711   -11.430 0.344   1.00 0.00 ? 7   ARG A HG3  3  
ATOM 3091  H HD2  . ARG A 1 7   ? 7.363   -12.711 1.630   1.00 0.00 ? 7   ARG A HD2  3  
ATOM 3092  H HD3  . ARG A 1 7   ? 8.894   -13.280 2.266   1.00 0.00 ? 7   ARG A HD3  3  
ATOM 3093  H HE   . ARG A 1 7   ? 7.731   -10.715 2.766   1.00 0.00 ? 7   ARG A HE   3  
ATOM 3094  H HH11 . ARG A 1 7   ? 10.855  -12.151 2.017   1.00 0.00 ? 7   ARG A HH11 3  
ATOM 3095  H HH12 . ARG A 1 7   ? 11.761  -10.906 2.812   1.00 0.00 ? 7   ARG A HH12 3  
ATOM 3096  H HH21 . ARG A 1 7   ? 8.925   -9.073  3.815   1.00 0.00 ? 7   ARG A HH21 3  
ATOM 3097  H HH22 . ARG A 1 7   ? 10.656  -9.144  3.841   1.00 0.00 ? 7   ARG A HH22 3  
ATOM 3098  N N    . LYS A 1 8   ? 6.715   -15.468 -0.205  1.00 0.00 ? 8   LYS A N    3  
ATOM 3099  C CA   . LYS A 1 8   ? 5.841   -16.229 0.671   1.00 0.00 ? 8   LYS A CA   3  
ATOM 3100  C C    . LYS A 1 8   ? 4.385   -15.863 0.377   1.00 0.00 ? 8   LYS A C    3  
ATOM 3101  O O    . LYS A 1 8   ? 3.607   -15.610 1.295   1.00 0.00 ? 8   LYS A O    3  
ATOM 3102  C CB   . LYS A 1 8   ? 6.242   -16.027 2.134   1.00 0.00 ? 8   LYS A CB   3  
ATOM 3103  C CG   . LYS A 1 8   ? 7.500   -16.830 2.474   1.00 0.00 ? 8   LYS A CG   3  
ATOM 3104  C CD   . LYS A 1 8   ? 7.247   -17.770 3.654   1.00 0.00 ? 8   LYS A CD   3  
ATOM 3105  C CE   . LYS A 1 8   ? 8.338   -18.839 3.747   1.00 0.00 ? 8   LYS A CE   3  
ATOM 3106  N NZ   . LYS A 1 8   ? 7.907   -20.080 3.066   1.00 0.00 ? 8   LYS A NZ   3  
ATOM 3107  H H    . LYS A 1 8   ? 7.411   -16.006 -0.680  1.00 0.00 ? 8   LYS A H    3  
ATOM 3108  H HA   . LYS A 1 8   ? 5.986   -17.284 0.441   1.00 0.00 ? 8   LYS A HA   3  
ATOM 3109  H HB2  . LYS A 1 8   ? 6.420   -14.968 2.324   1.00 0.00 ? 8   LYS A HB2  3  
ATOM 3110  H HB3  . LYS A 1 8   ? 5.423   -16.333 2.785   1.00 0.00 ? 8   LYS A HB3  3  
ATOM 3111  H HG2  . LYS A 1 8   ? 7.812   -17.408 1.605   1.00 0.00 ? 8   LYS A HG2  3  
ATOM 3112  H HG3  . LYS A 1 8   ? 8.316   -16.149 2.715   1.00 0.00 ? 8   LYS A HG3  3  
ATOM 3113  H HD2  . LYS A 1 8   ? 7.215   -17.196 4.581   1.00 0.00 ? 8   LYS A HD2  3  
ATOM 3114  H HD3  . LYS A 1 8   ? 6.274   -18.248 3.542   1.00 0.00 ? 8   LYS A HD3  3  
ATOM 3115  H HE2  . LYS A 1 8   ? 9.257   -18.468 3.294   1.00 0.00 ? 8   LYS A HE2  3  
ATOM 3116  H HE3  . LYS A 1 8   ? 8.561   -19.049 4.793   1.00 0.00 ? 8   LYS A HE3  3  
ATOM 3117  H HZ1  . LYS A 1 8   ? 8.609   -20.783 3.180   1.00 0.00 ? 8   LYS A HZ1  3  
ATOM 3118  H HZ2  . LYS A 1 8   ? 7.048   -20.399 3.467   1.00 0.00 ? 8   LYS A HZ2  3  
ATOM 3119  H HZ3  . LYS A 1 8   ? 7.773   -19.897 2.092   1.00 0.00 ? 8   LYS A HZ3  3  
ATOM 3120  N N    . GLU A 1 9   ? 4.061   -15.847 -0.908  1.00 0.00 ? 9   GLU A N    3  
ATOM 3121  C CA   . GLU A 1 9   ? 2.712   -15.516 -1.335  1.00 0.00 ? 9   GLU A CA   3  
ATOM 3122  C C    . GLU A 1 9   ? 2.384   -14.065 -0.979  1.00 0.00 ? 9   GLU A C    3  
ATOM 3123  O O    . GLU A 1 9   ? 1.858   -13.790 0.098   1.00 0.00 ? 9   GLU A O    3  
ATOM 3124  C CB   . GLU A 1 9   ? 1.692   -16.476 -0.721  1.00 0.00 ? 9   GLU A CB   3  
ATOM 3125  C CG   . GLU A 1 9   ? 1.651   -17.799 -1.489  1.00 0.00 ? 9   GLU A CG   3  
ATOM 3126  C CD   . GLU A 1 9   ? 1.795   -18.989 -0.539  1.00 0.00 ? 9   GLU A CD   3  
ATOM 3127  O OE1  . GLU A 1 9   ? 0.794   -19.295 0.144   1.00 0.00 ? 9   GLU A OE1  3  
ATOM 3128  O OE2  . GLU A 1 9   ? 2.904   -19.567 -0.518  1.00 0.00 ? 9   GLU A OE2  3  
ATOM 3129  H H    . GLU A 1 9   ? 4.700   -16.054 -1.649  1.00 0.00 ? 9   GLU A H    3  
ATOM 3130  H HA   . GLU A 1 9   ? 2.713   -15.641 -2.418  1.00 0.00 ? 9   GLU A HA   3  
ATOM 3131  H HB2  . GLU A 1 9   ? 1.947   -16.665 0.322   1.00 0.00 ? 9   GLU A HB2  3  
ATOM 3132  H HB3  . GLU A 1 9   ? 0.704   -16.016 -0.729  1.00 0.00 ? 9   GLU A HB3  3  
ATOM 3133  H HG2  . GLU A 1 9   ? 0.711   -17.877 -2.036  1.00 0.00 ? 9   GLU A HG2  3  
ATOM 3134  H HG3  . GLU A 1 9   ? 2.452   -17.819 -2.228  1.00 0.00 ? 9   GLU A HG3  3  
ATOM 3135  N N    . PRO A 1 10  ? 2.716   -13.151 -1.930  1.00 0.00 ? 10  PRO A N    3  
ATOM 3136  C CA   . PRO A 1 10  ? 2.461   -11.735 -1.728  1.00 0.00 ? 10  PRO A CA   3  
ATOM 3137  C C    . PRO A 1 10  ? 0.974   -11.416 -1.891  1.00 0.00 ? 10  PRO A C    3  
ATOM 3138  O O    . PRO A 1 10  ? 0.155   -12.320 -2.047  1.00 0.00 ? 10  PRO A O    3  
ATOM 3139  C CB   . PRO A 1 10  ? 3.336   -11.028 -2.750  1.00 0.00 ? 10  PRO A CB   3  
ATOM 3140  C CG   . PRO A 1 10  ? 3.692   -12.077 -3.791  1.00 0.00 ? 10  PRO A CG   3  
ATOM 3141  C CD   . PRO A 1 10  ? 3.340   -13.440 -3.218  1.00 0.00 ? 10  PRO A CD   3  
ATOM 3142  H HA   . PRO A 1 10  ? 2.696   -11.470 -0.792  1.00 0.00 ? 10  PRO A HA   3  
ATOM 3143  H HB2  . PRO A 1 10  ? 2.807   -10.190 -3.204  1.00 0.00 ? 10  PRO A HB2  3  
ATOM 3144  H HB3  . PRO A 1 10  ? 4.233   -10.622 -2.282  1.00 0.00 ? 10  PRO A HB3  3  
ATOM 3145  H HG2  . PRO A 1 10  ? 3.144   -11.898 -4.716  1.00 0.00 ? 10  PRO A HG2  3  
ATOM 3146  H HG3  . PRO A 1 10  ? 4.753   -12.028 -4.035  1.00 0.00 ? 10  PRO A HG3  3  
ATOM 3147  H HD2  . PRO A 1 10  ? 2.659   -13.982 -3.875  1.00 0.00 ? 10  PRO A HD2  3  
ATOM 3148  H HD3  . PRO A 1 10  ? 4.228   -14.060 -3.097  1.00 0.00 ? 10  PRO A HD3  3  
ATOM 3149  N N    . GLU A 1 11  ? 0.670   -10.127 -1.851  1.00 0.00 ? 11  GLU A N    3  
ATOM 3150  C CA   . GLU A 1 11  ? -0.705  -9.677  -1.993  1.00 0.00 ? 11  GLU A CA   3  
ATOM 3151  C C    . GLU A 1 11  ? -0.761  -8.396  -2.827  1.00 0.00 ? 11  GLU A C    3  
ATOM 3152  O O    . GLU A 1 11  ? -0.631  -7.296  -2.291  1.00 0.00 ? 11  GLU A O    3  
ATOM 3153  C CB   . GLU A 1 11  ? -1.358  -9.470  -0.625  1.00 0.00 ? 11  GLU A CB   3  
ATOM 3154  C CG   . GLU A 1 11  ? -2.870  -9.690  -0.700  1.00 0.00 ? 11  GLU A CG   3  
ATOM 3155  C CD   . GLU A 1 11  ? -3.231  -11.140 -0.371  1.00 0.00 ? 11  GLU A CD   3  
ATOM 3156  O OE1  . GLU A 1 11  ? -2.402  -11.793 0.298   1.00 0.00 ? 11  GLU A OE1  3  
ATOM 3157  O OE2  . GLU A 1 11  ? -4.328  -11.562 -0.797  1.00 0.00 ? 11  GLU A OE2  3  
ATOM 3158  H H    . GLU A 1 11  ? 1.342   -9.397  -1.724  1.00 0.00 ? 11  GLU A H    3  
ATOM 3159  H HA   . GLU A 1 11  ? -1.220  -10.482 -2.516  1.00 0.00 ? 11  GLU A HA   3  
ATOM 3160  H HB2  . GLU A 1 11  ? -0.922  -10.160 0.098   1.00 0.00 ? 11  GLU A HB2  3  
ATOM 3161  H HB3  . GLU A 1 11  ? -1.150  -8.462  -0.267  1.00 0.00 ? 11  GLU A HB3  3  
ATOM 3162  H HG2  . GLU A 1 11  ? -3.374  -9.019  -0.004  1.00 0.00 ? 11  GLU A HG2  3  
ATOM 3163  H HG3  . GLU A 1 11  ? -3.228  -9.440  -1.699  1.00 0.00 ? 11  GLU A HG3  3  
ATOM 3164  N N    . ILE A 1 12  ? -0.954  -8.580  -4.124  1.00 0.00 ? 12  ILE A N    3  
ATOM 3165  C CA   . ILE A 1 12  ? -1.029  -7.453  -5.037  1.00 0.00 ? 12  ILE A CA   3  
ATOM 3166  C C    . ILE A 1 12  ? -2.380  -6.755  -4.870  1.00 0.00 ? 12  ILE A C    3  
ATOM 3167  O O    . ILE A 1 12  ? -3.269  -7.270  -4.194  1.00 0.00 ? 12  ILE A O    3  
ATOM 3168  C CB   . ILE A 1 12  ? -0.744  -7.904  -6.471  1.00 0.00 ? 12  ILE A CB   3  
ATOM 3169  C CG1  . ILE A 1 12  ? -1.929  -8.682  -7.047  1.00 0.00 ? 12  ILE A CG1  3  
ATOM 3170  C CG2  . ILE A 1 12  ? 0.558   -8.705  -6.545  1.00 0.00 ? 12  ILE A CG2  3  
ATOM 3171  C CD1  . ILE A 1 12  ? -1.759  -8.906  -8.551  1.00 0.00 ? 12  ILE A CD1  3  
ATOM 3172  H H    . ILE A 1 12  ? -1.059  -9.478  -4.552  1.00 0.00 ? 12  ILE A H    3  
ATOM 3173  H HA   . ILE A 1 12  ? -0.241  -6.753  -4.758  1.00 0.00 ? 12  ILE A HA   3  
ATOM 3174  H HB   . ILE A 1 12  ? -0.611  -7.016  -7.089  1.00 0.00 ? 12  ILE A HB   3  
ATOM 3175  H HG12 . ILE A 1 12  ? -2.018  -9.644  -6.540  1.00 0.00 ? 12  ILE A HG12 3  
ATOM 3176  H HG13 . ILE A 1 12  ? -2.853  -8.136  -6.859  1.00 0.00 ? 12  ILE A HG13 3  
ATOM 3177  H HG21 . ILE A 1 12  ? 1.129   -8.556  -5.629  1.00 0.00 ? 12  ILE A HG21 3  
ATOM 3178  H HG22 . ILE A 1 12  ? 0.327   -9.764  -6.661  1.00 0.00 ? 12  ILE A HG22 3  
ATOM 3179  H HG23 . ILE A 1 12  ? 1.145   -8.366  -7.399  1.00 0.00 ? 12  ILE A HG23 3  
ATOM 3180  H HD11 . ILE A 1 12  ? -0.728  -9.188  -8.762  1.00 0.00 ? 12  ILE A HD11 3  
ATOM 3181  H HD12 . ILE A 1 12  ? -2.428  -9.703  -8.877  1.00 0.00 ? 12  ILE A HD12 3  
ATOM 3182  H HD13 . ILE A 1 12  ? -2.001  -7.987  -9.084  1.00 0.00 ? 12  ILE A HD13 3  
ATOM 3183  N N    . ILE A 1 13  ? -2.492  -5.593  -5.497  1.00 0.00 ? 13  ILE A N    3  
ATOM 3184  C CA   . ILE A 1 13  ? -3.720  -4.819  -5.425  1.00 0.00 ? 13  ILE A CA   3  
ATOM 3185  C C    . ILE A 1 13  ? -3.822  -3.919  -6.658  1.00 0.00 ? 13  ILE A C    3  
ATOM 3186  O O    . ILE A 1 13  ? -2.881  -3.196  -6.983  1.00 0.00 ? 13  ILE A O    3  
ATOM 3187  C CB   . ILE A 1 13  ? -3.798  -4.059  -4.100  1.00 0.00 ? 13  ILE A CB   3  
ATOM 3188  C CG1  . ILE A 1 13  ? -2.445  -3.439  -3.743  1.00 0.00 ? 13  ILE A CG1  3  
ATOM 3189  C CG2  . ILE A 1 13  ? -4.329  -4.959  -2.982  1.00 0.00 ? 13  ILE A CG2  3  
ATOM 3190  C CD1  . ILE A 1 13  ? -2.627  -2.169  -2.910  1.00 0.00 ? 13  ILE A CD1  3  
ATOM 3191  H H    . ILE A 1 13  ? -1.764  -5.181  -6.044  1.00 0.00 ? 13  ILE A H    3  
ATOM 3192  H HA   . ILE A 1 13  ? -4.551  -5.524  -5.442  1.00 0.00 ? 13  ILE A HA   3  
ATOM 3193  H HB   . ILE A 1 13  ? -4.507  -3.239  -4.218  1.00 0.00 ? 13  ILE A HB   3  
ATOM 3194  H HG12 . ILE A 1 13  ? -1.846  -4.160  -3.187  1.00 0.00 ? 13  ILE A HG12 3  
ATOM 3195  H HG13 . ILE A 1 13  ? -1.897  -3.204  -4.655  1.00 0.00 ? 13  ILE A HG13 3  
ATOM 3196  H HG21 . ILE A 1 13  ? -5.062  -5.653  -3.392  1.00 0.00 ? 13  ILE A HG21 3  
ATOM 3197  H HG22 . ILE A 1 13  ? -3.503  -5.519  -2.544  1.00 0.00 ? 13  ILE A HG22 3  
ATOM 3198  H HG23 . ILE A 1 13  ? -4.799  -4.345  -2.214  1.00 0.00 ? 13  ILE A HG23 3  
ATOM 3199  H HD11 . ILE A 1 13  ? -1.656  -1.705  -2.737  1.00 0.00 ? 13  ILE A HD11 3  
ATOM 3200  H HD12 . ILE A 1 13  ? -3.272  -1.472  -3.445  1.00 0.00 ? 13  ILE A HD12 3  
ATOM 3201  H HD13 . ILE A 1 13  ? -3.083  -2.424  -1.953  1.00 0.00 ? 13  ILE A HD13 3  
ATOM 3202  N N    . THR A 1 14  ? -4.973  -3.991  -7.310  1.00 0.00 ? 14  THR A N    3  
ATOM 3203  C CA   . THR A 1 14  ? -5.211  -3.191  -8.499  1.00 0.00 ? 14  THR A CA   3  
ATOM 3204  C C    . THR A 1 14  ? -6.703  -2.888  -8.649  1.00 0.00 ? 14  THR A C    3  
ATOM 3205  O O    . THR A 1 14  ? -7.498  -3.787  -8.921  1.00 0.00 ? 14  THR A O    3  
ATOM 3206  C CB   . THR A 1 14  ? -4.619  -3.937  -9.697  1.00 0.00 ? 14  THR A CB   3  
ATOM 3207  O OG1  . THR A 1 14  ? -4.979  -5.297  -9.471  1.00 0.00 ? 14  THR A OG1  3  
ATOM 3208  C CG2  . THR A 1 14  ? -3.089  -3.948  -9.682  1.00 0.00 ? 14  THR A CG2  3  
ATOM 3209  H H    . THR A 1 14  ? -5.734  -4.581  -7.039  1.00 0.00 ? 14  THR A H    3  
ATOM 3210  H HA   . THR A 1 14  ? -4.702  -2.235  -8.378  1.00 0.00 ? 14  THR A HA   3  
ATOM 3211  H HB   . THR A 1 14  ? -4.996  -3.529  -10.635 1.00 0.00 ? 14  THR A HB   3  
ATOM 3212  H HG1  . THR A 1 14  ? -4.640  -5.869  -10.218 1.00 0.00 ? 14  THR A HG1  3  
ATOM 3213  H HG21 . THR A 1 14  ? -2.721  -4.451  -10.576 1.00 0.00 ? 14  THR A HG21 3  
ATOM 3214  H HG22 . THR A 1 14  ? -2.718  -2.924  -9.662  1.00 0.00 ? 14  THR A HG22 3  
ATOM 3215  H HG23 . THR A 1 14  ? -2.739  -4.479  -8.796  1.00 0.00 ? 14  THR A HG23 3  
ATOM 3216  N N    . VAL A 1 15  ? -7.038  -1.620  -8.466  1.00 0.00 ? 15  VAL A N    3  
ATOM 3217  C CA   . VAL A 1 15  ? -8.421  -1.187  -8.577  1.00 0.00 ? 15  VAL A CA   3  
ATOM 3218  C C    . VAL A 1 15  ? -8.460  0.264   -9.059  1.00 0.00 ? 15  VAL A C    3  
ATOM 3219  O O    . VAL A 1 15  ? -7.564  1.048   -8.751  1.00 0.00 ? 15  VAL A O    3  
ATOM 3220  C CB   . VAL A 1 15  ? -9.143  -1.394  -7.244  1.00 0.00 ? 15  VAL A CB   3  
ATOM 3221  C CG1  . VAL A 1 15  ? -9.241  -2.881  -6.898  1.00 0.00 ? 15  VAL A CG1  3  
ATOM 3222  C CG2  . VAL A 1 15  ? -8.455  -0.614  -6.122  1.00 0.00 ? 15  VAL A CG2  3  
ATOM 3223  H H    . VAL A 1 15  ? -6.386  -0.895  -8.245  1.00 0.00 ? 15  VAL A H    3  
ATOM 3224  H HA   . VAL A 1 15  ? -8.904  -1.818  -9.323  1.00 0.00 ? 15  VAL A HA   3  
ATOM 3225  H HB   . VAL A 1 15  ? -10.157 -1.007  -7.348  1.00 0.00 ? 15  VAL A HB   3  
ATOM 3226  H HG11 . VAL A 1 15  ? -9.419  -3.454  -7.807  1.00 0.00 ? 15  VAL A HG11 3  
ATOM 3227  H HG12 . VAL A 1 15  ? -8.308  -3.209  -6.439  1.00 0.00 ? 15  VAL A HG12 3  
ATOM 3228  H HG13 . VAL A 1 15  ? -10.064 -3.039  -6.201  1.00 0.00 ? 15  VAL A HG13 3  
ATOM 3229  H HG21 . VAL A 1 15  ? -8.825  -0.962  -5.157  1.00 0.00 ? 15  VAL A HG21 3  
ATOM 3230  H HG22 . VAL A 1 15  ? -7.378  -0.772  -6.176  1.00 0.00 ? 15  VAL A HG22 3  
ATOM 3231  H HG23 . VAL A 1 15  ? -8.673  0.449   -6.232  1.00 0.00 ? 15  VAL A HG23 3  
ATOM 3232  N N    . THR A 1 16  ? -9.507  0.578   -9.808  1.00 0.00 ? 16  THR A N    3  
ATOM 3233  C CA   . THR A 1 16  ? -9.675  1.921   -10.336 1.00 0.00 ? 16  THR A CA   3  
ATOM 3234  C C    . THR A 1 16  ? -10.208 2.858   -9.250  1.00 0.00 ? 16  THR A C    3  
ATOM 3235  O O    . THR A 1 16  ? -11.265 2.606   -8.673  1.00 0.00 ? 16  THR A O    3  
ATOM 3236  C CB   . THR A 1 16  ? -10.581 1.836   -11.565 1.00 0.00 ? 16  THR A CB   3  
ATOM 3237  O OG1  . THR A 1 16  ? -11.886 1.655   -11.022 1.00 0.00 ? 16  THR A OG1  3  
ATOM 3238  C CG2  . THR A 1 16  ? -10.339 0.567   -12.385 1.00 0.00 ? 16  THR A CG2  3  
ATOM 3239  H H    . THR A 1 16  ? -10.232 -0.066  -10.054 1.00 0.00 ? 16  THR A H    3  
ATOM 3240  H HA   . THR A 1 16  ? -8.696  2.298   -10.631 1.00 0.00 ? 16  THR A HA   3  
ATOM 3241  H HB   . THR A 1 16  ? -10.480 2.726   -12.186 1.00 0.00 ? 16  THR A HB   3  
ATOM 3242  H HG1  . THR A 1 16  ? -11.964 0.745   -10.614 1.00 0.00 ? 16  THR A HG1  3  
ATOM 3243  H HG21 . THR A 1 16  ? -9.427  0.081   -12.040 1.00 0.00 ? 16  THR A HG21 3  
ATOM 3244  H HG22 . THR A 1 16  ? -11.183 -0.112  -12.261 1.00 0.00 ? 16  THR A HG22 3  
ATOM 3245  H HG23 . THR A 1 16  ? -10.236 0.830   -13.438 1.00 0.00 ? 16  THR A HG23 3  
ATOM 3246  N N    . LEU A 1 17  ? -9.454  3.919   -9.006  1.00 0.00 ? 17  LEU A N    3  
ATOM 3247  C CA   . LEU A 1 17  ? -9.837  4.895   -8.000  1.00 0.00 ? 17  LEU A CA   3  
ATOM 3248  C C    . LEU A 1 17  ? -11.173 5.528   -8.394  1.00 0.00 ? 17  LEU A C    3  
ATOM 3249  O O    . LEU A 1 17  ? -12.039 4.861   -8.958  1.00 0.00 ? 17  LEU A O    3  
ATOM 3250  C CB   . LEU A 1 17  ? -8.715  5.911   -7.784  1.00 0.00 ? 17  LEU A CB   3  
ATOM 3251  C CG   . LEU A 1 17  ? -8.703  6.618   -6.427  1.00 0.00 ? 17  LEU A CG   3  
ATOM 3252  C CD1  . LEU A 1 17  ? -8.723  8.138   -6.601  1.00 0.00 ? 17  LEU A CD1  3  
ATOM 3253  C CD2  . LEU A 1 17  ? -9.850  6.128   -5.542  1.00 0.00 ? 17  LEU A CD2  3  
ATOM 3254  H H    . LEU A 1 17  ? -8.596  4.116   -9.480  1.00 0.00 ? 17  LEU A H    3  
ATOM 3255  H HA   . LEU A 1 17  ? -9.973  4.359   -7.060  1.00 0.00 ? 17  LEU A HA   3  
ATOM 3256  H HB2  . LEU A 1 17  ? -7.760  5.402   -7.914  1.00 0.00 ? 17  LEU A HB2  3  
ATOM 3257  H HB3  . LEU A 1 17  ? -8.781  6.668   -8.565  1.00 0.00 ? 17  LEU A HB3  3  
ATOM 3258  H HG   . LEU A 1 17  ? -7.773  6.365   -5.918  1.00 0.00 ? 17  LEU A HG   3  
ATOM 3259  H HD11 . LEU A 1 17  ? -7.968  8.588   -5.955  1.00 0.00 ? 17  LEU A HD11 3  
ATOM 3260  H HD12 . LEU A 1 17  ? -8.507  8.388   -7.640  1.00 0.00 ? 17  LEU A HD12 3  
ATOM 3261  H HD13 . LEU A 1 17  ? -9.707  8.522   -6.332  1.00 0.00 ? 17  LEU A HD13 3  
ATOM 3262  H HD21 . LEU A 1 17  ? -10.728 5.936   -6.159  1.00 0.00 ? 17  LEU A HD21 3  
ATOM 3263  H HD22 . LEU A 1 17  ? -9.553  5.208   -5.038  1.00 0.00 ? 17  LEU A HD22 3  
ATOM 3264  H HD23 . LEU A 1 17  ? -10.088 6.889   -4.799  1.00 0.00 ? 17  LEU A HD23 3  
ATOM 3265  N N    . LYS A 1 18  ? -11.299 6.810   -8.081  1.00 0.00 ? 18  LYS A N    3  
ATOM 3266  C CA   . LYS A 1 18  ? -12.514 7.541   -8.396  1.00 0.00 ? 18  LYS A CA   3  
ATOM 3267  C C    . LYS A 1 18  ? -13.726 6.735   -7.923  1.00 0.00 ? 18  LYS A C    3  
ATOM 3268  O O    . LYS A 1 18  ? -14.848 6.976   -8.366  1.00 0.00 ? 18  LYS A O    3  
ATOM 3269  C CB   . LYS A 1 18  ? -12.556 7.898   -9.883  1.00 0.00 ? 18  LYS A CB   3  
ATOM 3270  C CG   . LYS A 1 18  ? -13.412 9.143   -10.125 1.00 0.00 ? 18  LYS A CG   3  
ATOM 3271  C CD   . LYS A 1 18  ? -14.824 8.758   -10.570 1.00 0.00 ? 18  LYS A CD   3  
ATOM 3272  C CE   . LYS A 1 18  ? -15.380 9.775   -11.569 1.00 0.00 ? 18  LYS A CE   3  
ATOM 3273  N NZ   . LYS A 1 18  ? -16.404 9.146   -12.433 1.00 0.00 ? 18  LYS A NZ   3  
ATOM 3274  H H    . LYS A 1 18  ? -10.590 7.345   -7.622  1.00 0.00 ? 18  LYS A H    3  
ATOM 3275  H HA   . LYS A 1 18  ? -12.485 8.478   -7.840  1.00 0.00 ? 18  LYS A HA   3  
ATOM 3276  H HB2  . LYS A 1 18  ? -11.543 8.072   -10.247 1.00 0.00 ? 18  LYS A HB2  3  
ATOM 3277  H HB3  . LYS A 1 18  ? -12.958 7.059   -10.451 1.00 0.00 ? 18  LYS A HB3  3  
ATOM 3278  H HG2  . LYS A 1 18  ? -13.463 9.736   -9.212  1.00 0.00 ? 18  LYS A HG2  3  
ATOM 3279  H HG3  . LYS A 1 18  ? -12.945 9.768   -10.885 1.00 0.00 ? 18  LYS A HG3  3  
ATOM 3280  H HD2  . LYS A 1 18  ? -14.810 7.767   -11.024 1.00 0.00 ? 18  LYS A HD2  3  
ATOM 3281  H HD3  . LYS A 1 18  ? -15.480 8.701   -9.701  1.00 0.00 ? 18  LYS A HD3  3  
ATOM 3282  H HE2  . LYS A 1 18  ? -15.816 10.618  -11.034 1.00 0.00 ? 18  LYS A HE2  3  
ATOM 3283  H HE3  . LYS A 1 18  ? -14.571 10.170  -12.183 1.00 0.00 ? 18  LYS A HE3  3  
ATOM 3284  H HZ1  . LYS A 1 18  ? -17.150 9.792   -12.592 1.00 0.00 ? 18  LYS A HZ1  3  
ATOM 3285  H HZ2  . LYS A 1 18  ? -15.991 8.892   -13.308 1.00 0.00 ? 18  LYS A HZ2  3  
ATOM 3286  H HZ3  . LYS A 1 18  ? -16.762 8.327   -11.984 1.00 0.00 ? 18  LYS A HZ3  3  
ATOM 3287  N N    . LYS A 1 19  ? -13.459 5.794   -7.029  1.00 0.00 ? 19  LYS A N    3  
ATOM 3288  C CA   . LYS A 1 19  ? -14.513 4.951   -6.492  1.00 0.00 ? 19  LYS A CA   3  
ATOM 3289  C C    . LYS A 1 19  ? -15.344 5.757   -5.492  1.00 0.00 ? 19  LYS A C    3  
ATOM 3290  O O    . LYS A 1 19  ? -16.253 6.490   -5.882  1.00 0.00 ? 19  LYS A O    3  
ATOM 3291  C CB   . LYS A 1 19  ? -13.925 3.665   -5.907  1.00 0.00 ? 19  LYS A CB   3  
ATOM 3292  C CG   . LYS A 1 19  ? -15.030 2.752   -5.371  1.00 0.00 ? 19  LYS A CG   3  
ATOM 3293  C CD   . LYS A 1 19  ? -14.584 1.288   -5.381  1.00 0.00 ? 19  LYS A CD   3  
ATOM 3294  C CE   . LYS A 1 19  ? -14.501 0.750   -6.811  1.00 0.00 ? 19  LYS A CE   3  
ATOM 3295  N NZ   . LYS A 1 19  ? -14.495 -0.730  -6.808  1.00 0.00 ? 19  LYS A NZ   3  
ATOM 3296  H H    . LYS A 1 19  ? -12.543 5.604   -6.674  1.00 0.00 ? 19  LYS A H    3  
ATOM 3297  H HA   . LYS A 1 19  ? -15.156 4.663   -7.323  1.00 0.00 ? 19  LYS A HA   3  
ATOM 3298  H HB2  . LYS A 1 19  ? -13.354 3.140   -6.673  1.00 0.00 ? 19  LYS A HB2  3  
ATOM 3299  H HB3  . LYS A 1 19  ? -13.230 3.911   -5.105  1.00 0.00 ? 19  LYS A HB3  3  
ATOM 3300  H HG2  . LYS A 1 19  ? -15.291 3.049   -4.355  1.00 0.00 ? 19  LYS A HG2  3  
ATOM 3301  H HG3  . LYS A 1 19  ? -15.928 2.867   -5.978  1.00 0.00 ? 19  LYS A HG3  3  
ATOM 3302  H HD2  . LYS A 1 19  ? -13.611 1.197   -4.897  1.00 0.00 ? 19  LYS A HD2  3  
ATOM 3303  H HD3  . LYS A 1 19  ? -15.285 0.687   -4.802  1.00 0.00 ? 19  LYS A HD3  3  
ATOM 3304  H HE2  . LYS A 1 19  ? -15.347 1.116   -7.393  1.00 0.00 ? 19  LYS A HE2  3  
ATOM 3305  H HE3  . LYS A 1 19  ? -13.597 1.123   -7.294  1.00 0.00 ? 19  LYS A HE3  3  
ATOM 3306  H HZ1  . LYS A 1 19  ? -14.074 -1.060  -5.963  1.00 0.00 ? 19  LYS A HZ1  3  
ATOM 3307  H HZ2  . LYS A 1 19  ? -15.434 -1.067  -6.866  1.00 0.00 ? 19  LYS A HZ2  3  
ATOM 3308  H HZ3  . LYS A 1 19  ? -13.972 -1.062  -7.593  1.00 0.00 ? 19  LYS A HZ3  3  
ATOM 3309  N N    . GLN A 1 20  ? -15.004 5.596   -4.222  1.00 0.00 ? 20  GLN A N    3  
ATOM 3310  C CA   . GLN A 1 20  ? -15.708 6.299   -3.163  1.00 0.00 ? 20  GLN A CA   3  
ATOM 3311  C C    . GLN A 1 20  ? -15.368 7.790   -3.200  1.00 0.00 ? 20  GLN A C    3  
ATOM 3312  O O    . GLN A 1 20  ? -16.211 8.631   -2.890  1.00 0.00 ? 20  GLN A O    3  
ATOM 3313  C CB   . GLN A 1 20  ? -15.384 5.696   -1.794  1.00 0.00 ? 20  GLN A CB   3  
ATOM 3314  C CG   . GLN A 1 20  ? -16.661 5.283   -1.061  1.00 0.00 ? 20  GLN A CG   3  
ATOM 3315  C CD   . GLN A 1 20  ? -16.459 5.318   0.455   1.00 0.00 ? 20  GLN A CD   3  
ATOM 3316  O OE1  . GLN A 1 20  ? -16.098 6.328   1.036   1.00 0.00 ? 20  GLN A OE1  3  
ATOM 3317  N NE2  . GLN A 1 20  ? -16.711 4.161   1.061   1.00 0.00 ? 20  GLN A NE2  3  
ATOM 3318  H H    . GLN A 1 20  ? -14.264 4.998   -3.913  1.00 0.00 ? 20  GLN A H    3  
ATOM 3319  H HA   . GLN A 1 20  ? -16.768 6.156   -3.374  1.00 0.00 ? 20  GLN A HA   3  
ATOM 3320  H HB2  . GLN A 1 20  ? -14.735 4.829   -1.919  1.00 0.00 ? 20  GLN A HB2  3  
ATOM 3321  H HB3  . GLN A 1 20  ? -14.835 6.422   -1.194  1.00 0.00 ? 20  GLN A HB3  3  
ATOM 3322  H HG2  . GLN A 1 20  ? -17.477 5.951   -1.338  1.00 0.00 ? 20  GLN A HG2  3  
ATOM 3323  H HG3  . GLN A 1 20  ? -16.953 4.279   -1.370  1.00 0.00 ? 20  GLN A HG3  3  
ATOM 3324  H HE21 . GLN A 1 20  ? -17.004 3.369   0.525   1.00 0.00 ? 20  GLN A HE21 3  
ATOM 3325  H HE22 . GLN A 1 20  ? -16.607 4.083   2.053   1.00 0.00 ? 20  GLN A HE22 3  
ATOM 3326  N N    . ASN A 1 21  ? -14.131 8.074   -3.580  1.00 0.00 ? 21  ASN A N    3  
ATOM 3327  C CA   . ASN A 1 21  ? -13.669 9.449   -3.661  1.00 0.00 ? 21  ASN A CA   3  
ATOM 3328  C C    . ASN A 1 21  ? -12.140 9.472   -3.619  1.00 0.00 ? 21  ASN A C    3  
ATOM 3329  O O    . ASN A 1 21  ? -11.512 10.344  -4.218  1.00 0.00 ? 21  ASN A O    3  
ATOM 3330  C CB   . ASN A 1 21  ? -14.187 10.274  -2.482  1.00 0.00 ? 21  ASN A CB   3  
ATOM 3331  C CG   . ASN A 1 21  ? -15.367 11.153  -2.904  1.00 0.00 ? 21  ASN A CG   3  
ATOM 3332  O OD1  . ASN A 1 21  ? -15.931 11.007  -3.975  1.00 0.00 ? 21  ASN A OD1  3  
ATOM 3333  N ND2  . ASN A 1 21  ? -15.706 12.072  -2.004  1.00 0.00 ? 21  ASN A ND2  3  
ATOM 3334  H H    . ASN A 1 21  ? -13.451 7.384   -3.830  1.00 0.00 ? 21  ASN A H    3  
ATOM 3335  H HA   . ASN A 1 21  ? -14.066 9.829   -4.602  1.00 0.00 ? 21  ASN A HA   3  
ATOM 3336  H HB2  . ASN A 1 21  ? -14.495 9.609   -1.675  1.00 0.00 ? 21  ASN A HB2  3  
ATOM 3337  H HB3  . ASN A 1 21  ? -13.385 10.900  -2.091  1.00 0.00 ? 21  ASN A HB3  3  
ATOM 3338  H HD21 . ASN A 1 21  ? -15.201 12.139  -1.143  1.00 0.00 ? 21  ASN A HD21 3  
ATOM 3339  H HD22 . ASN A 1 21  ? -16.466 12.695  -2.188  1.00 0.00 ? 21  ASN A HD22 3  
ATOM 3340  N N    . GLY A 1 22  ? -11.585 8.504   -2.905  1.00 0.00 ? 22  GLY A N    3  
ATOM 3341  C CA   . GLY A 1 22  ? -10.141 8.403   -2.777  1.00 0.00 ? 22  GLY A CA   3  
ATOM 3342  C C    . GLY A 1 22  ? -9.720  6.971   -2.440  1.00 0.00 ? 22  GLY A C    3  
ATOM 3343  O O    . GLY A 1 22  ? -10.341 6.013   -2.898  1.00 0.00 ? 22  GLY A O    3  
ATOM 3344  H H    . GLY A 1 22  ? -12.103 7.799   -2.421  1.00 0.00 ? 22  GLY A H    3  
ATOM 3345  H HA2  . GLY A 1 22  ? -9.667  8.716   -3.707  1.00 0.00 ? 22  GLY A HA2  3  
ATOM 3346  H HA3  . GLY A 1 22  ? -9.793  9.081   -1.998  1.00 0.00 ? 22  GLY A HA3  3  
ATOM 3347  N N    . MET A 1 23  ? -8.667  6.870   -1.642  1.00 0.00 ? 23  MET A N    3  
ATOM 3348  C CA   . MET A 1 23  ? -8.155  5.571   -1.239  1.00 0.00 ? 23  MET A CA   3  
ATOM 3349  C C    . MET A 1 23  ? -8.418  5.316   0.246   1.00 0.00 ? 23  MET A C    3  
ATOM 3350  O O    . MET A 1 23  ? -8.235  4.199   0.730   1.00 0.00 ? 23  MET A O    3  
ATOM 3351  C CB   . MET A 1 23  ? -6.651  5.508   -1.510  1.00 0.00 ? 23  MET A CB   3  
ATOM 3352  C CG   . MET A 1 23  ? -6.185  4.061   -1.686  1.00 0.00 ? 23  MET A CG   3  
ATOM 3353  S SD   . MET A 1 23  ? -4.421  4.016   -1.954  1.00 0.00 ? 23  MET A SD   3  
ATOM 3354  C CE   . MET A 1 23  ? -4.187  5.599   -2.745  1.00 0.00 ? 23  MET A CE   3  
ATOM 3355  H H    . MET A 1 23  ? -8.167  7.654   -1.274  1.00 0.00 ? 23  MET A H    3  
ATOM 3356  H HA   . MET A 1 23  ? -8.698  4.843   -1.842  1.00 0.00 ? 23  MET A HA   3  
ATOM 3357  H HB2  . MET A 1 23  ? -6.414  6.082   -2.406  1.00 0.00 ? 23  MET A HB2  3  
ATOM 3358  H HB3  . MET A 1 23  ? -6.109  5.970   -0.684  1.00 0.00 ? 23  MET A HB3  3  
ATOM 3359  H HG2  . MET A 1 23  ? -6.442  3.478   -0.803  1.00 0.00 ? 23  MET A HG2  3  
ATOM 3360  H HG3  . MET A 1 23  ? -6.701  3.605   -2.531  1.00 0.00 ? 23  MET A HG3  3  
ATOM 3361  H HE1  . MET A 1 23  ? -4.852  5.677   -3.605  1.00 0.00 ? 23  MET A HE1  3  
ATOM 3362  H HE2  . MET A 1 23  ? -4.412  6.396   -2.037  1.00 0.00 ? 23  MET A HE2  3  
ATOM 3363  H HE3  . MET A 1 23  ? -3.152  5.689   -3.077  1.00 0.00 ? 23  MET A HE3  3  
ATOM 3364  N N    . GLY A 1 24  ? -8.842  6.369   0.929   1.00 0.00 ? 24  GLY A N    3  
ATOM 3365  C CA   . GLY A 1 24  ? -9.131  6.273   2.350   1.00 0.00 ? 24  GLY A CA   3  
ATOM 3366  C C    . GLY A 1 24  ? -8.352  5.123   2.992   1.00 0.00 ? 24  GLY A C    3  
ATOM 3367  O O    . GLY A 1 24  ? -8.944  4.148   3.453   1.00 0.00 ? 24  GLY A O    3  
ATOM 3368  H H    . GLY A 1 24  ? -8.988  7.273   0.529   1.00 0.00 ? 24  GLY A H    3  
ATOM 3369  H HA2  . GLY A 1 24  ? -8.873  7.211   2.842   1.00 0.00 ? 24  GLY A HA2  3  
ATOM 3370  H HA3  . GLY A 1 24  ? -10.200 6.119   2.497   1.00 0.00 ? 24  GLY A HA3  3  
ATOM 3371  N N    . LEU A 1 25  ? -7.036  5.275   3.001   1.00 0.00 ? 25  LEU A N    3  
ATOM 3372  C CA   . LEU A 1 25  ? -6.170  4.261   3.578   1.00 0.00 ? 25  LEU A CA   3  
ATOM 3373  C C    . LEU A 1 25  ? -5.119  4.937   4.461   1.00 0.00 ? 25  LEU A C    3  
ATOM 3374  O O    . LEU A 1 25  ? -4.416  5.842   4.013   1.00 0.00 ? 25  LEU A O    3  
ATOM 3375  C CB   . LEU A 1 25  ? -5.574  3.377   2.481   1.00 0.00 ? 25  LEU A CB   3  
ATOM 3376  C CG   . LEU A 1 25  ? -4.126  2.931   2.691   1.00 0.00 ? 25  LEU A CG   3  
ATOM 3377  C CD1  . LEU A 1 25  ? -3.147  3.993   2.184   1.00 0.00 ? 25  LEU A CD1  3  
ATOM 3378  C CD2  . LEU A 1 25  ? -3.870  2.568   4.155   1.00 0.00 ? 25  LEU A CD2  3  
ATOM 3379  H H    . LEU A 1 25  ? -6.562  6.070   2.623   1.00 0.00 ? 25  LEU A H    3  
ATOM 3380  H HA   . LEU A 1 25  ? -6.789  3.621   4.207   1.00 0.00 ? 25  LEU A HA   3  
ATOM 3381  H HB2  . LEU A 1 25  ? -6.196  2.487   2.381   1.00 0.00 ? 25  LEU A HB2  3  
ATOM 3382  H HB3  . LEU A 1 25  ? -5.635  3.915   1.535   1.00 0.00 ? 25  LEU A HB3  3  
ATOM 3383  H HG   . LEU A 1 25  ? -3.956  2.030   2.101   1.00 0.00 ? 25  LEU A HG   3  
ATOM 3384  H HD11 . LEU A 1 25  ? -2.250  3.506   1.801   1.00 0.00 ? 25  LEU A HD11 3  
ATOM 3385  H HD12 . LEU A 1 25  ? -3.616  4.569   1.387   1.00 0.00 ? 25  LEU A HD12 3  
ATOM 3386  H HD13 . LEU A 1 25  ? -2.878  4.659   3.004   1.00 0.00 ? 25  LEU A HD13 3  
ATOM 3387  H HD21 . LEU A 1 25  ? -4.822  2.483   4.679   1.00 0.00 ? 25  LEU A HD21 3  
ATOM 3388  H HD22 . LEU A 1 25  ? -3.341  1.617   4.206   1.00 0.00 ? 25  LEU A HD22 3  
ATOM 3389  H HD23 . LEU A 1 25  ? -3.266  3.346   4.622   1.00 0.00 ? 25  LEU A HD23 3  
ATOM 3390  N N    . SER A 1 26  ? -5.045  4.472   5.699   1.00 0.00 ? 26  SER A N    3  
ATOM 3391  C CA   . SER A 1 26  ? -4.092  5.021   6.649   1.00 0.00 ? 26  SER A CA   3  
ATOM 3392  C C    . SER A 1 26  ? -2.859  4.119   6.732   1.00 0.00 ? 26  SER A C    3  
ATOM 3393  O O    . SER A 1 26  ? -2.939  2.996   7.226   1.00 0.00 ? 26  SER A O    3  
ATOM 3394  C CB   . SER A 1 26  ? -4.724  5.184   8.032   1.00 0.00 ? 26  SER A CB   3  
ATOM 3395  O OG   . SER A 1 26  ? -3.849  5.840   8.945   1.00 0.00 ? 26  SER A OG   3  
ATOM 3396  H H    . SER A 1 26  ? -5.621  3.736   6.056   1.00 0.00 ? 26  SER A H    3  
ATOM 3397  H HA   . SER A 1 26  ? -3.823  6.001   6.255   1.00 0.00 ? 26  SER A HA   3  
ATOM 3398  H HB2  . SER A 1 26  ? -5.649  5.755   7.943   1.00 0.00 ? 26  SER A HB2  3  
ATOM 3399  H HB3  . SER A 1 26  ? -4.992  4.204   8.427   1.00 0.00 ? 26  SER A HB3  3  
ATOM 3400  H HG   . SER A 1 26  ? -4.355  6.521   9.475   1.00 0.00 ? 26  SER A HG   3  
ATOM 3401  N N    . ILE A 1 27  ? -1.746  4.645   6.242   1.00 0.00 ? 27  ILE A N    3  
ATOM 3402  C CA   . ILE A 1 27  ? -0.497  3.902   6.255   1.00 0.00 ? 27  ILE A CA   3  
ATOM 3403  C C    . ILE A 1 27  ? 0.267   4.221   7.541   1.00 0.00 ? 27  ILE A C    3  
ATOM 3404  O O    . ILE A 1 27  ? -0.131  5.101   8.303   1.00 0.00 ? 27  ILE A O    3  
ATOM 3405  C CB   . ILE A 1 27  ? 0.303   4.176   4.980   1.00 0.00 ? 27  ILE A CB   3  
ATOM 3406  C CG1  . ILE A 1 27  ? 0.879   5.593   4.988   1.00 0.00 ? 27  ILE A CG1  3  
ATOM 3407  C CG2  . ILE A 1 27  ? -0.544  3.909   3.734   1.00 0.00 ? 27  ILE A CG2  3  
ATOM 3408  C CD1  . ILE A 1 27  ? 1.940   5.760   3.898   1.00 0.00 ? 27  ILE A CD1  3  
ATOM 3409  H H    . ILE A 1 27  ? -1.689  5.560   5.842   1.00 0.00 ? 27  ILE A H    3  
ATOM 3410  H HA   . ILE A 1 27  ? -0.749  2.842   6.256   1.00 0.00 ? 27  ILE A HA   3  
ATOM 3411  H HB   . ILE A 1 27  ? 1.146   3.486   4.951   1.00 0.00 ? 27  ILE A HB   3  
ATOM 3412  H HG12 . ILE A 1 27  ? 0.078   6.316   4.835   1.00 0.00 ? 27  ILE A HG12 3  
ATOM 3413  H HG13 . ILE A 1 27  ? 1.318   5.806   5.963   1.00 0.00 ? 27  ILE A HG13 3  
ATOM 3414  H HG21 . ILE A 1 27  ? -0.916  4.853   3.338   1.00 0.00 ? 27  ILE A HG21 3  
ATOM 3415  H HG22 . ILE A 1 27  ? 0.067   3.414   2.979   1.00 0.00 ? 27  ILE A HG22 3  
ATOM 3416  H HG23 . ILE A 1 27  ? -1.385  3.268   3.997   1.00 0.00 ? 27  ILE A HG23 3  
ATOM 3417  H HD11 . ILE A 1 27  ? 2.860   6.141   4.341   1.00 0.00 ? 27  ILE A HD11 3  
ATOM 3418  H HD12 . ILE A 1 27  ? 2.134   4.795   3.430   1.00 0.00 ? 27  ILE A HD12 3  
ATOM 3419  H HD13 . ILE A 1 27  ? 1.580   6.463   3.146   1.00 0.00 ? 27  ILE A HD13 3  
ATOM 3420  N N    . VAL A 1 28  ? 1.353   3.488   7.744   1.00 0.00 ? 28  VAL A N    3  
ATOM 3421  C CA   . VAL A 1 28  ? 2.177   3.682   8.924   1.00 0.00 ? 28  VAL A CA   3  
ATOM 3422  C C    . VAL A 1 28  ? 3.644   3.447   8.561   1.00 0.00 ? 28  VAL A C    3  
ATOM 3423  O O    . VAL A 1 28  ? 3.943   2.781   7.571   1.00 0.00 ? 28  VAL A O    3  
ATOM 3424  C CB   . VAL A 1 28  ? 1.689   2.776   10.057  1.00 0.00 ? 28  VAL A CB   3  
ATOM 3425  C CG1  . VAL A 1 28  ? 2.681   1.640   10.317  1.00 0.00 ? 28  VAL A CG1  3  
ATOM 3426  C CG2  . VAL A 1 28  ? 1.433   3.583   11.332  1.00 0.00 ? 28  VAL A CG2  3  
ATOM 3427  H H    . VAL A 1 28  ? 1.670   2.775   7.119   1.00 0.00 ? 28  VAL A H    3  
ATOM 3428  H HA   . VAL A 1 28  ? 2.056   4.717   9.244   1.00 0.00 ? 28  VAL A HA   3  
ATOM 3429  H HB   . VAL A 1 28  ? 0.744   2.331   9.747   1.00 0.00 ? 28  VAL A HB   3  
ATOM 3430  H HG11 . VAL A 1 28  ? 3.111   1.311   9.371   1.00 0.00 ? 28  VAL A HG11 3  
ATOM 3431  H HG12 . VAL A 1 28  ? 3.475   1.995   10.974  1.00 0.00 ? 28  VAL A HG12 3  
ATOM 3432  H HG13 . VAL A 1 28  ? 2.163   0.806   10.790  1.00 0.00 ? 28  VAL A HG13 3  
ATOM 3433  H HG21 . VAL A 1 28  ? 0.938   2.950   12.069  1.00 0.00 ? 28  VAL A HG21 3  
ATOM 3434  H HG22 . VAL A 1 28  ? 2.382   3.936   11.735  1.00 0.00 ? 28  VAL A HG22 3  
ATOM 3435  H HG23 . VAL A 1 28  ? 0.797   4.436   11.100  1.00 0.00 ? 28  VAL A HG23 3  
ATOM 3436  N N    . ALA A 1 29  ? 4.521   4.006   9.381   1.00 0.00 ? 29  ALA A N    3  
ATOM 3437  C CA   . ALA A 1 29  ? 5.950   3.866   9.159   1.00 0.00 ? 29  ALA A CA   3  
ATOM 3438  C C    . ALA A 1 29  ? 6.465   5.088   8.396   1.00 0.00 ? 29  ALA A C    3  
ATOM 3439  O O    . ALA A 1 29  ? 5.722   6.040   8.167   1.00 0.00 ? 29  ALA A O    3  
ATOM 3440  C CB   . ALA A 1 29  ? 6.225   2.556   8.417   1.00 0.00 ? 29  ALA A CB   3  
ATOM 3441  H H    . ALA A 1 29  ? 4.270   4.546   10.185  1.00 0.00 ? 29  ALA A H    3  
ATOM 3442  H HA   . ALA A 1 29  ? 6.436   3.826   10.134  1.00 0.00 ? 29  ALA A HA   3  
ATOM 3443  H HB1  . ALA A 1 29  ? 7.235   2.215   8.644   1.00 0.00 ? 29  ALA A HB1  3  
ATOM 3444  H HB2  . ALA A 1 29  ? 5.506   1.801   8.734   1.00 0.00 ? 29  ALA A HB2  3  
ATOM 3445  H HB3  . ALA A 1 29  ? 6.130   2.720   7.343   1.00 0.00 ? 29  ALA A HB3  3  
ATOM 3446  N N    . ALA A 1 30  ? 7.735   5.021   8.022   1.00 0.00 ? 30  ALA A N    3  
ATOM 3447  C CA   . ALA A 1 30  ? 8.358   6.110   7.290   1.00 0.00 ? 30  ALA A CA   3  
ATOM 3448  C C    . ALA A 1 30  ? 9.868   5.874   7.221   1.00 0.00 ? 30  ALA A C    3  
ATOM 3449  O O    . ALA A 1 30  ? 10.516  5.671   8.248   1.00 0.00 ? 30  ALA A O    3  
ATOM 3450  C CB   . ALA A 1 30  ? 8.006   7.441   7.956   1.00 0.00 ? 30  ALA A CB   3  
ATOM 3451  H H    . ALA A 1 30  ? 8.333   4.242   8.212   1.00 0.00 ? 30  ALA A H    3  
ATOM 3452  H HA   . ALA A 1 30  ? 7.952   6.105   6.278   1.00 0.00 ? 30  ALA A HA   3  
ATOM 3453  H HB1  . ALA A 1 30  ? 7.405   7.254   8.846   1.00 0.00 ? 30  ALA A HB1  3  
ATOM 3454  H HB2  . ALA A 1 30  ? 8.922   7.960   8.238   1.00 0.00 ? 30  ALA A HB2  3  
ATOM 3455  H HB3  . ALA A 1 30  ? 7.438   8.057   7.258   1.00 0.00 ? 30  ALA A HB3  3  
ATOM 3456  N N    . LYS A 1 31  ? 10.386  5.909   6.002   1.00 0.00 ? 31  LYS A N    3  
ATOM 3457  C CA   . LYS A 1 31  ? 11.808  5.701   5.787   1.00 0.00 ? 31  LYS A CA   3  
ATOM 3458  C C    . LYS A 1 31  ? 12.555  7.011   6.048   1.00 0.00 ? 31  LYS A C    3  
ATOM 3459  O O    . LYS A 1 31  ? 12.465  7.949   5.257   1.00 0.00 ? 31  LYS A O    3  
ATOM 3460  C CB   . LYS A 1 31  ? 12.059  5.116   4.395   1.00 0.00 ? 31  LYS A CB   3  
ATOM 3461  C CG   . LYS A 1 31  ? 13.502  5.363   3.950   1.00 0.00 ? 31  LYS A CG   3  
ATOM 3462  C CD   . LYS A 1 31  ? 13.693  4.985   2.479   1.00 0.00 ? 31  LYS A CD   3  
ATOM 3463  C CE   . LYS A 1 31  ? 14.890  5.724   1.875   1.00 0.00 ? 31  LYS A CE   3  
ATOM 3464  N NZ   . LYS A 1 31  ? 14.767  5.790   0.401   1.00 0.00 ? 31  LYS A NZ   3  
ATOM 3465  H H    . LYS A 1 31  ? 9.853   6.074   5.173   1.00 0.00 ? 31  LYS A H    3  
ATOM 3466  H HA   . LYS A 1 31  ? 12.144  4.961   6.513   1.00 0.00 ? 31  LYS A HA   3  
ATOM 3467  H HB2  . LYS A 1 31  ? 11.856  4.046   4.404   1.00 0.00 ? 31  LYS A HB2  3  
ATOM 3468  H HB3  . LYS A 1 31  ? 11.372  5.565   3.679   1.00 0.00 ? 31  LYS A HB3  3  
ATOM 3469  H HG2  . LYS A 1 31  ? 13.757  6.413   4.095   1.00 0.00 ? 31  LYS A HG2  3  
ATOM 3470  H HG3  . LYS A 1 31  ? 14.183  4.780   4.570   1.00 0.00 ? 31  LYS A HG3  3  
ATOM 3471  H HD2  . LYS A 1 31  ? 13.844  3.909   2.393   1.00 0.00 ? 31  LYS A HD2  3  
ATOM 3472  H HD3  . LYS A 1 31  ? 12.791  5.227   1.918   1.00 0.00 ? 31  LYS A HD3  3  
ATOM 3473  H HE2  . LYS A 1 31  ? 14.949  6.731   2.287   1.00 0.00 ? 31  LYS A HE2  3  
ATOM 3474  H HE3  . LYS A 1 31  ? 15.814  5.214   2.146   1.00 0.00 ? 31  LYS A HE3  3  
ATOM 3475  H HZ1  . LYS A 1 31  ? 13.861  6.136   0.158   1.00 0.00 ? 31  LYS A HZ1  3  
ATOM 3476  H HZ2  . LYS A 1 31  ? 15.467  6.404   0.036   1.00 0.00 ? 31  LYS A HZ2  3  
ATOM 3477  H HZ3  . LYS A 1 31  ? 14.891  4.876   0.015   1.00 0.00 ? 31  LYS A HZ3  3  
ATOM 3478  N N    . GLY A 1 32  ? 13.276  7.032   7.159   1.00 0.00 ? 32  GLY A N    3  
ATOM 3479  C CA   . GLY A 1 32  ? 14.039  8.211   7.534   1.00 0.00 ? 32  GLY A CA   3  
ATOM 3480  C C    . GLY A 1 32  ? 14.462  8.146   9.002   1.00 0.00 ? 32  GLY A C    3  
ATOM 3481  O O    . GLY A 1 32  ? 13.648  7.845   9.874   1.00 0.00 ? 32  GLY A O    3  
ATOM 3482  H H    . GLY A 1 32  ? 13.345  6.264   7.796   1.00 0.00 ? 32  GLY A H    3  
ATOM 3483  H HA2  . GLY A 1 32  ? 14.922  8.294   6.900   1.00 0.00 ? 32  GLY A HA2  3  
ATOM 3484  H HA3  . GLY A 1 32  ? 13.440  9.105   7.363   1.00 0.00 ? 32  GLY A HA3  3  
ATOM 3485  N N    . ALA A 1 33  ? 15.735  8.433   9.231   1.00 0.00 ? 33  ALA A N    3  
ATOM 3486  C CA   . ALA A 1 33  ? 16.276  8.410   10.580  1.00 0.00 ? 33  ALA A CA   3  
ATOM 3487  C C    . ALA A 1 33  ? 16.197  6.986   11.133  1.00 0.00 ? 33  ALA A C    3  
ATOM 3488  O O    . ALA A 1 33  ? 15.801  6.783   12.280  1.00 0.00 ? 33  ALA A O    3  
ATOM 3489  C CB   . ALA A 1 33  ? 15.521  9.417   11.450  1.00 0.00 ? 33  ALA A CB   3  
ATOM 3490  H H    . ALA A 1 33  ? 16.391  8.676   8.517   1.00 0.00 ? 33  ALA A H    3  
ATOM 3491  H HA   . ALA A 1 33  ? 17.322  8.712   10.523  1.00 0.00 ? 33  ALA A HA   3  
ATOM 3492  H HB1  . ALA A 1 33  ? 14.961  10.100  10.812  1.00 0.00 ? 33  ALA A HB1  3  
ATOM 3493  H HB2  . ALA A 1 33  ? 14.832  8.885   12.106  1.00 0.00 ? 33  ALA A HB2  3  
ATOM 3494  H HB3  . ALA A 1 33  ? 16.232  9.982   12.052  1.00 0.00 ? 33  ALA A HB3  3  
ATOM 3495  N N    . GLY A 1 34  ? 16.582  6.037   10.293  1.00 0.00 ? 34  GLY A N    3  
ATOM 3496  C CA   . GLY A 1 34  ? 16.559  4.638   10.684  1.00 0.00 ? 34  GLY A CA   3  
ATOM 3497  C C    . GLY A 1 34  ? 17.528  3.815   9.832   1.00 0.00 ? 34  GLY A C    3  
ATOM 3498  O O    . GLY A 1 34  ? 18.706  4.152   9.725   1.00 0.00 ? 34  GLY A O    3  
ATOM 3499  H H    . GLY A 1 34  ? 16.903  6.211   9.362   1.00 0.00 ? 34  GLY A H    3  
ATOM 3500  H HA2  . GLY A 1 34  ? 16.827  4.546   11.736  1.00 0.00 ? 34  GLY A HA2  3  
ATOM 3501  H HA3  . GLY A 1 34  ? 15.549  4.242   10.576  1.00 0.00 ? 34  GLY A HA3  3  
ATOM 3502  N N    . GLN A 1 35  ? 16.996  2.751   9.247   1.00 0.00 ? 35  GLN A N    3  
ATOM 3503  C CA   . GLN A 1 35  ? 17.799  1.878   8.409   1.00 0.00 ? 35  GLN A CA   3  
ATOM 3504  C C    . GLN A 1 35  ? 17.645  2.267   6.937   1.00 0.00 ? 35  GLN A C    3  
ATOM 3505  O O    . GLN A 1 35  ? 17.855  1.443   6.048   1.00 0.00 ? 35  GLN A O    3  
ATOM 3506  C CB   . GLN A 1 35  ? 17.426  0.411   8.630   1.00 0.00 ? 35  GLN A CB   3  
ATOM 3507  C CG   . GLN A 1 35  ? 15.946  0.169   8.324   1.00 0.00 ? 35  GLN A CG   3  
ATOM 3508  C CD   . GLN A 1 35  ? 15.213  -0.369  9.554   1.00 0.00 ? 35  GLN A CD   3  
ATOM 3509  O OE1  . GLN A 1 35  ? 15.316  -1.531  9.912   1.00 0.00 ? 35  GLN A OE1  3  
ATOM 3510  N NE2  . GLN A 1 35  ? 14.469  0.539   10.180  1.00 0.00 ? 35  GLN A NE2  3  
ATOM 3511  H H    . GLN A 1 35  ? 16.037  2.484   9.339   1.00 0.00 ? 35  GLN A H    3  
ATOM 3512  H HA   . GLN A 1 35  ? 18.829  2.037   8.727   1.00 0.00 ? 35  GLN A HA   3  
ATOM 3513  H HB2  . GLN A 1 35  ? 18.041  -0.224  7.993   1.00 0.00 ? 35  GLN A HB2  3  
ATOM 3514  H HB3  . GLN A 1 35  ? 17.638  0.129   9.661   1.00 0.00 ? 35  GLN A HB3  3  
ATOM 3515  H HG2  . GLN A 1 35  ? 15.482  1.099   7.997   1.00 0.00 ? 35  GLN A HG2  3  
ATOM 3516  H HG3  . GLN A 1 35  ? 15.853  -0.540  7.501   1.00 0.00 ? 35  GLN A HG3  3  
ATOM 3517  H HE21 . GLN A 1 35  ? 14.428  1.476   9.834   1.00 0.00 ? 35  GLN A HE21 3  
ATOM 3518  H HE22 . GLN A 1 35  ? 13.950  0.284   10.996  1.00 0.00 ? 35  GLN A HE22 3  
ATOM 3519  N N    . ASP A 1 36  ? 17.279  3.523   6.725   1.00 0.00 ? 36  ASP A N    3  
ATOM 3520  C CA   . ASP A 1 36  ? 17.094  4.031   5.376   1.00 0.00 ? 36  ASP A CA   3  
ATOM 3521  C C    . ASP A 1 36  ? 16.022  3.202   4.666   1.00 0.00 ? 36  ASP A C    3  
ATOM 3522  O O    . ASP A 1 36  ? 16.123  2.946   3.467   1.00 0.00 ? 36  ASP A O    3  
ATOM 3523  C CB   . ASP A 1 36  ? 18.387  3.925   4.566   1.00 0.00 ? 36  ASP A CB   3  
ATOM 3524  C CG   . ASP A 1 36  ? 19.384  5.065   4.785   1.00 0.00 ? 36  ASP A CG   3  
ATOM 3525  O OD1  . ASP A 1 36  ? 19.237  5.756   5.817   1.00 0.00 ? 36  ASP A OD1  3  
ATOM 3526  O OD2  . ASP A 1 36  ? 20.269  5.220   3.916   1.00 0.00 ? 36  ASP A OD2  3  
ATOM 3527  H H    . ASP A 1 36  ? 17.109  4.187   7.453   1.00 0.00 ? 36  ASP A H    3  
ATOM 3528  H HA   . ASP A 1 36  ? 16.801  5.073   5.500   1.00 0.00 ? 36  ASP A HA   3  
ATOM 3529  H HB2  . ASP A 1 36  ? 18.877  2.982   4.812   1.00 0.00 ? 36  ASP A HB2  3  
ATOM 3530  H HB3  . ASP A 1 36  ? 18.133  3.884   3.507   1.00 0.00 ? 36  ASP A HB3  3  
ATOM 3531  N N    . LYS A 1 37  ? 15.019  2.807   5.436   1.00 0.00 ? 37  LYS A N    3  
ATOM 3532  C CA   . LYS A 1 37  ? 13.929  2.012   4.895   1.00 0.00 ? 37  LYS A CA   3  
ATOM 3533  C C    . LYS A 1 37  ? 13.117  1.417   6.047   1.00 0.00 ? 37  LYS A C    3  
ATOM 3534  O O    . LYS A 1 37  ? 13.436  0.338   6.544   1.00 0.00 ? 37  LYS A O    3  
ATOM 3535  C CB   . LYS A 1 37  ? 14.463  0.966   3.915   1.00 0.00 ? 37  LYS A CB   3  
ATOM 3536  C CG   . LYS A 1 37  ? 13.492  -0.209  3.785   1.00 0.00 ? 37  LYS A CG   3  
ATOM 3537  C CD   . LYS A 1 37  ? 13.983  -1.418  4.585   1.00 0.00 ? 37  LYS A CD   3  
ATOM 3538  C CE   . LYS A 1 37  ? 14.743  -2.397  3.688   1.00 0.00 ? 37  LYS A CE   3  
ATOM 3539  N NZ   . LYS A 1 37  ? 15.786  -3.106  4.462   1.00 0.00 ? 37  LYS A NZ   3  
ATOM 3540  H H    . LYS A 1 37  ? 14.944  3.019   6.410   1.00 0.00 ? 37  LYS A H    3  
ATOM 3541  H HA   . LYS A 1 37  ? 13.284  2.685   4.329   1.00 0.00 ? 37  LYS A HA   3  
ATOM 3542  H HB2  . LYS A 1 37  ? 14.619  1.423   2.938   1.00 0.00 ? 37  LYS A HB2  3  
ATOM 3543  H HB3  . LYS A 1 37  ? 15.433  0.605   4.256   1.00 0.00 ? 37  LYS A HB3  3  
ATOM 3544  H HG2  . LYS A 1 37  ? 12.505  0.089   4.138   1.00 0.00 ? 37  LYS A HG2  3  
ATOM 3545  H HG3  . LYS A 1 37  ? 13.385  -0.483  2.735   1.00 0.00 ? 37  LYS A HG3  3  
ATOM 3546  H HD2  . LYS A 1 37  ? 14.631  -1.083  5.395   1.00 0.00 ? 37  LYS A HD2  3  
ATOM 3547  H HD3  . LYS A 1 37  ? 13.134  -1.923  5.044   1.00 0.00 ? 37  LYS A HD3  3  
ATOM 3548  H HE2  . LYS A 1 37  ? 14.048  -3.118  3.257   1.00 0.00 ? 37  LYS A HE2  3  
ATOM 3549  H HE3  . LYS A 1 37  ? 15.200  -1.859  2.857   1.00 0.00 ? 37  LYS A HE3  3  
ATOM 3550  H HZ1  . LYS A 1 37  ? 16.689  -2.774  4.187   1.00 0.00 ? 37  LYS A HZ1  3  
ATOM 3551  H HZ2  . LYS A 1 37  ? 15.651  -2.935  5.438   1.00 0.00 ? 37  LYS A HZ2  3  
ATOM 3552  H HZ3  . LYS A 1 37  ? 15.723  -4.088  4.284   1.00 0.00 ? 37  LYS A HZ3  3  
ATOM 3553  N N    . LEU A 1 38  ? 12.083  2.147   6.439   1.00 0.00 ? 38  LEU A N    3  
ATOM 3554  C CA   . LEU A 1 38  ? 11.222  1.705   7.524   1.00 0.00 ? 38  LEU A CA   3  
ATOM 3555  C C    . LEU A 1 38  ? 10.099  0.836   6.956   1.00 0.00 ? 38  LEU A C    3  
ATOM 3556  O O    . LEU A 1 38  ? 9.559   1.132   5.890   1.00 0.00 ? 38  LEU A O    3  
ATOM 3557  C CB   . LEU A 1 38  ? 10.724  2.903   8.334   1.00 0.00 ? 38  LEU A CB   3  
ATOM 3558  C CG   . LEU A 1 38  ? 10.488  2.653   9.825   1.00 0.00 ? 38  LEU A CG   3  
ATOM 3559  C CD1  . LEU A 1 38  ? 10.616  3.950   10.626  1.00 0.00 ? 38  LEU A CD1  3  
ATOM 3560  C CD2  . LEU A 1 38  ? 9.141   1.966   10.059  1.00 0.00 ? 38  LEU A CD2  3  
ATOM 3561  H H    . LEU A 1 38  ? 11.830  3.024   6.030   1.00 0.00 ? 38  LEU A H    3  
ATOM 3562  H HA   . LEU A 1 38  ? 11.828  1.093   8.192   1.00 0.00 ? 38  LEU A HA   3  
ATOM 3563  H HB2  . LEU A 1 38  ? 11.447  3.712   8.232   1.00 0.00 ? 38  LEU A HB2  3  
ATOM 3564  H HB3  . LEU A 1 38  ? 9.790   3.252   7.892   1.00 0.00 ? 38  LEU A HB3  3  
ATOM 3565  H HG   . LEU A 1 38  ? 11.261  1.974   10.184  1.00 0.00 ? 38  LEU A HG   3  
ATOM 3566  H HD11 . LEU A 1 38  ? 11.242  4.655   10.078  1.00 0.00 ? 38  LEU A HD11 3  
ATOM 3567  H HD12 . LEU A 1 38  ? 9.627   4.383   10.777  1.00 0.00 ? 38  LEU A HD12 3  
ATOM 3568  H HD13 . LEU A 1 38  ? 11.071  3.736   11.593  1.00 0.00 ? 38  LEU A HD13 3  
ATOM 3569  H HD21 . LEU A 1 38  ? 8.364   2.721   10.181  1.00 0.00 ? 38  LEU A HD21 3  
ATOM 3570  H HD22 . LEU A 1 38  ? 8.902   1.334   9.203   1.00 0.00 ? 38  LEU A HD22 3  
ATOM 3571  H HD23 . LEU A 1 38  ? 9.197   1.353   10.959  1.00 0.00 ? 38  LEU A HD23 3  
ATOM 3572  N N    . GLY A 1 39  ? 9.779   -0.218  7.692   1.00 0.00 ? 39  GLY A N    3  
ATOM 3573  C CA   . GLY A 1 39  ? 8.729   -1.132  7.275   1.00 0.00 ? 39  GLY A CA   3  
ATOM 3574  C C    . GLY A 1 39  ? 7.389   -0.405  7.145   1.00 0.00 ? 39  GLY A C    3  
ATOM 3575  O O    . GLY A 1 39  ? 6.834   0.063   8.138   1.00 0.00 ? 39  GLY A O    3  
ATOM 3576  H H    . GLY A 1 39  ? 10.223  -0.451  8.557   1.00 0.00 ? 39  GLY A H    3  
ATOM 3577  H HA2  . GLY A 1 39  ? 8.995   -1.585  6.320   1.00 0.00 ? 39  GLY A HA2  3  
ATOM 3578  H HA3  . GLY A 1 39  ? 8.639   -1.942  7.998   1.00 0.00 ? 39  GLY A HA3  3  
ATOM 3579  N N    . ILE A 1 40  ? 6.909   -0.333  5.912   1.00 0.00 ? 40  ILE A N    3  
ATOM 3580  C CA   . ILE A 1 40  ? 5.644   0.329   5.640   1.00 0.00 ? 40  ILE A CA   3  
ATOM 3581  C C    . ILE A 1 40  ? 4.493   -0.626  5.964   1.00 0.00 ? 40  ILE A C    3  
ATOM 3582  O O    . ILE A 1 40  ? 4.412   -1.718  5.405   1.00 0.00 ? 40  ILE A O    3  
ATOM 3583  C CB   . ILE A 1 40  ? 5.616   0.861   4.205   1.00 0.00 ? 40  ILE A CB   3  
ATOM 3584  C CG1  . ILE A 1 40  ? 6.840   1.735   3.921   1.00 0.00 ? 40  ILE A CG1  3  
ATOM 3585  C CG2  . ILE A 1 40  ? 4.307   1.598   3.919   1.00 0.00 ? 40  ILE A CG2  3  
ATOM 3586  C CD1  . ILE A 1 40  ? 7.001   2.818   4.990   1.00 0.00 ? 40  ILE A CD1  3  
ATOM 3587  H H    . ILE A 1 40  ? 7.366   -0.716  5.110   1.00 0.00 ? 40  ILE A H    3  
ATOM 3588  H HA   . ILE A 1 40  ? 5.576   1.190   6.304   1.00 0.00 ? 40  ILE A HA   3  
ATOM 3589  H HB   . ILE A 1 40  ? 5.662   0.011   3.525   1.00 0.00 ? 40  ILE A HB   3  
ATOM 3590  H HG12 . ILE A 1 40  ? 7.735   1.114   3.889   1.00 0.00 ? 40  ILE A HG12 3  
ATOM 3591  H HG13 . ILE A 1 40  ? 6.739   2.199   2.940   1.00 0.00 ? 40  ILE A HG13 3  
ATOM 3592  H HG21 . ILE A 1 40  ? 4.065   2.249   4.760   1.00 0.00 ? 40  ILE A HG21 3  
ATOM 3593  H HG22 . ILE A 1 40  ? 4.417   2.199   3.016   1.00 0.00 ? 40  ILE A HG22 3  
ATOM 3594  H HG23 . ILE A 1 40  ? 3.505   0.874   3.778   1.00 0.00 ? 40  ILE A HG23 3  
ATOM 3595  H HD11 . ILE A 1 40  ? 7.499   3.685   4.556   1.00 0.00 ? 40  ILE A HD11 3  
ATOM 3596  H HD12 . ILE A 1 40  ? 6.019   3.111   5.361   1.00 0.00 ? 40  ILE A HD12 3  
ATOM 3597  H HD13 . ILE A 1 40  ? 7.600   2.429   5.813   1.00 0.00 ? 40  ILE A HD13 3  
ATOM 3598  N N    . TYR A 1 41  ? 3.632   -0.178  6.865   1.00 0.00 ? 41  TYR A N    3  
ATOM 3599  C CA   . TYR A 1 41  ? 2.489   -0.979  7.271   1.00 0.00 ? 41  TYR A CA   3  
ATOM 3600  C C    . TYR A 1 41  ? 1.262   -0.099  7.515   1.00 0.00 ? 41  TYR A C    3  
ATOM 3601  O O    . TYR A 1 41  ? 1.351   0.924   8.192   1.00 0.00 ? 41  TYR A O    3  
ATOM 3602  C CB   . TYR A 1 41  ? 2.890   -1.651  8.585   1.00 0.00 ? 41  TYR A CB   3  
ATOM 3603  C CG   . TYR A 1 41  ? 2.444   -3.110  8.700   1.00 0.00 ? 41  TYR A CG   3  
ATOM 3604  C CD1  . TYR A 1 41  ? 2.588   -3.962  7.624   1.00 0.00 ? 41  TYR A CD1  3  
ATOM 3605  C CD2  . TYR A 1 41  ? 1.899   -3.574  9.879   1.00 0.00 ? 41  TYR A CD2  3  
ATOM 3606  C CE1  . TYR A 1 41  ? 2.169   -5.335  7.731   1.00 0.00 ? 41  TYR A CE1  3  
ATOM 3607  C CE2  . TYR A 1 41  ? 1.479   -4.948  9.987   1.00 0.00 ? 41  TYR A CE2  3  
ATOM 3608  C CZ   . TYR A 1 41  ? 1.635   -5.760  8.908   1.00 0.00 ? 41  TYR A CZ   3  
ATOM 3609  O OH   . TYR A 1 41  ? 1.239   -7.057  9.009   1.00 0.00 ? 41  TYR A OH   3  
ATOM 3610  H H    . TYR A 1 41  ? 3.705   0.712   7.315   1.00 0.00 ? 41  TYR A H    3  
ATOM 3611  H HA   . TYR A 1 41  ? 2.269   -1.682  6.467   1.00 0.00 ? 41  TYR A HA   3  
ATOM 3612  H HB2  . TYR A 1 41  ? 3.974   -1.603  8.690   1.00 0.00 ? 41  TYR A HB2  3  
ATOM 3613  H HB3  . TYR A 1 41  ? 2.464   -1.086  9.415   1.00 0.00 ? 41  TYR A HB3  3  
ATOM 3614  H HD1  . TYR A 1 41  ? 3.019   -3.595  6.692   1.00 0.00 ? 41  TYR A HD1  3  
ATOM 3615  H HD2  . TYR A 1 41  ? 1.785   -2.901  10.729  1.00 0.00 ? 41  TYR A HD2  3  
ATOM 3616  H HE1  . TYR A 1 41  ? 2.277   -6.019  6.889   1.00 0.00 ? 41  TYR A HE1  3  
ATOM 3617  H HE2  . TYR A 1 41  ? 1.047   -5.327  10.913  1.00 0.00 ? 41  TYR A HE2  3  
ATOM 3618  H HH   . TYR A 1 41  ? 1.991   -7.619  9.355   1.00 0.00 ? 41  TYR A HH   3  
ATOM 3619  N N    . VAL A 1 42  ? 0.143   -0.529  6.949   1.00 0.00 ? 42  VAL A N    3  
ATOM 3620  C CA   . VAL A 1 42  ? -1.101  0.207   7.097   1.00 0.00 ? 42  VAL A CA   3  
ATOM 3621  C C    . VAL A 1 42  ? -1.492  0.248   8.576   1.00 0.00 ? 42  VAL A C    3  
ATOM 3622  O O    . VAL A 1 42  ? -1.473  -0.777  9.255   1.00 0.00 ? 42  VAL A O    3  
ATOM 3623  C CB   . VAL A 1 42  ? -2.183  -0.410  6.209   1.00 0.00 ? 42  VAL A CB   3  
ATOM 3624  C CG1  . VAL A 1 42  ? -3.566  0.137   6.569   1.00 0.00 ? 42  VAL A CG1  3  
ATOM 3625  C CG2  . VAL A 1 42  ? -1.872  -0.185  4.728   1.00 0.00 ? 42  VAL A CG2  3  
ATOM 3626  H H    . VAL A 1 42  ? 0.078   -1.362  6.400   1.00 0.00 ? 42  VAL A H    3  
ATOM 3627  H HA   . VAL A 1 42  ? -0.923  1.226   6.753   1.00 0.00 ? 42  VAL A HA   3  
ATOM 3628  H HB   . VAL A 1 42  ? -2.191  -1.485  6.390   1.00 0.00 ? 42  VAL A HB   3  
ATOM 3629  H HG11 . VAL A 1 42  ? -3.598  0.373   7.632   1.00 0.00 ? 42  VAL A HG11 3  
ATOM 3630  H HG12 . VAL A 1 42  ? -3.761  1.041   5.990   1.00 0.00 ? 42  VAL A HG12 3  
ATOM 3631  H HG13 . VAL A 1 42  ? -4.324  -0.611  6.340   1.00 0.00 ? 42  VAL A HG13 3  
ATOM 3632  H HG21 . VAL A 1 42  ? -2.753  -0.421  4.132   1.00 0.00 ? 42  VAL A HG21 3  
ATOM 3633  H HG22 . VAL A 1 42  ? -1.594  0.857   4.570   1.00 0.00 ? 42  VAL A HG22 3  
ATOM 3634  H HG23 . VAL A 1 42  ? -1.047  -0.830  4.428   1.00 0.00 ? 42  VAL A HG23 3  
ATOM 3635  N N    . LYS A 1 43  ? -1.838  1.443   9.031   1.00 0.00 ? 43  LYS A N    3  
ATOM 3636  C CA   . LYS A 1 43  ? -2.233  1.631   10.416  1.00 0.00 ? 43  LYS A CA   3  
ATOM 3637  C C    . LYS A 1 43  ? -3.748  1.454   10.539  1.00 0.00 ? 43  LYS A C    3  
ATOM 3638  O O    . LYS A 1 43  ? -4.244  1.019   11.577  1.00 0.00 ? 43  LYS A O    3  
ATOM 3639  C CB   . LYS A 1 43  ? -1.727  2.976   10.940  1.00 0.00 ? 43  LYS A CB   3  
ATOM 3640  C CG   . LYS A 1 43  ? -2.565  4.131   10.388  1.00 0.00 ? 43  LYS A CG   3  
ATOM 3641  C CD   . LYS A 1 43  ? -2.736  5.234   11.434  1.00 0.00 ? 43  LYS A CD   3  
ATOM 3642  C CE   . LYS A 1 43  ? -1.803  6.412   11.146  1.00 0.00 ? 43  LYS A CE   3  
ATOM 3643  N NZ   . LYS A 1 43  ? -1.574  7.205   12.375  1.00 0.00 ? 43  LYS A NZ   3  
ATOM 3644  H H    . LYS A 1 43  ? -1.851  2.272   8.472   1.00 0.00 ? 43  LYS A H    3  
ATOM 3645  H HA   . LYS A 1 43  ? -1.746  0.852   11.003  1.00 0.00 ? 43  LYS A HA   3  
ATOM 3646  H HB2  . LYS A 1 43  ? -1.764  2.984   12.030  1.00 0.00 ? 43  LYS A HB2  3  
ATOM 3647  H HB3  . LYS A 1 43  ? -0.683  3.112   10.656  1.00 0.00 ? 43  LYS A HB3  3  
ATOM 3648  H HG2  . LYS A 1 43  ? -2.086  4.539   9.498   1.00 0.00 ? 43  LYS A HG2  3  
ATOM 3649  H HG3  . LYS A 1 43  ? -3.544  3.760   10.082  1.00 0.00 ? 43  LYS A HG3  3  
ATOM 3650  H HD2  . LYS A 1 43  ? -3.770  5.578   11.440  1.00 0.00 ? 43  LYS A HD2  3  
ATOM 3651  H HD3  . LYS A 1 43  ? -2.527  4.834   12.427  1.00 0.00 ? 43  LYS A HD3  3  
ATOM 3652  H HE2  . LYS A 1 43  ? -0.851  6.044   10.761  1.00 0.00 ? 43  LYS A HE2  3  
ATOM 3653  H HE3  . LYS A 1 43  ? -2.236  7.045   10.372  1.00 0.00 ? 43  LYS A HE3  3  
ATOM 3654  H HZ1  . LYS A 1 43  ? -1.774  8.167   12.192  1.00 0.00 ? 43  LYS A HZ1  3  
ATOM 3655  H HZ2  . LYS A 1 43  ? -2.174  6.872   13.102  1.00 0.00 ? 43  LYS A HZ2  3  
ATOM 3656  H HZ3  . LYS A 1 43  ? -0.620  7.111   12.660  1.00 0.00 ? 43  LYS A HZ3  3  
ATOM 3657  N N    . SER A 1 44  ? -4.441  1.801   9.464   1.00 0.00 ? 44  SER A N    3  
ATOM 3658  C CA   . SER A 1 44  ? -5.889  1.686   9.438   1.00 0.00 ? 44  SER A CA   3  
ATOM 3659  C C    . SER A 1 44  ? -6.423  2.111   8.068   1.00 0.00 ? 44  SER A C    3  
ATOM 3660  O O    . SER A 1 44  ? -5.657  2.259   7.118   1.00 0.00 ? 44  SER A O    3  
ATOM 3661  C CB   . SER A 1 44  ? -6.529  2.530   10.542  1.00 0.00 ? 44  SER A CB   3  
ATOM 3662  O OG   . SER A 1 44  ? -6.356  3.926   10.314  1.00 0.00 ? 44  SER A OG   3  
ATOM 3663  H H    . SER A 1 44  ? -4.030  2.154   8.623   1.00 0.00 ? 44  SER A H    3  
ATOM 3664  H HA   . SER A 1 44  ? -6.098  0.632   9.620   1.00 0.00 ? 44  SER A HA   3  
ATOM 3665  H HB2  . SER A 1 44  ? -7.593  2.301   10.603  1.00 0.00 ? 44  SER A HB2  3  
ATOM 3666  H HB3  . SER A 1 44  ? -6.089  2.262   11.503  1.00 0.00 ? 44  SER A HB3  3  
ATOM 3667  H HG   . SER A 1 44  ? -7.236  4.347   10.093  1.00 0.00 ? 44  SER A HG   3  
ATOM 3668  N N    . VAL A 1 45  ? -7.734  2.295   8.011   1.00 0.00 ? 45  VAL A N    3  
ATOM 3669  C CA   . VAL A 1 45  ? -8.379  2.700   6.774   1.00 0.00 ? 45  VAL A CA   3  
ATOM 3670  C C    . VAL A 1 45  ? -9.407  3.792   7.074   1.00 0.00 ? 45  VAL A C    3  
ATOM 3671  O O    . VAL A 1 45  ? -10.192 3.671   8.014   1.00 0.00 ? 45  VAL A O    3  
ATOM 3672  C CB   . VAL A 1 45  ? -8.989  1.481   6.078   1.00 0.00 ? 45  VAL A CB   3  
ATOM 3673  C CG1  . VAL A 1 45  ? -8.027  0.906   5.036   1.00 0.00 ? 45  VAL A CG1  3  
ATOM 3674  C CG2  . VAL A 1 45  ? -9.394  0.414   7.097   1.00 0.00 ? 45  VAL A CG2  3  
ATOM 3675  H H    . VAL A 1 45  ? -8.350  2.172   8.789   1.00 0.00 ? 45  VAL A H    3  
ATOM 3676  H HA   . VAL A 1 45  ? -7.610  3.112   6.121   1.00 0.00 ? 45  VAL A HA   3  
ATOM 3677  H HB   . VAL A 1 45  ? -9.890  1.807   5.559   1.00 0.00 ? 45  VAL A HB   3  
ATOM 3678  H HG11 . VAL A 1 45  ? -8.219  -0.159  4.912   1.00 0.00 ? 45  VAL A HG11 3  
ATOM 3679  H HG12 . VAL A 1 45  ? -8.176  1.416   4.084   1.00 0.00 ? 45  VAL A HG12 3  
ATOM 3680  H HG13 . VAL A 1 45  ? -6.999  1.054   5.370   1.00 0.00 ? 45  VAL A HG13 3  
ATOM 3681  H HG21 . VAL A 1 45  ? -10.150 0.821   7.768   1.00 0.00 ? 45  VAL A HG21 3  
ATOM 3682  H HG22 . VAL A 1 45  ? -9.801  -0.452  6.574   1.00 0.00 ? 45  VAL A HG22 3  
ATOM 3683  H HG23 . VAL A 1 45  ? -8.520  0.112   7.674   1.00 0.00 ? 45  VAL A HG23 3  
ATOM 3684  N N    . VAL A 1 46  ? -9.370  4.835   6.258   1.00 0.00 ? 46  VAL A N    3  
ATOM 3685  C CA   . VAL A 1 46  ? -10.289 5.949   6.424   1.00 0.00 ? 46  VAL A CA   3  
ATOM 3686  C C    . VAL A 1 46  ? -11.726 5.423   6.427   1.00 0.00 ? 46  VAL A C    3  
ATOM 3687  O O    . VAL A 1 46  ? -12.643 6.116   6.864   1.00 0.00 ? 46  VAL A O    3  
ATOM 3688  C CB   . VAL A 1 46  ? -10.039 7.000   5.340   1.00 0.00 ? 46  VAL A CB   3  
ATOM 3689  C CG1  . VAL A 1 46  ? -11.259 7.907   5.165   1.00 0.00 ? 46  VAL A CG1  3  
ATOM 3690  C CG2  . VAL A 1 46  ? -8.785  7.820   5.651   1.00 0.00 ? 46  VAL A CG2  3  
ATOM 3691  H H    . VAL A 1 46  ? -8.729  4.927   5.496   1.00 0.00 ? 46  VAL A H    3  
ATOM 3692  H HA   . VAL A 1 46  ? -10.080 6.406   7.392   1.00 0.00 ? 46  VAL A HA   3  
ATOM 3693  H HB   . VAL A 1 46  ? -9.873  6.477   4.399   1.00 0.00 ? 46  VAL A HB   3  
ATOM 3694  H HG11 . VAL A 1 46  ? -11.360 8.552   6.038   1.00 0.00 ? 46  VAL A HG11 3  
ATOM 3695  H HG12 . VAL A 1 46  ? -11.130 8.521   4.274   1.00 0.00 ? 46  VAL A HG12 3  
ATOM 3696  H HG13 . VAL A 1 46  ? -12.154 7.295   5.059   1.00 0.00 ? 46  VAL A HG13 3  
ATOM 3697  H HG21 . VAL A 1 46  ? -9.007  8.881   5.535   1.00 0.00 ? 46  VAL A HG21 3  
ATOM 3698  H HG22 . VAL A 1 46  ? -8.468  7.625   6.675   1.00 0.00 ? 46  VAL A HG22 3  
ATOM 3699  H HG23 . VAL A 1 46  ? -7.988  7.539   4.963   1.00 0.00 ? 46  VAL A HG23 3  
ATOM 3700  N N    . LYS A 1 47  ? -11.876 4.202   5.934   1.00 0.00 ? 47  LYS A N    3  
ATOM 3701  C CA   . LYS A 1 47  ? -13.186 3.576   5.875   1.00 0.00 ? 47  LYS A CA   3  
ATOM 3702  C C    . LYS A 1 47  ? -14.113 4.424   5.002   1.00 0.00 ? 47  LYS A C    3  
ATOM 3703  O O    . LYS A 1 47  ? -15.285 4.603   5.327   1.00 0.00 ? 47  LYS A O    3  
ATOM 3704  C CB   . LYS A 1 47  ? -13.726 3.327   7.285   1.00 0.00 ? 47  LYS A CB   3  
ATOM 3705  C CG   . LYS A 1 47  ? -14.787 2.225   7.279   1.00 0.00 ? 47  LYS A CG   3  
ATOM 3706  C CD   . LYS A 1 47  ? -15.862 2.494   8.335   1.00 0.00 ? 47  LYS A CD   3  
ATOM 3707  C CE   . LYS A 1 47  ? -15.308 2.286   9.746   1.00 0.00 ? 47  LYS A CE   3  
ATOM 3708  N NZ   . LYS A 1 47  ? -16.372 2.487   10.755  1.00 0.00 ? 47  LYS A NZ   3  
ATOM 3709  H H    . LYS A 1 47  ? -11.125 3.646   5.581   1.00 0.00 ? 47  LYS A H    3  
ATOM 3710  H HA   . LYS A 1 47  ? -13.061 2.602   5.401   1.00 0.00 ? 47  LYS A HA   3  
ATOM 3711  H HB2  . LYS A 1 47  ? -12.907 3.046   7.947   1.00 0.00 ? 47  LYS A HB2  3  
ATOM 3712  H HB3  . LYS A 1 47  ? -14.154 4.248   7.681   1.00 0.00 ? 47  LYS A HB3  3  
ATOM 3713  H HG2  . LYS A 1 47  ? -15.248 2.164   6.293   1.00 0.00 ? 47  LYS A HG2  3  
ATOM 3714  H HG3  . LYS A 1 47  ? -14.316 1.261   7.471   1.00 0.00 ? 47  LYS A HG3  3  
ATOM 3715  H HD2  . LYS A 1 47  ? -16.231 3.514   8.231   1.00 0.00 ? 47  LYS A HD2  3  
ATOM 3716  H HD3  . LYS A 1 47  ? -16.710 1.830   8.172   1.00 0.00 ? 47  LYS A HD3  3  
ATOM 3717  H HE2  . LYS A 1 47  ? -14.897 1.281   9.837   1.00 0.00 ? 47  LYS A HE2  3  
ATOM 3718  H HE3  . LYS A 1 47  ? -14.490 2.983   9.928   1.00 0.00 ? 47  LYS A HE3  3  
ATOM 3719  H HZ1  . LYS A 1 47  ? -17.007 3.190   10.434  1.00 0.00 ? 47  LYS A HZ1  3  
ATOM 3720  H HZ2  . LYS A 1 47  ? -16.867 1.629   10.893  1.00 0.00 ? 47  LYS A HZ2  3  
ATOM 3721  H HZ3  . LYS A 1 47  ? -15.961 2.778   11.619  1.00 0.00 ? 47  LYS A HZ3  3  
ATOM 3722  N N    . GLY A 1 48  ? -13.552 4.922   3.910   1.00 0.00 ? 48  GLY A N    3  
ATOM 3723  C CA   . GLY A 1 48  ? -14.314 5.747   2.987   1.00 0.00 ? 48  GLY A CA   3  
ATOM 3724  C C    . GLY A 1 48  ? -13.551 5.952   1.677   1.00 0.00 ? 48  GLY A C    3  
ATOM 3725  O O    . GLY A 1 48  ? -13.702 6.983   1.022   1.00 0.00 ? 48  GLY A O    3  
ATOM 3726  H H    . GLY A 1 48  ? -12.598 4.772   3.652   1.00 0.00 ? 48  GLY A H    3  
ATOM 3727  H HA2  . GLY A 1 48  ? -15.276 5.277   2.783   1.00 0.00 ? 48  GLY A HA2  3  
ATOM 3728  H HA3  . GLY A 1 48  ? -14.523 6.714   3.446   1.00 0.00 ? 48  GLY A HA3  3  
ATOM 3729  N N    . GLY A 1 49  ? -12.749 4.955   1.334   1.00 0.00 ? 49  GLY A N    3  
ATOM 3730  C CA   . GLY A 1 49  ? -11.963 5.014   0.114   1.00 0.00 ? 49  GLY A CA   3  
ATOM 3731  C C    . GLY A 1 49  ? -11.846 3.630   -0.530  1.00 0.00 ? 49  GLY A C    3  
ATOM 3732  O O    . GLY A 1 49  ? -12.126 2.618   0.110   1.00 0.00 ? 49  GLY A O    3  
ATOM 3733  H H    . GLY A 1 49  ? -12.633 4.121   1.872   1.00 0.00 ? 49  GLY A H    3  
ATOM 3734  H HA2  . GLY A 1 49  ? -12.425 5.707   -0.588  1.00 0.00 ? 49  GLY A HA2  3  
ATOM 3735  H HA3  . GLY A 1 49  ? -10.968 5.400   0.336   1.00 0.00 ? 49  GLY A HA3  3  
ATOM 3736  N N    . ALA A 1 50  ? -11.432 3.631   -1.788  1.00 0.00 ? 50  ALA A N    3  
ATOM 3737  C CA   . ALA A 1 50  ? -11.274 2.389   -2.526  1.00 0.00 ? 50  ALA A CA   3  
ATOM 3738  C C    . ALA A 1 50  ? -10.682 1.324   -1.601  1.00 0.00 ? 50  ALA A C    3  
ATOM 3739  O O    . ALA A 1 50  ? -11.116 0.173   -1.616  1.00 0.00 ? 50  ALA A O    3  
ATOM 3740  C CB   . ALA A 1 50  ? -10.407 2.635   -3.762  1.00 0.00 ? 50  ALA A CB   3  
ATOM 3741  H H    . ALA A 1 50  ? -11.206 4.459   -2.302  1.00 0.00 ? 50  ALA A H    3  
ATOM 3742  H HA   . ALA A 1 50  ? -12.264 2.068   -2.849  1.00 0.00 ? 50  ALA A HA   3  
ATOM 3743  H HB1  . ALA A 1 50  ? -9.800  3.528   -3.608  1.00 0.00 ? 50  ALA A HB1  3  
ATOM 3744  H HB2  . ALA A 1 50  ? -9.756  1.777   -3.925  1.00 0.00 ? 50  ALA A HB2  3  
ATOM 3745  H HB3  . ALA A 1 50  ? -11.048 2.777   -4.632  1.00 0.00 ? 50  ALA A HB3  3  
ATOM 3746  N N    . ALA A 1 51  ? -9.700  1.745   -0.818  1.00 0.00 ? 51  ALA A N    3  
ATOM 3747  C CA   . ALA A 1 51  ? -9.044  0.842   0.112   1.00 0.00 ? 51  ALA A CA   3  
ATOM 3748  C C    . ALA A 1 51  ? -10.103 0.096   0.925   1.00 0.00 ? 51  ALA A C    3  
ATOM 3749  O O    . ALA A 1 51  ? -10.513 -1.004  0.556   1.00 0.00 ? 51  ALA A O    3  
ATOM 3750  C CB   . ALA A 1 51  ? -8.079  1.633   0.998   1.00 0.00 ? 51  ALA A CB   3  
ATOM 3751  H H    . ALA A 1 51  ? -9.353  2.683   -0.812  1.00 0.00 ? 51  ALA A H    3  
ATOM 3752  H HA   . ALA A 1 51  ? -8.472  0.121   -0.473  1.00 0.00 ? 51  ALA A HA   3  
ATOM 3753  H HB1  . ALA A 1 51  ? -7.548  0.948   1.659   1.00 0.00 ? 51  ALA A HB1  3  
ATOM 3754  H HB2  . ALA A 1 51  ? -7.361  2.162   0.371   1.00 0.00 ? 51  ALA A HB2  3  
ATOM 3755  H HB3  . ALA A 1 51  ? -8.640  2.352   1.595   1.00 0.00 ? 51  ALA A HB3  3  
ATOM 3756  N N    . ASP A 1 52  ? -10.516 0.724   2.016   1.00 0.00 ? 52  ASP A N    3  
ATOM 3757  C CA   . ASP A 1 52  ? -11.521 0.133   2.885   1.00 0.00 ? 52  ASP A CA   3  
ATOM 3758  C C    . ASP A 1 52  ? -12.774 -0.183  2.066   1.00 0.00 ? 52  ASP A C    3  
ATOM 3759  O O    . ASP A 1 52  ? -13.663 -0.893  2.535   1.00 0.00 ? 52  ASP A O    3  
ATOM 3760  C CB   . ASP A 1 52  ? -11.917 1.098   4.004   1.00 0.00 ? 52  ASP A CB   3  
ATOM 3761  C CG   . ASP A 1 52  ? -12.058 0.460   5.387   1.00 0.00 ? 52  ASP A CG   3  
ATOM 3762  O OD1  . ASP A 1 52  ? -12.432 -0.732  5.428   1.00 0.00 ? 52  ASP A OD1  3  
ATOM 3763  O OD2  . ASP A 1 52  ? -11.788 1.180   6.374   1.00 0.00 ? 52  ASP A OD2  3  
ATOM 3764  H H    . ASP A 1 52  ? -10.178 1.618   2.309   1.00 0.00 ? 52  ASP A H    3  
ATOM 3765  H HA   . ASP A 1 52  ? -11.054 -0.762  3.295   1.00 0.00 ? 52  ASP A HA   3  
ATOM 3766  H HB2  . ASP A 1 52  ? -11.172 1.892   4.060   1.00 0.00 ? 52  ASP A HB2  3  
ATOM 3767  H HB3  . ASP A 1 52  ? -12.864 1.568   3.739   1.00 0.00 ? 52  ASP A HB3  3  
ATOM 3768  N N    . VAL A 1 53  ? -12.805 0.359   0.858   1.00 0.00 ? 53  VAL A N    3  
ATOM 3769  C CA   . VAL A 1 53  ? -13.935 0.144   -0.030  1.00 0.00 ? 53  VAL A CA   3  
ATOM 3770  C C    . VAL A 1 53  ? -13.747 -1.178  -0.777  1.00 0.00 ? 53  VAL A C    3  
ATOM 3771  O O    . VAL A 1 53  ? -14.721 -1.812  -1.180  1.00 0.00 ? 53  VAL A O    3  
ATOM 3772  C CB   . VAL A 1 53  ? -14.100 1.342   -0.967  1.00 0.00 ? 53  VAL A CB   3  
ATOM 3773  C CG1  . VAL A 1 53  ? -14.641 0.902   -2.329  1.00 0.00 ? 53  VAL A CG1  3  
ATOM 3774  C CG2  . VAL A 1 53  ? -14.998 2.410   -0.339  1.00 0.00 ? 53  VAL A CG2  3  
ATOM 3775  H H    . VAL A 1 53  ? -12.078 0.935   0.484   1.00 0.00 ? 53  VAL A H    3  
ATOM 3776  H HA   . VAL A 1 53  ? -14.830 0.073   0.588   1.00 0.00 ? 53  VAL A HA   3  
ATOM 3777  H HB   . VAL A 1 53  ? -13.116 1.782   -1.124  1.00 0.00 ? 53  VAL A HB   3  
ATOM 3778  H HG11 . VAL A 1 53  ? -13.821 0.527   -2.942  1.00 0.00 ? 53  VAL A HG11 3  
ATOM 3779  H HG12 . VAL A 1 53  ? -15.380 0.113   -2.189  1.00 0.00 ? 53  VAL A HG12 3  
ATOM 3780  H HG13 . VAL A 1 53  ? -15.107 1.753   -2.827  1.00 0.00 ? 53  VAL A HG13 3  
ATOM 3781  H HG21 . VAL A 1 53  ? -14.384 3.233   0.024   1.00 0.00 ? 53  VAL A HG21 3  
ATOM 3782  H HG22 . VAL A 1 53  ? -15.698 2.781   -1.087  1.00 0.00 ? 53  VAL A HG22 3  
ATOM 3783  H HG23 . VAL A 1 53  ? -15.552 1.975   0.493   1.00 0.00 ? 53  VAL A HG23 3  
ATOM 3784  N N    . ASP A 1 54  ? -12.487 -1.555  -0.940  1.00 0.00 ? 54  ASP A N    3  
ATOM 3785  C CA   . ASP A 1 54  ? -12.158 -2.790  -1.631  1.00 0.00 ? 54  ASP A CA   3  
ATOM 3786  C C    . ASP A 1 54  ? -12.385 -3.973  -0.688  1.00 0.00 ? 54  ASP A C    3  
ATOM 3787  O O    . ASP A 1 54  ? -12.159 -5.122  -1.064  1.00 0.00 ? 54  ASP A O    3  
ATOM 3788  C CB   . ASP A 1 54  ? -10.691 -2.805  -2.064  1.00 0.00 ? 54  ASP A CB   3  
ATOM 3789  C CG   . ASP A 1 54  ? -10.453 -3.172  -3.530  1.00 0.00 ? 54  ASP A CG   3  
ATOM 3790  O OD1  . ASP A 1 54  ? -11.463 -3.296  -4.255  1.00 0.00 ? 54  ASP A OD1  3  
ATOM 3791  O OD2  . ASP A 1 54  ? -9.266  -3.322  -3.892  1.00 0.00 ? 54  ASP A OD2  3  
ATOM 3792  H H    . ASP A 1 54  ? -11.700 -1.033  -0.609  1.00 0.00 ? 54  ASP A H    3  
ATOM 3793  H HA   . ASP A 1 54  ? -12.816 -2.816  -2.499  1.00 0.00 ? 54  ASP A HA   3  
ATOM 3794  H HB2  . ASP A 1 54  ? -10.262 -1.820  -1.878  1.00 0.00 ? 54  ASP A HB2  3  
ATOM 3795  H HB3  . ASP A 1 54  ? -10.149 -3.511  -1.435  1.00 0.00 ? 54  ASP A HB3  3  
ATOM 3796  N N    . GLY A 1 55  ? -12.829 -3.651  0.518   1.00 0.00 ? 55  GLY A N    3  
ATOM 3797  C CA   . GLY A 1 55  ? -13.089 -4.673  1.517   1.00 0.00 ? 55  GLY A CA   3  
ATOM 3798  C C    . GLY A 1 55  ? -11.901 -5.629  1.646   1.00 0.00 ? 55  GLY A C    3  
ATOM 3799  O O    . GLY A 1 55  ? -12.068 -6.846  1.581   1.00 0.00 ? 55  GLY A O    3  
ATOM 3800  H H    . GLY A 1 55  ? -13.010 -2.714  0.815   1.00 0.00 ? 55  GLY A H    3  
ATOM 3801  H HA2  . GLY A 1 55  ? -13.288 -4.203  2.480   1.00 0.00 ? 55  GLY A HA2  3  
ATOM 3802  H HA3  . GLY A 1 55  ? -13.983 -5.234  1.245   1.00 0.00 ? 55  GLY A HA3  3  
ATOM 3803  N N    . ARG A 1 56  ? -10.727 -5.042  1.825   1.00 0.00 ? 56  ARG A N    3  
ATOM 3804  C CA   . ARG A 1 56  ? -9.511  -5.826  1.964   1.00 0.00 ? 56  ARG A CA   3  
ATOM 3805  C C    . ARG A 1 56  ? -8.414  -4.991  2.627   1.00 0.00 ? 56  ARG A C    3  
ATOM 3806  O O    . ARG A 1 56  ? -7.675  -5.491  3.474   1.00 0.00 ? 56  ARG A O    3  
ATOM 3807  C CB   . ARG A 1 56  ? -9.016  -6.318  0.603   1.00 0.00 ? 56  ARG A CB   3  
ATOM 3808  C CG   . ARG A 1 56  ? -8.942  -7.846  0.566   1.00 0.00 ? 56  ARG A CG   3  
ATOM 3809  C CD   . ARG A 1 56  ? -9.118  -8.369  -0.861  1.00 0.00 ? 56  ARG A CD   3  
ATOM 3810  N NE   . ARG A 1 56  ? -7.800  -8.713  -1.440  1.00 0.00 ? 56  ARG A NE   3  
ATOM 3811  C CZ   . ARG A 1 56  ? -7.636  -9.409  -2.573  1.00 0.00 ? 56  ARG A CZ   3  
ATOM 3812  N NH1  . ARG A 1 56  ? -8.705  -9.841  -3.255  1.00 0.00 ? 56  ARG A NH1  3  
ATOM 3813  N NH2  . ARG A 1 56  ? -6.402  -9.675  -3.023  1.00 0.00 ? 56  ARG A NH2  3  
ATOM 3814  H H    . ARG A 1 56  ? -10.599 -4.051  1.877   1.00 0.00 ? 56  ARG A H    3  
ATOM 3815  H HA   . ARG A 1 56  ? -9.795  -6.671  2.591   1.00 0.00 ? 56  ARG A HA   3  
ATOM 3816  H HB2  . ARG A 1 56  ? -9.684  -5.963  -0.182  1.00 0.00 ? 56  ARG A HB2  3  
ATOM 3817  H HB3  . ARG A 1 56  ? -8.031  -5.898  0.396   1.00 0.00 ? 56  ARG A HB3  3  
ATOM 3818  H HG2  . ARG A 1 56  ? -7.983  -8.177  0.963   1.00 0.00 ? 56  ARG A HG2  3  
ATOM 3819  H HG3  . ARG A 1 56  ? -9.716  -8.266  1.209   1.00 0.00 ? 56  ARG A HG3  3  
ATOM 3820  H HD2  . ARG A 1 56  ? -9.764  -9.247  -0.859  1.00 0.00 ? 56  ARG A HD2  3  
ATOM 3821  H HD3  . ARG A 1 56  ? -9.609  -7.614  -1.476  1.00 0.00 ? 56  ARG A HD3  3  
ATOM 3822  H HE   . ARG A 1 56  ? -6.981  -8.406  -0.956  1.00 0.00 ? 56  ARG A HE   3  
ATOM 3823  H HH11 . ARG A 1 56  ? -9.626  -9.643  -2.919  1.00 0.00 ? 56  ARG A HH11 3  
ATOM 3824  H HH12 . ARG A 1 56  ? -8.583  -10.361 -4.101  1.00 0.00 ? 56  ARG A HH12 3  
ATOM 3825  H HH21 . ARG A 1 56  ? -5.604  -9.353  -2.514  1.00 0.00 ? 56  ARG A HH21 3  
ATOM 3826  H HH22 . ARG A 1 56  ? -6.279  -10.195 -3.869  1.00 0.00 ? 56  ARG A HH22 3  
ATOM 3827  N N    . LEU A 1 57  ? -8.342  -3.733  2.216   1.00 0.00 ? 57  LEU A N    3  
ATOM 3828  C CA   . LEU A 1 57  ? -7.347  -2.824  2.760   1.00 0.00 ? 57  LEU A CA   3  
ATOM 3829  C C    . LEU A 1 57  ? -7.683  -2.523  4.222   1.00 0.00 ? 57  LEU A C    3  
ATOM 3830  O O    . LEU A 1 57  ? -8.833  -2.243  4.553   1.00 0.00 ? 57  LEU A O    3  
ATOM 3831  C CB   . LEU A 1 57  ? -7.229  -1.574  1.886   1.00 0.00 ? 57  LEU A CB   3  
ATOM 3832  C CG   . LEU A 1 57  ? -6.499  -1.754  0.553   1.00 0.00 ? 57  LEU A CG   3  
ATOM 3833  C CD1  . LEU A 1 57  ? -5.899  -0.431  0.074   1.00 0.00 ? 57  LEU A CD1  3  
ATOM 3834  C CD2  . LEU A 1 57  ? -5.446  -2.860  0.650   1.00 0.00 ? 57  LEU A CD2  3  
ATOM 3835  H H    . LEU A 1 57  ? -8.946  -3.335  1.527   1.00 0.00 ? 57  LEU A H    3  
ATOM 3836  H HA   . LEU A 1 57  ? -6.384  -3.334  2.725   1.00 0.00 ? 57  LEU A HA   3  
ATOM 3837  H HB2  . LEU A 1 57  ? -8.233  -1.202  1.681   1.00 0.00 ? 57  LEU A HB2  3  
ATOM 3838  H HB3  . LEU A 1 57  ? -6.714  -0.802  2.458   1.00 0.00 ? 57  LEU A HB3  3  
ATOM 3839  H HG   . LEU A 1 57  ? -7.227  -2.067  -0.195  1.00 0.00 ? 57  LEU A HG   3  
ATOM 3840  H HD11 . LEU A 1 57  ? -6.506  -0.028  -0.736  1.00 0.00 ? 57  LEU A HD11 3  
ATOM 3841  H HD12 . LEU A 1 57  ? -5.879  0.280   0.901   1.00 0.00 ? 57  LEU A HD12 3  
ATOM 3842  H HD13 . LEU A 1 57  ? -4.883  -0.601  -0.283  1.00 0.00 ? 57  LEU A HD13 3  
ATOM 3843  H HD21 . LEU A 1 57  ? -4.841  -2.709  1.544   1.00 0.00 ? 57  LEU A HD21 3  
ATOM 3844  H HD22 . LEU A 1 57  ? -5.941  -3.829  0.705   1.00 0.00 ? 57  LEU A HD22 3  
ATOM 3845  H HD23 . LEU A 1 57  ? -4.805  -2.829  -0.232  1.00 0.00 ? 57  LEU A HD23 3  
ATOM 3846  N N    . ALA A 1 58  ? -6.657  -2.592  5.058   1.00 0.00 ? 58  ALA A N    3  
ATOM 3847  C CA   . ALA A 1 58  ? -6.828  -2.330  6.477   1.00 0.00 ? 58  ALA A CA   3  
ATOM 3848  C C    . ALA A 1 58  ? -5.477  -2.461  7.182   1.00 0.00 ? 58  ALA A C    3  
ATOM 3849  O O    . ALA A 1 58  ? -4.551  -3.071  6.650   1.00 0.00 ? 58  ALA A O    3  
ATOM 3850  C CB   . ALA A 1 58  ? -7.879  -3.283  7.048   1.00 0.00 ? 58  ALA A CB   3  
ATOM 3851  H H    . ALA A 1 58  ? -5.724  -2.821  4.780   1.00 0.00 ? 58  ALA A H    3  
ATOM 3852  H HA   . ALA A 1 58  ? -7.187  -1.306  6.584   1.00 0.00 ? 58  ALA A HA   3  
ATOM 3853  H HB1  . ALA A 1 58  ? -7.459  -3.820  7.899   1.00 0.00 ? 58  ALA A HB1  3  
ATOM 3854  H HB2  . ALA A 1 58  ? -8.749  -2.713  7.373   1.00 0.00 ? 58  ALA A HB2  3  
ATOM 3855  H HB3  . ALA A 1 58  ? -8.178  -3.997  6.281   1.00 0.00 ? 58  ALA A HB3  3  
ATOM 3856  N N    . ALA A 1 59  ? -5.407  -1.877  8.370   1.00 0.00 ? 59  ALA A N    3  
ATOM 3857  C CA   . ALA A 1 59  ? -4.184  -1.921  9.154   1.00 0.00 ? 59  ALA A CA   3  
ATOM 3858  C C    . ALA A 1 59  ? -3.540  -3.302  9.010   1.00 0.00 ? 59  ALA A C    3  
ATOM 3859  O O    . ALA A 1 59  ? -4.198  -4.321  9.214   1.00 0.00 ? 59  ALA A O    3  
ATOM 3860  C CB   . ALA A 1 59  ? -4.498  -1.573  10.610  1.00 0.00 ? 59  ALA A CB   3  
ATOM 3861  H H    . ALA A 1 59  ? -6.164  -1.383  8.796   1.00 0.00 ? 59  ALA A H    3  
ATOM 3862  H HA   . ALA A 1 59  ? -3.505  -1.169  8.752   1.00 0.00 ? 59  ALA A HA   3  
ATOM 3863  H HB1  . ALA A 1 59  ? -4.622  -2.491  11.185  1.00 0.00 ? 59  ALA A HB1  3  
ATOM 3864  H HB2  . ALA A 1 59  ? -3.679  -0.989  11.029  1.00 0.00 ? 59  ALA A HB2  3  
ATOM 3865  H HB3  . ALA A 1 59  ? -5.419  -0.991  10.654  1.00 0.00 ? 59  ALA A HB3  3  
ATOM 3866  N N    . GLY A 1 60  ? -2.263  -3.290  8.660   1.00 0.00 ? 60  GLY A N    3  
ATOM 3867  C CA   . GLY A 1 60  ? -1.523  -4.529  8.487   1.00 0.00 ? 60  GLY A CA   3  
ATOM 3868  C C    . GLY A 1 60  ? -1.075  -4.702  7.034   1.00 0.00 ? 60  GLY A C    3  
ATOM 3869  O O    . GLY A 1 60  ? -0.171  -5.485  6.749   1.00 0.00 ? 60  GLY A O    3  
ATOM 3870  H H    . GLY A 1 60  ? -1.735  -2.457  8.496   1.00 0.00 ? 60  GLY A H    3  
ATOM 3871  H HA2  . GLY A 1 60  ? -0.652  -4.531  9.143   1.00 0.00 ? 60  GLY A HA2  3  
ATOM 3872  H HA3  . GLY A 1 60  ? -2.146  -5.373  8.782   1.00 0.00 ? 60  GLY A HA3  3  
ATOM 3873  N N    . ASP A 1 61  ? -1.729  -3.958  6.155   1.00 0.00 ? 61  ASP A N    3  
ATOM 3874  C CA   . ASP A 1 61  ? -1.410  -4.019  4.739   1.00 0.00 ? 61  ASP A CA   3  
ATOM 3875  C C    . ASP A 1 61  ? 0.018   -3.515  4.520   1.00 0.00 ? 61  ASP A C    3  
ATOM 3876  O O    . ASP A 1 61  ? 0.357   -2.405  4.928   1.00 0.00 ? 61  ASP A O    3  
ATOM 3877  C CB   . ASP A 1 61  ? -2.354  -3.134  3.922   1.00 0.00 ? 61  ASP A CB   3  
ATOM 3878  C CG   . ASP A 1 61  ? -3.139  -3.861  2.829   1.00 0.00 ? 61  ASP A CG   3  
ATOM 3879  O OD1  . ASP A 1 61  ? -4.031  -4.654  3.203   1.00 0.00 ? 61  ASP A OD1  3  
ATOM 3880  O OD2  . ASP A 1 61  ? -2.830  -3.608  1.645   1.00 0.00 ? 61  ASP A OD2  3  
ATOM 3881  H H    . ASP A 1 61  ? -2.464  -3.323  6.395   1.00 0.00 ? 61  ASP A H    3  
ATOM 3882  H HA   . ASP A 1 61  ? -1.529  -5.067  4.463   1.00 0.00 ? 61  ASP A HA   3  
ATOM 3883  H HB2  . ASP A 1 61  ? -3.062  -2.659  4.602   1.00 0.00 ? 61  ASP A HB2  3  
ATOM 3884  H HB3  . ASP A 1 61  ? -1.772  -2.336  3.461   1.00 0.00 ? 61  ASP A HB3  3  
ATOM 3885  N N    . GLN A 1 62  ? 0.816   -4.354  3.876   1.00 0.00 ? 62  GLN A N    3  
ATOM 3886  C CA   . GLN A 1 62  ? 2.199   -4.007  3.599   1.00 0.00 ? 62  GLN A CA   3  
ATOM 3887  C C    . GLN A 1 62  ? 2.393   -3.757  2.102   1.00 0.00 ? 62  GLN A C    3  
ATOM 3888  O O    . GLN A 1 62  ? 2.324   -4.687  1.299   1.00 0.00 ? 62  GLN A O    3  
ATOM 3889  C CB   . GLN A 1 62  ? 3.149   -5.097  4.100   1.00 0.00 ? 62  GLN A CB   3  
ATOM 3890  C CG   . GLN A 1 62  ? 4.547   -4.531  4.354   1.00 0.00 ? 62  GLN A CG   3  
ATOM 3891  C CD   . GLN A 1 62  ? 5.581   -5.654  4.466   1.00 0.00 ? 62  GLN A CD   3  
ATOM 3892  O OE1  . GLN A 1 62  ? 6.191   -6.069  3.495   1.00 0.00 ? 62  GLN A OE1  3  
ATOM 3893  N NE2  . GLN A 1 62  ? 5.742   -6.120  5.701   1.00 0.00 ? 62  GLN A NE2  3  
ATOM 3894  H H    . GLN A 1 62  ? 0.531   -5.255  3.548   1.00 0.00 ? 62  GLN A H    3  
ATOM 3895  H HA   . GLN A 1 62  ? 2.385   -3.089  4.155   1.00 0.00 ? 62  GLN A HA   3  
ATOM 3896  H HB2  . GLN A 1 62  ? 2.756   -5.533  5.019   1.00 0.00 ? 62  GLN A HB2  3  
ATOM 3897  H HB3  . GLN A 1 62  ? 3.206   -5.901  3.366   1.00 0.00 ? 62  GLN A HB3  3  
ATOM 3898  H HG2  . GLN A 1 62  ? 4.824   -3.857  3.544   1.00 0.00 ? 62  GLN A HG2  3  
ATOM 3899  H HG3  . GLN A 1 62  ? 4.544   -3.943  5.272   1.00 0.00 ? 62  GLN A HG3  3  
ATOM 3900  H HE21 . GLN A 1 62  ? 5.209   -5.735  6.455   1.00 0.00 ? 62  GLN A HE21 3  
ATOM 3901  H HE22 . GLN A 1 62  ? 6.397   -6.855  5.876   1.00 0.00 ? 62  GLN A HE22 3  
ATOM 3902  N N    . LEU A 1 63  ? 2.633   -2.497  1.771   1.00 0.00 ? 63  LEU A N    3  
ATOM 3903  C CA   . LEU A 1 63  ? 2.837   -2.112  0.385   1.00 0.00 ? 63  LEU A CA   3  
ATOM 3904  C C    . LEU A 1 63  ? 4.308   -2.319  0.015   1.00 0.00 ? 63  LEU A C    3  
ATOM 3905  O O    . LEU A 1 63  ? 5.186   -1.642  0.547   1.00 0.00 ? 63  LEU A O    3  
ATOM 3906  C CB   . LEU A 1 63  ? 2.337   -0.686  0.145   1.00 0.00 ? 63  LEU A CB   3  
ATOM 3907  C CG   . LEU A 1 63  ? 0.979   -0.340  0.759   1.00 0.00 ? 63  LEU A CG   3  
ATOM 3908  C CD1  . LEU A 1 63  ? 1.150   0.336   2.121   1.00 0.00 ? 63  LEU A CD1  3  
ATOM 3909  C CD2  . LEU A 1 63  ? 0.144   0.509   -0.202  1.00 0.00 ? 63  LEU A CD2  3  
ATOM 3910  H H    . LEU A 1 63  ? 2.688   -1.746  2.430   1.00 0.00 ? 63  LEU A H    3  
ATOM 3911  H HA   . LEU A 1 63  ? 2.230   -2.775  -0.231  1.00 0.00 ? 63  LEU A HA   3  
ATOM 3912  H HB2  . LEU A 1 63  ? 3.079   0.009   0.537   1.00 0.00 ? 63  LEU A HB2  3  
ATOM 3913  H HB3  . LEU A 1 63  ? 2.281   -0.519  -0.931  1.00 0.00 ? 63  LEU A HB3  3  
ATOM 3914  H HG   . LEU A 1 63  ? 0.433   -1.268  0.926   1.00 0.00 ? 63  LEU A HG   3  
ATOM 3915  H HD11 . LEU A 1 63  ? 2.152   0.139   2.501   1.00 0.00 ? 63  LEU A HD11 3  
ATOM 3916  H HD12 . LEU A 1 63  ? 1.006   1.411   2.013   1.00 0.00 ? 63  LEU A HD12 3  
ATOM 3917  H HD13 . LEU A 1 63  ? 0.412   -0.061  2.818   1.00 0.00 ? 63  LEU A HD13 3  
ATOM 3918  H HD21 . LEU A 1 63  ? 0.806   1.057   -0.872  1.00 0.00 ? 63  LEU A HD21 3  
ATOM 3919  H HD22 . LEU A 1 63  ? -0.509  -0.140  -0.786  1.00 0.00 ? 63  LEU A HD22 3  
ATOM 3920  H HD23 . LEU A 1 63  ? -0.461  1.214   0.369   1.00 0.00 ? 63  LEU A HD23 3  
ATOM 3921  N N    . LEU A 1 64  ? 4.530   -3.256  -0.895  1.00 0.00 ? 64  LEU A N    3  
ATOM 3922  C CA   . LEU A 1 64  ? 5.878   -3.560  -1.343  1.00 0.00 ? 64  LEU A CA   3  
ATOM 3923  C C    . LEU A 1 64  ? 6.298   -2.545  -2.408  1.00 0.00 ? 64  LEU A C    3  
ATOM 3924  O O    . LEU A 1 64  ? 7.447   -2.107  -2.435  1.00 0.00 ? 64  LEU A O    3  
ATOM 3925  C CB   . LEU A 1 64  ? 5.974   -5.014  -1.807  1.00 0.00 ? 64  LEU A CB   3  
ATOM 3926  C CG   . LEU A 1 64  ? 6.745   -5.963  -0.887  1.00 0.00 ? 64  LEU A CG   3  
ATOM 3927  C CD1  . LEU A 1 64  ? 5.799   -6.951  -0.201  1.00 0.00 ? 64  LEU A CD1  3  
ATOM 3928  C CD2  . LEU A 1 64  ? 7.864   -6.676  -1.649  1.00 0.00 ? 64  LEU A CD2  3  
ATOM 3929  H H    . LEU A 1 64  ? 3.809   -3.802  -1.323  1.00 0.00 ? 64  LEU A H    3  
ATOM 3930  H HA   . LEU A 1 64  ? 6.540   -3.452  -0.483  1.00 0.00 ? 64  LEU A HA   3  
ATOM 3931  H HB2  . LEU A 1 64  ? 4.963   -5.402  -1.931  1.00 0.00 ? 64  LEU A HB2  3  
ATOM 3932  H HB3  . LEU A 1 64  ? 6.444   -5.031  -2.790  1.00 0.00 ? 64  LEU A HB3  3  
ATOM 3933  H HG   . LEU A 1 64  ? 7.216   -5.371  -0.103  1.00 0.00 ? 64  LEU A HG   3  
ATOM 3934  H HD11 . LEU A 1 64  ? 5.124   -6.407  0.460   1.00 0.00 ? 64  LEU A HD11 3  
ATOM 3935  H HD12 . LEU A 1 64  ? 5.219   -7.482  -0.955  1.00 0.00 ? 64  LEU A HD12 3  
ATOM 3936  H HD13 . LEU A 1 64  ? 6.380   -7.666  0.381   1.00 0.00 ? 64  LEU A HD13 3  
ATOM 3937  H HD21 . LEU A 1 64  ? 8.453   -7.274  -0.953  1.00 0.00 ? 64  LEU A HD21 3  
ATOM 3938  H HD22 . LEU A 1 64  ? 7.430   -7.326  -2.408  1.00 0.00 ? 64  LEU A HD22 3  
ATOM 3939  H HD23 . LEU A 1 64  ? 8.506   -5.937  -2.127  1.00 0.00 ? 64  LEU A HD23 3  
ATOM 3940  N N    . SER A 1 65  ? 5.344   -2.201  -3.260  1.00 0.00 ? 65  SER A N    3  
ATOM 3941  C CA   . SER A 1 65  ? 5.600   -1.246  -4.325  1.00 0.00 ? 65  SER A CA   3  
ATOM 3942  C C    . SER A 1 65  ? 4.297   -0.561  -4.739  1.00 0.00 ? 65  SER A C    3  
ATOM 3943  O O    . SER A 1 65  ? 3.211   -1.087  -4.499  1.00 0.00 ? 65  SER A O    3  
ATOM 3944  C CB   . SER A 1 65  ? 6.248   -1.928  -5.532  1.00 0.00 ? 65  SER A CB   3  
ATOM 3945  O OG   . SER A 1 65  ? 5.713   -3.229  -5.761  1.00 0.00 ? 65  SER A OG   3  
ATOM 3946  H H    . SER A 1 65  ? 4.412   -2.562  -3.232  1.00 0.00 ? 65  SER A H    3  
ATOM 3947  H HA   . SER A 1 65  ? 6.296   -0.522  -3.902  1.00 0.00 ? 65  SER A HA   3  
ATOM 3948  H HB2  . SER A 1 65  ? 6.097   -1.313  -6.420  1.00 0.00 ? 65  SER A HB2  3  
ATOM 3949  H HB3  . SER A 1 65  ? 7.323   -2.000  -5.374  1.00 0.00 ? 65  SER A HB3  3  
ATOM 3950  H HG   . SER A 1 65  ? 5.437   -3.643  -4.893  1.00 0.00 ? 65  SER A HG   3  
ATOM 3951  N N    . VAL A 1 66  ? 4.446   0.604   -5.353  1.00 0.00 ? 66  VAL A N    3  
ATOM 3952  C CA   . VAL A 1 66  ? 3.294   1.367   -5.802  1.00 0.00 ? 66  VAL A CA   3  
ATOM 3953  C C    . VAL A 1 66  ? 3.605   1.999   -7.160  1.00 0.00 ? 66  VAL A C    3  
ATOM 3954  O O    . VAL A 1 66  ? 4.592   2.719   -7.302  1.00 0.00 ? 66  VAL A O    3  
ATOM 3955  C CB   . VAL A 1 66  ? 2.901   2.395   -4.739  1.00 0.00 ? 66  VAL A CB   3  
ATOM 3956  C CG1  . VAL A 1 66  ? 1.680   3.202   -5.183  1.00 0.00 ? 66  VAL A CG1  3  
ATOM 3957  C CG2  . VAL A 1 66  ? 2.651   1.720   -3.389  1.00 0.00 ? 66  VAL A CG2  3  
ATOM 3958  H H    . VAL A 1 66  ? 5.333   1.025   -5.544  1.00 0.00 ? 66  VAL A H    3  
ATOM 3959  H HA   . VAL A 1 66  ? 2.464   0.670   -5.921  1.00 0.00 ? 66  VAL A HA   3  
ATOM 3960  H HB   . VAL A 1 66  ? 3.734   3.087   -4.618  1.00 0.00 ? 66  VAL A HB   3  
ATOM 3961  H HG11 . VAL A 1 66  ? 1.845   4.258   -4.969  1.00 0.00 ? 66  VAL A HG11 3  
ATOM 3962  H HG12 . VAL A 1 66  ? 1.525   3.069   -6.254  1.00 0.00 ? 66  VAL A HG12 3  
ATOM 3963  H HG13 . VAL A 1 66  ? 0.799   2.856   -4.643  1.00 0.00 ? 66  VAL A HG13 3  
ATOM 3964  H HG21 . VAL A 1 66  ? 1.691   1.204   -3.413  1.00 0.00 ? 66  VAL A HG21 3  
ATOM 3965  H HG22 . VAL A 1 66  ? 3.445   1.000   -3.190  1.00 0.00 ? 66  VAL A HG22 3  
ATOM 3966  H HG23 . VAL A 1 66  ? 2.639   2.474   -2.602  1.00 0.00 ? 66  VAL A HG23 3  
ATOM 3967  N N    . ASP A 1 67  ? 2.743   1.708   -8.123  1.00 0.00 ? 67  ASP A N    3  
ATOM 3968  C CA   . ASP A 1 67  ? 2.913   2.240   -9.465  1.00 0.00 ? 67  ASP A CA   3  
ATOM 3969  C C    . ASP A 1 67  ? 4.321   1.911   -9.965  1.00 0.00 ? 67  ASP A C    3  
ATOM 3970  O O    . ASP A 1 67  ? 4.925   2.698   -10.692 1.00 0.00 ? 67  ASP A O    3  
ATOM 3971  C CB   . ASP A 1 67  ? 2.749   3.761   -9.480  1.00 0.00 ? 67  ASP A CB   3  
ATOM 3972  C CG   . ASP A 1 67  ? 1.821   4.301   -10.569 1.00 0.00 ? 67  ASP A CG   3  
ATOM 3973  O OD1  . ASP A 1 67  ? 0.807   3.621   -10.839 1.00 0.00 ? 67  ASP A OD1  3  
ATOM 3974  O OD2  . ASP A 1 67  ? 2.145   5.381   -11.107 1.00 0.00 ? 67  ASP A OD2  3  
ATOM 3975  H H    . ASP A 1 67  ? 1.942   1.122   -7.999  1.00 0.00 ? 67  ASP A H    3  
ATOM 3976  H HA   . ASP A 1 67  ? 2.136   1.762   -10.062 1.00 0.00 ? 67  ASP A HA   3  
ATOM 3977  H HB2  . ASP A 1 67  ? 2.370   4.080   -8.509  1.00 0.00 ? 67  ASP A HB2  3  
ATOM 3978  H HB3  . ASP A 1 67  ? 3.732   4.216   -9.603  1.00 0.00 ? 67  ASP A HB3  3  
ATOM 3979  N N    . GLY A 1 68  ? 4.803   0.747   -9.555  1.00 0.00 ? 68  GLY A N    3  
ATOM 3980  C CA   . GLY A 1 68  ? 6.129   0.304   -9.952  1.00 0.00 ? 68  GLY A CA   3  
ATOM 3981  C C    . GLY A 1 68  ? 7.186   0.772   -8.950  1.00 0.00 ? 68  GLY A C    3  
ATOM 3982  O O    . GLY A 1 68  ? 8.194   0.098   -8.746  1.00 0.00 ? 68  GLY A O    3  
ATOM 3983  H H    . GLY A 1 68  ? 4.305   0.112   -8.964  1.00 0.00 ? 68  GLY A H    3  
ATOM 3984  H HA2  . GLY A 1 68  ? 6.146   -0.784  -10.024 1.00 0.00 ? 68  GLY A HA2  3  
ATOM 3985  H HA3  . GLY A 1 68  ? 6.364   0.693   -10.943 1.00 0.00 ? 68  GLY A HA3  3  
ATOM 3986  N N    . ARG A 1 69  ? 6.919   1.923   -8.351  1.00 0.00 ? 69  ARG A N    3  
ATOM 3987  C CA   . ARG A 1 69  ? 7.835   2.489   -7.375  1.00 0.00 ? 69  ARG A CA   3  
ATOM 3988  C C    . ARG A 1 69  ? 7.725   1.738   -6.046  1.00 0.00 ? 69  ARG A C    3  
ATOM 3989  O O    . ARG A 1 69  ? 6.670   1.742   -5.413  1.00 0.00 ? 69  ARG A O    3  
ATOM 3990  C CB   . ARG A 1 69  ? 7.542   3.972   -7.140  1.00 0.00 ? 69  ARG A CB   3  
ATOM 3991  C CG   . ARG A 1 69  ? 8.792   4.707   -6.650  1.00 0.00 ? 69  ARG A CG   3  
ATOM 3992  C CD   . ARG A 1 69  ? 9.145   5.868   -7.581  1.00 0.00 ? 69  ARG A CD   3  
ATOM 3993  N NE   . ARG A 1 69  ? 10.201  5.452   -8.531  1.00 0.00 ? 69  ARG A NE   3  
ATOM 3994  C CZ   . ARG A 1 69  ? 10.519  6.127   -9.644  1.00 0.00 ? 69  ARG A CZ   3  
ATOM 3995  N NH1  . ARG A 1 69  ? 9.864   7.254   -9.954  1.00 0.00 ? 69  ARG A NH1  3  
ATOM 3996  N NH2  . ARG A 1 69  ? 11.491  5.675   -10.448 1.00 0.00 ? 69  ARG A NH2  3  
ATOM 3997  H H    . ARG A 1 69  ? 6.096   2.465   -8.522  1.00 0.00 ? 69  ARG A H    3  
ATOM 3998  H HA   . ARG A 1 69  ? 8.824   2.364   -7.815  1.00 0.00 ? 69  ARG A HA   3  
ATOM 3999  H HB2  . ARG A 1 69  ? 7.188   4.427   -8.065  1.00 0.00 ? 69  ARG A HB2  3  
ATOM 4000  H HB3  . ARG A 1 69  ? 6.743   4.078   -6.407  1.00 0.00 ? 69  ARG A HB3  3  
ATOM 4001  H HG2  . ARG A 1 69  ? 8.624   5.083   -5.641  1.00 0.00 ? 69  ARG A HG2  3  
ATOM 4002  H HG3  . ARG A 1 69  ? 9.629   4.011   -6.596  1.00 0.00 ? 69  ARG A HG3  3  
ATOM 4003  H HD2  . ARG A 1 69  ? 8.259   6.190   -8.128  1.00 0.00 ? 69  ARG A HD2  3  
ATOM 4004  H HD3  . ARG A 1 69  ? 9.487   6.723   -6.997  1.00 0.00 ? 69  ARG A HD3  3  
ATOM 4005  H HE   . ARG A 1 69  ? 10.709  4.615   -8.330  1.00 0.00 ? 69  ARG A HE   3  
ATOM 4006  H HH11 . ARG A 1 69  ? 9.138   7.592   -9.354  1.00 0.00 ? 69  ARG A HH11 3  
ATOM 4007  H HH12 . ARG A 1 69  ? 10.101  7.758   -10.785 1.00 0.00 ? 69  ARG A HH12 3  
ATOM 4008  H HH21 . ARG A 1 69  ? 11.980  4.833   -10.217 1.00 0.00 ? 69  ARG A HH21 3  
ATOM 4009  H HH22 . ARG A 1 69  ? 11.728  6.178   -11.278 1.00 0.00 ? 69  ARG A HH22 3  
ATOM 4010  N N    . SER A 1 70  ? 8.828   1.113   -5.663  1.00 0.00 ? 70  SER A N    3  
ATOM 4011  C CA   . SER A 1 70  ? 8.869   0.360   -4.421  1.00 0.00 ? 70  SER A CA   3  
ATOM 4012  C C    . SER A 1 70  ? 8.356   1.224   -3.268  1.00 0.00 ? 70  SER A C    3  
ATOM 4013  O O    . SER A 1 70  ? 8.677   2.409   -3.185  1.00 0.00 ? 70  SER A O    3  
ATOM 4014  C CB   . SER A 1 70  ? 10.286  -0.135  -4.124  1.00 0.00 ? 70  SER A CB   3  
ATOM 4015  O OG   . SER A 1 70  ? 10.367  -1.558  -4.136  1.00 0.00 ? 70  SER A OG   3  
ATOM 4016  H H    . SER A 1 70  ? 9.682   1.115   -6.184  1.00 0.00 ? 70  SER A H    3  
ATOM 4017  H HA   . SER A 1 70  ? 8.212   -0.495  -4.580  1.00 0.00 ? 70  SER A HA   3  
ATOM 4018  H HB2  . SER A 1 70  ? 10.975  0.273   -4.863  1.00 0.00 ? 70  SER A HB2  3  
ATOM 4019  H HB3  . SER A 1 70  ? 10.604  0.238   -3.150  1.00 0.00 ? 70  SER A HB3  3  
ATOM 4020  H HG   . SER A 1 70  ? 11.256  -1.847  -4.493  1.00 0.00 ? 70  SER A HG   3  
ATOM 4021  N N    . LEU A 1 71  ? 7.567   0.598   -2.407  1.00 0.00 ? 71  LEU A N    3  
ATOM 4022  C CA   . LEU A 1 71  ? 7.007   1.295   -1.262  1.00 0.00 ? 71  LEU A CA   3  
ATOM 4023  C C    . LEU A 1 71  ? 7.446   0.592   0.024   1.00 0.00 ? 71  LEU A C    3  
ATOM 4024  O O    . LEU A 1 71  ? 7.104   1.027   1.122   1.00 0.00 ? 71  LEU A O    3  
ATOM 4025  C CB   . LEU A 1 71  ? 5.489   1.425   -1.404  1.00 0.00 ? 71  LEU A CB   3  
ATOM 4026  C CG   . LEU A 1 71  ? 4.865   2.690   -0.811  1.00 0.00 ? 71  LEU A CG   3  
ATOM 4027  C CD1  . LEU A 1 71  ? 4.598   3.732   -1.899  1.00 0.00 ? 71  LEU A CD1  3  
ATOM 4028  C CD2  . LEU A 1 71  ? 3.602   2.357   -0.014  1.00 0.00 ? 71  LEU A CD2  3  
ATOM 4029  H H    . LEU A 1 71  ? 7.311   -0.365  -2.482  1.00 0.00 ? 71  LEU A H    3  
ATOM 4030  H HA   . LEU A 1 71  ? 7.418   2.305   -1.261  1.00 0.00 ? 71  LEU A HA   3  
ATOM 4031  H HB2  . LEU A 1 71  ? 5.238   1.383   -2.464  1.00 0.00 ? 71  LEU A HB2  3  
ATOM 4032  H HB3  . LEU A 1 71  ? 5.024   0.559   -0.932  1.00 0.00 ? 71  LEU A HB3  3  
ATOM 4033  H HG   . LEU A 1 71  ? 5.579   3.129   -0.114  1.00 0.00 ? 71  LEU A HG   3  
ATOM 4034  H HD11 . LEU A 1 71  ? 5.269   4.579   -1.764  1.00 0.00 ? 71  LEU A HD11 3  
ATOM 4035  H HD12 . LEU A 1 71  ? 4.769   3.286   -2.879  1.00 0.00 ? 71  LEU A HD12 3  
ATOM 4036  H HD13 . LEU A 1 71  ? 3.565   4.072   -1.831  1.00 0.00 ? 71  LEU A HD13 3  
ATOM 4037  H HD21 . LEU A 1 71  ? 3.037   3.271   0.169   1.00 0.00 ? 71  LEU A HD21 3  
ATOM 4038  H HD22 . LEU A 1 71  ? 2.989   1.657   -0.581  1.00 0.00 ? 71  LEU A HD22 3  
ATOM 4039  H HD23 . LEU A 1 71  ? 3.882   1.906   0.938   1.00 0.00 ? 71  LEU A HD23 3  
ATOM 4040  N N    . VAL A 1 72  ? 8.197   -0.485  -0.156  1.00 0.00 ? 72  VAL A N    3  
ATOM 4041  C CA   . VAL A 1 72  ? 8.687   -1.253  0.976   1.00 0.00 ? 72  VAL A CA   3  
ATOM 4042  C C    . VAL A 1 72  ? 9.728   -0.428  1.735   1.00 0.00 ? 72  VAL A C    3  
ATOM 4043  O O    . VAL A 1 72  ? 10.845  -0.889  1.963   1.00 0.00 ? 72  VAL A O    3  
ATOM 4044  C CB   . VAL A 1 72  ? 9.227   -2.603  0.498   1.00 0.00 ? 72  VAL A CB   3  
ATOM 4045  C CG1  . VAL A 1 72  ? 10.369  -2.413  -0.502  1.00 0.00 ? 72  VAL A CG1  3  
ATOM 4046  C CG2  . VAL A 1 72  ? 9.670   -3.465  1.681   1.00 0.00 ? 72  VAL A CG2  3  
ATOM 4047  H H    . VAL A 1 72  ? 8.471   -0.832  -1.053  1.00 0.00 ? 72  VAL A H    3  
ATOM 4048  H HA   . VAL A 1 72  ? 7.840   -1.442  1.636   1.00 0.00 ? 72  VAL A HA   3  
ATOM 4049  H HB   . VAL A 1 72  ? 8.418   -3.125  -0.012  1.00 0.00 ? 72  VAL A HB   3  
ATOM 4050  H HG11 . VAL A 1 72  ? 9.975   -2.463  -1.517  1.00 0.00 ? 72  VAL A HG11 3  
ATOM 4051  H HG12 . VAL A 1 72  ? 10.836  -1.442  -0.340  1.00 0.00 ? 72  VAL A HG12 3  
ATOM 4052  H HG13 . VAL A 1 72  ? 11.110  -3.201  -0.360  1.00 0.00 ? 72  VAL A HG13 3  
ATOM 4053  H HG21 . VAL A 1 72  ? 10.653  -3.888  1.474   1.00 0.00 ? 72  VAL A HG21 3  
ATOM 4054  H HG22 . VAL A 1 72  ? 9.722   -2.851  2.580   1.00 0.00 ? 72  VAL A HG22 3  
ATOM 4055  H HG23 . VAL A 1 72  ? 8.952   -4.272  1.833   1.00 0.00 ? 72  VAL A HG23 3  
ATOM 4056  N N    . GLY A 1 73  ? 9.325   0.779   2.105   1.00 0.00 ? 73  GLY A N    3  
ATOM 4057  C CA   . GLY A 1 73  ? 10.209  1.673   2.833   1.00 0.00 ? 73  GLY A CA   3  
ATOM 4058  C C    . GLY A 1 73  ? 10.226  3.064   2.198   1.00 0.00 ? 73  GLY A C    3  
ATOM 4059  O O    . GLY A 1 73  ? 11.291  3.654   2.015   1.00 0.00 ? 73  GLY A O    3  
ATOM 4060  H H    . GLY A 1 73  ? 8.414   1.147   1.915   1.00 0.00 ? 73  GLY A H    3  
ATOM 4061  H HA2  . GLY A 1 73  ? 9.883   1.747   3.871   1.00 0.00 ? 73  GLY A HA2  3  
ATOM 4062  H HA3  . GLY A 1 73  ? 11.218  1.262   2.845   1.00 0.00 ? 73  GLY A HA3  3  
ATOM 4063  N N    . LEU A 1 74  ? 9.035   3.550   1.879   1.00 0.00 ? 74  LEU A N    3  
ATOM 4064  C CA   . LEU A 1 74  ? 8.901   4.861   1.268   1.00 0.00 ? 74  LEU A CA   3  
ATOM 4065  C C    . LEU A 1 74  ? 8.278   5.828   2.277   1.00 0.00 ? 74  LEU A C    3  
ATOM 4066  O O    . LEU A 1 74  ? 7.143   5.633   2.710   1.00 0.00 ? 74  LEU A O    3  
ATOM 4067  C CB   . LEU A 1 74  ? 8.126   4.762   -0.048  1.00 0.00 ? 74  LEU A CB   3  
ATOM 4068  C CG   . LEU A 1 74  ? 8.971   4.625   -1.316  1.00 0.00 ? 74  LEU A CG   3  
ATOM 4069  C CD1  . LEU A 1 74  ? 8.119   4.839   -2.568  1.00 0.00 ? 74  LEU A CD1  3  
ATOM 4070  C CD2  . LEU A 1 74  ? 10.177  5.565   -1.274  1.00 0.00 ? 74  LEU A CD2  3  
ATOM 4071  H H    . LEU A 1 74  ? 8.175   3.064   2.031   1.00 0.00 ? 74  LEU A H    3  
ATOM 4072  H HA   . LEU A 1 74  ? 9.903   5.213   1.025   1.00 0.00 ? 74  LEU A HA   3  
ATOM 4073  H HB2  . LEU A 1 74  ? 7.455   3.905   0.012   1.00 0.00 ? 74  LEU A HB2  3  
ATOM 4074  H HB3  . LEU A 1 74  ? 7.500   5.649   -0.146  1.00 0.00 ? 74  LEU A HB3  3  
ATOM 4075  H HG   . LEU A 1 74  ? 9.358   3.607   -1.360  1.00 0.00 ? 74  LEU A HG   3  
ATOM 4076  H HD11 . LEU A 1 74  ? 8.715   4.620   -3.454  1.00 0.00 ? 74  LEU A HD11 3  
ATOM 4077  H HD12 . LEU A 1 74  ? 7.255   4.176   -2.538  1.00 0.00 ? 74  LEU A HD12 3  
ATOM 4078  H HD13 . LEU A 1 74  ? 7.781   5.875   -2.605  1.00 0.00 ? 74  LEU A HD13 3  
ATOM 4079  H HD21 . LEU A 1 74  ? 11.020  5.054   -0.808  1.00 0.00 ? 74  LEU A HD21 3  
ATOM 4080  H HD22 . LEU A 1 74  ? 10.446  5.856   -2.290  1.00 0.00 ? 74  LEU A HD22 3  
ATOM 4081  H HD23 . LEU A 1 74  ? 9.926   6.454   -0.696  1.00 0.00 ? 74  LEU A HD23 3  
ATOM 4082  N N    . SER A 1 75  ? 9.048   6.849   2.623   1.00 0.00 ? 75  SER A N    3  
ATOM 4083  C CA   . SER A 1 75  ? 8.586   7.846   3.573   1.00 0.00 ? 75  SER A CA   3  
ATOM 4084  C C    . SER A 1 75  ? 7.135   8.224   3.271   1.00 0.00 ? 75  SER A C    3  
ATOM 4085  O O    . SER A 1 75  ? 6.788   8.504   2.124   1.00 0.00 ? 75  SER A O    3  
ATOM 4086  C CB   . SER A 1 75  ? 9.476   9.090   3.542   1.00 0.00 ? 75  SER A CB   3  
ATOM 4087  O OG   . SER A 1 75  ? 9.007   10.105  4.426   1.00 0.00 ? 75  SER A OG   3  
ATOM 4088  H H    . SER A 1 75  ? 9.970   7.000   2.266   1.00 0.00 ? 75  SER A H    3  
ATOM 4089  H HA   . SER A 1 75  ? 8.662   7.370   4.551   1.00 0.00 ? 75  SER A HA   3  
ATOM 4090  H HB2  . SER A 1 75  ? 10.495  8.814   3.814   1.00 0.00 ? 75  SER A HB2  3  
ATOM 4091  H HB3  . SER A 1 75  ? 9.514   9.484   2.526   1.00 0.00 ? 75  SER A HB3  3  
ATOM 4092  H HG   . SER A 1 75  ? 8.344   10.688  3.957   1.00 0.00 ? 75  SER A HG   3  
ATOM 4093  N N    . GLN A 1 76  ? 6.325   8.220   4.320   1.00 0.00 ? 76  GLN A N    3  
ATOM 4094  C CA   . GLN A 1 76  ? 4.919   8.559   4.181   1.00 0.00 ? 76  GLN A CA   3  
ATOM 4095  C C    . GLN A 1 76  ? 4.747   9.718   3.197   1.00 0.00 ? 76  GLN A C    3  
ATOM 4096  O O    . GLN A 1 76  ? 3.851   9.694   2.354   1.00 0.00 ? 76  GLN A O    3  
ATOM 4097  C CB   . GLN A 1 76  ? 4.300   8.896   5.539   1.00 0.00 ? 76  GLN A CB   3  
ATOM 4098  C CG   . GLN A 1 76  ? 2.776   8.764   5.495   1.00 0.00 ? 76  GLN A CG   3  
ATOM 4099  C CD   . GLN A 1 76  ? 2.108   9.830   6.365   1.00 0.00 ? 76  GLN A CD   3  
ATOM 4100  O OE1  . GLN A 1 76  ? 2.756   10.647  6.998   1.00 0.00 ? 76  GLN A OE1  3  
ATOM 4101  N NE2  . GLN A 1 76  ? 0.779   9.777   6.360   1.00 0.00 ? 76  GLN A NE2  3  
ATOM 4102  H H    . GLN A 1 76  ? 6.615   7.991   5.249   1.00 0.00 ? 76  GLN A H    3  
ATOM 4103  H HA   . GLN A 1 76  ? 4.443   7.663   3.784   1.00 0.00 ? 76  GLN A HA   3  
ATOM 4104  H HB2  . GLN A 1 76  ? 4.704   8.232   6.302   1.00 0.00 ? 76  GLN A HB2  3  
ATOM 4105  H HB3  . GLN A 1 76  ? 4.572   9.912   5.825   1.00 0.00 ? 76  GLN A HB3  3  
ATOM 4106  H HG2  . GLN A 1 76  ? 2.429   8.859   4.466   1.00 0.00 ? 76  GLN A HG2  3  
ATOM 4107  H HG3  . GLN A 1 76  ? 2.484   7.772   5.840   1.00 0.00 ? 76  GLN A HG3  3  
ATOM 4108  H HE21 . GLN A 1 76  ? 0.308   9.081   5.818   1.00 0.00 ? 76  GLN A HE21 3  
ATOM 4109  H HE22 . GLN A 1 76  ? 0.250   10.433  6.899   1.00 0.00 ? 76  GLN A HE22 3  
ATOM 4110  N N    . GLU A 1 77  ? 5.619   10.706  3.337   1.00 0.00 ? 77  GLU A N    3  
ATOM 4111  C CA   . GLU A 1 77  ? 5.575   11.872  2.471   1.00 0.00 ? 77  GLU A CA   3  
ATOM 4112  C C    . GLU A 1 77  ? 5.657   11.446  1.004   1.00 0.00 ? 77  GLU A C    3  
ATOM 4113  O O    . GLU A 1 77  ? 4.812   11.827  0.195   1.00 0.00 ? 77  GLU A O    3  
ATOM 4114  C CB   . GLU A 1 77  ? 6.692   12.856  2.820   1.00 0.00 ? 77  GLU A CB   3  
ATOM 4115  C CG   . GLU A 1 77  ? 6.350   13.650  4.082   1.00 0.00 ? 77  GLU A CG   3  
ATOM 4116  C CD   . GLU A 1 77  ? 5.270   14.696  3.796   1.00 0.00 ? 77  GLU A CD   3  
ATOM 4117  O OE1  . GLU A 1 77  ? 5.646   15.779  3.297   1.00 0.00 ? 77  GLU A OE1  3  
ATOM 4118  O OE2  . GLU A 1 77  ? 4.092   14.389  4.082   1.00 0.00 ? 77  GLU A OE2  3  
ATOM 4119  H H    . GLU A 1 77  ? 6.345   10.718  4.025   1.00 0.00 ? 77  GLU A H    3  
ATOM 4120  H HA   . GLU A 1 77  ? 4.611   12.341  2.666   1.00 0.00 ? 77  GLU A HA   3  
ATOM 4121  H HB2  . GLU A 1 77  ? 7.626   12.314  2.969   1.00 0.00 ? 77  GLU A HB2  3  
ATOM 4122  H HB3  . GLU A 1 77  ? 6.851   13.542  1.987   1.00 0.00 ? 77  GLU A HB3  3  
ATOM 4123  H HG2  . GLU A 1 77  ? 6.005   12.970  4.861   1.00 0.00 ? 77  GLU A HG2  3  
ATOM 4124  H HG3  . GLU A 1 77  ? 7.245   14.142  4.461   1.00 0.00 ? 77  GLU A HG3  3  
ATOM 4125  N N    . ARG A 1 78  ? 6.683   10.662  0.704   1.00 0.00 ? 78  ARG A N    3  
ATOM 4126  C CA   . ARG A 1 78  ? 6.887   10.181  -0.651  1.00 0.00 ? 78  ARG A CA   3  
ATOM 4127  C C    . ARG A 1 78  ? 5.772   9.208   -1.042  1.00 0.00 ? 78  ARG A C    3  
ATOM 4128  O O    . ARG A 1 78  ? 5.065   9.431   -2.024  1.00 0.00 ? 78  ARG A O    3  
ATOM 4129  C CB   . ARG A 1 78  ? 8.239   9.479   -0.789  1.00 0.00 ? 78  ARG A CB   3  
ATOM 4130  C CG   . ARG A 1 78  ? 8.614   9.296   -2.261  1.00 0.00 ? 78  ARG A CG   3  
ATOM 4131  C CD   . ARG A 1 78  ? 9.509   10.439  -2.745  1.00 0.00 ? 78  ARG A CD   3  
ATOM 4132  N NE   . ARG A 1 78  ? 8.770   11.288  -3.705  1.00 0.00 ? 78  ARG A NE   3  
ATOM 4133  C CZ   . ARG A 1 78  ? 9.333   12.281  -4.426  1.00 0.00 ? 78  ARG A CZ   3  
ATOM 4134  N NH1  . ARG A 1 78  ? 10.649  12.558  -4.300  1.00 0.00 ? 78  ARG A NH1  3  
ATOM 4135  N NH2  . ARG A 1 78  ? 8.578   12.977  -5.255  1.00 0.00 ? 78  ARG A NH2  3  
ATOM 4136  H H    . ARG A 1 78  ? 7.366   10.357  1.368   1.00 0.00 ? 78  ARG A H    3  
ATOM 4137  H HA   . ARG A 1 78  ? 6.861   11.077  -1.272  1.00 0.00 ? 78  ARG A HA   3  
ATOM 4138  H HB2  . ARG A 1 78  ? 9.009   10.061  -0.283  1.00 0.00 ? 78  ARG A HB2  3  
ATOM 4139  H HB3  . ARG A 1 78  ? 8.200   8.507   -0.297  1.00 0.00 ? 78  ARG A HB3  3  
ATOM 4140  H HG2  . ARG A 1 78  ? 9.130   8.344   -2.393  1.00 0.00 ? 78  ARG A HG2  3  
ATOM 4141  H HG3  . ARG A 1 78  ? 7.710   9.255   -2.868  1.00 0.00 ? 78  ARG A HG3  3  
ATOM 4142  H HD2  . ARG A 1 78  ? 9.839   11.037  -1.896  1.00 0.00 ? 78  ARG A HD2  3  
ATOM 4143  H HD3  . ARG A 1 78  ? 10.405  10.035  -3.217  1.00 0.00 ? 78  ARG A HD3  3  
ATOM 4144  H HE   . ARG A 1 78  ? 7.793   11.116  -3.828  1.00 0.00 ? 78  ARG A HE   3  
ATOM 4145  H HH11 . ARG A 1 78  ? 11.214  12.026  -3.670  1.00 0.00 ? 78  ARG A HH11 3  
ATOM 4146  H HH12 . ARG A 1 78  ? 11.058  13.296  -4.838  1.00 0.00 ? 78  ARG A HH12 3  
ATOM 4147  H HH21 . ARG A 1 78  ? 8.917   13.727  -5.824  1.00 0.00 ? 78  ARG A HH21 3  
ATOM 4148  N N    . ALA A 1 79  ? 5.650   8.151   -0.254  1.00 0.00 ? 79  ALA A N    3  
ATOM 4149  C CA   . ALA A 1 79  ? 4.633   7.143   -0.505  1.00 0.00 ? 79  ALA A CA   3  
ATOM 4150  C C    . ALA A 1 79  ? 3.278   7.828   -0.693  1.00 0.00 ? 79  ALA A C    3  
ATOM 4151  O O    . ALA A 1 79  ? 2.490   7.428   -1.549  1.00 0.00 ? 79  ALA A O    3  
ATOM 4152  C CB   . ALA A 1 79  ? 4.621   6.132   0.643   1.00 0.00 ? 79  ALA A CB   3  
ATOM 4153  H H    . ALA A 1 79  ? 6.229   7.977   0.543   1.00 0.00 ? 79  ALA A H    3  
ATOM 4154  H HA   . ALA A 1 79  ? 4.900   6.625   -1.426  1.00 0.00 ? 79  ALA A HA   3  
ATOM 4155  H HB1  . ALA A 1 79  ? 4.558   6.663   1.594   1.00 0.00 ? 79  ALA A HB1  3  
ATOM 4156  H HB2  . ALA A 1 79  ? 3.760   5.473   0.538   1.00 0.00 ? 79  ALA A HB2  3  
ATOM 4157  H HB3  . ALA A 1 79  ? 5.536   5.541   0.617   1.00 0.00 ? 79  ALA A HB3  3  
ATOM 4158  N N    . ALA A 1 80  ? 3.049   8.849   0.120   1.00 0.00 ? 80  ALA A N    3  
ATOM 4159  C CA   . ALA A 1 80  ? 1.802   9.593   0.054   1.00 0.00 ? 80  ALA A CA   3  
ATOM 4160  C C    . ALA A 1 80  ? 1.687   10.265  -1.316  1.00 0.00 ? 80  ALA A C    3  
ATOM 4161  O O    . ALA A 1 80  ? 0.627   10.238  -1.938  1.00 0.00 ? 80  ALA A O    3  
ATOM 4162  C CB   . ALA A 1 80  ? 1.747   10.600  1.204   1.00 0.00 ? 80  ALA A CB   3  
ATOM 4163  H H    . ALA A 1 80  ? 3.695   9.168   0.813   1.00 0.00 ? 80  ALA A H    3  
ATOM 4164  H HA   . ALA A 1 80  ? 0.985   8.882   0.170   1.00 0.00 ? 80  ALA A HA   3  
ATOM 4165  H HB1  . ALA A 1 80  ? 1.613   10.068  2.146   1.00 0.00 ? 80  ALA A HB1  3  
ATOM 4166  H HB2  . ALA A 1 80  ? 2.678   11.167  1.236   1.00 0.00 ? 80  ALA A HB2  3  
ATOM 4167  H HB3  . ALA A 1 80  ? 0.911   11.282  1.050   1.00 0.00 ? 80  ALA A HB3  3  
ATOM 4168  N N    . GLU A 1 81  ? 2.794   10.854  -1.745  1.00 0.00 ? 81  GLU A N    3  
ATOM 4169  C CA   . GLU A 1 81  ? 2.831   11.533  -3.030  1.00 0.00 ? 81  GLU A CA   3  
ATOM 4170  C C    . GLU A 1 81  ? 2.471   10.560  -4.154  1.00 0.00 ? 81  GLU A C    3  
ATOM 4171  O O    . GLU A 1 81  ? 1.734   10.913  -5.074  1.00 0.00 ? 81  GLU A O    3  
ATOM 4172  C CB   . GLU A 1 81  ? 4.199   12.171  -3.273  1.00 0.00 ? 81  GLU A CB   3  
ATOM 4173  C CG   . GLU A 1 81  ? 4.267   13.572  -2.663  1.00 0.00 ? 81  GLU A CG   3  
ATOM 4174  C CD   . GLU A 1 81  ? 3.661   14.612  -3.608  1.00 0.00 ? 81  GLU A CD   3  
ATOM 4175  O OE1  . GLU A 1 81  ? 2.414   14.652  -3.683  1.00 0.00 ? 81  GLU A OE1  3  
ATOM 4176  O OE2  . GLU A 1 81  ? 4.459   15.344  -4.233  1.00 0.00 ? 81  GLU A OE2  3  
ATOM 4177  H H    . GLU A 1 81  ? 3.653   10.872  -1.233  1.00 0.00 ? 81  GLU A H    3  
ATOM 4178  H HA   . GLU A 1 81  ? 2.077   12.317  -2.964  1.00 0.00 ? 81  GLU A HA   3  
ATOM 4179  H HB2  . GLU A 1 81  ? 4.979   11.544  -2.842  1.00 0.00 ? 81  GLU A HB2  3  
ATOM 4180  H HB3  . GLU A 1 81  ? 4.393   12.228  -4.345  1.00 0.00 ? 81  GLU A HB3  3  
ATOM 4181  H HG2  . GLU A 1 81  ? 3.734   13.585  -1.712  1.00 0.00 ? 81  GLU A HG2  3  
ATOM 4182  H HG3  . GLU A 1 81  ? 5.305   13.830  -2.450  1.00 0.00 ? 81  GLU A HG3  3  
ATOM 4183  N N    . LEU A 1 82  ? 3.009   9.354   -4.045  1.00 0.00 ? 82  LEU A N    3  
ATOM 4184  C CA   . LEU A 1 82  ? 2.754   8.327   -5.041  1.00 0.00 ? 82  LEU A CA   3  
ATOM 4185  C C    . LEU A 1 82  ? 1.299   7.865   -4.931  1.00 0.00 ? 82  LEU A C    3  
ATOM 4186  O O    . LEU A 1 82  ? 0.579   7.828   -5.927  1.00 0.00 ? 82  LEU A O    3  
ATOM 4187  C CB   . LEU A 1 82  ? 3.771   7.192   -4.913  1.00 0.00 ? 82  LEU A CB   3  
ATOM 4188  C CG   . LEU A 1 82  ? 5.128   7.428   -5.580  1.00 0.00 ? 82  LEU A CG   3  
ATOM 4189  C CD1  . LEU A 1 82  ? 6.273   7.176   -4.597  1.00 0.00 ? 82  LEU A CD1  3  
ATOM 4190  C CD2  . LEU A 1 82  ? 5.268   6.587   -6.850  1.00 0.00 ? 82  LEU A CD2  3  
ATOM 4191  H H    . LEU A 1 82  ? 3.607   9.074   -3.294  1.00 0.00 ? 82  LEU A H    3  
ATOM 4192  H HA   . LEU A 1 82  ? 2.899   8.781   -6.022  1.00 0.00 ? 82  LEU A HA   3  
ATOM 4193  H HB2  . LEU A 1 82  ? 3.938   6.998   -3.853  1.00 0.00 ? 82  LEU A HB2  3  
ATOM 4194  H HB3  . LEU A 1 82  ? 3.333   6.288   -5.336  1.00 0.00 ? 82  LEU A HB3  3  
ATOM 4195  H HG   . LEU A 1 82  ? 5.184   8.475   -5.878  1.00 0.00 ? 82  LEU A HG   3  
ATOM 4196  H HD11 . LEU A 1 82  ? 7.128   7.794   -4.870  1.00 0.00 ? 82  LEU A HD11 3  
ATOM 4197  H HD12 . LEU A 1 82  ? 5.948   7.430   -3.588  1.00 0.00 ? 82  LEU A HD12 3  
ATOM 4198  H HD13 . LEU A 1 82  ? 6.558   6.125   -4.633  1.00 0.00 ? 82  LEU A HD13 3  
ATOM 4199  H HD21 . LEU A 1 82  ? 4.392   5.947   -6.961  1.00 0.00 ? 82  LEU A HD21 3  
ATOM 4200  H HD22 . LEU A 1 82  ? 5.348   7.246   -7.715  1.00 0.00 ? 82  LEU A HD22 3  
ATOM 4201  H HD23 . LEU A 1 82  ? 6.163   5.969   -6.780  1.00 0.00 ? 82  LEU A HD23 3  
ATOM 4202  N N    . MET A 1 83  ? 0.911   7.525   -3.710  1.00 0.00 ? 83  MET A N    3  
ATOM 4203  C CA   . MET A 1 83  ? -0.445  7.067   -3.457  1.00 0.00 ? 83  MET A CA   3  
ATOM 4204  C C    . MET A 1 83  ? -1.458  8.184   -3.714  1.00 0.00 ? 83  MET A C    3  
ATOM 4205  O O    . MET A 1 83  ? -2.660  7.933   -3.781  1.00 0.00 ? 83  MET A O    3  
ATOM 4206  C CB   . MET A 1 83  ? -0.561  6.595   -2.006  1.00 0.00 ? 83  MET A CB   3  
ATOM 4207  C CG   . MET A 1 83  ? -0.127  5.134   -1.868  1.00 0.00 ? 83  MET A CG   3  
ATOM 4208  S SD   . MET A 1 83  ? -1.105  4.323   -0.615  1.00 0.00 ? 83  MET A SD   3  
ATOM 4209  C CE   . MET A 1 83  ? -0.527  5.186   0.837   1.00 0.00 ? 83  MET A CE   3  
ATOM 4210  H H    . MET A 1 83  ? 1.503   7.558   -2.905  1.00 0.00 ? 83  MET A H    3  
ATOM 4211  H HA   . MET A 1 83  ? -0.612  6.247   -4.156  1.00 0.00 ? 83  MET A HA   3  
ATOM 4212  H HB2  . MET A 1 83  ? 0.056   7.224   -1.365  1.00 0.00 ? 83  MET A HB2  3  
ATOM 4213  H HB3  . MET A 1 83  ? -1.591  6.706   -1.666  1.00 0.00 ? 83  MET A HB3  3  
ATOM 4214  H HG2  . MET A 1 83  ? -0.244  4.620   -2.822  1.00 0.00 ? 83  MET A HG2  3  
ATOM 4215  H HG3  . MET A 1 83  ? 0.930   5.084   -1.606  1.00 0.00 ? 83  MET A HG3  3  
ATOM 4216  H HE1  . MET A 1 83  ? 0.192   4.563   1.368   1.00 0.00 ? 83  MET A HE1  3  
ATOM 4217  H HE2  . MET A 1 83  ? -0.049  6.119   0.538   1.00 0.00 ? 83  MET A HE2  3  
ATOM 4218  H HE3  . MET A 1 83  ? -1.372  5.404   1.490   1.00 0.00 ? 83  MET A HE3  3  
ATOM 4219  N N    . THR A 1 84  ? -0.935  9.394   -3.850  1.00 0.00 ? 84  THR A N    3  
ATOM 4220  C CA   . THR A 1 84  ? -1.779  10.550  -4.098  1.00 0.00 ? 84  THR A CA   3  
ATOM 4221  C C    . THR A 1 84  ? -2.197  10.600  -5.569  1.00 0.00 ? 84  THR A C    3  
ATOM 4222  O O    . THR A 1 84  ? -3.308  10.203  -5.916  1.00 0.00 ? 84  THR A O    3  
ATOM 4223  C CB   . THR A 1 84  ? -1.019  11.797  -3.640  1.00 0.00 ? 84  THR A CB   3  
ATOM 4224  O OG1  . THR A 1 84  ? -1.187  11.805  -2.225  1.00 0.00 ? 84  THR A OG1  3  
ATOM 4225  C CG2  . THR A 1 84  ? -1.687  13.093  -4.103  1.00 0.00 ? 84  THR A CG2  3  
ATOM 4226  H H    . THR A 1 84  ? 0.044   9.589   -3.794  1.00 0.00 ? 84  THR A H    3  
ATOM 4227  H HA   . THR A 1 84  ? -2.690  10.443  -3.510  1.00 0.00 ? 84  THR A HA   3  
ATOM 4228  H HB   . THR A 1 84  ? 0.022   11.759  -3.962  1.00 0.00 ? 84  THR A HB   3  
ATOM 4229  H HG1  . THR A 1 84  ? -0.735  12.606  -1.832  1.00 0.00 ? 84  THR A HG1  3  
ATOM 4230  H HG21 . THR A 1 84  ? -0.946  13.891  -4.139  1.00 0.00 ? 84  THR A HG21 3  
ATOM 4231  H HG22 . THR A 1 84  ? -2.114  12.948  -5.096  1.00 0.00 ? 84  THR A HG22 3  
ATOM 4232  H HG23 . THR A 1 84  ? -2.479  13.363  -3.404  1.00 0.00 ? 84  THR A HG23 3  
ATOM 4233  N N    . ARG A 1 85  ? -1.284  11.090  -6.395  1.00 0.00 ? 85  ARG A N    3  
ATOM 4234  C CA   . ARG A 1 85  ? -1.544  11.196  -7.820  1.00 0.00 ? 85  ARG A CA   3  
ATOM 4235  C C    . ARG A 1 85  ? -1.628  9.805   -8.450  1.00 0.00 ? 85  ARG A C    3  
ATOM 4236  O O    . ARG A 1 85  ? -0.869  9.486   -9.365  1.00 0.00 ? 85  ARG A O    3  
ATOM 4237  C CB   . ARG A 1 85  ? -0.447  12.001  -8.521  1.00 0.00 ? 85  ARG A CB   3  
ATOM 4238  C CG   . ARG A 1 85  ? -0.841  13.474  -8.644  1.00 0.00 ? 85  ARG A CG   3  
ATOM 4239  C CD   . ARG A 1 85  ? 0.308   14.387  -8.213  1.00 0.00 ? 85  ARG A CD   3  
ATOM 4240  N NE   . ARG A 1 85  ? 0.669   15.303  -9.318  1.00 0.00 ? 85  ARG A NE   3  
ATOM 4241  C CZ   . ARG A 1 85  ? 1.628   16.236  -9.238  1.00 0.00 ? 85  ARG A CZ   3  
ATOM 4242  N NH1  . ARG A 1 85  ? 2.327   16.382  -8.104  1.00 0.00 ? 85  ARG A NH1  3  
ATOM 4243  N NH2  . ARG A 1 85  ? 1.887   17.022  -10.291 1.00 0.00 ? 85  ARG A NH2  3  
ATOM 4244  H H    . ARG A 1 85  ? -0.382  11.410  -6.104  1.00 0.00 ? 85  ARG A H    3  
ATOM 4245  H HA   . ARG A 1 85  ? -2.499  11.717  -7.891  1.00 0.00 ? 85  ARG A HA   3  
ATOM 4246  H HB2  . ARG A 1 85  ? 0.485   11.915  -7.963  1.00 0.00 ? 85  ARG A HB2  3  
ATOM 4247  H HB3  . ARG A 1 85  ? -0.264  11.586  -9.513  1.00 0.00 ? 85  ARG A HB3  3  
ATOM 4248  H HG2  . ARG A 1 85  ? -1.119  13.695  -9.675  1.00 0.00 ? 85  ARG A HG2  3  
ATOM 4249  H HG3  . ARG A 1 85  ? -1.718  13.672  -8.028  1.00 0.00 ? 85  ARG A HG3  3  
ATOM 4250  H HD2  . ARG A 1 85  ? 0.017   14.961  -7.334  1.00 0.00 ? 85  ARG A HD2  3  
ATOM 4251  H HD3  . ARG A 1 85  ? 1.173   13.787  -7.930  1.00 0.00 ? 85  ARG A HD3  3  
ATOM 4252  H HE   . ARG A 1 85  ? 0.167   15.220  -10.178 1.00 0.00 ? 85  ARG A HE   3  
ATOM 4253  H HH11 . ARG A 1 85  ? 2.134   15.795  -7.318  1.00 0.00 ? 85  ARG A HH11 3  
ATOM 4254  H HH12 . ARG A 1 85  ? 3.042   17.079  -8.044  1.00 0.00 ? 85  ARG A HH12 3  
ATOM 4255  H HH21 . ARG A 1 85  ? 1.365   16.913  -11.137 1.00 0.00 ? 85  ARG A HH21 3  
ATOM 4256  H HH22 . ARG A 1 85  ? 2.602   17.719  -10.231 1.00 0.00 ? 85  ARG A HH22 3  
ATOM 4257  N N    . THR A 1 86  ? -2.556  9.012   -7.935  1.00 0.00 ? 86  THR A N    3  
ATOM 4258  C CA   . THR A 1 86  ? -2.749  7.662   -8.436  1.00 0.00 ? 86  THR A CA   3  
ATOM 4259  C C    . THR A 1 86  ? -3.694  7.669   -9.639  1.00 0.00 ? 86  THR A C    3  
ATOM 4260  O O    . THR A 1 86  ? -3.568  6.837   -10.536 1.00 0.00 ? 86  THR A O    3  
ATOM 4261  C CB   . THR A 1 86  ? -3.248  6.795   -7.277  1.00 0.00 ? 86  THR A CB   3  
ATOM 4262  O OG1  . THR A 1 86  ? -3.770  7.734   -6.341  1.00 0.00 ? 86  THR A OG1  3  
ATOM 4263  C CG2  . THR A 1 86  ? -2.105  6.113   -6.523  1.00 0.00 ? 86  THR A CG2  3  
ATOM 4264  H H    . THR A 1 86  ? -3.169  9.279   -7.191  1.00 0.00 ? 86  THR A H    3  
ATOM 4265  H HA   . THR A 1 86  ? -1.788  7.284   -8.785  1.00 0.00 ? 86  THR A HA   3  
ATOM 4266  H HB   . THR A 1 86  ? -3.977  6.063   -7.625  1.00 0.00 ? 86  THR A HB   3  
ATOM 4267  H HG1  . THR A 1 86  ? -4.691  8.012   -6.613  1.00 0.00 ? 86  THR A HG1  3  
ATOM 4268  H HG21 . THR A 1 86  ? -1.466  6.870   -6.068  1.00 0.00 ? 86  THR A HG21 3  
ATOM 4269  H HG22 . THR A 1 86  ? -2.516  5.470   -5.745  1.00 0.00 ? 86  THR A HG22 3  
ATOM 4270  H HG23 . THR A 1 86  ? -1.518  5.512   -7.218  1.00 0.00 ? 86  THR A HG23 3  
ATOM 4271  N N    . SER A 1 87  ? -4.619  8.618   -9.620  1.00 0.00 ? 87  SER A N    3  
ATOM 4272  C CA   . SER A 1 87  ? -5.584  8.744   -10.698 1.00 0.00 ? 87  SER A CA   3  
ATOM 4273  C C    . SER A 1 87  ? -6.728  7.748   -10.496 1.00 0.00 ? 87  SER A C    3  
ATOM 4274  O O    . SER A 1 87  ? -6.744  7.007   -9.515  1.00 0.00 ? 87  SER A O    3  
ATOM 4275  C CB   . SER A 1 87  ? -4.921  8.522   -12.059 1.00 0.00 ? 87  SER A CB   3  
ATOM 4276  O OG   . SER A 1 87  ? -5.315  9.507   -13.012 1.00 0.00 ? 87  SER A OG   3  
ATOM 4277  H H    . SER A 1 87  ? -4.714  9.290   -8.886  1.00 0.00 ? 87  SER A H    3  
ATOM 4278  H HA   . SER A 1 87  ? -5.953  9.768   -10.637 1.00 0.00 ? 87  SER A HA   3  
ATOM 4279  H HB2  . SER A 1 87  ? -3.837  8.544   -11.943 1.00 0.00 ? 87  SER A HB2  3  
ATOM 4280  H HB3  . SER A 1 87  ? -5.181  7.532   -12.432 1.00 0.00 ? 87  SER A HB3  3  
ATOM 4281  H HG   . SER A 1 87  ? -6.121  9.193   -13.514 1.00 0.00 ? 87  SER A HG   3  
ATOM 4282  N N    . SER A 1 88  ? -7.657  7.763   -11.441 1.00 0.00 ? 88  SER A N    3  
ATOM 4283  C CA   . SER A 1 88  ? -8.801  6.871   -11.379 1.00 0.00 ? 88  SER A CA   3  
ATOM 4284  C C    . SER A 1 88  ? -8.333  5.415   -11.431 1.00 0.00 ? 88  SER A C    3  
ATOM 4285  O O    . SER A 1 88  ? -9.148  4.495   -11.375 1.00 0.00 ? 88  SER A O    3  
ATOM 4286  C CB   . SER A 1 88  ? -9.782  7.153   -12.519 1.00 0.00 ? 88  SER A CB   3  
ATOM 4287  O OG   . SER A 1 88  ? -9.132  7.194   -13.786 1.00 0.00 ? 88  SER A OG   3  
ATOM 4288  H H    . SER A 1 88  ? -7.636  8.369   -12.236 1.00 0.00 ? 88  SER A H    3  
ATOM 4289  H HA   . SER A 1 88  ? -9.283  7.084   -10.425 1.00 0.00 ? 88  SER A HA   3  
ATOM 4290  H HB2  . SER A 1 88  ? -10.554 6.384   -12.532 1.00 0.00 ? 88  SER A HB2  3  
ATOM 4291  H HB3  . SER A 1 88  ? -10.284 8.104   -12.338 1.00 0.00 ? 88  SER A HB3  3  
ATOM 4292  H HG   . SER A 1 88  ? -9.426  8.002   -14.296 1.00 0.00 ? 88  SER A HG   3  
ATOM 4293  N N    . VAL A 1 89  ? -7.023  5.251   -11.537 1.00 0.00 ? 89  VAL A N    3  
ATOM 4294  C CA   . VAL A 1 89  ? -6.437  3.923   -11.597 1.00 0.00 ? 89  VAL A CA   3  
ATOM 4295  C C    . VAL A 1 89  ? -5.294  3.829   -10.584 1.00 0.00 ? 89  VAL A C    3  
ATOM 4296  O O    . VAL A 1 89  ? -4.400  4.673   -10.571 1.00 0.00 ? 89  VAL A O    3  
ATOM 4297  C CB   . VAL A 1 89  ? -5.994  3.610   -13.028 1.00 0.00 ? 89  VAL A CB   3  
ATOM 4298  C CG1  . VAL A 1 89  ? -5.033  2.421   -13.057 1.00 0.00 ? 89  VAL A CG1  3  
ATOM 4299  C CG2  . VAL A 1 89  ? -7.202  3.361   -13.933 1.00 0.00 ? 89  VAL A CG2  3  
ATOM 4300  H H    . VAL A 1 89  ? -6.367  6.005   -11.582 1.00 0.00 ? 89  VAL A H    3  
ATOM 4301  H HA   . VAL A 1 89  ? -7.212  3.209   -11.319 1.00 0.00 ? 89  VAL A HA   3  
ATOM 4302  H HB   . VAL A 1 89  ? -5.462  4.481   -13.412 1.00 0.00 ? 89  VAL A HB   3  
ATOM 4303  H HG11 . VAL A 1 89  ? -5.576  1.508   -12.810 1.00 0.00 ? 89  VAL A HG11 3  
ATOM 4304  H HG12 . VAL A 1 89  ? -4.600  2.328   -14.053 1.00 0.00 ? 89  VAL A HG12 3  
ATOM 4305  H HG13 . VAL A 1 89  ? -4.238  2.578   -12.328 1.00 0.00 ? 89  VAL A HG13 3  
ATOM 4306  H HG21 . VAL A 1 89  ? -6.889  3.399   -14.976 1.00 0.00 ? 89  VAL A HG21 3  
ATOM 4307  H HG22 . VAL A 1 89  ? -7.623  2.380   -13.715 1.00 0.00 ? 89  VAL A HG22 3  
ATOM 4308  H HG23 . VAL A 1 89  ? -7.956  4.128   -13.753 1.00 0.00 ? 89  VAL A HG23 3  
ATOM 4309  N N    . VAL A 1 90  ? -5.361  2.794   -9.759  1.00 0.00 ? 90  VAL A N    3  
ATOM 4310  C CA   . VAL A 1 90  ? -4.343  2.578   -8.745  1.00 0.00 ? 90  VAL A CA   3  
ATOM 4311  C C    . VAL A 1 90  ? -3.837  1.137   -8.836  1.00 0.00 ? 90  VAL A C    3  
ATOM 4312  O O    . VAL A 1 90  ? -4.597  0.193   -8.624  1.00 0.00 ? 90  VAL A O    3  
ATOM 4313  C CB   . VAL A 1 90  ? -4.897  2.931   -7.364  1.00 0.00 ? 90  VAL A CB   3  
ATOM 4314  C CG1  . VAL A 1 90  ? -3.831  3.610   -6.502  1.00 0.00 ? 90  VAL A CG1  3  
ATOM 4315  C CG2  . VAL A 1 90  ? -6.147  3.807   -7.482  1.00 0.00 ? 90  VAL A CG2  3  
ATOM 4316  H H    . VAL A 1 90  ? -6.092  2.111   -9.777  1.00 0.00 ? 90  VAL A H    3  
ATOM 4317  H HA   . VAL A 1 90  ? -3.516  3.254   -8.960  1.00 0.00 ? 90  VAL A HA   3  
ATOM 4318  H HB   . VAL A 1 90  ? -5.185  2.002   -6.871  1.00 0.00 ? 90  VAL A HB   3  
ATOM 4319  H HG11 . VAL A 1 90  ? -4.275  4.454   -5.973  1.00 0.00 ? 90  VAL A HG11 3  
ATOM 4320  H HG12 . VAL A 1 90  ? -3.437  2.895   -5.780  1.00 0.00 ? 90  VAL A HG12 3  
ATOM 4321  H HG13 . VAL A 1 90  ? -3.022  3.966   -7.140  1.00 0.00 ? 90  VAL A HG13 3  
ATOM 4322  H HG21 . VAL A 1 90  ? -6.053  4.457   -8.352  1.00 0.00 ? 90  VAL A HG21 3  
ATOM 4323  H HG22 . VAL A 1 90  ? -7.026  3.172   -7.595  1.00 0.00 ? 90  VAL A HG22 3  
ATOM 4324  H HG23 . VAL A 1 90  ? -6.251  4.414   -6.583  1.00 0.00 ? 90  VAL A HG23 3  
ATOM 4325  N N    . THR A 1 91  ? -2.556  1.012   -9.150  1.00 0.00 ? 91  THR A N    3  
ATOM 4326  C CA   . THR A 1 91  ? -1.939  -0.298  -9.271  1.00 0.00 ? 91  THR A CA   3  
ATOM 4327  C C    . THR A 1 91  ? -0.719  -0.400  -8.353  1.00 0.00 ? 91  THR A C    3  
ATOM 4328  O O    . THR A 1 91  ? 0.334   0.161   -8.649  1.00 0.00 ? 91  THR A O    3  
ATOM 4329  C CB   . THR A 1 91  ? -1.609  -0.531  -10.747 1.00 0.00 ? 91  THR A CB   3  
ATOM 4330  O OG1  . THR A 1 91  ? -1.093  -1.859  -10.782 1.00 0.00 ? 91  THR A OG1  3  
ATOM 4331  C CG2  . THR A 1 91  ? -0.444  0.335   -11.231 1.00 0.00 ? 91  THR A CG2  3  
ATOM 4332  H H    . THR A 1 91  ? -1.944  1.784   -9.321  1.00 0.00 ? 91  THR A H    3  
ATOM 4333  H HA   . THR A 1 91  ? -2.656  -1.048  -8.936  1.00 0.00 ? 91  THR A HA   3  
ATOM 4334  H HB   . THR A 1 91  ? -2.490  -0.381  -11.371 1.00 0.00 ? 91  THR A HB   3  
ATOM 4335  H HG1  . THR A 1 91  ? -1.134  -2.217  -11.715 1.00 0.00 ? 91  THR A HG1  3  
ATOM 4336  H HG21 . THR A 1 91  ? 0.485   -0.027  -10.789 1.00 0.00 ? 91  THR A HG21 3  
ATOM 4337  H HG22 . THR A 1 91  ? -0.376  0.279   -12.317 1.00 0.00 ? 91  THR A HG22 3  
ATOM 4338  H HG23 . THR A 1 91  ? -0.610  1.369   -10.930 1.00 0.00 ? 91  THR A HG23 3  
ATOM 4339  N N    . LEU A 1 92  ? -0.904  -1.121  -7.256  1.00 0.00 ? 92  LEU A N    3  
ATOM 4340  C CA   . LEU A 1 92  ? 0.168   -1.304  -6.293  1.00 0.00 ? 92  LEU A CA   3  
ATOM 4341  C C    . LEU A 1 92  ? 0.287   -2.789  -5.944  1.00 0.00 ? 92  LEU A C    3  
ATOM 4342  O O    . LEU A 1 92  ? -0.532  -3.599  -6.376  1.00 0.00 ? 92  LEU A O    3  
ATOM 4343  C CB   . LEU A 1 92  ? -0.045  -0.402  -5.076  1.00 0.00 ? 92  LEU A CB   3  
ATOM 4344  C CG   . LEU A 1 92  ? -1.190  0.609   -5.182  1.00 0.00 ? 92  LEU A CG   3  
ATOM 4345  C CD1  . LEU A 1 92  ? -0.938  1.605   -6.316  1.00 0.00 ? 92  LEU A CD1  3  
ATOM 4346  C CD2  . LEU A 1 92  ? -2.536  -0.102  -5.332  1.00 0.00 ? 92  LEU A CD2  3  
ATOM 4347  H H    . LEU A 1 92  ? -1.764  -1.574  -7.023  1.00 0.00 ? 92  LEU A H    3  
ATOM 4348  H HA   . LEU A 1 92  ? 1.095   -0.986  -6.770  1.00 0.00 ? 92  LEU A HA   3  
ATOM 4349  H HB2  . LEU A 1 92  ? -0.225  -1.034  -4.206  1.00 0.00 ? 92  LEU A HB2  3  
ATOM 4350  H HB3  . LEU A 1 92  ? 0.879   0.145   -4.886  1.00 0.00 ? 92  LEU A HB3  3  
ATOM 4351  H HG   . LEU A 1 92  ? -1.229  1.180   -4.255  1.00 0.00 ? 92  LEU A HG   3  
ATOM 4352  H HD11 . LEU A 1 92  ? 0.000   1.359   -6.813  1.00 0.00 ? 92  LEU A HD11 3  
ATOM 4353  H HD12 . LEU A 1 92  ? -1.755  1.551   -7.035  1.00 0.00 ? 92  LEU A HD12 3  
ATOM 4354  H HD13 . LEU A 1 92  ? -0.880  2.613   -5.907  1.00 0.00 ? 92  LEU A HD13 3  
ATOM 4355  H HD21 . LEU A 1 92  ? -2.950  0.108   -6.318  1.00 0.00 ? 92  LEU A HD21 3  
ATOM 4356  H HD22 . LEU A 1 92  ? -2.394  -1.177  -5.219  1.00 0.00 ? 92  LEU A HD22 3  
ATOM 4357  H HD23 . LEU A 1 92  ? -3.224  0.256   -4.566  1.00 0.00 ? 92  LEU A HD23 3  
ATOM 4358  N N    . GLU A 1 93  ? 1.313   -3.101  -5.166  1.00 0.00 ? 93  GLU A N    3  
ATOM 4359  C CA   . GLU A 1 93  ? 1.549   -4.475  -4.754  1.00 0.00 ? 93  GLU A CA   3  
ATOM 4360  C C    . GLU A 1 93  ? 1.882   -4.532  -3.262  1.00 0.00 ? 93  GLU A C    3  
ATOM 4361  O O    . GLU A 1 93  ? 2.943   -4.075  -2.841  1.00 0.00 ? 93  GLU A O    3  
ATOM 4362  C CB   . GLU A 1 93  ? 2.661   -5.114  -5.589  1.00 0.00 ? 93  GLU A CB   3  
ATOM 4363  C CG   . GLU A 1 93  ? 2.572   -4.672  -7.051  1.00 0.00 ? 93  GLU A CG   3  
ATOM 4364  C CD   . GLU A 1 93  ? 3.769   -5.187  -7.853  1.00 0.00 ? 93  GLU A CD   3  
ATOM 4365  O OE1  . GLU A 1 93  ? 4.257   -6.283  -7.503  1.00 0.00 ? 93  GLU A OE1  3  
ATOM 4366  O OE2  . GLU A 1 93  ? 4.168   -4.472  -8.798  1.00 0.00 ? 93  GLU A OE2  3  
ATOM 4367  H H    . GLU A 1 93  ? 1.974   -2.436  -4.819  1.00 0.00 ? 93  GLU A H    3  
ATOM 4368  H HA   . GLU A 1 93  ? 0.613   -4.999  -4.945  1.00 0.00 ? 93  GLU A HA   3  
ATOM 4369  H HB2  . GLU A 1 93  ? 3.632   -4.837  -5.180  1.00 0.00 ? 93  GLU A HB2  3  
ATOM 4370  H HB3  . GLU A 1 93  ? 2.587   -6.200  -5.528  1.00 0.00 ? 93  GLU A HB3  3  
ATOM 4371  H HG2  . GLU A 1 93  ? 1.647   -5.044  -7.492  1.00 0.00 ? 93  GLU A HG2  3  
ATOM 4372  H HG3  . GLU A 1 93  ? 2.535   -3.584  -7.104  1.00 0.00 ? 93  GLU A HG3  3  
ATOM 4373  N N    . VAL A 1 94  ? 0.954   -5.096  -2.503  1.00 0.00 ? 94  VAL A N    3  
ATOM 4374  C CA   . VAL A 1 94  ? 1.136   -5.219  -1.066  1.00 0.00 ? 94  VAL A CA   3  
ATOM 4375  C C    . VAL A 1 94  ? 1.340   -6.692  -0.707  1.00 0.00 ? 94  VAL A C    3  
ATOM 4376  O O    . VAL A 1 94  ? 1.589   -7.520  -1.582  1.00 0.00 ? 94  VAL A O    3  
ATOM 4377  C CB   . VAL A 1 94  ? -0.047  -4.583  -0.333  1.00 0.00 ? 94  VAL A CB   3  
ATOM 4378  C CG1  . VAL A 1 94  ? -0.424  -3.240  -0.962  1.00 0.00 ? 94  VAL A CG1  3  
ATOM 4379  C CG2  . VAL A 1 94  ? -1.247  -5.531  -0.304  1.00 0.00 ? 94  VAL A CG2  3  
ATOM 4380  H H    . VAL A 1 94  ? 0.093   -5.465  -2.853  1.00 0.00 ? 94  VAL A H    3  
ATOM 4381  H HA   . VAL A 1 94  ? 2.036   -4.665  -0.800  1.00 0.00 ? 94  VAL A HA   3  
ATOM 4382  H HB   . VAL A 1 94  ? 0.258   -4.397  0.697   1.00 0.00 ? 94  VAL A HB   3  
ATOM 4383  H HG11 . VAL A 1 94  ? -0.421  -3.334  -2.048  1.00 0.00 ? 94  VAL A HG11 3  
ATOM 4384  H HG12 . VAL A 1 94  ? -1.419  -2.948  -0.626  1.00 0.00 ? 94  VAL A HG12 3  
ATOM 4385  H HG13 . VAL A 1 94  ? 0.299   -2.482  -0.661  1.00 0.00 ? 94  VAL A HG13 3  
ATOM 4386  H HG21 . VAL A 1 94  ? -0.925  -6.515  0.036   1.00 0.00 ? 94  VAL A HG21 3  
ATOM 4387  H HG22 . VAL A 1 94  ? -2.002  -5.140  0.379   1.00 0.00 ? 94  VAL A HG22 3  
ATOM 4388  H HG23 . VAL A 1 94  ? -1.671  -5.613  -1.305  1.00 0.00 ? 94  VAL A HG23 3  
ATOM 4389  N N    . ALA A 1 95  ? 1.228   -6.974  0.583   1.00 0.00 ? 95  ALA A N    3  
ATOM 4390  C CA   . ALA A 1 95  ? 1.398   -8.333  1.070   1.00 0.00 ? 95  ALA A CA   3  
ATOM 4391  C C    . ALA A 1 95  ? 1.104   -8.373  2.570   1.00 0.00 ? 95  ALA A C    3  
ATOM 4392  O O    . ALA A 1 95  ? 0.999   -7.330  3.214   1.00 0.00 ? 95  ALA A O    3  
ATOM 4393  C CB   . ALA A 1 95  ? 2.809   -8.821  0.738   1.00 0.00 ? 95  ALA A CB   3  
ATOM 4394  H H    . ALA A 1 95  ? 1.026   -6.295  1.289   1.00 0.00 ? 95  ALA A H    3  
ATOM 4395  H HA   . ALA A 1 95  ? 0.677   -8.964  0.550   1.00 0.00 ? 95  ALA A HA   3  
ATOM 4396  H HB1  . ALA A 1 95  ? 3.541   -8.171  1.218   1.00 0.00 ? 95  ALA A HB1  3  
ATOM 4397  H HB2  . ALA A 1 95  ? 2.935   -9.841  1.103   1.00 0.00 ? 95  ALA A HB2  3  
ATOM 4398  H HB3  . ALA A 1 95  ? 2.957   -8.800  -0.341  1.00 0.00 ? 95  ALA A HB3  3  
ATOM 4399  N N    . LYS A 1 96  ? 0.979   -9.588  3.084   1.00 0.00 ? 96  LYS A N    3  
ATOM 4400  C CA   . LYS A 1 96  ? 0.699   -9.778  4.497   1.00 0.00 ? 96  LYS A CA   3  
ATOM 4401  C C    . LYS A 1 96  ? -0.718  -9.289  4.803   1.00 0.00 ? 96  LYS A C    3  
ATOM 4402  O O    . LYS A 1 96  ? -0.902  -8.181  5.306   1.00 0.00 ? 96  LYS A O    3  
ATOM 4403  C CB   . LYS A 1 96  ? 1.778   -9.108  5.352   1.00 0.00 ? 96  LYS A CB   3  
ATOM 4404  C CG   . LYS A 1 96  ? 2.445   -10.121 6.285   1.00 0.00 ? 96  LYS A CG   3  
ATOM 4405  C CD   . LYS A 1 96  ? 3.690   -10.728 5.635   1.00 0.00 ? 96  LYS A CD   3  
ATOM 4406  C CE   . LYS A 1 96  ? 3.323   -11.937 4.772   1.00 0.00 ? 96  LYS A CE   3  
ATOM 4407  N NZ   . LYS A 1 96  ? 4.456   -12.887 4.702   1.00 0.00 ? 96  LYS A NZ   3  
ATOM 4408  H H    . LYS A 1 96  ? 1.066   -10.431 2.554   1.00 0.00 ? 96  LYS A H    3  
ATOM 4409  H HA   . LYS A 1 96  ? 0.747   -10.848 4.699   1.00 0.00 ? 96  LYS A HA   3  
ATOM 4410  H HB2  . LYS A 1 96  ? 2.529   -8.654  4.706   1.00 0.00 ? 96  LYS A HB2  3  
ATOM 4411  H HB3  . LYS A 1 96  ? 1.335   -8.304  5.939   1.00 0.00 ? 96  LYS A HB3  3  
ATOM 4412  H HG2  . LYS A 1 96  ? 2.720   -9.633  7.220   1.00 0.00 ? 96  LYS A HG2  3  
ATOM 4413  H HG3  . LYS A 1 96  ? 1.738   -10.912 6.534   1.00 0.00 ? 96  LYS A HG3  3  
ATOM 4414  H HD2  . LYS A 1 96  ? 4.188   -9.977  5.021   1.00 0.00 ? 96  LYS A HD2  3  
ATOM 4415  H HD3  . LYS A 1 96  ? 4.398   -11.029 6.407   1.00 0.00 ? 96  LYS A HD3  3  
ATOM 4416  H HE2  . LYS A 1 96  ? 2.448   -12.436 5.187   1.00 0.00 ? 96  LYS A HE2  3  
ATOM 4417  H HE3  . LYS A 1 96  ? 3.056   -11.607 3.768   1.00 0.00 ? 96  LYS A HE3  3  
ATOM 4418  H HZ1  . LYS A 1 96  ? 4.239   -13.619 4.057   1.00 0.00 ? 96  LYS A HZ1  3  
ATOM 4419  H HZ2  . LYS A 1 96  ? 5.277   -12.405 4.395   1.00 0.00 ? 96  LYS A HZ2  3  
ATOM 4420  H HZ3  . LYS A 1 96  ? 4.619   -13.278 5.608   1.00 0.00 ? 96  LYS A HZ3  3  
ATOM 4421  N N    . GLN A 1 97  ? -1.684  -10.138 4.485   1.00 0.00 ? 97  GLN A N    3  
ATOM 4422  C CA   . GLN A 1 97  ? -3.079  -9.807  4.719   1.00 0.00 ? 97  GLN A CA   3  
ATOM 4423  C C    . GLN A 1 97  ? -3.988  -10.875 4.108   1.00 0.00 ? 97  GLN A C    3  
ATOM 4424  O O    . GLN A 1 97  ? -4.373  -10.776 2.944   1.00 0.00 ? 97  GLN A O    3  
ATOM 4425  C CB   . GLN A 1 97  ? -3.413  -8.420  4.165   1.00 0.00 ? 97  GLN A CB   3  
ATOM 4426  C CG   . GLN A 1 97  ? -3.773  -7.451  5.294   1.00 0.00 ? 97  GLN A CG   3  
ATOM 4427  C CD   . GLN A 1 97  ? -5.042  -7.903  6.020   1.00 0.00 ? 97  GLN A CD   3  
ATOM 4428  O OE1  . GLN A 1 97  ? -5.530  -9.007  5.843   1.00 0.00 ? 97  GLN A OE1  3  
ATOM 4429  N NE2  . GLN A 1 97  ? -5.547  -6.990  6.844   1.00 0.00 ? 97  GLN A NE2  3  
ATOM 4430  H H    . GLN A 1 97  ? -1.526  -11.037 4.076   1.00 0.00 ? 97  GLN A H    3  
ATOM 4431  H HA   . GLN A 1 97  ? -3.197  -9.796  5.803   1.00 0.00 ? 97  GLN A HA   3  
ATOM 4432  H HB2  . GLN A 1 97  ? -2.561  -8.033  3.607   1.00 0.00 ? 97  GLN A HB2  3  
ATOM 4433  H HB3  . GLN A 1 97  ? -4.246  -8.495  3.466   1.00 0.00 ? 97  GLN A HB3  3  
ATOM 4434  H HG2  . GLN A 1 97  ? -2.947  -7.389  6.002   1.00 0.00 ? 97  GLN A HG2  3  
ATOM 4435  H HG3  . GLN A 1 97  ? -3.920  -6.451  4.886   1.00 0.00 ? 97  GLN A HG3  3  
ATOM 4436  H HE21 . GLN A 1 97  ? -5.098  -6.102  6.943   1.00 0.00 ? 97  GLN A HE21 3  
ATOM 4437  H HE22 . GLN A 1 97  ? -6.377  -7.191  7.365   1.00 0.00 ? 97  GLN A HE22 3  
ATOM 4438  N N    . GLY A 1 98  ? -4.305  -11.872 4.921   1.00 0.00 ? 98  GLY A N    3  
ATOM 4439  C CA   . GLY A 1 98  ? -5.162  -12.958 4.475   1.00 0.00 ? 98  GLY A CA   3  
ATOM 4440  C C    . GLY A 1 98  ? -6.392  -12.420 3.742   1.00 0.00 ? 98  GLY A C    3  
ATOM 4441  O O    . GLY A 1 98  ? -6.967  -11.410 4.146   1.00 0.00 ? 98  GLY A O    3  
ATOM 4442  H H    . GLY A 1 98  ? -3.987  -11.946 5.866   1.00 0.00 ? 98  GLY A H    3  
ATOM 4443  H HA2  . GLY A 1 98  ? -4.601  -13.620 3.815   1.00 0.00 ? 98  GLY A HA2  3  
ATOM 4444  H HA3  . GLY A 1 98  ? -5.476  -13.553 5.332   1.00 0.00 ? 98  GLY A HA3  3  
ATOM 4445  N N    . ALA A 1 99  ? -6.759  -13.117 2.677   1.00 0.00 ? 99  ALA A N    3  
ATOM 4446  C CA   . ALA A 1 99  ? -7.910  -12.722 1.884   1.00 0.00 ? 99  ALA A CA   3  
ATOM 4447  C C    . ALA A 1 99  ? -8.227  -13.823 0.869   1.00 0.00 ? 99  ALA A C    3  
ATOM 4448  O O    . ALA A 1 99  ? -7.356  -14.615 0.515   1.00 0.00 ? 99  ALA A O    3  
ATOM 4449  C CB   . ALA A 1 99  ? -7.632  -11.375 1.215   1.00 0.00 ? 99  ALA A CB   3  
ATOM 4450  H H    . ALA A 1 99  ? -6.285  -13.937 2.355   1.00 0.00 ? 99  ALA A H    3  
ATOM 4451  H HA   . ALA A 1 99  ? -8.757  -12.609 2.561   1.00 0.00 ? 99  ALA A HA   3  
ATOM 4452  H HB1  . ALA A 1 99  ? -8.329  -11.227 0.390   1.00 0.00 ? 99  ALA A HB1  3  
ATOM 4453  H HB2  . ALA A 1 99  ? -7.757  -10.574 1.944   1.00 0.00 ? 99  ALA A HB2  3  
ATOM 4454  H HB3  . ALA A 1 99  ? -6.611  -11.363 0.833   1.00 0.00 ? 99  ALA A HB3  3  
ATOM 4455  N N    . ILE A 1 100 ? -9.477  -13.836 0.429   1.00 0.00 ? 100 ILE A N    3  
ATOM 4456  C CA   . ILE A 1 100 ? -9.920  -14.826 -0.538  1.00 0.00 ? 100 ILE A CA   3  
ATOM 4457  C C    . ILE A 1 100 ? -11.344 -14.492 -0.987  1.00 0.00 ? 100 ILE A C    3  
ATOM 4458  O O    . ILE A 1 100 ? -12.221 -14.256 -0.158  1.00 0.00 ? 100 ILE A O    3  
ATOM 4459  C CB   . ILE A 1 100 ? -9.769  -16.237 0.033   1.00 0.00 ? 100 ILE A CB   3  
ATOM 4460  C CG1  . ILE A 1 100 ? -9.859  -17.289 -1.074  1.00 0.00 ? 100 ILE A CG1  3  
ATOM 4461  C CG2  . ILE A 1 100 ? -10.787 -16.489 1.147   1.00 0.00 ? 100 ILE A CG2  3  
ATOM 4462  C CD1  . ILE A 1 100 ? -8.490  -17.530 -1.714  1.00 0.00 ? 100 ILE A CD1  3  
ATOM 4463  H H    . ILE A 1 100 ? -10.180 -13.187 0.722   1.00 0.00 ? 100 ILE A H    3  
ATOM 4464  H HA   . ILE A 1 100 ? -9.259  -14.756 -1.402  1.00 0.00 ? 100 ILE A HA   3  
ATOM 4465  H HB   . ILE A 1 100 ? -8.778  -16.322 0.478   1.00 0.00 ? 100 ILE A HB   3  
ATOM 4466  H HG12 . ILE A 1 100 ? -10.242 -18.223 -0.663  1.00 0.00 ? 100 ILE A HG12 3  
ATOM 4467  H HG13 . ILE A 1 100 ? -10.568 -16.962 -1.835  1.00 0.00 ? 100 ILE A HG13 3  
ATOM 4468  H HG21 . ILE A 1 100 ? -11.766 -16.681 0.708   1.00 0.00 ? 100 ILE A HG21 3  
ATOM 4469  H HG22 . ILE A 1 100 ? -10.477 -17.353 1.735   1.00 0.00 ? 100 ILE A HG22 3  
ATOM 4470  H HG23 . ILE A 1 100 ? -10.844 -15.613 1.793   1.00 0.00 ? 100 ILE A HG23 3  
ATOM 4471  H HD11 . ILE A 1 100 ? -7.728  -17.575 -0.936  1.00 0.00 ? 100 ILE A HD11 3  
ATOM 4472  H HD12 . ILE A 1 100 ? -8.506  -18.472 -2.262  1.00 0.00 ? 100 ILE A HD12 3  
ATOM 4473  H HD13 . ILE A 1 100 ? -8.261  -16.714 -2.400  1.00 0.00 ? 100 ILE A HD13 3  
ATOM 4474  N N    . TYR A 1 101 ? -11.530 -14.485 -2.299  1.00 0.00 ? 101 TYR A N    3  
ATOM 4475  C CA   . TYR A 1 101 ? -12.832 -14.185 -2.868  1.00 0.00 ? 101 TYR A CA   3  
ATOM 4476  C C    . TYR A 1 101 ? -13.121 -15.077 -4.077  1.00 0.00 ? 101 TYR A C    3  
ATOM 4477  O O    . TYR A 1 101 ? -14.269 -15.199 -4.503  1.00 0.00 ? 101 TYR A O    3  
ATOM 4478  C CB   . TYR A 1 101 ? -12.765 -12.727 -3.330  1.00 0.00 ? 101 TYR A CB   3  
ATOM 4479  C CG   . TYR A 1 101 ? -14.133 -12.060 -3.485  1.00 0.00 ? 101 TYR A CG   3  
ATOM 4480  C CD1  . TYR A 1 101 ? -14.878 -11.745 -2.367  1.00 0.00 ? 101 TYR A CD1  3  
ATOM 4481  C CD2  . TYR A 1 101 ? -14.622 -11.774 -4.743  1.00 0.00 ? 101 TYR A CD2  3  
ATOM 4482  C CE1  . TYR A 1 101 ? -16.165 -11.117 -2.513  1.00 0.00 ? 101 TYR A CE1  3  
ATOM 4483  C CE2  . TYR A 1 101 ? -15.910 -11.145 -4.890  1.00 0.00 ? 101 TYR A CE2  3  
ATOM 4484  C CZ   . TYR A 1 101 ? -16.618 -10.848 -3.767  1.00 0.00 ? 101 TYR A CZ   3  
ATOM 4485  O OH   . TYR A 1 101 ? -17.834 -10.255 -3.905  1.00 0.00 ? 101 TYR A OH   3  
ATOM 4486  H H    . TYR A 1 101 ? -10.811 -14.678 -2.967  1.00 0.00 ? 101 TYR A H    3  
ATOM 4487  H HA   . TYR A 1 101 ? -13.585 -14.369 -2.102  1.00 0.00 ? 101 TYR A HA   3  
ATOM 4488  H HB2  . TYR A 1 101 ? -12.173 -12.157 -2.614  1.00 0.00 ? 101 TYR A HB2  3  
ATOM 4489  H HB3  . TYR A 1 101 ? -12.240 -12.683 -4.284  1.00 0.00 ? 101 TYR A HB3  3  
ATOM 4490  H HD1  . TYR A 1 101 ? -14.491 -11.971 -1.373  1.00 0.00 ? 101 TYR A HD1  3  
ATOM 4491  H HD2  . TYR A 1 101 ? -14.034 -12.023 -5.626  1.00 0.00 ? 101 TYR A HD2  3  
ATOM 4492  H HE1  . TYR A 1 101 ? -16.764 -10.862 -1.638  1.00 0.00 ? 101 TYR A HE1  3  
ATOM 4493  H HE2  . TYR A 1 101 ? -16.308 -10.914 -5.877  1.00 0.00 ? 101 TYR A HE2  3  
ATOM 4494  H HH   . TYR A 1 101 ? -18.451 -10.569 -3.184  1.00 0.00 ? 101 TYR A HH   3  
ATOM 4495  N N    . GLY A 1 1   ? 8.716   -14.647 7.663   1.00 0.00 ? 1   GLY A N    4  
ATOM 4496  C CA   . GLY A 1 1   ? 7.673   -15.484 7.096   1.00 0.00 ? 1   GLY A CA   4  
ATOM 4497  C C    . GLY A 1 1   ? 8.237   -16.834 6.647   1.00 0.00 ? 1   GLY A C    4  
ATOM 4498  O O    . GLY A 1 1   ? 8.790   -16.947 5.554   1.00 0.00 ? 1   GLY A O    4  
ATOM 4499  H H1   . GLY A 1 1   ? 9.466   -15.144 8.100   1.00 0.00 ? 1   GLY A H1   4  
ATOM 4500  H HA2  . GLY A 1 1   ? 6.887   -15.642 7.834   1.00 0.00 ? 1   GLY A HA2  4  
ATOM 4501  H HA3  . GLY A 1 1   ? 7.216   -14.976 6.246   1.00 0.00 ? 1   GLY A HA3  4  
ATOM 4502  N N    . PRO A 1 2   ? 8.072   -17.850 7.536   1.00 0.00 ? 2   PRO A N    4  
ATOM 4503  C CA   . PRO A 1 2   ? 8.558   -19.187 7.243   1.00 0.00 ? 2   PRO A CA   4  
ATOM 4504  C C    . PRO A 1 2   ? 7.656   -19.887 6.224   1.00 0.00 ? 2   PRO A C    4  
ATOM 4505  O O    . PRO A 1 2   ? 6.679   -19.307 5.753   1.00 0.00 ? 2   PRO A O    4  
ATOM 4506  C CB   . PRO A 1 2   ? 8.596   -19.896 8.587   1.00 0.00 ? 2   PRO A CB   4  
ATOM 4507  C CG   . PRO A 1 2   ? 7.696   -19.089 9.509   1.00 0.00 ? 2   PRO A CG   4  
ATOM 4508  C CD   . PRO A 1 2   ? 7.421   -17.752 8.839   1.00 0.00 ? 2   PRO A CD   4  
ATOM 4509  H HA   . PRO A 1 2   ? 9.464   -19.143 6.821   1.00 0.00 ? 2   PRO A HA   4  
ATOM 4510  H HB2  . PRO A 1 2   ? 8.243   -20.923 8.497   1.00 0.00 ? 2   PRO A HB2  4  
ATOM 4511  H HB3  . PRO A 1 2   ? 9.613   -19.941 8.975   1.00 0.00 ? 2   PRO A HB3  4  
ATOM 4512  H HG2  . PRO A 1 2   ? 6.764   -19.622 9.695   1.00 0.00 ? 2   PRO A HG2  4  
ATOM 4513  H HG3  . PRO A 1 2   ? 8.177   -18.939 10.476  1.00 0.00 ? 2   PRO A HG3  4  
ATOM 4514  H HD2  . PRO A 1 2   ? 6.351   -17.574 8.735   1.00 0.00 ? 2   PRO A HD2  4  
ATOM 4515  H HD3  . PRO A 1 2   ? 7.826   -16.926 9.423   1.00 0.00 ? 2   PRO A HD3  4  
ATOM 4516  N N    . LEU A 1 3   ? 8.017   -21.123 5.913   1.00 0.00 ? 3   LEU A N    4  
ATOM 4517  C CA   . LEU A 1 3   ? 7.252   -21.908 4.958   1.00 0.00 ? 3   LEU A CA   4  
ATOM 4518  C C    . LEU A 1 3   ? 5.792   -21.970 5.409   1.00 0.00 ? 3   LEU A C    4  
ATOM 4519  O O    . LEU A 1 3   ? 5.455   -21.513 6.500   1.00 0.00 ? 3   LEU A O    4  
ATOM 4520  C CB   . LEU A 1 3   ? 7.894   -23.283 4.760   1.00 0.00 ? 3   LEU A CB   4  
ATOM 4521  C CG   . LEU A 1 3   ? 9.227   -23.299 4.009   1.00 0.00 ? 3   LEU A CG   4  
ATOM 4522  C CD1  . LEU A 1 3   ? 10.393  -23.548 4.968   1.00 0.00 ? 3   LEU A CD1  4  
ATOM 4523  C CD2  . LEU A 1 3   ? 9.200   -24.314 2.865   1.00 0.00 ? 3   LEU A CD2  4  
ATOM 4524  H H    . LEU A 1 3   ? 8.813   -21.588 6.300   1.00 0.00 ? 3   LEU A H    4  
ATOM 4525  H HA   . LEU A 1 3   ? 7.297   -21.391 4.000   1.00 0.00 ? 3   LEU A HA   4  
ATOM 4526  H HB2  . LEU A 1 3   ? 8.045   -23.736 5.739   1.00 0.00 ? 3   LEU A HB2  4  
ATOM 4527  H HB3  . LEU A 1 3   ? 7.189   -23.916 4.221   1.00 0.00 ? 3   LEU A HB3  4  
ATOM 4528  H HG   . LEU A 1 3   ? 9.380   -22.316 3.564   1.00 0.00 ? 3   LEU A HG   4  
ATOM 4529  H HD11 . LEU A 1 3   ? 11.323  -23.229 4.499   1.00 0.00 ? 3   LEU A HD11 4  
ATOM 4530  H HD12 . LEU A 1 3   ? 10.236  -22.982 5.886   1.00 0.00 ? 3   LEU A HD12 4  
ATOM 4531  H HD13 . LEU A 1 3   ? 10.450  -24.611 5.203   1.00 0.00 ? 3   LEU A HD13 4  
ATOM 4532  H HD21 . LEU A 1 3   ? 10.213  -24.472 2.495   1.00 0.00 ? 3   LEU A HD21 4  
ATOM 4533  H HD22 . LEU A 1 3   ? 8.793   -25.259 3.226   1.00 0.00 ? 3   LEU A HD22 4  
ATOM 4534  H HD23 . LEU A 1 3   ? 8.574   -23.934 2.057   1.00 0.00 ? 3   LEU A HD23 4  
ATOM 4535  N N    . GLY A 1 4   ? 4.963   -22.540 4.546   1.00 0.00 ? 4   GLY A N    4  
ATOM 4536  C CA   . GLY A 1 4   ? 3.546   -22.668 4.842   1.00 0.00 ? 4   GLY A CA   4  
ATOM 4537  C C    . GLY A 1 4   ? 2.828   -23.466 3.752   1.00 0.00 ? 4   GLY A C    4  
ATOM 4538  O O    . GLY A 1 4   ? 3.415   -24.360 3.144   1.00 0.00 ? 4   GLY A O    4  
ATOM 4539  H H    . GLY A 1 4   ? 5.245   -22.909 3.661   1.00 0.00 ? 4   GLY A H    4  
ATOM 4540  H HA2  . GLY A 1 4   ? 3.415   -23.161 5.805   1.00 0.00 ? 4   GLY A HA2  4  
ATOM 4541  H HA3  . GLY A 1 4   ? 3.098   -21.678 4.928   1.00 0.00 ? 4   GLY A HA3  4  
ATOM 4542  N N    . SER A 1 5   ? 1.569   -23.113 3.537   1.00 0.00 ? 5   SER A N    4  
ATOM 4543  C CA   . SER A 1 5   ? 0.765   -23.786 2.531   1.00 0.00 ? 5   SER A CA   4  
ATOM 4544  C C    . SER A 1 5   ? 1.368   -23.560 1.143   1.00 0.00 ? 5   SER A C    4  
ATOM 4545  O O    . SER A 1 5   ? 1.799   -24.508 0.488   1.00 0.00 ? 5   SER A O    4  
ATOM 4546  C CB   . SER A 1 5   ? -0.684  -23.295 2.566   1.00 0.00 ? 5   SER A CB   4  
ATOM 4547  O OG   . SER A 1 5   ? -0.775  -21.886 2.381   1.00 0.00 ? 5   SER A OG   4  
ATOM 4548  H H    . SER A 1 5   ? 1.100   -22.385 4.036   1.00 0.00 ? 5   SER A H    4  
ATOM 4549  H HA   . SER A 1 5   ? 0.797   -24.843 2.795   1.00 0.00 ? 5   SER A HA   4  
ATOM 4550  H HB2  . SER A 1 5   ? -1.257  -23.801 1.789   1.00 0.00 ? 5   SER A HB2  4  
ATOM 4551  H HB3  . SER A 1 5   ? -1.135  -23.566 3.521   1.00 0.00 ? 5   SER A HB3  4  
ATOM 4552  H HG   . SER A 1 5   ? -0.515  -21.412 3.222   1.00 0.00 ? 5   SER A HG   4  
ATOM 4553  N N    . LEU A 1 6   ? 1.380   -22.299 0.736   1.00 0.00 ? 6   LEU A N    4  
ATOM 4554  C CA   . LEU A 1 6   ? 1.923   -21.938 -0.562  1.00 0.00 ? 6   LEU A CA   4  
ATOM 4555  C C    . LEU A 1 6   ? 0.886   -22.240 -1.646  1.00 0.00 ? 6   LEU A C    4  
ATOM 4556  O O    . LEU A 1 6   ? 0.886   -23.325 -2.226  1.00 0.00 ? 6   LEU A O    4  
ATOM 4557  C CB   . LEU A 1 6   ? 3.270   -22.626 -0.791  1.00 0.00 ? 6   LEU A CB   4  
ATOM 4558  C CG   . LEU A 1 6   ? 4.347   -21.783 -1.476  1.00 0.00 ? 6   LEU A CG   4  
ATOM 4559  C CD1  . LEU A 1 6   ? 3.954   -21.459 -2.919  1.00 0.00 ? 6   LEU A CD1  4  
ATOM 4560  C CD2  . LEU A 1 6   ? 4.652   -20.521 -0.668  1.00 0.00 ? 6   LEU A CD2  4  
ATOM 4561  H H    . LEU A 1 6   ? 1.027   -21.534 1.275   1.00 0.00 ? 6   LEU A H    4  
ATOM 4562  H HA   . LEU A 1 6   ? 2.108   -20.863 -0.551  1.00 0.00 ? 6   LEU A HA   4  
ATOM 4563  H HB2  . LEU A 1 6   ? 3.654   -22.957 0.174   1.00 0.00 ? 6   LEU A HB2  4  
ATOM 4564  H HB3  . LEU A 1 6   ? 3.101   -23.521 -1.390  1.00 0.00 ? 6   LEU A HB3  4  
ATOM 4565  H HG   . LEU A 1 6   ? 5.265   -22.369 -1.517  1.00 0.00 ? 6   LEU A HG   4  
ATOM 4566  H HD11 . LEU A 1 6   ? 4.853   -21.351 -3.525  1.00 0.00 ? 6   LEU A HD11 4  
ATOM 4567  H HD12 . LEU A 1 6   ? 3.341   -22.267 -3.319  1.00 0.00 ? 6   LEU A HD12 4  
ATOM 4568  H HD13 . LEU A 1 6   ? 3.387   -20.528 -2.940  1.00 0.00 ? 6   LEU A HD13 4  
ATOM 4569  H HD21 . LEU A 1 6   ? 5.729   -20.357 -0.641  1.00 0.00 ? 6   LEU A HD21 4  
ATOM 4570  H HD22 . LEU A 1 6   ? 4.166   -19.664 -1.135  1.00 0.00 ? 6   LEU A HD22 4  
ATOM 4571  H HD23 . LEU A 1 6   ? 4.277   -20.641 0.349   1.00 0.00 ? 6   LEU A HD23 4  
ATOM 4572  N N    . ARG A 1 7   ? 0.027   -21.260 -1.888  1.00 0.00 ? 7   ARG A N    4  
ATOM 4573  C CA   . ARG A 1 7   ? -1.013  -21.408 -2.892  1.00 0.00 ? 7   ARG A CA   4  
ATOM 4574  C C    . ARG A 1 7   ? -1.898  -20.160 -2.927  1.00 0.00 ? 7   ARG A C    4  
ATOM 4575  O O    . ARG A 1 7   ? -1.941  -19.452 -3.932  1.00 0.00 ? 7   ARG A O    4  
ATOM 4576  C CB   . ARG A 1 7   ? -1.882  -22.634 -2.609  1.00 0.00 ? 7   ARG A CB   4  
ATOM 4577  C CG   . ARG A 1 7   ? -1.659  -23.720 -3.663  1.00 0.00 ? 7   ARG A CG   4  
ATOM 4578  C CD   . ARG A 1 7   ? -2.131  -25.084 -3.154  1.00 0.00 ? 7   ARG A CD   4  
ATOM 4579  N NE   . ARG A 1 7   ? -1.593  -26.160 -4.017  1.00 0.00 ? 7   ARG A NE   4  
ATOM 4580  C CZ   . ARG A 1 7   ? -1.996  -26.387 -5.274  1.00 0.00 ? 7   ARG A CZ   4  
ATOM 4581  N NH1  . ARG A 1 7   ? -2.943  -25.615 -5.824  1.00 0.00 ? 7   ARG A NH1  4  
ATOM 4582  N NH2  . ARG A 1 7   ? -1.452  -27.386 -5.982  1.00 0.00 ? 7   ARG A NH2  4  
ATOM 4583  H H    . ARG A 1 7   ? 0.034   -20.381 -1.413  1.00 0.00 ? 7   ARG A H    4  
ATOM 4584  H HA   . ARG A 1 7   ? -0.476  -21.534 -3.833  1.00 0.00 ? 7   ARG A HA   4  
ATOM 4585  H HB2  . ARG A 1 7   ? -1.649  -23.029 -1.620  1.00 0.00 ? 7   ARG A HB2  4  
ATOM 4586  H HB3  . ARG A 1 7   ? -2.933  -22.345 -2.597  1.00 0.00 ? 7   ARG A HB3  4  
ATOM 4587  H HG2  . ARG A 1 7   ? -2.197  -23.462 -4.576  1.00 0.00 ? 7   ARG A HG2  4  
ATOM 4588  H HG3  . ARG A 1 7   ? -0.601  -23.770 -3.920  1.00 0.00 ? 7   ARG A HG3  4  
ATOM 4589  H HD2  . ARG A 1 7   ? -1.801  -25.231 -2.126  1.00 0.00 ? 7   ARG A HD2  4  
ATOM 4590  H HD3  . ARG A 1 7   ? -3.220  -25.122 -3.149  1.00 0.00 ? 7   ARG A HD3  4  
ATOM 4591  H HE   . ARG A 1 7   ? -0.885  -26.754 -3.637  1.00 0.00 ? 7   ARG A HE   4  
ATOM 4592  H HH11 . ARG A 1 7   ? -3.350  -24.869 -5.296  1.00 0.00 ? 7   ARG A HH11 4  
ATOM 4593  H HH12 . ARG A 1 7   ? -3.244  -25.784 -6.763  1.00 0.00 ? 7   ARG A HH12 4  
ATOM 4594  H HH21 . ARG A 1 7   ? -0.745  -27.962 -5.572  1.00 0.00 ? 7   ARG A HH21 4  
ATOM 4595  H HH22 . ARG A 1 7   ? -1.752  -27.555 -6.921  1.00 0.00 ? 7   ARG A HH22 4  
ATOM 4596  N N    . LYS A 1 8   ? -2.583  -19.929 -1.816  1.00 0.00 ? 8   LYS A N    4  
ATOM 4597  C CA   . LYS A 1 8   ? -3.465  -18.780 -1.707  1.00 0.00 ? 8   LYS A CA   4  
ATOM 4598  C C    . LYS A 1 8   ? -2.872  -17.780 -0.712  1.00 0.00 ? 8   LYS A C    4  
ATOM 4599  O O    . LYS A 1 8   ? -2.821  -18.048 0.487   1.00 0.00 ? 8   LYS A O    4  
ATOM 4600  C CB   . LYS A 1 8   ? -4.886  -19.226 -1.357  1.00 0.00 ? 8   LYS A CB   4  
ATOM 4601  C CG   . LYS A 1 8   ? -5.858  -18.044 -1.398  1.00 0.00 ? 8   LYS A CG   4  
ATOM 4602  C CD   . LYS A 1 8   ? -6.581  -17.882 -0.060  1.00 0.00 ? 8   LYS A CD   4  
ATOM 4603  C CE   . LYS A 1 8   ? -7.642  -18.968 0.126   1.00 0.00 ? 8   LYS A CE   4  
ATOM 4604  N NZ   . LYS A 1 8   ? -8.827  -18.422 0.825   1.00 0.00 ? 8   LYS A NZ   4  
ATOM 4605  H H    . LYS A 1 8   ? -2.543  -20.510 -1.003  1.00 0.00 ? 8   LYS A H    4  
ATOM 4606  H HA   . LYS A 1 8   ? -3.509  -18.306 -2.688  1.00 0.00 ? 8   LYS A HA   4  
ATOM 4607  H HB2  . LYS A 1 8   ? -5.213  -19.995 -2.056  1.00 0.00 ? 8   LYS A HB2  4  
ATOM 4608  H HB3  . LYS A 1 8   ? -4.896  -19.674 -0.363  1.00 0.00 ? 8   LYS A HB3  4  
ATOM 4609  H HG2  . LYS A 1 8   ? -5.314  -17.130 -1.635  1.00 0.00 ? 8   LYS A HG2  4  
ATOM 4610  H HG3  . LYS A 1 8   ? -6.587  -18.197 -2.194  1.00 0.00 ? 8   LYS A HG3  4  
ATOM 4611  H HD2  . LYS A 1 8   ? -5.859  -17.930 0.756   1.00 0.00 ? 8   LYS A HD2  4  
ATOM 4612  H HD3  . LYS A 1 8   ? -7.049  -16.899 -0.012  1.00 0.00 ? 8   LYS A HD3  4  
ATOM 4613  H HE2  . LYS A 1 8   ? -7.937  -19.367 -0.845  1.00 0.00 ? 8   LYS A HE2  4  
ATOM 4614  H HE3  . LYS A 1 8   ? -7.226  -19.798 0.697   1.00 0.00 ? 8   LYS A HE3  4  
ATOM 4615  H HZ1  . LYS A 1 8   ? -8.884  -18.817 1.742   1.00 0.00 ? 8   LYS A HZ1  4  
ATOM 4616  H HZ2  . LYS A 1 8   ? -8.743  -17.428 0.895   1.00 0.00 ? 8   LYS A HZ2  4  
ATOM 4617  H HZ3  . LYS A 1 8   ? -9.653  -18.651 0.310   1.00 0.00 ? 8   LYS A HZ3  4  
ATOM 4618  N N    . GLU A 1 9   ? -2.438  -16.648 -1.247  1.00 0.00 ? 9   GLU A N    4  
ATOM 4619  C CA   . GLU A 1 9   ? -1.850  -15.607 -0.421  1.00 0.00 ? 9   GLU A CA   4  
ATOM 4620  C C    . GLU A 1 9   ? -1.937  -14.254 -1.131  1.00 0.00 ? 9   GLU A C    4  
ATOM 4621  O O    . GLU A 1 9   ? -2.303  -14.187 -2.303  1.00 0.00 ? 9   GLU A O    4  
ATOM 4622  C CB   . GLU A 1 9   ? -0.402  -15.945 -0.061  1.00 0.00 ? 9   GLU A CB   4  
ATOM 4623  C CG   . GLU A 1 9   ? -0.280  -16.337 1.413   1.00 0.00 ? 9   GLU A CG   4  
ATOM 4624  C CD   . GLU A 1 9   ? 0.702   -17.496 1.593   1.00 0.00 ? 9   GLU A CD   4  
ATOM 4625  O OE1  . GLU A 1 9   ? 1.915   -17.205 1.670   1.00 0.00 ? 9   GLU A OE1  4  
ATOM 4626  O OE2  . GLU A 1 9   ? 0.217   -18.647 1.650   1.00 0.00 ? 9   GLU A OE2  4  
ATOM 4627  H H    . GLU A 1 9   ? -2.483  -16.438 -2.224  1.00 0.00 ? 9   GLU A H    4  
ATOM 4628  H HA   . GLU A 1 9   ? -2.449  -15.587 0.489   1.00 0.00 ? 9   GLU A HA   4  
ATOM 4629  H HB2  . GLU A 1 9   ? -0.049  -16.764 -0.689  1.00 0.00 ? 9   GLU A HB2  4  
ATOM 4630  H HB3  . GLU A 1 9   ? 0.238   -15.087 -0.267  1.00 0.00 ? 9   GLU A HB3  4  
ATOM 4631  H HG2  . GLU A 1 9   ? 0.055   -15.478 1.994   1.00 0.00 ? 9   GLU A HG2  4  
ATOM 4632  H HG3  . GLU A 1 9   ? -1.259  -16.621 1.799   1.00 0.00 ? 9   GLU A HG3  4  
ATOM 4633  N N    . PRO A 1 10  ? -1.585  -13.183 -0.370  1.00 0.00 ? 10  PRO A N    4  
ATOM 4634  C CA   . PRO A 1 10  ? -1.620  -11.836 -0.914  1.00 0.00 ? 10  PRO A CA   4  
ATOM 4635  C C    . PRO A 1 10  ? -0.442  -11.595 -1.859  1.00 0.00 ? 10  PRO A C    4  
ATOM 4636  O O    . PRO A 1 10  ? 0.209   -12.542 -2.300  1.00 0.00 ? 10  PRO A O    4  
ATOM 4637  C CB   . PRO A 1 10  ? -1.604  -10.921 0.300   1.00 0.00 ? 10  PRO A CB   4  
ATOM 4638  C CG   . PRO A 1 10  ? -1.094  -11.769 1.454   1.00 0.00 ? 10  PRO A CG   4  
ATOM 4639  C CD   . PRO A 1 10  ? -1.147  -13.225 1.022   1.00 0.00 ? 10  PRO A CD   4  
ATOM 4640  H HA   . PRO A 1 10  ? -2.444  -11.705 -1.465  1.00 0.00 ? 10  PRO A HA   4  
ATOM 4641  H HB2  . PRO A 1 10  ? -0.957  -10.060 0.132   1.00 0.00 ? 10  PRO A HB2  4  
ATOM 4642  H HB3  . PRO A 1 10  ? -2.601  -10.534 0.511   1.00 0.00 ? 10  PRO A HB3  4  
ATOM 4643  H HG2  . PRO A 1 10  ? -0.074  -11.485 1.714   1.00 0.00 ? 10  PRO A HG2  4  
ATOM 4644  H HG3  . PRO A 1 10  ? -1.705  -11.612 2.343   1.00 0.00 ? 10  PRO A HG3  4  
ATOM 4645  H HD2  . PRO A 1 10  ? -0.171  -13.702 1.115   1.00 0.00 ? 10  PRO A HD2  4  
ATOM 4646  H HD3  . PRO A 1 10  ? -1.841  -13.796 1.638   1.00 0.00 ? 10  PRO A HD3  4  
ATOM 4647  N N    . GLU A 1 11  ? -0.202  -10.323 -2.144  1.00 0.00 ? 11  GLU A N    4  
ATOM 4648  C CA   . GLU A 1 11  ? 0.887   -9.947  -3.029  1.00 0.00 ? 11  GLU A CA   4  
ATOM 4649  C C    . GLU A 1 11  ? 0.596   -8.593  -3.681  1.00 0.00 ? 11  GLU A C    4  
ATOM 4650  O O    . GLU A 1 11  ? 0.986   -7.551  -3.156  1.00 0.00 ? 11  GLU A O    4  
ATOM 4651  C CB   . GLU A 1 11  ? 1.131   -11.024 -4.087  1.00 0.00 ? 11  GLU A CB   4  
ATOM 4652  C CG   . GLU A 1 11  ? 2.285   -11.941 -3.679  1.00 0.00 ? 11  GLU A CG   4  
ATOM 4653  C CD   . GLU A 1 11  ? 3.493   -11.744 -4.598  1.00 0.00 ? 11  GLU A CD   4  
ATOM 4654  O OE1  . GLU A 1 11  ? 3.874   -10.569 -4.790  1.00 0.00 ? 11  GLU A OE1  4  
ATOM 4655  O OE2  . GLU A 1 11  ? 4.008   -12.773 -5.087  1.00 0.00 ? 11  GLU A OE2  4  
ATOM 4656  H H    . GLU A 1 11  ? -0.736  -9.560  -1.781  1.00 0.00 ? 11  GLU A H    4  
ATOM 4657  H HA   . GLU A 1 11  ? 1.766   -9.868  -2.389  1.00 0.00 ? 11  GLU A HA   4  
ATOM 4658  H HB2  . GLU A 1 11  ? 0.225   -11.614 -4.227  1.00 0.00 ? 11  GLU A HB2  4  
ATOM 4659  H HB3  . GLU A 1 11  ? 1.356   -10.554 -5.045  1.00 0.00 ? 11  GLU A HB3  4  
ATOM 4660  H HG2  . GLU A 1 11  ? 2.571   -11.736 -2.648  1.00 0.00 ? 11  GLU A HG2  4  
ATOM 4661  H HG3  . GLU A 1 11  ? 1.960   -12.981 -3.719  1.00 0.00 ? 11  GLU A HG3  4  
ATOM 4662  N N    . ILE A 1 12  ? -0.085  -8.653  -4.815  1.00 0.00 ? 12  ILE A N    4  
ATOM 4663  C CA   . ILE A 1 12  ? -0.432  -7.445  -5.544  1.00 0.00 ? 12  ILE A CA   4  
ATOM 4664  C C    . ILE A 1 12  ? -1.894  -7.088  -5.265  1.00 0.00 ? 12  ILE A C    4  
ATOM 4665  O O    . ILE A 1 12  ? -2.629  -7.880  -4.678  1.00 0.00 ? 12  ILE A O    4  
ATOM 4666  C CB   . ILE A 1 12  ? -0.112  -7.606  -7.032  1.00 0.00 ? 12  ILE A CB   4  
ATOM 4667  C CG1  . ILE A 1 12  ? -1.143  -8.502  -7.721  1.00 0.00 ? 12  ILE A CG1  4  
ATOM 4668  C CG2  . ILE A 1 12  ? 1.317   -8.117  -7.232  1.00 0.00 ? 12  ILE A CG2  4  
ATOM 4669  C CD1  . ILE A 1 12  ? -1.044  -8.380  -9.243  1.00 0.00 ? 12  ILE A CD1  4  
ATOM 4670  H H    . ILE A 1 12  ? -0.399  -9.505  -5.235  1.00 0.00 ? 12  ILE A H    4  
ATOM 4671  H HA   . ILE A 1 12  ? 0.198   -6.641  -5.164  1.00 0.00 ? 12  ILE A HA   4  
ATOM 4672  H HB   . ILE A 1 12  ? -0.171  -6.625  -7.502  1.00 0.00 ? 12  ILE A HB   4  
ATOM 4673  H HG12 . ILE A 1 12  ? -0.985  -9.539  -7.424  1.00 0.00 ? 12  ILE A HG12 4  
ATOM 4674  H HG13 . ILE A 1 12  ? -2.146  -8.226  -7.395  1.00 0.00 ? 12  ILE A HG13 4  
ATOM 4675  H HG21 . ILE A 1 12  ? 1.889   -7.966  -6.317  1.00 0.00 ? 12  ILE A HG21 4  
ATOM 4676  H HG22 . ILE A 1 12  ? 1.292   -9.180  -7.474  1.00 0.00 ? 12  ILE A HG22 4  
ATOM 4677  H HG23 . ILE A 1 12  ? 1.787   -7.569  -8.049  1.00 0.00 ? 12  ILE A HG23 4  
ATOM 4678  H HD11 . ILE A 1 12  ? -1.171  -7.337  -9.533  1.00 0.00 ? 12  ILE A HD11 4  
ATOM 4679  H HD12 . ILE A 1 12  ? -0.067  -8.733  -9.573  1.00 0.00 ? 12  ILE A HD12 4  
ATOM 4680  H HD13 . ILE A 1 12  ? -1.825  -8.984  -9.707  1.00 0.00 ? 12  ILE A HD13 4  
ATOM 4681  N N    . ILE A 1 13  ? -2.271  -5.895  -5.700  1.00 0.00 ? 13  ILE A N    4  
ATOM 4682  C CA   . ILE A 1 13  ? -3.632  -5.423  -5.504  1.00 0.00 ? 13  ILE A CA   4  
ATOM 4683  C C    . ILE A 1 13  ? -3.863  -4.177  -6.362  1.00 0.00 ? 13  ILE A C    4  
ATOM 4684  O O    . ILE A 1 13  ? -3.086  -3.226  -6.303  1.00 0.00 ? 13  ILE A O    4  
ATOM 4685  C CB   . ILE A 1 13  ? -3.915  -5.207  -4.017  1.00 0.00 ? 13  ILE A CB   4  
ATOM 4686  C CG1  . ILE A 1 13  ? -5.362  -5.572  -3.675  1.00 0.00 ? 13  ILE A CG1  4  
ATOM 4687  C CG2  . ILE A 1 13  ? -3.570  -3.778  -3.594  1.00 0.00 ? 13  ILE A CG2  4  
ATOM 4688  C CD1  . ILE A 1 13  ? -5.567  -7.088  -3.708  1.00 0.00 ? 13  ILE A CD1  4  
ATOM 4689  H H    . ILE A 1 13  ? -1.667  -5.256  -6.177  1.00 0.00 ? 13  ILE A H    4  
ATOM 4690  H HA   . ILE A 1 13  ? -4.303  -6.210  -5.850  1.00 0.00 ? 13  ILE A HA   4  
ATOM 4691  H HB   . ILE A 1 13  ? -3.271  -5.876  -3.445  1.00 0.00 ? 13  ILE A HB   4  
ATOM 4692  H HG12 . ILE A 1 13  ? -5.614  -5.189  -2.687  1.00 0.00 ? 13  ILE A HG12 4  
ATOM 4693  H HG13 . ILE A 1 13  ? -6.038  -5.095  -4.384  1.00 0.00 ? 13  ILE A HG13 4  
ATOM 4694  H HG21 . ILE A 1 13  ? -2.489  -3.645  -3.612  1.00 0.00 ? 13  ILE A HG21 4  
ATOM 4695  H HG22 . ILE A 1 13  ? -4.034  -3.073  -4.285  1.00 0.00 ? 13  ILE A HG22 4  
ATOM 4696  H HG23 . ILE A 1 13  ? -3.942  -3.597  -2.586  1.00 0.00 ? 13  ILE A HG23 4  
ATOM 4697  H HD11 . ILE A 1 13  ? -5.465  -7.490  -2.700  1.00 0.00 ? 13  ILE A HD11 4  
ATOM 4698  H HD12 . ILE A 1 13  ? -6.563  -7.312  -4.090  1.00 0.00 ? 13  ILE A HD12 4  
ATOM 4699  H HD13 . ILE A 1 13  ? -4.818  -7.542  -4.358  1.00 0.00 ? 13  ILE A HD13 4  
ATOM 4700  N N    . THR A 1 14  ? -4.936  -4.223  -7.138  1.00 0.00 ? 14  THR A N    4  
ATOM 4701  C CA   . THR A 1 14  ? -5.280  -3.110  -8.006  1.00 0.00 ? 14  THR A CA   4  
ATOM 4702  C C    . THR A 1 14  ? -6.789  -2.861  -7.983  1.00 0.00 ? 14  THR A C    4  
ATOM 4703  O O    . THR A 1 14  ? -7.578  -3.802  -8.060  1.00 0.00 ? 14  THR A O    4  
ATOM 4704  C CB   . THR A 1 14  ? -4.736  -3.414  -9.403  1.00 0.00 ? 14  THR A CB   4  
ATOM 4705  O OG1  . THR A 1 14  ? -3.365  -3.733  -9.180  1.00 0.00 ? 14  THR A OG1  4  
ATOM 4706  C CG2  . THR A 1 14  ? -4.689  -2.173  -10.297 1.00 0.00 ? 14  THR A CG2  4  
ATOM 4707  H H    . THR A 1 14  ? -5.564  -5.001  -7.179  1.00 0.00 ? 14  THR A H    4  
ATOM 4708  H HA   . THR A 1 14  ? -4.802  -2.211  -7.617  1.00 0.00 ? 14  THR A HA   4  
ATOM 4709  H HB   . THR A 1 14  ? -5.305  -4.214  -9.877  1.00 0.00 ? 14  THR A HB   4  
ATOM 4710  H HG1  . THR A 1 14  ? -2.955  -3.064  -8.561  1.00 0.00 ? 14  THR A HG1  4  
ATOM 4711  H HG21 . THR A 1 14  ? -4.373  -1.313  -9.708  1.00 0.00 ? 14  THR A HG21 4  
ATOM 4712  H HG22 . THR A 1 14  ? -3.982  -2.337  -11.110 1.00 0.00 ? 14  THR A HG22 4  
ATOM 4713  H HG23 . THR A 1 14  ? -5.680  -1.986  -10.710 1.00 0.00 ? 14  THR A HG23 4  
ATOM 4714  N N    . VAL A 1 15  ? -7.146  -1.590  -7.876  1.00 0.00 ? 15  VAL A N    4  
ATOM 4715  C CA   . VAL A 1 15  ? -8.547  -1.206  -7.841  1.00 0.00 ? 15  VAL A CA   4  
ATOM 4716  C C    . VAL A 1 15  ? -8.704  0.189   -8.450  1.00 0.00 ? 15  VAL A C    4  
ATOM 4717  O O    . VAL A 1 15  ? -7.830  1.040   -8.294  1.00 0.00 ? 15  VAL A O    4  
ATOM 4718  C CB   . VAL A 1 15  ? -9.079  -1.297  -6.410  1.00 0.00 ? 15  VAL A CB   4  
ATOM 4719  C CG1  . VAL A 1 15  ? -8.490  -0.190  -5.534  1.00 0.00 ? 15  VAL A CG1  4  
ATOM 4720  C CG2  . VAL A 1 15  ? -10.609 -1.257  -6.390  1.00 0.00 ? 15  VAL A CG2  4  
ATOM 4721  H H    . VAL A 1 15  ? -6.498  -0.831  -7.814  1.00 0.00 ? 15  VAL A H    4  
ATOM 4722  H HA   . VAL A 1 15  ? -9.099  -1.920  -8.453  1.00 0.00 ? 15  VAL A HA   4  
ATOM 4723  H HB   . VAL A 1 15  ? -8.764  -2.255  -5.996  1.00 0.00 ? 15  VAL A HB   4  
ATOM 4724  H HG11 . VAL A 1 15  ? -9.099  0.710   -5.628  1.00 0.00 ? 15  VAL A HG11 4  
ATOM 4725  H HG12 . VAL A 1 15  ? -8.481  -0.515  -4.494  1.00 0.00 ? 15  VAL A HG12 4  
ATOM 4726  H HG13 . VAL A 1 15  ? -7.472  0.026   -5.857  1.00 0.00 ? 15  VAL A HG13 4  
ATOM 4727  H HG21 . VAL A 1 15  ? -10.944 -0.221  -6.356  1.00 0.00 ? 15  VAL A HG21 4  
ATOM 4728  H HG22 . VAL A 1 15  ? -10.996 -1.735  -7.290  1.00 0.00 ? 15  VAL A HG22 4  
ATOM 4729  H HG23 . VAL A 1 15  ? -10.975 -1.787  -5.511  1.00 0.00 ? 15  VAL A HG23 4  
ATOM 4730  N N    . THR A 1 16  ? -9.825  0.380   -9.130  1.00 0.00 ? 16  THR A N    4  
ATOM 4731  C CA   . THR A 1 16  ? -10.108 1.657   -9.763  1.00 0.00 ? 16  THR A CA   4  
ATOM 4732  C C    . THR A 1 16  ? -10.569 2.678   -8.720  1.00 0.00 ? 16  THR A C    4  
ATOM 4733  O O    . THR A 1 16  ? -11.585 2.478   -8.057  1.00 0.00 ? 16  THR A O    4  
ATOM 4734  C CB   . THR A 1 16  ? -11.132 1.418   -10.874 1.00 0.00 ? 16  THR A CB   4  
ATOM 4735  O OG1  . THR A 1 16  ? -12.300 0.984   -10.182 1.00 0.00 ? 16  THR A OG1  4  
ATOM 4736  C CG2  . THR A 1 16  ? -10.763 0.230   -11.764 1.00 0.00 ? 16  THR A CG2  4  
ATOM 4737  H H    . THR A 1 16  ? -10.531 -0.317  -9.252  1.00 0.00 ? 16  THR A H    4  
ATOM 4738  H HA   . THR A 1 16  ? -9.183  2.038   -10.196 1.00 0.00 ? 16  THR A HA   4  
ATOM 4739  H HB   . THR A 1 16  ? -11.279 2.320   -11.468 1.00 0.00 ? 16  THR A HB   4  
ATOM 4740  H HG1  . THR A 1 16  ? -12.236 0.006   -9.984  1.00 0.00 ? 16  THR A HG1  4  
ATOM 4741  H HG21 . THR A 1 16  ? -11.573 0.038   -12.468 1.00 0.00 ? 16  THR A HG21 4  
ATOM 4742  H HG22 . THR A 1 16  ? -9.850  0.458   -12.315 1.00 0.00 ? 16  THR A HG22 4  
ATOM 4743  H HG23 . THR A 1 16  ? -10.603 -0.652  -11.145 1.00 0.00 ? 16  THR A HG23 4  
ATOM 4744  N N    . LEU A 1 17  ? -9.799  3.751   -8.609  1.00 0.00 ? 17  LEU A N    4  
ATOM 4745  C CA   . LEU A 1 17  ? -10.116 4.803   -7.658  1.00 0.00 ? 17  LEU A CA   4  
ATOM 4746  C C    . LEU A 1 17  ? -11.326 5.592   -8.162  1.00 0.00 ? 17  LEU A C    4  
ATOM 4747  O O    . LEU A 1 17  ? -12.192 5.041   -8.840  1.00 0.00 ? 17  LEU A O    4  
ATOM 4748  C CB   . LEU A 1 17  ? -8.885  5.671   -7.390  1.00 0.00 ? 17  LEU A CB   4  
ATOM 4749  C CG   . LEU A 1 17  ? -8.851  6.387   -6.038  1.00 0.00 ? 17  LEU A CG   4  
ATOM 4750  C CD1  . LEU A 1 17  ? -8.642  7.892   -6.220  1.00 0.00 ? 17  LEU A CD1  4  
ATOM 4751  C CD2  . LEU A 1 17  ? -10.107 6.078   -5.222  1.00 0.00 ? 17  LEU A CD2  4  
ATOM 4752  H H    . LEU A 1 17  ? -8.974  3.906   -9.152  1.00 0.00 ? 17  LEU A H    4  
ATOM 4753  H HA   . LEU A 1 17  ? -10.383 4.324   -6.717  1.00 0.00 ? 17  LEU A HA   4  
ATOM 4754  H HB2  . LEU A 1 17  ? -7.998  5.043   -7.468  1.00 0.00 ? 17  LEU A HB2  4  
ATOM 4755  H HB3  . LEU A 1 17  ? -8.815  6.421   -8.178  1.00 0.00 ? 17  LEU A HB3  4  
ATOM 4756  H HG   . LEU A 1 17  ? -7.998  6.010   -5.473  1.00 0.00 ? 17  LEU A HG   4  
ATOM 4757  H HD11 . LEU A 1 17  ? -9.579  8.415   -6.028  1.00 0.00 ? 17  LEU A HD11 4  
ATOM 4758  H HD12 . LEU A 1 17  ? -7.881  8.240   -5.521  1.00 0.00 ? 17  LEU A HD12 4  
ATOM 4759  H HD13 . LEU A 1 17  ? -8.316  8.093   -7.241  1.00 0.00 ? 17  LEU A HD13 4  
ATOM 4760  H HD21 . LEU A 1 17  ? -9.958  5.154   -4.663  1.00 0.00 ? 17  LEU A HD21 4  
ATOM 4761  H HD22 . LEU A 1 17  ? -10.300 6.895   -4.527  1.00 0.00 ? 17  LEU A HD22 4  
ATOM 4762  H HD23 . LEU A 1 17  ? -10.958 5.963   -5.894  1.00 0.00 ? 17  LEU A HD23 4  
ATOM 4763  N N    . LYS A 1 18  ? -11.348 6.869   -7.811  1.00 0.00 ? 18  LYS A N    4  
ATOM 4764  C CA   . LYS A 1 18  ? -12.438 7.739   -8.219  1.00 0.00 ? 18  LYS A CA   4  
ATOM 4765  C C    . LYS A 1 18  ? -13.765 7.144   -7.743  1.00 0.00 ? 18  LYS A C    4  
ATOM 4766  O O    . LYS A 1 18  ? -14.831 7.542   -8.211  1.00 0.00 ? 18  LYS A O    4  
ATOM 4767  C CB   . LYS A 1 18  ? -12.384 7.994   -9.726  1.00 0.00 ? 18  LYS A CB   4  
ATOM 4768  C CG   . LYS A 1 18  ? -12.132 9.474   -10.023 1.00 0.00 ? 18  LYS A CG   4  
ATOM 4769  C CD   . LYS A 1 18  ? -12.248 9.760   -11.522 1.00 0.00 ? 18  LYS A CD   4  
ATOM 4770  C CE   . LYS A 1 18  ? -13.244 10.891  -11.788 1.00 0.00 ? 18  LYS A CE   4  
ATOM 4771  N NZ   . LYS A 1 18  ? -14.614 10.351  -11.934 1.00 0.00 ? 18  LYS A NZ   4  
ATOM 4772  H H    . LYS A 1 18  ? -10.640 7.310   -7.259  1.00 0.00 ? 18  LYS A H    4  
ATOM 4773  H HA   . LYS A 1 18  ? -12.293 8.699   -7.724  1.00 0.00 ? 18  LYS A HA   4  
ATOM 4774  H HB2  . LYS A 1 18  ? -11.595 7.390   -10.174 1.00 0.00 ? 18  LYS A HB2  4  
ATOM 4775  H HB3  . LYS A 1 18  ? -13.322 7.683   -10.185 1.00 0.00 ? 18  LYS A HB3  4  
ATOM 4776  H HG2  . LYS A 1 18  ? -12.849 10.086  -9.476  1.00 0.00 ? 18  LYS A HG2  4  
ATOM 4777  H HG3  . LYS A 1 18  ? -11.139 9.755   -9.671  1.00 0.00 ? 18  LYS A HG3  4  
ATOM 4778  H HD2  . LYS A 1 18  ? -11.270 10.031  -11.921 1.00 0.00 ? 18  LYS A HD2  4  
ATOM 4779  H HD3  . LYS A 1 18  ? -12.568 8.859   -12.044 1.00 0.00 ? 18  LYS A HD3  4  
ATOM 4780  H HE2  . LYS A 1 18  ? -13.215 11.609  -10.969 1.00 0.00 ? 18  LYS A HE2  4  
ATOM 4781  H HE3  . LYS A 1 18  ? -12.960 11.428  -12.693 1.00 0.00 ? 18  LYS A HE3  4  
ATOM 4782  H HZ1  . LYS A 1 18  ? -14.581 9.351   -11.931 1.00 0.00 ? 18  LYS A HZ1  4  
ATOM 4783  H HZ2  . LYS A 1 18  ? -15.180 10.667  -11.172 1.00 0.00 ? 18  LYS A HZ2  4  
ATOM 4784  H HZ3  . LYS A 1 18  ? -15.008 10.669  -12.796 1.00 0.00 ? 18  LYS A HZ3  4  
ATOM 4785  N N    . LYS A 1 19  ? -13.656 6.201   -6.819  1.00 0.00 ? 19  LYS A N    4  
ATOM 4786  C CA   . LYS A 1 19  ? -14.834 5.547   -6.274  1.00 0.00 ? 19  LYS A CA   4  
ATOM 4787  C C    . LYS A 1 19  ? -15.530 6.493   -5.294  1.00 0.00 ? 19  LYS A C    4  
ATOM 4788  O O    . LYS A 1 19  ? -16.340 7.326   -5.698  1.00 0.00 ? 19  LYS A O    4  
ATOM 4789  C CB   . LYS A 1 19  ? -14.463 4.194   -5.665  1.00 0.00 ? 19  LYS A CB   4  
ATOM 4790  C CG   . LYS A 1 19  ? -14.337 3.121   -6.748  1.00 0.00 ? 19  LYS A CG   4  
ATOM 4791  C CD   . LYS A 1 19  ? -14.212 1.728   -6.127  1.00 0.00 ? 19  LYS A CD   4  
ATOM 4792  C CE   . LYS A 1 19  ? -15.401 0.847   -6.514  1.00 0.00 ? 19  LYS A CE   4  
ATOM 4793  N NZ   . LYS A 1 19  ? -16.024 0.257   -5.308  1.00 0.00 ? 19  LYS A NZ   4  
ATOM 4794  H H    . LYS A 1 19  ? -12.786 5.883   -6.444  1.00 0.00 ? 19  LYS A H    4  
ATOM 4795  H HA   . LYS A 1 19  ? -15.512 5.351   -7.105  1.00 0.00 ? 19  LYS A HA   4  
ATOM 4796  H HB2  . LYS A 1 19  ? -13.521 4.281   -5.123  1.00 0.00 ? 19  LYS A HB2  4  
ATOM 4797  H HB3  . LYS A 1 19  ? -15.221 3.897   -4.940  1.00 0.00 ? 19  LYS A HB3  4  
ATOM 4798  H HG2  . LYS A 1 19  ? -15.208 3.155   -7.401  1.00 0.00 ? 19  LYS A HG2  4  
ATOM 4799  H HG3  . LYS A 1 19  ? -13.465 3.326   -7.368  1.00 0.00 ? 19  LYS A HG3  4  
ATOM 4800  H HD2  . LYS A 1 19  ? -13.285 1.260   -6.458  1.00 0.00 ? 19  LYS A HD2  4  
ATOM 4801  H HD3  . LYS A 1 19  ? -14.156 1.813   -5.042  1.00 0.00 ? 19  LYS A HD3  4  
ATOM 4802  H HE2  . LYS A 1 19  ? -16.138 1.438   -7.059  1.00 0.00 ? 19  LYS A HE2  4  
ATOM 4803  H HE3  . LYS A 1 19  ? -15.071 0.053   -7.185  1.00 0.00 ? 19  LYS A HE3  4  
ATOM 4804  H HZ1  . LYS A 1 19  ? -15.673 -0.670  -5.171  1.00 0.00 ? 19  LYS A HZ1  4  
ATOM 4805  H HZ2  . LYS A 1 19  ? -15.803 0.818   -4.511  1.00 0.00 ? 19  LYS A HZ2  4  
ATOM 4806  H HZ3  . LYS A 1 19  ? -17.016 0.223   -5.428  1.00 0.00 ? 19  LYS A HZ3  4  
ATOM 4807  N N    . GLN A 1 20  ? -15.189 6.333   -4.024  1.00 0.00 ? 20  GLN A N    4  
ATOM 4808  C CA   . GLN A 1 20  ? -15.771 7.163   -2.982  1.00 0.00 ? 20  GLN A CA   4  
ATOM 4809  C C    . GLN A 1 20  ? -15.241 8.595   -3.086  1.00 0.00 ? 20  GLN A C    4  
ATOM 4810  O O    . GLN A 1 20  ? -15.964 9.550   -2.807  1.00 0.00 ? 20  GLN A O    4  
ATOM 4811  C CB   . GLN A 1 20  ? -15.496 6.576   -1.596  1.00 0.00 ? 20  GLN A CB   4  
ATOM 4812  C CG   . GLN A 1 20  ? -16.535 7.057   -0.581  1.00 0.00 ? 20  GLN A CG   4  
ATOM 4813  C CD   . GLN A 1 20  ? -15.978 8.195   0.277   1.00 0.00 ? 20  GLN A CD   4  
ATOM 4814  O OE1  . GLN A 1 20  ? -15.129 8.965   -0.142  1.00 0.00 ? 20  GLN A OE1  4  
ATOM 4815  N NE2  . GLN A 1 20  ? -16.500 8.256   1.498   1.00 0.00 ? 20  GLN A NE2  4  
ATOM 4816  H H    . GLN A 1 20  ? -14.529 5.653   -3.703  1.00 0.00 ? 20  GLN A H    4  
ATOM 4817  H HA   . GLN A 1 20  ? -16.844 7.151   -3.169  1.00 0.00 ? 20  GLN A HA   4  
ATOM 4818  H HB2  . GLN A 1 20  ? -15.511 5.487   -1.649  1.00 0.00 ? 20  GLN A HB2  4  
ATOM 4819  H HB3  . GLN A 1 20  ? -14.499 6.865   -1.266  1.00 0.00 ? 20  GLN A HB3  4  
ATOM 4820  H HG2  . GLN A 1 20  ? -17.430 7.396   -1.104  1.00 0.00 ? 20  GLN A HG2  4  
ATOM 4821  H HG3  . GLN A 1 20  ? -16.835 6.227   0.058   1.00 0.00 ? 20  GLN A HG3  4  
ATOM 4822  H HE21 . GLN A 1 20  ? -17.193 7.593   1.780   1.00 0.00 ? 20  GLN A HE21 4  
ATOM 4823  H HE22 . GLN A 1 20  ? -16.199 8.966   2.135   1.00 0.00 ? 20  GLN A HE22 4  
ATOM 4824  N N    . ASN A 1 21  ? -13.983 8.698   -3.489  1.00 0.00 ? 21  ASN A N    4  
ATOM 4825  C CA   . ASN A 1 21  ? -13.348 9.997   -3.633  1.00 0.00 ? 21  ASN A CA   4  
ATOM 4826  C C    . ASN A 1 21  ? -11.828 9.824   -3.595  1.00 0.00 ? 21  ASN A C    4  
ATOM 4827  O O    . ASN A 1 21  ? -11.103 10.512  -4.312  1.00 0.00 ? 21  ASN A O    4  
ATOM 4828  C CB   . ASN A 1 21  ? -13.745 10.934  -2.491  1.00 0.00 ? 21  ASN A CB   4  
ATOM 4829  C CG   . ASN A 1 21  ? -14.669 12.047  -2.991  1.00 0.00 ? 21  ASN A CG   4  
ATOM 4830  O OD1  . ASN A 1 21  ? -14.723 12.362  -4.169  1.00 0.00 ? 21  ASN A OD1  4  
ATOM 4831  N ND2  . ASN A 1 21  ? -15.391 12.622  -2.034  1.00 0.00 ? 21  ASN A ND2  4  
ATOM 4832  H H    . ASN A 1 21  ? -13.402 7.916   -3.714  1.00 0.00 ? 21  ASN A H    4  
ATOM 4833  H HA   . ASN A 1 21  ? -13.700 10.383  -4.590  1.00 0.00 ? 21  ASN A HA   4  
ATOM 4834  H HB2  . ASN A 1 21  ? -14.246 10.366  -1.707  1.00 0.00 ? 21  ASN A HB2  4  
ATOM 4835  H HB3  . ASN A 1 21  ? -12.851 11.372  -2.047  1.00 0.00 ? 21  ASN A HB3  4  
ATOM 4836  H HD21 . ASN A 1 21  ? -15.300 12.315  -1.086  1.00 0.00 ? 21  ASN A HD21 4  
ATOM 4837  H HD22 . ASN A 1 21  ? -16.026 13.360  -2.261  1.00 0.00 ? 21  ASN A HD22 4  
ATOM 4838  N N    . GLY A 1 22  ? -11.390 8.901   -2.752  1.00 0.00 ? 22  GLY A N    4  
ATOM 4839  C CA   . GLY A 1 22  ? -9.970  8.629   -2.611  1.00 0.00 ? 22  GLY A CA   4  
ATOM 4840  C C    . GLY A 1 22  ? -9.724  7.156   -2.278  1.00 0.00 ? 22  GLY A C    4  
ATOM 4841  O O    . GLY A 1 22  ? -10.593 6.313   -2.496  1.00 0.00 ? 22  GLY A O    4  
ATOM 4842  H H    . GLY A 1 22  ? -11.987 8.345   -2.172  1.00 0.00 ? 22  GLY A H    4  
ATOM 4843  H HA2  . GLY A 1 22  ? -9.453  8.887   -3.535  1.00 0.00 ? 22  GLY A HA2  4  
ATOM 4844  H HA3  . GLY A 1 22  ? -9.552  9.258   -1.826  1.00 0.00 ? 22  GLY A HA3  4  
ATOM 4845  N N    . MET A 1 23  ? -8.537  6.891   -1.754  1.00 0.00 ? 23  MET A N    4  
ATOM 4846  C CA   . MET A 1 23  ? -8.166  5.534   -1.388  1.00 0.00 ? 23  MET A CA   4  
ATOM 4847  C C    . MET A 1 23  ? -8.371  5.295   0.109   1.00 0.00 ? 23  MET A C    4  
ATOM 4848  O O    . MET A 1 23  ? -8.263  4.164   0.581   1.00 0.00 ? 23  MET A O    4  
ATOM 4849  C CB   . MET A 1 23  ? -6.699  5.292   -1.747  1.00 0.00 ? 23  MET A CB   4  
ATOM 4850  C CG   . MET A 1 23  ? -5.797  6.357   -1.120  1.00 0.00 ? 23  MET A CG   4  
ATOM 4851  S SD   . MET A 1 23  ? -4.088  5.854   -1.233  1.00 0.00 ? 23  MET A SD   4  
ATOM 4852  C CE   . MET A 1 23  ? -3.836  6.002   -2.993  1.00 0.00 ? 23  MET A CE   4  
ATOM 4853  H H    . MET A 1 23  ? -7.836  7.582   -1.579  1.00 0.00 ? 23  MET A H    4  
ATOM 4854  H HA   . MET A 1 23  ? -8.828  4.885   -1.961  1.00 0.00 ? 23  MET A HA   4  
ATOM 4855  H HB2  . MET A 1 23  ? -6.395  4.303   -1.402  1.00 0.00 ? 23  MET A HB2  4  
ATOM 4856  H HB3  . MET A 1 23  ? -6.579  5.301   -2.831  1.00 0.00 ? 23  MET A HB3  4  
ATOM 4857  H HG2  . MET A 1 23  ? -5.938  7.310   -1.629  1.00 0.00 ? 23  MET A HG2  4  
ATOM 4858  H HG3  . MET A 1 23  ? -6.072  6.509   -0.076  1.00 0.00 ? 23  MET A HG3  4  
ATOM 4859  H HE1  . MET A 1 23  ? -4.485  6.784   -3.389  1.00 0.00 ? 23  MET A HE1  4  
ATOM 4860  H HE2  . MET A 1 23  ? -2.796  6.259   -3.191  1.00 0.00 ? 23  MET A HE2  4  
ATOM 4861  H HE3  . MET A 1 23  ? -4.075  5.054   -3.476  1.00 0.00 ? 23  MET A HE3  4  
ATOM 4862  N N    . GLY A 1 24  ? -8.664  6.377   0.815   1.00 0.00 ? 24  GLY A N    4  
ATOM 4863  C CA   . GLY A 1 24  ? -8.886  6.299   2.249   1.00 0.00 ? 24  GLY A CA   4  
ATOM 4864  C C    . GLY A 1 24  ? -8.087  5.149   2.865   1.00 0.00 ? 24  GLY A C    4  
ATOM 4865  O O    . GLY A 1 24  ? -8.664  4.208   3.407   1.00 0.00 ? 24  GLY A O    4  
ATOM 4866  H H    . GLY A 1 24  ? -8.751  7.293   0.423   1.00 0.00 ? 24  GLY A H    4  
ATOM 4867  H HA2  . GLY A 1 24  ? -8.597  7.240   2.717   1.00 0.00 ? 24  GLY A HA2  4  
ATOM 4868  H HA3  . GLY A 1 24  ? -9.948  6.157   2.449   1.00 0.00 ? 24  GLY A HA3  4  
ATOM 4869  N N    . LEU A 1 25  ? -6.771  5.263   2.761   1.00 0.00 ? 25  LEU A N    4  
ATOM 4870  C CA   . LEU A 1 25  ? -5.887  4.244   3.302   1.00 0.00 ? 25  LEU A CA   4  
ATOM 4871  C C    . LEU A 1 25  ? -4.917  4.891   4.292   1.00 0.00 ? 25  LEU A C    4  
ATOM 4872  O O    . LEU A 1 25  ? -4.156  5.786   3.927   1.00 0.00 ? 25  LEU A O    4  
ATOM 4873  C CB   . LEU A 1 25  ? -5.194  3.481   2.171   1.00 0.00 ? 25  LEU A CB   4  
ATOM 4874  C CG   . LEU A 1 25  ? -4.388  2.249   2.588   1.00 0.00 ? 25  LEU A CG   4  
ATOM 4875  C CD1  . LEU A 1 25  ? -3.479  1.778   1.451   1.00 0.00 ? 25  LEU A CD1  4  
ATOM 4876  C CD2  . LEU A 1 25  ? -3.606  2.516   3.875   1.00 0.00 ? 25  LEU A CD2  4  
ATOM 4877  H H    . LEU A 1 25  ? -6.309  6.032   2.319   1.00 0.00 ? 25  LEU A H    4  
ATOM 4878  H HA   . LEU A 1 25  ? -6.506  3.527   3.842   1.00 0.00 ? 25  LEU A HA   4  
ATOM 4879  H HB2  . LEU A 1 25  ? -5.952  3.169   1.452   1.00 0.00 ? 25  LEU A HB2  4  
ATOM 4880  H HB3  . LEU A 1 25  ? -4.526  4.169   1.652   1.00 0.00 ? 25  LEU A HB3  4  
ATOM 4881  H HG   . LEU A 1 25  ? -5.087  1.439   2.798   1.00 0.00 ? 25  LEU A HG   4  
ATOM 4882  H HD11 . LEU A 1 25  ? -2.590  2.407   1.413   1.00 0.00 ? 25  LEU A HD11 4  
ATOM 4883  H HD12 . LEU A 1 25  ? -3.185  0.743   1.627   1.00 0.00 ? 25  LEU A HD12 4  
ATOM 4884  H HD13 . LEU A 1 25  ? -4.015  1.848   0.505   1.00 0.00 ? 25  LEU A HD13 4  
ATOM 4885  H HD21 . LEU A 1 25  ? -4.286  2.489   4.726   1.00 0.00 ? 25  LEU A HD21 4  
ATOM 4886  H HD22 . LEU A 1 25  ? -2.839  1.751   3.999   1.00 0.00 ? 25  LEU A HD22 4  
ATOM 4887  H HD23 . LEU A 1 25  ? -3.134  3.497   3.817   1.00 0.00 ? 25  LEU A HD23 4  
ATOM 4888  N N    . SER A 1 26  ? -4.974  4.412   5.526   1.00 0.00 ? 26  SER A N    4  
ATOM 4889  C CA   . SER A 1 26  ? -4.110  4.932   6.572   1.00 0.00 ? 26  SER A CA   4  
ATOM 4890  C C    . SER A 1 26  ? -2.848  4.074   6.683   1.00 0.00 ? 26  SER A C    4  
ATOM 4891  O O    . SER A 1 26  ? -2.894  2.960   7.203   1.00 0.00 ? 26  SER A O    4  
ATOM 4892  C CB   . SER A 1 26  ? -4.839  4.979   7.916   1.00 0.00 ? 26  SER A CB   4  
ATOM 4893  O OG   . SER A 1 26  ? -4.099  5.696   8.900   1.00 0.00 ? 26  SER A OG   4  
ATOM 4894  H H    . SER A 1 26  ? -5.596  3.683   5.815   1.00 0.00 ? 26  SER A H    4  
ATOM 4895  H HA   . SER A 1 26  ? -3.858  5.945   6.260   1.00 0.00 ? 26  SER A HA   4  
ATOM 4896  H HB2  . SER A 1 26  ? -5.814  5.449   7.783   1.00 0.00 ? 26  SER A HB2  4  
ATOM 4897  H HB3  . SER A 1 26  ? -5.020  3.963   8.267   1.00 0.00 ? 26  SER A HB3  4  
ATOM 4898  H HG   . SER A 1 26  ? -4.722  6.108   9.565   1.00 0.00 ? 26  SER A HG   4  
ATOM 4899  N N    . ILE A 1 27  ? -1.751  4.625   6.186   1.00 0.00 ? 27  ILE A N    4  
ATOM 4900  C CA   . ILE A 1 27  ? -0.479  3.924   6.222   1.00 0.00 ? 27  ILE A CA   4  
ATOM 4901  C C    . ILE A 1 27  ? 0.229   4.229   7.544   1.00 0.00 ? 27  ILE A C    4  
ATOM 4902  O O    . ILE A 1 27  ? -0.234  5.062   8.322   1.00 0.00 ? 27  ILE A O    4  
ATOM 4903  C CB   . ILE A 1 27  ? 0.356   4.264   4.986   1.00 0.00 ? 27  ILE A CB   4  
ATOM 4904  C CG1  . ILE A 1 27  ? 0.878   5.700   5.054   1.00 0.00 ? 27  ILE A CG1  4  
ATOM 4905  C CG2  . ILE A 1 27  ? -0.434  4.001   3.702   1.00 0.00 ? 27  ILE A CG2  4  
ATOM 4906  C CD1  . ILE A 1 27  ? 1.961   5.941   4.001   1.00 0.00 ? 27  ILE A CD1  4  
ATOM 4907  H H    . ILE A 1 27  ? -1.722  5.531   5.764   1.00 0.00 ? 27  ILE A H    4  
ATOM 4908  H HA   . ILE A 1 27  ? -0.693  2.856   6.183   1.00 0.00 ? 27  ILE A HA   4  
ATOM 4909  H HB   . ILE A 1 27  ? 1.225   3.606   4.969   1.00 0.00 ? 27  ILE A HB   4  
ATOM 4910  H HG12 . ILE A 1 27  ? 0.055   6.398   4.900   1.00 0.00 ? 27  ILE A HG12 4  
ATOM 4911  H HG13 . ILE A 1 27  ? 1.281   5.897   6.047   1.00 0.00 ? 27  ILE A HG13 4  
ATOM 4912  H HG21 . ILE A 1 27  ? 0.258   3.800   2.884   1.00 0.00 ? 27  ILE A HG21 4  
ATOM 4913  H HG22 . ILE A 1 27  ? -1.086  3.140   3.846   1.00 0.00 ? 27  ILE A HG22 4  
ATOM 4914  H HG23 . ILE A 1 27  ? -1.037  4.877   3.461   1.00 0.00 ? 27  ILE A HG23 4  
ATOM 4915  H HD11 . ILE A 1 27  ? 2.813   6.440   4.462   1.00 0.00 ? 27  ILE A HD11 4  
ATOM 4916  H HD12 . ILE A 1 27  ? 2.282   4.986   3.585   1.00 0.00 ? 27  ILE A HD12 4  
ATOM 4917  H HD13 . ILE A 1 27  ? 1.560   6.568   3.204   1.00 0.00 ? 27  ILE A HD13 4  
ATOM 4918  N N    . VAL A 1 28  ? 1.338   3.537   7.758   1.00 0.00 ? 28  VAL A N    4  
ATOM 4919  C CA   . VAL A 1 28  ? 2.114   3.723   8.973   1.00 0.00 ? 28  VAL A CA   4  
ATOM 4920  C C    . VAL A 1 28  ? 3.560   3.293   8.720   1.00 0.00 ? 28  VAL A C    4  
ATOM 4921  O O    . VAL A 1 28  ? 3.837   2.107   8.546   1.00 0.00 ? 28  VAL A O    4  
ATOM 4922  C CB   . VAL A 1 28  ? 1.460   2.969   10.132  1.00 0.00 ? 28  VAL A CB   4  
ATOM 4923  C CG1  . VAL A 1 28  ? 2.349   1.819   10.610  1.00 0.00 ? 28  VAL A CG1  4  
ATOM 4924  C CG2  . VAL A 1 28  ? 1.125   3.918   11.285  1.00 0.00 ? 28  VAL A CG2  4  
ATOM 4925  H H    . VAL A 1 28  ? 1.707   2.861   7.121   1.00 0.00 ? 28  VAL A H    4  
ATOM 4926  H HA   . VAL A 1 28  ? 2.101   4.787   9.212   1.00 0.00 ? 28  VAL A HA   4  
ATOM 4927  H HB   . VAL A 1 28  ? 0.525   2.541   9.769   1.00 0.00 ? 28  VAL A HB   4  
ATOM 4928  H HG11 . VAL A 1 28  ? 3.353   2.194   10.807  1.00 0.00 ? 28  VAL A HG11 4  
ATOM 4929  H HG12 . VAL A 1 28  ? 1.934   1.394   11.523  1.00 0.00 ? 28  VAL A HG12 4  
ATOM 4930  H HG13 . VAL A 1 28  ? 2.394   1.050   9.838   1.00 0.00 ? 28  VAL A HG13 4  
ATOM 4931  H HG21 . VAL A 1 28  ? 1.943   4.625   11.422  1.00 0.00 ? 28  VAL A HG21 4  
ATOM 4932  H HG22 . VAL A 1 28  ? 0.209   4.463   11.053  1.00 0.00 ? 28  VAL A HG22 4  
ATOM 4933  H HG23 . VAL A 1 28  ? 0.984   3.343   12.200  1.00 0.00 ? 28  VAL A HG23 4  
ATOM 4934  N N    . ALA A 1 29  ? 4.444   4.280   8.708   1.00 0.00 ? 29  ALA A N    4  
ATOM 4935  C CA   . ALA A 1 29  ? 5.855   4.018   8.480   1.00 0.00 ? 29  ALA A CA   4  
ATOM 4936  C C    . ALA A 1 29  ? 6.548   5.315   8.057   1.00 0.00 ? 29  ALA A C    4  
ATOM 4937  O O    . ALA A 1 29  ? 5.951   6.389   8.115   1.00 0.00 ? 29  ALA A O    4  
ATOM 4938  C CB   . ALA A 1 29  ? 6.006   2.909   7.436   1.00 0.00 ? 29  ALA A CB   4  
ATOM 4939  H H    . ALA A 1 29  ? 4.210   5.242   8.851   1.00 0.00 ? 29  ALA A H    4  
ATOM 4940  H HA   . ALA A 1 29  ? 6.285   3.676   9.421   1.00 0.00 ? 29  ALA A HA   4  
ATOM 4941  H HB1  . ALA A 1 29  ? 5.928   1.938   7.925   1.00 0.00 ? 29  ALA A HB1  4  
ATOM 4942  H HB2  . ALA A 1 29  ? 5.219   3.004   6.689   1.00 0.00 ? 29  ALA A HB2  4  
ATOM 4943  H HB3  . ALA A 1 29  ? 6.979   2.996   6.953   1.00 0.00 ? 29  ALA A HB3  4  
ATOM 4944  N N    . ALA A 1 30  ? 7.797   5.172   7.640   1.00 0.00 ? 30  ALA A N    4  
ATOM 4945  C CA   . ALA A 1 30  ? 8.577   6.319   7.208   1.00 0.00 ? 30  ALA A CA   4  
ATOM 4946  C C    . ALA A 1 30  ? 10.062  5.949   7.205   1.00 0.00 ? 30  ALA A C    4  
ATOM 4947  O O    . ALA A 1 30  ? 10.580  5.439   8.198   1.00 0.00 ? 30  ALA A O    4  
ATOM 4948  C CB   . ALA A 1 30  ? 8.276   7.514   8.115   1.00 0.00 ? 30  ALA A CB   4  
ATOM 4949  H H    . ALA A 1 30  ? 8.275   4.295   7.596   1.00 0.00 ? 30  ALA A H    4  
ATOM 4950  H HA   . ALA A 1 30  ? 8.271   6.565   6.191   1.00 0.00 ? 30  ALA A HA   4  
ATOM 4951  H HB1  . ALA A 1 30  ? 7.664   8.236   7.574   1.00 0.00 ? 30  ALA A HB1  4  
ATOM 4952  H HB2  . ALA A 1 30  ? 7.737   7.172   8.999   1.00 0.00 ? 30  ALA A HB2  4  
ATOM 4953  H HB3  . ALA A 1 30  ? 9.211   7.984   8.419   1.00 0.00 ? 30  ALA A HB3  4  
ATOM 4954  N N    . LYS A 1 31  ? 10.705  6.220   6.079   1.00 0.00 ? 31  LYS A N    4  
ATOM 4955  C CA   . LYS A 1 31  ? 12.120  5.922   5.935   1.00 0.00 ? 31  LYS A CA   4  
ATOM 4956  C C    . LYS A 1 31  ? 12.940  7.131   6.387   1.00 0.00 ? 31  LYS A C    4  
ATOM 4957  O O    . LYS A 1 31  ? 12.977  8.152   5.702   1.00 0.00 ? 31  LYS A O    4  
ATOM 4958  C CB   . LYS A 1 31  ? 12.429  5.469   4.506   1.00 0.00 ? 31  LYS A CB   4  
ATOM 4959  C CG   . LYS A 1 31  ? 11.940  6.499   3.486   1.00 0.00 ? 31  LYS A CG   4  
ATOM 4960  C CD   . LYS A 1 31  ? 12.475  6.183   2.088   1.00 0.00 ? 31  LYS A CD   4  
ATOM 4961  C CE   . LYS A 1 31  ? 13.852  6.812   1.872   1.00 0.00 ? 31  LYS A CE   4  
ATOM 4962  N NZ   . LYS A 1 31  ? 13.727  8.271   1.654   1.00 0.00 ? 31  LYS A NZ   4  
ATOM 4963  H H    . LYS A 1 31  ? 10.276  6.635   5.276   1.00 0.00 ? 31  LYS A H    4  
ATOM 4964  H HA   . LYS A 1 31  ? 12.346  5.084   6.595   1.00 0.00 ? 31  LYS A HA   4  
ATOM 4965  H HB2  . LYS A 1 31  ? 13.502  5.319   4.392   1.00 0.00 ? 31  LYS A HB2  4  
ATOM 4966  H HB3  . LYS A 1 31  ? 11.952  4.508   4.315   1.00 0.00 ? 31  LYS A HB3  4  
ATOM 4967  H HG2  . LYS A 1 31  ? 10.851  6.511   3.469   1.00 0.00 ? 31  LYS A HG2  4  
ATOM 4968  H HG3  . LYS A 1 31  ? 12.265  7.495   3.787   1.00 0.00 ? 31  LYS A HG3  4  
ATOM 4969  H HD2  . LYS A 1 31  ? 12.540  5.103   1.956   1.00 0.00 ? 31  LYS A HD2  4  
ATOM 4970  H HD3  . LYS A 1 31  ? 11.779  6.554   1.336   1.00 0.00 ? 31  LYS A HD3  4  
ATOM 4971  H HE2  . LYS A 1 31  ? 14.486  6.621   2.738   1.00 0.00 ? 31  LYS A HE2  4  
ATOM 4972  H HE3  . LYS A 1 31  ? 14.339  6.351   1.013   1.00 0.00 ? 31  LYS A HE3  4  
ATOM 4973  H HZ1  . LYS A 1 31  ? 12.796  8.562   1.875   1.00 0.00 ? 31  LYS A HZ1  4  
ATOM 4974  H HZ2  . LYS A 1 31  ? 14.375  8.753   2.243   1.00 0.00 ? 31  LYS A HZ2  4  
ATOM 4975  H HZ3  . LYS A 1 31  ? 13.925  8.483   0.697   1.00 0.00 ? 31  LYS A HZ3  4  
ATOM 4976  N N    . GLY A 1 32  ? 13.578  6.976   7.538   1.00 0.00 ? 32  GLY A N    4  
ATOM 4977  C CA   . GLY A 1 32  ? 14.395  8.043   8.090   1.00 0.00 ? 32  GLY A CA   4  
ATOM 4978  C C    . GLY A 1 32  ? 14.458  7.952   9.616   1.00 0.00 ? 32  GLY A C    4  
ATOM 4979  O O    . GLY A 1 32  ? 13.644  7.268   10.235  1.00 0.00 ? 32  GLY A O    4  
ATOM 4980  H H    . GLY A 1 32  ? 13.542  6.143   8.089   1.00 0.00 ? 32  GLY A H    4  
ATOM 4981  H HA2  . GLY A 1 32  ? 15.403  7.985   7.678   1.00 0.00 ? 32  GLY A HA2  4  
ATOM 4982  H HA3  . GLY A 1 32  ? 13.986  9.009   7.796   1.00 0.00 ? 32  GLY A HA3  4  
ATOM 4983  N N    . ALA A 1 33  ? 15.431  8.653   10.180  1.00 0.00 ? 33  ALA A N    4  
ATOM 4984  C CA   . ALA A 1 33  ? 15.610  8.660   11.622  1.00 0.00 ? 33  ALA A CA   4  
ATOM 4985  C C    . ALA A 1 33  ? 15.712  7.219   12.126  1.00 0.00 ? 33  ALA A C    4  
ATOM 4986  O O    . ALA A 1 33  ? 15.212  6.898   13.203  1.00 0.00 ? 33  ALA A O    4  
ATOM 4987  C CB   . ALA A 1 33  ? 14.459  9.426   12.276  1.00 0.00 ? 33  ALA A CB   4  
ATOM 4988  H H    . ALA A 1 33  ? 16.089  9.207   9.669   1.00 0.00 ? 33  ALA A H    4  
ATOM 4989  H HA   . ALA A 1 33  ? 16.544  9.179   11.837  1.00 0.00 ? 33  ALA A HA   4  
ATOM 4990  H HB1  . ALA A 1 33  ? 14.861  10.173  12.961  1.00 0.00 ? 33  ALA A HB1  4  
ATOM 4991  H HB2  . ALA A 1 33  ? 13.868  9.922   11.505  1.00 0.00 ? 33  ALA A HB2  4  
ATOM 4992  H HB3  . ALA A 1 33  ? 13.826  8.731   12.827  1.00 0.00 ? 33  ALA A HB3  4  
ATOM 4993  N N    . GLY A 1 34  ? 16.363  6.390   11.323  1.00 0.00 ? 34  GLY A N    4  
ATOM 4994  C CA   . GLY A 1 34  ? 16.537  4.991   11.675  1.00 0.00 ? 34  GLY A CA   4  
ATOM 4995  C C    . GLY A 1 34  ? 17.609  4.335   10.802  1.00 0.00 ? 34  GLY A C    4  
ATOM 4996  O O    . GLY A 1 34  ? 18.701  4.029   11.278  1.00 0.00 ? 34  GLY A O    4  
ATOM 4997  H H    . GLY A 1 34  ? 16.767  6.659   10.449  1.00 0.00 ? 34  GLY A H    4  
ATOM 4998  H HA2  . GLY A 1 34  ? 16.817  4.908   12.725  1.00 0.00 ? 34  GLY A HA2  4  
ATOM 4999  H HA3  . GLY A 1 34  ? 15.591  4.462   11.554  1.00 0.00 ? 34  GLY A HA3  4  
ATOM 5000  N N    . GLN A 1 35  ? 17.260  4.139   9.539   1.00 0.00 ? 35  GLN A N    4  
ATOM 5001  C CA   . GLN A 1 35  ? 18.179  3.526   8.595   1.00 0.00 ? 35  GLN A CA   4  
ATOM 5002  C C    . GLN A 1 35  ? 17.811  3.920   7.163   1.00 0.00 ? 35  GLN A C    4  
ATOM 5003  O O    . GLN A 1 35  ? 18.076  3.173   6.222   1.00 0.00 ? 35  GLN A O    4  
ATOM 5004  C CB   . GLN A 1 35  ? 18.197  2.005   8.757   1.00 0.00 ? 35  GLN A CB   4  
ATOM 5005  C CG   . GLN A 1 35  ? 19.551  1.425   8.342   1.00 0.00 ? 35  GLN A CG   4  
ATOM 5006  C CD   . GLN A 1 35  ? 19.602  -0.083  8.593   1.00 0.00 ? 35  GLN A CD   4  
ATOM 5007  O OE1  . GLN A 1 35  ? 18.590  -0.752  8.723   1.00 0.00 ? 35  GLN A OE1  4  
ATOM 5008  N NE2  . GLN A 1 35  ? 20.834  -0.580  8.654   1.00 0.00 ? 35  GLN A NE2  4  
ATOM 5009  H H    . GLN A 1 35  ? 16.370  4.391   9.159   1.00 0.00 ? 35  GLN A H    4  
ATOM 5010  H HA   . GLN A 1 35  ? 19.162  3.924   8.847   1.00 0.00 ? 35  GLN A HA   4  
ATOM 5011  H HB2  . GLN A 1 35  ? 17.989  1.744   9.795   1.00 0.00 ? 35  GLN A HB2  4  
ATOM 5012  H HB3  . GLN A 1 35  ? 17.407  1.561   8.152   1.00 0.00 ? 35  GLN A HB3  4  
ATOM 5013  H HG2  . GLN A 1 35  ? 19.729  1.628   7.286   1.00 0.00 ? 35  GLN A HG2  4  
ATOM 5014  H HG3  . GLN A 1 35  ? 20.348  1.917   8.900   1.00 0.00 ? 35  GLN A HG3  4  
ATOM 5015  H HE21 . GLN A 1 35  ? 21.623  0.024   8.539   1.00 0.00 ? 35  GLN A HE21 4  
ATOM 5016  H HE22 . GLN A 1 35  ? 20.972  -1.558  8.815   1.00 0.00 ? 35  GLN A HE22 4  
ATOM 5017  N N    . ASP A 1 36  ? 17.206  5.093   7.043   1.00 0.00 ? 36  ASP A N    4  
ATOM 5018  C CA   . ASP A 1 36  ? 16.799  5.595   5.742   1.00 0.00 ? 36  ASP A CA   4  
ATOM 5019  C C    . ASP A 1 36  ? 15.937  4.543   5.041   1.00 0.00 ? 36  ASP A C    4  
ATOM 5020  O O    . ASP A 1 36  ? 16.057  4.341   3.833   1.00 0.00 ? 36  ASP A O    4  
ATOM 5021  C CB   . ASP A 1 36  ? 18.014  5.877   4.856   1.00 0.00 ? 36  ASP A CB   4  
ATOM 5022  C CG   . ASP A 1 36  ? 17.943  7.181   4.058   1.00 0.00 ? 36  ASP A CG   4  
ATOM 5023  O OD1  . ASP A 1 36  ? 18.028  8.247   4.704   1.00 0.00 ? 36  ASP A OD1  4  
ATOM 5024  O OD2  . ASP A 1 36  ? 17.806  7.081   2.819   1.00 0.00 ? 36  ASP A OD2  4  
ATOM 5025  H H    . ASP A 1 36  ? 16.994  5.694   7.813   1.00 0.00 ? 36  ASP A H    4  
ATOM 5026  H HA   . ASP A 1 36  ? 16.250  6.514   5.948   1.00 0.00 ? 36  ASP A HA   4  
ATOM 5027  H HB2  . ASP A 1 36  ? 18.905  5.901   5.483   1.00 0.00 ? 36  ASP A HB2  4  
ATOM 5028  H HB3  . ASP A 1 36  ? 18.137  5.048   4.159   1.00 0.00 ? 36  ASP A HB3  4  
ATOM 5029  N N    . LYS A 1 37  ? 15.087  3.900   5.828   1.00 0.00 ? 37  LYS A N    4  
ATOM 5030  C CA   . LYS A 1 37  ? 14.205  2.874   5.298   1.00 0.00 ? 37  LYS A CA   4  
ATOM 5031  C C    . LYS A 1 37  ? 13.384  2.273   6.441   1.00 0.00 ? 37  LYS A C    4  
ATOM 5032  O O    . LYS A 1 37  ? 13.939  1.867   7.461   1.00 0.00 ? 37  LYS A O    4  
ATOM 5033  C CB   . LYS A 1 37  ? 15.004  1.839   4.504   1.00 0.00 ? 37  LYS A CB   4  
ATOM 5034  C CG   . LYS A 1 37  ? 14.411  1.642   3.107   1.00 0.00 ? 37  LYS A CG   4  
ATOM 5035  C CD   . LYS A 1 37  ? 14.803  0.280   2.532   1.00 0.00 ? 37  LYS A CD   4  
ATOM 5036  C CE   . LYS A 1 37  ? 16.119  0.370   1.757   1.00 0.00 ? 37  LYS A CE   4  
ATOM 5037  N NZ   . LYS A 1 37  ? 17.237  -0.159  2.571   1.00 0.00 ? 37  LYS A NZ   4  
ATOM 5038  H H    . LYS A 1 37  ? 14.995  4.071   6.810   1.00 0.00 ? 37  LYS A H    4  
ATOM 5039  H HA   . LYS A 1 37  ? 13.522  3.359   4.600   1.00 0.00 ? 37  LYS A HA   4  
ATOM 5040  H HB2  . LYS A 1 37  ? 16.042  2.161   4.421   1.00 0.00 ? 37  LYS A HB2  4  
ATOM 5041  H HB3  . LYS A 1 37  ? 15.008  0.889   5.039   1.00 0.00 ? 37  LYS A HB3  4  
ATOM 5042  H HG2  . LYS A 1 37  ? 13.325  1.722   3.155   1.00 0.00 ? 37  LYS A HG2  4  
ATOM 5043  H HG3  . LYS A 1 37  ? 14.760  2.435   2.445   1.00 0.00 ? 37  LYS A HG3  4  
ATOM 5044  H HD2  . LYS A 1 37  ? 14.901  -0.445  3.340   1.00 0.00 ? 37  LYS A HD2  4  
ATOM 5045  H HD3  . LYS A 1 37  ? 14.013  -0.082  1.874   1.00 0.00 ? 37  LYS A HD3  4  
ATOM 5046  H HE2  . LYS A 1 37  ? 16.040  -0.194  0.828   1.00 0.00 ? 37  LYS A HE2  4  
ATOM 5047  H HE3  . LYS A 1 37  ? 16.318  1.406   1.485   1.00 0.00 ? 37  LYS A HE3  4  
ATOM 5048  H HZ1  . LYS A 1 37  ? 18.039  -0.290  1.989   1.00 0.00 ? 37  LYS A HZ1  4  
ATOM 5049  H HZ2  . LYS A 1 37  ? 17.455  0.491   3.299   1.00 0.00 ? 37  LYS A HZ2  4  
ATOM 5050  H HZ3  . LYS A 1 37  ? 16.970  -1.034  2.974   1.00 0.00 ? 37  LYS A HZ3  4  
ATOM 5051  N N    . LEU A 1 38  ? 12.076  2.236   6.232   1.00 0.00 ? 38  LEU A N    4  
ATOM 5052  C CA   . LEU A 1 38  ? 11.174  1.691   7.232   1.00 0.00 ? 38  LEU A CA   4  
ATOM 5053  C C    . LEU A 1 38  ? 10.087  0.869   6.537   1.00 0.00 ? 38  LEU A C    4  
ATOM 5054  O O    . LEU A 1 38  ? 9.614   1.239   5.464   1.00 0.00 ? 38  LEU A O    4  
ATOM 5055  C CB   . LEU A 1 38  ? 10.626  2.807   8.123   1.00 0.00 ? 38  LEU A CB   4  
ATOM 5056  C CG   . LEU A 1 38  ? 10.020  2.364   9.457   1.00 0.00 ? 38  LEU A CG   4  
ATOM 5057  C CD1  . LEU A 1 38  ? 10.162  3.460   10.515  1.00 0.00 ? 38  LEU A CD1  4  
ATOM 5058  C CD2  . LEU A 1 38  ? 8.565   1.925   9.279   1.00 0.00 ? 38  LEU A CD2  4  
ATOM 5059  H H    . LEU A 1 38  ? 11.634  2.568   5.399   1.00 0.00 ? 38  LEU A H    4  
ATOM 5060  H HA   . LEU A 1 38  ? 11.756  1.026   7.870   1.00 0.00 ? 38  LEU A HA   4  
ATOM 5061  H HB2  . LEU A 1 38  ? 11.433  3.510   8.330   1.00 0.00 ? 38  LEU A HB2  4  
ATOM 5062  H HB3  . LEU A 1 38  ? 9.865   3.351   7.564   1.00 0.00 ? 38  LEU A HB3  4  
ATOM 5063  H HG   . LEU A 1 38  ? 10.576  1.497   9.814   1.00 0.00 ? 38  LEU A HG   4  
ATOM 5064  H HD11 . LEU A 1 38  ? 9.907   3.054   11.494  1.00 0.00 ? 38  LEU A HD11 4  
ATOM 5065  H HD12 . LEU A 1 38  ? 11.191  3.820   10.528  1.00 0.00 ? 38  LEU A HD12 4  
ATOM 5066  H HD13 . LEU A 1 38  ? 9.491   4.285   10.276  1.00 0.00 ? 38  LEU A HD13 4  
ATOM 5067  H HD21 . LEU A 1 38  ? 8.053   2.623   8.616   1.00 0.00 ? 38  LEU A HD21 4  
ATOM 5068  H HD22 . LEU A 1 38  ? 8.537   0.925   8.845   1.00 0.00 ? 38  LEU A HD22 4  
ATOM 5069  H HD23 . LEU A 1 38  ? 8.067   1.914   10.248  1.00 0.00 ? 38  LEU A HD23 4  
ATOM 5070  N N    . GLY A 1 39  ? 9.722   -0.232  7.178   1.00 0.00 ? 39  GLY A N    4  
ATOM 5071  C CA   . GLY A 1 39  ? 8.700   -1.110  6.636   1.00 0.00 ? 39  GLY A CA   4  
ATOM 5072  C C    . GLY A 1 39  ? 7.353   -0.391  6.542   1.00 0.00 ? 39  GLY A C    4  
ATOM 5073  O O    . GLY A 1 39  ? 6.762   -0.036  7.561   1.00 0.00 ? 39  GLY A O    4  
ATOM 5074  H H    . GLY A 1 39  ? 10.112  -0.527  8.051   1.00 0.00 ? 39  GLY A H    4  
ATOM 5075  H HA2  . GLY A 1 39  ? 9.000   -1.457  5.647   1.00 0.00 ? 39  GLY A HA2  4  
ATOM 5076  H HA3  . GLY A 1 39  ? 8.601   -1.994  7.267   1.00 0.00 ? 39  GLY A HA3  4  
ATOM 5077  N N    . ILE A 1 40  ? 6.906   -0.197  5.310   1.00 0.00 ? 40  ILE A N    4  
ATOM 5078  C CA   . ILE A 1 40  ? 5.639   0.473   5.070   1.00 0.00 ? 40  ILE A CA   4  
ATOM 5079  C C    . ILE A 1 40  ? 4.491   -0.480  5.405   1.00 0.00 ? 40  ILE A C    4  
ATOM 5080  O O    . ILE A 1 40  ? 4.268   -1.462  4.698   1.00 0.00 ? 40  ILE A O    4  
ATOM 5081  C CB   . ILE A 1 40  ? 5.586   1.023   3.643   1.00 0.00 ? 40  ILE A CB   4  
ATOM 5082  C CG1  . ILE A 1 40  ? 6.749   1.982   3.381   1.00 0.00 ? 40  ILE A CG1  4  
ATOM 5083  C CG2  . ILE A 1 40  ? 4.231   1.673   3.356   1.00 0.00 ? 40  ILE A CG2  4  
ATOM 5084  C CD1  . ILE A 1 40  ? 6.580   3.279   4.175   1.00 0.00 ? 40  ILE A CD1  4  
ATOM 5085  H H    . ILE A 1 40  ? 7.392   -0.489  4.486   1.00 0.00 ? 40  ILE A H    4  
ATOM 5086  H HA   . ILE A 1 40  ? 5.589   1.327   5.746   1.00 0.00 ? 40  ILE A HA   4  
ATOM 5087  H HB   . ILE A 1 40  ? 5.695   0.188   2.951   1.00 0.00 ? 40  ILE A HB   4  
ATOM 5088  H HG12 . ILE A 1 40  ? 7.689   1.503   3.655   1.00 0.00 ? 40  ILE A HG12 4  
ATOM 5089  H HG13 . ILE A 1 40  ? 6.805   2.208   2.316   1.00 0.00 ? 40  ILE A HG13 4  
ATOM 5090  H HG21 . ILE A 1 40  ? 4.368   2.515   2.677   1.00 0.00 ? 40  ILE A HG21 4  
ATOM 5091  H HG22 . ILE A 1 40  ? 3.567   0.940   2.896   1.00 0.00 ? 40  ILE A HG22 4  
ATOM 5092  H HG23 . ILE A 1 40  ? 3.793   2.026   4.289   1.00 0.00 ? 40  ILE A HG23 4  
ATOM 5093  H HD11 . ILE A 1 40  ? 7.313   3.309   4.981   1.00 0.00 ? 40  ILE A HD11 4  
ATOM 5094  H HD12 . ILE A 1 40  ? 6.731   4.132   3.514   1.00 0.00 ? 40  ILE A HD12 4  
ATOM 5095  H HD13 . ILE A 1 40  ? 5.575   3.318   4.596   1.00 0.00 ? 40  ILE A HD13 4  
ATOM 5096  N N    . TYR A 1 41  ? 3.792   -0.157  6.483   1.00 0.00 ? 41  TYR A N    4  
ATOM 5097  C CA   . TYR A 1 41  ? 2.672   -0.973  6.921   1.00 0.00 ? 41  TYR A CA   4  
ATOM 5098  C C    . TYR A 1 41  ? 1.433   -0.111  7.175   1.00 0.00 ? 41  TYR A C    4  
ATOM 5099  O O    . TYR A 1 41  ? 1.516   0.922   7.836   1.00 0.00 ? 41  TYR A O    4  
ATOM 5100  C CB   . TYR A 1 41  ? 3.108   -1.617  8.237   1.00 0.00 ? 41  TYR A CB   4  
ATOM 5101  C CG   . TYR A 1 41  ? 3.129   -3.147  8.205   1.00 0.00 ? 41  TYR A CG   4  
ATOM 5102  C CD1  . TYR A 1 41  ? 4.048   -3.808  7.416   1.00 0.00 ? 41  TYR A CD1  4  
ATOM 5103  C CD2  . TYR A 1 41  ? 2.228   -3.865  8.964   1.00 0.00 ? 41  TYR A CD2  4  
ATOM 5104  C CE1  . TYR A 1 41  ? 4.068   -5.248  7.385   1.00 0.00 ? 41  TYR A CE1  4  
ATOM 5105  C CE2  . TYR A 1 41  ? 2.247   -5.305  8.933   1.00 0.00 ? 41  TYR A CE2  4  
ATOM 5106  C CZ   . TYR A 1 41  ? 3.166   -5.925  8.145   1.00 0.00 ? 41  TYR A CZ   4  
ATOM 5107  O OH   . TYR A 1 41  ? 3.184   -7.285  8.116   1.00 0.00 ? 41  TYR A OH   4  
ATOM 5108  H H    . TYR A 1 41  ? 3.979   0.643   7.052   1.00 0.00 ? 41  TYR A H    4  
ATOM 5109  H HA   . TYR A 1 41  ? 2.450   -1.691  6.132   1.00 0.00 ? 41  TYR A HA   4  
ATOM 5110  H HB2  . TYR A 1 41  ? 4.104   -1.257  8.494   1.00 0.00 ? 41  TYR A HB2  4  
ATOM 5111  H HB3  . TYR A 1 41  ? 2.437   -1.290  9.031   1.00 0.00 ? 41  TYR A HB3  4  
ATOM 5112  H HD1  . TYR A 1 41  ? 4.760   -3.240  6.817   1.00 0.00 ? 41  TYR A HD1  4  
ATOM 5113  H HD2  . TYR A 1 41  ? 1.501   -3.343  9.587   1.00 0.00 ? 41  TYR A HD2  4  
ATOM 5114  H HE1  . TYR A 1 41  ? 4.789   -5.782  6.767   1.00 0.00 ? 41  TYR A HE1  4  
ATOM 5115  H HE2  . TYR A 1 41  ? 1.541   -5.885  9.527   1.00 0.00 ? 41  TYR A HE2  4  
ATOM 5116  H HH   . TYR A 1 41  ? 3.291   -7.605  7.175   1.00 0.00 ? 41  TYR A HH   4  
ATOM 5117  N N    . VAL A 1 42  ? 0.312   -0.569  6.635   1.00 0.00 ? 42  VAL A N    4  
ATOM 5118  C CA   . VAL A 1 42  ? -0.942  0.146   6.795   1.00 0.00 ? 42  VAL A CA   4  
ATOM 5119  C C    . VAL A 1 42  ? -1.325  0.170   8.276   1.00 0.00 ? 42  VAL A C    4  
ATOM 5120  O O    . VAL A 1 42  ? -1.274  -0.857  8.951   1.00 0.00 ? 42  VAL A O    4  
ATOM 5121  C CB   . VAL A 1 42  ? -2.020  -0.482  5.909   1.00 0.00 ? 42  VAL A CB   4  
ATOM 5122  C CG1  . VAL A 1 42  ? -3.403  0.075   6.250   1.00 0.00 ? 42  VAL A CG1  4  
ATOM 5123  C CG2  . VAL A 1 42  ? -1.697  -0.280  4.427   1.00 0.00 ? 42  VAL A CG2  4  
ATOM 5124  H H    . VAL A 1 42  ? 0.253   -1.411  6.099   1.00 0.00 ? 42  VAL A H    4  
ATOM 5125  H HA   . VAL A 1 42  ? -0.782  1.170   6.458   1.00 0.00 ? 42  VAL A HA   4  
ATOM 5126  H HB   . VAL A 1 42  ? -2.032  -1.554  6.106   1.00 0.00 ? 42  VAL A HB   4  
ATOM 5127  H HG11 . VAL A 1 42  ? -3.753  0.705   5.433   1.00 0.00 ? 42  VAL A HG11 4  
ATOM 5128  H HG12 . VAL A 1 42  ? -4.101  -0.750  6.397   1.00 0.00 ? 42  VAL A HG12 4  
ATOM 5129  H HG13 . VAL A 1 42  ? -3.342  0.665   7.164   1.00 0.00 ? 42  VAL A HG13 4  
ATOM 5130  H HG21 . VAL A 1 42  ? -2.625  -0.212  3.860   1.00 0.00 ? 42  VAL A HG21 4  
ATOM 5131  H HG22 . VAL A 1 42  ? -1.127  0.640   4.302   1.00 0.00 ? 42  VAL A HG22 4  
ATOM 5132  H HG23 . VAL A 1 42  ? -1.110  -1.124  4.065   1.00 0.00 ? 42  VAL A HG23 4  
ATOM 5133  N N    . LYS A 1 43  ? -1.701  1.354   8.739   1.00 0.00 ? 43  LYS A N    4  
ATOM 5134  C CA   . LYS A 1 43  ? -2.092  1.525   10.127  1.00 0.00 ? 43  LYS A CA   4  
ATOM 5135  C C    . LYS A 1 43  ? -3.598  1.285   10.261  1.00 0.00 ? 43  LYS A C    4  
ATOM 5136  O O    . LYS A 1 43  ? -4.061  0.783   11.284  1.00 0.00 ? 43  LYS A O    4  
ATOM 5137  C CB   . LYS A 1 43  ? -1.639  2.891   10.647  1.00 0.00 ? 43  LYS A CB   4  
ATOM 5138  C CG   . LYS A 1 43  ? -2.820  3.683   11.210  1.00 0.00 ? 43  LYS A CG   4  
ATOM 5139  C CD   . LYS A 1 43  ? -2.451  5.156   11.400  1.00 0.00 ? 43  LYS A CD   4  
ATOM 5140  C CE   . LYS A 1 43  ? -2.216  5.477   12.877  1.00 0.00 ? 43  LYS A CE   4  
ATOM 5141  N NZ   . LYS A 1 43  ? -2.425  6.919   13.134  1.00 0.00 ? 43  LYS A NZ   4  
ATOM 5142  H H    . LYS A 1 43  ? -1.740  2.184   8.183   1.00 0.00 ? 43  LYS A H    4  
ATOM 5143  H HA   . LYS A 1 43  ? -1.569  0.768   10.710  1.00 0.00 ? 43  LYS A HA   4  
ATOM 5144  H HB2  . LYS A 1 43  ? -0.884  2.757   11.423  1.00 0.00 ? 43  LYS A HB2  4  
ATOM 5145  H HB3  . LYS A 1 43  ? -1.169  3.453   9.841   1.00 0.00 ? 43  LYS A HB3  4  
ATOM 5146  H HG2  . LYS A 1 43  ? -3.672  3.602   10.534  1.00 0.00 ? 43  LYS A HG2  4  
ATOM 5147  H HG3  . LYS A 1 43  ? -3.128  3.256   12.164  1.00 0.00 ? 43  LYS A HG3  4  
ATOM 5148  H HD2  . LYS A 1 43  ? -1.554  5.387   10.826  1.00 0.00 ? 43  LYS A HD2  4  
ATOM 5149  H HD3  . LYS A 1 43  ? -3.250  5.788   11.009  1.00 0.00 ? 43  LYS A HD3  4  
ATOM 5150  H HE2  . LYS A 1 43  ? -2.895  4.889   13.495  1.00 0.00 ? 43  LYS A HE2  4  
ATOM 5151  H HE3  . LYS A 1 43  ? -1.202  5.194   13.159  1.00 0.00 ? 43  LYS A HE3  4  
ATOM 5152  H HZ1  . LYS A 1 43  ? -3.398  7.134   13.058  1.00 0.00 ? 43  LYS A HZ1  4  
ATOM 5153  H HZ2  . LYS A 1 43  ? -2.105  7.143   14.055  1.00 0.00 ? 43  LYS A HZ2  4  
ATOM 5154  H HZ3  . LYS A 1 43  ? -1.912  7.455   12.463  1.00 0.00 ? 43  LYS A HZ3  4  
ATOM 5155  N N    . SER A 1 44  ? -4.319  1.656   9.214   1.00 0.00 ? 44  SER A N    4  
ATOM 5156  C CA   . SER A 1 44  ? -5.762  1.488   9.202   1.00 0.00 ? 44  SER A CA   4  
ATOM 5157  C C    . SER A 1 44  ? -6.331  1.943   7.857   1.00 0.00 ? 44  SER A C    4  
ATOM 5158  O O    . SER A 1 44  ? -5.583  2.166   6.906   1.00 0.00 ? 44  SER A O    4  
ATOM 5159  C CB   . SER A 1 44  ? -6.417  2.265   10.346  1.00 0.00 ? 44  SER A CB   4  
ATOM 5160  O OG   . SER A 1 44  ? -6.314  3.674   10.161  1.00 0.00 ? 44  SER A OG   4  
ATOM 5161  H H    . SER A 1 44  ? -3.935  2.064   8.386   1.00 0.00 ? 44  SER A H    4  
ATOM 5162  H HA   . SER A 1 44  ? -5.929  0.420   9.347   1.00 0.00 ? 44  SER A HA   4  
ATOM 5163  H HB2  . SER A 1 44  ? -7.468  1.985   10.419  1.00 0.00 ? 44  SER A HB2  4  
ATOM 5164  H HB3  . SER A 1 44  ? -5.947  1.987   11.289  1.00 0.00 ? 44  SER A HB3  4  
ATOM 5165  H HG   . SER A 1 44  ? -7.006  3.985   9.510   1.00 0.00 ? 44  SER A HG   4  
ATOM 5166  N N    . VAL A 1 45  ? -7.650  2.067   7.819   1.00 0.00 ? 45  VAL A N    4  
ATOM 5167  C CA   . VAL A 1 45  ? -8.328  2.491   6.606   1.00 0.00 ? 45  VAL A CA   4  
ATOM 5168  C C    . VAL A 1 45  ? -9.290  3.633   6.938   1.00 0.00 ? 45  VAL A C    4  
ATOM 5169  O O    . VAL A 1 45  ? -10.050 3.549   7.902   1.00 0.00 ? 45  VAL A O    4  
ATOM 5170  C CB   . VAL A 1 45  ? -9.021  1.297   5.949   1.00 0.00 ? 45  VAL A CB   4  
ATOM 5171  C CG1  . VAL A 1 45  ? -8.138  0.680   4.862   1.00 0.00 ? 45  VAL A CG1  4  
ATOM 5172  C CG2  . VAL A 1 45  ? -9.418  0.251   6.992   1.00 0.00 ? 45  VAL A CG2  4  
ATOM 5173  H H    . VAL A 1 45  ? -8.251  1.883   8.597   1.00 0.00 ? 45  VAL A H    4  
ATOM 5174  H HA   . VAL A 1 45  ? -7.568  2.862   5.918   1.00 0.00 ? 45  VAL A HA   4  
ATOM 5175  H HB   . VAL A 1 45  ? -9.933  1.658   5.474   1.00 0.00 ? 45  VAL A HB   4  
ATOM 5176  H HG11 . VAL A 1 45  ? -8.375  1.134   3.900   1.00 0.00 ? 45  VAL A HG11 4  
ATOM 5177  H HG12 . VAL A 1 45  ? -7.090  0.859   5.101   1.00 0.00 ? 45  VAL A HG12 4  
ATOM 5178  H HG13 . VAL A 1 45  ? -8.320  -0.394  4.812   1.00 0.00 ? 45  VAL A HG13 4  
ATOM 5179  H HG21 . VAL A 1 45  ? -10.248 -0.345  6.612   1.00 0.00 ? 45  VAL A HG21 4  
ATOM 5180  H HG22 . VAL A 1 45  ? -8.567  -0.400  7.197   1.00 0.00 ? 45  VAL A HG22 4  
ATOM 5181  H HG23 . VAL A 1 45  ? -9.721  0.751   7.912   1.00 0.00 ? 45  VAL A HG23 4  
ATOM 5182  N N    . VAL A 1 46  ? -9.227  4.674   6.121   1.00 0.00 ? 46  VAL A N    4  
ATOM 5183  C CA   . VAL A 1 46  ? -10.084 5.832   6.315   1.00 0.00 ? 46  VAL A CA   4  
ATOM 5184  C C    . VAL A 1 46  ? -11.544 5.378   6.362   1.00 0.00 ? 46  VAL A C    4  
ATOM 5185  O O    . VAL A 1 46  ? -12.414 6.118   6.818   1.00 0.00 ? 46  VAL A O    4  
ATOM 5186  C CB   . VAL A 1 46  ? -9.815  6.871   5.225   1.00 0.00 ? 46  VAL A CB   4  
ATOM 5187  C CG1  . VAL A 1 46  ? -10.995 7.835   5.084   1.00 0.00 ? 46  VAL A CG1  4  
ATOM 5188  C CG2  . VAL A 1 46  ? -8.516  7.631   5.501   1.00 0.00 ? 46  VAL A CG2  4  
ATOM 5189  H H    . VAL A 1 46  ? -8.607  4.735   5.339   1.00 0.00 ? 46  VAL A H    4  
ATOM 5190  H HA   . VAL A 1 46  ? -9.824  6.275   7.276   1.00 0.00 ? 46  VAL A HA   4  
ATOM 5191  H HB   . VAL A 1 46  ? -9.699  6.342   4.279   1.00 0.00 ? 46  VAL A HB   4  
ATOM 5192  H HG11 . VAL A 1 46  ? -11.051 8.473   5.966   1.00 0.00 ? 46  VAL A HG11 4  
ATOM 5193  H HG12 . VAL A 1 46  ? -10.855 8.452   4.197   1.00 0.00 ? 46  VAL A HG12 4  
ATOM 5194  H HG13 . VAL A 1 46  ? -11.920 7.265   4.988   1.00 0.00 ? 46  VAL A HG13 4  
ATOM 5195  H HG21 . VAL A 1 46  ? -7.783  7.388   4.731   1.00 0.00 ? 46  VAL A HG21 4  
ATOM 5196  H HG22 . VAL A 1 46  ? -8.713  8.703   5.489   1.00 0.00 ? 46  VAL A HG22 4  
ATOM 5197  H HG23 . VAL A 1 46  ? -8.127  7.344   6.477   1.00 0.00 ? 46  VAL A HG23 4  
ATOM 5198  N N    . LYS A 1 47  ? -11.769 4.163   5.882   1.00 0.00 ? 47  LYS A N    4  
ATOM 5199  C CA   . LYS A 1 47  ? -13.108 3.602   5.863   1.00 0.00 ? 47  LYS A CA   4  
ATOM 5200  C C    . LYS A 1 47  ? -14.026 4.511   5.044   1.00 0.00 ? 47  LYS A C    4  
ATOM 5201  O O    . LYS A 1 47  ? -15.174 4.742   5.421   1.00 0.00 ? 47  LYS A O    4  
ATOM 5202  C CB   . LYS A 1 47  ? -13.605 3.350   7.289   1.00 0.00 ? 47  LYS A CB   4  
ATOM 5203  C CG   . LYS A 1 47  ? -14.089 4.648   7.938   1.00 0.00 ? 47  LYS A CG   4  
ATOM 5204  C CD   . LYS A 1 47  ? -15.322 4.399   8.809   1.00 0.00 ? 47  LYS A CD   4  
ATOM 5205  C CE   . LYS A 1 47  ? -14.921 3.878   10.190  1.00 0.00 ? 47  LYS A CE   4  
ATOM 5206  N NZ   . LYS A 1 47  ? -14.929 4.978   11.181  1.00 0.00 ? 47  LYS A NZ   4  
ATOM 5207  H H    . LYS A 1 47  ? -11.055 3.567   5.513   1.00 0.00 ? 47  LYS A H    4  
ATOM 5208  H HA   . LYS A 1 47  ? -13.050 2.633   5.367   1.00 0.00 ? 47  LYS A HA   4  
ATOM 5209  H HB2  . LYS A 1 47  ? -14.416 2.622   7.273   1.00 0.00 ? 47  LYS A HB2  4  
ATOM 5210  H HB3  . LYS A 1 47  ? -12.802 2.918   7.886   1.00 0.00 ? 47  LYS A HB3  4  
ATOM 5211  H HG2  . LYS A 1 47  ? -13.291 5.076   8.544   1.00 0.00 ? 47  LYS A HG2  4  
ATOM 5212  H HG3  . LYS A 1 47  ? -14.328 5.379   7.164   1.00 0.00 ? 47  LYS A HG3  4  
ATOM 5213  H HD2  . LYS A 1 47  ? -15.890 5.323   8.915   1.00 0.00 ? 47  LYS A HD2  4  
ATOM 5214  H HD3  . LYS A 1 47  ? -15.977 3.677   8.320   1.00 0.00 ? 47  LYS A HD3  4  
ATOM 5215  H HE2  . LYS A 1 47  ? -15.609 3.094   10.504  1.00 0.00 ? 47  LYS A HE2  4  
ATOM 5216  H HE3  . LYS A 1 47  ? -13.928 3.431   10.143  1.00 0.00 ? 47  LYS A HE3  4  
ATOM 5217  H HZ1  . LYS A 1 47  ? -14.631 5.825   10.740  1.00 0.00 ? 47  LYS A HZ1  4  
ATOM 5218  H HZ2  . LYS A 1 47  ? -15.854 5.097   11.540  1.00 0.00 ? 47  LYS A HZ2  4  
ATOM 5219  H HZ3  . LYS A 1 47  ? -14.306 4.755   11.931  1.00 0.00 ? 47  LYS A HZ3  4  
ATOM 5220  N N    . GLY A 1 48  ? -13.486 5.003   3.939   1.00 0.00 ? 48  GLY A N    4  
ATOM 5221  C CA   . GLY A 1 48  ? -14.242 5.883   3.064   1.00 0.00 ? 48  GLY A CA   4  
ATOM 5222  C C    . GLY A 1 48  ? -13.531 6.063   1.721   1.00 0.00 ? 48  GLY A C    4  
ATOM 5223  O O    . GLY A 1 48  ? -13.690 7.091   1.064   1.00 0.00 ? 48  GLY A O    4  
ATOM 5224  H H    . GLY A 1 48  ? -12.551 4.811   3.640   1.00 0.00 ? 48  GLY A H    4  
ATOM 5225  H HA2  . GLY A 1 48  ? -15.237 5.471   2.900   1.00 0.00 ? 48  GLY A HA2  4  
ATOM 5226  H HA3  . GLY A 1 48  ? -14.374 6.853   3.543   1.00 0.00 ? 48  GLY A HA3  4  
ATOM 5227  N N    . GLY A 1 49  ? -12.762 5.049   1.354   1.00 0.00 ? 49  GLY A N    4  
ATOM 5228  C CA   . GLY A 1 49  ? -12.026 5.083   0.102   1.00 0.00 ? 49  GLY A CA   4  
ATOM 5229  C C    . GLY A 1 49  ? -12.023 3.708   -0.570  1.00 0.00 ? 49  GLY A C    4  
ATOM 5230  O O    . GLY A 1 49  ? -12.255 2.693   0.085   1.00 0.00 ? 49  GLY A O    4  
ATOM 5231  H H    . GLY A 1 49  ? -12.638 4.217   1.895   1.00 0.00 ? 49  GLY A H    4  
ATOM 5232  H HA2  . GLY A 1 49  ? -12.474 5.817   -0.568  1.00 0.00 ? 49  GLY A HA2  4  
ATOM 5233  H HA3  . GLY A 1 49  ? -11.001 5.403   0.287   1.00 0.00 ? 49  GLY A HA3  4  
ATOM 5234  N N    . ALA A 1 50  ? -11.758 3.720   -1.868  1.00 0.00 ? 50  ALA A N    4  
ATOM 5235  C CA   . ALA A 1 50  ? -11.722 2.486   -2.636  1.00 0.00 ? 50  ALA A CA   4  
ATOM 5236  C C    . ALA A 1 50  ? -11.060 1.389   -1.799  1.00 0.00 ? 50  ALA A C    4  
ATOM 5237  O O    . ALA A 1 50  ? -11.476 0.233   -1.845  1.00 0.00 ? 50  ALA A O    4  
ATOM 5238  C CB   . ALA A 1 50  ? -10.995 2.730   -3.959  1.00 0.00 ? 50  ALA A CB   4  
ATOM 5239  H H    . ALA A 1 50  ? -11.571 4.550   -2.393  1.00 0.00 ? 50  ALA A H    4  
ATOM 5240  H HA   . ALA A 1 50  ? -12.752 2.198   -2.849  1.00 0.00 ? 50  ALA A HA   4  
ATOM 5241  H HB1  . ALA A 1 50  ? -9.926  2.829   -3.773  1.00 0.00 ? 50  ALA A HB1  4  
ATOM 5242  H HB2  . ALA A 1 50  ? -11.170 1.888   -4.630  1.00 0.00 ? 50  ALA A HB2  4  
ATOM 5243  H HB3  . ALA A 1 50  ? -11.371 3.644   -4.418  1.00 0.00 ? 50  ALA A HB3  4  
ATOM 5244  N N    . ALA A 1 51  ? -10.040 1.791   -1.055  1.00 0.00 ? 51  ALA A N    4  
ATOM 5245  C CA   . ALA A 1 51  ? -9.316  0.857   -0.210  1.00 0.00 ? 51  ALA A CA   4  
ATOM 5246  C C    . ALA A 1 51  ? -10.310 0.104   0.678   1.00 0.00 ? 51  ALA A C    4  
ATOM 5247  O O    . ALA A 1 51  ? -10.672 -1.034  0.384   1.00 0.00 ? 51  ALA A O    4  
ATOM 5248  C CB   . ALA A 1 51  ? -8.264  1.614   0.603   1.00 0.00 ? 51  ALA A CB   4  
ATOM 5249  H H    . ALA A 1 51  ? -9.708  2.734   -1.024  1.00 0.00 ? 51  ALA A H    4  
ATOM 5250  H HA   . ALA A 1 51  ? -8.811  0.144   -0.861  1.00 0.00 ? 51  ALA A HA   4  
ATOM 5251  H HB1  . ALA A 1 51  ? -8.761  2.258   1.329   1.00 0.00 ? 51  ALA A HB1  4  
ATOM 5252  H HB2  . ALA A 1 51  ? -7.627  0.900   1.126   1.00 0.00 ? 51  ALA A HB2  4  
ATOM 5253  H HB3  . ALA A 1 51  ? -7.656  2.222   -0.066  1.00 0.00 ? 51  ALA A HB3  4  
ATOM 5254  N N    . ASP A 1 52  ? -10.722 0.771   1.746   1.00 0.00 ? 52  ASP A N    4  
ATOM 5255  C CA   . ASP A 1 52  ? -11.666 0.179   2.679   1.00 0.00 ? 52  ASP A CA   4  
ATOM 5256  C C    . ASP A 1 52  ? -12.987 -0.094  1.957   1.00 0.00 ? 52  ASP A C    4  
ATOM 5257  O O    . ASP A 1 52  ? -13.878 -0.737  2.508   1.00 0.00 ? 52  ASP A O    4  
ATOM 5258  C CB   . ASP A 1 52  ? -11.952 1.124   3.847   1.00 0.00 ? 52  ASP A CB   4  
ATOM 5259  C CG   . ASP A 1 52  ? -12.150 0.439   5.200   1.00 0.00 ? 52  ASP A CG   4  
ATOM 5260  O OD1  . ASP A 1 52  ? -12.602 -0.727  5.185   1.00 0.00 ? 52  ASP A OD1  4  
ATOM 5261  O OD2  . ASP A 1 52  ? -11.846 1.095   6.219   1.00 0.00 ? 52  ASP A OD2  4  
ATOM 5262  H H    . ASP A 1 52  ? -10.422 1.696   1.978   1.00 0.00 ? 52  ASP A H    4  
ATOM 5263  H HA   . ASP A 1 52  ? -11.187 -0.735  3.031   1.00 0.00 ? 52  ASP A HA   4  
ATOM 5264  H HB2  . ASP A 1 52  ? -11.127 1.832   3.933   1.00 0.00 ? 52  ASP A HB2  4  
ATOM 5265  H HB3  . ASP A 1 52  ? -12.846 1.704   3.616   1.00 0.00 ? 52  ASP A HB3  4  
ATOM 5266  N N    . VAL A 1 53  ? -13.071 0.410   0.734   1.00 0.00 ? 53  VAL A N    4  
ATOM 5267  C CA   . VAL A 1 53  ? -14.268 0.229   -0.069  1.00 0.00 ? 53  VAL A CA   4  
ATOM 5268  C C    . VAL A 1 53  ? -14.162 -1.086  -0.845  1.00 0.00 ? 53  VAL A C    4  
ATOM 5269  O O    . VAL A 1 53  ? -15.175 -1.712  -1.153  1.00 0.00 ? 53  VAL A O    4  
ATOM 5270  C CB   . VAL A 1 53  ? -14.477 1.442   -0.977  1.00 0.00 ? 53  VAL A CB   4  
ATOM 5271  C CG1  . VAL A 1 53  ? -14.762 1.008   -2.416  1.00 0.00 ? 53  VAL A CG1  4  
ATOM 5272  C CG2  . VAL A 1 53  ? -15.596 2.339   -0.443  1.00 0.00 ? 53  VAL A CG2  4  
ATOM 5273  H H    . VAL A 1 53  ? -12.341 0.932   0.293   1.00 0.00 ? 53  VAL A H    4  
ATOM 5274  H HA   . VAL A 1 53  ? -15.115 0.167   0.613   1.00 0.00 ? 53  VAL A HA   4  
ATOM 5275  H HB   . VAL A 1 53  ? -13.555 2.023   -0.979  1.00 0.00 ? 53  VAL A HB   4  
ATOM 5276  H HG11 . VAL A 1 53  ? -14.767 1.884   -3.065  1.00 0.00 ? 53  VAL A HG11 4  
ATOM 5277  H HG12 . VAL A 1 53  ? -13.989 0.315   -2.747  1.00 0.00 ? 53  VAL A HG12 4  
ATOM 5278  H HG13 . VAL A 1 53  ? -15.734 0.517   -2.462  1.00 0.00 ? 53  VAL A HG13 4  
ATOM 5279  H HG21 . VAL A 1 53  ? -15.400 2.581   0.602   1.00 0.00 ? 53  VAL A HG21 4  
ATOM 5280  H HG22 . VAL A 1 53  ? -15.635 3.259   -1.027  1.00 0.00 ? 53  VAL A HG22 4  
ATOM 5281  H HG23 . VAL A 1 53  ? -16.550 1.818   -0.523  1.00 0.00 ? 53  VAL A HG23 4  
ATOM 5282  N N    . ASP A 1 54  ? -12.927 -1.467  -1.137  1.00 0.00 ? 54  ASP A N    4  
ATOM 5283  C CA   . ASP A 1 54  ? -12.676 -2.696  -1.870  1.00 0.00 ? 54  ASP A CA   4  
ATOM 5284  C C    . ASP A 1 54  ? -12.769 -3.884  -0.911  1.00 0.00 ? 54  ASP A C    4  
ATOM 5285  O O    . ASP A 1 54  ? -12.544 -5.026  -1.309  1.00 0.00 ? 54  ASP A O    4  
ATOM 5286  C CB   . ASP A 1 54  ? -11.276 -2.693  -2.487  1.00 0.00 ? 54  ASP A CB   4  
ATOM 5287  C CG   . ASP A 1 54  ? -11.086 -3.653  -3.663  1.00 0.00 ? 54  ASP A CG   4  
ATOM 5288  O OD1  . ASP A 1 54  ? -12.112 -4.201  -4.120  1.00 0.00 ? 54  ASP A OD1  4  
ATOM 5289  O OD2  . ASP A 1 54  ? -9.918  -3.817  -4.078  1.00 0.00 ? 54  ASP A OD2  4  
ATOM 5290  H H    . ASP A 1 54  ? -12.109 -0.952  -0.882  1.00 0.00 ? 54  ASP A H    4  
ATOM 5291  H HA   . ASP A 1 54  ? -13.440 -2.726  -2.647  1.00 0.00 ? 54  ASP A HA   4  
ATOM 5292  H HB2  . ASP A 1 54  ? -11.044 -1.682  -2.821  1.00 0.00 ? 54  ASP A HB2  4  
ATOM 5293  H HB3  . ASP A 1 54  ? -10.553 -2.946  -1.711  1.00 0.00 ? 54  ASP A HB3  4  
ATOM 5294  N N    . GLY A 1 55  ? -13.101 -3.575  0.334   1.00 0.00 ? 55  GLY A N    4  
ATOM 5295  C CA   . GLY A 1 55  ? -13.226 -4.604  1.352   1.00 0.00 ? 55  GLY A CA   4  
ATOM 5296  C C    . GLY A 1 55  ? -12.003 -5.524  1.355   1.00 0.00 ? 55  GLY A C    4  
ATOM 5297  O O    . GLY A 1 55  ? -12.141 -6.746  1.370   1.00 0.00 ? 55  GLY A O    4  
ATOM 5298  H H    . GLY A 1 55  ? -13.282 -2.644  0.649   1.00 0.00 ? 55  GLY A H    4  
ATOM 5299  H HA2  . GLY A 1 55  ? -13.338 -4.139  2.332   1.00 0.00 ? 55  GLY A HA2  4  
ATOM 5300  H HA3  . GLY A 1 55  ? -14.126 -5.191  1.173   1.00 0.00 ? 55  GLY A HA3  4  
ATOM 5301  N N    . ARG A 1 56  ? -10.834 -4.901  1.341   1.00 0.00 ? 56  ARG A N    4  
ATOM 5302  C CA   . ARG A 1 56  ? -9.588  -5.648  1.343   1.00 0.00 ? 56  ARG A CA   4  
ATOM 5303  C C    . ARG A 1 56  ? -8.502  -4.868  2.087   1.00 0.00 ? 56  ARG A C    4  
ATOM 5304  O O    . ARG A 1 56  ? -7.776  -5.433  2.904   1.00 0.00 ? 56  ARG A O    4  
ATOM 5305  C CB   . ARG A 1 56  ? -9.115  -5.933  -0.084  1.00 0.00 ? 56  ARG A CB   4  
ATOM 5306  C CG   . ARG A 1 56  ? -8.954  -7.436  -0.319  1.00 0.00 ? 56  ARG A CG   4  
ATOM 5307  C CD   . ARG A 1 56  ? -7.750  -7.985  0.449   1.00 0.00 ? 56  ARG A CD   4  
ATOM 5308  N NE   . ARG A 1 56  ? -8.130  -8.269  1.851   1.00 0.00 ? 56  ARG A NE   4  
ATOM 5309  C CZ   . ARG A 1 56  ? -8.852  -9.331  2.233   1.00 0.00 ? 56  ARG A CZ   4  
ATOM 5310  N NH1  . ARG A 1 56  ? -9.277  -10.216 1.320   1.00 0.00 ? 56  ARG A NH1  4  
ATOM 5311  N NH2  . ARG A 1 56  ? -9.150  -9.508  3.527   1.00 0.00 ? 56  ARG A NH2  4  
ATOM 5312  H H    . ARG A 1 56  ? -10.730 -3.906  1.330   1.00 0.00 ? 56  ARG A H    4  
ATOM 5313  H HA   . ARG A 1 56  ? -9.822  -6.580  1.856   1.00 0.00 ? 56  ARG A HA   4  
ATOM 5314  H HB2  . ARG A 1 56  ? -9.831  -5.525  -0.797  1.00 0.00 ? 56  ARG A HB2  4  
ATOM 5315  H HB3  . ARG A 1 56  ? -8.165  -5.429  -0.264  1.00 0.00 ? 56  ARG A HB3  4  
ATOM 5316  H HG2  . ARG A 1 56  ? -9.858  -7.956  -0.004  1.00 0.00 ? 56  ARG A HG2  4  
ATOM 5317  H HG3  . ARG A 1 56  ? -8.829  -7.630  -1.384  1.00 0.00 ? 56  ARG A HG3  4  
ATOM 5318  H HD2  . ARG A 1 56  ? -7.387  -8.894  -0.029  1.00 0.00 ? 56  ARG A HD2  4  
ATOM 5319  H HD3  . ARG A 1 56  ? -6.933  -7.264  0.424   1.00 0.00 ? 56  ARG A HD3  4  
ATOM 5320  H HE   . ARG A 1 56  ? -7.829  -7.628  2.557   1.00 0.00 ? 56  ARG A HE   4  
ATOM 5321  H HH11 . ARG A 1 56  ? -9.055  -10.083 0.354   1.00 0.00 ? 56  ARG A HH11 4  
ATOM 5322  H HH12 . ARG A 1 56  ? -9.816  -11.008 1.605   1.00 0.00 ? 56  ARG A HH12 4  
ATOM 5323  H HH21 . ARG A 1 56  ? -8.833  -8.848  4.208   1.00 0.00 ? 56  ARG A HH21 4  
ATOM 5324  H HH22 . ARG A 1 56  ? -9.689  -10.301 3.812   1.00 0.00 ? 56  ARG A HH22 4  
ATOM 5325  N N    . LEU A 1 57  ? -8.424  -3.582  1.777   1.00 0.00 ? 57  LEU A N    4  
ATOM 5326  C CA   . LEU A 1 57  ? -7.439  -2.719  2.406   1.00 0.00 ? 57  LEU A CA   4  
ATOM 5327  C C    . LEU A 1 57  ? -7.677  -2.697  3.917   1.00 0.00 ? 57  LEU A C    4  
ATOM 5328  O O    . LEU A 1 57  ? -8.821  -2.714  4.369   1.00 0.00 ? 57  LEU A O    4  
ATOM 5329  C CB   . LEU A 1 57  ? -7.452  -1.332  1.761   1.00 0.00 ? 57  LEU A CB   4  
ATOM 5330  C CG   . LEU A 1 57  ? -6.473  -1.120  0.605   1.00 0.00 ? 57  LEU A CG   4  
ATOM 5331  C CD1  . LEU A 1 57  ? -5.321  -0.204  1.023   1.00 0.00 ? 57  LEU A CD1  4  
ATOM 5332  C CD2  . LEU A 1 57  ? -5.971  -2.458  0.059   1.00 0.00 ? 57  LEU A CD2  4  
ATOM 5333  H H    . LEU A 1 57  ? -9.018  -3.131  1.111   1.00 0.00 ? 57  LEU A H    4  
ATOM 5334  H HA   . LEU A 1 57  ? -6.457  -3.153  2.217   1.00 0.00 ? 57  LEU A HA   4  
ATOM 5335  H HB2  . LEU A 1 57  ? -8.461  -1.131  1.398   1.00 0.00 ? 57  LEU A HB2  4  
ATOM 5336  H HB3  . LEU A 1 57  ? -7.239  -0.592  2.533   1.00 0.00 ? 57  LEU A HB3  4  
ATOM 5337  H HG   . LEU A 1 57  ? -7.004  -0.620  -0.205  1.00 0.00 ? 57  LEU A HG   4  
ATOM 5338  H HD11 . LEU A 1 57  ? -4.482  -0.341  0.342   1.00 0.00 ? 57  LEU A HD11 4  
ATOM 5339  H HD12 . LEU A 1 57  ? -5.651  0.835   0.989   1.00 0.00 ? 57  LEU A HD12 4  
ATOM 5340  H HD13 . LEU A 1 57  ? -5.010  -0.452  2.038   1.00 0.00 ? 57  LEU A HD13 4  
ATOM 5341  H HD21 . LEU A 1 57  ? -5.601  -2.320  -0.957  1.00 0.00 ? 57  LEU A HD21 4  
ATOM 5342  H HD22 . LEU A 1 57  ? -5.166  -2.830  0.692   1.00 0.00 ? 57  LEU A HD22 4  
ATOM 5343  H HD23 . LEU A 1 57  ? -6.790  -3.177  0.052   1.00 0.00 ? 57  LEU A HD23 4  
ATOM 5344  N N    . ALA A 1 58  ? -6.578  -2.661  4.656   1.00 0.00 ? 58  ALA A N    4  
ATOM 5345  C CA   . ALA A 1 58  ? -6.653  -2.636  6.107   1.00 0.00 ? 58  ALA A CA   4  
ATOM 5346  C C    . ALA A 1 58  ? -5.241  -2.737  6.688   1.00 0.00 ? 58  ALA A C    4  
ATOM 5347  O O    . ALA A 1 58  ? -4.343  -3.289  6.055   1.00 0.00 ? 58  ALA A O    4  
ATOM 5348  C CB   . ALA A 1 58  ? -7.564  -3.767  6.591   1.00 0.00 ? 58  ALA A CB   4  
ATOM 5349  H H    . ALA A 1 58  ? -5.651  -2.647  4.281   1.00 0.00 ? 58  ALA A H    4  
ATOM 5350  H HA   . ALA A 1 58  ? -7.091  -1.682  6.401   1.00 0.00 ? 58  ALA A HA   4  
ATOM 5351  H HB1  . ALA A 1 58  ? -7.384  -4.659  5.992   1.00 0.00 ? 58  ALA A HB1  4  
ATOM 5352  H HB2  . ALA A 1 58  ? -7.351  -3.982  7.638   1.00 0.00 ? 58  ALA A HB2  4  
ATOM 5353  H HB3  . ALA A 1 58  ? -8.605  -3.463  6.487   1.00 0.00 ? 58  ALA A HB3  4  
ATOM 5354  N N    . ALA A 1 59  ? -5.089  -2.194  7.887   1.00 0.00 ? 59  ALA A N    4  
ATOM 5355  C CA   . ALA A 1 59  ? -3.802  -2.215  8.561   1.00 0.00 ? 59  ALA A CA   4  
ATOM 5356  C C    . ALA A 1 59  ? -3.097  -3.540  8.262   1.00 0.00 ? 59  ALA A C    4  
ATOM 5357  O O    . ALA A 1 59  ? -3.741  -4.584  8.174   1.00 0.00 ? 59  ALA A O    4  
ATOM 5358  C CB   . ALA A 1 59  ? -4.006  -1.988  10.060  1.00 0.00 ? 59  ALA A CB   4  
ATOM 5359  H H    . ALA A 1 59  ? -5.824  -1.746  8.396   1.00 0.00 ? 59  ALA A H    4  
ATOM 5360  H HA   . ALA A 1 59  ? -3.204  -1.397  8.160   1.00 0.00 ? 59  ALA A HA   4  
ATOM 5361  H HB1  . ALA A 1 59  ? -3.411  -1.133  10.382  1.00 0.00 ? 59  ALA A HB1  4  
ATOM 5362  H HB2  . ALA A 1 59  ? -5.060  -1.793  10.258  1.00 0.00 ? 59  ALA A HB2  4  
ATOM 5363  H HB3  . ALA A 1 59  ? -3.692  -2.876  10.608  1.00 0.00 ? 59  ALA A HB3  4  
ATOM 5364  N N    . GLY A 1 60  ? -1.783  -3.454  8.116   1.00 0.00 ? 60  GLY A N    4  
ATOM 5365  C CA   . GLY A 1 60  ? -0.983  -4.633  7.829   1.00 0.00 ? 60  GLY A CA   4  
ATOM 5366  C C    . GLY A 1 60  ? -0.757  -4.790  6.324   1.00 0.00 ? 60  GLY A C    4  
ATOM 5367  O O    . GLY A 1 60  ? 0.061   -5.603  5.897   1.00 0.00 ? 60  GLY A O    4  
ATOM 5368  H H    . GLY A 1 60  ? -1.266  -2.601  8.189   1.00 0.00 ? 60  GLY A H    4  
ATOM 5369  H HA2  . GLY A 1 60  ? -0.023  -4.559  8.339   1.00 0.00 ? 60  GLY A HA2  4  
ATOM 5370  H HA3  . GLY A 1 60  ? -1.483  -5.520  8.219   1.00 0.00 ? 60  GLY A HA3  4  
ATOM 5371  N N    . ASP A 1 61  ? -1.497  -3.999  5.561   1.00 0.00 ? 61  ASP A N    4  
ATOM 5372  C CA   . ASP A 1 61  ? -1.388  -4.039  4.113   1.00 0.00 ? 61  ASP A CA   4  
ATOM 5373  C C    . ASP A 1 61  ? 0.005   -3.562  3.697   1.00 0.00 ? 61  ASP A C    4  
ATOM 5374  O O    . ASP A 1 61  ? 0.143   -2.521  3.057   1.00 0.00 ? 61  ASP A O    4  
ATOM 5375  C CB   . ASP A 1 61  ? -2.419  -3.119  3.457   1.00 0.00 ? 61  ASP A CB   4  
ATOM 5376  C CG   . ASP A 1 61  ? -3.469  -3.830  2.601   1.00 0.00 ? 61  ASP A CG   4  
ATOM 5377  O OD1  . ASP A 1 61  ? -4.491  -4.248  3.187   1.00 0.00 ? 61  ASP A OD1  4  
ATOM 5378  O OD2  . ASP A 1 61  ? -3.226  -3.939  1.379   1.00 0.00 ? 61  ASP A OD2  4  
ATOM 5379  H H    . ASP A 1 61  ? -2.161  -3.340  5.917   1.00 0.00 ? 61  ASP A H    4  
ATOM 5380  H HA   . ASP A 1 61  ? -1.571  -5.079  3.841   1.00 0.00 ? 61  ASP A HA   4  
ATOM 5381  H HB2  . ASP A 1 61  ? -2.929  -2.555  4.237   1.00 0.00 ? 61  ASP A HB2  4  
ATOM 5382  H HB3  . ASP A 1 61  ? -1.893  -2.396  2.833   1.00 0.00 ? 61  ASP A HB3  4  
ATOM 5383  N N    . GLN A 1 62  ? 1.003   -4.346  4.079   1.00 0.00 ? 62  GLN A N    4  
ATOM 5384  C CA   . GLN A 1 62  ? 2.380   -4.016  3.754   1.00 0.00 ? 62  GLN A CA   4  
ATOM 5385  C C    . GLN A 1 62  ? 2.523   -3.754  2.253   1.00 0.00 ? 62  GLN A C    4  
ATOM 5386  O O    . GLN A 1 62  ? 2.426   -4.678  1.446   1.00 0.00 ? 62  GLN A O    4  
ATOM 5387  C CB   . GLN A 1 62  ? 3.331   -5.124  4.211   1.00 0.00 ? 62  GLN A CB   4  
ATOM 5388  C CG   . GLN A 1 62  ? 4.791   -4.694  4.049   1.00 0.00 ? 62  GLN A CG   4  
ATOM 5389  C CD   . GLN A 1 62  ? 5.569   -5.703  3.202   1.00 0.00 ? 62  GLN A CD   4  
ATOM 5390  O OE1  . GLN A 1 62  ? 5.749   -5.541  2.006   1.00 0.00 ? 62  GLN A OE1  4  
ATOM 5391  N NE2  . GLN A 1 62  ? 6.018   -6.751  3.886   1.00 0.00 ? 62  GLN A NE2  4  
ATOM 5392  H H    . GLN A 1 62  ? 0.882   -5.191  4.600   1.00 0.00 ? 62  GLN A H    4  
ATOM 5393  H HA   . GLN A 1 62  ? 2.599   -3.105  4.311   1.00 0.00 ? 62  GLN A HA   4  
ATOM 5394  H HB2  . GLN A 1 62  ? 3.135   -5.370  5.254   1.00 0.00 ? 62  GLN A HB2  4  
ATOM 5395  H HB3  . GLN A 1 62  ? 3.148   -6.028  3.630   1.00 0.00 ? 62  GLN A HB3  4  
ATOM 5396  H HG2  . GLN A 1 62  ? 4.834   -3.711  3.580   1.00 0.00 ? 62  GLN A HG2  4  
ATOM 5397  H HG3  . GLN A 1 62  ? 5.257   -4.601  5.029   1.00 0.00 ? 62  GLN A HG3  4  
ATOM 5398  H HE21 . GLN A 1 62  ? 5.836   -6.824  4.867   1.00 0.00 ? 62  GLN A HE21 4  
ATOM 5399  H HE22 . GLN A 1 62  ? 6.539   -7.467  3.420   1.00 0.00 ? 62  GLN A HE22 4  
ATOM 5400  N N    . LEU A 1 63  ? 2.752   -2.492  1.924   1.00 0.00 ? 63  LEU A N    4  
ATOM 5401  C CA   . LEU A 1 63  ? 2.909   -2.097  0.535   1.00 0.00 ? 63  LEU A CA   4  
ATOM 5402  C C    . LEU A 1 63  ? 4.338   -2.401  0.081   1.00 0.00 ? 63  LEU A C    4  
ATOM 5403  O O    . LEU A 1 63  ? 5.288   -1.770  0.543   1.00 0.00 ? 63  LEU A O    4  
ATOM 5404  C CB   . LEU A 1 63  ? 2.502   -0.635  0.344   1.00 0.00 ? 63  LEU A CB   4  
ATOM 5405  C CG   . LEU A 1 63  ? 1.011   -0.328  0.497   1.00 0.00 ? 63  LEU A CG   4  
ATOM 5406  C CD1  . LEU A 1 63  ? 0.720   0.314   1.855   1.00 0.00 ? 63  LEU A CD1  4  
ATOM 5407  C CD2  . LEU A 1 63  ? 0.505   0.532   -0.663  1.00 0.00 ? 63  LEU A CD2  4  
ATOM 5408  H H    . LEU A 1 63  ? 2.829   -1.746  2.587   1.00 0.00 ? 63  LEU A H    4  
ATOM 5409  H HA   . LEU A 1 63  ? 2.223   -2.703  -0.057  1.00 0.00 ? 63  LEU A HA   4  
ATOM 5410  H HB2  . LEU A 1 63  ? 3.053   -0.028  1.062   1.00 0.00 ? 63  LEU A HB2  4  
ATOM 5411  H HB3  . LEU A 1 63  ? 2.817   -0.317  -0.650  1.00 0.00 ? 63  LEU A HB3  4  
ATOM 5412  H HG   . LEU A 1 63  ? 0.463   -1.270  0.463   1.00 0.00 ? 63  LEU A HG   4  
ATOM 5413  H HD11 . LEU A 1 63  ? 1.302   1.231   1.955   1.00 0.00 ? 63  LEU A HD11 4  
ATOM 5414  H HD12 . LEU A 1 63  ? -0.342  0.548   1.927   1.00 0.00 ? 63  LEU A HD12 4  
ATOM 5415  H HD13 . LEU A 1 63  ? 0.994   -0.378  2.651   1.00 0.00 ? 63  LEU A HD13 4  
ATOM 5416  H HD21 . LEU A 1 63  ? 1.118   0.347   -1.545  1.00 0.00 ? 63  LEU A HD21 4  
ATOM 5417  H HD22 . LEU A 1 63  ? -0.531  0.275   -0.881  1.00 0.00 ? 63  LEU A HD22 4  
ATOM 5418  H HD23 . LEU A 1 63  ? 0.569   1.585   -0.390  1.00 0.00 ? 63  LEU A HD23 4  
ATOM 5419  N N    . LEU A 1 64  ? 4.447   -3.369  -0.817  1.00 0.00 ? 64  LEU A N    4  
ATOM 5420  C CA   . LEU A 1 64  ? 5.744   -3.765  -1.338  1.00 0.00 ? 64  LEU A CA   4  
ATOM 5421  C C    . LEU A 1 64  ? 6.161   -2.797  -2.447  1.00 0.00 ? 64  LEU A C    4  
ATOM 5422  O O    . LEU A 1 64  ? 7.349   -2.541  -2.638  1.00 0.00 ? 64  LEU A O    4  
ATOM 5423  C CB   . LEU A 1 64  ? 5.720   -5.230  -1.778  1.00 0.00 ? 64  LEU A CB   4  
ATOM 5424  C CG   . LEU A 1 64  ? 7.035   -5.998  -1.625  1.00 0.00 ? 64  LEU A CG   4  
ATOM 5425  C CD1  . LEU A 1 64  ? 6.781   -7.501  -1.501  1.00 0.00 ? 64  LEU A CD1  4  
ATOM 5426  C CD2  . LEU A 1 64  ? 7.997   -5.671  -2.769  1.00 0.00 ? 64  LEU A CD2  4  
ATOM 5427  H H    . LEU A 1 64  ? 3.669   -3.878  -1.188  1.00 0.00 ? 64  LEU A H    4  
ATOM 5428  H HA   . LEU A 1 64  ? 6.462   -3.685  -0.522  1.00 0.00 ? 64  LEU A HA   4  
ATOM 5429  H HB2  . LEU A 1 64  ? 4.951   -5.749  -1.205  1.00 0.00 ? 64  LEU A HB2  4  
ATOM 5430  H HB3  . LEU A 1 64  ? 5.419   -5.270  -2.824  1.00 0.00 ? 64  LEU A HB3  4  
ATOM 5431  H HG   . LEU A 1 64  ? 7.513   -5.675  -0.700  1.00 0.00 ? 64  LEU A HG   4  
ATOM 5432  H HD11 . LEU A 1 64  ? 7.695   -8.045  -1.739  1.00 0.00 ? 64  LEU A HD11 4  
ATOM 5433  H HD12 . LEU A 1 64  ? 6.475   -7.735  -0.481  1.00 0.00 ? 64  LEU A HD12 4  
ATOM 5434  H HD13 . LEU A 1 64  ? 5.992   -7.795  -2.193  1.00 0.00 ? 64  LEU A HD13 4  
ATOM 5435  H HD21 . LEU A 1 64  ? 7.638   -4.794  -3.306  1.00 0.00 ? 64  LEU A HD21 4  
ATOM 5436  H HD22 . LEU A 1 64  ? 8.988   -5.468  -2.363  1.00 0.00 ? 64  LEU A HD22 4  
ATOM 5437  H HD23 . LEU A 1 64  ? 8.051   -6.519  -3.451  1.00 0.00 ? 64  LEU A HD23 4  
ATOM 5438  N N    . SER A 1 65  ? 5.160   -2.285  -3.149  1.00 0.00 ? 65  SER A N    4  
ATOM 5439  C CA   . SER A 1 65  ? 5.408   -1.351  -4.233  1.00 0.00 ? 65  SER A CA   4  
ATOM 5440  C C    . SER A 1 65  ? 4.124   -0.592  -4.574  1.00 0.00 ? 65  SER A C    4  
ATOM 5441  O O    . SER A 1 65  ? 3.029   -1.026  -4.218  1.00 0.00 ? 65  SER A O    4  
ATOM 5442  C CB   . SER A 1 65  ? 5.942   -2.073  -5.471  1.00 0.00 ? 65  SER A CB   4  
ATOM 5443  O OG   . SER A 1 65  ? 5.302   -3.330  -5.674  1.00 0.00 ? 65  SER A OG   4  
ATOM 5444  H H    . SER A 1 65  ? 4.197   -2.498  -2.986  1.00 0.00 ? 65  SER A H    4  
ATOM 5445  H HA   . SER A 1 65  ? 6.168   -0.666  -3.857  1.00 0.00 ? 65  SER A HA   4  
ATOM 5446  H HB2  . SER A 1 65  ? 5.794   -1.445  -6.350  1.00 0.00 ? 65  SER A HB2  4  
ATOM 5447  H HB3  . SER A 1 65  ? 7.016   -2.226  -5.367  1.00 0.00 ? 65  SER A HB3  4  
ATOM 5448  H HG   . SER A 1 65  ? 4.729   -3.294  -6.493  1.00 0.00 ? 65  SER A HG   4  
ATOM 5449  N N    . VAL A 1 66  ? 4.300   0.527   -5.261  1.00 0.00 ? 66  VAL A N    4  
ATOM 5450  C CA   . VAL A 1 66  ? 3.169   1.349   -5.654  1.00 0.00 ? 66  VAL A CA   4  
ATOM 5451  C C    . VAL A 1 66  ? 3.444   1.966   -7.027  1.00 0.00 ? 66  VAL A C    4  
ATOM 5452  O O    . VAL A 1 66  ? 4.432   2.678   -7.205  1.00 0.00 ? 66  VAL A O    4  
ATOM 5453  C CB   . VAL A 1 66  ? 2.882   2.396   -4.576  1.00 0.00 ? 66  VAL A CB   4  
ATOM 5454  C CG1  . VAL A 1 66  ? 1.731   3.313   -4.993  1.00 0.00 ? 66  VAL A CG1  4  
ATOM 5455  C CG2  . VAL A 1 66  ? 2.593   1.730   -3.229  1.00 0.00 ? 66  VAL A CG2  4  
ATOM 5456  H H    . VAL A 1 66  ? 5.193   0.873   -5.548  1.00 0.00 ? 66  VAL A H    4  
ATOM 5457  H HA   . VAL A 1 66  ? 2.298   0.697   -5.731  1.00 0.00 ? 66  VAL A HA   4  
ATOM 5458  H HB   . VAL A 1 66  ? 3.775   3.011   -4.460  1.00 0.00 ? 66  VAL A HB   4  
ATOM 5459  H HG11 . VAL A 1 66  ? 0.805   2.739   -5.032  1.00 0.00 ? 66  VAL A HG11 4  
ATOM 5460  H HG12 . VAL A 1 66  ? 1.627   4.120   -4.267  1.00 0.00 ? 66  VAL A HG12 4  
ATOM 5461  H HG13 . VAL A 1 66  ? 1.939   3.733   -5.977  1.00 0.00 ? 66  VAL A HG13 4  
ATOM 5462  H HG21 . VAL A 1 66  ? 3.479   1.193   -2.891  1.00 0.00 ? 66  VAL A HG21 4  
ATOM 5463  H HG22 . VAL A 1 66  ? 2.329   2.492   -2.496  1.00 0.00 ? 66  VAL A HG22 4  
ATOM 5464  H HG23 . VAL A 1 66  ? 1.764   1.031   -3.340  1.00 0.00 ? 66  VAL A HG23 4  
ATOM 5465  N N    . ASP A 1 67  ? 2.554   1.671   -7.963  1.00 0.00 ? 67  ASP A N    4  
ATOM 5466  C CA   . ASP A 1 67  ? 2.690   2.187   -9.314  1.00 0.00 ? 67  ASP A CA   4  
ATOM 5467  C C    . ASP A 1 67  ? 4.078   1.835   -9.854  1.00 0.00 ? 67  ASP A C    4  
ATOM 5468  O O    . ASP A 1 67  ? 4.669   2.606   -10.607 1.00 0.00 ? 67  ASP A O    4  
ATOM 5469  C CB   . ASP A 1 67  ? 2.546   3.710   -9.339  1.00 0.00 ? 67  ASP A CB   4  
ATOM 5470  C CG   . ASP A 1 67  ? 1.907   4.279   -10.607 1.00 0.00 ? 67  ASP A CG   4  
ATOM 5471  O OD1  . ASP A 1 67  ? 0.709   3.990   -10.818 1.00 0.00 ? 67  ASP A OD1  4  
ATOM 5472  O OD2  . ASP A 1 67  ? 2.630   4.990   -11.337 1.00 0.00 ? 67  ASP A OD2  4  
ATOM 5473  H H    . ASP A 1 67  ? 1.754   1.091   -7.810  1.00 0.00 ? 67  ASP A H    4  
ATOM 5474  H HA   . ASP A 1 67  ? 1.889   1.715   -9.883  1.00 0.00 ? 67  ASP A HA   4  
ATOM 5475  H HB2  . ASP A 1 67  ? 1.949   4.018   -8.480  1.00 0.00 ? 67  ASP A HB2  4  
ATOM 5476  H HB3  . ASP A 1 67  ? 3.533   4.155   -9.217  1.00 0.00 ? 67  ASP A HB3  4  
ATOM 5477  N N    . GLY A 1 68  ? 4.557   0.668   -9.447  1.00 0.00 ? 68  GLY A N    4  
ATOM 5478  C CA   . GLY A 1 68  ? 5.864   0.204   -9.880  1.00 0.00 ? 68  GLY A CA   4  
ATOM 5479  C C    . GLY A 1 68  ? 6.950   0.620   -8.886  1.00 0.00 ? 68  GLY A C    4  
ATOM 5480  O O    . GLY A 1 68  ? 7.932   -0.097  -8.698  1.00 0.00 ? 68  GLY A O    4  
ATOM 5481  H H    . GLY A 1 68  ? 4.069   0.047   -8.834  1.00 0.00 ? 68  GLY A H    4  
ATOM 5482  H HA2  . GLY A 1 68  ? 5.853   -0.881  -9.980  1.00 0.00 ? 68  GLY A HA2  4  
ATOM 5483  H HA3  . GLY A 1 68  ? 6.091   0.613   -10.865 1.00 0.00 ? 68  GLY A HA3  4  
ATOM 5484  N N    . ARG A 1 69  ? 6.738   1.777   -8.276  1.00 0.00 ? 69  ARG A N    4  
ATOM 5485  C CA   . ARG A 1 69  ? 7.687   2.296   -7.306  1.00 0.00 ? 69  ARG A CA   4  
ATOM 5486  C C    . ARG A 1 69  ? 7.632   1.475   -6.017  1.00 0.00 ? 69  ARG A C    4  
ATOM 5487  O O    . ARG A 1 69  ? 6.605   1.442   -5.341  1.00 0.00 ? 69  ARG A O    4  
ATOM 5488  C CB   . ARG A 1 69  ? 7.395   3.763   -6.981  1.00 0.00 ? 69  ARG A CB   4  
ATOM 5489  C CG   . ARG A 1 69  ? 8.519   4.372   -6.140  1.00 0.00 ? 69  ARG A CG   4  
ATOM 5490  C CD   . ARG A 1 69  ? 8.995   5.697   -6.738  1.00 0.00 ? 69  ARG A CD   4  
ATOM 5491  N NE   . ARG A 1 69  ? 10.451  5.856   -6.521  1.00 0.00 ? 69  ARG A NE   4  
ATOM 5492  C CZ   . ARG A 1 69  ? 11.163  6.908   -6.947  1.00 0.00 ? 69  ARG A CZ   4  
ATOM 5493  N NH1  . ARG A 1 69  ? 10.559  7.900   -7.615  1.00 0.00 ? 69  ARG A NH1  4  
ATOM 5494  N NH2  . ARG A 1 69  ? 12.480  6.968   -6.704  1.00 0.00 ? 69  ARG A NH2  4  
ATOM 5495  H H    . ARG A 1 69  ? 5.937   2.354   -8.435  1.00 0.00 ? 69  ARG A H    4  
ATOM 5496  H HA   . ARG A 1 69  ? 8.660   2.203   -7.790  1.00 0.00 ? 69  ARG A HA   4  
ATOM 5497  H HB2  . ARG A 1 69  ? 7.282   4.328   -7.906  1.00 0.00 ? 69  ARG A HB2  4  
ATOM 5498  H HB3  . ARG A 1 69  ? 6.451   3.839   -6.443  1.00 0.00 ? 69  ARG A HB3  4  
ATOM 5499  H HG2  . ARG A 1 69  ? 8.168   4.534   -5.121  1.00 0.00 ? 69  ARG A HG2  4  
ATOM 5500  H HG3  . ARG A 1 69  ? 9.354   3.674   -6.082  1.00 0.00 ? 69  ARG A HG3  4  
ATOM 5501  H HD2  . ARG A 1 69  ? 8.773   5.725   -7.805  1.00 0.00 ? 69  ARG A HD2  4  
ATOM 5502  H HD3  . ARG A 1 69  ? 8.458   6.527   -6.279  1.00 0.00 ? 69  ARG A HD3  4  
ATOM 5503  H HE   . ARG A 1 69  ? 10.932  5.134   -6.025  1.00 0.00 ? 69  ARG A HE   4  
ATOM 5504  H HH11 . ARG A 1 69  ? 9.577   7.855   -7.796  1.00 0.00 ? 69  ARG A HH11 4  
ATOM 5505  H HH12 . ARG A 1 69  ? 11.091  8.685   -7.933  1.00 0.00 ? 69  ARG A HH12 4  
ATOM 5506  H HH21 . ARG A 1 69  ? 12.930  6.228   -6.206  1.00 0.00 ? 69  ARG A HH21 4  
ATOM 5507  H HH22 . ARG A 1 69  ? 13.011  7.753   -7.022  1.00 0.00 ? 69  ARG A HH22 4  
ATOM 5508  N N    . SER A 1 70  ? 8.750   0.831   -5.715  1.00 0.00 ? 70  SER A N    4  
ATOM 5509  C CA   . SER A 1 70  ? 8.842   0.012   -4.518  1.00 0.00 ? 70  SER A CA   4  
ATOM 5510  C C    . SER A 1 70  ? 8.421   0.826   -3.293  1.00 0.00 ? 70  SER A C    4  
ATOM 5511  O O    . SER A 1 70  ? 8.781   1.995   -3.167  1.00 0.00 ? 70  SER A O    4  
ATOM 5512  C CB   . SER A 1 70  ? 10.259  -0.534  -4.332  1.00 0.00 ? 70  SER A CB   4  
ATOM 5513  O OG   . SER A 1 70  ? 10.314  -1.947  -4.503  1.00 0.00 ? 70  SER A OG   4  
ATOM 5514  H H    . SER A 1 70  ? 9.581   0.863   -6.270  1.00 0.00 ? 70  SER A H    4  
ATOM 5515  H HA   . SER A 1 70  ? 8.153   -0.816  -4.682  1.00 0.00 ? 70  SER A HA   4  
ATOM 5516  H HB2  . SER A 1 70  ? 10.929  -0.056  -5.048  1.00 0.00 ? 70  SER A HB2  4  
ATOM 5517  H HB3  . SER A 1 70  ? 10.620  -0.275  -3.337  1.00 0.00 ? 70  SER A HB3  4  
ATOM 5518  H HG   . SER A 1 70  ? 9.829   -2.401  -3.755  1.00 0.00 ? 70  SER A HG   4  
ATOM 5519  N N    . LEU A 1 71  ? 7.665   0.175   -2.421  1.00 0.00 ? 71  LEU A N    4  
ATOM 5520  C CA   . LEU A 1 71  ? 7.192   0.824   -1.210  1.00 0.00 ? 71  LEU A CA   4  
ATOM 5521  C C    . LEU A 1 71  ? 7.688   0.044   0.009   1.00 0.00 ? 71  LEU A C    4  
ATOM 5522  O O    . LEU A 1 71  ? 7.498   0.474   1.145   1.00 0.00 ? 71  LEU A O    4  
ATOM 5523  C CB   . LEU A 1 71  ? 5.672   0.995   -1.253  1.00 0.00 ? 71  LEU A CB   4  
ATOM 5524  C CG   . LEU A 1 71  ? 5.141   2.374   -0.854  1.00 0.00 ? 71  LEU A CG   4  
ATOM 5525  C CD1  . LEU A 1 71  ? 5.067   3.305   -2.066  1.00 0.00 ? 71  LEU A CD1  4  
ATOM 5526  C CD2  . LEU A 1 71  ? 3.794   2.256   -0.139  1.00 0.00 ? 71  LEU A CD2  4  
ATOM 5527  H H    . LEU A 1 71  ? 7.377   -0.776  -2.531  1.00 0.00 ? 71  LEU A H    4  
ATOM 5528  H HA   . LEU A 1 71  ? 7.628   1.822   -1.183  1.00 0.00 ? 71  LEU A HA   4  
ATOM 5529  H HB2  . LEU A 1 71  ? 5.330   0.775   -2.265  1.00 0.00 ? 71  LEU A HB2  4  
ATOM 5530  H HB3  . LEU A 1 71  ? 5.224   0.251   -0.596  1.00 0.00 ? 71  LEU A HB3  4  
ATOM 5531  H HG   . LEU A 1 71  ? 5.842   2.819   -0.149  1.00 0.00 ? 71  LEU A HG   4  
ATOM 5532  H HD11 . LEU A 1 71  ? 5.545   2.826   -2.921  1.00 0.00 ? 71  LEU A HD11 4  
ATOM 5533  H HD12 . LEU A 1 71  ? 4.023   3.512   -2.302  1.00 0.00 ? 71  LEU A HD12 4  
ATOM 5534  H HD13 . LEU A 1 71  ? 5.581   4.239   -1.838  1.00 0.00 ? 71  LEU A HD13 4  
ATOM 5535  H HD21 . LEU A 1 71  ? 3.101   1.686   -0.759  1.00 0.00 ? 71  LEU A HD21 4  
ATOM 5536  H HD22 . LEU A 1 71  ? 3.932   1.746   0.814   1.00 0.00 ? 71  LEU A HD22 4  
ATOM 5537  H HD23 . LEU A 1 71  ? 3.388   3.252   0.038   1.00 0.00 ? 71  LEU A HD23 4  
ATOM 5538  N N    . VAL A 1 72  ? 8.315   -1.090  -0.269  1.00 0.00 ? 72  VAL A N    4  
ATOM 5539  C CA   . VAL A 1 72  ? 8.840   -1.934  0.790   1.00 0.00 ? 72  VAL A CA   4  
ATOM 5540  C C    . VAL A 1 72  ? 10.028  -1.234  1.453   1.00 0.00 ? 72  VAL A C    4  
ATOM 5541  O O    . VAL A 1 72  ? 11.119  -1.796  1.533   1.00 0.00 ? 72  VAL A O    4  
ATOM 5542  C CB   . VAL A 1 72  ? 9.195   -3.314  0.233   1.00 0.00 ? 72  VAL A CB   4  
ATOM 5543  C CG1  . VAL A 1 72  ? 10.549  -3.287  -0.479  1.00 0.00 ? 72  VAL A CG1  4  
ATOM 5544  C CG2  . VAL A 1 72  ? 9.177   -4.373  1.337   1.00 0.00 ? 72  VAL A CG2  4  
ATOM 5545  H H    . VAL A 1 72  ? 8.466   -1.433  -1.197  1.00 0.00 ? 72  VAL A H    4  
ATOM 5546  H HA   . VAL A 1 72  ? 8.051   -2.062  1.531   1.00 0.00 ? 72  VAL A HA   4  
ATOM 5547  H HB   . VAL A 1 72  ? 8.436   -3.584  -0.502  1.00 0.00 ? 72  VAL A HB   4  
ATOM 5548  H HG11 . VAL A 1 72  ? 10.527  -3.970  -1.327  1.00 0.00 ? 72  VAL A HG11 4  
ATOM 5549  H HG12 . VAL A 1 72  ? 10.753  -2.276  -0.832  1.00 0.00 ? 72  VAL A HG12 4  
ATOM 5550  H HG13 . VAL A 1 72  ? 11.331  -3.594  0.216   1.00 0.00 ? 72  VAL A HG13 4  
ATOM 5551  H HG21 . VAL A 1 72  ? 9.906   -5.150  1.107   1.00 0.00 ? 72  VAL A HG21 4  
ATOM 5552  H HG22 . VAL A 1 72  ? 9.430   -3.908  2.290   1.00 0.00 ? 72  VAL A HG22 4  
ATOM 5553  H HG23 . VAL A 1 72  ? 8.183   -4.815  1.401   1.00 0.00 ? 72  VAL A HG23 4  
ATOM 5554  N N    . GLY A 1 73  ? 9.776   -0.017  1.912   1.00 0.00 ? 73  GLY A N    4  
ATOM 5555  C CA   . GLY A 1 73  ? 10.811  0.766   2.565   1.00 0.00 ? 73  GLY A CA   4  
ATOM 5556  C C    . GLY A 1 73  ? 10.822  2.205   2.043   1.00 0.00 ? 73  GLY A C    4  
ATOM 5557  O O    . GLY A 1 73  ? 11.883  2.755   1.752   1.00 0.00 ? 73  GLY A O    4  
ATOM 5558  H H    . GLY A 1 73  ? 8.886   0.434   1.843   1.00 0.00 ? 73  GLY A H    4  
ATOM 5559  H HA2  . GLY A 1 73  ? 10.645  0.768   3.642   1.00 0.00 ? 73  GLY A HA2  4  
ATOM 5560  H HA3  . GLY A 1 73  ? 11.784  0.306   2.392   1.00 0.00 ? 73  GLY A HA3  4  
ATOM 5561  N N    . LEU A 1 74  ? 9.629   2.772   1.940   1.00 0.00 ? 74  LEU A N    4  
ATOM 5562  C CA   . LEU A 1 74  ? 9.488   4.136   1.458   1.00 0.00 ? 74  LEU A CA   4  
ATOM 5563  C C    . LEU A 1 74  ? 9.127   5.051   2.630   1.00 0.00 ? 74  LEU A C    4  
ATOM 5564  O O    . LEU A 1 74  ? 9.048   4.602   3.772   1.00 0.00 ? 74  LEU A O    4  
ATOM 5565  C CB   . LEU A 1 74  ? 8.489   4.194   0.301   1.00 0.00 ? 74  LEU A CB   4  
ATOM 5566  C CG   . LEU A 1 74  ? 9.089   4.157   -1.106  1.00 0.00 ? 74  LEU A CG   4  
ATOM 5567  C CD1  . LEU A 1 74  ? 8.028   4.467   -2.163  1.00 0.00 ? 74  LEU A CD1  4  
ATOM 5568  C CD2  . LEU A 1 74  ? 10.295  5.092   -1.213  1.00 0.00 ? 74  LEU A CD2  4  
ATOM 5569  H H    . LEU A 1 74  ? 8.771   2.317   2.179   1.00 0.00 ? 74  LEU A H    4  
ATOM 5570  H HA   . LEU A 1 74  ? 10.456  4.445   1.064   1.00 0.00 ? 74  LEU A HA   4  
ATOM 5571  H HB2  . LEU A 1 74  ? 7.797   3.358   0.402   1.00 0.00 ? 74  LEU A HB2  4  
ATOM 5572  H HB3  . LEU A 1 74  ? 7.902   5.108   0.400   1.00 0.00 ? 74  LEU A HB3  4  
ATOM 5573  H HG   . LEU A 1 74  ? 9.448   3.145   -1.297  1.00 0.00 ? 74  LEU A HG   4  
ATOM 5574  H HD11 . LEU A 1 74  ? 7.417   3.581   -2.336  1.00 0.00 ? 74  LEU A HD11 4  
ATOM 5575  H HD12 . LEU A 1 74  ? 7.394   5.282   -1.814  1.00 0.00 ? 74  LEU A HD12 4  
ATOM 5576  H HD13 . LEU A 1 74  ? 8.516   4.759   -3.093  1.00 0.00 ? 74  LEU A HD13 4  
ATOM 5577  H HD21 . LEU A 1 74  ? 10.241  5.846   -0.428  1.00 0.00 ? 74  LEU A HD21 4  
ATOM 5578  H HD22 . LEU A 1 74  ? 11.213  4.515   -1.100  1.00 0.00 ? 74  LEU A HD22 4  
ATOM 5579  H HD23 . LEU A 1 74  ? 10.291  5.581   -2.187  1.00 0.00 ? 74  LEU A HD23 4  
ATOM 5580  N N    . SER A 1 75  ? 8.917   6.319   2.306   1.00 0.00 ? 75  SER A N    4  
ATOM 5581  C CA   . SER A 1 75  ? 8.565   7.301   3.317   1.00 0.00 ? 75  SER A CA   4  
ATOM 5582  C C    . SER A 1 75  ? 7.133   7.790   3.096   1.00 0.00 ? 75  SER A C    4  
ATOM 5583  O O    . SER A 1 75  ? 6.721   8.025   1.961   1.00 0.00 ? 75  SER A O    4  
ATOM 5584  C CB   . SER A 1 75  ? 9.538   8.482   3.299   1.00 0.00 ? 75  SER A CB   4  
ATOM 5585  O OG   . SER A 1 75  ? 8.879   9.720   3.551   1.00 0.00 ? 75  SER A OG   4  
ATOM 5586  H H    . SER A 1 75  ? 8.982   6.676   1.374   1.00 0.00 ? 75  SER A H    4  
ATOM 5587  H HA   . SER A 1 75  ? 8.648   6.777   4.269   1.00 0.00 ? 75  SER A HA   4  
ATOM 5588  H HB2  . SER A 1 75  ? 10.313  8.324   4.049   1.00 0.00 ? 75  SER A HB2  4  
ATOM 5589  H HB3  . SER A 1 75  ? 10.036  8.527   2.330   1.00 0.00 ? 75  SER A HB3  4  
ATOM 5590  H HG   . SER A 1 75  ? 8.404   9.682   4.430   1.00 0.00 ? 75  SER A HG   4  
ATOM 5591  N N    . GLN A 1 76  ? 6.412   7.929   4.199   1.00 0.00 ? 76  GLN A N    4  
ATOM 5592  C CA   . GLN A 1 76  ? 5.034   8.386   4.140   1.00 0.00 ? 76  GLN A CA   4  
ATOM 5593  C C    . GLN A 1 76  ? 4.887   9.497   3.099   1.00 0.00 ? 76  GLN A C    4  
ATOM 5594  O O    . GLN A 1 76  ? 4.007   9.438   2.242   1.00 0.00 ? 76  GLN A O    4  
ATOM 5595  C CB   . GLN A 1 76  ? 4.553   8.855   5.515   1.00 0.00 ? 76  GLN A CB   4  
ATOM 5596  C CG   . GLN A 1 76  ? 3.050   9.142   5.501   1.00 0.00 ? 76  GLN A CG   4  
ATOM 5597  C CD   . GLN A 1 76  ? 2.697   10.263  6.480   1.00 0.00 ? 76  GLN A CD   4  
ATOM 5598  O OE1  . GLN A 1 76  ? 3.529   10.760  7.221   1.00 0.00 ? 76  GLN A OE1  4  
ATOM 5599  N NE2  . GLN A 1 76  ? 1.419   10.632  6.442   1.00 0.00 ? 76  GLN A NE2  4  
ATOM 5600  H H    . GLN A 1 76  ? 6.754   7.735   5.119   1.00 0.00 ? 76  GLN A H    4  
ATOM 5601  H HA   . GLN A 1 76  ? 4.453   7.515   3.836   1.00 0.00 ? 76  GLN A HA   4  
ATOM 5602  H HB2  . GLN A 1 76  ? 4.774   8.092   6.261   1.00 0.00 ? 76  GLN A HB2  4  
ATOM 5603  H HB3  . GLN A 1 76  ? 5.095   9.754   5.807   1.00 0.00 ? 76  GLN A HB3  4  
ATOM 5604  H HG2  . GLN A 1 76  ? 2.739   9.421   4.494   1.00 0.00 ? 76  GLN A HG2  4  
ATOM 5605  H HG3  . GLN A 1 76  ? 2.501   8.238   5.765   1.00 0.00 ? 76  GLN A HG3  4  
ATOM 5606  H HE21 . GLN A 1 76  ? 0.788   10.183  5.810   1.00 0.00 ? 76  GLN A HE21 4  
ATOM 5607  H HE22 . GLN A 1 76  ? 1.091   11.359  7.045   1.00 0.00 ? 76  GLN A HE22 4  
ATOM 5608  N N    . GLU A 1 77  ? 5.763   10.485  3.208   1.00 0.00 ? 77  GLU A N    4  
ATOM 5609  C CA   . GLU A 1 77  ? 5.742   11.609  2.287   1.00 0.00 ? 77  GLU A CA   4  
ATOM 5610  C C    . GLU A 1 77  ? 5.778   11.110  0.841   1.00 0.00 ? 77  GLU A C    4  
ATOM 5611  O O    . GLU A 1 77  ? 4.973   11.537  0.013   1.00 0.00 ? 77  GLU A O    4  
ATOM 5612  C CB   . GLU A 1 77  ? 6.902   12.567  2.564   1.00 0.00 ? 77  GLU A CB   4  
ATOM 5613  C CG   . GLU A 1 77  ? 6.454   14.024  2.429   1.00 0.00 ? 77  GLU A CG   4  
ATOM 5614  C CD   . GLU A 1 77  ? 7.326   14.775  1.421   1.00 0.00 ? 77  GLU A CD   4  
ATOM 5615  O OE1  . GLU A 1 77  ? 8.536   14.909  1.706   1.00 0.00 ? 77  GLU A OE1  4  
ATOM 5616  O OE2  . GLU A 1 77  ? 6.763   15.198  0.388   1.00 0.00 ? 77  GLU A OE2  4  
ATOM 5617  H H    . GLU A 1 77  ? 6.476   10.526  3.908   1.00 0.00 ? 77  GLU A H    4  
ATOM 5618  H HA   . GLU A 1 77  ? 4.800   12.123  2.478   1.00 0.00 ? 77  GLU A HA   4  
ATOM 5619  H HB2  . GLU A 1 77  ? 7.289   12.394  3.568   1.00 0.00 ? 77  GLU A HB2  4  
ATOM 5620  H HB3  . GLU A 1 77  ? 7.718   12.368  1.869   1.00 0.00 ? 77  GLU A HB3  4  
ATOM 5621  H HG2  . GLU A 1 77  ? 5.412   14.059  2.112   1.00 0.00 ? 77  GLU A HG2  4  
ATOM 5622  H HG3  . GLU A 1 77  ? 6.508   14.516  3.400   1.00 0.00 ? 77  GLU A HG3  4  
ATOM 5623  N N    . ARG A 1 78  ? 6.718   10.213  0.580   1.00 0.00 ? 78  ARG A N    4  
ATOM 5624  C CA   . ARG A 1 78  ? 6.868   9.652   -0.752  1.00 0.00 ? 78  ARG A CA   4  
ATOM 5625  C C    . ARG A 1 78  ? 5.664   8.773   -1.096  1.00 0.00 ? 78  ARG A C    4  
ATOM 5626  O O    . ARG A 1 78  ? 4.902   9.087   -2.009  1.00 0.00 ? 78  ARG A O    4  
ATOM 5627  C CB   . ARG A 1 78  ? 8.147   8.819   -0.857  1.00 0.00 ? 78  ARG A CB   4  
ATOM 5628  C CG   . ARG A 1 78  ? 9.108   9.418   -1.885  1.00 0.00 ? 78  ARG A CG   4  
ATOM 5629  C CD   . ARG A 1 78  ? 10.555  9.340   -1.393  1.00 0.00 ? 78  ARG A CD   4  
ATOM 5630  N NE   . ARG A 1 78  ? 11.118  10.703  -1.260  1.00 0.00 ? 78  ARG A NE   4  
ATOM 5631  C CZ   . ARG A 1 78  ? 10.968  11.480  -0.167  1.00 0.00 ? 78  ARG A CZ   4  
ATOM 5632  N NH1  . ARG A 1 78  ? 10.271  11.035  0.900   1.00 0.00 ? 78  ARG A NH1  4  
ATOM 5633  N NH2  . ARG A 1 78  ? 11.514  12.682  -0.156  1.00 0.00 ? 78  ARG A NH2  4  
ATOM 5634  H H    . ARG A 1 78  ? 7.368   9.872   1.259   1.00 0.00 ? 78  ARG A H    4  
ATOM 5635  H HA   . ARG A 1 78  ? 6.925   10.516  -1.414  1.00 0.00 ? 78  ARG A HA   4  
ATOM 5636  H HB2  . ARG A 1 78  ? 8.634   8.770   0.117   1.00 0.00 ? 78  ARG A HB2  4  
ATOM 5637  H HB3  . ARG A 1 78  ? 7.897   7.796   -1.140  1.00 0.00 ? 78  ARG A HB3  4  
ATOM 5638  H HG2  . ARG A 1 78  ? 9.014   8.884   -2.831  1.00 0.00 ? 78  ARG A HG2  4  
ATOM 5639  H HG3  . ARG A 1 78  ? 8.841   10.457  -2.077  1.00 0.00 ? 78  ARG A HG3  4  
ATOM 5640  H HD2  . ARG A 1 78  ? 10.594  8.827   -0.433  1.00 0.00 ? 78  ARG A HD2  4  
ATOM 5641  H HD3  . ARG A 1 78  ? 11.155  8.757   -2.091  1.00 0.00 ? 78  ARG A HD3  4  
ATOM 5642  H HE   . ARG A 1 78  ? 11.642  11.071  -2.028  1.00 0.00 ? 78  ARG A HE   4  
ATOM 5643  H HH11 . ARG A 1 78  ? 9.860   10.123  0.884   1.00 0.00 ? 78  ARG A HH11 4  
ATOM 5644  H HH12 . ARG A 1 78  ? 10.164  11.617  1.706   1.00 0.00 ? 78  ARG A HH12 4  
ATOM 5645  H HH21 . ARG A 1 78  ? 11.450  13.319  0.612   1.00 0.00 ? 78  ARG A HH21 4  
ATOM 5646  N N    . ALA A 1 79  ? 5.531   7.688   -0.347  1.00 0.00 ? 79  ALA A N    4  
ATOM 5647  C CA   . ALA A 1 79  ? 4.433   6.760   -0.562  1.00 0.00 ? 79  ALA A CA   4  
ATOM 5648  C C    . ALA A 1 79  ? 3.130   7.547   -0.713  1.00 0.00 ? 79  ALA A C    4  
ATOM 5649  O O    . ALA A 1 79  ? 2.256   7.164   -1.490  1.00 0.00 ? 79  ALA A O    4  
ATOM 5650  C CB   . ALA A 1 79  ? 4.379   5.757   0.592   1.00 0.00 ? 79  ALA A CB   4  
ATOM 5651  H H    . ALA A 1 79  ? 6.156   7.439   0.393   1.00 0.00 ? 79  ALA A H    4  
ATOM 5652  H HA   . ALA A 1 79  ? 4.631   6.220   -1.488  1.00 0.00 ? 79  ALA A HA   4  
ATOM 5653  H HB1  . ALA A 1 79  ? 4.774   6.221   1.496   1.00 0.00 ? 79  ALA A HB1  4  
ATOM 5654  H HB2  . ALA A 1 79  ? 3.346   5.454   0.761   1.00 0.00 ? 79  ALA A HB2  4  
ATOM 5655  H HB3  . ALA A 1 79  ? 4.978   4.882   0.341   1.00 0.00 ? 79  ALA A HB3  4  
ATOM 5656  N N    . ALA A 1 80  ? 3.039   8.632   0.042   1.00 0.00 ? 80  ALA A N    4  
ATOM 5657  C CA   . ALA A 1 80  ? 1.857   9.475   0.002   1.00 0.00 ? 80  ALA A CA   4  
ATOM 5658  C C    . ALA A 1 80  ? 1.792   10.191  -1.349  1.00 0.00 ? 80  ALA A C    4  
ATOM 5659  O O    . ALA A 1 80  ? 0.723   10.297  -1.948  1.00 0.00 ? 80  ALA A O    4  
ATOM 5660  C CB   . ALA A 1 80  ? 1.886   10.452  1.179   1.00 0.00 ? 80  ALA A CB   4  
ATOM 5661  H H    . ALA A 1 80  ? 3.754   8.936   0.672   1.00 0.00 ? 80  ALA A H    4  
ATOM 5662  H HA   . ALA A 1 80  ? 0.985   8.829   0.104   1.00 0.00 ? 80  ALA A HA   4  
ATOM 5663  H HB1  . ALA A 1 80  ? 1.822   9.897   2.114   1.00 0.00 ? 80  ALA A HB1  4  
ATOM 5664  H HB2  . ALA A 1 80  ? 2.817   11.020  1.156   1.00 0.00 ? 80  ALA A HB2  4  
ATOM 5665  H HB3  . ALA A 1 80  ? 1.041   11.136  1.104   1.00 0.00 ? 80  ALA A HB3  4  
ATOM 5666  N N    . GLU A 1 81  ? 2.949   10.663  -1.788  1.00 0.00 ? 81  GLU A N    4  
ATOM 5667  C CA   . GLU A 1 81  ? 3.037   11.366  -3.057  1.00 0.00 ? 81  GLU A CA   4  
ATOM 5668  C C    . GLU A 1 81  ? 2.650   10.434  -4.208  1.00 0.00 ? 81  GLU A C    4  
ATOM 5669  O O    . GLU A 1 81  ? 1.964   10.847  -5.142  1.00 0.00 ? 81  GLU A O    4  
ATOM 5670  C CB   . GLU A 1 81  ? 4.438   11.944  -3.268  1.00 0.00 ? 81  GLU A CB   4  
ATOM 5671  C CG   . GLU A 1 81  ? 4.442   13.460  -3.060  1.00 0.00 ? 81  GLU A CG   4  
ATOM 5672  C CD   . GLU A 1 81  ? 4.505   14.197  -4.399  1.00 0.00 ? 81  GLU A CD   4  
ATOM 5673  O OE1  . GLU A 1 81  ? 3.473   14.182  -5.104  1.00 0.00 ? 81  GLU A OE1  4  
ATOM 5674  O OE2  . GLU A 1 81  ? 5.584   14.758  -4.688  1.00 0.00 ? 81  GLU A OE2  4  
ATOM 5675  H H    . GLU A 1 81  ? 3.814   10.572  -1.295  1.00 0.00 ? 81  GLU A H    4  
ATOM 5676  H HA   . GLU A 1 81  ? 2.320   12.183  -2.986  1.00 0.00 ? 81  GLU A HA   4  
ATOM 5677  H HB2  . GLU A 1 81  ? 5.136   11.476  -2.574  1.00 0.00 ? 81  GLU A HB2  4  
ATOM 5678  H HB3  . GLU A 1 81  ? 4.784   11.710  -4.274  1.00 0.00 ? 81  GLU A HB3  4  
ATOM 5679  H HG2  . GLU A 1 81  ? 3.544   13.759  -2.518  1.00 0.00 ? 81  GLU A HG2  4  
ATOM 5680  H HG3  . GLU A 1 81  ? 5.295   13.744  -2.444  1.00 0.00 ? 81  GLU A HG3  4  
ATOM 5681  N N    . LEU A 1 82  ? 3.106   9.195   -4.103  1.00 0.00 ? 82  LEU A N    4  
ATOM 5682  C CA   . LEU A 1 82  ? 2.816   8.201   -5.123  1.00 0.00 ? 82  LEU A CA   4  
ATOM 5683  C C    . LEU A 1 82  ? 1.334   7.830   -5.059  1.00 0.00 ? 82  LEU A C    4  
ATOM 5684  O O    . LEU A 1 82  ? 0.665   7.754   -6.089  1.00 0.00 ? 82  LEU A O    4  
ATOM 5685  C CB   . LEU A 1 82  ? 3.757   7.003   -4.986  1.00 0.00 ? 82  LEU A CB   4  
ATOM 5686  C CG   . LEU A 1 82  ? 5.246   7.291   -5.192  1.00 0.00 ? 82  LEU A CG   4  
ATOM 5687  C CD1  . LEU A 1 82  ? 6.103   6.453   -4.242  1.00 0.00 ? 82  LEU A CD1  4  
ATOM 5688  C CD2  . LEU A 1 82  ? 5.646   7.089   -6.655  1.00 0.00 ? 82  LEU A CD2  4  
ATOM 5689  H H    . LEU A 1 82  ? 3.664   8.867   -3.340  1.00 0.00 ? 82  LEU A H    4  
ATOM 5690  H HA   . LEU A 1 82  ? 3.017   8.660   -6.091  1.00 0.00 ? 82  LEU A HA   4  
ATOM 5691  H HB2  . LEU A 1 82  ? 3.625   6.573   -3.993  1.00 0.00 ? 82  LEU A HB2  4  
ATOM 5692  H HB3  . LEU A 1 82  ? 3.452   6.243   -5.705  1.00 0.00 ? 82  LEU A HB3  4  
ATOM 5693  H HG   . LEU A 1 82  ? 5.427   8.339   -4.951  1.00 0.00 ? 82  LEU A HG   4  
ATOM 5694  H HD11 . LEU A 1 82  ? 7.154   6.554   -4.516  1.00 0.00 ? 82  LEU A HD11 4  
ATOM 5695  H HD12 . LEU A 1 82  ? 5.960   6.802   -3.219  1.00 0.00 ? 82  LEU A HD12 4  
ATOM 5696  H HD13 . LEU A 1 82  ? 5.808   5.407   -4.314  1.00 0.00 ? 82  LEU A HD13 4  
ATOM 5697  H HD21 . LEU A 1 82  ? 5.927   8.048   -7.091  1.00 0.00 ? 82  LEU A HD21 4  
ATOM 5698  H HD22 . LEU A 1 82  ? 6.492   6.404   -6.709  1.00 0.00 ? 82  LEU A HD22 4  
ATOM 5699  H HD23 . LEU A 1 82  ? 4.804   6.671   -7.207  1.00 0.00 ? 82  LEU A HD23 4  
ATOM 5700  N N    . MET A 1 83  ? 0.864   7.607   -3.841  1.00 0.00 ? 83  MET A N    4  
ATOM 5701  C CA   . MET A 1 83  ? -0.528  7.245   -3.630  1.00 0.00 ? 83  MET A CA   4  
ATOM 5702  C C    . MET A 1 83  ? -1.454  8.422   -3.943  1.00 0.00 ? 83  MET A C    4  
ATOM 5703  O O    . MET A 1 83  ? -2.654  8.237   -4.138  1.00 0.00 ? 83  MET A O    4  
ATOM 5704  C CB   . MET A 1 83  ? -0.727  6.810   -2.177  1.00 0.00 ? 83  MET A CB   4  
ATOM 5705  C CG   . MET A 1 83  ? -0.714  5.285   -2.055  1.00 0.00 ? 83  MET A CG   4  
ATOM 5706  S SD   . MET A 1 83  ? 0.318   4.791   -0.684  1.00 0.00 ? 83  MET A SD   4  
ATOM 5707  C CE   . MET A 1 83  ? -0.599  5.509   0.669   1.00 0.00 ? 83  MET A CE   4  
ATOM 5708  H H    . MET A 1 83  ? 1.415   7.670   -3.009  1.00 0.00 ? 83  MET A H    4  
ATOM 5709  H HA   . MET A 1 83  ? -0.725  6.425   -4.321  1.00 0.00 ? 83  MET A HA   4  
ATOM 5710  H HB2  . MET A 1 83  ? 0.060   7.235   -1.555  1.00 0.00 ? 83  MET A HB2  4  
ATOM 5711  H HB3  . MET A 1 83  ? -1.674  7.199   -1.804  1.00 0.00 ? 83  MET A HB3  4  
ATOM 5712  H HG2  . MET A 1 83  ? -1.728  4.914   -1.908  1.00 0.00 ? 83  MET A HG2  4  
ATOM 5713  H HG3  . MET A 1 83  ? -0.343  4.841   -2.978  1.00 0.00 ? 83  MET A HG3  4  
ATOM 5714  H HE1  . MET A 1 83  ? -1.424  4.850   0.938   1.00 0.00 ? 83  MET A HE1  4  
ATOM 5715  H HE2  . MET A 1 83  ? 0.061   5.636   1.527   1.00 0.00 ? 83  MET A HE2  4  
ATOM 5716  H HE3  . MET A 1 83  ? -0.992  6.480   0.366   1.00 0.00 ? 83  MET A HE3  4  
ATOM 5717  N N    . THR A 1 84  ? -0.861  9.606   -3.980  1.00 0.00 ? 84  THR A N    4  
ATOM 5718  C CA   . THR A 1 84  ? -1.618  10.813  -4.265  1.00 0.00 ? 84  THR A CA   4  
ATOM 5719  C C    . THR A 1 84  ? -2.115  10.802  -5.712  1.00 0.00 ? 84  THR A C    4  
ATOM 5720  O O    . THR A 1 84  ? -3.285  10.524  -5.968  1.00 0.00 ? 84  THR A O    4  
ATOM 5721  C CB   . THR A 1 84  ? -0.732  12.016  -3.936  1.00 0.00 ? 84  THR A CB   4  
ATOM 5722  O OG1  . THR A 1 84  ? -0.879  12.181  -2.528  1.00 0.00 ? 84  THR A OG1  4  
ATOM 5723  C CG2  . THR A 1 84  ? -1.274  13.321  -4.523  1.00 0.00 ? 84  THR A CG2  4  
ATOM 5724  H H    . THR A 1 84  ? 0.115   9.748   -3.819  1.00 0.00 ? 84  THR A H    4  
ATOM 5725  H HA   . THR A 1 84  ? -2.500  10.825  -3.624  1.00 0.00 ? 84  THR A HA   4  
ATOM 5726  H HB   . THR A 1 84  ? 0.295   11.842  -4.257  1.00 0.00 ? 84  THR A HB   4  
ATOM 5727  H HG1  . THR A 1 84  ? -0.541  11.369  -2.052  1.00 0.00 ? 84  THR A HG1  4  
ATOM 5728  H HG21 . THR A 1 84  ? -2.255  13.532  -4.095  1.00 0.00 ? 84  THR A HG21 4  
ATOM 5729  H HG22 . THR A 1 84  ? -0.592  14.137  -4.286  1.00 0.00 ? 84  THR A HG22 4  
ATOM 5730  H HG23 . THR A 1 84  ? -1.363  13.224  -5.605  1.00 0.00 ? 84  THR A HG23 4  
ATOM 5731  N N    . ARG A 1 85  ? -1.200  11.107  -6.620  1.00 0.00 ? 85  ARG A N    4  
ATOM 5732  C CA   . ARG A 1 85  ? -1.530  11.135  -8.035  1.00 0.00 ? 85  ARG A CA   4  
ATOM 5733  C C    . ARG A 1 85  ? -1.679  9.711   -8.574  1.00 0.00 ? 85  ARG A C    4  
ATOM 5734  O O    . ARG A 1 85  ? -0.992  9.325   -9.518  1.00 0.00 ? 85  ARG A O    4  
ATOM 5735  C CB   . ARG A 1 85  ? -0.452  11.866  -8.838  1.00 0.00 ? 85  ARG A CB   4  
ATOM 5736  C CG   . ARG A 1 85  ? -0.966  12.245  -10.228 1.00 0.00 ? 85  ARG A CG   4  
ATOM 5737  C CD   . ARG A 1 85  ? 0.051   11.874  -11.309 1.00 0.00 ? 85  ARG A CD   4  
ATOM 5738  N NE   . ARG A 1 85  ? 0.699   13.096  -11.835 1.00 0.00 ? 85  ARG A NE   4  
ATOM 5739  C CZ   . ARG A 1 85  ? 1.762   13.685  -11.271 1.00 0.00 ? 85  ARG A CZ   4  
ATOM 5740  N NH1  . ARG A 1 85  ? 2.304   13.168  -10.160 1.00 0.00 ? 85  ARG A NH1  4  
ATOM 5741  N NH2  . ARG A 1 85  ? 2.284   14.791  -11.818 1.00 0.00 ? 85  ARG A NH2  4  
ATOM 5742  H H    . ARG A 1 85  ? -0.250  11.331  -6.404  1.00 0.00 ? 85  ARG A H    4  
ATOM 5743  H HA   . ARG A 1 85  ? -2.474  11.676  -8.090  1.00 0.00 ? 85  ARG A HA   4  
ATOM 5744  H HB2  . ARG A 1 85  ? -0.141  12.763  -8.303  1.00 0.00 ? 85  ARG A HB2  4  
ATOM 5745  H HB3  . ARG A 1 85  ? 0.429   11.231  -8.933  1.00 0.00 ? 85  ARG A HB3  4  
ATOM 5746  H HG2  . ARG A 1 85  ? -1.910  11.737  -10.422 1.00 0.00 ? 85  ARG A HG2  4  
ATOM 5747  H HG3  . ARG A 1 85  ? -1.167  13.316  -10.265 1.00 0.00 ? 85  ARG A HG3  4  
ATOM 5748  H HD2  . ARG A 1 85  ? 0.804   11.202  -10.897 1.00 0.00 ? 85  ARG A HD2  4  
ATOM 5749  H HD3  . ARG A 1 85  ? -0.445  11.339  -12.118 1.00 0.00 ? 85  ARG A HD3  4  
ATOM 5750  H HE   . ARG A 1 85  ? 0.320   13.508  -12.664 1.00 0.00 ? 85  ARG A HE   4  
ATOM 5751  H HH11 . ARG A 1 85  ? 1.914   12.342  -9.752  1.00 0.00 ? 85  ARG A HH11 4  
ATOM 5752  H HH12 . ARG A 1 85  ? 3.097   13.607  -9.739  1.00 0.00 ? 85  ARG A HH12 4  
ATOM 5753  H HH21 . ARG A 1 85  ? 1.880   15.178  -12.648 1.00 0.00 ? 85  ARG A HH21 4  
ATOM 5754  H HH22 . ARG A 1 85  ? 3.078   15.231  -11.397 1.00 0.00 ? 85  ARG A HH22 4  
ATOM 5755  N N    . THR A 1 86  ? -2.582  8.968   -7.950  1.00 0.00 ? 86  THR A N    4  
ATOM 5756  C CA   . THR A 1 86  ? -2.831  7.595   -8.355  1.00 0.00 ? 86  THR A CA   4  
ATOM 5757  C C    . THR A 1 86  ? -3.834  7.553   -9.509  1.00 0.00 ? 86  THR A C    4  
ATOM 5758  O O    . THR A 1 86  ? -3.774  6.664   -10.357 1.00 0.00 ? 86  THR A O    4  
ATOM 5759  C CB   . THR A 1 86  ? -3.290  6.814   -7.122  1.00 0.00 ? 86  THR A CB   4  
ATOM 5760  O OG1  . THR A 1 86  ? -3.750  7.821   -6.225  1.00 0.00 ? 86  THR A OG1  4  
ATOM 5761  C CG2  . THR A 1 86  ? -2.126  6.156   -6.379  1.00 0.00 ? 86  THR A CG2  4  
ATOM 5762  H H    . THR A 1 86  ? -3.138  9.290   -7.183  1.00 0.00 ? 86  THR A H    4  
ATOM 5763  H HA   . THR A 1 86  ? -1.898  7.172   -8.727  1.00 0.00 ? 86  THR A HA   4  
ATOM 5764  H HB   . THR A 1 86  ? -4.049  6.078   -7.388  1.00 0.00 ? 86  THR A HB   4  
ATOM 5765  H HG1  . THR A 1 86  ? -4.666  8.123   -6.489  1.00 0.00 ? 86  THR A HG1  4  
ATOM 5766  H HG21 . THR A 1 86  ? -1.728  5.337   -6.979  1.00 0.00 ? 86  THR A HG21 4  
ATOM 5767  H HG22 . THR A 1 86  ? -1.342  6.893   -6.205  1.00 0.00 ? 86  THR A HG22 4  
ATOM 5768  H HG23 . THR A 1 86  ? -2.478  5.768   -5.423  1.00 0.00 ? 86  THR A HG23 4  
ATOM 5769  N N    . SER A 1 87  ? -4.734  8.525   -9.505  1.00 0.00 ? 87  SER A N    4  
ATOM 5770  C CA   . SER A 1 87  ? -5.750  8.610   -10.541 1.00 0.00 ? 87  SER A CA   4  
ATOM 5771  C C    . SER A 1 87  ? -6.910  7.668   -10.215 1.00 0.00 ? 87  SER A C    4  
ATOM 5772  O O    . SER A 1 87  ? -6.901  7.000   -9.182  1.00 0.00 ? 87  SER A O    4  
ATOM 5773  C CB   . SER A 1 87  ? -5.164  8.276   -11.914 1.00 0.00 ? 87  SER A CB   4  
ATOM 5774  O OG   . SER A 1 87  ? -5.599  9.190   -12.917 1.00 0.00 ? 87  SER A OG   4  
ATOM 5775  H H    . SER A 1 87  ? -4.777  9.244   -8.811  1.00 0.00 ? 87  SER A H    4  
ATOM 5776  H HA   . SER A 1 87  ? -6.085  9.647   -10.532 1.00 0.00 ? 87  SER A HA   4  
ATOM 5777  H HB2  . SER A 1 87  ? -4.076  8.290   -11.858 1.00 0.00 ? 87  SER A HB2  4  
ATOM 5778  H HB3  . SER A 1 87  ? -5.455  7.264   -12.196 1.00 0.00 ? 87  SER A HB3  4  
ATOM 5779  H HG   . SER A 1 87  ? -6.322  9.777   -12.554 1.00 0.00 ? 87  SER A HG   4  
ATOM 5780  N N    . SER A 1 88  ? -7.882  7.644   -11.116 1.00 0.00 ? 88  SER A N    4  
ATOM 5781  C CA   . SER A 1 88  ? -9.047  6.794   -10.937 1.00 0.00 ? 88  SER A CA   4  
ATOM 5782  C C    . SER A 1 88  ? -8.631  5.322   -10.963 1.00 0.00 ? 88  SER A C    4  
ATOM 5783  O O    . SER A 1 88  ? -9.481  4.433   -10.979 1.00 0.00 ? 88  SER A O    4  
ATOM 5784  C CB   . SER A 1 88  ? -10.098 7.068   -12.014 1.00 0.00 ? 88  SER A CB   4  
ATOM 5785  O OG   . SER A 1 88  ? -9.582  6.870   -13.327 1.00 0.00 ? 88  SER A OG   4  
ATOM 5786  H H    . SER A 1 88  ? -7.881  8.190   -11.953 1.00 0.00 ? 88  SER A H    4  
ATOM 5787  H HA   . SER A 1 88  ? -9.451  7.060   -9.960  1.00 0.00 ? 88  SER A HA   4  
ATOM 5788  H HB2  . SER A 1 88  ? -10.955 6.412   -11.859 1.00 0.00 ? 88  SER A HB2  4  
ATOM 5789  H HB3  . SER A 1 88  ? -10.459 8.092   -11.917 1.00 0.00 ? 88  SER A HB3  4  
ATOM 5790  H HG   . SER A 1 88  ? -10.323 6.633   -13.955 1.00 0.00 ? 88  SER A HG   4  
ATOM 5791  N N    . VAL A 1 89  ? -7.323  5.110   -10.967 1.00 0.00 ? 89  VAL A N    4  
ATOM 5792  C CA   . VAL A 1 89  ? -6.784  3.761   -10.991 1.00 0.00 ? 89  VAL A CA   4  
ATOM 5793  C C    . VAL A 1 89  ? -5.557  3.691   -10.080 1.00 0.00 ? 89  VAL A C    4  
ATOM 5794  O O    . VAL A 1 89  ? -4.646  4.510   -10.194 1.00 0.00 ? 89  VAL A O    4  
ATOM 5795  C CB   . VAL A 1 89  ? -6.482  3.344   -12.432 1.00 0.00 ? 89  VAL A CB   4  
ATOM 5796  C CG1  . VAL A 1 89  ? -5.513  2.161   -12.469 1.00 0.00 ? 89  VAL A CG1  4  
ATOM 5797  C CG2  . VAL A 1 89  ? -7.771  3.020   -13.190 1.00 0.00 ? 89  VAL A CG2  4  
ATOM 5798  H H    . VAL A 1 89  ? -6.638  5.839   -10.954 1.00 0.00 ? 89  VAL A H    4  
ATOM 5799  H HA   . VAL A 1 89  ? -7.551  3.093   -10.600 1.00 0.00 ? 89  VAL A HA   4  
ATOM 5800  H HB   . VAL A 1 89  ? -6.003  4.186   -12.932 1.00 0.00 ? 89  VAL A HB   4  
ATOM 5801  H HG11 . VAL A 1 89  ? -5.236  1.950   -13.502 1.00 0.00 ? 89  VAL A HG11 4  
ATOM 5802  H HG12 . VAL A 1 89  ? -4.618  2.407   -11.897 1.00 0.00 ? 89  VAL A HG12 4  
ATOM 5803  H HG13 . VAL A 1 89  ? -5.993  1.284   -12.035 1.00 0.00 ? 89  VAL A HG13 4  
ATOM 5804  H HG21 . VAL A 1 89  ? -8.129  3.916   -13.698 1.00 0.00 ? 89  VAL A HG21 4  
ATOM 5805  H HG22 . VAL A 1 89  ? -7.574  2.240   -13.925 1.00 0.00 ? 89  VAL A HG22 4  
ATOM 5806  H HG23 . VAL A 1 89  ? -8.529  2.675   -12.487 1.00 0.00 ? 89  VAL A HG23 4  
ATOM 5807  N N    . VAL A 1 90  ? -5.572  2.704   -9.196  1.00 0.00 ? 90  VAL A N    4  
ATOM 5808  C CA   . VAL A 1 90  ? -4.473  2.516   -8.265  1.00 0.00 ? 90  VAL A CA   4  
ATOM 5809  C C    . VAL A 1 90  ? -3.958  1.079   -8.374  1.00 0.00 ? 90  VAL A C    4  
ATOM 5810  O O    . VAL A 1 90  ? -4.696  0.130   -8.111  1.00 0.00 ? 90  VAL A O    4  
ATOM 5811  C CB   . VAL A 1 90  ? -4.917  2.886   -6.848  1.00 0.00 ? 90  VAL A CB   4  
ATOM 5812  C CG1  . VAL A 1 90  ? -3.802  3.617   -6.098  1.00 0.00 ? 90  VAL A CG1  4  
ATOM 5813  C CG2  . VAL A 1 90  ? -6.198  3.721   -6.876  1.00 0.00 ? 90  VAL A CG2  4  
ATOM 5814  H H    . VAL A 1 90  ? -6.317  2.042   -9.109  1.00 0.00 ? 90  VAL A H    4  
ATOM 5815  H HA   . VAL A 1 90  ? -3.674  3.197   -8.557  1.00 0.00 ? 90  VAL A HA   4  
ATOM 5816  H HB   . VAL A 1 90  ? -5.131  1.962   -6.312  1.00 0.00 ? 90  VAL A HB   4  
ATOM 5817  H HG11 . VAL A 1 90  ? -4.044  4.678   -6.031  1.00 0.00 ? 90  VAL A HG11 4  
ATOM 5818  H HG12 . VAL A 1 90  ? -3.706  3.202   -5.094  1.00 0.00 ? 90  VAL A HG12 4  
ATOM 5819  H HG13 . VAL A 1 90  ? -2.861  3.493   -6.634  1.00 0.00 ? 90  VAL A HG13 4  
ATOM 5820  H HG21 . VAL A 1 90  ? -6.007  4.663   -7.392  1.00 0.00 ? 90  VAL A HG21 4  
ATOM 5821  H HG22 . VAL A 1 90  ? -6.979  3.171   -7.401  1.00 0.00 ? 90  VAL A HG22 4  
ATOM 5822  H HG23 . VAL A 1 90  ? -6.521  3.926   -5.855  1.00 0.00 ? 90  VAL A HG23 4  
ATOM 5823  N N    . THR A 1 91  ? -2.697  0.964   -8.761  1.00 0.00 ? 91  THR A N    4  
ATOM 5824  C CA   . THR A 1 91  ? -2.075  -0.342  -8.908  1.00 0.00 ? 91  THR A CA   4  
ATOM 5825  C C    . THR A 1 91  ? -0.827  -0.440  -8.028  1.00 0.00 ? 91  THR A C    4  
ATOM 5826  O O    . THR A 1 91  ? 0.242   0.037   -8.405  1.00 0.00 ? 91  THR A O    4  
ATOM 5827  C CB   . THR A 1 91  ? -1.790  -0.565  -10.394 1.00 0.00 ? 91  THR A CB   4  
ATOM 5828  O OG1  . THR A 1 91  ? -1.335  -1.914  -10.462 1.00 0.00 ? 91  THR A OG1  4  
ATOM 5829  C CG2  . THR A 1 91  ? -0.598  0.255   -10.892 1.00 0.00 ? 91  THR A CG2  4  
ATOM 5830  H H    . THR A 1 91  ? -2.103  1.740   -8.972  1.00 0.00 ? 91  THR A H    4  
ATOM 5831  H HA   . THR A 1 91  ? -2.776  -1.098  -8.554  1.00 0.00 ? 91  THR A HA   4  
ATOM 5832  H HB   . THR A 1 91  ? -2.677  -0.366  -10.995 1.00 0.00 ? 91  THR A HB   4  
ATOM 5833  H HG1  . THR A 1 91  ? -0.522  -2.029  -9.891  1.00 0.00 ? 91  THR A HG1  4  
ATOM 5834  H HG21 . THR A 1 91  ? 0.328   -0.201  -10.543 1.00 0.00 ? 91  THR A HG21 4  
ATOM 5835  H HG22 . THR A 1 91  ? -0.603  0.280   -11.981 1.00 0.00 ? 91  THR A HG22 4  
ATOM 5836  H HG23 . THR A 1 91  ? -0.670  1.272   -10.505 1.00 0.00 ? 91  THR A HG23 4  
ATOM 5837  N N    . LEU A 1 92  ? -1.005  -1.062  -6.872  1.00 0.00 ? 92  LEU A N    4  
ATOM 5838  C CA   . LEU A 1 92  ? 0.094   -1.229  -5.936  1.00 0.00 ? 92  LEU A CA   4  
ATOM 5839  C C    . LEU A 1 92  ? 0.105   -2.670  -5.422  1.00 0.00 ? 92  LEU A C    4  
ATOM 5840  O O    . LEU A 1 92  ? -0.821  -3.435  -5.687  1.00 0.00 ? 92  LEU A O    4  
ATOM 5841  C CB   . LEU A 1 92  ? 0.014   -0.181  -4.824  1.00 0.00 ? 92  LEU A CB   4  
ATOM 5842  C CG   . LEU A 1 92  ? -1.375  0.067   -4.234  1.00 0.00 ? 92  LEU A CG   4  
ATOM 5843  C CD1  . LEU A 1 92  ? -2.285  0.765   -5.247  1.00 0.00 ? 92  LEU A CD1  4  
ATOM 5844  C CD2  . LEU A 1 92  ? -1.990  -1.234  -3.712  1.00 0.00 ? 92  LEU A CD2  4  
ATOM 5845  H H    . LEU A 1 92  ? -1.878  -1.448  -6.573  1.00 0.00 ? 92  LEU A H    4  
ATOM 5846  H HA   . LEU A 1 92  ? 1.019   -1.050  -6.482  1.00 0.00 ? 92  LEU A HA   4  
ATOM 5847  H HB2  . LEU A 1 92  ? 0.681   -0.485  -4.017  1.00 0.00 ? 92  LEU A HB2  4  
ATOM 5848  H HB3  . LEU A 1 92  ? 0.395   0.763   -5.214  1.00 0.00 ? 92  LEU A HB3  4  
ATOM 5849  H HG   . LEU A 1 92  ? -1.270  0.738   -3.381  1.00 0.00 ? 92  LEU A HG   4  
ATOM 5850  H HD11 . LEU A 1 92  ? -1.678  1.357   -5.932  1.00 0.00 ? 92  LEU A HD11 4  
ATOM 5851  H HD12 . LEU A 1 92  ? -2.843  0.017   -5.810  1.00 0.00 ? 92  LEU A HD12 4  
ATOM 5852  H HD13 . LEU A 1 92  ? -2.981  1.418   -4.721  1.00 0.00 ? 92  LEU A HD13 4  
ATOM 5853  H HD21 . LEU A 1 92  ? -2.107  -1.936  -4.538  1.00 0.00 ? 92  LEU A HD21 4  
ATOM 5854  H HD22 . LEU A 1 92  ? -1.335  -1.667  -2.957  1.00 0.00 ? 92  LEU A HD22 4  
ATOM 5855  H HD23 . LEU A 1 92  ? -2.964  -1.024  -3.272  1.00 0.00 ? 92  LEU A HD23 4  
ATOM 5856  N N    . GLU A 1 93  ? 1.164   -2.997  -4.696  1.00 0.00 ? 93  GLU A N    4  
ATOM 5857  C CA   . GLU A 1 93  ? 1.309   -4.333  -4.142  1.00 0.00 ? 93  GLU A CA   4  
ATOM 5858  C C    . GLU A 1 93  ? 1.202   -4.290  -2.617  1.00 0.00 ? 93  GLU A C    4  
ATOM 5859  O O    . GLU A 1 93  ? 1.832   -3.455  -1.970  1.00 0.00 ? 93  GLU A O    4  
ATOM 5860  C CB   . GLU A 1 93  ? 2.629   -4.969  -4.582  1.00 0.00 ? 93  GLU A CB   4  
ATOM 5861  C CG   . GLU A 1 93  ? 2.657   -5.185  -6.096  1.00 0.00 ? 93  GLU A CG   4  
ATOM 5862  C CD   . GLU A 1 93  ? 3.990   -5.790  -6.539  1.00 0.00 ? 93  GLU A CD   4  
ATOM 5863  O OE1  . GLU A 1 93  ? 4.909   -5.821  -5.692  1.00 0.00 ? 93  GLU A OE1  4  
ATOM 5864  O OE2  . GLU A 1 93  ? 4.061   -6.208  -7.715  1.00 0.00 ? 93  GLU A OE2  4  
ATOM 5865  H H    . GLU A 1 93  ? 1.913   -2.369  -4.484  1.00 0.00 ? 93  GLU A H    4  
ATOM 5866  H HA   . GLU A 1 93  ? 0.481   -4.909  -4.556  1.00 0.00 ? 93  GLU A HA   4  
ATOM 5867  H HB2  . GLU A 1 93  ? 3.461   -4.328  -4.287  1.00 0.00 ? 93  GLU A HB2  4  
ATOM 5868  H HB3  . GLU A 1 93  ? 2.766   -5.922  -4.072  1.00 0.00 ? 93  GLU A HB3  4  
ATOM 5869  H HG2  . GLU A 1 93  ? 1.839   -5.845  -6.387  1.00 0.00 ? 93  GLU A HG2  4  
ATOM 5870  H HG3  . GLU A 1 93  ? 2.497   -4.235  -6.606  1.00 0.00 ? 93  GLU A HG3  4  
ATOM 5871  N N    . VAL A 1 94  ? 0.399   -5.201  -2.086  1.00 0.00 ? 94  VAL A N    4  
ATOM 5872  C CA   . VAL A 1 94  ? 0.201   -5.277  -0.649  1.00 0.00 ? 94  VAL A CA   4  
ATOM 5873  C C    . VAL A 1 94  ? 0.356   -6.730  -0.193  1.00 0.00 ? 94  VAL A C    4  
ATOM 5874  O O    . VAL A 1 94  ? 0.071   -7.656  -0.952  1.00 0.00 ? 94  VAL A O    4  
ATOM 5875  C CB   . VAL A 1 94  ? -1.155  -4.675  -0.274  1.00 0.00 ? 94  VAL A CB   4  
ATOM 5876  C CG1  . VAL A 1 94  ? -1.344  -3.304  -0.926  1.00 0.00 ? 94  VAL A CG1  4  
ATOM 5877  C CG2  . VAL A 1 94  ? -2.297  -5.622  -0.647  1.00 0.00 ? 94  VAL A CG2  4  
ATOM 5878  H H    . VAL A 1 94  ? -0.110  -5.877  -2.619  1.00 0.00 ? 94  VAL A H    4  
ATOM 5879  H HA   . VAL A 1 94  ? 0.979   -4.677  -0.177  1.00 0.00 ? 94  VAL A HA   4  
ATOM 5880  H HB   . VAL A 1 94  ? -1.173  -4.538  0.807   1.00 0.00 ? 94  VAL A HB   4  
ATOM 5881  H HG11 . VAL A 1 94  ? -0.901  -2.536  -0.292  1.00 0.00 ? 94  VAL A HG11 4  
ATOM 5882  H HG12 . VAL A 1 94  ? -0.858  -3.295  -1.901  1.00 0.00 ? 94  VAL A HG12 4  
ATOM 5883  H HG13 . VAL A 1 94  ? -2.409  -3.104  -1.048  1.00 0.00 ? 94  VAL A HG13 4  
ATOM 5884  H HG21 . VAL A 1 94  ? -3.252  -5.144  -0.427  1.00 0.00 ? 94  VAL A HG21 4  
ATOM 5885  H HG22 . VAL A 1 94  ? -2.243  -5.855  -1.710  1.00 0.00 ? 94  VAL A HG22 4  
ATOM 5886  H HG23 . VAL A 1 94  ? -2.210  -6.542  -0.069  1.00 0.00 ? 94  VAL A HG23 4  
ATOM 5887  N N    . ALA A 1 95  ? 0.808   -6.884  1.043   1.00 0.00 ? 95  ALA A N    4  
ATOM 5888  C CA   . ALA A 1 95  ? 1.005   -8.208  1.608   1.00 0.00 ? 95  ALA A CA   4  
ATOM 5889  C C    . ALA A 1 95  ? 0.666   -8.177  3.099   1.00 0.00 ? 95  ALA A C    4  
ATOM 5890  O O    . ALA A 1 95  ? 0.807   -7.142  3.750   1.00 0.00 ? 95  ALA A O    4  
ATOM 5891  C CB   . ALA A 1 95  ? 2.440   -8.668  1.345   1.00 0.00 ? 95  ALA A CB   4  
ATOM 5892  H H    . ALA A 1 95  ? 1.038   -6.126  1.653   1.00 0.00 ? 95  ALA A H    4  
ATOM 5893  H HA   . ALA A 1 95  ? 0.320   -8.890  1.103   1.00 0.00 ? 95  ALA A HA   4  
ATOM 5894  H HB1  . ALA A 1 95  ? 2.931   -8.888  2.293   1.00 0.00 ? 95  ALA A HB1  4  
ATOM 5895  H HB2  . ALA A 1 95  ? 2.427   -9.565  0.726   1.00 0.00 ? 95  ALA A HB2  4  
ATOM 5896  H HB3  . ALA A 1 95  ? 2.986   -7.878  0.828   1.00 0.00 ? 95  ALA A HB3  4  
ATOM 5897  N N    . LYS A 1 96  ? 0.226   -9.323  3.598   1.00 0.00 ? 96  LYS A N    4  
ATOM 5898  C CA   . LYS A 1 96  ? -0.134  -9.439  5.001   1.00 0.00 ? 96  LYS A CA   4  
ATOM 5899  C C    . LYS A 1 96  ? -0.395  -10.909 5.336   1.00 0.00 ? 96  LYS A C    4  
ATOM 5900  O O    . LYS A 1 96  ? 0.354   -11.519 6.097   1.00 0.00 ? 96  LYS A O    4  
ATOM 5901  C CB   . LYS A 1 96  ? -1.307  -8.515  5.332   1.00 0.00 ? 96  LYS A CB   4  
ATOM 5902  C CG   . LYS A 1 96  ? -2.356  -8.540  4.218   1.00 0.00 ? 96  LYS A CG   4  
ATOM 5903  C CD   . LYS A 1 96  ? -3.699  -9.054  4.741   1.00 0.00 ? 96  LYS A CD   4  
ATOM 5904  C CE   . LYS A 1 96  ? -4.757  -9.042  3.636   1.00 0.00 ? 96  LYS A CE   4  
ATOM 5905  N NZ   . LYS A 1 96  ? -5.950  -8.281  4.071   1.00 0.00 ? 96  LYS A NZ   4  
ATOM 5906  H H    . LYS A 1 96  ? 0.114   -10.159 3.062   1.00 0.00 ? 96  LYS A H    4  
ATOM 5907  H HA   . LYS A 1 96  ? 0.720   -9.098  5.587   1.00 0.00 ? 96  LYS A HA   4  
ATOM 5908  H HB2  . LYS A 1 96  ? -1.763  -8.823  6.273   1.00 0.00 ? 96  LYS A HB2  4  
ATOM 5909  H HB3  . LYS A 1 96  ? -0.944  -7.497  5.472   1.00 0.00 ? 96  LYS A HB3  4  
ATOM 5910  H HG2  . LYS A 1 96  ? -2.480  -7.537  3.809   1.00 0.00 ? 96  LYS A HG2  4  
ATOM 5911  H HG3  . LYS A 1 96  ? -2.011  -9.176  3.403   1.00 0.00 ? 96  LYS A HG3  4  
ATOM 5912  H HD2  . LYS A 1 96  ? -3.580  -10.067 5.124   1.00 0.00 ? 96  LYS A HD2  4  
ATOM 5913  H HD3  . LYS A 1 96  ? -4.030  -8.434  5.574   1.00 0.00 ? 96  LYS A HD3  4  
ATOM 5914  H HE2  . LYS A 1 96  ? -4.343  -8.595  2.732   1.00 0.00 ? 96  LYS A HE2  4  
ATOM 5915  H HE3  . LYS A 1 96  ? -5.042  -10.064 3.386   1.00 0.00 ? 96  LYS A HE3  4  
ATOM 5916  H HZ1  . LYS A 1 96  ? -5.949  -7.381  3.634   1.00 0.00 ? 96  LYS A HZ1  4  
ATOM 5917  H HZ2  . LYS A 1 96  ? -6.777  -8.778  3.807   1.00 0.00 ? 96  LYS A HZ2  4  
ATOM 5918  H HZ3  . LYS A 1 96  ? -5.931  -8.169  5.064   1.00 0.00 ? 96  LYS A HZ3  4  
ATOM 5919  N N    . GLN A 1 97  ? -1.461  -11.436 4.750   1.00 0.00 ? 97  GLN A N    4  
ATOM 5920  C CA   . GLN A 1 97  ? -1.830  -12.823 4.976   1.00 0.00 ? 97  GLN A CA   4  
ATOM 5921  C C    . GLN A 1 97  ? -3.041  -13.196 4.119   1.00 0.00 ? 97  GLN A C    4  
ATOM 5922  O O    . GLN A 1 97  ? -3.986  -12.417 4.000   1.00 0.00 ? 97  GLN A O    4  
ATOM 5923  C CB   . GLN A 1 97  ? -2.107  -13.081 6.459   1.00 0.00 ? 97  GLN A CB   4  
ATOM 5924  C CG   . GLN A 1 97  ? -3.225  -12.172 6.974   1.00 0.00 ? 97  GLN A CG   4  
ATOM 5925  C CD   . GLN A 1 97  ? -3.799  -12.701 8.290   1.00 0.00 ? 97  GLN A CD   4  
ATOM 5926  O OE1  . GLN A 1 97  ? -3.897  -13.895 8.519   1.00 0.00 ? 97  GLN A OE1  4  
ATOM 5927  N NE2  . GLN A 1 97  ? -4.171  -11.748 9.140   1.00 0.00 ? 97  GLN A NE2  4  
ATOM 5928  H H    . GLN A 1 97  ? -2.065  -10.933 4.132   1.00 0.00 ? 97  GLN A H    4  
ATOM 5929  H HA   . GLN A 1 97  ? -0.964  -13.407 4.668   1.00 0.00 ? 97  GLN A HA   4  
ATOM 5930  H HB2  . GLN A 1 97  ? -2.387  -14.125 6.603   1.00 0.00 ? 97  GLN A HB2  4  
ATOM 5931  H HB3  . GLN A 1 97  ? -1.199  -12.911 7.037   1.00 0.00 ? 97  GLN A HB3  4  
ATOM 5932  H HG2  . GLN A 1 97  ? -2.839  -11.163 7.121   1.00 0.00 ? 97  GLN A HG2  4  
ATOM 5933  H HG3  . GLN A 1 97  ? -4.017  -12.105 6.229   1.00 0.00 ? 97  GLN A HG3  4  
ATOM 5934  H HE21 . GLN A 1 97  ? -4.064  -10.786 8.890   1.00 0.00 ? 97  GLN A HE21 4  
ATOM 5935  H HE22 . GLN A 1 97  ? -4.559  -11.994 10.028  1.00 0.00 ? 97  GLN A HE22 4  
ATOM 5936  N N    . GLY A 1 98  ? -2.974  -14.387 3.543   1.00 0.00 ? 98  GLY A N    4  
ATOM 5937  C CA   . GLY A 1 98  ? -4.053  -14.873 2.700   1.00 0.00 ? 98  GLY A CA   4  
ATOM 5938  C C    . GLY A 1 98  ? -4.494  -13.801 1.702   1.00 0.00 ? 98  GLY A C    4  
ATOM 5939  O O    . GLY A 1 98  ? -3.805  -13.543 0.717   1.00 0.00 ? 98  GLY A O    4  
ATOM 5940  H H    . GLY A 1 98  ? -2.202  -15.015 3.645   1.00 0.00 ? 98  GLY A H    4  
ATOM 5941  H HA2  . GLY A 1 98  ? -3.726  -15.763 2.162   1.00 0.00 ? 98  GLY A HA2  4  
ATOM 5942  H HA3  . GLY A 1 98  ? -4.899  -15.168 3.321   1.00 0.00 ? 98  GLY A HA3  4  
ATOM 5943  N N    . ALA A 1 99  ? -5.642  -13.205 1.992   1.00 0.00 ? 99  ALA A N    4  
ATOM 5944  C CA   . ALA A 1 99  ? -6.183  -12.166 1.132   1.00 0.00 ? 99  ALA A CA   4  
ATOM 5945  C C    . ALA A 1 99  ? -6.657  -12.793 -0.181  1.00 0.00 ? 99  ALA A C    4  
ATOM 5946  O O    . ALA A 1 99  ? -6.257  -13.905 -0.522  1.00 0.00 ? 99  ALA A O    4  
ATOM 5947  C CB   . ALA A 1 99  ? -5.126  -11.082 0.913   1.00 0.00 ? 99  ALA A CB   4  
ATOM 5948  H H    . ALA A 1 99  ? -6.196  -13.420 2.795   1.00 0.00 ? 99  ALA A H    4  
ATOM 5949  H HA   . ALA A 1 99  ? -7.038  -11.724 1.644   1.00 0.00 ? 99  ALA A HA   4  
ATOM 5950  H HB1  . ALA A 1 99  ? -4.970  -10.938 -0.156  1.00 0.00 ? 99  ALA A HB1  4  
ATOM 5951  H HB2  . ALA A 1 99  ? -5.466  -10.148 1.360   1.00 0.00 ? 99  ALA A HB2  4  
ATOM 5952  H HB3  . ALA A 1 99  ? -4.190  -11.388 1.379   1.00 0.00 ? 99  ALA A HB3  4  
ATOM 5953  N N    . ILE A 1 100 ? -7.502  -12.051 -0.882  1.00 0.00 ? 100 ILE A N    4  
ATOM 5954  C CA   . ILE A 1 100 ? -8.034  -12.520 -2.150  1.00 0.00 ? 100 ILE A CA   4  
ATOM 5955  C C    . ILE A 1 100 ? -8.904  -11.424 -2.770  1.00 0.00 ? 100 ILE A C    4  
ATOM 5956  O O    . ILE A 1 100 ? -9.626  -10.725 -2.061  1.00 0.00 ? 100 ILE A O    4  
ATOM 5957  C CB   . ILE A 1 100 ? -8.763  -13.853 -1.965  1.00 0.00 ? 100 ILE A CB   4  
ATOM 5958  C CG1  . ILE A 1 100 ? -8.510  -14.786 -3.151  1.00 0.00 ? 100 ILE A CG1  4  
ATOM 5959  C CG2  . ILE A 1 100 ? -10.257 -13.631 -1.720  1.00 0.00 ? 100 ILE A CG2  4  
ATOM 5960  C CD1  . ILE A 1 100 ? -7.494  -15.871 -2.788  1.00 0.00 ? 100 ILE A CD1  4  
ATOM 5961  H H    . ILE A 1 100 ? -7.822  -11.147 -0.598  1.00 0.00 ? 100 ILE A H    4  
ATOM 5962  H HA   . ILE A 1 100 ? -7.188  -12.705 -2.812  1.00 0.00 ? 100 ILE A HA   4  
ATOM 5963  H HB   . ILE A 1 100 ? -8.360  -14.342 -1.079  1.00 0.00 ? 100 ILE A HB   4  
ATOM 5964  H HG12 . ILE A 1 100 ? -9.447  -15.248 -3.461  1.00 0.00 ? 100 ILE A HG12 4  
ATOM 5965  H HG13 . ILE A 1 100 ? -8.143  -14.209 -4.000  1.00 0.00 ? 100 ILE A HG13 4  
ATOM 5966  H HG21 . ILE A 1 100 ? -10.396 -12.739 -1.108  1.00 0.00 ? 100 ILE A HG21 4  
ATOM 5967  H HG22 . ILE A 1 100 ? -10.767 -13.500 -2.674  1.00 0.00 ? 100 ILE A HG22 4  
ATOM 5968  H HG23 . ILE A 1 100 ? -10.672 -14.495 -1.202  1.00 0.00 ? 100 ILE A HG23 4  
ATOM 5969  H HD11 . ILE A 1 100 ? -8.020  -16.796 -2.551  1.00 0.00 ? 100 ILE A HD11 4  
ATOM 5970  H HD12 . ILE A 1 100 ? -6.825  -16.039 -3.632  1.00 0.00 ? 100 ILE A HD12 4  
ATOM 5971  H HD13 . ILE A 1 100 ? -6.914  -15.551 -1.922  1.00 0.00 ? 100 ILE A HD13 4  
ATOM 5972  N N    . TYR A 1 101 ? -8.805  -11.309 -4.086  1.00 0.00 ? 101 TYR A N    4  
ATOM 5973  C CA   . TYR A 1 101 ? -9.574  -10.310 -4.809  1.00 0.00 ? 101 TYR A CA   4  
ATOM 5974  C C    . TYR A 1 101 ? -10.963 -10.136 -4.193  1.00 0.00 ? 101 TYR A C    4  
ATOM 5975  O O    . TYR A 1 101 ? -11.198 -9.191  -3.441  1.00 0.00 ? 101 TYR A O    4  
ATOM 5976  C CB   . TYR A 1 101 ? -9.724  -10.845 -6.235  1.00 0.00 ? 101 TYR A CB   4  
ATOM 5977  C CG   . TYR A 1 101 ? -8.938  -10.053 -7.283  1.00 0.00 ? 101 TYR A CG   4  
ATOM 5978  C CD1  . TYR A 1 101 ? -7.574  -9.896  -7.148  1.00 0.00 ? 101 TYR A CD1  4  
ATOM 5979  C CD2  . TYR A 1 101 ? -9.594  -9.497  -8.362  1.00 0.00 ? 101 TYR A CD2  4  
ATOM 5980  C CE1  . TYR A 1 101 ? -6.834  -9.151  -8.134  1.00 0.00 ? 101 TYR A CE1  4  
ATOM 5981  C CE2  . TYR A 1 101 ? -8.854  -8.753  -9.348  1.00 0.00 ? 101 TYR A CE2  4  
ATOM 5982  C CZ   . TYR A 1 101 ? -7.511  -8.616  -9.185  1.00 0.00 ? 101 TYR A CZ   4  
ATOM 5983  O OH   . TYR A 1 101 ? -6.812  -7.913  -10.116 1.00 0.00 ? 101 TYR A OH   4  
ATOM 5984  H H    . TYR A 1 101 ? -8.215  -11.882 -4.655  1.00 0.00 ? 101 TYR A H    4  
ATOM 5985  H HA   . TYR A 1 101 ? -9.036  -9.364  -4.749  1.00 0.00 ? 101 TYR A HA   4  
ATOM 5986  H HB2  . TYR A 1 101 ? -9.397  -11.884 -6.259  1.00 0.00 ? 101 TYR A HB2  4  
ATOM 5987  H HB3  . TYR A 1 101 ? -10.780 -10.837 -6.506  1.00 0.00 ? 101 TYR A HB3  4  
ATOM 5988  H HD1  . TYR A 1 101 ? -7.056  -10.335 -6.295  1.00 0.00 ? 101 TYR A HD1  4  
ATOM 5989  H HD2  . TYR A 1 101 ? -10.671 -9.622  -8.469  1.00 0.00 ? 101 TYR A HD2  4  
ATOM 5990  H HE1  . TYR A 1 101 ? -5.756  -9.019  -8.039  1.00 0.00 ? 101 TYR A HE1  4  
ATOM 5991  H HE2  . TYR A 1 101 ? -9.359  -8.308  -10.206 1.00 0.00 ? 101 TYR A HE2  4  
ATOM 5992  H HH   . TYR A 1 101 ? -6.977  -6.934  -9.999  1.00 0.00 ? 101 TYR A HH   4  
ATOM 5993  N N    . GLY A 1 1   ? 4.608   -5.751  11.502  1.00 0.00 ? 1   GLY A N    5  
ATOM 5994  C CA   . GLY A 1 1   ? 5.903   -5.213  11.883  1.00 0.00 ? 1   GLY A CA   5  
ATOM 5995  C C    . GLY A 1 1   ? 6.883   -5.260  10.709  1.00 0.00 ? 1   GLY A C    5  
ATOM 5996  O O    . GLY A 1 1   ? 6.627   -5.927  9.708   1.00 0.00 ? 1   GLY A O    5  
ATOM 5997  H H1   . GLY A 1 1   ? 4.141   -5.250  10.773  1.00 0.00 ? 1   GLY A H1   5  
ATOM 5998  H HA2  . GLY A 1 1   ? 5.788   -4.184  12.225  1.00 0.00 ? 1   GLY A HA2  5  
ATOM 5999  H HA3  . GLY A 1 1   ? 6.306   -5.783  12.721  1.00 0.00 ? 1   GLY A HA3  5  
ATOM 6000  N N    . PRO A 1 2   ? 8.015   -4.523  10.875  1.00 0.00 ? 2   PRO A N    5  
ATOM 6001  C CA   . PRO A 1 2   ? 9.034   -4.474  9.842   1.00 0.00 ? 2   PRO A CA   5  
ATOM 6002  C C    . PRO A 1 2   ? 9.843   -5.772  9.807   1.00 0.00 ? 2   PRO A C    5  
ATOM 6003  O O    . PRO A 1 2   ? 10.898  -5.868  10.433  1.00 0.00 ? 2   PRO A O    5  
ATOM 6004  C CB   . PRO A 1 2   ? 9.879   -3.257  10.180  1.00 0.00 ? 2   PRO A CB   5  
ATOM 6005  C CG   . PRO A 1 2   ? 9.591   -2.941  11.638  1.00 0.00 ? 2   PRO A CG   5  
ATOM 6006  C CD   . PRO A 1 2   ? 8.352   -3.720  12.047  1.00 0.00 ? 2   PRO A CD   5  
ATOM 6007  H HA   . PRO A 1 2   ? 8.610   -4.393  8.940   1.00 0.00 ? 2   PRO A HA   5  
ATOM 6008  H HB2  . PRO A 1 2   ? 10.939  -3.462  10.026  1.00 0.00 ? 2   PRO A HB2  5  
ATOM 6009  H HB3  . PRO A 1 2   ? 9.622   -2.413  9.539   1.00 0.00 ? 2   PRO A HB3  5  
ATOM 6010  H HG2  . PRO A 1 2   ? 10.440  -3.217  12.264  1.00 0.00 ? 2   PRO A HG2  5  
ATOM 6011  H HG3  . PRO A 1 2   ? 9.431   -1.871  11.773  1.00 0.00 ? 2   PRO A HG3  5  
ATOM 6012  H HD2  . PRO A 1 2   ? 8.548   -4.350  12.915  1.00 0.00 ? 2   PRO A HD2  5  
ATOM 6013  H HD3  . PRO A 1 2   ? 7.534   -3.052  12.318  1.00 0.00 ? 2   PRO A HD3  5  
ATOM 6014  N N    . LEU A 1 3   ? 9.318   -6.740  9.070   1.00 0.00 ? 3   LEU A N    5  
ATOM 6015  C CA   . LEU A 1 3   ? 9.979   -8.028  8.946   1.00 0.00 ? 3   LEU A CA   5  
ATOM 6016  C C    . LEU A 1 3   ? 10.315  -8.285  7.475   1.00 0.00 ? 3   LEU A C    5  
ATOM 6017  O O    . LEU A 1 3   ? 11.486  -8.331  7.102   1.00 0.00 ? 3   LEU A O    5  
ATOM 6018  C CB   . LEU A 1 3   ? 9.129   -9.129  9.583   1.00 0.00 ? 3   LEU A CB   5  
ATOM 6019  C CG   . LEU A 1 3   ? 9.527   -9.548  11.000  1.00 0.00 ? 3   LEU A CG   5  
ATOM 6020  C CD1  . LEU A 1 3   ? 8.291   -9.784  11.870  1.00 0.00 ? 3   LEU A CD1  5  
ATOM 6021  C CD2  . LEU A 1 3   ? 10.449  -10.768 10.973  1.00 0.00 ? 3   LEU A CD2  5  
ATOM 6022  H H    . LEU A 1 3   ? 8.460   -6.654  8.564   1.00 0.00 ? 3   LEU A H    5  
ATOM 6023  H HA   . LEU A 1 3   ? 10.910  -7.974  9.509   1.00 0.00 ? 3   LEU A HA   5  
ATOM 6024  H HB2  . LEU A 1 3   ? 8.092   -8.795  9.603   1.00 0.00 ? 3   LEU A HB2  5  
ATOM 6025  H HB3  . LEU A 1 3   ? 9.168   -10.009 8.941   1.00 0.00 ? 3   LEU A HB3  5  
ATOM 6026  H HG   . LEU A 1 3   ? 10.088  -8.731  11.453  1.00 0.00 ? 3   LEU A HG   5  
ATOM 6027  H HD11 . LEU A 1 3   ? 7.932   -10.803 11.724  1.00 0.00 ? 3   LEU A HD11 5  
ATOM 6028  H HD12 . LEU A 1 3   ? 8.550   -9.636  12.918  1.00 0.00 ? 3   LEU A HD12 5  
ATOM 6029  H HD13 . LEU A 1 3   ? 7.508   -9.079  11.588  1.00 0.00 ? 3   LEU A HD13 5  
ATOM 6030  H HD21 . LEU A 1 3   ? 11.419  -10.482 10.566  1.00 0.00 ? 3   LEU A HD21 5  
ATOM 6031  H HD22 . LEU A 1 3   ? 10.578  -11.150 11.986  1.00 0.00 ? 3   LEU A HD22 5  
ATOM 6032  H HD23 . LEU A 1 3   ? 10.008  -11.543 10.346  1.00 0.00 ? 3   LEU A HD23 5  
ATOM 6033  N N    . GLY A 1 4   ? 9.267   -8.445  6.681   1.00 0.00 ? 4   GLY A N    5  
ATOM 6034  C CA   . GLY A 1 4   ? 9.436   -8.696  5.260   1.00 0.00 ? 4   GLY A CA   5  
ATOM 6035  C C    . GLY A 1 4   ? 8.489   -9.798  4.781   1.00 0.00 ? 4   GLY A C    5  
ATOM 6036  O O    . GLY A 1 4   ? 7.833   -10.452 5.590   1.00 0.00 ? 4   GLY A O    5  
ATOM 6037  H H    . GLY A 1 4   ? 8.317   -8.406  6.993   1.00 0.00 ? 4   GLY A H    5  
ATOM 6038  H HA2  . GLY A 1 4   ? 9.246   -7.780  4.700   1.00 0.00 ? 4   GLY A HA2  5  
ATOM 6039  H HA3  . GLY A 1 4   ? 10.467  -8.984  5.058   1.00 0.00 ? 4   GLY A HA3  5  
ATOM 6040  N N    . SER A 1 5   ? 8.449   -9.971  3.468   1.00 0.00 ? 5   SER A N    5  
ATOM 6041  C CA   . SER A 1 5   ? 7.594   -10.983 2.872   1.00 0.00 ? 5   SER A CA   5  
ATOM 6042  C C    . SER A 1 5   ? 7.978   -11.195 1.406   1.00 0.00 ? 5   SER A C    5  
ATOM 6043  O O    . SER A 1 5   ? 8.811   -10.467 0.867   1.00 0.00 ? 5   SER A O    5  
ATOM 6044  C CB   . SER A 1 5   ? 6.119   -10.593 2.983   1.00 0.00 ? 5   SER A CB   5  
ATOM 6045  O OG   . SER A 1 5   ? 5.794   -9.487  2.145   1.00 0.00 ? 5   SER A OG   5  
ATOM 6046  H H    . SER A 1 5   ? 8.986   -9.434  2.817   1.00 0.00 ? 5   SER A H    5  
ATOM 6047  H HA   . SER A 1 5   ? 7.774   -11.889 3.449   1.00 0.00 ? 5   SER A HA   5  
ATOM 6048  H HB2  . SER A 1 5   ? 5.497   -11.447 2.714   1.00 0.00 ? 5   SER A HB2  5  
ATOM 6049  H HB3  . SER A 1 5   ? 5.887   -10.344 4.018   1.00 0.00 ? 5   SER A HB3  5  
ATOM 6050  H HG   . SER A 1 5   ? 6.149   -8.641  2.543   1.00 0.00 ? 5   SER A HG   5  
ATOM 6051  N N    . LEU A 1 6   ? 7.352   -12.195 0.802   1.00 0.00 ? 6   LEU A N    5  
ATOM 6052  C CA   . LEU A 1 6   ? 7.618   -12.511 -0.591  1.00 0.00 ? 6   LEU A CA   5  
ATOM 6053  C C    . LEU A 1 6   ? 6.308   -12.460 -1.380  1.00 0.00 ? 6   LEU A C    5  
ATOM 6054  O O    . LEU A 1 6   ? 6.143   -11.619 -2.262  1.00 0.00 ? 6   LEU A O    5  
ATOM 6055  C CB   . LEU A 1 6   ? 8.353   -13.848 -0.706  1.00 0.00 ? 6   LEU A CB   5  
ATOM 6056  C CG   . LEU A 1 6   ? 9.880   -13.782 -0.642  1.00 0.00 ? 6   LEU A CG   5  
ATOM 6057  C CD1  . LEU A 1 6   ? 10.439  -12.914 -1.771  1.00 0.00 ? 6   LEU A CD1  5  
ATOM 6058  C CD2  . LEU A 1 6   ? 10.352  -13.306 0.733   1.00 0.00 ? 6   LEU A CD2  5  
ATOM 6059  H H    . LEU A 1 6   ? 6.676   -12.782 1.248   1.00 0.00 ? 6   LEU A H    5  
ATOM 6060  H HA   . LEU A 1 6   ? 8.286   -11.742 -0.979  1.00 0.00 ? 6   LEU A HA   5  
ATOM 6061  H HB2  . LEU A 1 6   ? 8.004   -14.502 0.094   1.00 0.00 ? 6   LEU A HB2  5  
ATOM 6062  H HB3  . LEU A 1 6   ? 8.068   -14.317 -1.647  1.00 0.00 ? 6   LEU A HB3  5  
ATOM 6063  H HG   . LEU A 1 6   ? 10.272  -14.789 -0.786  1.00 0.00 ? 6   LEU A HG   5  
ATOM 6064  H HD11 . LEU A 1 6   ? 11.452  -13.236 -2.011  1.00 0.00 ? 6   LEU A HD11 5  
ATOM 6065  H HD12 . LEU A 1 6   ? 9.807   -13.015 -2.654  1.00 0.00 ? 6   LEU A HD12 5  
ATOM 6066  H HD13 . LEU A 1 6   ? 10.455  -11.871 -1.454  1.00 0.00 ? 6   LEU A HD13 5  
ATOM 6067  H HD21 . LEU A 1 6   ? 9.588   -13.532 1.478   1.00 0.00 ? 6   LEU A HD21 5  
ATOM 6068  H HD22 . LEU A 1 6   ? 11.278  -13.816 0.997   1.00 0.00 ? 6   LEU A HD22 5  
ATOM 6069  H HD23 . LEU A 1 6   ? 10.524  -12.230 0.706   1.00 0.00 ? 6   LEU A HD23 5  
ATOM 6070  N N    . ARG A 1 7   ? 5.410   -13.370 -1.033  1.00 0.00 ? 7   ARG A N    5  
ATOM 6071  C CA   . ARG A 1 7   ? 4.120   -13.439 -1.698  1.00 0.00 ? 7   ARG A CA   5  
ATOM 6072  C C    . ARG A 1 7   ? 3.055   -13.971 -0.737  1.00 0.00 ? 7   ARG A C    5  
ATOM 6073  O O    . ARG A 1 7   ? 3.196   -15.066 -0.193  1.00 0.00 ? 7   ARG A O    5  
ATOM 6074  C CB   . ARG A 1 7   ? 4.182   -14.344 -2.930  1.00 0.00 ? 7   ARG A CB   5  
ATOM 6075  C CG   . ARG A 1 7   ? 5.138   -13.775 -3.980  1.00 0.00 ? 7   ARG A CG   5  
ATOM 6076  C CD   . ARG A 1 7   ? 6.561   -14.295 -3.766  1.00 0.00 ? 7   ARG A CD   5  
ATOM 6077  N NE   . ARG A 1 7   ? 7.104   -14.823 -5.038  1.00 0.00 ? 7   ARG A NE   5  
ATOM 6078  C CZ   . ARG A 1 7   ? 6.787   -16.019 -5.551  1.00 0.00 ? 7   ARG A CZ   5  
ATOM 6079  N NH1  . ARG A 1 7   ? 5.928   -16.819 -4.904  1.00 0.00 ? 7   ARG A NH1  5  
ATOM 6080  N NH2  . ARG A 1 7   ? 7.328   -16.416 -6.710  1.00 0.00 ? 7   ARG A NH2  5  
ATOM 6081  H H    . ARG A 1 7   ? 5.552   -14.051 -0.314  1.00 0.00 ? 7   ARG A H    5  
ATOM 6082  H HA   . ARG A 1 7   ? 3.903   -12.413 -1.994  1.00 0.00 ? 7   ARG A HA   5  
ATOM 6083  H HB2  . ARG A 1 7   ? 4.511   -15.341 -2.637  1.00 0.00 ? 7   ARG A HB2  5  
ATOM 6084  H HB3  . ARG A 1 7   ? 3.186   -14.450 -3.359  1.00 0.00 ? 7   ARG A HB3  5  
ATOM 6085  H HG2  . ARG A 1 7   ? 4.793   -14.049 -4.977  1.00 0.00 ? 7   ARG A HG2  5  
ATOM 6086  H HG3  . ARG A 1 7   ? 5.133   -12.686 -3.930  1.00 0.00 ? 7   ARG A HG3  5  
ATOM 6087  H HD2  . ARG A 1 7   ? 7.198   -13.492 -3.394  1.00 0.00 ? 7   ARG A HD2  5  
ATOM 6088  H HD3  . ARG A 1 7   ? 6.561   -15.078 -3.008  1.00 0.00 ? 7   ARG A HD3  5  
ATOM 6089  H HE   . ARG A 1 7   ? 7.748   -14.251 -5.546  1.00 0.00 ? 7   ARG A HE   5  
ATOM 6090  H HH11 . ARG A 1 7   ? 5.524   -16.523 -4.038  1.00 0.00 ? 7   ARG A HH11 5  
ATOM 6091  H HH12 . ARG A 1 7   ? 5.692   -17.712 -5.287  1.00 0.00 ? 7   ARG A HH12 5  
ATOM 6092  H HH21 . ARG A 1 7   ? 7.969   -15.819 -7.193  1.00 0.00 ? 7   ARG A HH21 5  
ATOM 6093  H HH22 . ARG A 1 7   ? 7.092   -17.309 -7.093  1.00 0.00 ? 7   ARG A HH22 5  
ATOM 6094  N N    . LYS A 1 8   ? 2.013   -13.172 -0.557  1.00 0.00 ? 8   LYS A N    5  
ATOM 6095  C CA   . LYS A 1 8   ? 0.925   -13.549 0.330   1.00 0.00 ? 8   LYS A CA   5  
ATOM 6096  C C    . LYS A 1 8   ? -0.369  -13.661 -0.478  1.00 0.00 ? 8   LYS A C    5  
ATOM 6097  O O    . LYS A 1 8   ? -0.343  -13.625 -1.707  1.00 0.00 ? 8   LYS A O    5  
ATOM 6098  C CB   . LYS A 1 8   ? 0.833   -12.578 1.508   1.00 0.00 ? 8   LYS A CB   5  
ATOM 6099  C CG   . LYS A 1 8   ? 1.682   -13.062 2.685   1.00 0.00 ? 8   LYS A CG   5  
ATOM 6100  C CD   . LYS A 1 8   ? 3.149   -12.665 2.504   1.00 0.00 ? 8   LYS A CD   5  
ATOM 6101  C CE   . LYS A 1 8   ? 4.050   -13.442 3.465   1.00 0.00 ? 8   LYS A CE   5  
ATOM 6102  N NZ   . LYS A 1 8   ? 4.499   -12.571 4.574   1.00 0.00 ? 8   LYS A NZ   5  
ATOM 6103  H H    . LYS A 1 8   ? 1.906   -12.284 -1.003  1.00 0.00 ? 8   LYS A H    5  
ATOM 6104  H HA   . LYS A 1 8   ? 1.163   -14.531 0.739   1.00 0.00 ? 8   LYS A HA   5  
ATOM 6105  H HB2  . LYS A 1 8   ? 1.168   -11.589 1.196   1.00 0.00 ? 8   LYS A HB2  5  
ATOM 6106  H HB3  . LYS A 1 8   ? -0.206  -12.478 1.821   1.00 0.00 ? 8   LYS A HB3  5  
ATOM 6107  H HG2  . LYS A 1 8   ? 1.299   -12.638 3.613   1.00 0.00 ? 8   LYS A HG2  5  
ATOM 6108  H HG3  . LYS A 1 8   ? 1.604   -14.146 2.773   1.00 0.00 ? 8   LYS A HG3  5  
ATOM 6109  H HD2  . LYS A 1 8   ? 3.456   -12.855 1.476   1.00 0.00 ? 8   LYS A HD2  5  
ATOM 6110  H HD3  . LYS A 1 8   ? 3.263   -11.595 2.678   1.00 0.00 ? 8   LYS A HD3  5  
ATOM 6111  H HE2  . LYS A 1 8   ? 3.511   -14.301 3.864   1.00 0.00 ? 8   LYS A HE2  5  
ATOM 6112  H HE3  . LYS A 1 8   ? 4.915   -13.831 2.927   1.00 0.00 ? 8   LYS A HE3  5  
ATOM 6113  H HZ1  . LYS A 1 8   ? 4.319   -11.616 4.341   1.00 0.00 ? 8   LYS A HZ1  5  
ATOM 6114  H HZ2  . LYS A 1 8   ? 4.002   -12.811 5.408   1.00 0.00 ? 8   LYS A HZ2  5  
ATOM 6115  H HZ3  . LYS A 1 8   ? 5.480   -12.699 4.722   1.00 0.00 ? 8   LYS A HZ3  5  
ATOM 6116  N N    . GLU A 1 9   ? -1.471  -13.793 0.246   1.00 0.00 ? 9   GLU A N    5  
ATOM 6117  C CA   . GLU A 1 9   ? -2.773  -13.910 -0.388  1.00 0.00 ? 9   GLU A CA   5  
ATOM 6118  C C    . GLU A 1 9   ? -2.932  -12.846 -1.476  1.00 0.00 ? 9   GLU A C    5  
ATOM 6119  O O    . GLU A 1 9   ? -3.195  -13.170 -2.633  1.00 0.00 ? 9   GLU A O    5  
ATOM 6120  C CB   . GLU A 1 9   ? -3.897  -13.809 0.645   1.00 0.00 ? 9   GLU A CB   5  
ATOM 6121  C CG   . GLU A 1 9   ? -4.588  -15.160 0.838   1.00 0.00 ? 9   GLU A CG   5  
ATOM 6122  C CD   . GLU A 1 9   ? -4.146  -15.820 2.146   1.00 0.00 ? 9   GLU A CD   5  
ATOM 6123  O OE1  . GLU A 1 9   ? -3.058  -16.436 2.132   1.00 0.00 ? 9   GLU A OE1  5  
ATOM 6124  O OE2  . GLU A 1 9   ? -4.906  -15.694 3.130   1.00 0.00 ? 9   GLU A OE2  5  
ATOM 6125  H H    . GLU A 1 9   ? -1.484  -13.821 1.245   1.00 0.00 ? 9   GLU A H    5  
ATOM 6126  H HA   . GLU A 1 9   ? -2.789  -14.903 -0.837  1.00 0.00 ? 9   GLU A HA   5  
ATOM 6127  H HB2  . GLU A 1 9   ? -3.492  -13.464 1.596   1.00 0.00 ? 9   GLU A HB2  5  
ATOM 6128  H HB3  . GLU A 1 9   ? -4.627  -13.066 0.323   1.00 0.00 ? 9   GLU A HB3  5  
ATOM 6129  H HG2  . GLU A 1 9   ? -5.669  -15.023 0.843   1.00 0.00 ? 9   GLU A HG2  5  
ATOM 6130  H HG3  . GLU A 1 9   ? -4.354  -15.816 -0.001  1.00 0.00 ? 9   GLU A HG3  5  
ATOM 6131  N N    . PRO A 1 10  ? -2.759  -11.564 -1.056  1.00 0.00 ? 10  PRO A N    5  
ATOM 6132  C CA   . PRO A 1 10  ? -2.880  -10.450 -1.981  1.00 0.00 ? 10  PRO A CA   5  
ATOM 6133  C C    . PRO A 1 10  ? -1.651  -10.354 -2.887  1.00 0.00 ? 10  PRO A C    5  
ATOM 6134  O O    . PRO A 1 10  ? -1.674  -10.828 -4.022  1.00 0.00 ? 10  PRO A O    5  
ATOM 6135  C CB   . PRO A 1 10  ? -3.065  -9.225  -1.100  1.00 0.00 ? 10  PRO A CB   5  
ATOM 6136  C CG   . PRO A 1 10  ? -2.578  -9.628  0.282   1.00 0.00 ? 10  PRO A CG   5  
ATOM 6137  C CD   . PRO A 1 10  ? -2.446  -11.142 0.307   1.00 0.00 ? 10  PRO A CD   5  
ATOM 6138  H HA   . PRO A 1 10  ? -3.660  -10.589 -2.591  1.00 0.00 ? 10  PRO A HA   5  
ATOM 6139  H HB2  . PRO A 1 10  ? -2.495  -8.379  -1.483  1.00 0.00 ? 10  PRO A HB2  5  
ATOM 6140  H HB3  . PRO A 1 10  ? -4.111  -8.919  -1.072  1.00 0.00 ? 10  PRO A HB3  5  
ATOM 6141  H HG2  . PRO A 1 10  ? -1.619  -9.158  0.502   1.00 0.00 ? 10  PRO A HG2  5  
ATOM 6142  H HG3  . PRO A 1 10  ? -3.279  -9.294  1.047   1.00 0.00 ? 10  PRO A HG3  5  
ATOM 6143  H HD2  . PRO A 1 10  ? -1.440  -11.448 0.594   1.00 0.00 ? 10  PRO A HD2  5  
ATOM 6144  H HD3  . PRO A 1 10  ? -3.132  -11.588 1.027   1.00 0.00 ? 10  PRO A HD3  5  
ATOM 6145  N N    . GLU A 1 11  ? -0.607  -9.739  -2.352  1.00 0.00 ? 11  GLU A N    5  
ATOM 6146  C CA   . GLU A 1 11  ? 0.629   -9.576  -3.098  1.00 0.00 ? 11  GLU A CA   5  
ATOM 6147  C C    . GLU A 1 11  ? 0.520   -8.384  -4.052  1.00 0.00 ? 11  GLU A C    5  
ATOM 6148  O O    . GLU A 1 11  ? 1.100   -7.329  -3.801  1.00 0.00 ? 11  GLU A O    5  
ATOM 6149  C CB   . GLU A 1 11  ? 0.984   -10.855 -3.858  1.00 0.00 ? 11  GLU A CB   5  
ATOM 6150  C CG   . GLU A 1 11  ? 2.489   -11.127 -3.802  1.00 0.00 ? 11  GLU A CG   5  
ATOM 6151  C CD   . GLU A 1 11  ? 3.155   -10.800 -5.140  1.00 0.00 ? 11  GLU A CD   5  
ATOM 6152  O OE1  . GLU A 1 11  ? 2.624   -11.269 -6.169  1.00 0.00 ? 11  GLU A OE1  5  
ATOM 6153  O OE2  . GLU A 1 11  ? 4.182   -10.087 -5.103  1.00 0.00 ? 11  GLU A OE2  5  
ATOM 6154  H H    . GLU A 1 11  ? -0.596  -9.357  -1.428  1.00 0.00 ? 11  GLU A H    5  
ATOM 6155  H HA   . GLU A 1 11  ? 1.396   -9.381  -2.349  1.00 0.00 ? 11  GLU A HA   5  
ATOM 6156  H HB2  . GLU A 1 11  ? 0.442   -11.699 -3.430  1.00 0.00 ? 11  GLU A HB2  5  
ATOM 6157  H HB3  . GLU A 1 11  ? 0.666   -10.766 -4.897  1.00 0.00 ? 11  GLU A HB3  5  
ATOM 6158  H HG2  . GLU A 1 11  ? 2.940   -10.529 -3.011  1.00 0.00 ? 11  GLU A HG2  5  
ATOM 6159  H HG3  . GLU A 1 11  ? 2.664   -12.173 -3.551  1.00 0.00 ? 11  GLU A HG3  5  
ATOM 6160  N N    . ILE A 1 12  ? -0.229  -8.593  -5.125  1.00 0.00 ? 12  ILE A N    5  
ATOM 6161  C CA   . ILE A 1 12  ? -0.422  -7.549  -6.117  1.00 0.00 ? 12  ILE A CA   5  
ATOM 6162  C C    . ILE A 1 12  ? -1.883  -7.095  -6.096  1.00 0.00 ? 12  ILE A C    5  
ATOM 6163  O O    . ILE A 1 12  ? -2.773  -7.838  -6.506  1.00 0.00 ? 12  ILE A O    5  
ATOM 6164  C CB   . ILE A 1 12  ? 0.056   -8.021  -7.492  1.00 0.00 ? 12  ILE A CB   5  
ATOM 6165  C CG1  . ILE A 1 12  ? -0.270  -6.987  -8.571  1.00 0.00 ? 12  ILE A CG1  5  
ATOM 6166  C CG2  . ILE A 1 12  ? -0.517  -9.400  -7.827  1.00 0.00 ? 12  ILE A CG2  5  
ATOM 6167  C CD1  . ILE A 1 12  ? 0.732   -7.063  -9.724  1.00 0.00 ? 12  ILE A CD1  5  
ATOM 6168  H H    . ILE A 1 12  ? -0.697  -9.454  -5.321  1.00 0.00 ? 12  ILE A H    5  
ATOM 6169  H HA   . ILE A 1 12  ? 0.206   -6.705  -5.830  1.00 0.00 ? 12  ILE A HA   5  
ATOM 6170  H HB   . ILE A 1 12  ? 1.141   -8.123  -7.460  1.00 0.00 ? 12  ILE A HB   5  
ATOM 6171  H HG12 . ILE A 1 12  ? -1.278  -7.156  -8.949  1.00 0.00 ? 12  ILE A HG12 5  
ATOM 6172  H HG13 . ILE A 1 12  ? -0.256  -5.987  -8.137  1.00 0.00 ? 12  ILE A HG13 5  
ATOM 6173  H HG21 . ILE A 1 12  ? -1.449  -9.549  -7.281  1.00 0.00 ? 12  ILE A HG21 5  
ATOM 6174  H HG22 . ILE A 1 12  ? -0.710  -9.462  -8.899  1.00 0.00 ? 12  ILE A HG22 5  
ATOM 6175  H HG23 . ILE A 1 12  ? 0.199   -10.170 -7.542  1.00 0.00 ? 12  ILE A HG23 5  
ATOM 6176  H HD11 . ILE A 1 12  ? 1.436   -7.875  -9.541  1.00 0.00 ? 12  ILE A HD11 5  
ATOM 6177  H HD12 . ILE A 1 12  ? 0.200   -7.246  -10.657 1.00 0.00 ? 12  ILE A HD12 5  
ATOM 6178  H HD13 . ILE A 1 12  ? 1.276   -6.121  -9.796  1.00 0.00 ? 12  ILE A HD13 5  
ATOM 6179  N N    . ILE A 1 13  ? -2.084  -5.877  -5.615  1.00 0.00 ? 13  ILE A N    5  
ATOM 6180  C CA   . ILE A 1 13  ? -3.421  -5.316  -5.535  1.00 0.00 ? 13  ILE A CA   5  
ATOM 6181  C C    . ILE A 1 13  ? -3.544  -4.158  -6.528  1.00 0.00 ? 13  ILE A C    5  
ATOM 6182  O O    . ILE A 1 13  ? -2.735  -3.232  -6.511  1.00 0.00 ? 13  ILE A O    5  
ATOM 6183  C CB   . ILE A 1 13  ? -3.754  -4.926  -4.093  1.00 0.00 ? 13  ILE A CB   5  
ATOM 6184  C CG1  . ILE A 1 13  ? -3.820  -6.162  -3.193  1.00 0.00 ? 13  ILE A CG1  5  
ATOM 6185  C CG2  . ILE A 1 13  ? -5.041  -4.102  -4.031  1.00 0.00 ? 13  ILE A CG2  5  
ATOM 6186  C CD1  . ILE A 1 13  ? -4.791  -7.200  -3.758  1.00 0.00 ? 13  ILE A CD1  5  
ATOM 6187  H H    . ILE A 1 13  ? -1.354  -5.279  -5.283  1.00 0.00 ? 13  ILE A H    5  
ATOM 6188  H HA   . ILE A 1 13  ? -4.122  -6.098  -5.827  1.00 0.00 ? 13  ILE A HA   5  
ATOM 6189  H HB   . ILE A 1 13  ? -2.949  -4.295  -3.715  1.00 0.00 ? 13  ILE A HB   5  
ATOM 6190  H HG12 . ILE A 1 13  ? -2.827  -6.601  -3.098  1.00 0.00 ? 13  ILE A HG12 5  
ATOM 6191  H HG13 . ILE A 1 13  ? -4.137  -5.870  -2.191  1.00 0.00 ? 13  ILE A HG13 5  
ATOM 6192  H HG21 . ILE A 1 13  ? -5.356  -3.998  -2.992  1.00 0.00 ? 13  ILE A HG21 5  
ATOM 6193  H HG22 . ILE A 1 13  ? -4.861  -3.115  -4.456  1.00 0.00 ? 13  ILE A HG22 5  
ATOM 6194  H HG23 . ILE A 1 13  ? -5.823  -4.606  -4.599  1.00 0.00 ? 13  ILE A HG23 5  
ATOM 6195  H HD11 . ILE A 1 13  ? -5.562  -6.697  -4.341  1.00 0.00 ? 13  ILE A HD11 5  
ATOM 6196  H HD12 . ILE A 1 13  ? -4.247  -7.896  -4.398  1.00 0.00 ? 13  ILE A HD12 5  
ATOM 6197  H HD13 . ILE A 1 13  ? -5.255  -7.748  -2.938  1.00 0.00 ? 13  ILE A HD13 5  
ATOM 6198  N N    . THR A 1 14  ? -4.563  -4.249  -7.370  1.00 0.00 ? 14  THR A N    5  
ATOM 6199  C CA   . THR A 1 14  ? -4.802  -3.221  -8.369  1.00 0.00 ? 14  THR A CA   5  
ATOM 6200  C C    . THR A 1 14  ? -6.304  -3.041  -8.600  1.00 0.00 ? 14  THR A C    5  
ATOM 6201  O O    . THR A 1 14  ? -6.999  -3.992  -8.953  1.00 0.00 ? 14  THR A O    5  
ATOM 6202  C CB   . THR A 1 14  ? -4.034  -3.605  -9.636  1.00 0.00 ? 14  THR A CB   5  
ATOM 6203  O OG1  . THR A 1 14  ? -4.603  -2.781  -10.650 1.00 0.00 ? 14  THR A OG1  5  
ATOM 6204  C CG2  . THR A 1 14  ? -4.341  -5.031  -10.098 1.00 0.00 ? 14  THR A CG2  5  
ATOM 6205  H H    . THR A 1 14  ? -5.217  -5.006  -7.378  1.00 0.00 ? 14  THR A H    5  
ATOM 6206  H HA   . THR A 1 14  ? -4.422  -2.274  -7.986  1.00 0.00 ? 14  THR A HA   5  
ATOM 6207  H HB   . THR A 1 14  ? -2.962  -3.462  -9.499  1.00 0.00 ? 14  THR A HB   5  
ATOM 6208  H HG1  . THR A 1 14  ? -3.884  -2.264  -11.114 1.00 0.00 ? 14  THR A HG1  5  
ATOM 6209  H HG21 . THR A 1 14  ? -4.744  -5.604  -9.263  1.00 0.00 ? 14  THR A HG21 5  
ATOM 6210  H HG22 . THR A 1 14  ? -5.073  -5.001  -10.905 1.00 0.00 ? 14  THR A HG22 5  
ATOM 6211  H HG23 . THR A 1 14  ? -3.425  -5.502  -10.454 1.00 0.00 ? 14  THR A HG23 5  
ATOM 6212  N N    . VAL A 1 15  ? -6.759  -1.814  -8.393  1.00 0.00 ? 15  VAL A N    5  
ATOM 6213  C CA   . VAL A 1 15  ? -8.165  -1.498  -8.574  1.00 0.00 ? 15  VAL A CA   5  
ATOM 6214  C C    . VAL A 1 15  ? -8.304  -0.031  -8.989  1.00 0.00 ? 15  VAL A C    5  
ATOM 6215  O O    . VAL A 1 15  ? -7.499  0.809   -8.591  1.00 0.00 ? 15  VAL A O    5  
ATOM 6216  C CB   . VAL A 1 15  ? -8.946  -1.835  -7.303  1.00 0.00 ? 15  VAL A CB   5  
ATOM 6217  C CG1  . VAL A 1 15  ? -8.646  -0.827  -6.191  1.00 0.00 ? 15  VAL A CG1  5  
ATOM 6218  C CG2  . VAL A 1 15  ? -10.448 -1.909  -7.585  1.00 0.00 ? 15  VAL A CG2  5  
ATOM 6219  H H    . VAL A 1 15  ? -6.186  -1.046  -8.107  1.00 0.00 ? 15  VAL A H    5  
ATOM 6220  H HA   . VAL A 1 15  ? -8.543  -2.128  -9.380  1.00 0.00 ? 15  VAL A HA   5  
ATOM 6221  H HB   . VAL A 1 15  ? -8.621  -2.818  -6.961  1.00 0.00 ? 15  VAL A HB   5  
ATOM 6222  H HG11 . VAL A 1 15  ? -8.254  0.091   -6.629  1.00 0.00 ? 15  VAL A HG11 5  
ATOM 6223  H HG12 . VAL A 1 15  ? -9.562  -0.606  -5.644  1.00 0.00 ? 15  VAL A HG12 5  
ATOM 6224  H HG13 . VAL A 1 15  ? -7.908  -1.248  -5.509  1.00 0.00 ? 15  VAL A HG13 5  
ATOM 6225  H HG21 . VAL A 1 15  ? -10.926 -2.549  -6.842  1.00 0.00 ? 15  VAL A HG21 5  
ATOM 6226  H HG22 . VAL A 1 15  ? -10.877 -0.909  -7.533  1.00 0.00 ? 15  VAL A HG22 5  
ATOM 6227  H HG23 . VAL A 1 15  ? -10.611 -2.324  -8.580  1.00 0.00 ? 15  VAL A HG23 5  
ATOM 6228  N N    . THR A 1 16  ? -9.331  0.231   -9.785  1.00 0.00 ? 16  THR A N    5  
ATOM 6229  C CA   . THR A 1 16  ? -9.585  1.581   -10.258 1.00 0.00 ? 16  THR A CA   5  
ATOM 6230  C C    . THR A 1 16  ? -10.044 2.473   -9.103  1.00 0.00 ? 16  THR A C    5  
ATOM 6231  O O    . THR A 1 16  ? -11.058 2.196   -8.465  1.00 0.00 ? 16  THR A O    5  
ATOM 6232  C CB   . THR A 1 16  ? -10.598 1.498   -11.401 1.00 0.00 ? 16  THR A CB   5  
ATOM 6233  O OG1  . THR A 1 16  ? -11.673 0.735   -10.859 1.00 0.00 ? 16  THR A OG1  5  
ATOM 6234  C CG2  . THR A 1 16  ? -10.093 0.650   -12.571 1.00 0.00 ? 16  THR A CG2  5  
ATOM 6235  H H    . THR A 1 16  ? -9.981  -0.459  -10.104 1.00 0.00 ? 16  THR A H    5  
ATOM 6236  H HA   . THR A 1 16  ? -8.649  1.996   -10.631 1.00 0.00 ? 16  THR A HA   5  
ATOM 6237  H HB   . THR A 1 16  ? -10.888 2.493   -11.738 1.00 0.00 ? 16  THR A HB   5  
ATOM 6238  H HG1  . THR A 1 16  ? -12.044 1.193   -10.051 1.00 0.00 ? 16  THR A HG1  5  
ATOM 6239  H HG21 . THR A 1 16  ? -9.656  1.301   -13.329 1.00 0.00 ? 16  THR A HG21 5  
ATOM 6240  H HG22 . THR A 1 16  ? -9.338  -0.049  -12.213 1.00 0.00 ? 16  THR A HG22 5  
ATOM 6241  H HG23 . THR A 1 16  ? -10.926 0.096   -13.004 1.00 0.00 ? 16  THR A HG23 5  
ATOM 6242  N N    . LEU A 1 17  ? -9.275  3.527   -8.870  1.00 0.00 ? 17  LEU A N    5  
ATOM 6243  C CA   . LEU A 1 17  ? -9.590  4.462   -7.803  1.00 0.00 ? 17  LEU A CA   5  
ATOM 6244  C C    . LEU A 1 17  ? -10.944 5.115   -8.087  1.00 0.00 ? 17  LEU A C    5  
ATOM 6245  O O    . LEU A 1 17  ? -11.903 4.433   -8.448  1.00 0.00 ? 17  LEU A O    5  
ATOM 6246  C CB   . LEU A 1 17  ? -8.451  5.465   -7.617  1.00 0.00 ? 17  LEU A CB   5  
ATOM 6247  C CG   . LEU A 1 17  ? -8.393  6.170   -6.260  1.00 0.00 ? 17  LEU A CG   5  
ATOM 6248  C CD1  . LEU A 1 17  ? -8.387  7.690   -6.432  1.00 0.00 ? 17  LEU A CD1  5  
ATOM 6249  C CD2  . LEU A 1 17  ? -9.529  5.701   -5.350  1.00 0.00 ? 17  LEU A CD2  5  
ATOM 6250  H H    . LEU A 1 17  ? -8.452  3.745   -9.394  1.00 0.00 ? 17  LEU A H    5  
ATOM 6251  H HA   . LEU A 1 17  ? -9.669  3.889   -6.880  1.00 0.00 ? 17  LEU A HA   5  
ATOM 6252  H HB2  . LEU A 1 17  ? -7.506  4.946   -7.775  1.00 0.00 ? 17  LEU A HB2  5  
ATOM 6253  H HB3  . LEU A 1 17  ? -8.530  6.224   -8.395  1.00 0.00 ? 17  LEU A HB3  5  
ATOM 6254  H HG   . LEU A 1 17  ? -7.457  5.897   -5.773  1.00 0.00 ? 17  LEU A HG   5  
ATOM 6255  H HD11 . LEU A 1 17  ? -7.653  8.129   -5.756  1.00 0.00 ? 17  LEU A HD11 5  
ATOM 6256  H HD12 . LEU A 1 17  ? -8.127  7.939   -7.461  1.00 0.00 ? 17  LEU A HD12 5  
ATOM 6257  H HD13 . LEU A 1 17  ? -9.376  8.086   -6.201  1.00 0.00 ? 17  LEU A HD13 5  
ATOM 6258  H HD21 . LEU A 1 17  ? -9.668  6.419   -4.542  1.00 0.00 ? 17  LEU A HD21 5  
ATOM 6259  H HD22 . LEU A 1 17  ? -10.450 5.622   -5.928  1.00 0.00 ? 17  LEU A HD22 5  
ATOM 6260  H HD23 . LEU A 1 17  ? -9.280  4.726   -4.930  1.00 0.00 ? 17  LEU A HD23 5  
ATOM 6261  N N    . LYS A 1 18  ? -10.981 6.428   -7.912  1.00 0.00 ? 18  LYS A N    5  
ATOM 6262  C CA   . LYS A 1 18  ? -12.202 7.180   -8.145  1.00 0.00 ? 18  LYS A CA   5  
ATOM 6263  C C    . LYS A 1 18  ? -13.233 6.812   -7.077  1.00 0.00 ? 18  LYS A C    5  
ATOM 6264  O O    . LYS A 1 18  ? -13.647 7.662   -6.289  1.00 0.00 ? 18  LYS A O    5  
ATOM 6265  C CB   . LYS A 1 18  ? -12.697 6.969   -9.577  1.00 0.00 ? 18  LYS A CB   5  
ATOM 6266  C CG   . LYS A 1 18  ? -13.832 7.938   -9.913  1.00 0.00 ? 18  LYS A CG   5  
ATOM 6267  C CD   . LYS A 1 18  ? -13.886 8.219   -11.416 1.00 0.00 ? 18  LYS A CD   5  
ATOM 6268  C CE   . LYS A 1 18  ? -15.068 7.499   -12.067 1.00 0.00 ? 18  LYS A CE   5  
ATOM 6269  N NZ   . LYS A 1 18  ? -14.730 7.091   -13.448 1.00 0.00 ? 18  LYS A NZ   5  
ATOM 6270  H H    . LYS A 1 18  ? -10.197 6.974   -7.618  1.00 0.00 ? 18  LYS A H    5  
ATOM 6271  H HA   . LYS A 1 18  ? -11.958 8.238   -8.041  1.00 0.00 ? 18  LYS A HA   5  
ATOM 6272  H HB2  . LYS A 1 18  ? -11.873 7.112   -10.276 1.00 0.00 ? 18  LYS A HB2  5  
ATOM 6273  H HB3  . LYS A 1 18  ? -13.042 5.942   -9.698  1.00 0.00 ? 18  LYS A HB3  5  
ATOM 6274  H HG2  . LYS A 1 18  ? -14.783 7.518   -9.584  1.00 0.00 ? 18  LYS A HG2  5  
ATOM 6275  H HG3  . LYS A 1 18  ? -13.691 8.872   -9.369  1.00 0.00 ? 18  LYS A HG3  5  
ATOM 6276  H HD2  . LYS A 1 18  ? -13.971 9.293   -11.586 1.00 0.00 ? 18  LYS A HD2  5  
ATOM 6277  H HD3  . LYS A 1 18  ? -12.956 7.895   -11.884 1.00 0.00 ? 18  LYS A HD3  5  
ATOM 6278  H HE2  . LYS A 1 18  ? -15.337 6.622   -11.478 1.00 0.00 ? 18  LYS A HE2  5  
ATOM 6279  H HE3  . LYS A 1 18  ? -15.939 8.154   -12.078 1.00 0.00 ? 18  LYS A HE3  5  
ATOM 6280  H HZ1  . LYS A 1 18  ? -14.093 6.320   -13.422 1.00 0.00 ? 18  LYS A HZ1  5  
ATOM 6281  H HZ2  . LYS A 1 18  ? -15.563 6.818   -13.929 1.00 0.00 ? 18  LYS A HZ2  5  
ATOM 6282  H HZ3  . LYS A 1 18  ? -14.305 7.858   -13.928 1.00 0.00 ? 18  LYS A HZ3  5  
ATOM 6283  N N    . LYS A 1 19  ? -13.619 5.545   -7.084  1.00 0.00 ? 19  LYS A N    5  
ATOM 6284  C CA   . LYS A 1 19  ? -14.595 5.054   -6.125  1.00 0.00 ? 19  LYS A CA   5  
ATOM 6285  C C    . LYS A 1 19  ? -15.367 6.238   -5.538  1.00 0.00 ? 19  LYS A C    5  
ATOM 6286  O O    . LYS A 1 19  ? -15.822 7.113   -6.273  1.00 0.00 ? 19  LYS A O    5  
ATOM 6287  C CB   . LYS A 1 19  ? -13.916 4.179   -5.070  1.00 0.00 ? 19  LYS A CB   5  
ATOM 6288  C CG   . LYS A 1 19  ? -14.757 2.937   -4.764  1.00 0.00 ? 19  LYS A CG   5  
ATOM 6289  C CD   . LYS A 1 19  ? -16.049 3.316   -4.038  1.00 0.00 ? 19  LYS A CD   5  
ATOM 6290  C CE   . LYS A 1 19  ? -17.110 2.226   -4.204  1.00 0.00 ? 19  LYS A CE   5  
ATOM 6291  N NZ   . LYS A 1 19  ? -17.889 2.445   -5.443  1.00 0.00 ? 19  LYS A NZ   5  
ATOM 6292  H H    . LYS A 1 19  ? -13.278 4.860   -7.728  1.00 0.00 ? 19  LYS A H    5  
ATOM 6293  H HA   . LYS A 1 19  ? -15.296 4.420   -6.668  1.00 0.00 ? 19  LYS A HA   5  
ATOM 6294  H HB2  . LYS A 1 19  ? -12.930 3.876   -5.422  1.00 0.00 ? 19  LYS A HB2  5  
ATOM 6295  H HB3  . LYS A 1 19  ? -13.765 4.754   -4.157  1.00 0.00 ? 19  LYS A HB3  5  
ATOM 6296  H HG2  . LYS A 1 19  ? -14.995 2.418   -5.692  1.00 0.00 ? 19  LYS A HG2  5  
ATOM 6297  H HG3  . LYS A 1 19  ? -14.180 2.245   -4.151  1.00 0.00 ? 19  LYS A HG3  5  
ATOM 6298  H HD2  . LYS A 1 19  ? -15.843 3.470   -2.979  1.00 0.00 ? 19  LYS A HD2  5  
ATOM 6299  H HD3  . LYS A 1 19  ? -16.428 4.260   -4.430  1.00 0.00 ? 19  LYS A HD3  5  
ATOM 6300  H HE2  . LYS A 1 19  ? -16.633 1.247   -4.235  1.00 0.00 ? 19  LYS A HE2  5  
ATOM 6301  H HE3  . LYS A 1 19  ? -17.779 2.227   -3.343  1.00 0.00 ? 19  LYS A HE3  5  
ATOM 6302  H HZ1  . LYS A 1 19  ? -18.258 1.572   -5.764  1.00 0.00 ? 19  LYS A HZ1  5  
ATOM 6303  H HZ2  . LYS A 1 19  ? -18.641 3.077   -5.258  1.00 0.00 ? 19  LYS A HZ2  5  
ATOM 6304  H HZ3  . LYS A 1 19  ? -17.293 2.833   -6.147  1.00 0.00 ? 19  LYS A HZ3  5  
ATOM 6305  N N    . GLN A 1 20  ? -15.490 6.227   -4.219  1.00 0.00 ? 20  GLN A N    5  
ATOM 6306  C CA   . GLN A 1 20  ? -16.199 7.288   -3.525  1.00 0.00 ? 20  GLN A CA   5  
ATOM 6307  C C    . GLN A 1 20  ? -15.394 8.588   -3.580  1.00 0.00 ? 20  GLN A C    5  
ATOM 6308  O O    . GLN A 1 20  ? -15.900 9.651   -3.223  1.00 0.00 ? 20  GLN A O    5  
ATOM 6309  C CB   . GLN A 1 20  ? -16.502 6.891   -2.079  1.00 0.00 ? 20  GLN A CB   5  
ATOM 6310  C CG   . GLN A 1 20  ? -17.553 5.781   -2.024  1.00 0.00 ? 20  GLN A CG   5  
ATOM 6311  C CD   . GLN A 1 20  ? -18.251 5.755   -0.662  1.00 0.00 ? 20  GLN A CD   5  
ATOM 6312  O OE1  . GLN A 1 20  ? -19.443 5.987   -0.542  1.00 0.00 ? 20  GLN A OE1  5  
ATOM 6313  N NE2  . GLN A 1 20  ? -17.445 5.460   0.353   1.00 0.00 ? 20  GLN A NE2  5  
ATOM 6314  H H    . GLN A 1 20  ? -15.117 5.511   -3.629  1.00 0.00 ? 20  GLN A H    5  
ATOM 6315  H HA   . GLN A 1 20  ? -17.138 7.412   -4.066  1.00 0.00 ? 20  GLN A HA   5  
ATOM 6316  H HB2  . GLN A 1 20  ? -15.587 6.555   -1.591  1.00 0.00 ? 20  GLN A HB2  5  
ATOM 6317  H HB3  . GLN A 1 20  ? -16.856 7.761   -1.526  1.00 0.00 ? 20  GLN A HB3  5  
ATOM 6318  H HG2  . GLN A 1 20  ? -18.291 5.935   -2.811  1.00 0.00 ? 20  GLN A HG2  5  
ATOM 6319  H HG3  . GLN A 1 20  ? -17.081 4.818   -2.213  1.00 0.00 ? 20  GLN A HG3  5  
ATOM 6320  H HE21 . GLN A 1 20  ? -16.475 5.280   0.186   1.00 0.00 ? 20  GLN A HE21 5  
ATOM 6321  H HE22 . GLN A 1 20  ? -17.808 5.418   1.284   1.00 0.00 ? 20  GLN A HE22 5  
ATOM 6322  N N    . ASN A 1 21  ? -14.154 8.460   -4.029  1.00 0.00 ? 21  ASN A N    5  
ATOM 6323  C CA   . ASN A 1 21  ? -13.274 9.611   -4.135  1.00 0.00 ? 21  ASN A CA   5  
ATOM 6324  C C    . ASN A 1 21  ? -11.820 9.136   -4.160  1.00 0.00 ? 21  ASN A C    5  
ATOM 6325  O O    . ASN A 1 21  ? -11.168 9.176   -5.202  1.00 0.00 ? 21  ASN A O    5  
ATOM 6326  C CB   . ASN A 1 21  ? -13.445 10.547  -2.937  1.00 0.00 ? 21  ASN A CB   5  
ATOM 6327  C CG   . ASN A 1 21  ? -14.304 11.759  -3.305  1.00 0.00 ? 21  ASN A CG   5  
ATOM 6328  O OD1  . ASN A 1 21  ? -14.503 12.081  -4.464  1.00 0.00 ? 21  ASN A OD1  5  
ATOM 6329  N ND2  . ASN A 1 21  ? -14.799 12.409  -2.256  1.00 0.00 ? 21  ASN A ND2  5  
ATOM 6330  H H    . ASN A 1 21  ? -13.750 7.592   -4.317  1.00 0.00 ? 21  ASN A H    5  
ATOM 6331  H HA   . ASN A 1 21  ? -13.565 10.111  -5.059  1.00 0.00 ? 21  ASN A HA   5  
ATOM 6332  H HB2  . ASN A 1 21  ? -13.907 10.006  -2.111  1.00 0.00 ? 21  ASN A HB2  5  
ATOM 6333  H HB3  . ASN A 1 21  ? -12.467 10.882  -2.590  1.00 0.00 ? 21  ASN A HB3  5  
ATOM 6334  H HD21 . ASN A 1 21  ? -14.597 12.092  -1.329  1.00 0.00 ? 21  ASN A HD21 5  
ATOM 6335  H HD22 . ASN A 1 21  ? -15.374 13.216  -2.394  1.00 0.00 ? 21  ASN A HD22 5  
ATOM 6336  N N    . GLY A 1 22  ? -11.354 8.697   -3.000  1.00 0.00 ? 22  GLY A N    5  
ATOM 6337  C CA   . GLY A 1 22  ? -9.989  8.214   -2.876  1.00 0.00 ? 22  GLY A CA   5  
ATOM 6338  C C    . GLY A 1 22  ? -9.961  6.784   -2.335  1.00 0.00 ? 22  GLY A C    5  
ATOM 6339  O O    . GLY A 1 22  ? -10.945 6.055   -2.445  1.00 0.00 ? 22  GLY A O    5  
ATOM 6340  H H    . GLY A 1 22  ? -11.891 8.668   -2.157  1.00 0.00 ? 22  GLY A H    5  
ATOM 6341  H HA2  . GLY A 1 22  ? -9.498  8.249   -3.848  1.00 0.00 ? 22  GLY A HA2  5  
ATOM 6342  H HA3  . GLY A 1 22  ? -9.427  8.870   -2.211  1.00 0.00 ? 22  GLY A HA3  5  
ATOM 6343  N N    . MET A 1 23  ? -8.821  6.424   -1.762  1.00 0.00 ? 23  MET A N    5  
ATOM 6344  C CA   . MET A 1 23  ? -8.652  5.094   -1.203  1.00 0.00 ? 23  MET A CA   5  
ATOM 6345  C C    . MET A 1 23  ? -8.874  5.102   0.310   1.00 0.00 ? 23  MET A C    5  
ATOM 6346  O O    . MET A 1 23  ? -8.961  4.045   0.934   1.00 0.00 ? 23  MET A O    5  
ATOM 6347  C CB   . MET A 1 23  ? -7.240  4.588   -1.509  1.00 0.00 ? 23  MET A CB   5  
ATOM 6348  C CG   . MET A 1 23  ? -6.185  5.591   -1.041  1.00 0.00 ? 23  MET A CG   5  
ATOM 6349  S SD   . MET A 1 23  ? -4.579  4.813   -0.997  1.00 0.00 ? 23  MET A SD   5  
ATOM 6350  C CE   . MET A 1 23  ? -3.869  5.481   -2.492  1.00 0.00 ? 23  MET A CE   5  
ATOM 6351  H H    . MET A 1 23  ? -8.025  7.023   -1.676  1.00 0.00 ? 23  MET A H    5  
ATOM 6352  H HA   . MET A 1 23  ? -9.408  4.475   -1.686  1.00 0.00 ? 23  MET A HA   5  
ATOM 6353  H HB2  . MET A 1 23  ? -7.079  3.629   -1.016  1.00 0.00 ? 23  MET A HB2  5  
ATOM 6354  H HB3  . MET A 1 23  ? -7.136  4.417   -2.581  1.00 0.00 ? 23  MET A HB3  5  
ATOM 6355  H HG2  . MET A 1 23  ? -6.163  6.449   -1.713  1.00 0.00 ? 23  MET A HG2  5  
ATOM 6356  H HG3  . MET A 1 23  ? -6.443  5.968   -0.052  1.00 0.00 ? 23  MET A HG3  5  
ATOM 6357  H HE1  . MET A 1 23  ? -2.892  5.029   -2.664  1.00 0.00 ? 23  MET A HE1  5  
ATOM 6358  H HE2  . MET A 1 23  ? -4.524  5.263   -3.335  1.00 0.00 ? 23  MET A HE2  5  
ATOM 6359  H HE3  . MET A 1 23  ? -3.756  6.561   -2.389  1.00 0.00 ? 23  MET A HE3  5  
ATOM 6360  N N    . GLY A 1 24  ? -8.961  6.306   0.857   1.00 0.00 ? 24  GLY A N    5  
ATOM 6361  C CA   . GLY A 1 24  ? -9.172  6.465   2.286   1.00 0.00 ? 24  GLY A CA   5  
ATOM 6362  C C    . GLY A 1 24  ? -8.470  5.355   3.071   1.00 0.00 ? 24  GLY A C    5  
ATOM 6363  O O    . GLY A 1 24  ? -9.122  4.557   3.743   1.00 0.00 ? 24  GLY A O    5  
ATOM 6364  H H    . GLY A 1 24  ? -8.890  7.160   0.342   1.00 0.00 ? 24  GLY A H    5  
ATOM 6365  H HA2  . GLY A 1 24  ? -8.796  7.436   2.606   1.00 0.00 ? 24  GLY A HA2  5  
ATOM 6366  H HA3  . GLY A 1 24  ? -10.240 6.450   2.503   1.00 0.00 ? 24  GLY A HA3  5  
ATOM 6367  N N    . LEU A 1 25  ? -7.150  5.341   2.961   1.00 0.00 ? 25  LEU A N    5  
ATOM 6368  C CA   . LEU A 1 25  ? -6.352  4.342   3.652   1.00 0.00 ? 25  LEU A CA   5  
ATOM 6369  C C    . LEU A 1 25  ? -5.387  5.042   4.611   1.00 0.00 ? 25  LEU A C    5  
ATOM 6370  O O    . LEU A 1 25  ? -4.775  6.048   4.257   1.00 0.00 ? 25  LEU A O    5  
ATOM 6371  C CB   . LEU A 1 25  ? -5.660  3.420   2.647   1.00 0.00 ? 25  LEU A CB   5  
ATOM 6372  C CG   . LEU A 1 25  ? -4.918  2.219   3.239   1.00 0.00 ? 25  LEU A CG   5  
ATOM 6373  C CD1  . LEU A 1 25  ? -3.721  2.673   4.076   1.00 0.00 ? 25  LEU A CD1  5  
ATOM 6374  C CD2  . LEU A 1 25  ? -5.869  1.325   4.036   1.00 0.00 ? 25  LEU A CD2  5  
ATOM 6375  H H    . LEU A 1 25  ? -6.627  5.994   2.412   1.00 0.00 ? 25  LEU A H    5  
ATOM 6376  H HA   . LEU A 1 25  ? -7.035  3.727   4.237   1.00 0.00 ? 25  LEU A HA   5  
ATOM 6377  H HB2  . LEU A 1 25  ? -6.409  3.049   1.947   1.00 0.00 ? 25  LEU A HB2  5  
ATOM 6378  H HB3  . LEU A 1 25  ? -4.950  4.012   2.070   1.00 0.00 ? 25  LEU A HB3  5  
ATOM 6379  H HG   . LEU A 1 25  ? -4.527  1.620   2.416   1.00 0.00 ? 25  LEU A HG   5  
ATOM 6380  H HD11 . LEU A 1 25  ? -2.925  1.932   4.004   1.00 0.00 ? 25  LEU A HD11 5  
ATOM 6381  H HD12 . LEU A 1 25  ? -3.360  3.632   3.704   1.00 0.00 ? 25  LEU A HD12 5  
ATOM 6382  H HD13 . LEU A 1 25  ? -4.025  2.779   5.118   1.00 0.00 ? 25  LEU A HD13 5  
ATOM 6383  H HD21 . LEU A 1 25  ? -5.363  0.396   4.295   1.00 0.00 ? 25  LEU A HD21 5  
ATOM 6384  H HD22 . LEU A 1 25  ? -6.173  1.840   4.948   1.00 0.00 ? 25  LEU A HD22 5  
ATOM 6385  H HD23 . LEU A 1 25  ? -6.750  1.104   3.433   1.00 0.00 ? 25  LEU A HD23 5  
ATOM 6386  N N    . SER A 1 26  ? -5.281  4.480   5.807   1.00 0.00 ? 26  SER A N    5  
ATOM 6387  C CA   . SER A 1 26  ? -4.400  5.038   6.819   1.00 0.00 ? 26  SER A CA   5  
ATOM 6388  C C    . SER A 1 26  ? -3.139  4.181   6.945   1.00 0.00 ? 26  SER A C    5  
ATOM 6389  O O    . SER A 1 26  ? -3.183  3.080   7.493   1.00 0.00 ? 26  SER A O    5  
ATOM 6390  C CB   . SER A 1 26  ? -5.110  5.139   8.171   1.00 0.00 ? 26  SER A CB   5  
ATOM 6391  O OG   . SER A 1 26  ? -5.943  6.292   8.251   1.00 0.00 ? 26  SER A OG   5  
ATOM 6392  H H    . SER A 1 26  ? -5.782  3.662   6.087   1.00 0.00 ? 26  SER A H    5  
ATOM 6393  H HA   . SER A 1 26  ? -4.150  6.038   6.465   1.00 0.00 ? 26  SER A HA   5  
ATOM 6394  H HB2  . SER A 1 26  ? -5.711  4.244   8.332   1.00 0.00 ? 26  SER A HB2  5  
ATOM 6395  H HB3  . SER A 1 26  ? -4.368  5.172   8.969   1.00 0.00 ? 26  SER A HB3  5  
ATOM 6396  H HG   . SER A 1 26  ? -5.409  7.114   8.056   1.00 0.00 ? 26  SER A HG   5  
ATOM 6397  N N    . ILE A 1 27  ? -2.043  4.718   6.428   1.00 0.00 ? 27  ILE A N    5  
ATOM 6398  C CA   . ILE A 1 27  ? -0.772  4.016   6.476   1.00 0.00 ? 27  ILE A CA   5  
ATOM 6399  C C    . ILE A 1 27  ? -0.033  4.395   7.761   1.00 0.00 ? 27  ILE A C    5  
ATOM 6400  O O    . ILE A 1 27  ? -0.498  5.242   8.522   1.00 0.00 ? 27  ILE A O    5  
ATOM 6401  C CB   . ILE A 1 27  ? 0.034   4.281   5.203   1.00 0.00 ? 27  ILE A CB   5  
ATOM 6402  C CG1  . ILE A 1 27  ? 0.591   5.707   5.192   1.00 0.00 ? 27  ILE A CG1  5  
ATOM 6403  C CG2  . ILE A 1 27  ? -0.798  3.982   3.954   1.00 0.00 ? 27  ILE A CG2  5  
ATOM 6404  C CD1  . ILE A 1 27  ? 1.594   5.895   4.053   1.00 0.00 ? 27  ILE A CD1  5  
ATOM 6405  H H    . ILE A 1 27  ? -2.015  5.614   5.985   1.00 0.00 ? 27  ILE A H    5  
ATOM 6406  H HA   . ILE A 1 27  ? -0.989  2.949   6.504   1.00 0.00 ? 27  ILE A HA   5  
ATOM 6407  H HB   . ILE A 1 27  ? 0.887   3.603   5.191   1.00 0.00 ? 27  ILE A HB   5  
ATOM 6408  H HG12 . ILE A 1 27  ? -0.227  6.419   5.083   1.00 0.00 ? 27  ILE A HG12 5  
ATOM 6409  H HG13 . ILE A 1 27  ? 1.073   5.919   6.146   1.00 0.00 ? 27  ILE A HG13 5  
ATOM 6410  H HG21 . ILE A 1 27  ? -1.267  3.003   4.056   1.00 0.00 ? 27  ILE A HG21 5  
ATOM 6411  H HG22 . ILE A 1 27  ? -1.570  4.744   3.841   1.00 0.00 ? 27  ILE A HG22 5  
ATOM 6412  H HG23 . ILE A 1 27  ? -0.152  3.986   3.077   1.00 0.00 ? 27  ILE A HG23 5  
ATOM 6413  H HD11 . ILE A 1 27  ? 1.737   4.947   3.534   1.00 0.00 ? 27  ILE A HD11 5  
ATOM 6414  H HD12 . ILE A 1 27  ? 1.214   6.639   3.353   1.00 0.00 ? 27  ILE A HD12 5  
ATOM 6415  H HD13 . ILE A 1 27  ? 2.547   6.233   4.460   1.00 0.00 ? 27  ILE A HD13 5  
ATOM 6416  N N    . VAL A 1 28  ? 1.106   3.748   7.964   1.00 0.00 ? 28  VAL A N    5  
ATOM 6417  C CA   . VAL A 1 28  ? 1.913   4.007   9.144   1.00 0.00 ? 28  VAL A CA   5  
ATOM 6418  C C    . VAL A 1 28  ? 3.344   3.526   8.892   1.00 0.00 ? 28  VAL A C    5  
ATOM 6419  O O    . VAL A 1 28  ? 3.581   2.331   8.724   1.00 0.00 ? 28  VAL A O    5  
ATOM 6420  C CB   . VAL A 1 28  ? 1.271   3.355   10.370  1.00 0.00 ? 28  VAL A CB   5  
ATOM 6421  C CG1  . VAL A 1 28  ? 1.013   1.867   10.129  1.00 0.00 ? 28  VAL A CG1  5  
ATOM 6422  C CG2  . VAL A 1 28  ? 2.131   3.568   11.617  1.00 0.00 ? 28  VAL A CG2  5  
ATOM 6423  H H    . VAL A 1 28  ? 1.477   3.061   7.340   1.00 0.00 ? 28  VAL A H    5  
ATOM 6424  H HA   . VAL A 1 28  ? 1.928   5.085   9.303   1.00 0.00 ? 28  VAL A HA   5  
ATOM 6425  H HB   . VAL A 1 28  ? 0.309   3.838   10.540  1.00 0.00 ? 28  VAL A HB   5  
ATOM 6426  H HG11 . VAL A 1 28  ? 1.921   1.399   9.746   1.00 0.00 ? 28  VAL A HG11 5  
ATOM 6427  H HG12 . VAL A 1 28  ? 0.727   1.391   11.067  1.00 0.00 ? 28  VAL A HG12 5  
ATOM 6428  H HG13 . VAL A 1 28  ? 0.210   1.750   9.402   1.00 0.00 ? 28  VAL A HG13 5  
ATOM 6429  H HG21 . VAL A 1 28  ? 2.773   4.437   11.472  1.00 0.00 ? 28  VAL A HG21 5  
ATOM 6430  H HG22 . VAL A 1 28  ? 1.485   3.734   12.480  1.00 0.00 ? 28  VAL A HG22 5  
ATOM 6431  H HG23 . VAL A 1 28  ? 2.747   2.686   11.789  1.00 0.00 ? 28  VAL A HG23 5  
ATOM 6432  N N    . ALA A 1 29  ? 4.261   4.483   8.875   1.00 0.00 ? 29  ALA A N    5  
ATOM 6433  C CA   . ALA A 1 29  ? 5.662   4.172   8.647   1.00 0.00 ? 29  ALA A CA   5  
ATOM 6434  C C    . ALA A 1 29  ? 6.394   5.439   8.200   1.00 0.00 ? 29  ALA A C    5  
ATOM 6435  O O    . ALA A 1 29  ? 5.849   6.538   8.285   1.00 0.00 ? 29  ALA A O    5  
ATOM 6436  C CB   . ALA A 1 29  ? 5.774   3.041   7.623   1.00 0.00 ? 29  ALA A CB   5  
ATOM 6437  H H    . ALA A 1 29  ? 4.060   5.452   9.013   1.00 0.00 ? 29  ALA A H    5  
ATOM 6438  H HA   . ALA A 1 29  ? 6.085   3.832   9.593   1.00 0.00 ? 29  ALA A HA   5  
ATOM 6439  H HB1  . ALA A 1 29  ? 6.742   3.097   7.124   1.00 0.00 ? 29  ALA A HB1  5  
ATOM 6440  H HB2  . ALA A 1 29  ? 5.682   2.081   8.130   1.00 0.00 ? 29  ALA A HB2  5  
ATOM 6441  H HB3  . ALA A 1 29  ? 4.979   3.140   6.884   1.00 0.00 ? 29  ALA A HB3  5  
ATOM 6442  N N    . ALA A 1 30  ? 7.619   5.242   7.733   1.00 0.00 ? 30  ALA A N    5  
ATOM 6443  C CA   . ALA A 1 30  ? 8.431   6.355   7.272   1.00 0.00 ? 30  ALA A CA   5  
ATOM 6444  C C    . ALA A 1 30  ? 9.690   5.814   6.592   1.00 0.00 ? 30  ALA A C    5  
ATOM 6445  O O    . ALA A 1 30  ? 9.666   4.737   5.999   1.00 0.00 ? 30  ALA A O    5  
ATOM 6446  C CB   . ALA A 1 30  ? 8.755   7.274   8.452   1.00 0.00 ? 30  ALA A CB   5  
ATOM 6447  H H    . ALA A 1 30  ? 8.055   4.345   7.667   1.00 0.00 ? 30  ALA A H    5  
ATOM 6448  H HA   . ALA A 1 30  ? 7.845   6.914   6.542   1.00 0.00 ? 30  ALA A HA   5  
ATOM 6449  H HB1  . ALA A 1 30  ? 8.093   7.041   9.286   1.00 0.00 ? 30  ALA A HB1  5  
ATOM 6450  H HB2  . ALA A 1 30  ? 9.791   7.123   8.756   1.00 0.00 ? 30  ALA A HB2  5  
ATOM 6451  H HB3  . ALA A 1 30  ? 8.612   8.312   8.153   1.00 0.00 ? 30  ALA A HB3  5  
ATOM 6452  N N    . LYS A 1 31  ? 10.761  6.587   6.700   1.00 0.00 ? 31  LYS A N    5  
ATOM 6453  C CA   . LYS A 1 31  ? 12.027  6.199   6.102   1.00 0.00 ? 31  LYS A CA   5  
ATOM 6454  C C    . LYS A 1 31  ? 13.116  7.180   6.542   1.00 0.00 ? 31  LYS A C    5  
ATOM 6455  O O    . LYS A 1 31  ? 13.130  8.332   6.108   1.00 0.00 ? 31  LYS A O    5  
ATOM 6456  C CB   . LYS A 1 31  ? 11.888  6.075   4.584   1.00 0.00 ? 31  LYS A CB   5  
ATOM 6457  C CG   . LYS A 1 31  ? 13.186  6.475   3.879   1.00 0.00 ? 31  LYS A CG   5  
ATOM 6458  C CD   . LYS A 1 31  ? 13.176  6.027   2.416   1.00 0.00 ? 31  LYS A CD   5  
ATOM 6459  C CE   . LYS A 1 31  ? 13.884  7.050   1.525   1.00 0.00 ? 31  LYS A CE   5  
ATOM 6460  N NZ   . LYS A 1 31  ? 13.577  6.796   0.100   1.00 0.00 ? 31  LYS A NZ   5  
ATOM 6461  H H    . LYS A 1 31  ? 10.773  7.462   7.184   1.00 0.00 ? 31  LYS A H    5  
ATOM 6462  H HA   . LYS A 1 31  ? 12.280  5.210   6.485   1.00 0.00 ? 31  LYS A HA   5  
ATOM 6463  H HB2  . LYS A 1 31  ? 11.629  5.049   4.321   1.00 0.00 ? 31  LYS A HB2  5  
ATOM 6464  H HB3  . LYS A 1 31  ? 11.071  6.708   4.237   1.00 0.00 ? 31  LYS A HB3  5  
ATOM 6465  H HG2  . LYS A 1 31  ? 13.313  7.556   3.932   1.00 0.00 ? 31  LYS A HG2  5  
ATOM 6466  H HG3  . LYS A 1 31  ? 14.036  6.029   4.395   1.00 0.00 ? 31  LYS A HG3  5  
ATOM 6467  H HD2  . LYS A 1 31  ? 13.668  5.058   2.326   1.00 0.00 ? 31  LYS A HD2  5  
ATOM 6468  H HD3  . LYS A 1 31  ? 12.148  5.896   2.079   1.00 0.00 ? 31  LYS A HD3  5  
ATOM 6469  H HE2  . LYS A 1 31  ? 13.569  8.057   1.797   1.00 0.00 ? 31  LYS A HE2  5  
ATOM 6470  H HE3  . LYS A 1 31  ? 14.961  6.998   1.686   1.00 0.00 ? 31  LYS A HE3  5  
ATOM 6471  H HZ1  . LYS A 1 31  ? 14.113  7.416   -0.472  1.00 0.00 ? 31  LYS A HZ1  5  
ATOM 6472  H HZ2  . LYS A 1 31  ? 13.808  5.850   -0.127  1.00 0.00 ? 31  LYS A HZ2  5  
ATOM 6473  H HZ3  . LYS A 1 31  ? 12.602  6.949   -0.064  1.00 0.00 ? 31  LYS A HZ3  5  
ATOM 6474  N N    . GLY A 1 32  ? 14.001  6.689   7.396   1.00 0.00 ? 32  GLY A N    5  
ATOM 6475  C CA   . GLY A 1 32  ? 15.091  7.509   7.899   1.00 0.00 ? 32  GLY A CA   5  
ATOM 6476  C C    . GLY A 1 32  ? 15.294  7.290   9.399   1.00 0.00 ? 32  GLY A C    5  
ATOM 6477  O O    . GLY A 1 32  ? 14.468  6.658   10.056  1.00 0.00 ? 32  GLY A O    5  
ATOM 6478  H H    . GLY A 1 32  ? 13.983  5.752   7.743   1.00 0.00 ? 32  GLY A H    5  
ATOM 6479  H HA2  . GLY A 1 32  ? 16.009  7.266   7.364   1.00 0.00 ? 32  GLY A HA2  5  
ATOM 6480  H HA3  . GLY A 1 32  ? 14.878  8.560   7.706   1.00 0.00 ? 32  GLY A HA3  5  
ATOM 6481  N N    . ALA A 1 33  ? 16.399  7.826   9.898   1.00 0.00 ? 33  ALA A N    5  
ATOM 6482  C CA   . ALA A 1 33  ? 16.721  7.697   11.309  1.00 0.00 ? 33  ALA A CA   5  
ATOM 6483  C C    . ALA A 1 33  ? 16.968  6.224   11.639  1.00 0.00 ? 33  ALA A C    5  
ATOM 6484  O O    . ALA A 1 33  ? 16.473  5.718   12.646  1.00 0.00 ? 33  ALA A O    5  
ATOM 6485  C CB   . ALA A 1 33  ? 15.593  8.302   12.148  1.00 0.00 ? 33  ALA A CB   5  
ATOM 6486  H H    . ALA A 1 33  ? 17.065  8.339   9.358   1.00 0.00 ? 33  ALA A H    5  
ATOM 6487  H HA   . ALA A 1 33  ? 17.636  8.260   11.493  1.00 0.00 ? 33  ALA A HA   5  
ATOM 6488  H HB1  . ALA A 1 33  ? 15.172  7.535   12.798  1.00 0.00 ? 33  ALA A HB1  5  
ATOM 6489  H HB2  . ALA A 1 33  ? 15.989  9.116   12.756  1.00 0.00 ? 33  ALA A HB2  5  
ATOM 6490  H HB3  . ALA A 1 33  ? 14.815  8.686   11.488  1.00 0.00 ? 33  ALA A HB3  5  
ATOM 6491  N N    . GLY A 1 34  ? 17.732  5.576   10.773  1.00 0.00 ? 34  GLY A N    5  
ATOM 6492  C CA   . GLY A 1 34  ? 18.050  4.171   10.960  1.00 0.00 ? 34  GLY A CA   5  
ATOM 6493  C C    . GLY A 1 34  ? 18.656  3.572   9.688   1.00 0.00 ? 34  GLY A C    5  
ATOM 6494  O O    . GLY A 1 34  ? 19.777  3.910   9.312   1.00 0.00 ? 34  GLY A O    5  
ATOM 6495  H H    . GLY A 1 34  ? 18.130  5.995   9.956   1.00 0.00 ? 34  GLY A H    5  
ATOM 6496  H HA2  . GLY A 1 34  ? 18.751  4.060   11.787  1.00 0.00 ? 34  GLY A HA2  5  
ATOM 6497  H HA3  . GLY A 1 34  ? 17.148  3.623   11.230  1.00 0.00 ? 34  GLY A HA3  5  
ATOM 6498  N N    . GLN A 1 35  ? 17.887  2.693   9.062   1.00 0.00 ? 35  GLN A N    5  
ATOM 6499  C CA   . GLN A 1 35  ? 18.334  2.044   7.841   1.00 0.00 ? 35  GLN A CA   5  
ATOM 6500  C C    . GLN A 1 35  ? 17.965  2.893   6.623   1.00 0.00 ? 35  GLN A C    5  
ATOM 6501  O O    . GLN A 1 35  ? 17.927  2.392   5.501   1.00 0.00 ? 35  GLN A O    5  
ATOM 6502  C CB   . GLN A 1 35  ? 17.750  0.635   7.724   1.00 0.00 ? 35  GLN A CB   5  
ATOM 6503  C CG   . GLN A 1 35  ? 18.645  -0.390  8.424   1.00 0.00 ? 35  GLN A CG   5  
ATOM 6504  C CD   . GLN A 1 35  ? 19.164  -1.432  7.432   1.00 0.00 ? 35  GLN A CD   5  
ATOM 6505  O OE1  . GLN A 1 35  ? 19.129  -1.251  6.226   1.00 0.00 ? 35  GLN A OE1  5  
ATOM 6506  N NE2  . GLN A 1 35  ? 19.647  -2.531  8.005   1.00 0.00 ? 35  GLN A NE2  5  
ATOM 6507  H H    . GLN A 1 35  ? 16.976  2.424   9.375   1.00 0.00 ? 35  GLN A H    5  
ATOM 6508  H HA   . GLN A 1 35  ? 19.418  1.975   7.930   1.00 0.00 ? 35  GLN A HA   5  
ATOM 6509  H HB2  . GLN A 1 35  ? 16.753  0.613   8.164   1.00 0.00 ? 35  GLN A HB2  5  
ATOM 6510  H HB3  . GLN A 1 35  ? 17.640  0.369   6.673   1.00 0.00 ? 35  GLN A HB3  5  
ATOM 6511  H HG2  . GLN A 1 35  ? 19.485  0.119   8.896   1.00 0.00 ? 35  GLN A HG2  5  
ATOM 6512  H HG3  . GLN A 1 35  ? 18.085  -0.885  9.218   1.00 0.00 ? 35  GLN A HG3  5  
ATOM 6513  H HE21 . GLN A 1 35  ? 19.647  -2.617  9.002   1.00 0.00 ? 35  GLN A HE21 5  
ATOM 6514  H HE22 . GLN A 1 35  ? 20.011  -3.271  7.440   1.00 0.00 ? 35  GLN A HE22 5  
ATOM 6515  N N    . ASP A 1 36  ? 17.703  4.165   6.886   1.00 0.00 ? 36  ASP A N    5  
ATOM 6516  C CA   . ASP A 1 36  ? 17.339  5.089   5.825   1.00 0.00 ? 36  ASP A CA   5  
ATOM 6517  C C    . ASP A 1 36  ? 16.075  4.583   5.126   1.00 0.00 ? 36  ASP A C    5  
ATOM 6518  O O    . ASP A 1 36  ? 15.922  4.749   3.917   1.00 0.00 ? 36  ASP A O    5  
ATOM 6519  C CB   . ASP A 1 36  ? 18.450  5.191   4.778   1.00 0.00 ? 36  ASP A CB   5  
ATOM 6520  C CG   . ASP A 1 36  ? 19.565  6.183   5.113   1.00 0.00 ? 36  ASP A CG   5  
ATOM 6521  O OD1  . ASP A 1 36  ? 19.404  7.365   4.737   1.00 0.00 ? 36  ASP A OD1  5  
ATOM 6522  O OD2  . ASP A 1 36  ? 20.552  5.738   5.737   1.00 0.00 ? 36  ASP A OD2  5  
ATOM 6523  H H    . ASP A 1 36  ? 17.736  4.565   7.802   1.00 0.00 ? 36  ASP A H    5  
ATOM 6524  H HA   . ASP A 1 36  ? 17.186  6.048   6.320   1.00 0.00 ? 36  ASP A HA   5  
ATOM 6525  H HB2  . ASP A 1 36  ? 18.891  4.204   4.642   1.00 0.00 ? 36  ASP A HB2  5  
ATOM 6526  H HB3  . ASP A 1 36  ? 18.005  5.475   3.825   1.00 0.00 ? 36  ASP A HB3  5  
ATOM 6527  N N    . LYS A 1 37  ? 15.202  3.977   5.917   1.00 0.00 ? 37  LYS A N    5  
ATOM 6528  C CA   . LYS A 1 37  ? 13.957  3.446   5.390   1.00 0.00 ? 37  LYS A CA   5  
ATOM 6529  C C    . LYS A 1 37  ? 13.207  2.713   6.504   1.00 0.00 ? 37  LYS A C    5  
ATOM 6530  O O    . LYS A 1 37  ? 13.817  2.251   7.467   1.00 0.00 ? 37  LYS A O    5  
ATOM 6531  C CB   . LYS A 1 37  ? 14.223  2.582   4.155   1.00 0.00 ? 37  LYS A CB   5  
ATOM 6532  C CG   . LYS A 1 37  ? 15.326  1.558   4.431   1.00 0.00 ? 37  LYS A CG   5  
ATOM 6533  C CD   . LYS A 1 37  ? 14.894  0.157   3.994   1.00 0.00 ? 37  LYS A CD   5  
ATOM 6534  C CE   . LYS A 1 37  ? 15.995  -0.528  3.181   1.00 0.00 ? 37  LYS A CE   5  
ATOM 6535  N NZ   . LYS A 1 37  ? 15.881  -0.169  1.750   1.00 0.00 ? 37  LYS A NZ   5  
ATOM 6536  H H    . LYS A 1 37  ? 15.334  3.847   6.900   1.00 0.00 ? 37  LYS A H    5  
ATOM 6537  H HA   . LYS A 1 37  ? 13.352  4.293   5.066   1.00 0.00 ? 37  LYS A HA   5  
ATOM 6538  H HB2  . LYS A 1 37  ? 13.308  2.067   3.863   1.00 0.00 ? 37  LYS A HB2  5  
ATOM 6539  H HB3  . LYS A 1 37  ? 14.512  3.217   3.318   1.00 0.00 ? 37  LYS A HB3  5  
ATOM 6540  H HG2  . LYS A 1 37  ? 16.234  1.845   3.900   1.00 0.00 ? 37  LYS A HG2  5  
ATOM 6541  H HG3  . LYS A 1 37  ? 15.566  1.554   5.494   1.00 0.00 ? 37  LYS A HG3  5  
ATOM 6542  H HD2  . LYS A 1 37  ? 14.657  -0.445  4.872   1.00 0.00 ? 37  LYS A HD2  5  
ATOM 6543  H HD3  . LYS A 1 37  ? 13.984  0.222   3.398   1.00 0.00 ? 37  LYS A HD3  5  
ATOM 6544  H HE2  . LYS A 1 37  ? 16.973  -0.231  3.560   1.00 0.00 ? 37  LYS A HE2  5  
ATOM 6545  H HE3  . LYS A 1 37  ? 15.922  -1.609  3.298   1.00 0.00 ? 37  LYS A HE3  5  
ATOM 6546  H HZ1  . LYS A 1 37  ? 16.737  -0.389  1.282   1.00 0.00 ? 37  LYS A HZ1  5  
ATOM 6547  H HZ2  . LYS A 1 37  ? 15.133  -0.687  1.335   1.00 0.00 ? 37  LYS A HZ2  5  
ATOM 6548  H HZ3  . LYS A 1 37  ? 15.696  0.810   1.665   1.00 0.00 ? 37  LYS A HZ3  5  
ATOM 6549  N N    . LEU A 1 38  ? 11.896  2.629   6.335   1.00 0.00 ? 38  LEU A N    5  
ATOM 6550  C CA   . LEU A 1 38  ? 11.056  1.960   7.314   1.00 0.00 ? 38  LEU A CA   5  
ATOM 6551  C C    . LEU A 1 38  ? 9.973   1.160   6.589   1.00 0.00 ? 38  LEU A C    5  
ATOM 6552  O O    . LEU A 1 38  ? 9.497   1.569   5.531   1.00 0.00 ? 38  LEU A O    5  
ATOM 6553  C CB   . LEU A 1 38  ? 10.505  2.967   8.325   1.00 0.00 ? 38  LEU A CB   5  
ATOM 6554  C CG   . LEU A 1 38  ? 9.924   2.377   9.612   1.00 0.00 ? 38  LEU A CG   5  
ATOM 6555  C CD1  . LEU A 1 38  ? 10.157  3.314   10.799  1.00 0.00 ? 38  LEU A CD1  5  
ATOM 6556  C CD2  . LEU A 1 38  ? 8.444   2.031   9.437   1.00 0.00 ? 38  LEU A CD2  5  
ATOM 6557  H H    . LEU A 1 38  ? 11.408  3.008   5.549   1.00 0.00 ? 38  LEU A H    5  
ATOM 6558  H HA   . LEU A 1 38  ? 11.689  1.264   7.866   1.00 0.00 ? 38  LEU A HA   5  
ATOM 6559  H HB2  . LEU A 1 38  ? 11.304  3.657   8.594   1.00 0.00 ? 38  LEU A HB2  5  
ATOM 6560  H HB3  . LEU A 1 38  ? 9.728   3.555   7.835   1.00 0.00 ? 38  LEU A HB3  5  
ATOM 6561  H HG   . LEU A 1 38  ? 10.449  1.447   9.828   1.00 0.00 ? 38  LEU A HG   5  
ATOM 6562  H HD11 . LEU A 1 38  ? 11.216  3.317   11.056  1.00 0.00 ? 38  LEU A HD11 5  
ATOM 6563  H HD12 . LEU A 1 38  ? 9.845   4.324   10.531  1.00 0.00 ? 38  LEU A HD12 5  
ATOM 6564  H HD13 . LEU A 1 38  ? 9.576   2.969   11.654  1.00 0.00 ? 38  LEU A HD13 5  
ATOM 6565  H HD21 . LEU A 1 38  ? 8.228   1.092   9.947   1.00 0.00 ? 38  LEU A HD21 5  
ATOM 6566  H HD22 . LEU A 1 38  ? 7.832   2.825   9.864   1.00 0.00 ? 38  LEU A HD22 5  
ATOM 6567  H HD23 . LEU A 1 38  ? 8.218   1.928   8.376   1.00 0.00 ? 38  LEU A HD23 5  
ATOM 6568  N N    . GLY A 1 39  ? 9.613   0.033   7.187   1.00 0.00 ? 39  GLY A N    5  
ATOM 6569  C CA   . GLY A 1 39  ? 8.595   -0.828  6.611   1.00 0.00 ? 39  GLY A CA   5  
ATOM 6570  C C    . GLY A 1 39  ? 7.241   -0.116  6.558   1.00 0.00 ? 39  GLY A C    5  
ATOM 6571  O O    . GLY A 1 39  ? 6.676   0.228   7.595   1.00 0.00 ? 39  GLY A O    5  
ATOM 6572  H H    . GLY A 1 39  ? 10.005  -0.293  8.048   1.00 0.00 ? 39  GLY A H    5  
ATOM 6573  H HA2  . GLY A 1 39  ? 8.892   -1.127  5.606   1.00 0.00 ? 39  GLY A HA2  5  
ATOM 6574  H HA3  . GLY A 1 39  ? 8.507   -1.739  7.202   1.00 0.00 ? 39  GLY A HA3  5  
ATOM 6575  N N    . ILE A 1 40  ? 6.761   0.083   5.340   1.00 0.00 ? 40  ILE A N    5  
ATOM 6576  C CA   . ILE A 1 40  ? 5.485   0.748   5.138   1.00 0.00 ? 40  ILE A CA   5  
ATOM 6577  C C    . ILE A 1 40  ? 4.350   -0.229  5.453   1.00 0.00 ? 40  ILE A C    5  
ATOM 6578  O O    . ILE A 1 40  ? 4.158   -1.214  4.742   1.00 0.00 ? 40  ILE A O    5  
ATOM 6579  C CB   . ILE A 1 40  ? 5.408   1.345   3.731   1.00 0.00 ? 40  ILE A CB   5  
ATOM 6580  C CG1  . ILE A 1 40  ? 6.596   2.271   3.463   1.00 0.00 ? 40  ILE A CG1  5  
ATOM 6581  C CG2  . ILE A 1 40  ? 4.069   2.051   3.507   1.00 0.00 ? 40  ILE A CG2  5  
ATOM 6582  C CD1  . ILE A 1 40  ? 6.907   3.133   4.689   1.00 0.00 ? 40  ILE A CD1  5  
ATOM 6583  H H    . ILE A 1 40  ? 7.227   -0.200  4.501   1.00 0.00 ? 40  ILE A H    5  
ATOM 6584  H HA   . ILE A 1 40  ? 5.433   1.577   5.843   1.00 0.00 ? 40  ILE A HA   5  
ATOM 6585  H HB   . ILE A 1 40  ? 5.467   0.530   3.010   1.00 0.00 ? 40  ILE A HB   5  
ATOM 6586  H HG12 . ILE A 1 40  ? 7.472   1.678   3.200   1.00 0.00 ? 40  ILE A HG12 5  
ATOM 6587  H HG13 . ILE A 1 40  ? 6.377   2.912   2.609   1.00 0.00 ? 40  ILE A HG13 5  
ATOM 6588  H HG21 . ILE A 1 40  ? 4.244   3.027   3.055   1.00 0.00 ? 40  ILE A HG21 5  
ATOM 6589  H HG22 . ILE A 1 40  ? 3.448   1.449   2.844   1.00 0.00 ? 40  ILE A HG22 5  
ATOM 6590  H HG23 . ILE A 1 40  ? 3.562   2.179   4.463   1.00 0.00 ? 40  ILE A HG23 5  
ATOM 6591  H HD11 . ILE A 1 40  ? 5.975   3.420   5.177   1.00 0.00 ? 40  ILE A HD11 5  
ATOM 6592  H HD12 . ILE A 1 40  ? 7.522   2.565   5.386   1.00 0.00 ? 40  ILE A HD12 5  
ATOM 6593  H HD13 . ILE A 1 40  ? 7.444   4.029   4.376   1.00 0.00 ? 40  ILE A HD13 5  
ATOM 6594  N N    . TYR A 1 41  ? 3.629   0.077   6.521   1.00 0.00 ? 41  TYR A N    5  
ATOM 6595  C CA   . TYR A 1 41  ? 2.518   -0.762  6.940   1.00 0.00 ? 41  TYR A CA   5  
ATOM 6596  C C    . TYR A 1 41  ? 1.258   0.074   7.175   1.00 0.00 ? 41  TYR A C    5  
ATOM 6597  O O    . TYR A 1 41  ? 1.340   1.210   7.640   1.00 0.00 ? 41  TYR A O    5  
ATOM 6598  C CB   . TYR A 1 41  ? 2.947   -1.399  8.263   1.00 0.00 ? 41  TYR A CB   5  
ATOM 6599  C CG   . TYR A 1 41  ? 3.131   -2.917  8.192   1.00 0.00 ? 41  TYR A CG   5  
ATOM 6600  C CD1  . TYR A 1 41  ? 4.237   -3.449  7.561   1.00 0.00 ? 41  TYR A CD1  5  
ATOM 6601  C CD2  . TYR A 1 41  ? 2.191   -3.753  8.759   1.00 0.00 ? 41  TYR A CD2  5  
ATOM 6602  C CE1  . TYR A 1 41  ? 4.410   -4.877  7.494   1.00 0.00 ? 41  TYR A CE1  5  
ATOM 6603  C CE2  . TYR A 1 41  ? 2.364   -5.181  8.692   1.00 0.00 ? 41  TYR A CE2  5  
ATOM 6604  C CZ   . TYR A 1 41  ? 3.465   -5.672  8.063   1.00 0.00 ? 41  TYR A CZ   5  
ATOM 6605  O OH   . TYR A 1 41  ? 3.628   -7.021  8.000   1.00 0.00 ? 41  TYR A OH   5  
ATOM 6606  H H    . TYR A 1 41  ? 3.792   0.880   7.095   1.00 0.00 ? 41  TYR A H    5  
ATOM 6607  H HA   . TYR A 1 41  ? 2.324   -1.483  6.147   1.00 0.00 ? 41  TYR A HA   5  
ATOM 6608  H HB2  . TYR A 1 41  ? 3.884   -0.945  8.587   1.00 0.00 ? 41  TYR A HB2  5  
ATOM 6609  H HB3  . TYR A 1 41  ? 2.202   -1.169  9.024   1.00 0.00 ? 41  TYR A HB3  5  
ATOM 6610  H HD1  . TYR A 1 41  ? 4.979   -2.788  7.112   1.00 0.00 ? 41  TYR A HD1  5  
ATOM 6611  H HD2  . TYR A 1 41  ? 1.318   -3.332  9.258   1.00 0.00 ? 41  TYR A HD2  5  
ATOM 6612  H HE1  . TYR A 1 41  ? 5.278   -5.311  6.998   1.00 0.00 ? 41  TYR A HE1  5  
ATOM 6613  H HE2  . TYR A 1 41  ? 1.629   -5.853  9.136   1.00 0.00 ? 41  TYR A HE2  5  
ATOM 6614  H HH   . TYR A 1 41  ? 3.446   -7.430  8.894   1.00 0.00 ? 41  TYR A HH   5  
ATOM 6615  N N    . VAL A 1 42  ? 0.122   -0.522  6.843   1.00 0.00 ? 42  VAL A N    5  
ATOM 6616  C CA   . VAL A 1 42  ? -1.154  0.153   7.012   1.00 0.00 ? 42  VAL A CA   5  
ATOM 6617  C C    . VAL A 1 42  ? -1.560  0.105   8.486   1.00 0.00 ? 42  VAL A C    5  
ATOM 6618  O O    . VAL A 1 42  ? -1.511  -0.952  9.113   1.00 0.00 ? 42  VAL A O    5  
ATOM 6619  C CB   . VAL A 1 42  ? -2.200  -0.465  6.083   1.00 0.00 ? 42  VAL A CB   5  
ATOM 6620  C CG1  . VAL A 1 42  ? -3.592  0.101   6.371   1.00 0.00 ? 42  VAL A CG1  5  
ATOM 6621  C CG2  . VAL A 1 42  ? -1.818  -0.263  4.615   1.00 0.00 ? 42  VAL A CG2  5  
ATOM 6622  H H    . VAL A 1 42  ? 0.064   -1.446  6.465   1.00 0.00 ? 42  VAL A H    5  
ATOM 6623  H HA   . VAL A 1 42  ? -1.016  1.195   6.720   1.00 0.00 ? 42  VAL A HA   5  
ATOM 6624  H HB   . VAL A 1 42  ? -2.228  -1.537  6.277   1.00 0.00 ? 42  VAL A HB   5  
ATOM 6625  H HG11 . VAL A 1 42  ? -4.344  -0.517  5.881   1.00 0.00 ? 42  VAL A HG11 5  
ATOM 6626  H HG12 . VAL A 1 42  ? -3.768  0.103   7.447   1.00 0.00 ? 42  VAL A HG12 5  
ATOM 6627  H HG13 . VAL A 1 42  ? -3.655  1.121   5.990   1.00 0.00 ? 42  VAL A HG13 5  
ATOM 6628  H HG21 . VAL A 1 42  ? -2.717  -0.287  4.000   1.00 0.00 ? 42  VAL A HG21 5  
ATOM 6629  H HG22 . VAL A 1 42  ? -1.324  0.702   4.498   1.00 0.00 ? 42  VAL A HG22 5  
ATOM 6630  H HG23 . VAL A 1 42  ? -1.142  -1.058  4.303   1.00 0.00 ? 42  VAL A HG23 5  
ATOM 6631  N N    . LYS A 1 43  ? -1.952  1.263   8.997   1.00 0.00 ? 43  LYS A N    5  
ATOM 6632  C CA   . LYS A 1 43  ? -2.366  1.366   10.386  1.00 0.00 ? 43  LYS A CA   5  
ATOM 6633  C C    . LYS A 1 43  ? -3.878  1.148   10.480  1.00 0.00 ? 43  LYS A C    5  
ATOM 6634  O O    . LYS A 1 43  ? -4.366  0.574   11.453  1.00 0.00 ? 43  LYS A O    5  
ATOM 6635  C CB   . LYS A 1 43  ? -1.898  2.693   10.988  1.00 0.00 ? 43  LYS A CB   5  
ATOM 6636  C CG   . LYS A 1 43  ? -2.770  3.092   12.180  1.00 0.00 ? 43  LYS A CG   5  
ATOM 6637  C CD   . LYS A 1 43  ? -3.654  4.293   11.835  1.00 0.00 ? 43  LYS A CD   5  
ATOM 6638  C CE   . LYS A 1 43  ? -3.262  5.518   12.663  1.00 0.00 ? 43  LYS A CE   5  
ATOM 6639  N NZ   . LYS A 1 43  ? -4.028  5.554   13.929  1.00 0.00 ? 43  LYS A NZ   5  
ATOM 6640  H H    . LYS A 1 43  ? -1.989  2.118   8.481   1.00 0.00 ? 43  LYS A H    5  
ATOM 6641  H HA   . LYS A 1 43  ? -1.867  0.568   10.936  1.00 0.00 ? 43  LYS A HA   5  
ATOM 6642  H HB2  . LYS A 1 43  ? -0.859  2.606   11.306  1.00 0.00 ? 43  LYS A HB2  5  
ATOM 6643  H HB3  . LYS A 1 43  ? -1.934  3.473   10.229  1.00 0.00 ? 43  LYS A HB3  5  
ATOM 6644  H HG2  . LYS A 1 43  ? -3.395  2.250   12.477  1.00 0.00 ? 43  LYS A HG2  5  
ATOM 6645  H HG3  . LYS A 1 43  ? -2.137  3.335   13.033  1.00 0.00 ? 43  LYS A HG3  5  
ATOM 6646  H HD2  . LYS A 1 43  ? -3.562  4.522   10.773  1.00 0.00 ? 43  LYS A HD2  5  
ATOM 6647  H HD3  . LYS A 1 43  ? -4.699  4.044   12.018  1.00 0.00 ? 43  LYS A HD3  5  
ATOM 6648  H HE2  . LYS A 1 43  ? -2.194  5.493   12.878  1.00 0.00 ? 43  LYS A HE2  5  
ATOM 6649  H HE3  . LYS A 1 43  ? -3.451  6.426   12.091  1.00 0.00 ? 43  LYS A HE3  5  
ATOM 6650  H HZ1  . LYS A 1 43  ? -3.508  6.058   14.619  1.00 0.00 ? 43  LYS A HZ1  5  
ATOM 6651  H HZ2  . LYS A 1 43  ? -4.905  6.009   13.775  1.00 0.00 ? 43  LYS A HZ2  5  
ATOM 6652  H HZ3  . LYS A 1 43  ? -4.188  4.620   14.249  1.00 0.00 ? 43  LYS A HZ3  5  
ATOM 6653  N N    . SER A 1 44  ? -4.576  1.617   9.457   1.00 0.00 ? 44  SER A N    5  
ATOM 6654  C CA   . SER A 1 44  ? -6.022  1.480   9.412   1.00 0.00 ? 44  SER A CA   5  
ATOM 6655  C C    . SER A 1 44  ? -6.556  2.001   8.076   1.00 0.00 ? 44  SER A C    5  
ATOM 6656  O O    . SER A 1 44  ? -5.802  2.141   7.115   1.00 0.00 ? 44  SER A O    5  
ATOM 6657  C CB   . SER A 1 44  ? -6.682  2.225   10.574  1.00 0.00 ? 44  SER A CB   5  
ATOM 6658  O OG   . SER A 1 44  ? -6.606  3.639   10.414  1.00 0.00 ? 44  SER A OG   5  
ATOM 6659  H H    . SER A 1 44  ? -4.171  2.083   8.670   1.00 0.00 ? 44  SER A H    5  
ATOM 6660  H HA   . SER A 1 44  ? -6.214  0.412   9.511   1.00 0.00 ? 44  SER A HA   5  
ATOM 6661  H HB2  . SER A 1 44  ? -7.727  1.925   10.651  1.00 0.00 ? 44  SER A HB2  5  
ATOM 6662  H HB3  . SER A 1 44  ? -6.199  1.940   11.509  1.00 0.00 ? 44  SER A HB3  5  
ATOM 6663  H HG   . SER A 1 44  ? -5.653  3.920   10.298  1.00 0.00 ? 44  SER A HG   5  
ATOM 6664  N N    . VAL A 1 45  ? -7.852  2.273   8.059   1.00 0.00 ? 45  VAL A N    5  
ATOM 6665  C CA   . VAL A 1 45  ? -8.496  2.775   6.857   1.00 0.00 ? 45  VAL A CA   5  
ATOM 6666  C C    . VAL A 1 45  ? -9.358  3.988   7.214   1.00 0.00 ? 45  VAL A C    5  
ATOM 6667  O O    . VAL A 1 45  ? -9.959  4.033   8.286   1.00 0.00 ? 45  VAL A O    5  
ATOM 6668  C CB   . VAL A 1 45  ? -9.289  1.655   6.182   1.00 0.00 ? 45  VAL A CB   5  
ATOM 6669  C CG1  . VAL A 1 45  ? -8.747  1.367   4.780   1.00 0.00 ? 45  VAL A CG1  5  
ATOM 6670  C CG2  . VAL A 1 45  ? -9.290  0.389   7.040   1.00 0.00 ? 45  VAL A CG2  5  
ATOM 6671  H H    . VAL A 1 45  ? -8.459  2.157   8.846   1.00 0.00 ? 45  VAL A H    5  
ATOM 6672  H HA   . VAL A 1 45  ? -7.710  3.093   6.172   1.00 0.00 ? 45  VAL A HA   5  
ATOM 6673  H HB   . VAL A 1 45  ? -10.321 1.991   6.079   1.00 0.00 ? 45  VAL A HB   5  
ATOM 6674  H HG11 . VAL A 1 45  ? -8.024  0.553   4.831   1.00 0.00 ? 45  VAL A HG11 5  
ATOM 6675  H HG12 . VAL A 1 45  ? -9.569  1.083   4.124   1.00 0.00 ? 45  VAL A HG12 5  
ATOM 6676  H HG13 . VAL A 1 45  ? -8.261  2.261   4.388   1.00 0.00 ? 45  VAL A HG13 5  
ATOM 6677  H HG21 . VAL A 1 45  ? -8.265  0.131   7.308   1.00 0.00 ? 45  VAL A HG21 5  
ATOM 6678  H HG22 . VAL A 1 45  ? -9.869  0.565   7.947   1.00 0.00 ? 45  VAL A HG22 5  
ATOM 6679  H HG23 . VAL A 1 45  ? -9.736  -0.431  6.478   1.00 0.00 ? 45  VAL A HG23 5  
ATOM 6680  N N    . VAL A 1 46  ? -9.392  4.941   6.294   1.00 0.00 ? 46  VAL A N    5  
ATOM 6681  C CA   . VAL A 1 46  ? -10.170 6.151   6.498   1.00 0.00 ? 46  VAL A CA   5  
ATOM 6682  C C    . VAL A 1 46  ? -11.643 5.779   6.681   1.00 0.00 ? 46  VAL A C    5  
ATOM 6683  O O    . VAL A 1 46  ? -12.438 6.590   7.154   1.00 0.00 ? 46  VAL A O    5  
ATOM 6684  C CB   . VAL A 1 46  ? -9.939  7.124   5.341   1.00 0.00 ? 46  VAL A CB   5  
ATOM 6685  C CG1  . VAL A 1 46  ? -11.113 8.094   5.197   1.00 0.00 ? 46  VAL A CG1  5  
ATOM 6686  C CG2  . VAL A 1 46  ? -8.620  7.880   5.516   1.00 0.00 ? 46  VAL A CG2  5  
ATOM 6687  H H    . VAL A 1 46  ? -8.900  4.897   5.425   1.00 0.00 ? 46  VAL A H    5  
ATOM 6688  H HA   . VAL A 1 46  ? -9.812  6.623   7.413   1.00 0.00 ? 46  VAL A HA   5  
ATOM 6689  H HB   . VAL A 1 46  ? -9.871  6.541   4.422   1.00 0.00 ? 46  VAL A HB   5  
ATOM 6690  H HG11 . VAL A 1 46  ? -11.136 8.766   6.055   1.00 0.00 ? 46  VAL A HG11 5  
ATOM 6691  H HG12 . VAL A 1 46  ? -10.993 8.677   4.283   1.00 0.00 ? 46  VAL A HG12 5  
ATOM 6692  H HG13 . VAL A 1 46  ? -12.045 7.532   5.150   1.00 0.00 ? 46  VAL A HG13 5  
ATOM 6693  H HG21 . VAL A 1 46  ? -8.787  8.944   5.351   1.00 0.00 ? 46  VAL A HG21 5  
ATOM 6694  H HG22 . VAL A 1 46  ? -8.243  7.724   6.527   1.00 0.00 ? 46  VAL A HG22 5  
ATOM 6695  H HG23 . VAL A 1 46  ? -7.891  7.511   4.795   1.00 0.00 ? 46  VAL A HG23 5  
ATOM 6696  N N    . LYS A 1 47  ? -11.963 4.552   6.296   1.00 0.00 ? 47  LYS A N    5  
ATOM 6697  C CA   . LYS A 1 47  ? -13.326 4.063   6.411   1.00 0.00 ? 47  LYS A CA   5  
ATOM 6698  C C    . LYS A 1 47  ? -14.253 4.947   5.573   1.00 0.00 ? 47  LYS A C    5  
ATOM 6699  O O    . LYS A 1 47  ? -15.359 5.274   6.001   1.00 0.00 ? 47  LYS A O    5  
ATOM 6700  C CB   . LYS A 1 47  ? -13.737 3.962   7.882   1.00 0.00 ? 47  LYS A CB   5  
ATOM 6701  C CG   . LYS A 1 47  ? -14.888 2.970   8.063   1.00 0.00 ? 47  LYS A CG   5  
ATOM 6702  C CD   . LYS A 1 47  ? -14.553 1.932   9.136   1.00 0.00 ? 47  LYS A CD   5  
ATOM 6703  C CE   . LYS A 1 47  ? -15.138 0.565   8.777   1.00 0.00 ? 47  LYS A CE   5  
ATOM 6704  N NZ   . LYS A 1 47  ? -16.588 0.528   9.071   1.00 0.00 ? 47  LYS A NZ   5  
ATOM 6705  H H    . LYS A 1 47  ? -11.311 3.899   5.912   1.00 0.00 ? 47  LYS A H    5  
ATOM 6706  H HA   . LYS A 1 47  ? -13.347 3.054   6.001   1.00 0.00 ? 47  LYS A HA   5  
ATOM 6707  H HB2  . LYS A 1 47  ? -12.883 3.647   8.481   1.00 0.00 ? 47  LYS A HB2  5  
ATOM 6708  H HB3  . LYS A 1 47  ? -14.037 4.944   8.247   1.00 0.00 ? 47  LYS A HB3  5  
ATOM 6709  H HG2  . LYS A 1 47  ? -15.795 3.507   8.341   1.00 0.00 ? 47  LYS A HG2  5  
ATOM 6710  H HG3  . LYS A 1 47  ? -15.092 2.468   7.117   1.00 0.00 ? 47  LYS A HG3  5  
ATOM 6711  H HD2  . LYS A 1 47  ? -13.471 1.852   9.245   1.00 0.00 ? 47  LYS A HD2  5  
ATOM 6712  H HD3  . LYS A 1 47  ? -14.947 2.259   10.098  1.00 0.00 ? 47  LYS A HD3  5  
ATOM 6713  H HE2  . LYS A 1 47  ? -14.969 0.357   7.721   1.00 0.00 ? 47  LYS A HE2  5  
ATOM 6714  H HE3  . LYS A 1 47  ? -14.626 -0.215  9.341   1.00 0.00 ? 47  LYS A HE3  5  
ATOM 6715  H HZ1  . LYS A 1 47  ? -16.883 1.423   9.404   1.00 0.00 ? 47  LYS A HZ1  5  
ATOM 6716  H HZ2  . LYS A 1 47  ? -17.091 0.300   8.238   1.00 0.00 ? 47  LYS A HZ2  5  
ATOM 6717  H HZ3  . LYS A 1 47  ? -16.769 -0.165  9.770   1.00 0.00 ? 47  LYS A HZ3  5  
ATOM 6718  N N    . GLY A 1 48  ? -13.768 5.308   4.395   1.00 0.00 ? 48  GLY A N    5  
ATOM 6719  C CA   . GLY A 1 48  ? -14.539 6.147   3.493   1.00 0.00 ? 48  GLY A CA   5  
ATOM 6720  C C    . GLY A 1 48  ? -13.858 6.254   2.127   1.00 0.00 ? 48  GLY A C    5  
ATOM 6721  O O    . GLY A 1 48  ? -13.956 7.282   1.459   1.00 0.00 ? 48  GLY A O    5  
ATOM 6722  H H    . GLY A 1 48  ? -12.867 5.038   4.054   1.00 0.00 ? 48  GLY A H    5  
ATOM 6723  H HA2  . GLY A 1 48  ? -15.540 5.734   3.373   1.00 0.00 ? 48  GLY A HA2  5  
ATOM 6724  H HA3  . GLY A 1 48  ? -14.653 7.141   3.925   1.00 0.00 ? 48  GLY A HA3  5  
ATOM 6725  N N    . GLY A 1 49  ? -13.184 5.177   1.751   1.00 0.00 ? 49  GLY A N    5  
ATOM 6726  C CA   . GLY A 1 49  ? -12.488 5.136   0.477   1.00 0.00 ? 49  GLY A CA   5  
ATOM 6727  C C    . GLY A 1 49  ? -12.563 3.740   -0.145  1.00 0.00 ? 49  GLY A C    5  
ATOM 6728  O O    . GLY A 1 49  ? -12.803 2.757   0.555   1.00 0.00 ? 49  GLY A O    5  
ATOM 6729  H H    . GLY A 1 49  ? -13.110 4.344   2.300   1.00 0.00 ? 49  GLY A H    5  
ATOM 6730  H HA2  . GLY A 1 49  ? -12.926 5.866   -0.204  1.00 0.00 ? 49  GLY A HA2  5  
ATOM 6731  H HA3  . GLY A 1 49  ? -11.445 5.419   0.619   1.00 0.00 ? 49  GLY A HA3  5  
ATOM 6732  N N    . ALA A 1 50  ? -12.353 3.698   -1.452  1.00 0.00 ? 50  ALA A N    5  
ATOM 6733  C CA   . ALA A 1 50  ? -12.394 2.438   -2.176  1.00 0.00 ? 50  ALA A CA   5  
ATOM 6734  C C    . ALA A 1 50  ? -11.710 1.353   -1.342  1.00 0.00 ? 50  ALA A C    5  
ATOM 6735  O O    . ALA A 1 50  ? -12.169 0.213   -1.304  1.00 0.00 ? 50  ALA A O    5  
ATOM 6736  C CB   . ALA A 1 50  ? -11.741 2.617   -3.549  1.00 0.00 ? 50  ALA A CB   5  
ATOM 6737  H H    . ALA A 1 50  ? -12.158 4.502   -2.014  1.00 0.00 ? 50  ALA A H    5  
ATOM 6738  H HA   . ALA A 1 50  ? -13.441 2.170   -2.318  1.00 0.00 ? 50  ALA A HA   5  
ATOM 6739  H HB1  . ALA A 1 50  ? -10.698 2.305   -3.498  1.00 0.00 ? 50  ALA A HB1  5  
ATOM 6740  H HB2  . ALA A 1 50  ? -12.267 2.007   -4.283  1.00 0.00 ? 50  ALA A HB2  5  
ATOM 6741  H HB3  . ALA A 1 50  ? -11.794 3.665   -3.842  1.00 0.00 ? 50  ALA A HB3  5  
ATOM 6742  N N    . ALA A 1 51  ? -10.623 1.747   -0.694  1.00 0.00 ? 51  ALA A N    5  
ATOM 6743  C CA   . ALA A 1 51  ? -9.871  0.822   0.137   1.00 0.00 ? 51  ALA A CA   5  
ATOM 6744  C C    . ALA A 1 51  ? -10.815 0.169   1.148   1.00 0.00 ? 51  ALA A C    5  
ATOM 6745  O O    . ALA A 1 51  ? -11.194 -0.991  0.991   1.00 0.00 ? 51  ALA A O    5  
ATOM 6746  C CB   . ALA A 1 51  ? -8.716  1.565   0.812   1.00 0.00 ? 51  ALA A CB   5  
ATOM 6747  H H    . ALA A 1 51  ? -10.256 2.676   -0.731  1.00 0.00 ? 51  ALA A H    5  
ATOM 6748  H HA   . ALA A 1 51  ? -9.459  0.050   -0.514  1.00 0.00 ? 51  ALA A HA   5  
ATOM 6749  H HB1  . ALA A 1 51  ? -9.090  2.098   1.686   1.00 0.00 ? 51  ALA A HB1  5  
ATOM 6750  H HB2  . ALA A 1 51  ? -7.955  0.848   1.121   1.00 0.00 ? 51  ALA A HB2  5  
ATOM 6751  H HB3  . ALA A 1 51  ? -8.282  2.276   0.110   1.00 0.00 ? 51  ALA A HB3  5  
ATOM 6752  N N    . ASP A 1 52  ? -11.168 0.942   2.165   1.00 0.00 ? 52  ASP A N    5  
ATOM 6753  C CA   . ASP A 1 52  ? -12.061 0.453   3.202   1.00 0.00 ? 52  ASP A CA   5  
ATOM 6754  C C    . ASP A 1 52  ? -13.439 0.182   2.596   1.00 0.00 ? 52  ASP A C    5  
ATOM 6755  O O    . ASP A 1 52  ? -14.309 -0.387  3.254   1.00 0.00 ? 52  ASP A O    5  
ATOM 6756  C CB   . ASP A 1 52  ? -12.229 1.488   4.316   1.00 0.00 ? 52  ASP A CB   5  
ATOM 6757  C CG   . ASP A 1 52  ? -12.676 0.920   5.664   1.00 0.00 ? 52  ASP A CG   5  
ATOM 6758  O OD1  . ASP A 1 52  ? -11.788 0.434   6.398   1.00 0.00 ? 52  ASP A OD1  5  
ATOM 6759  O OD2  . ASP A 1 52  ? -13.895 0.983   5.931   1.00 0.00 ? 52  ASP A OD2  5  
ATOM 6760  H H    . ASP A 1 52  ? -10.856 1.884   2.285   1.00 0.00 ? 52  ASP A H    5  
ATOM 6761  H HA   . ASP A 1 52  ? -11.588 -0.452  3.584   1.00 0.00 ? 52  ASP A HA   5  
ATOM 6762  H HB2  . ASP A 1 52  ? -11.282 2.009   4.454   1.00 0.00 ? 52  ASP A HB2  5  
ATOM 6763  H HB3  . ASP A 1 52  ? -12.958 2.232   3.993   1.00 0.00 ? 52  ASP A HB3  5  
ATOM 6764  N N    . VAL A 1 53  ? -13.595 0.602   1.349   1.00 0.00 ? 53  VAL A N    5  
ATOM 6765  C CA   . VAL A 1 53  ? -14.853 0.411   0.647   1.00 0.00 ? 53  VAL A CA   5  
ATOM 6766  C C    . VAL A 1 53  ? -14.818 -0.923  -0.102  1.00 0.00 ? 53  VAL A C    5  
ATOM 6767  O O    . VAL A 1 53  ? -15.854 -1.554  -0.301  1.00 0.00 ? 53  VAL A O    5  
ATOM 6768  C CB   . VAL A 1 53  ? -15.127 1.605   -0.271  1.00 0.00 ? 53  VAL A CB   5  
ATOM 6769  C CG1  . VAL A 1 53  ? -15.801 1.155   -1.568  1.00 0.00 ? 53  VAL A CG1  5  
ATOM 6770  C CG2  . VAL A 1 53  ? -15.965 2.665   0.445   1.00 0.00 ? 53  VAL A CG2  5  
ATOM 6771  H H    . VAL A 1 53  ? -12.883 1.063   0.821   1.00 0.00 ? 53  VAL A H    5  
ATOM 6772  H HA   . VAL A 1 53  ? -15.645 0.373   1.395   1.00 0.00 ? 53  VAL A HA   5  
ATOM 6773  H HB   . VAL A 1 53  ? -14.168 2.054   -0.530  1.00 0.00 ? 53  VAL A HB   5  
ATOM 6774  H HG11 . VAL A 1 53  ? -15.039 0.925   -2.313  1.00 0.00 ? 53  VAL A HG11 5  
ATOM 6775  H HG12 . VAL A 1 53  ? -16.402 0.266   -1.376  1.00 0.00 ? 53  VAL A HG12 5  
ATOM 6776  H HG13 . VAL A 1 53  ? -16.443 1.954   -1.940  1.00 0.00 ? 53  VAL A HG13 5  
ATOM 6777  H HG21 . VAL A 1 53  ? -15.310 3.319   1.021   1.00 0.00 ? 53  VAL A HG21 5  
ATOM 6778  H HG22 . VAL A 1 53  ? -16.510 3.256   -0.292  1.00 0.00 ? 53  VAL A HG22 5  
ATOM 6779  H HG23 . VAL A 1 53  ? -16.673 2.178   1.115   1.00 0.00 ? 53  VAL A HG23 5  
ATOM 6780  N N    . ASP A 1 54  ? -13.614 -1.312  -0.495  1.00 0.00 ? 54  ASP A N    5  
ATOM 6781  C CA   . ASP A 1 54  ? -13.430 -2.559  -1.218  1.00 0.00 ? 54  ASP A CA   5  
ATOM 6782  C C    . ASP A 1 54  ? -13.225 -3.698  -0.217  1.00 0.00 ? 54  ASP A C    5  
ATOM 6783  O O    . ASP A 1 54  ? -12.861 -4.808  -0.600  1.00 0.00 ? 54  ASP A O    5  
ATOM 6784  C CB   . ASP A 1 54  ? -12.196 -2.496  -2.121  1.00 0.00 ? 54  ASP A CB   5  
ATOM 6785  C CG   . ASP A 1 54  ? -12.459 -1.988  -3.540  1.00 0.00 ? 54  ASP A CG   5  
ATOM 6786  O OD1  . ASP A 1 54  ? -12.833 -0.801  -3.657  1.00 0.00 ? 54  ASP A OD1  5  
ATOM 6787  O OD2  . ASP A 1 54  ? -12.280 -2.798  -4.475  1.00 0.00 ? 54  ASP A OD2  5  
ATOM 6788  H H    . ASP A 1 54  ? -12.776 -0.792  -0.329  1.00 0.00 ? 54  ASP A H    5  
ATOM 6789  H HA   . ASP A 1 54  ? -14.336 -2.683  -1.811  1.00 0.00 ? 54  ASP A HA   5  
ATOM 6790  H HB2  . ASP A 1 54  ? -11.454 -1.850  -1.651  1.00 0.00 ? 54  ASP A HB2  5  
ATOM 6791  H HB3  . ASP A 1 54  ? -11.759 -3.492  -2.183  1.00 0.00 ? 54  ASP A HB3  5  
ATOM 6792  N N    . GLY A 1 55  ? -13.467 -3.382  1.047   1.00 0.00 ? 55  GLY A N    5  
ATOM 6793  C CA   . GLY A 1 55  ? -13.314 -4.365  2.106   1.00 0.00 ? 55  GLY A CA   5  
ATOM 6794  C C    . GLY A 1 55  ? -12.118 -5.280  1.837   1.00 0.00 ? 55  GLY A C    5  
ATOM 6795  O O    . GLY A 1 55  ? -12.112 -6.438  2.250   1.00 0.00 ? 55  GLY A O    5  
ATOM 6796  H H    . GLY A 1 55  ? -13.763 -2.477  1.351   1.00 0.00 ? 55  GLY A H    5  
ATOM 6797  H HA2  . GLY A 1 55  ? -13.180 -3.858  3.062   1.00 0.00 ? 55  GLY A HA2  5  
ATOM 6798  H HA3  . GLY A 1 55  ? -14.222 -4.963  2.187   1.00 0.00 ? 55  GLY A HA3  5  
ATOM 6799  N N    . ARG A 1 56  ? -11.133 -4.725  1.145   1.00 0.00 ? 56  ARG A N    5  
ATOM 6800  C CA   . ARG A 1 56  ? -9.934  -5.476  0.815   1.00 0.00 ? 56  ARG A CA   5  
ATOM 6801  C C    . ARG A 1 56  ? -8.692  -4.748  1.333   1.00 0.00 ? 56  ARG A C    5  
ATOM 6802  O O    . ARG A 1 56  ? -7.574  -5.239  1.185   1.00 0.00 ? 56  ARG A O    5  
ATOM 6803  C CB   . ARG A 1 56  ? -9.807  -5.675  -0.697  1.00 0.00 ? 56  ARG A CB   5  
ATOM 6804  C CG   . ARG A 1 56  ? -10.574 -6.918  -1.153  1.00 0.00 ? 56  ARG A CG   5  
ATOM 6805  C CD   . ARG A 1 56  ? -9.946  -7.518  -2.413  1.00 0.00 ? 56  ARG A CD   5  
ATOM 6806  N NE   . ARG A 1 56  ? -10.920 -7.489  -3.527  1.00 0.00 ? 56  ARG A NE   5  
ATOM 6807  C CZ   . ARG A 1 56  ? -10.819 -8.239  -4.633  1.00 0.00 ? 56  ARG A CZ   5  
ATOM 6808  N NH1  . ARG A 1 56  ? -9.786  -9.079  -4.780  1.00 0.00 ? 56  ARG A NH1  5  
ATOM 6809  N NH2  . ARG A 1 56  ? -11.750 -8.147  -5.592  1.00 0.00 ? 56  ARG A NH2  5  
ATOM 6810  H H    . ARG A 1 56  ? -11.146 -3.782  0.812   1.00 0.00 ? 56  ARG A H    5  
ATOM 6811  H HA   . ARG A 1 56  ? -10.062 -6.438  1.313   1.00 0.00 ? 56  ARG A HA   5  
ATOM 6812  H HB2  . ARG A 1 56  ? -10.190 -4.796  -1.216  1.00 0.00 ? 56  ARG A HB2  5  
ATOM 6813  H HB3  . ARG A 1 56  ? -8.756  -5.772  -0.968  1.00 0.00 ? 56  ARG A HB3  5  
ATOM 6814  H HG2  . ARG A 1 56  ? -10.577 -7.661  -0.355  1.00 0.00 ? 56  ARG A HG2  5  
ATOM 6815  H HG3  . ARG A 1 56  ? -11.613 -6.657  -1.350  1.00 0.00 ? 56  ARG A HG3  5  
ATOM 6816  H HD2  . ARG A 1 56  ? -9.052  -6.957  -2.686  1.00 0.00 ? 56  ARG A HD2  5  
ATOM 6817  H HD3  . ARG A 1 56  ? -9.632  -8.543  -2.220  1.00 0.00 ? 56  ARG A HD3  5  
ATOM 6818  H HE   . ARG A 1 56  ? -11.704 -6.872  -3.449  1.00 0.00 ? 56  ARG A HE   5  
ATOM 6819  H HH11 . ARG A 1 56  ? -9.091  -9.147  -4.065  1.00 0.00 ? 56  ARG A HH11 5  
ATOM 6820  H HH12 . ARG A 1 56  ? -9.710  -9.638  -5.606  1.00 0.00 ? 56  ARG A HH12 5  
ATOM 6821  H HH21 . ARG A 1 56  ? -12.521 -7.520  -5.482  1.00 0.00 ? 56  ARG A HH21 5  
ATOM 6822  H HH22 . ARG A 1 56  ? -11.674 -8.706  -6.418  1.00 0.00 ? 56  ARG A HH22 5  
ATOM 6823  N N    . LEU A 1 57  ? -8.931  -3.590  1.930   1.00 0.00 ? 57  LEU A N    5  
ATOM 6824  C CA   . LEU A 1 57  ? -7.845  -2.789  2.471   1.00 0.00 ? 57  LEU A CA   5  
ATOM 6825  C C    . LEU A 1 57  ? -7.946  -2.766  3.997   1.00 0.00 ? 57  LEU A C    5  
ATOM 6826  O O    . LEU A 1 57  ? -9.021  -2.980  4.555   1.00 0.00 ? 57  LEU A O    5  
ATOM 6827  C CB   . LEU A 1 57  ? -7.836  -1.398  1.833   1.00 0.00 ? 57  LEU A CB   5  
ATOM 6828  C CG   . LEU A 1 57  ? -6.803  -1.173  0.728   1.00 0.00 ? 57  LEU A CG   5  
ATOM 6829  C CD1  . LEU A 1 57  ? -5.611  -0.368  1.248   1.00 0.00 ? 57  LEU A CD1  5  
ATOM 6830  C CD2  . LEU A 1 57  ? -6.369  -2.502  0.104   1.00 0.00 ? 57  LEU A CD2  5  
ATOM 6831  H H    . LEU A 1 57  ? -9.843  -3.198  2.046   1.00 0.00 ? 57  LEU A H    5  
ATOM 6832  H HA   . LEU A 1 57  ? -6.910  -3.277  2.193   1.00 0.00 ? 57  LEU A HA   5  
ATOM 6833  H HB2  . LEU A 1 57  ? -8.827  -1.202  1.423   1.00 0.00 ? 57  LEU A HB2  5  
ATOM 6834  H HB3  . LEU A 1 57  ? -7.665  -0.662  2.619   1.00 0.00 ? 57  LEU A HB3  5  
ATOM 6835  H HG   . LEU A 1 57  ? -7.270  -0.585  -0.062  1.00 0.00 ? 57  LEU A HG   5  
ATOM 6836  H HD11 . LEU A 1 57  ? -4.773  -0.472  0.558   1.00 0.00 ? 57  LEU A HD11 5  
ATOM 6837  H HD12 . LEU A 1 57  ? -5.889  0.683   1.325   1.00 0.00 ? 57  LEU A HD12 5  
ATOM 6838  H HD13 . LEU A 1 57  ? -5.321  -0.741  2.230   1.00 0.00 ? 57  LEU A HD13 5  
ATOM 6839  H HD21 . LEU A 1 57  ? -6.074  -2.337  -0.932  1.00 0.00 ? 57  LEU A HD21 5  
ATOM 6840  H HD22 . LEU A 1 57  ? -5.525  -2.907  0.663   1.00 0.00 ? 57  LEU A HD22 5  
ATOM 6841  H HD23 . LEU A 1 57  ? -7.199  -3.207  0.138   1.00 0.00 ? 57  LEU A HD23 5  
ATOM 6842  N N    . ALA A 1 58  ? -6.812  -2.503  4.629   1.00 0.00 ? 58  ALA A N    5  
ATOM 6843  C CA   . ALA A 1 58  ? -6.759  -2.449  6.080   1.00 0.00 ? 58  ALA A CA   5  
ATOM 6844  C C    . ALA A 1 58  ? -5.304  -2.577  6.538   1.00 0.00 ? 58  ALA A C    5  
ATOM 6845  O O    . ALA A 1 58  ? -4.414  -2.829  5.728   1.00 0.00 ? 58  ALA A O    5  
ATOM 6846  C CB   . ALA A 1 58  ? -7.653  -3.544  6.665   1.00 0.00 ? 58  ALA A CB   5  
ATOM 6847  H H    . ALA A 1 58  ? -5.941  -2.330  4.168   1.00 0.00 ? 58  ALA A H    5  
ATOM 6848  H HA   . ALA A 1 58  ? -7.144  -1.478  6.390   1.00 0.00 ? 58  ALA A HA   5  
ATOM 6849  H HB1  . ALA A 1 58  ? -8.611  -3.114  6.958   1.00 0.00 ? 58  ALA A HB1  5  
ATOM 6850  H HB2  . ALA A 1 58  ? -7.816  -4.319  5.916   1.00 0.00 ? 58  ALA A HB2  5  
ATOM 6851  H HB3  . ALA A 1 58  ? -7.169  -3.981  7.539   1.00 0.00 ? 58  ALA A HB3  5  
ATOM 6852  N N    . ALA A 1 59  ? -5.109  -2.399  7.836   1.00 0.00 ? 59  ALA A N    5  
ATOM 6853  C CA   . ALA A 1 59  ? -3.778  -2.491  8.412   1.00 0.00 ? 59  ALA A CA   5  
ATOM 6854  C C    . ALA A 1 59  ? -3.103  -3.774  7.922   1.00 0.00 ? 59  ALA A C    5  
ATOM 6855  O O    . ALA A 1 59  ? -3.778  -4.724  7.529   1.00 0.00 ? 59  ALA A O    5  
ATOM 6856  C CB   . ALA A 1 59  ? -3.876  -2.430  9.938   1.00 0.00 ? 59  ALA A CB   5  
ATOM 6857  H H    . ALA A 1 59  ? -5.838  -2.194  8.489   1.00 0.00 ? 59  ALA A H    5  
ATOM 6858  H HA   . ALA A 1 59  ? -3.204  -1.633  8.063   1.00 0.00 ? 59  ALA A HA   5  
ATOM 6859  H HB1  . ALA A 1 59  ? -4.905  -2.618  10.243  1.00 0.00 ? 59  ALA A HB1  5  
ATOM 6860  H HB2  . ALA A 1 59  ? -3.223  -3.186  10.374  1.00 0.00 ? 59  ALA A HB2  5  
ATOM 6861  H HB3  . ALA A 1 59  ? -3.569  -1.443  10.282  1.00 0.00 ? 59  ALA A HB3  5  
ATOM 6862  N N    . GLY A 1 60  ? -1.779  -3.761  7.962   1.00 0.00 ? 60  GLY A N    5  
ATOM 6863  C CA   . GLY A 1 60  ? -1.005  -4.911  7.527   1.00 0.00 ? 60  GLY A CA   5  
ATOM 6864  C C    . GLY A 1 60  ? -0.790  -4.886  6.013   1.00 0.00 ? 60  GLY A C    5  
ATOM 6865  O O    . GLY A 1 60  ? -0.002  -5.667  5.481   1.00 0.00 ? 60  GLY A O    5  
ATOM 6866  H H    . GLY A 1 60  ? -1.237  -2.984  8.284   1.00 0.00 ? 60  GLY A H    5  
ATOM 6867  H HA2  . GLY A 1 60  ? -0.041  -4.918  8.035   1.00 0.00 ? 60  GLY A HA2  5  
ATOM 6868  H HA3  . GLY A 1 60  ? -1.521  -5.829  7.810   1.00 0.00 ? 60  GLY A HA3  5  
ATOM 6869  N N    . ASP A 1 61  ? -1.505  -3.981  5.360   1.00 0.00 ? 61  ASP A N    5  
ATOM 6870  C CA   . ASP A 1 61  ? -1.402  -3.845  3.917   1.00 0.00 ? 61  ASP A CA   5  
ATOM 6871  C C    . ASP A 1 61  ? -0.015  -3.310  3.558   1.00 0.00 ? 61  ASP A C    5  
ATOM 6872  O O    . ASP A 1 61  ? 0.110   -2.212  3.017   1.00 0.00 ? 61  ASP A O    5  
ATOM 6873  C CB   . ASP A 1 61  ? -2.442  -2.859  3.382   1.00 0.00 ? 61  ASP A CB   5  
ATOM 6874  C CG   . ASP A 1 61  ? -3.543  -3.483  2.522   1.00 0.00 ? 61  ASP A CG   5  
ATOM 6875  O OD1  . ASP A 1 61  ? -3.179  -4.116  1.507   1.00 0.00 ? 61  ASP A OD1  5  
ATOM 6876  O OD2  . ASP A 1 61  ? -4.722  -3.313  2.898   1.00 0.00 ? 61  ASP A OD2  5  
ATOM 6877  H H    . ASP A 1 61  ? -2.144  -3.350  5.800   1.00 0.00 ? 61  ASP A H    5  
ATOM 6878  H HA   . ASP A 1 61  ? -1.579  -4.845  3.522   1.00 0.00 ? 61  ASP A HA   5  
ATOM 6879  H HB2  . ASP A 1 61  ? -2.907  -2.350  4.227   1.00 0.00 ? 61  ASP A HB2  5  
ATOM 6880  H HB3  . ASP A 1 61  ? -1.930  -2.097  2.794   1.00 0.00 ? 61  ASP A HB3  5  
ATOM 6881  N N    . GLN A 1 62  ? 0.993   -4.111  3.872   1.00 0.00 ? 62  GLN A N    5  
ATOM 6882  C CA   . GLN A 1 62  ? 2.367   -3.731  3.588   1.00 0.00 ? 62  GLN A CA   5  
ATOM 6883  C C    . GLN A 1 62  ? 2.577   -3.589  2.080   1.00 0.00 ? 62  GLN A C    5  
ATOM 6884  O O    . GLN A 1 62  ? 2.576   -4.581  1.353   1.00 0.00 ? 62  GLN A O    5  
ATOM 6885  C CB   . GLN A 1 62  ? 3.349   -4.741  4.186   1.00 0.00 ? 62  GLN A CB   5  
ATOM 6886  C CG   . GLN A 1 62  ? 4.778   -4.195  4.164   1.00 0.00 ? 62  GLN A CG   5  
ATOM 6887  C CD   . GLN A 1 62  ? 5.800   -5.334  4.150   1.00 0.00 ? 62  GLN A CD   5  
ATOM 6888  O OE1  . GLN A 1 62  ? 5.644   -6.350  4.806   1.00 0.00 ? 62  GLN A OE1  5  
ATOM 6889  N NE2  . GLN A 1 62  ? 6.851   -5.107  3.369   1.00 0.00 ? 62  GLN A NE2  5  
ATOM 6890  H H    . GLN A 1 62  ? 0.883   -5.002  4.311   1.00 0.00 ? 62  GLN A H    5  
ATOM 6891  H HA   . GLN A 1 62  ? 2.507   -2.766  4.074   1.00 0.00 ? 62  GLN A HA   5  
ATOM 6892  H HB2  . GLN A 1 62  ? 3.059   -4.972  5.211   1.00 0.00 ? 62  GLN A HB2  5  
ATOM 6893  H HB3  . GLN A 1 62  ? 3.304   -5.674  3.624   1.00 0.00 ? 62  GLN A HB3  5  
ATOM 6894  H HG2  . GLN A 1 62  ? 4.917   -3.566  3.285   1.00 0.00 ? 62  GLN A HG2  5  
ATOM 6895  H HG3  . GLN A 1 62  ? 4.943   -3.564  5.038   1.00 0.00 ? 62  GLN A HG3  5  
ATOM 6896  H HE21 . GLN A 1 62  ? 6.918   -4.251  2.857   1.00 0.00 ? 62  GLN A HE21 5  
ATOM 6897  H HE22 . GLN A 1 62  ? 7.575   -5.793  3.293   1.00 0.00 ? 62  GLN A HE22 5  
ATOM 6898  N N    . LEU A 1 63  ? 2.753   -2.347  1.654   1.00 0.00 ? 63  LEU A N    5  
ATOM 6899  C CA   . LEU A 1 63  ? 2.964   -2.061  0.245   1.00 0.00 ? 63  LEU A CA   5  
ATOM 6900  C C    . LEU A 1 63  ? 4.443   -2.260  -0.095  1.00 0.00 ? 63  LEU A C    5  
ATOM 6901  O O    . LEU A 1 63  ? 5.304   -1.553  0.426   1.00 0.00 ? 63  LEU A O    5  
ATOM 6902  C CB   . LEU A 1 63  ? 2.435   -0.670  -0.106  1.00 0.00 ? 63  LEU A CB   5  
ATOM 6903  C CG   . LEU A 1 63  ? 0.968   -0.404  0.239   1.00 0.00 ? 63  LEU A CG   5  
ATOM 6904  C CD1  . LEU A 1 63  ? 0.848   0.548   1.430   1.00 0.00 ? 63  LEU A CD1  5  
ATOM 6905  C CD2  . LEU A 1 63  ? 0.202   0.107   -0.983  1.00 0.00 ? 63  LEU A CD2  5  
ATOM 6906  H H    . LEU A 1 63  ? 2.752   -1.545  2.252   1.00 0.00 ? 63  LEU A H    5  
ATOM 6907  H HA   . LEU A 1 63  ? 2.379   -2.782  -0.326  1.00 0.00 ? 63  LEU A HA   5  
ATOM 6908  H HB2  . LEU A 1 63  ? 3.048   0.071   0.408   1.00 0.00 ? 63  LEU A HB2  5  
ATOM 6909  H HB3  . LEU A 1 63  ? 2.571   -0.509  -1.175  1.00 0.00 ? 63  LEU A HB3  5  
ATOM 6910  H HG   . LEU A 1 63  ? 0.510   -1.348  0.534   1.00 0.00 ? 63  LEU A HG   5  
ATOM 6911  H HD11 . LEU A 1 63  ? 1.656   0.352   2.135   1.00 0.00 ? 63  LEU A HD11 5  
ATOM 6912  H HD12 . LEU A 1 63  ? 0.914   1.579   1.080   1.00 0.00 ? 63  LEU A HD12 5  
ATOM 6913  H HD13 . LEU A 1 63  ? -0.111  0.393   1.925   1.00 0.00 ? 63  LEU A HD13 5  
ATOM 6914  H HD21 . LEU A 1 63  ? -0.350  -0.716  -1.436  1.00 0.00 ? 63  LEU A HD21 5  
ATOM 6915  H HD22 . LEU A 1 63  ? -0.496  0.886   -0.674  1.00 0.00 ? 63  LEU A HD22 5  
ATOM 6916  H HD23 . LEU A 1 63  ? 0.905   0.517   -1.708  1.00 0.00 ? 63  LEU A HD23 5  
ATOM 6917  N N    . LEU A 1 64  ? 4.692   -3.227  -0.967  1.00 0.00 ? 64  LEU A N    5  
ATOM 6918  C CA   . LEU A 1 64  ? 6.052   -3.527  -1.382  1.00 0.00 ? 64  LEU A CA   5  
ATOM 6919  C C    . LEU A 1 64  ? 6.484   -2.530  -2.458  1.00 0.00 ? 64  LEU A C    5  
ATOM 6920  O O    . LEU A 1 64  ? 7.643   -2.121  -2.502  1.00 0.00 ? 64  LEU A O    5  
ATOM 6921  C CB   . LEU A 1 64  ? 6.168   -4.990  -1.817  1.00 0.00 ? 64  LEU A CB   5  
ATOM 6922  C CG   . LEU A 1 64  ? 7.384   -5.752  -1.286  1.00 0.00 ? 64  LEU A CG   5  
ATOM 6923  C CD1  . LEU A 1 64  ? 8.687   -5.098  -1.750  1.00 0.00 ? 64  LEU A CD1  5  
ATOM 6924  C CD2  . LEU A 1 64  ? 7.323   -5.891  0.236   1.00 0.00 ? 64  LEU A CD2  5  
ATOM 6925  H H    . LEU A 1 64  ? 3.986   -3.798  -1.386  1.00 0.00 ? 64  LEU A H    5  
ATOM 6926  H HA   . LEU A 1 64  ? 6.695   -3.397  -0.512  1.00 0.00 ? 64  LEU A HA   5  
ATOM 6927  H HB2  . LEU A 1 64  ? 5.268   -5.515  -1.499  1.00 0.00 ? 64  LEU A HB2  5  
ATOM 6928  H HB3  . LEU A 1 64  ? 6.189   -5.024  -2.906  1.00 0.00 ? 64  LEU A HB3  5  
ATOM 6929  H HG   . LEU A 1 64  ? 7.364   -6.759  -1.703  1.00 0.00 ? 64  LEU A HG   5  
ATOM 6930  H HD11 . LEU A 1 64  ? 8.980   -5.514  -2.714  1.00 0.00 ? 64  LEU A HD11 5  
ATOM 6931  H HD12 . LEU A 1 64  ? 8.538   -4.022  -1.850  1.00 0.00 ? 64  LEU A HD12 5  
ATOM 6932  H HD13 . LEU A 1 64  ? 9.471   -5.289  -1.017  1.00 0.00 ? 64  LEU A HD13 5  
ATOM 6933  H HD21 . LEU A 1 64  ? 6.731   -6.769  0.497   1.00 0.00 ? 64  LEU A HD21 5  
ATOM 6934  H HD22 . LEU A 1 64  ? 8.332   -6.003  0.632   1.00 0.00 ? 64  LEU A HD22 5  
ATOM 6935  H HD23 . LEU A 1 64  ? 6.861   -5.001  0.664   1.00 0.00 ? 64  LEU A HD23 5  
ATOM 6936  N N    . SER A 1 65  ? 5.528   -2.166  -3.301  1.00 0.00 ? 65  SER A N    5  
ATOM 6937  C CA   . SER A 1 65  ? 5.796   -1.224  -4.375  1.00 0.00 ? 65  SER A CA   5  
ATOM 6938  C C    . SER A 1 65  ? 4.480   -0.656  -4.912  1.00 0.00 ? 65  SER A C    5  
ATOM 6939  O O    . SER A 1 65  ? 3.463   -1.347  -4.930  1.00 0.00 ? 65  SER A O    5  
ATOM 6940  C CB   . SER A 1 65  ? 6.588   -1.886  -5.503  1.00 0.00 ? 65  SER A CB   5  
ATOM 6941  O OG   . SER A 1 65  ? 7.487   -2.878  -5.014  1.00 0.00 ? 65  SER A OG   5  
ATOM 6942  H H    . SER A 1 65  ? 4.588   -2.503  -3.259  1.00 0.00 ? 65  SER A H    5  
ATOM 6943  H HA   . SER A 1 65  ? 6.397   -0.435  -3.923  1.00 0.00 ? 65  SER A HA   5  
ATOM 6944  H HB2  . SER A 1 65  ? 5.898   -2.341  -6.213  1.00 0.00 ? 65  SER A HB2  5  
ATOM 6945  H HB3  . SER A 1 65  ? 7.149   -1.125  -6.047  1.00 0.00 ? 65  SER A HB3  5  
ATOM 6946  H HG   . SER A 1 65  ? 8.025   -2.508  -4.257  1.00 0.00 ? 65  SER A HG   5  
ATOM 6947  N N    . VAL A 1 66  ? 4.544   0.597   -5.337  1.00 0.00 ? 66  VAL A N    5  
ATOM 6948  C CA   . VAL A 1 66  ? 3.371   1.266   -5.873  1.00 0.00 ? 66  VAL A CA   5  
ATOM 6949  C C    . VAL A 1 66  ? 3.714   1.875   -7.235  1.00 0.00 ? 66  VAL A C    5  
ATOM 6950  O O    . VAL A 1 66  ? 4.692   2.609   -7.361  1.00 0.00 ? 66  VAL A O    5  
ATOM 6951  C CB   . VAL A 1 66  ? 2.853   2.298   -4.870  1.00 0.00 ? 66  VAL A CB   5  
ATOM 6952  C CG1  . VAL A 1 66  ? 2.536   1.644   -3.524  1.00 0.00 ? 66  VAL A CG1  5  
ATOM 6953  C CG2  . VAL A 1 66  ? 3.849   3.447   -4.701  1.00 0.00 ? 66  VAL A CG2  5  
ATOM 6954  H H    . VAL A 1 66  ? 5.376   1.152   -5.319  1.00 0.00 ? 66  VAL A H    5  
ATOM 6955  H HA   . VAL A 1 66  ? 2.597   0.511   -6.011  1.00 0.00 ? 66  VAL A HA   5  
ATOM 6956  H HB   . VAL A 1 66  ? 1.926   2.715   -5.266  1.00 0.00 ? 66  VAL A HB   5  
ATOM 6957  H HG11 . VAL A 1 66  ? 1.484   1.799   -3.283  1.00 0.00 ? 66  VAL A HG11 5  
ATOM 6958  H HG12 . VAL A 1 66  ? 2.742   0.575   -3.582  1.00 0.00 ? 66  VAL A HG12 5  
ATOM 6959  H HG13 . VAL A 1 66  ? 3.156   2.092   -2.748  1.00 0.00 ? 66  VAL A HG13 5  
ATOM 6960  H HG21 . VAL A 1 66  ? 3.817   4.089   -5.581  1.00 0.00 ? 66  VAL A HG21 5  
ATOM 6961  H HG22 . VAL A 1 66  ? 3.587   4.028   -3.817  1.00 0.00 ? 66  VAL A HG22 5  
ATOM 6962  H HG23 . VAL A 1 66  ? 4.854   3.041   -4.584  1.00 0.00 ? 66  VAL A HG23 5  
ATOM 6963  N N    . ASP A 1 67  ? 2.889   1.547   -8.218  1.00 0.00 ? 67  ASP A N    5  
ATOM 6964  C CA   . ASP A 1 67  ? 3.093   2.052   -9.565  1.00 0.00 ? 67  ASP A CA   5  
ATOM 6965  C C    . ASP A 1 67  ? 4.522   1.737   -10.013 1.00 0.00 ? 67  ASP A C    5  
ATOM 6966  O O    . ASP A 1 67  ? 5.135   2.518   -10.738 1.00 0.00 ? 67  ASP A O    5  
ATOM 6967  C CB   . ASP A 1 67  ? 2.905   3.569   -9.619  1.00 0.00 ? 67  ASP A CB   5  
ATOM 6968  C CG   . ASP A 1 67  ? 2.023   4.072   -10.763 1.00 0.00 ? 67  ASP A CG   5  
ATOM 6969  O OD1  . ASP A 1 67  ? 1.867   3.305   -11.739 1.00 0.00 ? 67  ASP A OD1  5  
ATOM 6970  O OD2  . ASP A 1 67  ? 1.524   5.211   -10.638 1.00 0.00 ? 67  ASP A OD2  5  
ATOM 6971  H H    . ASP A 1 67  ? 2.096   0.949   -8.107  1.00 0.00 ? 67  ASP A H    5  
ATOM 6972  H HA   . ASP A 1 67  ? 2.344   1.549   -10.176 1.00 0.00 ? 67  ASP A HA   5  
ATOM 6973  H HB2  . ASP A 1 67  ? 2.472   3.900   -8.675  1.00 0.00 ? 67  ASP A HB2  5  
ATOM 6974  H HB3  . ASP A 1 67  ? 3.885   4.039   -9.702  1.00 0.00 ? 67  ASP A HB3  5  
ATOM 6975  N N    . GLY A 1 68  ? 5.010   0.590   -9.562  1.00 0.00 ? 68  GLY A N    5  
ATOM 6976  C CA   . GLY A 1 68  ? 6.355   0.162   -9.907  1.00 0.00 ? 68  GLY A CA   5  
ATOM 6977  C C    . GLY A 1 68  ? 7.365   0.628   -8.856  1.00 0.00 ? 68  GLY A C    5  
ATOM 6978  O O    . GLY A 1 68  ? 8.322   -0.083  -8.552  1.00 0.00 ? 68  GLY A O    5  
ATOM 6979  H H    . GLY A 1 68  ? 4.504   -0.039  -8.972  1.00 0.00 ? 68  GLY A H    5  
ATOM 6980  H HA2  . GLY A 1 68  ? 6.384   -0.924  -9.989  1.00 0.00 ? 68  GLY A HA2  5  
ATOM 6981  H HA3  . GLY A 1 68  ? 6.629   0.563   -10.883 1.00 0.00 ? 68  GLY A HA3  5  
ATOM 6982  N N    . ARG A 1 69  ? 7.117   1.818   -8.330  1.00 0.00 ? 69  ARG A N    5  
ATOM 6983  C CA   . ARG A 1 69  ? 7.993   2.386   -7.319  1.00 0.00 ? 69  ARG A CA   5  
ATOM 6984  C C    . ARG A 1 69  ? 7.835   1.635   -5.996  1.00 0.00 ? 69  ARG A C    5  
ATOM 6985  O O    . ARG A 1 69  ? 6.751   1.613   -5.416  1.00 0.00 ? 69  ARG A O    5  
ATOM 6986  C CB   . ARG A 1 69  ? 7.686   3.869   -7.095  1.00 0.00 ? 69  ARG A CB   5  
ATOM 6987  C CG   . ARG A 1 69  ? 8.892   4.594   -6.495  1.00 0.00 ? 69  ARG A CG   5  
ATOM 6988  C CD   . ARG A 1 69  ? 9.552   5.509   -7.528  1.00 0.00 ? 69  ARG A CD   5  
ATOM 6989  N NE   . ARG A 1 69  ? 10.199  6.654   -6.850  1.00 0.00 ? 69  ARG A NE   5  
ATOM 6990  C CZ   . ARG A 1 69  ? 11.326  6.561   -6.131  1.00 0.00 ? 69  ARG A CZ   5  
ATOM 6991  N NH1  . ARG A 1 69  ? 11.937  5.377   -5.992  1.00 0.00 ? 69  ARG A NH1  5  
ATOM 6992  N NH2  . ARG A 1 69  ? 11.842  7.653   -5.550  1.00 0.00 ? 69  ARG A NH2  5  
ATOM 6993  H H    . ARG A 1 69  ? 6.336   2.389   -8.582  1.00 0.00 ? 69  ARG A H    5  
ATOM 6994  H HA   . ARG A 1 69  ? 8.998   2.265   -7.722  1.00 0.00 ? 69  ARG A HA   5  
ATOM 6995  H HB2  . ARG A 1 69  ? 7.412   4.334   -8.042  1.00 0.00 ? 69  ARG A HB2  5  
ATOM 6996  H HB3  . ARG A 1 69  ? 6.828   3.970   -6.430  1.00 0.00 ? 69  ARG A HB3  5  
ATOM 6997  H HG2  . ARG A 1 69  ? 8.576   5.181   -5.633  1.00 0.00 ? 69  ARG A HG2  5  
ATOM 6998  H HG3  . ARG A 1 69  ? 9.617   3.864   -6.135  1.00 0.00 ? 69  ARG A HG3  5  
ATOM 6999  H HD2  . ARG A 1 69  ? 10.291  4.950   -8.102  1.00 0.00 ? 69  ARG A HD2  5  
ATOM 7000  H HD3  . ARG A 1 69  ? 8.805   5.870   -8.236  1.00 0.00 ? 69  ARG A HD3  5  
ATOM 7001  H HE   . ARG A 1 69  ? 9.769   7.553   -6.933  1.00 0.00 ? 69  ARG A HE   5  
ATOM 7002  H HH11 . ARG A 1 69  ? 11.552  4.562   -6.425  1.00 0.00 ? 69  ARG A HH11 5  
ATOM 7003  H HH12 . ARG A 1 69  ? 12.778  5.308   -5.455  1.00 0.00 ? 69  ARG A HH12 5  
ATOM 7004  H HH21 . ARG A 1 69  ? 11.386  8.537   -5.654  1.00 0.00 ? 69  ARG A HH21 5  
ATOM 7005  H HH22 . ARG A 1 69  ? 12.683  7.584   -5.014  1.00 0.00 ? 69  ARG A HH22 5  
ATOM 7006  N N    . SER A 1 70  ? 8.933   1.036   -5.558  1.00 0.00 ? 70  SER A N    5  
ATOM 7007  C CA   . SER A 1 70  ? 8.930   0.285   -4.314  1.00 0.00 ? 70  SER A CA   5  
ATOM 7008  C C    . SER A 1 70  ? 8.413   1.164   -3.173  1.00 0.00 ? 70  SER A C    5  
ATOM 7009  O O    . SER A 1 70  ? 8.760   2.341   -3.086  1.00 0.00 ? 70  SER A O    5  
ATOM 7010  C CB   . SER A 1 70  ? 10.328  -0.243  -3.986  1.00 0.00 ? 70  SER A CB   5  
ATOM 7011  O OG   . SER A 1 70  ? 10.923  -0.906  -5.098  1.00 0.00 ? 70  SER A OG   5  
ATOM 7012  H H    . SER A 1 70  ? 9.811   1.058   -6.036  1.00 0.00 ? 70  SER A H    5  
ATOM 7013  H HA   . SER A 1 70  ? 8.256   -0.555  -4.485  1.00 0.00 ? 70  SER A HA   5  
ATOM 7014  H HB2  . SER A 1 70  ? 10.965  0.586   -3.676  1.00 0.00 ? 70  SER A HB2  5  
ATOM 7015  H HB3  . SER A 1 70  ? 10.267  -0.931  -3.143  1.00 0.00 ? 70  SER A HB3  5  
ATOM 7016  H HG   . SER A 1 70  ? 10.228  -1.104  -5.790  1.00 0.00 ? 70  SER A HG   5  
ATOM 7017  N N    . LEU A 1 71  ? 7.593   0.558   -2.327  1.00 0.00 ? 71  LEU A N    5  
ATOM 7018  C CA   . LEU A 1 71  ? 7.025   1.271   -1.196  1.00 0.00 ? 71  LEU A CA   5  
ATOM 7019  C C    . LEU A 1 71  ? 7.414   0.555   0.100   1.00 0.00 ? 71  LEU A C    5  
ATOM 7020  O O    . LEU A 1 71  ? 7.035   0.985   1.188   1.00 0.00 ? 71  LEU A O    5  
ATOM 7021  C CB   . LEU A 1 71  ? 5.515   1.443   -1.374  1.00 0.00 ? 71  LEU A CB   5  
ATOM 7022  C CG   . LEU A 1 71  ? 4.898   2.678   -0.712  1.00 0.00 ? 71  LEU A CG   5  
ATOM 7023  C CD1  . LEU A 1 71  ? 4.883   3.866   -1.676  1.00 0.00 ? 71  LEU A CD1  5  
ATOM 7024  C CD2  . LEU A 1 71  ? 3.505   2.367   -0.163  1.00 0.00 ? 71  LEU A CD2  5  
ATOM 7025  H H    . LEU A 1 71  ? 7.316   -0.399  -2.405  1.00 0.00 ? 71  LEU A H    5  
ATOM 7026  H HA   . LEU A 1 71  ? 7.464   2.269   -1.184  1.00 0.00 ? 71  LEU A HA   5  
ATOM 7027  H HB2  . LEU A 1 71  ? 5.297   1.480   -2.441  1.00 0.00 ? 71  LEU A HB2  5  
ATOM 7028  H HB3  . LEU A 1 71  ? 5.019   0.557   -0.977  1.00 0.00 ? 71  LEU A HB3  5  
ATOM 7029  H HG   . LEU A 1 71  ? 5.523   2.959   0.136   1.00 0.00 ? 71  LEU A HG   5  
ATOM 7030  H HD11 . LEU A 1 71  ? 5.128   3.522   -2.681  1.00 0.00 ? 71  LEU A HD11 5  
ATOM 7031  H HD12 . LEU A 1 71  ? 3.891   4.318   -1.678  1.00 0.00 ? 71  LEU A HD12 5  
ATOM 7032  H HD13 . LEU A 1 71  ? 5.618   4.604   -1.355  1.00 0.00 ? 71  LEU A HD13 5  
ATOM 7033  H HD21 . LEU A 1 71  ? 3.014   1.639   -0.809  1.00 0.00 ? 71  LEU A HD21 5  
ATOM 7034  H HD22 . LEU A 1 71  ? 3.594   1.958   0.843   1.00 0.00 ? 71  LEU A HD22 5  
ATOM 7035  H HD23 . LEU A 1 71  ? 2.914   3.282   -0.132  1.00 0.00 ? 71  LEU A HD23 5  
ATOM 7036  N N    . VAL A 1 72  ? 8.165   -0.524  -0.061  1.00 0.00 ? 72  VAL A N    5  
ATOM 7037  C CA   . VAL A 1 72  ? 8.609   -1.304  1.082   1.00 0.00 ? 72  VAL A CA   5  
ATOM 7038  C C    . VAL A 1 72  ? 9.383   -0.398  2.042   1.00 0.00 ? 72  VAL A C    5  
ATOM 7039  O O    . VAL A 1 72  ? 9.687   -0.794  3.166   1.00 0.00 ? 72  VAL A O    5  
ATOM 7040  C CB   . VAL A 1 72  ? 9.425   -2.508  0.609   1.00 0.00 ? 72  VAL A CB   5  
ATOM 7041  C CG1  . VAL A 1 72  ? 10.717  -2.060  -0.077  1.00 0.00 ? 72  VAL A CG1  5  
ATOM 7042  C CG2  . VAL A 1 72  ? 9.722   -3.460  1.769   1.00 0.00 ? 72  VAL A CG2  5  
ATOM 7043  H H    . VAL A 1 72  ? 8.469   -0.867  -0.950  1.00 0.00 ? 72  VAL A H    5  
ATOM 7044  H HA   . VAL A 1 72  ? 7.721   -1.677  1.591   1.00 0.00 ? 72  VAL A HA   5  
ATOM 7045  H HB   . VAL A 1 72  ? 8.828   -3.050  -0.124  1.00 0.00 ? 72  VAL A HB   5  
ATOM 7046  H HG11 . VAL A 1 72  ? 11.545  -2.125  0.630   1.00 0.00 ? 72  VAL A HG11 5  
ATOM 7047  H HG12 . VAL A 1 72  ? 10.918  -2.706  -0.932  1.00 0.00 ? 72  VAL A HG12 5  
ATOM 7048  H HG13 . VAL A 1 72  ? 10.610  -1.030  -0.417  1.00 0.00 ? 72  VAL A HG13 5  
ATOM 7049  H HG21 . VAL A 1 72  ? 10.791  -3.455  1.979   1.00 0.00 ? 72  VAL A HG21 5  
ATOM 7050  H HG22 . VAL A 1 72  ? 9.176   -3.133  2.655   1.00 0.00 ? 72  VAL A HG22 5  
ATOM 7051  H HG23 . VAL A 1 72  ? 9.408   -4.469  1.501   1.00 0.00 ? 72  VAL A HG23 5  
ATOM 7052  N N    . GLY A 1 73  ? 9.679   0.802   1.564   1.00 0.00 ? 73  GLY A N    5  
ATOM 7053  C CA   . GLY A 1 73  ? 10.412  1.767   2.365   1.00 0.00 ? 73  GLY A CA   5  
ATOM 7054  C C    . GLY A 1 73  ? 10.243  3.183   1.809   1.00 0.00 ? 73  GLY A C    5  
ATOM 7055  O O    . GLY A 1 73  ? 11.227  3.882   1.574   1.00 0.00 ? 73  GLY A O    5  
ATOM 7056  H H    . GLY A 1 73  ? 9.428   1.117   0.648   1.00 0.00 ? 73  GLY A H    5  
ATOM 7057  H HA2  . GLY A 1 73  ? 10.057  1.733   3.395   1.00 0.00 ? 73  GLY A HA2  5  
ATOM 7058  H HA3  . GLY A 1 73  ? 11.469  1.503   2.383   1.00 0.00 ? 73  GLY A HA3  5  
ATOM 7059  N N    . LEU A 1 74  ? 8.989   3.562   1.614   1.00 0.00 ? 74  LEU A N    5  
ATOM 7060  C CA   . LEU A 1 74  ? 8.679   4.881   1.089   1.00 0.00 ? 74  LEU A CA   5  
ATOM 7061  C C    . LEU A 1 74  ? 8.034   5.724   2.191   1.00 0.00 ? 74  LEU A C    5  
ATOM 7062  O O    . LEU A 1 74  ? 6.875   5.509   2.544   1.00 0.00 ? 74  LEU A O    5  
ATOM 7063  C CB   . LEU A 1 74  ? 7.828   4.768   -0.177  1.00 0.00 ? 74  LEU A CB   5  
ATOM 7064  C CG   . LEU A 1 74  ? 8.597   4.674   -1.496  1.00 0.00 ? 74  LEU A CG   5  
ATOM 7065  C CD1  . LEU A 1 74  ? 7.640   4.674   -2.690  1.00 0.00 ? 74  LEU A CD1  5  
ATOM 7066  C CD2  . LEU A 1 74  ? 9.643   5.785   -1.600  1.00 0.00 ? 74  LEU A CD2  5  
ATOM 7067  H H    . LEU A 1 74  ? 8.194   2.987   1.808   1.00 0.00 ? 74  LEU A H    5  
ATOM 7068  H HA   . LEU A 1 74  ? 9.621   5.349   0.803   1.00 0.00 ? 74  LEU A HA   5  
ATOM 7069  H HB2  . LEU A 1 74  ? 7.193   3.886   -0.086  1.00 0.00 ? 74  LEU A HB2  5  
ATOM 7070  H HB3  . LEU A 1 74  ? 7.167   5.633   -0.225  1.00 0.00 ? 74  LEU A HB3  5  
ATOM 7071  H HG   . LEU A 1 74  ? 9.132   3.725   -1.513  1.00 0.00 ? 74  LEU A HG   5  
ATOM 7072  H HD11 . LEU A 1 74  ? 8.209   4.788   -3.612  1.00 0.00 ? 74  LEU A HD11 5  
ATOM 7073  H HD12 . LEU A 1 74  ? 7.091   3.733   -2.716  1.00 0.00 ? 74  LEU A HD12 5  
ATOM 7074  H HD13 . LEU A 1 74  ? 6.937   5.502   -2.592  1.00 0.00 ? 74  LEU A HD13 5  
ATOM 7075  H HD21 . LEU A 1 74  ? 9.271   6.683   -1.107  1.00 0.00 ? 74  LEU A HD21 5  
ATOM 7076  H HD22 . LEU A 1 74  ? 10.566  5.462   -1.118  1.00 0.00 ? 74  LEU A HD22 5  
ATOM 7077  H HD23 . LEU A 1 74  ? 9.839   6.002   -2.650  1.00 0.00 ? 74  LEU A HD23 5  
ATOM 7078  N N    . SER A 1 75  ? 8.811   6.667   2.703   1.00 0.00 ? 75  SER A N    5  
ATOM 7079  C CA   . SER A 1 75  ? 8.330   7.544   3.757   1.00 0.00 ? 75  SER A CA   5  
ATOM 7080  C C    . SER A 1 75  ? 6.894   7.980   3.460   1.00 0.00 ? 75  SER A C    5  
ATOM 7081  O O    . SER A 1 75  ? 6.557   8.282   2.316   1.00 0.00 ? 75  SER A O    5  
ATOM 7082  C CB   . SER A 1 75  ? 9.235   8.768   3.911   1.00 0.00 ? 75  SER A CB   5  
ATOM 7083  O OG   . SER A 1 75  ? 8.617   9.795   4.682   1.00 0.00 ? 75  SER A OG   5  
ATOM 7084  H H    . SER A 1 75  ? 9.752   6.836   2.409   1.00 0.00 ? 75  SER A H    5  
ATOM 7085  H HA   . SER A 1 75  ? 8.368   6.947   4.668   1.00 0.00 ? 75  SER A HA   5  
ATOM 7086  H HB2  . SER A 1 75  ? 10.170  8.470   4.387   1.00 0.00 ? 75  SER A HB2  5  
ATOM 7087  H HB3  . SER A 1 75  ? 9.489   9.157   2.925   1.00 0.00 ? 75  SER A HB3  5  
ATOM 7088  H HG   . SER A 1 75  ? 8.961   10.690  4.398   1.00 0.00 ? 75  SER A HG   5  
ATOM 7089  N N    . GLN A 1 76  ? 6.086   7.999   4.510   1.00 0.00 ? 76  GLN A N    5  
ATOM 7090  C CA   . GLN A 1 76  ? 4.694   8.393   4.376   1.00 0.00 ? 76  GLN A CA   5  
ATOM 7091  C C    . GLN A 1 76  ? 4.569   9.584   3.423   1.00 0.00 ? 76  GLN A C    5  
ATOM 7092  O O    . GLN A 1 76  ? 3.565   9.722   2.726   1.00 0.00 ? 76  GLN A O    5  
ATOM 7093  C CB   . GLN A 1 76  ? 4.082   8.715   5.740   1.00 0.00 ? 76  GLN A CB   5  
ATOM 7094  C CG   . GLN A 1 76  ? 4.827   9.868   6.417   1.00 0.00 ? 76  GLN A CG   5  
ATOM 7095  C CD   . GLN A 1 76  ? 3.890   11.049  6.678   1.00 0.00 ? 76  GLN A CD   5  
ATOM 7096  O OE1  . GLN A 1 76  ? 2.694   10.896  6.867   1.00 0.00 ? 76  GLN A OE1  5  
ATOM 7097  N NE2  . GLN A 1 76  ? 4.497   12.231  6.678   1.00 0.00 ? 76  GLN A NE2  5  
ATOM 7098  H H    . GLN A 1 76  ? 6.368   7.752   5.437   1.00 0.00 ? 76  GLN A H    5  
ATOM 7099  H HA   . GLN A 1 76  ? 4.187   7.526   3.953   1.00 0.00 ? 76  GLN A HA   5  
ATOM 7100  H HB2  . GLN A 1 76  ? 3.031   8.979   5.618   1.00 0.00 ? 76  GLN A HB2  5  
ATOM 7101  H HB3  . GLN A 1 76  ? 4.117   7.831   6.377   1.00 0.00 ? 76  GLN A HB3  5  
ATOM 7102  H HG2  . GLN A 1 76  ? 5.256   9.524   7.358   1.00 0.00 ? 76  GLN A HG2  5  
ATOM 7103  H HG3  . GLN A 1 76  ? 5.656   10.189  5.787   1.00 0.00 ? 76  GLN A HG3  5  
ATOM 7104  H HE21 . GLN A 1 76  ? 5.483   12.288  6.517   1.00 0.00 ? 76  GLN A HE21 5  
ATOM 7105  H HE22 . GLN A 1 76  ? 3.969   13.065  6.840   1.00 0.00 ? 76  GLN A HE22 5  
ATOM 7106  N N    . GLU A 1 77  ? 5.602   10.413  3.425   1.00 0.00 ? 77  GLU A N    5  
ATOM 7107  C CA   . GLU A 1 77  ? 5.620   11.587  2.569   1.00 0.00 ? 77  GLU A CA   5  
ATOM 7108  C C    . GLU A 1 77  ? 5.663   11.172  1.097   1.00 0.00 ? 77  GLU A C    5  
ATOM 7109  O O    . GLU A 1 77  ? 4.829   11.602  0.302   1.00 0.00 ? 77  GLU A O    5  
ATOM 7110  C CB   . GLU A 1 77  ? 6.798   12.500  2.916   1.00 0.00 ? 77  GLU A CB   5  
ATOM 7111  C CG   . GLU A 1 77  ? 6.375   13.589  3.904   1.00 0.00 ? 77  GLU A CG   5  
ATOM 7112  C CD   . GLU A 1 77  ? 5.601   14.702  3.196   1.00 0.00 ? 77  GLU A CD   5  
ATOM 7113  O OE1  . GLU A 1 77  ? 6.270   15.639  2.711   1.00 0.00 ? 77  GLU A OE1  5  
ATOM 7114  O OE2  . GLU A 1 77  ? 4.356   14.591  3.156   1.00 0.00 ? 77  GLU A OE2  5  
ATOM 7115  H H    . GLU A 1 77  ? 6.414   10.293  3.995   1.00 0.00 ? 77  GLU A H    5  
ATOM 7116  H HA   . GLU A 1 77  ? 4.688   12.112  2.778   1.00 0.00 ? 77  GLU A HA   5  
ATOM 7117  H HB2  . GLU A 1 77  ? 7.607   11.909  3.345   1.00 0.00 ? 77  GLU A HB2  5  
ATOM 7118  H HB3  . GLU A 1 77  ? 7.186   12.960  2.007   1.00 0.00 ? 77  GLU A HB3  5  
ATOM 7119  H HG2  . GLU A 1 77  ? 5.757   13.153  4.689   1.00 0.00 ? 77  GLU A HG2  5  
ATOM 7120  H HG3  . GLU A 1 77  ? 7.257   14.007  4.390   1.00 0.00 ? 77  GLU A HG3  5  
ATOM 7121  N N    . ARG A 1 78  ? 6.644   10.340  0.779   1.00 0.00 ? 78  ARG A N    5  
ATOM 7122  C CA   . ARG A 1 78  ? 6.807   9.861   -0.583  1.00 0.00 ? 78  ARG A CA   5  
ATOM 7123  C C    . ARG A 1 78  ? 5.653   8.930   -0.960  1.00 0.00 ? 78  ARG A C    5  
ATOM 7124  O O    . ARG A 1 78  ? 5.016   9.113   -1.996  1.00 0.00 ? 78  ARG A O    5  
ATOM 7125  C CB   . ARG A 1 78  ? 8.132   9.114   -0.749  1.00 0.00 ? 78  ARG A CB   5  
ATOM 7126  C CG   . ARG A 1 78  ? 9.204   10.025  -1.351  1.00 0.00 ? 78  ARG A CG   5  
ATOM 7127  C CD   . ARG A 1 78  ? 10.117  10.591  -0.262  1.00 0.00 ? 78  ARG A CD   5  
ATOM 7128  N NE   . ARG A 1 78  ? 9.690   11.962  0.095   1.00 0.00 ? 78  ARG A NE   5  
ATOM 7129  C CZ   . ARG A 1 78  ? 9.971   13.058  -0.641  1.00 0.00 ? 78  ARG A CZ   5  
ATOM 7130  N NH1  . ARG A 1 78  ? 10.684  12.953  -1.782  1.00 0.00 ? 78  ARG A NH1  5  
ATOM 7131  N NH2  . ARG A 1 78  ? 9.539   14.235  -0.227  1.00 0.00 ? 78  ARG A NH2  5  
ATOM 7132  H H    . ARG A 1 78  ? 7.319   9.995   1.432   1.00 0.00 ? 78  ARG A H    5  
ATOM 7133  H HA   . ARG A 1 78  ? 6.802   10.761  -1.197  1.00 0.00 ? 78  ARG A HA   5  
ATOM 7134  H HB2  . ARG A 1 78  ? 8.468   8.742   0.219   1.00 0.00 ? 78  ARG A HB2  5  
ATOM 7135  H HB3  . ARG A 1 78  ? 7.986   8.245   -1.391  1.00 0.00 ? 78  ARG A HB3  5  
ATOM 7136  H HG2  . ARG A 1 78  ? 9.798   9.466   -2.074  1.00 0.00 ? 78  ARG A HG2  5  
ATOM 7137  H HG3  . ARG A 1 78  ? 8.729   10.842  -1.893  1.00 0.00 ? 78  ARG A HG3  5  
ATOM 7138  H HD2  . ARG A 1 78  ? 10.086  9.950   0.619   1.00 0.00 ? 78  ARG A HD2  5  
ATOM 7139  H HD3  . ARG A 1 78  ? 11.149  10.602  -0.611  1.00 0.00 ? 78  ARG A HD3  5  
ATOM 7140  H HE   . ARG A 1 78  ? 9.159   12.084  0.934   1.00 0.00 ? 78  ARG A HE   5  
ATOM 7141  H HH11 . ARG A 1 78  ? 11.008  12.057  -2.089  1.00 0.00 ? 78  ARG A HH11 5  
ATOM 7142  H HH12 . ARG A 1 78  ? 10.888  13.770  -2.322  1.00 0.00 ? 78  ARG A HH12 5  
ATOM 7143  H HH21 . ARG A 1 78  ? 9.704   15.093  -0.713  1.00 0.00 ? 78  ARG A HH21 5  
ATOM 7144  N N    . ALA A 1 79  ? 5.420   7.951   -0.098  1.00 0.00 ? 79  ALA A N    5  
ATOM 7145  C CA   . ALA A 1 79  ? 4.354   6.990   -0.328  1.00 0.00 ? 79  ALA A CA   5  
ATOM 7146  C C    . ALA A 1 79  ? 3.036   7.739   -0.539  1.00 0.00 ? 79  ALA A C    5  
ATOM 7147  O O    . ALA A 1 79  ? 2.225   7.351   -1.379  1.00 0.00 ? 79  ALA A O    5  
ATOM 7148  C CB   . ALA A 1 79  ? 4.287   6.012   0.846   1.00 0.00 ? 79  ALA A CB   5  
ATOM 7149  H H    . ALA A 1 79  ? 5.942   7.809   0.742   1.00 0.00 ? 79  ALA A H    5  
ATOM 7150  H HA   . ALA A 1 79  ? 4.596   6.436   -1.234  1.00 0.00 ? 79  ALA A HA   5  
ATOM 7151  H HB1  . ALA A 1 79  ? 5.070   5.261   0.739   1.00 0.00 ? 79  ALA A HB1  5  
ATOM 7152  H HB2  . ALA A 1 79  ? 4.429   6.554   1.780   1.00 0.00 ? 79  ALA A HB2  5  
ATOM 7153  H HB3  . ALA A 1 79  ? 3.313   5.522   0.856   1.00 0.00 ? 79  ALA A HB3  5  
ATOM 7154  N N    . ALA A 1 80  ? 2.863   8.798   0.238   1.00 0.00 ? 80  ALA A N    5  
ATOM 7155  C CA   . ALA A 1 80  ? 1.657   9.604   0.146   1.00 0.00 ? 80  ALA A CA   5  
ATOM 7156  C C    . ALA A 1 80  ? 1.605   10.283  -1.224  1.00 0.00 ? 80  ALA A C    5  
ATOM 7157  O O    . ALA A 1 80  ? 0.556   10.318  -1.864  1.00 0.00 ? 80  ALA A O    5  
ATOM 7158  C CB   . ALA A 1 80  ? 1.627   10.611  1.298   1.00 0.00 ? 80  ALA A CB   5  
ATOM 7159  H H    . ALA A 1 80  ? 3.527   9.107   0.919   1.00 0.00 ? 80  ALA A H    5  
ATOM 7160  H HA   . ALA A 1 80  ? 0.802   8.935   0.243   1.00 0.00 ? 80  ALA A HA   5  
ATOM 7161  H HB1  . ALA A 1 80  ? 0.837   11.341  1.122   1.00 0.00 ? 80  ALA A HB1  5  
ATOM 7162  H HB2  . ALA A 1 80  ? 1.436   10.087  2.234   1.00 0.00 ? 80  ALA A HB2  5  
ATOM 7163  H HB3  . ALA A 1 80  ? 2.588   11.123  1.358   1.00 0.00 ? 80  ALA A HB3  5  
ATOM 7164  N N    . GLU A 1 81  ? 2.752   10.805  -1.633  1.00 0.00 ? 81  GLU A N    5  
ATOM 7165  C CA   . GLU A 1 81  ? 2.851   11.481  -2.916  1.00 0.00 ? 81  GLU A CA   5  
ATOM 7166  C C    . GLU A 1 81  ? 2.528   10.511  -4.054  1.00 0.00 ? 81  GLU A C    5  
ATOM 7167  O O    . GLU A 1 81  ? 1.839   10.873  -5.006  1.00 0.00 ? 81  GLU A O    5  
ATOM 7168  C CB   . GLU A 1 81  ? 4.236   12.104  -3.102  1.00 0.00 ? 81  GLU A CB   5  
ATOM 7169  C CG   . GLU A 1 81  ? 4.147   13.630  -3.167  1.00 0.00 ? 81  GLU A CG   5  
ATOM 7170  C CD   . GLU A 1 81  ? 5.505   14.271  -2.873  1.00 0.00 ? 81  GLU A CD   5  
ATOM 7171  O OE1  . GLU A 1 81  ? 6.522   13.631  -3.218  1.00 0.00 ? 81  GLU A OE1  5  
ATOM 7172  O OE2  . GLU A 1 81  ? 5.495   15.387  -2.310  1.00 0.00 ? 81  GLU A OE2  5  
ATOM 7173  H H    . GLU A 1 81  ? 3.602   10.772  -1.107  1.00 0.00 ? 81  GLU A H    5  
ATOM 7174  H HA   . GLU A 1 81  ? 2.104   12.275  -2.883  1.00 0.00 ? 81  GLU A HA   5  
ATOM 7175  H HB2  . GLU A 1 81  ? 4.885   11.808  -2.278  1.00 0.00 ? 81  GLU A HB2  5  
ATOM 7176  H HB3  . GLU A 1 81  ? 4.690   11.723  -4.017  1.00 0.00 ? 81  GLU A HB3  5  
ATOM 7177  H HG2  . GLU A 1 81  ? 3.803   13.936  -4.155  1.00 0.00 ? 81  GLU A HG2  5  
ATOM 7178  H HG3  . GLU A 1 81  ? 3.410   13.986  -2.448  1.00 0.00 ? 81  GLU A HG3  5  
ATOM 7179  N N    . LEU A 1 82  ? 3.041   9.297   -3.917  1.00 0.00 ? 82  LEU A N    5  
ATOM 7180  C CA   . LEU A 1 82  ? 2.816   8.272   -4.921  1.00 0.00 ? 82  LEU A CA   5  
ATOM 7181  C C    . LEU A 1 82  ? 1.351   7.833   -4.877  1.00 0.00 ? 82  LEU A C    5  
ATOM 7182  O O    . LEU A 1 82  ? 0.671   7.822   -5.902  1.00 0.00 ? 82  LEU A O    5  
ATOM 7183  C CB   . LEU A 1 82  ? 3.808   7.120   -4.744  1.00 0.00 ? 82  LEU A CB   5  
ATOM 7184  C CG   . LEU A 1 82  ? 4.925   7.031   -5.785  1.00 0.00 ? 82  LEU A CG   5  
ATOM 7185  C CD1  . LEU A 1 82  ? 6.172   6.370   -5.196  1.00 0.00 ? 82  LEU A CD1  5  
ATOM 7186  C CD2  . LEU A 1 82  ? 4.440   6.316   -7.049  1.00 0.00 ? 82  LEU A CD2  5  
ATOM 7187  H H    . LEU A 1 82  ? 3.600   9.011   -3.139  1.00 0.00 ? 82  LEU A H    5  
ATOM 7188  H HA   . LEU A 1 82  ? 3.013   8.720   -5.895  1.00 0.00 ? 82  LEU A HA   5  
ATOM 7189  H HB2  . LEU A 1 82  ? 4.264   7.209   -3.758  1.00 0.00 ? 82  LEU A HB2  5  
ATOM 7190  H HB3  . LEU A 1 82  ? 3.252   6.183   -4.755  1.00 0.00 ? 82  LEU A HB3  5  
ATOM 7191  H HG   . LEU A 1 82  ? 5.204   8.044   -6.076  1.00 0.00 ? 82  LEU A HG   5  
ATOM 7192  H HD11 . LEU A 1 82  ? 6.781   7.124   -4.696  1.00 0.00 ? 82  LEU A HD11 5  
ATOM 7193  H HD12 . LEU A 1 82  ? 5.874   5.607   -4.476  1.00 0.00 ? 82  LEU A HD12 5  
ATOM 7194  H HD13 . LEU A 1 82  ? 6.751   5.908   -5.996  1.00 0.00 ? 82  LEU A HD13 5  
ATOM 7195  H HD21 . LEU A 1 82  ? 5.253   5.720   -7.463  1.00 0.00 ? 82  LEU A HD21 5  
ATOM 7196  H HD22 . LEU A 1 82  ? 3.603   5.665   -6.799  1.00 0.00 ? 82  LEU A HD22 5  
ATOM 7197  H HD23 . LEU A 1 82  ? 4.120   7.055   -7.784  1.00 0.00 ? 82  LEU A HD23 5  
ATOM 7198  N N    . MET A 1 83  ? 0.907   7.483   -3.679  1.00 0.00 ? 83  MET A N    5  
ATOM 7199  C CA   . MET A 1 83  ? -0.465  7.045   -3.488  1.00 0.00 ? 83  MET A CA   5  
ATOM 7200  C C    . MET A 1 83  ? -1.451  8.161   -3.839  1.00 0.00 ? 83  MET A C    5  
ATOM 7201  O O    . MET A 1 83  ? -2.633  7.903   -4.061  1.00 0.00 ? 83  MET A O    5  
ATOM 7202  C CB   . MET A 1 83  ? -0.669  6.624   -2.031  1.00 0.00 ? 83  MET A CB   5  
ATOM 7203  C CG   . MET A 1 83  ? -0.005  5.273   -1.753  1.00 0.00 ? 83  MET A CG   5  
ATOM 7204  S SD   . MET A 1 83  ? -0.758  4.505   -0.328  1.00 0.00 ? 83  MET A SD   5  
ATOM 7205  C CE   . MET A 1 83  ? 0.280   5.167   0.965   1.00 0.00 ? 83  MET A CE   5  
ATOM 7206  H H    . MET A 1 83  ? 1.466   7.495   -2.850  1.00 0.00 ? 83  MET A H    5  
ATOM 7207  H HA   . MET A 1 83  ? -0.601  6.203   -4.167  1.00 0.00 ? 83  MET A HA   5  
ATOM 7208  H HB2  . MET A 1 83  ? -0.251  7.382   -1.368  1.00 0.00 ? 83  MET A HB2  5  
ATOM 7209  H HB3  . MET A 1 83  ? -1.734  6.561   -1.812  1.00 0.00 ? 83  MET A HB3  5  
ATOM 7210  H HG2  . MET A 1 83  ? -0.106  4.624   -2.622  1.00 0.00 ? 83  MET A HG2  5  
ATOM 7211  H HG3  . MET A 1 83  ? 1.062   5.412   -1.580  1.00 0.00 ? 83  MET A HG3  5  
ATOM 7212  H HE1  . MET A 1 83  ? -0.345  5.577   1.758   1.00 0.00 ? 83  MET A HE1  5  
ATOM 7213  H HE2  . MET A 1 83  ? 0.907   4.372   1.370   1.00 0.00 ? 83  MET A HE2  5  
ATOM 7214  H HE3  . MET A 1 83  ? 0.912   5.955   0.556   1.00 0.00 ? 83  MET A HE3  5  
ATOM 7215  N N    . THR A 1 84  ? -0.928  9.378   -3.879  1.00 0.00 ? 84  THR A N    5  
ATOM 7216  C CA   . THR A 1 84  ? -1.748  10.534  -4.200  1.00 0.00 ? 84  THR A CA   5  
ATOM 7217  C C    . THR A 1 84  ? -2.124  10.526  -5.683  1.00 0.00 ? 84  THR A C    5  
ATOM 7218  O O    . THR A 1 84  ? -3.228  10.121  -6.044  1.00 0.00 ? 84  THR A O    5  
ATOM 7219  C CB   . THR A 1 84  ? -0.983  11.788  -3.774  1.00 0.00 ? 84  THR A CB   5  
ATOM 7220  O OG1  . THR A 1 84  ? -1.198  11.866  -2.367  1.00 0.00 ? 84  THR A OG1  5  
ATOM 7221  C CG2  . THR A 1 84  ? -1.613  13.072  -4.318  1.00 0.00 ? 84  THR A CG2  5  
ATOM 7222  H H    . THR A 1 84  ? 0.034   9.579   -3.697  1.00 0.00 ? 84  THR A H    5  
ATOM 7223  H HA   . THR A 1 84  ? -2.677  10.464  -3.634  1.00 0.00 ? 84  THR A HA   5  
ATOM 7224  H HB   . THR A 1 84  ? 0.067   11.719  -4.058  1.00 0.00 ? 84  THR A HB   5  
ATOM 7225  H HG1  . THR A 1 84  ? -0.478  12.413  -1.940  1.00 0.00 ? 84  THR A HG1  5  
ATOM 7226  H HG21 . THR A 1 84  ? -1.339  13.195  -5.366  1.00 0.00 ? 84  THR A HG21 5  
ATOM 7227  H HG22 . THR A 1 84  ? -2.697  13.009  -4.231  1.00 0.00 ? 84  THR A HG22 5  
ATOM 7228  H HG23 . THR A 1 84  ? -1.251  13.926  -3.745  1.00 0.00 ? 84  THR A HG23 5  
ATOM 7229  N N    . ARG A 1 85  ? -1.185  10.978  -6.501  1.00 0.00 ? 85  ARG A N    5  
ATOM 7230  C CA   . ARG A 1 85  ? -1.405  11.029  -7.936  1.00 0.00 ? 85  ARG A CA   5  
ATOM 7231  C C    . ARG A 1 85  ? -1.451  9.613   -8.516  1.00 0.00 ? 85  ARG A C    5  
ATOM 7232  O O    . ARG A 1 85  ? -0.669  9.276   -9.404  1.00 0.00 ? 85  ARG A O    5  
ATOM 7233  C CB   . ARG A 1 85  ? -0.299  11.823  -8.635  1.00 0.00 ? 85  ARG A CB   5  
ATOM 7234  C CG   . ARG A 1 85  ? -0.797  12.409  -9.957  1.00 0.00 ? 85  ARG A CG   5  
ATOM 7235  C CD   . ARG A 1 85  ? 0.368   12.678  -10.912 1.00 0.00 ? 85  ARG A CD   5  
ATOM 7236  N NE   . ARG A 1 85  ? -0.147  13.116  -12.228 1.00 0.00 ? 85  ARG A NE   5  
ATOM 7237  C CZ   . ARG A 1 85  ? -0.496  14.378  -12.516 1.00 0.00 ? 85  ARG A CZ   5  
ATOM 7238  N NH1  . ARG A 1 85  ? -0.388  15.332  -11.582 1.00 0.00 ? 85  ARG A NH1  5  
ATOM 7239  N NH2  . ARG A 1 85  ? -0.953  14.684  -13.737 1.00 0.00 ? 85  ARG A NH2  5  
ATOM 7240  H H    . ARG A 1 85  ? -0.290  11.306  -6.198  1.00 0.00 ? 85  ARG A H    5  
ATOM 7241  H HA   . ARG A 1 85  ? -2.364  11.532  -8.054  1.00 0.00 ? 85  ARG A HA   5  
ATOM 7242  H HB2  . ARG A 1 85  ? 0.044   12.626  -7.983  1.00 0.00 ? 85  ARG A HB2  5  
ATOM 7243  H HB3  . ARG A 1 85  ? 0.558   11.174  -8.820  1.00 0.00 ? 85  ARG A HB3  5  
ATOM 7244  H HG2  . ARG A 1 85  ? -1.502  11.720  -10.423 1.00 0.00 ? 85  ARG A HG2  5  
ATOM 7245  H HG3  . ARG A 1 85  ? -1.337  13.337  -9.767  1.00 0.00 ? 85  ARG A HG3  5  
ATOM 7246  H HD2  . ARG A 1 85  ? 1.022   13.443  -10.494 1.00 0.00 ? 85  ARG A HD2  5  
ATOM 7247  H HD3  . ARG A 1 85  ? 0.968   11.775  -11.029 1.00 0.00 ? 85  ARG A HD3  5  
ATOM 7248  H HE   . ARG A 1 85  ? -0.239  12.429  -12.948 1.00 0.00 ? 85  ARG A HE   5  
ATOM 7249  H HH11 . ARG A 1 85  ? -0.047  15.103  -10.670 1.00 0.00 ? 85  ARG A HH11 5  
ATOM 7250  H HH12 . ARG A 1 85  ? -0.649  16.274  -11.796 1.00 0.00 ? 85  ARG A HH12 5  
ATOM 7251  H HH21 . ARG A 1 85  ? -1.034  13.972  -14.435 1.00 0.00 ? 85  ARG A HH21 5  
ATOM 7252  H HH22 . ARG A 1 85  ? -1.214  15.625  -13.952 1.00 0.00 ? 85  ARG A HH22 5  
ATOM 7253  N N    . THR A 1 86  ? -2.375  8.823   -7.990  1.00 0.00 ? 86  THR A N    5  
ATOM 7254  C CA   . THR A 1 86  ? -2.534  7.452   -8.445  1.00 0.00 ? 86  THR A CA   5  
ATOM 7255  C C    . THR A 1 86  ? -3.502  7.391   -9.628  1.00 0.00 ? 86  THR A C    5  
ATOM 7256  O O    . THR A 1 86  ? -3.370  6.531   -10.498 1.00 0.00 ? 86  THR A O    5  
ATOM 7257  C CB   . THR A 1 86  ? -2.980  6.607   -7.250  1.00 0.00 ? 86  THR A CB   5  
ATOM 7258  O OG1  . THR A 1 86  ? -3.511  7.557   -6.331  1.00 0.00 ? 86  THR A OG1  5  
ATOM 7259  C CG2  . THR A 1 86  ? -1.801  5.983   -6.501  1.00 0.00 ? 86  THR A CG2  5  
ATOM 7260  H H    . THR A 1 86  ? -3.007  9.105   -7.269  1.00 0.00 ? 86  THR A H    5  
ATOM 7261  H HA   . THR A 1 86  ? -1.568  7.095   -8.802  1.00 0.00 ? 86  THR A HA   5  
ATOM 7262  H HB   . THR A 1 86  ? -3.694  5.843   -7.559  1.00 0.00 ? 86  THR A HB   5  
ATOM 7263  H HG1  . THR A 1 86  ? -4.442  7.808   -6.598  1.00 0.00 ? 86  THR A HG1  5  
ATOM 7264  H HG21 . THR A 1 86  ? -2.174  5.268   -5.767  1.00 0.00 ? 86  THR A HG21 5  
ATOM 7265  H HG22 . THR A 1 86  ? -1.150  5.470   -7.209  1.00 0.00 ? 86  THR A HG22 5  
ATOM 7266  H HG23 . THR A 1 86  ? -1.239  6.766   -5.991  1.00 0.00 ? 86  THR A HG23 5  
ATOM 7267  N N    . SER A 1 87  ? -4.452  8.314   -9.622  1.00 0.00 ? 87  SER A N    5  
ATOM 7268  C CA   . SER A 1 87  ? -5.442  8.375   -10.684 1.00 0.00 ? 87  SER A CA   5  
ATOM 7269  C C    . SER A 1 87  ? -6.558  7.364   -10.419 1.00 0.00 ? 87  SER A C    5  
ATOM 7270  O O    . SER A 1 87  ? -6.539  6.663   -9.408  1.00 0.00 ? 87  SER A O    5  
ATOM 7271  C CB   . SER A 1 87  ? -4.802  8.113   -12.049 1.00 0.00 ? 87  SER A CB   5  
ATOM 7272  O OG   . SER A 1 87  ? -5.226  9.058   -13.028 1.00 0.00 ? 87  SER A OG   5  
ATOM 7273  H H    . SER A 1 87  ? -4.552  9.009   -8.911  1.00 0.00 ? 87  SER A H    5  
ATOM 7274  H HA   . SER A 1 87  ? -5.832  9.393   -10.656 1.00 0.00 ? 87  SER A HA   5  
ATOM 7275  H HB2  . SER A 1 87  ? -3.716  8.152   -11.954 1.00 0.00 ? 87  SER A HB2  5  
ATOM 7276  H HB3  . SER A 1 87  ? -5.056  7.107   -12.382 1.00 0.00 ? 87  SER A HB3  5  
ATOM 7277  H HG   . SER A 1 87  ? -6.219  9.168   -12.989 1.00 0.00 ? 87  SER A HG   5  
ATOM 7278  N N    . SER A 1 88  ? -7.505  7.319   -11.344 1.00 0.00 ? 88  SER A N    5  
ATOM 7279  C CA   . SER A 1 88  ? -8.628  6.405   -11.223 1.00 0.00 ? 88  SER A CA   5  
ATOM 7280  C C    . SER A 1 88  ? -8.135  4.958   -11.294 1.00 0.00 ? 88  SER A C    5  
ATOM 7281  O O    . SER A 1 88  ? -8.937  4.026   -11.312 1.00 0.00 ? 88  SER A O    5  
ATOM 7282  C CB   . SER A 1 88  ? -9.671  6.665   -12.312 1.00 0.00 ? 88  SER A CB   5  
ATOM 7283  O OG   . SER A 1 88  ? -9.278  6.119   -13.568 1.00 0.00 ? 88  SER A OG   5  
ATOM 7284  H H    . SER A 1 88  ? -7.514  7.892   -12.164 1.00 0.00 ? 88  SER A H    5  
ATOM 7285  H HA   . SER A 1 88  ? -9.065  6.612   -10.246 1.00 0.00 ? 88  SER A HA   5  
ATOM 7286  H HB2  . SER A 1 88  ? -10.625 6.232   -12.011 1.00 0.00 ? 88  SER A HB2  5  
ATOM 7287  H HB3  . SER A 1 88  ? -9.826  7.739   -12.416 1.00 0.00 ? 88  SER A HB3  5  
ATOM 7288  H HG   . SER A 1 88  ? -8.314  5.854   -13.539 1.00 0.00 ? 88  SER A HG   5  
ATOM 7289  N N    . VAL A 1 89  ? -6.818  4.817   -11.334 1.00 0.00 ? 89  VAL A N    5  
ATOM 7290  C CA   . VAL A 1 89  ? -6.209  3.500   -11.403 1.00 0.00 ? 89  VAL A CA   5  
ATOM 7291  C C    . VAL A 1 89  ? -5.042  3.430   -10.416 1.00 0.00 ? 89  VAL A C    5  
ATOM 7292  O O    . VAL A 1 89  ? -4.165  4.292   -10.424 1.00 0.00 ? 89  VAL A O    5  
ATOM 7293  C CB   . VAL A 1 89  ? -5.794  3.190   -12.843 1.00 0.00 ? 89  VAL A CB   5  
ATOM 7294  C CG1  . VAL A 1 89  ? -5.291  4.450   -13.551 1.00 0.00 ? 89  VAL A CG1  5  
ATOM 7295  C CG2  . VAL A 1 89  ? -4.741  2.081   -12.884 1.00 0.00 ? 89  VAL A CG2  5  
ATOM 7296  H H    . VAL A 1 89  ? -6.173  5.581   -11.319 1.00 0.00 ? 89  VAL A H    5  
ATOM 7297  H HA   . VAL A 1 89  ? -6.964  2.772   -11.106 1.00 0.00 ? 89  VAL A HA   5  
ATOM 7298  H HB   . VAL A 1 89  ? -6.675  2.835   -13.377 1.00 0.00 ? 89  VAL A HB   5  
ATOM 7299  H HG11 . VAL A 1 89  ? -4.848  5.126   -12.820 1.00 0.00 ? 89  VAL A HG11 5  
ATOM 7300  H HG12 . VAL A 1 89  ? -4.542  4.175   -14.293 1.00 0.00 ? 89  VAL A HG12 5  
ATOM 7301  H HG13 . VAL A 1 89  ? -6.126  4.947   -14.045 1.00 0.00 ? 89  VAL A HG13 5  
ATOM 7302  H HG21 . VAL A 1 89  ? -3.919  2.336   -12.215 1.00 0.00 ? 89  VAL A HG21 5  
ATOM 7303  H HG22 . VAL A 1 89  ? -5.191  1.141   -12.564 1.00 0.00 ? 89  VAL A HG22 5  
ATOM 7304  H HG23 . VAL A 1 89  ? -4.362  1.976   -13.900 1.00 0.00 ? 89  VAL A HG23 5  
ATOM 7305  N N    . VAL A 1 90  ? -5.069  2.394   -9.590  1.00 0.00 ? 90  VAL A N    5  
ATOM 7306  C CA   . VAL A 1 90  ? -4.024  2.200   -8.599  1.00 0.00 ? 90  VAL A CA   5  
ATOM 7307  C C    . VAL A 1 90  ? -3.502  0.765   -8.689  1.00 0.00 ? 90  VAL A C    5  
ATOM 7308  O O    . VAL A 1 90  ? -4.249  -0.187  -8.468  1.00 0.00 ? 90  VAL A O    5  
ATOM 7309  C CB   . VAL A 1 90  ? -4.549  2.559   -7.208  1.00 0.00 ? 90  VAL A CB   5  
ATOM 7310  C CG1  . VAL A 1 90  ? -3.505  3.345   -6.413  1.00 0.00 ? 90  VAL A CG1  5  
ATOM 7311  C CG2  . VAL A 1 90  ? -5.865  3.335   -7.302  1.00 0.00 ? 90  VAL A CG2  5  
ATOM 7312  H H    . VAL A 1 90  ? -5.785  1.696   -9.591  1.00 0.00 ? 90  VAL A H    5  
ATOM 7313  H HA   . VAL A 1 90  ? -3.211  2.885   -8.840  1.00 0.00 ? 90  VAL A HA   5  
ATOM 7314  H HB   . VAL A 1 90  ? -4.746  1.629   -6.674  1.00 0.00 ? 90  VAL A HB   5  
ATOM 7315  H HG11 . VAL A 1 90  ? -2.568  3.369   -6.970  1.00 0.00 ? 90  VAL A HG11 5  
ATOM 7316  H HG12 . VAL A 1 90  ? -3.859  4.363   -6.254  1.00 0.00 ? 90  VAL A HG12 5  
ATOM 7317  H HG13 . VAL A 1 90  ? -3.342  2.862   -5.450  1.00 0.00 ? 90  VAL A HG13 5  
ATOM 7318  H HG21 . VAL A 1 90  ? -5.827  4.011   -8.155  1.00 0.00 ? 90  VAL A HG21 5  
ATOM 7319  H HG22 . VAL A 1 90  ? -6.691  2.635   -7.429  1.00 0.00 ? 90  VAL A HG22 5  
ATOM 7320  H HG23 . VAL A 1 90  ? -6.013  3.910   -6.388  1.00 0.00 ? 90  VAL A HG23 5  
ATOM 7321  N N    . THR A 1 91  ? -2.222  0.654   -9.014  1.00 0.00 ? 91  THR A N    5  
ATOM 7322  C CA   . THR A 1 91  ? -1.591  -0.649  -9.136  1.00 0.00 ? 91  THR A CA   5  
ATOM 7323  C C    . THR A 1 91  ? -0.373  -0.740  -8.216  1.00 0.00 ? 91  THR A C    5  
ATOM 7324  O O    . THR A 1 91  ? 0.727   -0.339  -8.594  1.00 0.00 ? 91  THR A O    5  
ATOM 7325  C CB   . THR A 1 91  ? -1.256  -0.876  -10.612 1.00 0.00 ? 91  THR A CB   5  
ATOM 7326  O OG1  . THR A 1 91  ? -0.729  -2.200  -10.649 1.00 0.00 ? 91  THR A OG1  5  
ATOM 7327  C CG2  . THR A 1 91  ? -0.097  0.000   -11.090 1.00 0.00 ? 91  THR A CG2  5  
ATOM 7328  H H    . THR A 1 91  ? -1.621  1.433   -9.193  1.00 0.00 ? 91  THR A H    5  
ATOM 7329  H HA   . THR A 1 91  ? -2.300  -1.407  -8.804  1.00 0.00 ? 91  THR A HA   5  
ATOM 7330  H HB   . THR A 1 91  ? -2.137  -0.733  -11.237 1.00 0.00 ? 91  THR A HB   5  
ATOM 7331  H HG1  . THR A 1 91  ? 0.144   -2.234  -10.162 1.00 0.00 ? 91  THR A HG1  5  
ATOM 7332  H HG21 . THR A 1 91  ? 0.846   -0.423  -10.743 1.00 0.00 ? 91  THR A HG21 5  
ATOM 7333  H HG22 . THR A 1 91  ? -0.097  0.040   -12.180 1.00 0.00 ? 91  THR A HG22 5  
ATOM 7334  H HG23 . THR A 1 91  ? -0.213  1.007   -10.690 1.00 0.00 ? 91  THR A HG23 5  
ATOM 7335  N N    . LEU A 1 92  ? -0.609  -1.270  -7.024  1.00 0.00 ? 92  LEU A N    5  
ATOM 7336  C CA   . LEU A 1 92  ? 0.455   -1.418  -6.046  1.00 0.00 ? 92  LEU A CA   5  
ATOM 7337  C C    . LEU A 1 92  ? 0.408   -2.829  -5.458  1.00 0.00 ? 92  LEU A C    5  
ATOM 7338  O O    . LEU A 1 92  ? -0.642  -3.470  -5.456  1.00 0.00 ? 92  LEU A O    5  
ATOM 7339  C CB   . LEU A 1 92  ? 0.375   -0.310  -4.995  1.00 0.00 ? 92  LEU A CB   5  
ATOM 7340  C CG   . LEU A 1 92  ? -0.984  -0.126  -4.317  1.00 0.00 ? 92  LEU A CG   5  
ATOM 7341  C CD1  . LEU A 1 92  ? -1.910  0.741   -5.172  1.00 0.00 ? 92  LEU A CD1  5  
ATOM 7342  C CD2  . LEU A 1 92  ? -1.615  -1.477  -3.977  1.00 0.00 ? 92  LEU A CD2  5  
ATOM 7343  H H    . LEU A 1 92  ? -1.507  -1.593  -6.724  1.00 0.00 ? 92  LEU A H    5  
ATOM 7344  H HA   . LEU A 1 92  ? 1.402   -1.295  -6.573  1.00 0.00 ? 92  LEU A HA   5  
ATOM 7345  H HB2  . LEU A 1 92  ? 1.119   -0.513  -4.224  1.00 0.00 ? 92  LEU A HB2  5  
ATOM 7346  H HB3  . LEU A 1 92  ? 0.654   0.632   -5.466  1.00 0.00 ? 92  LEU A HB3  5  
ATOM 7347  H HG   . LEU A 1 92  ? -0.828  0.402   -3.376  1.00 0.00 ? 92  LEU A HG   5  
ATOM 7348  H HD11 . LEU A 1 92  ? -1.782  1.789   -4.900  1.00 0.00 ? 92  LEU A HD11 5  
ATOM 7349  H HD12 . LEU A 1 92  ? -1.664  0.606   -6.225  1.00 0.00 ? 92  LEU A HD12 5  
ATOM 7350  H HD13 . LEU A 1 92  ? -2.945  0.446   -5.000  1.00 0.00 ? 92  LEU A HD13 5  
ATOM 7351  H HD21 . LEU A 1 92  ? -0.853  -2.143  -3.572  1.00 0.00 ? 92  LEU A HD21 5  
ATOM 7352  H HD22 . LEU A 1 92  ? -2.404  -1.335  -3.238  1.00 0.00 ? 92  LEU A HD22 5  
ATOM 7353  H HD23 . LEU A 1 92  ? -2.039  -1.918  -4.880  1.00 0.00 ? 92  LEU A HD23 5  
ATOM 7354  N N    . GLU A 1 93  ? 1.558   -3.273  -4.972  1.00 0.00 ? 93  GLU A N    5  
ATOM 7355  C CA   . GLU A 1 93  ? 1.661   -4.596  -4.381  1.00 0.00 ? 93  GLU A CA   5  
ATOM 7356  C C    . GLU A 1 93  ? 1.631   -4.500  -2.855  1.00 0.00 ? 93  GLU A C    5  
ATOM 7357  O O    . GLU A 1 93  ? 2.422   -3.771  -2.259  1.00 0.00 ? 93  GLU A O    5  
ATOM 7358  C CB   . GLU A 1 93  ? 2.924   -5.314  -4.861  1.00 0.00 ? 93  GLU A CB   5  
ATOM 7359  C CG   . GLU A 1 93  ? 2.906   -5.499  -6.380  1.00 0.00 ? 93  GLU A CG   5  
ATOM 7360  C CD   . GLU A 1 93  ? 3.847   -6.628  -6.806  1.00 0.00 ? 93  GLU A CD   5  
ATOM 7361  O OE1  . GLU A 1 93  ? 3.433   -7.798  -6.658  1.00 0.00 ? 93  GLU A OE1  5  
ATOM 7362  O OE2  . GLU A 1 93  ? 4.959   -6.295  -7.269  1.00 0.00 ? 93  GLU A OE2  5  
ATOM 7363  H H    . GLU A 1 93  ? 2.407   -2.745  -4.977  1.00 0.00 ? 93  GLU A H    5  
ATOM 7364  H HA   . GLU A 1 93  ? 0.785   -5.140  -4.735  1.00 0.00 ? 93  GLU A HA   5  
ATOM 7365  H HB2  . GLU A 1 93  ? 3.804   -4.741  -4.571  1.00 0.00 ? 93  GLU A HB2  5  
ATOM 7366  H HB3  . GLU A 1 93  ? 3.001   -6.286  -4.374  1.00 0.00 ? 93  GLU A HB3  5  
ATOM 7367  H HG2  . GLU A 1 93  ? 1.892   -5.722  -6.711  1.00 0.00 ? 93  GLU A HG2  5  
ATOM 7368  H HG3  . GLU A 1 93  ? 3.203   -4.570  -6.866  1.00 0.00 ? 93  GLU A HG3  5  
ATOM 7369  N N    . VAL A 1 94  ? 0.709   -5.247  -2.264  1.00 0.00 ? 94  VAL A N    5  
ATOM 7370  C CA   . VAL A 1 94  ? 0.566   -5.256  -0.819  1.00 0.00 ? 94  VAL A CA   5  
ATOM 7371  C C    . VAL A 1 94  ? 0.677   -6.694  -0.308  1.00 0.00 ? 94  VAL A C    5  
ATOM 7372  O O    . VAL A 1 94  ? 0.411   -7.641  -1.046  1.00 0.00 ? 94  VAL A O    5  
ATOM 7373  C CB   . VAL A 1 94  ? -0.747  -4.579  -0.419  1.00 0.00 ? 94  VAL A CB   5  
ATOM 7374  C CG1  . VAL A 1 94  ? -0.950  -3.276  -1.195  1.00 0.00 ? 94  VAL A CG1  5  
ATOM 7375  C CG2  . VAL A 1 94  ? -1.933  -5.525  -0.615  1.00 0.00 ? 94  VAL A CG2  5  
ATOM 7376  H H    . VAL A 1 94  ? 0.069   -5.838  -2.756  1.00 0.00 ? 94  VAL A H    5  
ATOM 7377  H HA   . VAL A 1 94  ? 1.387   -4.671  -0.403  1.00 0.00 ? 94  VAL A HA   5  
ATOM 7378  H HB   . VAL A 1 94  ? -0.687  -4.332  0.641   1.00 0.00 ? 94  VAL A HB   5  
ATOM 7379  H HG11 . VAL A 1 94  ? -1.956  -3.257  -1.614  1.00 0.00 ? 94  VAL A HG11 5  
ATOM 7380  H HG12 . VAL A 1 94  ? -0.820  -2.428  -0.522  1.00 0.00 ? 94  VAL A HG12 5  
ATOM 7381  H HG13 . VAL A 1 94  ? -0.219  -3.216  -2.001  1.00 0.00 ? 94  VAL A HG13 5  
ATOM 7382  H HG21 . VAL A 1 94  ? -2.769  -4.975  -1.047  1.00 0.00 ? 94  VAL A HG21 5  
ATOM 7383  H HG22 . VAL A 1 94  ? -1.645  -6.335  -1.286  1.00 0.00 ? 94  VAL A HG22 5  
ATOM 7384  H HG23 . VAL A 1 94  ? -2.230  -5.940  0.349   1.00 0.00 ? 94  VAL A HG23 5  
ATOM 7385  N N    . ALA A 1 95  ? 1.070   -6.811  0.952   1.00 0.00 ? 95  ALA A N    5  
ATOM 7386  C CA   . ALA A 1 95  ? 1.220   -8.118  1.570   1.00 0.00 ? 95  ALA A CA   5  
ATOM 7387  C C    . ALA A 1 95  ? 0.766   -8.042  3.029   1.00 0.00 ? 95  ALA A C    5  
ATOM 7388  O O    . ALA A 1 95  ? 0.818   -6.978  3.645   1.00 0.00 ? 95  ALA A O    5  
ATOM 7389  C CB   . ALA A 1 95  ? 2.671   -8.584  1.435   1.00 0.00 ? 95  ALA A CB   5  
ATOM 7390  H H    . ALA A 1 95  ? 1.285   -6.036  1.546   1.00 0.00 ? 95  ALA A H    5  
ATOM 7391  H HA   . ALA A 1 95  ? 0.576   -8.815  1.034   1.00 0.00 ? 95  ALA A HA   5  
ATOM 7392  H HB1  . ALA A 1 95  ? 3.341   -7.752  1.650   1.00 0.00 ? 95  ALA A HB1  5  
ATOM 7393  H HB2  . ALA A 1 95  ? 2.859   -9.394  2.139   1.00 0.00 ? 95  ALA A HB2  5  
ATOM 7394  H HB3  . ALA A 1 95  ? 2.845   -8.938  0.419   1.00 0.00 ? 95  ALA A HB3  5  
ATOM 7395  N N    . LYS A 1 96  ? 0.331   -9.184  3.541   1.00 0.00 ? 96  LYS A N    5  
ATOM 7396  C CA   . LYS A 1 96  ? -0.132  -9.260  4.916   1.00 0.00 ? 96  LYS A CA   5  
ATOM 7397  C C    . LYS A 1 96  ? -1.493  -8.570  5.031   1.00 0.00 ? 96  LYS A C    5  
ATOM 7398  O O    . LYS A 1 96  ? -1.616  -7.538  5.689   1.00 0.00 ? 96  LYS A O    5  
ATOM 7399  C CB   . LYS A 1 96  ? 0.925   -8.698  5.869   1.00 0.00 ? 96  LYS A CB   5  
ATOM 7400  C CG   . LYS A 1 96  ? 0.717   -9.225  7.290   1.00 0.00 ? 96  LYS A CG   5  
ATOM 7401  C CD   . LYS A 1 96  ? 2.001   -9.855  7.835   1.00 0.00 ? 96  LYS A CD   5  
ATOM 7402  C CE   . LYS A 1 96  ? 1.704   -11.175 8.549   1.00 0.00 ? 96  LYS A CE   5  
ATOM 7403  N NZ   . LYS A 1 96  ? 2.963   -11.878 8.883   1.00 0.00 ? 96  LYS A NZ   5  
ATOM 7404  H H    . LYS A 1 96  ? 0.292   -10.045 3.034   1.00 0.00 ? 96  LYS A H    5  
ATOM 7405  H HA   . LYS A 1 96  ? -0.258  -10.315 5.161   1.00 0.00 ? 96  LYS A HA   5  
ATOM 7406  H HB2  . LYS A 1 96  ? 1.920   -8.972  5.518   1.00 0.00 ? 96  LYS A HB2  5  
ATOM 7407  H HB3  . LYS A 1 96  ? 0.877   -7.609  5.870   1.00 0.00 ? 96  LYS A HB3  5  
ATOM 7408  H HG2  . LYS A 1 96  ? 0.404   -8.409  7.942   1.00 0.00 ? 96  LYS A HG2  5  
ATOM 7409  H HG3  . LYS A 1 96  ? -0.085  -9.963  7.295   1.00 0.00 ? 96  LYS A HG3  5  
ATOM 7410  H HD2  . LYS A 1 96  ? 2.700   -10.029 7.017   1.00 0.00 ? 96  LYS A HD2  5  
ATOM 7411  H HD3  . LYS A 1 96  ? 2.485   -9.164  8.526   1.00 0.00 ? 96  LYS A HD3  5  
ATOM 7412  H HE2  . LYS A 1 96  ? 1.134   -10.983 9.458   1.00 0.00 ? 96  LYS A HE2  5  
ATOM 7413  H HE3  . LYS A 1 96  ? 1.085   -11.808 7.913   1.00 0.00 ? 96  LYS A HE3  5  
ATOM 7414  H HZ1  . LYS A 1 96  ? 3.206   -12.499 8.139   1.00 0.00 ? 96  LYS A HZ1  5  
ATOM 7415  H HZ2  . LYS A 1 96  ? 3.694   -11.208 9.011   1.00 0.00 ? 96  LYS A HZ2  5  
ATOM 7416  H HZ3  . LYS A 1 96  ? 2.838   -12.401 9.727   1.00 0.00 ? 96  LYS A HZ3  5  
ATOM 7417  N N    . GLN A 1 97  ? -2.480  -9.167  4.380   1.00 0.00 ? 97  GLN A N    5  
ATOM 7418  C CA   . GLN A 1 97  ? -3.827  -8.622  4.400   1.00 0.00 ? 97  GLN A CA   5  
ATOM 7419  C C    . GLN A 1 97  ? -4.852  -9.733  4.163   1.00 0.00 ? 97  GLN A C    5  
ATOM 7420  O O    . GLN A 1 97  ? -5.314  -9.927  3.039   1.00 0.00 ? 97  GLN A O    5  
ATOM 7421  C CB   . GLN A 1 97  ? -3.982  -7.503  3.368   1.00 0.00 ? 97  GLN A CB   5  
ATOM 7422  C CG   . GLN A 1 97  ? -5.185  -6.617  3.697   1.00 0.00 ? 97  GLN A CG   5  
ATOM 7423  C CD   . GLN A 1 97  ? -6.483  -7.426  3.680   1.00 0.00 ? 97  GLN A CD   5  
ATOM 7424  O OE1  . GLN A 1 97  ? -7.078  -7.715  4.705   1.00 0.00 ? 97  GLN A OE1  5  
ATOM 7425  N NE2  . GLN A 1 97  ? -6.887  -7.775  2.462   1.00 0.00 ? 97  GLN A NE2  5  
ATOM 7426  H H    . GLN A 1 97  ? -2.371  -10.006 3.846   1.00 0.00 ? 97  GLN A H    5  
ATOM 7427  H HA   . GLN A 1 97  ? -3.956  -8.207  5.400   1.00 0.00 ? 97  GLN A HA   5  
ATOM 7428  H HB2  . GLN A 1 97  ? -3.076  -6.898  3.344   1.00 0.00 ? 97  GLN A HB2  5  
ATOM 7429  H HB3  . GLN A 1 97  ? -4.104  -7.935  2.375   1.00 0.00 ? 97  GLN A HB3  5  
ATOM 7430  H HG2  . GLN A 1 97  ? -5.049  -6.162  4.678   1.00 0.00 ? 97  GLN A HG2  5  
ATOM 7431  H HG3  . GLN A 1 97  ? -5.250  -5.803  2.975   1.00 0.00 ? 97  GLN A HG3  5  
ATOM 7432  H HE21 . GLN A 1 97  ? -6.352  -7.505  1.661   1.00 0.00 ? 97  GLN A HE21 5  
ATOM 7433  H HE22 . GLN A 1 97  ? -7.727  -8.306  2.346   1.00 0.00 ? 97  GLN A HE22 5  
ATOM 7434  N N    . GLY A 1 98  ? -5.178  -10.434 5.239   1.00 0.00 ? 98  GLY A N    5  
ATOM 7435  C CA   . GLY A 1 98  ? -6.140  -11.520 5.162   1.00 0.00 ? 98  GLY A CA   5  
ATOM 7436  C C    . GLY A 1 98  ? -7.570  -10.981 5.083   1.00 0.00 ? 98  GLY A C    5  
ATOM 7437  O O    . GLY A 1 98  ? -7.836  -9.853  5.494   1.00 0.00 ? 98  GLY A O    5  
ATOM 7438  H H    . GLY A 1 98  ? -4.798  -10.270 6.149   1.00 0.00 ? 98  GLY A H    5  
ATOM 7439  H HA2  . GLY A 1 98  ? -5.930  -12.135 4.287   1.00 0.00 ? 98  GLY A HA2  5  
ATOM 7440  H HA3  . GLY A 1 98  ? -6.038  -12.163 6.036   1.00 0.00 ? 98  GLY A HA3  5  
ATOM 7441  N N    . ALA A 1 99  ? -8.453  -11.814 4.552   1.00 0.00 ? 99  ALA A N    5  
ATOM 7442  C CA   . ALA A 1 99  ? -9.849  -11.435 4.414   1.00 0.00 ? 99  ALA A CA   5  
ATOM 7443  C C    . ALA A 1 99  ? -10.735 -12.634 4.759   1.00 0.00 ? 99  ALA A C    5  
ATOM 7444  O O    . ALA A 1 99  ? -11.445 -12.617 5.764   1.00 0.00 ? 99  ALA A O    5  
ATOM 7445  C CB   . ALA A 1 99  ? -10.100 -10.915 2.997   1.00 0.00 ? 99  ALA A CB   5  
ATOM 7446  H H    . ALA A 1 99  ? -8.229  -12.730 4.220   1.00 0.00 ? 99  ALA A H    5  
ATOM 7447  H HA   . ALA A 1 99  ? -10.047 -10.632 5.123   1.00 0.00 ? 99  ALA A HA   5  
ATOM 7448  H HB1  . ALA A 1 99  ? -10.614 -11.679 2.415   1.00 0.00 ? 99  ALA A HB1  5  
ATOM 7449  H HB2  . ALA A 1 99  ? -10.716 -10.017 3.044   1.00 0.00 ? 99  ALA A HB2  5  
ATOM 7450  H HB3  . ALA A 1 99  ? -9.147  -10.678 2.524   1.00 0.00 ? 99  ALA A HB3  5  
ATOM 7451  N N    . ILE A 1 100 ? -10.664 -13.647 3.908   1.00 0.00 ? 100 ILE A N    5  
ATOM 7452  C CA   . ILE A 1 100 ? -11.450 -14.852 4.110   1.00 0.00 ? 100 ILE A CA   5  
ATOM 7453  C C    . ILE A 1 100 ? -10.602 -15.891 4.847   1.00 0.00 ? 100 ILE A C    5  
ATOM 7454  O O    . ILE A 1 100 ? -10.877 -16.215 6.001   1.00 0.00 ? 100 ILE A O    5  
ATOM 7455  C CB   . ILE A 1 100 ? -12.017 -15.352 2.780   1.00 0.00 ? 100 ILE A CB   5  
ATOM 7456  C CG1  . ILE A 1 100 ? -13.045 -14.368 2.218   1.00 0.00 ? 100 ILE A CG1  5  
ATOM 7457  C CG2  . ILE A 1 100 ? -12.591 -16.762 2.924   1.00 0.00 ? 100 ILE A CG2  5  
ATOM 7458  C CD1  . ILE A 1 100 ? -12.406 -13.434 1.189   1.00 0.00 ? 100 ILE A CD1  5  
ATOM 7459  H H    . ILE A 1 100 ? -10.083 -13.653 3.093   1.00 0.00 ? 100 ILE A H    5  
ATOM 7460  H HA   . ILE A 1 100 ? -12.298 -14.586 4.742   1.00 0.00 ? 100 ILE A HA   5  
ATOM 7461  H HB   . ILE A 1 100 ? -11.200 -15.409 2.060   1.00 0.00 ? 100 ILE A HB   5  
ATOM 7462  H HG12 . ILE A 1 100 ? -13.865 -14.919 1.755   1.00 0.00 ? 100 ILE A HG12 5  
ATOM 7463  H HG13 . ILE A 1 100 ? -13.475 -13.782 3.030   1.00 0.00 ? 100 ILE A HG13 5  
ATOM 7464  H HG21 . ILE A 1 100 ? -13.644 -16.757 2.640   1.00 0.00 ? 100 ILE A HG21 5  
ATOM 7465  H HG22 . ILE A 1 100 ? -12.044 -17.446 2.275   1.00 0.00 ? 100 ILE A HG22 5  
ATOM 7466  H HG23 . ILE A 1 100 ? -12.496 -17.089 3.959   1.00 0.00 ? 100 ILE A HG23 5  
ATOM 7467  H HD11 . ILE A 1 100 ? -12.868 -13.595 0.215   1.00 0.00 ? 100 ILE A HD11 5  
ATOM 7468  H HD12 . ILE A 1 100 ? -12.556 -12.399 1.496   1.00 0.00 ? 100 ILE A HD12 5  
ATOM 7469  H HD13 . ILE A 1 100 ? -11.338 -13.642 1.124   1.00 0.00 ? 100 ILE A HD13 5  
ATOM 7470  N N    . TYR A 1 101 ? -9.590  -16.384 4.149   1.00 0.00 ? 101 TYR A N    5  
ATOM 7471  C CA   . TYR A 1 101 ? -8.700  -17.380 4.722   1.00 0.00 ? 101 TYR A CA   5  
ATOM 7472  C C    . TYR A 1 101 ? -7.431  -16.728 5.274   1.00 0.00 ? 101 TYR A C    5  
ATOM 7473  O O    . TYR A 1 101 ? -7.391  -15.516 5.482   1.00 0.00 ? 101 TYR A O    5  
ATOM 7474  C CB   . TYR A 1 101 ? -8.321  -18.317 3.574   1.00 0.00 ? 101 TYR A CB   5  
ATOM 7475  C CG   . TYR A 1 101 ? -7.226  -19.325 3.930   1.00 0.00 ? 101 TYR A CG   5  
ATOM 7476  C CD1  . TYR A 1 101 ? -5.910  -18.917 4.005   1.00 0.00 ? 101 TYR A CD1  5  
ATOM 7477  C CD2  . TYR A 1 101 ? -7.555  -20.643 4.177   1.00 0.00 ? 101 TYR A CD2  5  
ATOM 7478  C CE1  . TYR A 1 101 ? -4.880  -19.866 4.340   1.00 0.00 ? 101 TYR A CE1  5  
ATOM 7479  C CE2  . TYR A 1 101 ? -6.525  -21.592 4.512   1.00 0.00 ? 101 TYR A CE2  5  
ATOM 7480  C CZ   . TYR A 1 101 ? -5.238  -21.156 4.576   1.00 0.00 ? 101 TYR A CZ   5  
ATOM 7481  O OH   . TYR A 1 101 ? -4.266  -22.053 4.893   1.00 0.00 ? 101 TYR A OH   5  
ATOM 7482  H H    . TYR A 1 101 ? -9.374  -16.115 3.210   1.00 0.00 ? 101 TYR A H    5  
ATOM 7483  H HA   . TYR A 1 101 ? -9.230  -17.874 5.537   1.00 0.00 ? 101 TYR A HA   5  
ATOM 7484  H HB2  . TYR A 1 101 ? -9.209  -18.860 3.252   1.00 0.00 ? 101 TYR A HB2  5  
ATOM 7485  H HB3  . TYR A 1 101 ? -7.988  -17.719 2.726   1.00 0.00 ? 101 TYR A HB3  5  
ATOM 7486  H HD1  . TYR A 1 101 ? -5.650  -17.877 3.810   1.00 0.00 ? 101 TYR A HD1  5  
ATOM 7487  H HD2  . TYR A 1 101 ? -8.595  -20.965 4.118   1.00 0.00 ? 101 TYR A HD2  5  
ATOM 7488  H HE1  . TYR A 1 101 ? -3.836  -19.557 4.402   1.00 0.00 ? 101 TYR A HE1  5  
ATOM 7489  H HE2  . TYR A 1 101 ? -6.771  -22.635 4.709   1.00 0.00 ? 101 TYR A HE2  5  
ATOM 7490  H HH   . TYR A 1 101 ? -4.355  -22.331 5.849   1.00 0.00 ? 101 TYR A HH   5  
ATOM 7491  N N    . GLY A 1 1   ? 2.739   -15.359 22.450  1.00 0.00 ? 1   GLY A N    6  
ATOM 7492  C CA   . GLY A 1 1   ? 3.015   -16.485 21.574  1.00 0.00 ? 1   GLY A CA   6  
ATOM 7493  C C    . GLY A 1 1   ? 3.917   -16.067 20.412  1.00 0.00 ? 1   GLY A C    6  
ATOM 7494  O O    . GLY A 1 1   ? 4.751   -15.174 20.558  1.00 0.00 ? 1   GLY A O    6  
ATOM 7495  H H1   . GLY A 1 1   ? 3.259   -15.352 23.305  1.00 0.00 ? 1   GLY A H1   6  
ATOM 7496  H HA2  . GLY A 1 1   ? 3.493   -17.284 22.142  1.00 0.00 ? 1   GLY A HA2  6  
ATOM 7497  H HA3  . GLY A 1 1   ? 2.078   -16.886 21.186  1.00 0.00 ? 1   GLY A HA3  6  
ATOM 7498  N N    . PRO A 1 2   ? 3.716   -16.751 19.253  1.00 0.00 ? 2   PRO A N    6  
ATOM 7499  C CA   . PRO A 1 2   ? 4.502   -16.460 18.066  1.00 0.00 ? 2   PRO A CA   6  
ATOM 7500  C C    . PRO A 1 2   ? 4.047   -15.153 17.414  1.00 0.00 ? 2   PRO A C    6  
ATOM 7501  O O    . PRO A 1 2   ? 2.934   -15.067 16.897  1.00 0.00 ? 2   PRO A O    6  
ATOM 7502  C CB   . PRO A 1 2   ? 4.315   -17.670 17.165  1.00 0.00 ? 2   PRO A CB   6  
ATOM 7503  C CG   . PRO A 1 2   ? 3.071   -18.380 17.672  1.00 0.00 ? 2   PRO A CG   6  
ATOM 7504  C CD   . PRO A 1 2   ? 2.738   -17.815 19.043  1.00 0.00 ? 2   PRO A CD   6  
ATOM 7505  H HA   . PRO A 1 2   ? 5.462   -16.324 18.310  1.00 0.00 ? 2   PRO A HA   6  
ATOM 7506  H HB2  . PRO A 1 2   ? 4.196   -17.367 16.125  1.00 0.00 ? 2   PRO A HB2  6  
ATOM 7507  H HB3  . PRO A 1 2   ? 5.184   -18.326 17.207  1.00 0.00 ? 2   PRO A HB3  6  
ATOM 7508  H HG2  . PRO A 1 2   ? 2.238   -18.228 16.985  1.00 0.00 ? 2   PRO A HG2  6  
ATOM 7509  H HG3  . PRO A 1 2   ? 3.243   -19.454 17.733  1.00 0.00 ? 2   PRO A HG3  6  
ATOM 7510  H HD2  . PRO A 1 2   ? 1.720   -17.429 19.076  1.00 0.00 ? 2   PRO A HD2  6  
ATOM 7511  H HD3  . PRO A 1 2   ? 2.814   -18.580 19.816  1.00 0.00 ? 2   PRO A HD3  6  
ATOM 7512  N N    . LEU A 1 3   ? 4.931   -14.167 17.460  1.00 0.00 ? 3   LEU A N    6  
ATOM 7513  C CA   . LEU A 1 3   ? 4.635   -12.868 16.881  1.00 0.00 ? 3   LEU A CA   6  
ATOM 7514  C C    . LEU A 1 3   ? 5.230   -12.795 15.473  1.00 0.00 ? 3   LEU A C    6  
ATOM 7515  O O    . LEU A 1 3   ? 6.423   -12.544 15.312  1.00 0.00 ? 3   LEU A O    6  
ATOM 7516  C CB   . LEU A 1 3   ? 5.108   -11.747 17.808  1.00 0.00 ? 3   LEU A CB   6  
ATOM 7517  C CG   . LEU A 1 3   ? 4.037   -11.116 18.699  1.00 0.00 ? 3   LEU A CG   6  
ATOM 7518  C CD1  . LEU A 1 3   ? 3.000   -10.365 17.862  1.00 0.00 ? 3   LEU A CD1  6  
ATOM 7519  C CD2  . LEU A 1 3   ? 3.390   -12.165 19.606  1.00 0.00 ? 3   LEU A CD2  6  
ATOM 7520  H H    . LEU A 1 3   ? 5.834   -14.245 17.883  1.00 0.00 ? 3   LEU A H    6  
ATOM 7521  H HA   . LEU A 1 3   ? 3.551   -12.785 16.802  1.00 0.00 ? 3   LEU A HA   6  
ATOM 7522  H HB2  . LEU A 1 3   ? 5.899   -12.140 18.447  1.00 0.00 ? 3   LEU A HB2  6  
ATOM 7523  H HB3  . LEU A 1 3   ? 5.554   -10.961 17.197  1.00 0.00 ? 3   LEU A HB3  6  
ATOM 7524  H HG   . LEU A 1 3   ? 4.519   -10.384 19.347  1.00 0.00 ? 3   LEU A HG   6  
ATOM 7525  H HD11 . LEU A 1 3   ? 3.241   -9.302  17.852  1.00 0.00 ? 3   LEU A HD11 6  
ATOM 7526  H HD12 . LEU A 1 3   ? 3.009   -10.749 16.841  1.00 0.00 ? 3   LEU A HD12 6  
ATOM 7527  H HD13 . LEU A 1 3   ? 2.010   -10.509 18.295  1.00 0.00 ? 3   LEU A HD13 6  
ATOM 7528  H HD21 . LEU A 1 3   ? 2.834   -11.666 20.400  1.00 0.00 ? 3   LEU A HD21 6  
ATOM 7529  H HD22 . LEU A 1 3   ? 2.711   -12.783 19.019  1.00 0.00 ? 3   LEU A HD22 6  
ATOM 7530  H HD23 . LEU A 1 3   ? 4.166   -12.793 20.045  1.00 0.00 ? 3   LEU A HD23 6  
ATOM 7531  N N    . GLY A 1 4   ? 4.370   -13.018 14.489  1.00 0.00 ? 4   GLY A N    6  
ATOM 7532  C CA   . GLY A 1 4   ? 4.796   -12.980 13.101  1.00 0.00 ? 4   GLY A CA   6  
ATOM 7533  C C    . GLY A 1 4   ? 3.800   -13.714 12.202  1.00 0.00 ? 4   GLY A C    6  
ATOM 7534  O O    . GLY A 1 4   ? 2.903   -13.097 11.629  1.00 0.00 ? 4   GLY A O    6  
ATOM 7535  H H    . GLY A 1 4   ? 3.401   -13.221 14.629  1.00 0.00 ? 4   GLY A H    6  
ATOM 7536  H HA2  . GLY A 1 4   ? 4.892   -11.944 12.774  1.00 0.00 ? 4   GLY A HA2  6  
ATOM 7537  H HA3  . GLY A 1 4   ? 5.781   -13.436 13.006  1.00 0.00 ? 4   GLY A HA3  6  
ATOM 7538  N N    . SER A 1 5   ? 3.990   -15.022 12.106  1.00 0.00 ? 5   SER A N    6  
ATOM 7539  C CA   . SER A 1 5   ? 3.119   -15.847 11.286  1.00 0.00 ? 5   SER A CA   6  
ATOM 7540  C C    . SER A 1 5   ? 3.160   -15.369 9.833   1.00 0.00 ? 5   SER A C    6  
ATOM 7541  O O    . SER A 1 5   ? 3.536   -14.229 9.562   1.00 0.00 ? 5   SER A O    6  
ATOM 7542  C CB   . SER A 1 5   ? 1.683   -15.824 11.812  1.00 0.00 ? 5   SER A CB   6  
ATOM 7543  O OG   . SER A 1 5   ? 0.867   -16.806 11.180  1.00 0.00 ? 5   SER A OG   6  
ATOM 7544  H H    . SER A 1 5   ? 4.722   -15.516 12.575  1.00 0.00 ? 5   SER A H    6  
ATOM 7545  H HA   . SER A 1 5   ? 3.519   -16.858 11.367  1.00 0.00 ? 5   SER A HA   6  
ATOM 7546  H HB2  . SER A 1 5   ? 1.688   -15.995 12.889  1.00 0.00 ? 5   SER A HB2  6  
ATOM 7547  H HB3  . SER A 1 5   ? 1.253   -14.835 11.649  1.00 0.00 ? 5   SER A HB3  6  
ATOM 7548  H HG   . SER A 1 5   ? -0.065  -16.459 11.074  1.00 0.00 ? 5   SER A HG   6  
ATOM 7549  N N    . LEU A 1 6   ? 2.768   -16.263 8.938   1.00 0.00 ? 6   LEU A N    6  
ATOM 7550  C CA   . LEU A 1 6   ? 2.755   -15.946 7.520   1.00 0.00 ? 6   LEU A CA   6  
ATOM 7551  C C    . LEU A 1 6   ? 1.891   -16.970 6.781   1.00 0.00 ? 6   LEU A C    6  
ATOM 7552  O O    . LEU A 1 6   ? 1.971   -18.167 7.054   1.00 0.00 ? 6   LEU A O    6  
ATOM 7553  C CB   . LEU A 1 6   ? 4.183   -15.842 6.981   1.00 0.00 ? 6   LEU A CB   6  
ATOM 7554  C CG   . LEU A 1 6   ? 4.721   -14.425 6.775   1.00 0.00 ? 6   LEU A CG   6  
ATOM 7555  C CD1  . LEU A 1 6   ? 5.782   -14.083 7.823   1.00 0.00 ? 6   LEU A CD1  6  
ATOM 7556  C CD2  . LEU A 1 6   ? 5.243   -14.239 5.349   1.00 0.00 ? 6   LEU A CD2  6  
ATOM 7557  H H    . LEU A 1 6   ? 2.463   -17.187 9.167   1.00 0.00 ? 6   LEU A H    6  
ATOM 7558  H HA   . LEU A 1 6   ? 2.296   -14.963 7.409   1.00 0.00 ? 6   LEU A HA   6  
ATOM 7559  H HB2  . LEU A 1 6   ? 4.848   -16.366 7.668   1.00 0.00 ? 6   LEU A HB2  6  
ATOM 7560  H HB3  . LEU A 1 6   ? 4.229   -16.369 6.028   1.00 0.00 ? 6   LEU A HB3  6  
ATOM 7561  H HG   . LEU A 1 6   ? 3.897   -13.724 6.910   1.00 0.00 ? 6   LEU A HG   6  
ATOM 7562  H HD11 . LEU A 1 6   ? 5.791   -14.853 8.594   1.00 0.00 ? 6   LEU A HD11 6  
ATOM 7563  H HD12 . LEU A 1 6   ? 6.761   -14.034 7.346   1.00 0.00 ? 6   LEU A HD12 6  
ATOM 7564  H HD13 . LEU A 1 6   ? 5.549   -13.119 8.275   1.00 0.00 ? 6   LEU A HD13 6  
ATOM 7565  H HD21 . LEU A 1 6   ? 4.524   -14.653 4.642   1.00 0.00 ? 6   LEU A HD21 6  
ATOM 7566  H HD22 . LEU A 1 6   ? 5.380   -13.176 5.148   1.00 0.00 ? 6   LEU A HD22 6  
ATOM 7567  H HD23 . LEU A 1 6   ? 6.197   -14.755 5.241   1.00 0.00 ? 6   LEU A HD23 6  
ATOM 7568  N N    . ARG A 1 7   ? 1.086   -16.463 5.859   1.00 0.00 ? 7   ARG A N    6  
ATOM 7569  C CA   . ARG A 1 7   ? 0.208   -17.319 5.079   1.00 0.00 ? 7   ARG A CA   6  
ATOM 7570  C C    . ARG A 1 7   ? 0.106   -16.804 3.642   1.00 0.00 ? 7   ARG A C    6  
ATOM 7571  O O    . ARG A 1 7   ? 0.684   -15.772 3.305   1.00 0.00 ? 7   ARG A O    6  
ATOM 7572  C CB   . ARG A 1 7   ? -1.192  -17.378 5.693   1.00 0.00 ? 7   ARG A CB   6  
ATOM 7573  C CG   . ARG A 1 7   ? -1.431  -18.722 6.384   1.00 0.00 ? 7   ARG A CG   6  
ATOM 7574  C CD   . ARG A 1 7   ? -2.897  -18.874 6.794   1.00 0.00 ? 7   ARG A CD   6  
ATOM 7575  N NE   . ARG A 1 7   ? -3.771  -18.736 5.608   1.00 0.00 ? 7   ARG A NE   6  
ATOM 7576  C CZ   . ARG A 1 7   ? -4.064  -19.740 4.769   1.00 0.00 ? 7   ARG A CZ   6  
ATOM 7577  N NH1  . ARG A 1 7   ? -3.554  -20.961 4.982   1.00 0.00 ? 7   ARG A NH1  6  
ATOM 7578  N NH2  . ARG A 1 7   ? -4.866  -19.523 3.718   1.00 0.00 ? 7   ARG A NH2  6  
ATOM 7579  H H    . ARG A 1 7   ? 1.027   -15.488 5.644   1.00 0.00 ? 7   ARG A H    6  
ATOM 7580  H HA   . ARG A 1 7   ? 0.677   -18.302 5.111   1.00 0.00 ? 7   ARG A HA   6  
ATOM 7581  H HB2  . ARG A 1 7   ? -1.312  -16.568 6.413   1.00 0.00 ? 7   ARG A HB2  6  
ATOM 7582  H HB3  . ARG A 1 7   ? -1.941  -17.227 4.915   1.00 0.00 ? 7   ARG A HB3  6  
ATOM 7583  H HG2  . ARG A 1 7   ? -1.150  -19.535 5.714   1.00 0.00 ? 7   ARG A HG2  6  
ATOM 7584  H HG3  . ARG A 1 7   ? -0.794  -18.800 7.265   1.00 0.00 ? 7   ARG A HG3  6  
ATOM 7585  H HD2  . ARG A 1 7   ? -3.054  -19.847 7.260   1.00 0.00 ? 7   ARG A HD2  6  
ATOM 7586  H HD3  . ARG A 1 7   ? -3.156  -18.120 7.536   1.00 0.00 ? 7   ARG A HD3  6  
ATOM 7587  H HE   . ARG A 1 7   ? -4.168  -17.838 5.420   1.00 0.00 ? 7   ARG A HE   6  
ATOM 7588  H HH11 . ARG A 1 7   ? -2.955  -21.123 5.766   1.00 0.00 ? 7   ARG A HH11 6  
ATOM 7589  H HH12 . ARG A 1 7   ? -3.773  -21.710 4.356   1.00 0.00 ? 7   ARG A HH12 6  
ATOM 7590  H HH21 . ARG A 1 7   ? -5.247  -18.612 3.559   1.00 0.00 ? 7   ARG A HH21 6  
ATOM 7591  H HH22 . ARG A 1 7   ? -5.085  -20.272 3.093   1.00 0.00 ? 7   ARG A HH22 6  
ATOM 7592  N N    . LYS A 1 8   ? -0.633  -17.549 2.832   1.00 0.00 ? 8   LYS A N    6  
ATOM 7593  C CA   . LYS A 1 8   ? -0.818  -17.181 1.438   1.00 0.00 ? 8   LYS A CA   6  
ATOM 7594  C C    . LYS A 1 8   ? -2.223  -16.605 1.250   1.00 0.00 ? 8   LYS A C    6  
ATOM 7595  O O    . LYS A 1 8   ? -3.188  -17.118 1.813   1.00 0.00 ? 8   LYS A O    6  
ATOM 7596  C CB   . LYS A 1 8   ? -0.513  -18.370 0.525   1.00 0.00 ? 8   LYS A CB   6  
ATOM 7597  C CG   . LYS A 1 8   ? 0.703   -18.086 -0.358  1.00 0.00 ? 8   LYS A CG   6  
ATOM 7598  C CD   . LYS A 1 8   ? 2.005   -18.285 0.420   1.00 0.00 ? 8   LYS A CD   6  
ATOM 7599  C CE   . LYS A 1 8   ? 2.404   -17.006 1.158   1.00 0.00 ? 8   LYS A CE   6  
ATOM 7600  N NZ   . LYS A 1 8   ? 3.862   -16.776 1.046   1.00 0.00 ? 8   LYS A NZ   6  
ATOM 7601  H H    . LYS A 1 8   ? -1.099  -18.387 3.113   1.00 0.00 ? 8   LYS A H    6  
ATOM 7602  H HA   . LYS A 1 8   ? -0.091  -16.403 1.207   1.00 0.00 ? 8   LYS A HA   6  
ATOM 7603  H HB2  . LYS A 1 8   ? -0.329  -19.259 1.129   1.00 0.00 ? 8   LYS A HB2  6  
ATOM 7604  H HB3  . LYS A 1 8   ? -1.380  -18.585 -0.100  1.00 0.00 ? 8   LYS A HB3  6  
ATOM 7605  H HG2  . LYS A 1 8   ? 0.689   -18.746 -1.226  1.00 0.00 ? 8   LYS A HG2  6  
ATOM 7606  H HG3  . LYS A 1 8   ? 0.652   -17.064 -0.735  1.00 0.00 ? 8   LYS A HG3  6  
ATOM 7607  H HD2  . LYS A 1 8   ? 1.885   -19.099 1.135   1.00 0.00 ? 8   LYS A HD2  6  
ATOM 7608  H HD3  . LYS A 1 8   ? 2.801   -18.578 -0.265  1.00 0.00 ? 8   LYS A HD3  6  
ATOM 7609  H HE2  . LYS A 1 8   ? 1.863   -16.156 0.742   1.00 0.00 ? 8   LYS A HE2  6  
ATOM 7610  H HE3  . LYS A 1 8   ? 2.121   -17.081 2.208   1.00 0.00 ? 8   LYS A HE3  6  
ATOM 7611  H HZ1  . LYS A 1 8   ? 4.247   -16.627 1.957   1.00 0.00 ? 8   LYS A HZ1  6  
ATOM 7612  H HZ2  . LYS A 1 8   ? 4.294   -17.575 0.628   1.00 0.00 ? 8   LYS A HZ2  6  
ATOM 7613  H HZ3  . LYS A 1 8   ? 4.029   -15.971 0.477   1.00 0.00 ? 8   LYS A HZ3  6  
ATOM 7614  N N    . GLU A 1 9   ? -2.292  -15.546 0.456   1.00 0.00 ? 9   GLU A N    6  
ATOM 7615  C CA   . GLU A 1 9   ? -3.562  -14.895 0.186   1.00 0.00 ? 9   GLU A CA   6  
ATOM 7616  C C    . GLU A 1 9   ? -3.331  -13.533 -0.472  1.00 0.00 ? 9   GLU A C    6  
ATOM 7617  O O    . GLU A 1 9   ? -3.854  -13.265 -1.553  1.00 0.00 ? 9   GLU A O    6  
ATOM 7618  C CB   . GLU A 1 9   ? -4.388  -14.752 1.466   1.00 0.00 ? 9   GLU A CB   6  
ATOM 7619  C CG   . GLU A 1 9   ? -5.647  -15.620 1.406   1.00 0.00 ? 9   GLU A CG   6  
ATOM 7620  C CD   . GLU A 1 9   ? -6.441  -15.346 0.128   1.00 0.00 ? 9   GLU A CD   6  
ATOM 7621  O OE1  . GLU A 1 9   ? -6.831  -14.173 -0.058  1.00 0.00 ? 9   GLU A OE1  6  
ATOM 7622  O OE2  . GLU A 1 9   ? -6.641  -16.316 -0.635  1.00 0.00 ? 9   GLU A OE2  6  
ATOM 7623  H H    . GLU A 1 9   ? -1.501  -15.135 0.002   1.00 0.00 ? 9   GLU A H    6  
ATOM 7624  H HA   . GLU A 1 9   ? -4.086  -15.556 -0.505  1.00 0.00 ? 9   GLU A HA   6  
ATOM 7625  H HB2  . GLU A 1 9   ? -3.784  -15.040 2.327   1.00 0.00 ? 9   GLU A HB2  6  
ATOM 7626  H HB3  . GLU A 1 9   ? -4.668  -13.709 1.608   1.00 0.00 ? 9   GLU A HB3  6  
ATOM 7627  H HG2  . GLU A 1 9   ? -5.369  -16.674 1.447   1.00 0.00 ? 9   GLU A HG2  6  
ATOM 7628  H HG3  . GLU A 1 9   ? -6.272  -15.422 2.277   1.00 0.00 ? 9   GLU A HG3  6  
ATOM 7629  N N    . PRO A 1 10  ? -2.527  -12.687 0.225   1.00 0.00 ? 10  PRO A N    6  
ATOM 7630  C CA   . PRO A 1 10  ? -2.220  -11.359 -0.280  1.00 0.00 ? 10  PRO A CA   6  
ATOM 7631  C C    . PRO A 1 10  ? -1.210  -11.429 -1.427  1.00 0.00 ? 10  PRO A C    6  
ATOM 7632  O O    . PRO A 1 10  ? -0.844  -12.516 -1.871  1.00 0.00 ? 10  PRO A O    6  
ATOM 7633  C CB   . PRO A 1 10  ? -1.700  -10.591 0.924   1.00 0.00 ? 10  PRO A CB   6  
ATOM 7634  C CG   . PRO A 1 10  ? -1.297  -11.641 1.947   1.00 0.00 ? 10  PRO A CG   6  
ATOM 7635  C CD   . PRO A 1 10  ? -1.891  -12.970 1.509   1.00 0.00 ? 10  PRO A CD   6  
ATOM 7636  H HA   . PRO A 1 10  ? -3.041  -10.936 -0.663  1.00 0.00 ? 10  PRO A HA   6  
ATOM 7637  H HB2  . PRO A 1 10  ? -0.850  -9.966  0.651   1.00 0.00 ? 10  PRO A HB2  6  
ATOM 7638  H HB3  . PRO A 1 10  ? -2.467  -9.928  1.326   1.00 0.00 ? 10  PRO A HB3  6  
ATOM 7639  H HG2  . PRO A 1 10  ? -0.211  -11.711 2.014   1.00 0.00 ? 10  PRO A HG2  6  
ATOM 7640  H HG3  . PRO A 1 10  ? -1.661  -11.369 2.937   1.00 0.00 ? 10  PRO A HG3  6  
ATOM 7641  H HD2  . PRO A 1 10  ? -1.120  -13.734 1.408   1.00 0.00 ? 10  PRO A HD2  6  
ATOM 7642  H HD3  . PRO A 1 10  ? -2.613  -13.340 2.236   1.00 0.00 ? 10  PRO A HD3  6  
ATOM 7643  N N    . GLU A 1 11  ? -0.789  -10.255 -1.873  1.00 0.00 ? 11  GLU A N    6  
ATOM 7644  C CA   . GLU A 1 11  ? 0.172   -10.169 -2.960  1.00 0.00 ? 11  GLU A CA   6  
ATOM 7645  C C    . GLU A 1 11  ? 0.083   -8.801  -3.640  1.00 0.00 ? 11  GLU A C    6  
ATOM 7646  O O    . GLU A 1 11  ? 0.758   -7.857  -3.234  1.00 0.00 ? 11  GLU A O    6  
ATOM 7647  C CB   . GLU A 1 11  ? -0.041  -11.298 -3.970  1.00 0.00 ? 11  GLU A CB   6  
ATOM 7648  C CG   . GLU A 1 11  ? 0.951   -12.439 -3.734  1.00 0.00 ? 11  GLU A CG   6  
ATOM 7649  C CD   . GLU A 1 11  ? 1.843   -12.653 -4.959  1.00 0.00 ? 11  GLU A CD   6  
ATOM 7650  O OE1  . GLU A 1 11  ? 2.478   -11.662 -5.379  1.00 0.00 ? 11  GLU A OE1  6  
ATOM 7651  O OE2  . GLU A 1 11  ? 1.868   -13.803 -5.449  1.00 0.00 ? 11  GLU A OE2  6  
ATOM 7652  H H    . GLU A 1 11  ? -1.092  -9.375  -1.507  1.00 0.00 ? 11  GLU A H    6  
ATOM 7653  H HA   . GLU A 1 11  ? 1.149   -10.287 -2.493  1.00 0.00 ? 11  GLU A HA   6  
ATOM 7654  H HB2  . GLU A 1 11  ? -1.060  -11.676 -3.890  1.00 0.00 ? 11  GLU A HB2  6  
ATOM 7655  H HB3  . GLU A 1 11  ? 0.078   -10.912 -4.983  1.00 0.00 ? 11  GLU A HB3  6  
ATOM 7656  H HG2  . GLU A 1 11  ? 1.570   -12.214 -2.865  1.00 0.00 ? 11  GLU A HG2  6  
ATOM 7657  H HG3  . GLU A 1 11  ? 0.408   -13.357 -3.510  1.00 0.00 ? 11  GLU A HG3  6  
ATOM 7658  N N    . ILE A 1 12  ? -0.756  -8.738  -4.664  1.00 0.00 ? 12  ILE A N    6  
ATOM 7659  C CA   . ILE A 1 12  ? -0.942  -7.502  -5.404  1.00 0.00 ? 12  ILE A CA   6  
ATOM 7660  C C    . ILE A 1 12  ? -2.383  -7.018  -5.226  1.00 0.00 ? 12  ILE A C    6  
ATOM 7661  O O    . ILE A 1 12  ? -3.227  -7.748  -4.710  1.00 0.00 ? 12  ILE A O    6  
ATOM 7662  C CB   . ILE A 1 12  ? -0.532  -7.686  -6.867  1.00 0.00 ? 12  ILE A CB   6  
ATOM 7663  C CG1  . ILE A 1 12  ? -1.621  -8.418  -7.654  1.00 0.00 ? 12  ILE A CG1  6  
ATOM 7664  C CG2  . ILE A 1 12  ? 0.823   -8.389  -6.972  1.00 0.00 ? 12  ILE A CG2  6  
ATOM 7665  C CD1  . ILE A 1 12  ? -1.692  -9.892  -7.249  1.00 0.00 ? 12  ILE A CD1  6  
ATOM 7666  H H    . ILE A 1 12  ? -1.302  -9.511  -4.988  1.00 0.00 ? 12  ILE A H    6  
ATOM 7667  H HA   . ILE A 1 12  ? -0.272  -6.759  -4.972  1.00 0.00 ? 12  ILE A HA   6  
ATOM 7668  H HB   . ILE A 1 12  ? -0.418  -6.699  -7.316  1.00 0.00 ? 12  ILE A HB   6  
ATOM 7669  H HG12 . ILE A 1 12  ? -2.585  -7.942  -7.477  1.00 0.00 ? 12  ILE A HG12 6  
ATOM 7670  H HG13 . ILE A 1 12  ? -1.418  -8.340  -8.722  1.00 0.00 ? 12  ILE A HG13 6  
ATOM 7671  H HG21 . ILE A 1 12  ? 1.085   -8.818  -6.005  1.00 0.00 ? 12  ILE A HG21 6  
ATOM 7672  H HG22 . ILE A 1 12  ? 0.763   -9.183  -7.717  1.00 0.00 ? 12  ILE A HG22 6  
ATOM 7673  H HG23 . ILE A 1 12  ? 1.584   -7.668  -7.269  1.00 0.00 ? 12  ILE A HG23 6  
ATOM 7674  H HD11 . ILE A 1 12  ? -2.542  -10.045 -6.583  1.00 0.00 ? 12  ILE A HD11 6  
ATOM 7675  H HD12 . ILE A 1 12  ? -1.814  -10.508 -8.140  1.00 0.00 ? 12  ILE A HD12 6  
ATOM 7676  H HD13 . ILE A 1 12  ? -0.773  -10.173 -6.736  1.00 0.00 ? 12  ILE A HD13 6  
ATOM 7677  N N    . ILE A 1 13  ? -2.619  -5.789  -5.663  1.00 0.00 ? 13  ILE A N    6  
ATOM 7678  C CA   . ILE A 1 13  ? -3.942  -5.199  -5.558  1.00 0.00 ? 13  ILE A CA   6  
ATOM 7679  C C    . ILE A 1 13  ? -4.076  -4.073  -6.585  1.00 0.00 ? 13  ILE A C    6  
ATOM 7680  O O    . ILE A 1 13  ? -3.228  -3.185  -6.652  1.00 0.00 ? 13  ILE A O    6  
ATOM 7681  C CB   . ILE A 1 13  ? -4.219  -4.755  -4.120  1.00 0.00 ? 13  ILE A CB   6  
ATOM 7682  C CG1  . ILE A 1 13  ? -3.012  -4.021  -3.531  1.00 0.00 ? 13  ILE A CG1  6  
ATOM 7683  C CG2  . ILE A 1 13  ? -4.647  -5.941  -3.253  1.00 0.00 ? 13  ILE A CG2  6  
ATOM 7684  C CD1  . ILE A 1 13  ? -3.434  -3.116  -2.371  1.00 0.00 ? 13  ILE A CD1  6  
ATOM 7685  H H    . ILE A 1 13  ? -1.926  -5.202  -6.081  1.00 0.00 ? 13  ILE A H    6  
ATOM 7686  H HA   . ILE A 1 13  ? -4.667  -5.976  -5.800  1.00 0.00 ? 13  ILE A HA   6  
ATOM 7687  H HB   . ILE A 1 13  ? -5.049  -4.050  -4.134  1.00 0.00 ? 13  ILE A HB   6  
ATOM 7688  H HG12 . ILE A 1 13  ? -2.276  -4.746  -3.182  1.00 0.00 ? 13  ILE A HG12 6  
ATOM 7689  H HG13 . ILE A 1 13  ? -2.531  -3.425  -4.306  1.00 0.00 ? 13  ILE A HG13 6  
ATOM 7690  H HG21 . ILE A 1 13  ? -5.185  -5.576  -2.378  1.00 0.00 ? 13  ILE A HG21 6  
ATOM 7691  H HG22 . ILE A 1 13  ? -5.297  -6.598  -3.832  1.00 0.00 ? 13  ILE A HG22 6  
ATOM 7692  H HG23 . ILE A 1 13  ? -3.764  -6.494  -2.932  1.00 0.00 ? 13  ILE A HG23 6  
ATOM 7693  H HD11 . ILE A 1 13  ? -2.713  -2.305  -2.263  1.00 0.00 ? 13  ILE A HD11 6  
ATOM 7694  H HD12 . ILE A 1 13  ? -4.421  -2.701  -2.575  1.00 0.00 ? 13  ILE A HD12 6  
ATOM 7695  H HD13 . ILE A 1 13  ? -3.467  -3.698  -1.450  1.00 0.00 ? 13  ILE A HD13 6  
ATOM 7696  N N    . THR A 1 14  ? -5.149  -4.146  -7.360  1.00 0.00 ? 14  THR A N    6  
ATOM 7697  C CA   . THR A 1 14  ? -5.405  -3.145  -8.380  1.00 0.00 ? 14  THR A CA   6  
ATOM 7698  C C    . THR A 1 14  ? -6.907  -2.875  -8.498  1.00 0.00 ? 14  THR A C    6  
ATOM 7699  O O    . THR A 1 14  ? -7.689  -3.793  -8.740  1.00 0.00 ? 14  THR A O    6  
ATOM 7700  C CB   . THR A 1 14  ? -4.770  -3.627  -9.686  1.00 0.00 ? 14  THR A CB   6  
ATOM 7701  O OG1  . THR A 1 14  ? -5.031  -2.572  -10.609 1.00 0.00 ? 14  THR A OG1  6  
ATOM 7702  C CG2  . THR A 1 14  ? -5.500  -4.832  -10.282 1.00 0.00 ? 14  THR A CG2  6  
ATOM 7703  H H    . THR A 1 14  ? -5.834  -4.872  -7.298  1.00 0.00 ? 14  THR A H    6  
ATOM 7704  H HA   . THR A 1 14  ? -4.936  -2.211  -8.070  1.00 0.00 ? 14  THR A HA   6  
ATOM 7705  H HB   . THR A 1 14  ? -3.711  -3.842  -9.547  1.00 0.00 ? 14  THR A HB   6  
ATOM 7706  H HG1  . THR A 1 14  ? -6.016  -2.480  -10.753 1.00 0.00 ? 14  THR A HG1  6  
ATOM 7707  H HG21 . THR A 1 14  ? -6.302  -4.485  -10.934 1.00 0.00 ? 14  THR A HG21 6  
ATOM 7708  H HG22 . THR A 1 14  ? -4.797  -5.434  -10.858 1.00 0.00 ? 14  THR A HG22 6  
ATOM 7709  H HG23 . THR A 1 14  ? -5.922  -5.435  -9.478  1.00 0.00 ? 14  THR A HG23 6  
ATOM 7710  N N    . VAL A 1 15  ? -7.264  -1.612  -8.321  1.00 0.00 ? 15  VAL A N    6  
ATOM 7711  C CA   . VAL A 1 15  ? -8.658  -1.210  -8.404  1.00 0.00 ? 15  VAL A CA   6  
ATOM 7712  C C    . VAL A 1 15  ? -8.740  0.231   -8.912  1.00 0.00 ? 15  VAL A C    6  
ATOM 7713  O O    . VAL A 1 15  ? -7.866  1.046   -8.619  1.00 0.00 ? 15  VAL A O    6  
ATOM 7714  C CB   . VAL A 1 15  ? -9.341  -1.406  -7.049  1.00 0.00 ? 15  VAL A CB   6  
ATOM 7715  C CG1  . VAL A 1 15  ? -9.399  -2.888  -6.674  1.00 0.00 ? 15  VAL A CG1  6  
ATOM 7716  C CG2  . VAL A 1 15  ? -8.642  -0.591  -5.959  1.00 0.00 ? 15  VAL A CG2  6  
ATOM 7717  H H    . VAL A 1 15  ? -6.622  -0.871  -8.124  1.00 0.00 ? 15  VAL A H    6  
ATOM 7718  H HA   . VAL A 1 15  ? -9.147  -1.864  -9.126  1.00 0.00 ? 15  VAL A HA   6  
ATOM 7719  H HB   . VAL A 1 15  ? -10.365 -1.042  -7.134  1.00 0.00 ? 15  VAL A HB   6  
ATOM 7720  H HG11 . VAL A 1 15  ? -8.389  -3.255  -6.489  1.00 0.00 ? 15  VAL A HG11 6  
ATOM 7721  H HG12 . VAL A 1 15  ? -10.001 -3.012  -5.773  1.00 0.00 ? 15  VAL A HG12 6  
ATOM 7722  H HG13 . VAL A 1 15  ? -9.847  -3.453  -7.491  1.00 0.00 ? 15  VAL A HG13 6  
ATOM 7723  H HG21 . VAL A 1 15  ? -7.995  0.155   -6.422  1.00 0.00 ? 15  VAL A HG21 6  
ATOM 7724  H HG22 . VAL A 1 15  ? -9.389  -0.091  -5.343  1.00 0.00 ? 15  VAL A HG22 6  
ATOM 7725  H HG23 . VAL A 1 15  ? -8.042  -1.255  -5.337  1.00 0.00 ? 15  VAL A HG23 6  
ATOM 7726  N N    . THR A 1 16  ? -9.797  0.501   -9.663  1.00 0.00 ? 16  THR A N    6  
ATOM 7727  C CA   . THR A 1 16  ? -10.003 1.830   -10.214 1.00 0.00 ? 16  THR A CA   6  
ATOM 7728  C C    . THR A 1 16  ? -10.480 2.791   -9.124  1.00 0.00 ? 16  THR A C    6  
ATOM 7729  O O    . THR A 1 16  ? -11.574 2.632   -8.585  1.00 0.00 ? 16  THR A O    6  
ATOM 7730  C CB   . THR A 1 16  ? -10.979 1.709   -11.386 1.00 0.00 ? 16  THR A CB   6  
ATOM 7731  O OG1  . THR A 1 16  ? -12.037 0.902   -10.876 1.00 0.00 ? 16  THR A OG1  6  
ATOM 7732  C CG2  . THR A 1 16  ? -10.407 0.886   -12.542 1.00 0.00 ? 16  THR A CG2  6  
ATOM 7733  H H    . THR A 1 16  ? -10.502 -0.167  -9.897  1.00 0.00 ? 16  THR A H    6  
ATOM 7734  H HA   . THR A 1 16  ? -9.046  2.205   -10.575 1.00 0.00 ? 16  THR A HA   6  
ATOM 7735  H HB   . THR A 1 16  ? -11.299 2.693   -11.730 1.00 0.00 ? 16  THR A HB   6  
ATOM 7736  H HG1  . THR A 1 16  ? -12.591 1.430   -10.233 1.00 0.00 ? 16  THR A HG1  6  
ATOM 7737  H HG21 . THR A 1 16  ? -11.208 0.320   -13.017 1.00 0.00 ? 16  THR A HG21 6  
ATOM 7738  H HG22 . THR A 1 16  ? -9.952  1.554   -13.274 1.00 0.00 ? 16  THR A HG22 6  
ATOM 7739  H HG23 . THR A 1 16  ? -9.653  0.198   -12.160 1.00 0.00 ? 16  THR A HG23 6  
ATOM 7740  N N    . LEU A 1 17  ? -9.635  3.768   -8.831  1.00 0.00 ? 17  LEU A N    6  
ATOM 7741  C CA   . LEU A 1 17  ? -9.956  4.756   -7.814  1.00 0.00 ? 17  LEU A CA   6  
ATOM 7742  C C    . LEU A 1 17  ? -11.232 5.499   -8.215  1.00 0.00 ? 17  LEU A C    6  
ATOM 7743  O O    . LEU A 1 17  ? -12.094 4.938   -8.890  1.00 0.00 ? 17  LEU A O    6  
ATOM 7744  C CB   . LEU A 1 17  ? -8.760  5.677   -7.565  1.00 0.00 ? 17  LEU A CB   6  
ATOM 7745  C CG   . LEU A 1 17  ? -8.679  6.311   -6.175  1.00 0.00 ? 17  LEU A CG   6  
ATOM 7746  C CD1  . LEU A 1 17  ? -8.638  7.837   -6.269  1.00 0.00 ? 17  LEU A CD1  6  
ATOM 7747  C CD2  . LEU A 1 17  ? -9.821  5.821   -5.282  1.00 0.00 ? 17  LEU A CD2  6  
ATOM 7748  H H    . LEU A 1 17  ? -8.746  3.891   -9.273  1.00 0.00 ? 17  LEU A H    6  
ATOM 7749  H HA   . LEU A 1 17  ? -10.147 4.218   -6.885  1.00 0.00 ? 17  LEU A HA   6  
ATOM 7750  H HB2  . LEU A 1 17  ? -7.846  5.109   -7.738  1.00 0.00 ? 17  LEU A HB2  6  
ATOM 7751  H HB3  . LEU A 1 17  ? -8.782  6.477   -8.306  1.00 0.00 ? 17  LEU A HB3  6  
ATOM 7752  H HG   . LEU A 1 17  ? -7.746  5.992   -5.708  1.00 0.00 ? 17  LEU A HG   6  
ATOM 7753  H HD11 . LEU A 1 17  ? -7.853  8.221   -5.618  1.00 0.00 ? 17  LEU A HD11 6  
ATOM 7754  H HD12 . LEU A 1 17  ? -8.434  8.132   -7.298  1.00 0.00 ? 17  LEU A HD12 6  
ATOM 7755  H HD13 . LEU A 1 17  ? -9.600  8.246   -5.958  1.00 0.00 ? 17  LEU A HD13 6  
ATOM 7756  H HD21 . LEU A 1 17  ? -9.934  6.497   -4.434  1.00 0.00 ? 17  LEU A HD21 6  
ATOM 7757  H HD22 . LEU A 1 17  ? -10.747 5.800   -5.856  1.00 0.00 ? 17  LEU A HD22 6  
ATOM 7758  H HD23 . LEU A 1 17  ? -9.594  4.818   -4.920  1.00 0.00 ? 17  LEU A HD23 6  
ATOM 7759  N N    . LYS A 1 18  ? -11.311 6.749   -7.784  1.00 0.00 ? 18  LYS A N    6  
ATOM 7760  C CA   . LYS A 1 18  ? -12.467 7.574   -8.090  1.00 0.00 ? 18  LYS A CA   6  
ATOM 7761  C C    . LYS A 1 18  ? -13.711 6.961   -7.444  1.00 0.00 ? 18  LYS A C    6  
ATOM 7762  O O    . LYS A 1 18  ? -14.831 7.398   -7.707  1.00 0.00 ? 18  LYS A O    6  
ATOM 7763  C CB   . LYS A 1 18  ? -12.595 7.778   -9.601  1.00 0.00 ? 18  LYS A CB   6  
ATOM 7764  C CG   . LYS A 1 18  ? -12.542 9.264   -9.960  1.00 0.00 ? 18  LYS A CG   6  
ATOM 7765  C CD   . LYS A 1 18  ? -13.617 9.617   -10.990 1.00 0.00 ? 18  LYS A CD   6  
ATOM 7766  C CE   . LYS A 1 18  ? -14.816 10.292  -10.321 1.00 0.00 ? 18  LYS A CE   6  
ATOM 7767  N NZ   . LYS A 1 18  ? -15.816 9.282   -9.907  1.00 0.00 ? 18  LYS A NZ   6  
ATOM 7768  H H    . LYS A 1 18  ? -10.605 7.197   -7.236  1.00 0.00 ? 18  LYS A H    6  
ATOM 7769  H HA   . LYS A 1 18  ? -12.295 8.555   -7.646  1.00 0.00 ? 18  LYS A HA   6  
ATOM 7770  H HB2  . LYS A 1 18  ? -11.792 7.247   -10.113 1.00 0.00 ? 18  LYS A HB2  6  
ATOM 7771  H HB3  . LYS A 1 18  ? -13.534 7.348   -9.951  1.00 0.00 ? 18  LYS A HB3  6  
ATOM 7772  H HG2  . LYS A 1 18  ? -12.683 9.864   -9.061  1.00 0.00 ? 18  LYS A HG2  6  
ATOM 7773  H HG3  . LYS A 1 18  ? -11.558 9.511   -10.357 1.00 0.00 ? 18  LYS A HG3  6  
ATOM 7774  H HD2  . LYS A 1 18  ? -13.198 10.281  -11.746 1.00 0.00 ? 18  LYS A HD2  6  
ATOM 7775  H HD3  . LYS A 1 18  ? -13.945 8.714   -11.504 1.00 0.00 ? 18  LYS A HD3  6  
ATOM 7776  H HE2  . LYS A 1 18  ? -14.483 10.860  -9.452  1.00 0.00 ? 18  LYS A HE2  6  
ATOM 7777  H HE3  . LYS A 1 18  ? -15.273 11.003  -11.010 1.00 0.00 ? 18  LYS A HE3  6  
ATOM 7778  H HZ1  . LYS A 1 18  ? -16.631 9.365   -10.480 1.00 0.00 ? 18  LYS A HZ1  6  
ATOM 7779  H HZ2  . LYS A 1 18  ? -15.427 8.367   -10.011 1.00 0.00 ? 18  LYS A HZ2  6  
ATOM 7780  H HZ3  . LYS A 1 18  ? -16.065 9.432   -8.950  1.00 0.00 ? 18  LYS A HZ3  6  
ATOM 7781  N N    . LYS A 1 19  ? -13.474 5.958   -6.611  1.00 0.00 ? 19  LYS A N    6  
ATOM 7782  C CA   . LYS A 1 19  ? -14.561 5.281   -5.926  1.00 0.00 ? 19  LYS A CA   6  
ATOM 7783  C C    . LYS A 1 19  ? -15.334 6.294   -5.078  1.00 0.00 ? 19  LYS A C    6  
ATOM 7784  O O    . LYS A 1 19  ? -15.936 7.224   -5.612  1.00 0.00 ? 19  LYS A O    6  
ATOM 7785  C CB   . LYS A 1 19  ? -14.031 4.088   -5.127  1.00 0.00 ? 19  LYS A CB   6  
ATOM 7786  C CG   . LYS A 1 19  ? -13.494 2.999   -6.058  1.00 0.00 ? 19  LYS A CG   6  
ATOM 7787  C CD   . LYS A 1 19  ? -14.054 1.627   -5.677  1.00 0.00 ? 19  LYS A CD   6  
ATOM 7788  C CE   . LYS A 1 19  ? -15.511 1.486   -6.122  1.00 0.00 ? 19  LYS A CE   6  
ATOM 7789  N NZ   . LYS A 1 19  ? -15.913 0.062   -6.136  1.00 0.00 ? 19  LYS A NZ   6  
ATOM 7790  H H    . LYS A 1 19  ? -12.560 5.609   -6.402  1.00 0.00 ? 19  LYS A H    6  
ATOM 7791  H HA   . LYS A 1 19  ? -15.232 4.885   -6.688  1.00 0.00 ? 19  LYS A HA   6  
ATOM 7792  H HB2  . LYS A 1 19  ? -13.239 4.419   -4.454  1.00 0.00 ? 19  LYS A HB2  6  
ATOM 7793  H HB3  . LYS A 1 19  ? -14.827 3.680   -4.505  1.00 0.00 ? 19  LYS A HB3  6  
ATOM 7794  H HG2  . LYS A 1 19  ? -13.763 3.232   -7.089  1.00 0.00 ? 19  LYS A HG2  6  
ATOM 7795  H HG3  . LYS A 1 19  ? -12.406 2.979   -6.010  1.00 0.00 ? 19  LYS A HG3  6  
ATOM 7796  H HD2  . LYS A 1 19  ? -13.451 0.844   -6.138  1.00 0.00 ? 19  LYS A HD2  6  
ATOM 7797  H HD3  . LYS A 1 19  ? -13.984 1.489   -4.598  1.00 0.00 ? 19  LYS A HD3  6  
ATOM 7798  H HE2  . LYS A 1 19  ? -16.159 2.047   -5.448  1.00 0.00 ? 19  LYS A HE2  6  
ATOM 7799  H HE3  . LYS A 1 19  ? -15.637 1.916   -7.116  1.00 0.00 ? 19  LYS A HE3  6  
ATOM 7800  H HZ1  . LYS A 1 19  ? -16.772 -0.047  -5.637  1.00 0.00 ? 19  LYS A HZ1  6  
ATOM 7801  H HZ2  . LYS A 1 19  ? -16.036 -0.240  -7.082  1.00 0.00 ? 19  LYS A HZ2  6  
ATOM 7802  H HZ3  . LYS A 1 19  ? -15.201 -0.490  -5.701  1.00 0.00 ? 19  LYS A HZ3  6  
ATOM 7803  N N    . GLN A 1 20  ? -15.292 6.078   -3.772  1.00 0.00 ? 20  GLN A N    6  
ATOM 7804  C CA   . GLN A 1 20  ? -15.981 6.961   -2.845  1.00 0.00 ? 20  GLN A CA   6  
ATOM 7805  C C    . GLN A 1 20  ? -15.275 8.317   -2.780  1.00 0.00 ? 20  GLN A C    6  
ATOM 7806  O O    . GLN A 1 20  ? -15.806 9.270   -2.212  1.00 0.00 ? 20  GLN A O    6  
ATOM 7807  C CB   . GLN A 1 20  ? -16.081 6.327   -1.457  1.00 0.00 ? 20  GLN A CB   6  
ATOM 7808  C CG   . GLN A 1 20  ? -17.087 7.079   -0.583  1.00 0.00 ? 20  GLN A CG   6  
ATOM 7809  C CD   . GLN A 1 20  ? -16.406 7.668   0.655   1.00 0.00 ? 20  GLN A CD   6  
ATOM 7810  O OE1  . GLN A 1 20  ? -15.632 8.608   0.581   1.00 0.00 ? 20  GLN A OE1  6  
ATOM 7811  N NE2  . GLN A 1 20  ? -16.737 7.064   1.793   1.00 0.00 ? 20  GLN A NE2  6  
ATOM 7812  H H    . GLN A 1 20  ? -14.800 5.319   -3.345  1.00 0.00 ? 20  GLN A H    6  
ATOM 7813  H HA   . GLN A 1 20  ? -16.983 7.085   -3.255  1.00 0.00 ? 20  GLN A HA   6  
ATOM 7814  H HB2  . GLN A 1 20  ? -16.383 5.284   -1.550  1.00 0.00 ? 20  GLN A HB2  6  
ATOM 7815  H HB3  . GLN A 1 20  ? -15.102 6.334   -0.978  1.00 0.00 ? 20  GLN A HB3  6  
ATOM 7816  H HG2  . GLN A 1 20  ? -17.552 7.877   -1.161  1.00 0.00 ? 20  GLN A HG2  6  
ATOM 7817  H HG3  . GLN A 1 20  ? -17.885 6.402   -0.276  1.00 0.00 ? 20  GLN A HG3  6  
ATOM 7818  H HE21 . GLN A 1 20  ? -17.379 6.298   1.784   1.00 0.00 ? 20  GLN A HE21 6  
ATOM 7819  H HE22 . GLN A 1 20  ? -16.343 7.377   2.657   1.00 0.00 ? 20  GLN A HE22 6  
ATOM 7820  N N    . ASN A 1 21  ? -14.089 8.360   -3.368  1.00 0.00 ? 21  ASN A N    6  
ATOM 7821  C CA   . ASN A 1 21  ? -13.305 9.583   -3.384  1.00 0.00 ? 21  ASN A CA   6  
ATOM 7822  C C    . ASN A 1 21  ? -11.833 9.237   -3.617  1.00 0.00 ? 21  ASN A C    6  
ATOM 7823  O O    . ASN A 1 21  ? -11.303 9.463   -4.704  1.00 0.00 ? 21  ASN A O    6  
ATOM 7824  C CB   . ASN A 1 21  ? -13.411 10.322  -2.048  1.00 0.00 ? 21  ASN A CB   6  
ATOM 7825  C CG   . ASN A 1 21  ? -14.317 11.548  -2.171  1.00 0.00 ? 21  ASN A CG   6  
ATOM 7826  O OD1  . ASN A 1 21  ? -14.841 11.863  -3.227  1.00 0.00 ? 21  ASN A OD1  6  
ATOM 7827  N ND2  . ASN A 1 21  ? -14.473 12.221  -1.034  1.00 0.00 ? 21  ASN A ND2  6  
ATOM 7828  H H    . ASN A 1 21  ? -13.664 7.579   -3.827  1.00 0.00 ? 21  ASN A H    6  
ATOM 7829  H HA   . ASN A 1 21  ? -13.725 10.182  -4.191  1.00 0.00 ? 21  ASN A HA   6  
ATOM 7830  H HB2  . ASN A 1 21  ? -13.804 9.649   -1.286  1.00 0.00 ? 21  ASN A HB2  6  
ATOM 7831  H HB3  . ASN A 1 21  ? -12.418 10.630  -1.719  1.00 0.00 ? 21  ASN A HB3  6  
ATOM 7832  H HD21 . ASN A 1 21  ? -14.015 11.910  -0.202  1.00 0.00 ? 21  ASN A HD21 6  
ATOM 7833  H HD22 . ASN A 1 21  ? -15.048 13.039  -1.012  1.00 0.00 ? 21  ASN A HD22 6  
ATOM 7834  N N    . GLY A 1 22  ? -11.213 8.695   -2.579  1.00 0.00 ? 22  GLY A N    6  
ATOM 7835  C CA   . GLY A 1 22  ? -9.813  8.316   -2.657  1.00 0.00 ? 22  GLY A CA   6  
ATOM 7836  C C    . GLY A 1 22  ? -9.609  6.871   -2.198  1.00 0.00 ? 22  GLY A C    6  
ATOM 7837  O O    . GLY A 1 22  ? -10.488 6.029   -2.379  1.00 0.00 ? 22  GLY A O    6  
ATOM 7838  H H    . GLY A 1 22  ? -11.651 8.514   -1.698  1.00 0.00 ? 22  GLY A H    6  
ATOM 7839  H HA2  . GLY A 1 22  ? -9.459  8.429   -3.682  1.00 0.00 ? 22  GLY A HA2  6  
ATOM 7840  H HA3  . GLY A 1 22  ? -9.216  8.985   -2.038  1.00 0.00 ? 22  GLY A HA3  6  
ATOM 7841  N N    . MET A 1 23  ? -8.446  6.628   -1.613  1.00 0.00 ? 23  MET A N    6  
ATOM 7842  C CA   . MET A 1 23  ? -8.116  5.299   -1.127  1.00 0.00 ? 23  MET A CA   6  
ATOM 7843  C C    . MET A 1 23  ? -8.348  5.194   0.382   1.00 0.00 ? 23  MET A C    6  
ATOM 7844  O O    . MET A 1 23  ? -8.302  4.102   0.946   1.00 0.00 ? 23  MET A O    6  
ATOM 7845  C CB   . MET A 1 23  ? -6.651  4.989   -1.441  1.00 0.00 ? 23  MET A CB   6  
ATOM 7846  C CG   . MET A 1 23  ? -5.728  6.070   -0.874  1.00 0.00 ? 23  MET A CG   6  
ATOM 7847  S SD   . MET A 1 23  ? -4.028  5.537   -0.977  1.00 0.00 ? 23  MET A SD   6  
ATOM 7848  C CE   . MET A 1 23  ? -3.769  5.664   -2.738  1.00 0.00 ? 23  MET A CE   6  
ATOM 7849  H H    . MET A 1 23  ? -7.737  7.318   -1.470  1.00 0.00 ? 23  MET A H    6  
ATOM 7850  H HA   . MET A 1 23  ? -8.787  4.619   -1.653  1.00 0.00 ? 23  MET A HA   6  
ATOM 7851  H HB2  . MET A 1 23  ? -6.382  4.020   -1.021  1.00 0.00 ? 23  MET A HB2  6  
ATOM 7852  H HB3  . MET A 1 23  ? -6.514  4.918   -2.520  1.00 0.00 ? 23  MET A HB3  6  
ATOM 7853  H HG2  . MET A 1 23  ? -5.860  6.999   -1.428  1.00 0.00 ? 23  MET A HG2  6  
ATOM 7854  H HG3  . MET A 1 23  ? -5.991  6.277   0.163   1.00 0.00 ? 23  MET A HG3  6  
ATOM 7855  H HE1  . MET A 1 23  ? -2.748  5.366   -2.978  1.00 0.00 ? 23  MET A HE1  6  
ATOM 7856  H HE2  . MET A 1 23  ? -4.469  5.009   -3.257  1.00 0.00 ? 23  MET A HE2  6  
ATOM 7857  H HE3  . MET A 1 23  ? -3.931  6.694   -3.056  1.00 0.00 ? 23  MET A HE3  6  
ATOM 7858  N N    . GLY A 1 24  ? -8.592  6.344   0.992   1.00 0.00 ? 24  GLY A N    6  
ATOM 7859  C CA   . GLY A 1 24  ? -8.831  6.396   2.424   1.00 0.00 ? 24  GLY A CA   6  
ATOM 7860  C C    . GLY A 1 24  ? -8.127  5.240   3.140   1.00 0.00 ? 24  GLY A C    6  
ATOM 7861  O O    . GLY A 1 24  ? -8.778  4.400   3.758   1.00 0.00 ? 24  GLY A O    6  
ATOM 7862  H H    . GLY A 1 24  ? -8.627  7.228   0.526   1.00 0.00 ? 24  GLY A H    6  
ATOM 7863  H HA2  . GLY A 1 24  ? -8.474  7.345   2.823   1.00 0.00 ? 24  GLY A HA2  6  
ATOM 7864  H HA3  . GLY A 1 24  ? -9.902  6.350   2.620   1.00 0.00 ? 24  GLY A HA3  6  
ATOM 7865  N N    . LEU A 1 25  ? -6.807  5.236   3.031   1.00 0.00 ? 25  LEU A N    6  
ATOM 7866  C CA   . LEU A 1 25  ? -6.008  4.198   3.660   1.00 0.00 ? 25  LEU A CA   6  
ATOM 7867  C C    . LEU A 1 25  ? -5.034  4.839   4.651   1.00 0.00 ? 25  LEU A C    6  
ATOM 7868  O O    . LEU A 1 25  ? -4.324  5.783   4.306   1.00 0.00 ? 25  LEU A O    6  
ATOM 7869  C CB   . LEU A 1 25  ? -5.324  3.332   2.600   1.00 0.00 ? 25  LEU A CB   6  
ATOM 7870  C CG   . LEU A 1 25  ? -4.579  2.100   3.118   1.00 0.00 ? 25  LEU A CG   6  
ATOM 7871  C CD1  . LEU A 1 25  ? -3.429  2.504   4.042   1.00 0.00 ? 25  LEU A CD1  6  
ATOM 7872  C CD2  . LEU A 1 25  ? -5.542  1.122   3.795   1.00 0.00 ? 25  LEU A CD2  6  
ATOM 7873  H H    . LEU A 1 25  ? -6.285  5.924   2.526   1.00 0.00 ? 25  LEU A H    6  
ATOM 7874  H HA   . LEU A 1 25  ? -6.689  3.552   4.214   1.00 0.00 ? 25  LEU A HA   6  
ATOM 7875  H HB2  . LEU A 1 25  ? -6.080  3.002   1.887   1.00 0.00 ? 25  LEU A HB2  6  
ATOM 7876  H HB3  . LEU A 1 25  ? -4.618  3.955   2.051   1.00 0.00 ? 25  LEU A HB3  6  
ATOM 7877  H HG   . LEU A 1 25  ? -4.141  1.582   2.265   1.00 0.00 ? 25  LEU A HG   6  
ATOM 7878  H HD11 . LEU A 1 25  ? -2.676  1.715   4.051   1.00 0.00 ? 25  LEU A HD11 6  
ATOM 7879  H HD12 . LEU A 1 25  ? -2.981  3.430   3.681   1.00 0.00 ? 25  LEU A HD12 6  
ATOM 7880  H HD13 . LEU A 1 25  ? -3.810  2.654   5.052   1.00 0.00 ? 25  LEU A HD13 6  
ATOM 7881  H HD21 . LEU A 1 25  ? -5.049  0.159   3.925   1.00 0.00 ? 25  LEU A HD21 6  
ATOM 7882  H HD22 . LEU A 1 25  ? -5.835  1.515   4.768   1.00 0.00 ? 25  LEU A HD22 6  
ATOM 7883  H HD23 . LEU A 1 25  ? -6.428  0.995   3.173   1.00 0.00 ? 25  LEU A HD23 6  
ATOM 7884  N N    . SER A 1 26  ? -5.033  4.302   5.862   1.00 0.00 ? 26  SER A N    6  
ATOM 7885  C CA   . SER A 1 26  ? -4.158  4.810   6.905   1.00 0.00 ? 26  SER A CA   6  
ATOM 7886  C C    . SER A 1 26  ? -2.886  3.963   6.980   1.00 0.00 ? 26  SER A C    6  
ATOM 7887  O O    . SER A 1 26  ? -2.908  2.847   7.496   1.00 0.00 ? 26  SER A O    6  
ATOM 7888  C CB   . SER A 1 26  ? -4.867  4.823   8.260   1.00 0.00 ? 26  SER A CB   6  
ATOM 7889  O OG   . SER A 1 26  ? -5.874  5.829   8.326   1.00 0.00 ? 26  SER A OG   6  
ATOM 7890  H H    . SER A 1 26  ? -5.613  3.534   6.134   1.00 0.00 ? 26  SER A H    6  
ATOM 7891  H HA   . SER A 1 26  ? -3.921  5.832   6.610   1.00 0.00 ? 26  SER A HA   6  
ATOM 7892  H HB2  . SER A 1 26  ? -5.317  3.847   8.444   1.00 0.00 ? 26  SER A HB2  6  
ATOM 7893  H HB3  . SER A 1 26  ? -4.136  4.990   9.051   1.00 0.00 ? 26  SER A HB3  6  
ATOM 7894  H HG   . SER A 1 26  ? -5.452  6.735   8.359   1.00 0.00 ? 26  SER A HG   6  
ATOM 7895  N N    . ILE A 1 27  ? -1.807  4.527   6.457   1.00 0.00 ? 27  ILE A N    6  
ATOM 7896  C CA   . ILE A 1 27  ? -0.527  3.838   6.458   1.00 0.00 ? 27  ILE A CA   6  
ATOM 7897  C C    . ILE A 1 27  ? 0.210   4.142   7.764   1.00 0.00 ? 27  ILE A C    6  
ATOM 7898  O O    . ILE A 1 27  ? -0.211  5.006   8.531   1.00 0.00 ? 27  ILE A O    6  
ATOM 7899  C CB   . ILE A 1 27  ? 0.273   4.192   5.203   1.00 0.00 ? 27  ILE A CB   6  
ATOM 7900  C CG1  . ILE A 1 27  ? 0.756   5.643   5.253   1.00 0.00 ? 27  ILE A CG1  6  
ATOM 7901  C CG2  . ILE A 1 27  ? -0.534  3.899   3.937   1.00 0.00 ? 27  ILE A CG2  6  
ATOM 7902  C CD1  . ILE A 1 27  ? 1.849   5.893   4.211   1.00 0.00 ? 27  ILE A CD1  6  
ATOM 7903  H H    . ILE A 1 27  ? -1.797  5.435   6.039   1.00 0.00 ? 27  ILE A H    6  
ATOM 7904  H HA   . ILE A 1 27  ? -0.733  2.768   6.418   1.00 0.00 ? 27  ILE A HA   6  
ATOM 7905  H HB   . ILE A 1 27  ? 1.159   3.558   5.173   1.00 0.00 ? 27  ILE A HB   6  
ATOM 7906  H HG12 . ILE A 1 27  ? -0.083  6.316   5.074   1.00 0.00 ? 27  ILE A HG12 6  
ATOM 7907  H HG13 . ILE A 1 27  ? 1.139   5.869   6.248   1.00 0.00 ? 27  ILE A HG13 6  
ATOM 7908  H HG21 . ILE A 1 27  ? 0.135   3.871   3.078   1.00 0.00 ? 27  ILE A HG21 6  
ATOM 7909  H HG22 . ILE A 1 27  ? -1.035  2.937   4.040   1.00 0.00 ? 27  ILE A HG22 6  
ATOM 7910  H HG23 . ILE A 1 27  ? -1.279  4.682   3.792   1.00 0.00 ? 27  ILE A HG23 6  
ATOM 7911  H HD11 . ILE A 1 27  ? 2.142   4.946   3.758   1.00 0.00 ? 27  ILE A HD11 6  
ATOM 7912  H HD12 . ILE A 1 27  ? 1.468   6.562   3.439   1.00 0.00 ? 27  ILE A HD12 6  
ATOM 7913  H HD13 . ILE A 1 27  ? 2.713   6.349   4.693   1.00 0.00 ? 27  ILE A HD13 6  
ATOM 7914  N N    . VAL A 1 28  ? 1.296   3.414   7.976   1.00 0.00 ? 28  VAL A N    6  
ATOM 7915  C CA   . VAL A 1 28  ? 2.096   3.595   9.176   1.00 0.00 ? 28  VAL A CA   6  
ATOM 7916  C C    . VAL A 1 28  ? 3.542   3.188   8.886   1.00 0.00 ? 28  VAL A C    6  
ATOM 7917  O O    . VAL A 1 28  ? 3.832   2.009   8.692   1.00 0.00 ? 28  VAL A O    6  
ATOM 7918  C CB   . VAL A 1 28  ? 1.477   2.817   10.339  1.00 0.00 ? 28  VAL A CB   6  
ATOM 7919  C CG1  . VAL A 1 28  ? 2.386   1.664   10.771  1.00 0.00 ? 28  VAL A CG1  6  
ATOM 7920  C CG2  . VAL A 1 28  ? 1.169   3.744   11.517  1.00 0.00 ? 28  VAL A CG2  6  
ATOM 7921  H H    . VAL A 1 28  ? 1.631   2.713   7.347   1.00 0.00 ? 28  VAL A H    6  
ATOM 7922  H HA   . VAL A 1 28  ? 2.073   4.655   9.429   1.00 0.00 ? 28  VAL A HA   6  
ATOM 7923  H HB   . VAL A 1 28  ? 0.536   2.390   9.994   1.00 0.00 ? 28  VAL A HB   6  
ATOM 7924  H HG11 . VAL A 1 28  ? 2.437   0.923   9.973   1.00 0.00 ? 28  VAL A HG11 6  
ATOM 7925  H HG12 . VAL A 1 28  ? 3.385   2.046   10.978  1.00 0.00 ? 28  VAL A HG12 6  
ATOM 7926  H HG13 . VAL A 1 28  ? 1.981   1.201   11.671  1.00 0.00 ? 28  VAL A HG13 6  
ATOM 7927  H HG21 . VAL A 1 28  ? 1.534   4.747   11.295  1.00 0.00 ? 28  VAL A HG21 6  
ATOM 7928  H HG22 . VAL A 1 28  ? 0.092   3.777   11.681  1.00 0.00 ? 28  VAL A HG22 6  
ATOM 7929  H HG23 . VAL A 1 28  ? 1.662   3.368   12.413  1.00 0.00 ? 28  VAL A HG23 6  
ATOM 7930  N N    . ALA A 1 29  ? 4.411   4.188   8.866   1.00 0.00 ? 29  ALA A N    6  
ATOM 7931  C CA   . ALA A 1 29  ? 5.820   3.949   8.603   1.00 0.00 ? 29  ALA A CA   6  
ATOM 7932  C C    . ALA A 1 29  ? 6.487   5.262   8.188   1.00 0.00 ? 29  ALA A C    6  
ATOM 7933  O O    . ALA A 1 29  ? 5.883   6.328   8.290   1.00 0.00 ? 29  ALA A O    6  
ATOM 7934  C CB   . ALA A 1 29  ? 5.963   2.860   7.537   1.00 0.00 ? 29  ALA A CB   6  
ATOM 7935  H H    . ALA A 1 29  ? 4.168   5.144   9.025   1.00 0.00 ? 29  ALA A H    6  
ATOM 7936  H HA   . ALA A 1 29  ? 6.275   3.596   9.528   1.00 0.00 ? 29  ALA A HA   6  
ATOM 7937  H HB1  . ALA A 1 29  ? 6.908   2.990   7.009   1.00 0.00 ? 29  ALA A HB1  6  
ATOM 7938  H HB2  . ALA A 1 29  ? 5.946   1.880   8.014   1.00 0.00 ? 29  ALA A HB2  6  
ATOM 7939  H HB3  . ALA A 1 29  ? 5.139   2.935   6.829   1.00 0.00 ? 29  ALA A HB3  6  
ATOM 7940  N N    . ALA A 1 30  ? 7.725   5.141   7.730   1.00 0.00 ? 30  ALA A N    6  
ATOM 7941  C CA   . ALA A 1 30  ? 8.480   6.305   7.300   1.00 0.00 ? 30  ALA A CA   6  
ATOM 7942  C C    . ALA A 1 30  ? 9.967   5.948   7.237   1.00 0.00 ? 30  ALA A C    6  
ATOM 7943  O O    . ALA A 1 30  ? 10.520  5.405   8.192   1.00 0.00 ? 30  ALA A O    6  
ATOM 7944  C CB   . ALA A 1 30  ? 8.201   7.474   8.248   1.00 0.00 ? 30  ALA A CB   6  
ATOM 7945  H H    . ALA A 1 30  ? 8.209   4.270   7.651   1.00 0.00 ? 30  ALA A H    6  
ATOM 7946  H HA   . ALA A 1 30  ? 8.136   6.574   6.301   1.00 0.00 ? 30  ALA A HA   6  
ATOM 7947  H HB1  . ALA A 1 30  ? 7.556   8.199   7.751   1.00 0.00 ? 30  ALA A HB1  6  
ATOM 7948  H HB2  . ALA A 1 30  ? 7.707   7.103   9.146   1.00 0.00 ? 30  ALA A HB2  6  
ATOM 7949  H HB3  . ALA A 1 30  ? 9.142   7.952   8.522   1.00 0.00 ? 30  ALA A HB3  6  
ATOM 7950  N N    . LYS A 1 31  ? 10.571  6.267   6.102   1.00 0.00 ? 31  LYS A N    6  
ATOM 7951  C CA   . LYS A 1 31  ? 11.982  5.987   5.901   1.00 0.00 ? 31  LYS A CA   6  
ATOM 7952  C C    . LYS A 1 31  ? 12.809  7.182   6.380   1.00 0.00 ? 31  LYS A C    6  
ATOM 7953  O O    . LYS A 1 31  ? 12.815  8.233   5.740   1.00 0.00 ? 31  LYS A O    6  
ATOM 7954  C CB   . LYS A 1 31  ? 12.250  5.599   4.445   1.00 0.00 ? 31  LYS A CB   6  
ATOM 7955  C CG   . LYS A 1 31  ? 11.731  6.673   3.487   1.00 0.00 ? 31  LYS A CG   6  
ATOM 7956  C CD   . LYS A 1 31  ? 12.212  6.412   2.058   1.00 0.00 ? 31  LYS A CD   6  
ATOM 7957  C CE   . LYS A 1 31  ? 13.473  7.221   1.747   1.00 0.00 ? 31  LYS A CE   6  
ATOM 7958  N NZ   . LYS A 1 31  ? 14.652  6.331   1.660   1.00 0.00 ? 31  LYS A NZ   6  
ATOM 7959  H H    . LYS A 1 31  ? 10.114  6.709   5.329   1.00 0.00 ? 31  LYS A H    6  
ATOM 7960  H HA   . LYS A 1 31  ? 12.235  5.124   6.516   1.00 0.00 ? 31  LYS A HA   6  
ATOM 7961  H HB2  . LYS A 1 31  ? 13.320  5.456   4.293   1.00 0.00 ? 31  LYS A HB2  6  
ATOM 7962  H HB3  . LYS A 1 31  ? 11.768  4.646   4.225   1.00 0.00 ? 31  LYS A HB3  6  
ATOM 7963  H HG2  . LYS A 1 31  ? 10.642  6.691   3.510   1.00 0.00 ? 31  LYS A HG2  6  
ATOM 7964  H HG3  . LYS A 1 31  ? 12.073  7.654   3.816   1.00 0.00 ? 31  LYS A HG3  6  
ATOM 7965  H HD2  . LYS A 1 31  ? 12.417  5.349   1.928   1.00 0.00 ? 31  LYS A HD2  6  
ATOM 7966  H HD3  . LYS A 1 31  ? 11.425  6.673   1.352   1.00 0.00 ? 31  LYS A HD3  6  
ATOM 7967  H HE2  . LYS A 1 31  ? 13.345  7.758   0.808   1.00 0.00 ? 31  LYS A HE2  6  
ATOM 7968  H HE3  . LYS A 1 31  ? 13.632  7.970   2.523   1.00 0.00 ? 31  LYS A HE3  6  
ATOM 7969  H HZ1  . LYS A 1 31  ? 15.260  6.654   0.935   1.00 0.00 ? 31  LYS A HZ1  6  
ATOM 7970  H HZ2  . LYS A 1 31  ? 15.141  6.338   2.533   1.00 0.00 ? 31  LYS A HZ2  6  
ATOM 7971  H HZ3  . LYS A 1 31  ? 14.352  5.400   1.454   1.00 0.00 ? 31  LYS A HZ3  6  
ATOM 7972  N N    . GLY A 1 32  ? 13.485  6.982   7.501   1.00 0.00 ? 32  GLY A N    6  
ATOM 7973  C CA   . GLY A 1 32  ? 14.313  8.030   8.073   1.00 0.00 ? 32  GLY A CA   6  
ATOM 7974  C C    . GLY A 1 32  ? 14.300  7.966   9.602   1.00 0.00 ? 32  GLY A C    6  
ATOM 7975  O O    . GLY A 1 32  ? 13.510  7.229   10.189  1.00 0.00 ? 32  GLY A O    6  
ATOM 7976  H H    . GLY A 1 32  ? 13.474  6.124   8.015   1.00 0.00 ? 32  GLY A H    6  
ATOM 7977  H HA2  . GLY A 1 32  ? 15.336  7.930   7.710   1.00 0.00 ? 32  GLY A HA2  6  
ATOM 7978  H HA3  . GLY A 1 32  ? 13.952  9.004   7.744   1.00 0.00 ? 32  GLY A HA3  6  
ATOM 7979  N N    . ALA A 1 33  ? 15.184  8.749   10.203  1.00 0.00 ? 33  ALA A N    6  
ATOM 7980  C CA   . ALA A 1 33  ? 15.285  8.790   11.652  1.00 0.00 ? 33  ALA A CA   6  
ATOM 7981  C C    . ALA A 1 33  ? 15.461  7.368   12.187  1.00 0.00 ? 33  ALA A C    6  
ATOM 7982  O O    . ALA A 1 33  ? 14.936  7.030   13.247  1.00 0.00 ? 33  ALA A O    6  
ATOM 7983  C CB   . ALA A 1 33  ? 14.048  9.481   12.230  1.00 0.00 ? 33  ALA A CB   6  
ATOM 7984  H H    . ALA A 1 33  ? 15.823  9.346   9.718   1.00 0.00 ? 33  ALA A H    6  
ATOM 7985  H HA   . ALA A 1 33  ? 16.166  9.378   11.907  1.00 0.00 ? 33  ALA A HA   6  
ATOM 7986  H HB1  . ALA A 1 33  ? 13.472  9.931   11.421  1.00 0.00 ? 33  ALA A HB1  6  
ATOM 7987  H HB2  . ALA A 1 33  ? 13.432  8.748   12.750  1.00 0.00 ? 33  ALA A HB2  6  
ATOM 7988  H HB3  . ALA A 1 33  ? 14.359  10.257  12.930  1.00 0.00 ? 33  ALA A HB3  6  
ATOM 7989  N N    . GLY A 1 34  ? 16.203  6.572   11.430  1.00 0.00 ? 34  GLY A N    6  
ATOM 7990  C CA   . GLY A 1 34  ? 16.455  5.194   11.816  1.00 0.00 ? 34  GLY A CA   6  
ATOM 7991  C C    . GLY A 1 34  ? 17.518  4.560   10.916  1.00 0.00 ? 34  GLY A C    6  
ATOM 7992  O O    . GLY A 1 34  ? 18.601  4.209   11.381  1.00 0.00 ? 34  GLY A O    6  
ATOM 7993  H H    . GLY A 1 34  ? 16.626  6.855   10.570  1.00 0.00 ? 34  GLY A H    6  
ATOM 7994  H HA2  . GLY A 1 34  ? 16.784  5.158   12.854  1.00 0.00 ? 34  GLY A HA2  6  
ATOM 7995  H HA3  . GLY A 1 34  ? 15.531  4.620   11.753  1.00 0.00 ? 34  GLY A HA3  6  
ATOM 7996  N N    . GLN A 1 35  ? 17.170  4.430   9.644   1.00 0.00 ? 35  GLN A N    6  
ATOM 7997  C CA   . GLN A 1 35  ? 18.081  3.844   8.675   1.00 0.00 ? 35  GLN A CA   6  
ATOM 7998  C C    . GLN A 1 35  ? 17.688  4.262   7.257   1.00 0.00 ? 35  GLN A C    6  
ATOM 7999  O O    . GLN A 1 35  ? 17.985  3.558   6.293   1.00 0.00 ? 35  GLN A O    6  
ATOM 8000  C CB   . GLN A 1 35  ? 18.115  2.320   8.808   1.00 0.00 ? 35  GLN A CB   6  
ATOM 8001  C CG   . GLN A 1 35  ? 18.945  1.894   10.020  1.00 0.00 ? 35  GLN A CG   6  
ATOM 8002  C CD   . GLN A 1 35  ? 19.432  0.451   9.871   1.00 0.00 ? 35  GLN A CD   6  
ATOM 8003  O OE1  . GLN A 1 35  ? 19.609  -0.062  8.779   1.00 0.00 ? 35  GLN A OE1  6  
ATOM 8004  N NE2  . GLN A 1 35  ? 19.637  -0.173  11.028  1.00 0.00 ? 35  GLN A NE2  6  
ATOM 8005  H H    . GLN A 1 35  ? 16.287  4.718   9.274   1.00 0.00 ? 35  GLN A H    6  
ATOM 8006  H HA   . GLN A 1 35  ? 19.063  4.246   8.921   1.00 0.00 ? 35  GLN A HA   6  
ATOM 8007  H HB2  . GLN A 1 35  ? 17.099  1.937   8.905   1.00 0.00 ? 35  GLN A HB2  6  
ATOM 8008  H HB3  . GLN A 1 35  ? 18.535  1.882   7.902   1.00 0.00 ? 35  GLN A HB3  6  
ATOM 8009  H HG2  . GLN A 1 35  ? 19.801  2.560   10.132  1.00 0.00 ? 35  GLN A HG2  6  
ATOM 8010  H HG3  . GLN A 1 35  ? 18.347  1.988   10.926  1.00 0.00 ? 35  GLN A HG3  6  
ATOM 8011  H HE21 . GLN A 1 35  ? 19.473  0.306   11.890  1.00 0.00 ? 35  GLN A HE21 6  
ATOM 8012  H HE22 . GLN A 1 35  ? 19.956  -1.121  11.035  1.00 0.00 ? 35  GLN A HE22 6  
ATOM 8013  N N    . ASP A 1 36  ? 17.026  5.407   7.174   1.00 0.00 ? 36  ASP A N    6  
ATOM 8014  C CA   . ASP A 1 36  ? 16.589  5.927   5.889   1.00 0.00 ? 36  ASP A CA   6  
ATOM 8015  C C    . ASP A 1 36  ? 15.782  4.854   5.157   1.00 0.00 ? 36  ASP A C    6  
ATOM 8016  O O    . ASP A 1 36  ? 15.899  4.706   3.941   1.00 0.00 ? 36  ASP A O    6  
ATOM 8017  C CB   . ASP A 1 36  ? 17.785  6.301   5.011   1.00 0.00 ? 36  ASP A CB   6  
ATOM 8018  C CG   . ASP A 1 36  ? 17.668  7.650   4.298   1.00 0.00 ? 36  ASP A CG   6  
ATOM 8019  O OD1  . ASP A 1 36  ? 16.709  7.794   3.510   1.00 0.00 ? 36  ASP A OD1  6  
ATOM 8020  O OD2  . ASP A 1 36  ? 18.541  8.506   4.558   1.00 0.00 ? 36  ASP A OD2  6  
ATOM 8021  H H    . ASP A 1 36  ? 16.788  5.974   7.962   1.00 0.00 ? 36  ASP A H    6  
ATOM 8022  H HA   . ASP A 1 36  ? 15.994  6.809   6.125   1.00 0.00 ? 36  ASP A HA   6  
ATOM 8023  H HB2  . ASP A 1 36  ? 18.682  6.311   5.630   1.00 0.00 ? 36  ASP A HB2  6  
ATOM 8024  H HB3  . ASP A 1 36  ? 17.924  5.522   4.262   1.00 0.00 ? 36  ASP A HB3  6  
ATOM 8025  N N    . LYS A 1 37  ? 14.980  4.133   5.927   1.00 0.00 ? 37  LYS A N    6  
ATOM 8026  C CA   . LYS A 1 37  ? 14.153  3.078   5.367   1.00 0.00 ? 37  LYS A CA   6  
ATOM 8027  C C    . LYS A 1 37  ? 13.360  2.407   6.489   1.00 0.00 ? 37  LYS A C    6  
ATOM 8028  O O    . LYS A 1 37  ? 13.932  1.986   7.493   1.00 0.00 ? 37  LYS A O    6  
ATOM 8029  C CB   . LYS A 1 37  ? 15.007  2.105   4.550   1.00 0.00 ? 37  LYS A CB   6  
ATOM 8030  C CG   . LYS A 1 37  ? 14.199  0.869   4.152   1.00 0.00 ? 37  LYS A CG   6  
ATOM 8031  C CD   . LYS A 1 37  ? 14.759  0.235   2.877   1.00 0.00 ? 37  LYS A CD   6  
ATOM 8032  C CE   . LYS A 1 37  ? 15.304  -1.168  3.156   1.00 0.00 ? 37  LYS A CE   6  
ATOM 8033  N NZ   . LYS A 1 37  ? 14.646  -2.163  2.280   1.00 0.00 ? 37  LYS A NZ   6  
ATOM 8034  H H    . LYS A 1 37  ? 14.891  4.261   6.915   1.00 0.00 ? 37  LYS A H    6  
ATOM 8035  H HA   . LYS A 1 37  ? 13.450  3.546   4.678   1.00 0.00 ? 37  LYS A HA   6  
ATOM 8036  H HB2  . LYS A 1 37  ? 15.379  2.604   3.656   1.00 0.00 ? 37  LYS A HB2  6  
ATOM 8037  H HB3  . LYS A 1 37  ? 15.877  1.803   5.132   1.00 0.00 ? 37  LYS A HB3  6  
ATOM 8038  H HG2  . LYS A 1 37  ? 14.218  0.141   4.963   1.00 0.00 ? 37  LYS A HG2  6  
ATOM 8039  H HG3  . LYS A 1 37  ? 13.156  1.145   3.997   1.00 0.00 ? 37  LYS A HG3  6  
ATOM 8040  H HD2  . LYS A 1 37  ? 13.977  0.181   2.120   1.00 0.00 ? 37  LYS A HD2  6  
ATOM 8041  H HD3  . LYS A 1 37  ? 15.552  0.863   2.473   1.00 0.00 ? 37  LYS A HD3  6  
ATOM 8042  H HE2  . LYS A 1 37  ? 16.381  -1.185  2.991   1.00 0.00 ? 37  LYS A HE2  6  
ATOM 8043  H HE3  . LYS A 1 37  ? 15.137  -1.428  4.201   1.00 0.00 ? 37  LYS A HE3  6  
ATOM 8044  H HZ1  . LYS A 1 37  ? 15.342  -2.726  1.834   1.00 0.00 ? 37  LYS A HZ1  6  
ATOM 8045  H HZ2  . LYS A 1 37  ? 14.047  -2.745  2.828   1.00 0.00 ? 37  LYS A HZ2  6  
ATOM 8046  H HZ3  . LYS A 1 37  ? 14.106  -1.689  1.584   1.00 0.00 ? 37  LYS A HZ3  6  
ATOM 8047  N N    . LEU A 1 38  ? 12.053  2.329   6.282   1.00 0.00 ? 38  LEU A N    6  
ATOM 8048  C CA   . LEU A 1 38  ? 11.175  1.716   7.264   1.00 0.00 ? 38  LEU A CA   6  
ATOM 8049  C C    . LEU A 1 38  ? 10.109  0.890   6.543   1.00 0.00 ? 38  LEU A C    6  
ATOM 8050  O O    . LEU A 1 38  ? 9.670   1.251   5.452   1.00 0.00 ? 38  LEU A O    6  
ATOM 8051  C CB   . LEU A 1 38  ? 10.599  2.778   8.204   1.00 0.00 ? 38  LEU A CB   6  
ATOM 8052  C CG   . LEU A 1 38  ? 9.979   2.258   9.503   1.00 0.00 ? 38  LEU A CG   6  
ATOM 8053  C CD1  . LEU A 1 38  ? 10.100  3.295   10.621  1.00 0.00 ? 38  LEU A CD1  6  
ATOM 8054  C CD2  . LEU A 1 38  ? 8.530   1.820   9.282   1.00 0.00 ? 38  LEU A CD2  6  
ATOM 8055  H H    . LEU A 1 38  ? 11.595  2.674   5.463   1.00 0.00 ? 38  LEU A H    6  
ATOM 8056  H HA   . LEU A 1 38  ? 11.782  1.044   7.871   1.00 0.00 ? 38  LEU A HA   6  
ATOM 8057  H HB2  . LEU A 1 38  ? 11.394  3.478   8.459   1.00 0.00 ? 38  LEU A HB2  6  
ATOM 8058  H HB3  . LEU A 1 38  ? 9.840   3.341   7.662   1.00 0.00 ? 38  LEU A HB3  6  
ATOM 8059  H HG   . LEU A 1 38  ? 10.537  1.377   9.819   1.00 0.00 ? 38  LEU A HG   6  
ATOM 8060  H HD11 . LEU A 1 38  ? 11.019  3.867   10.489  1.00 0.00 ? 38  LEU A HD11 6  
ATOM 8061  H HD12 . LEU A 1 38  ? 9.245   3.970   10.585  1.00 0.00 ? 38  LEU A HD12 6  
ATOM 8062  H HD13 . LEU A 1 38  ? 10.122  2.789   11.586  1.00 0.00 ? 38  LEU A HD13 6  
ATOM 8063  H HD21 . LEU A 1 38  ? 8.515   0.813   8.866   1.00 0.00 ? 38  LEU A HD21 6  
ATOM 8064  H HD22 . LEU A 1 38  ? 7.999   1.829   10.233  1.00 0.00 ? 38  LEU A HD22 6  
ATOM 8065  H HD23 . LEU A 1 38  ? 8.045   2.507   8.588   1.00 0.00 ? 38  LEU A HD23 6  
ATOM 8066  N N    . GLY A 1 39  ? 9.722   -0.205  7.182   1.00 0.00 ? 39  GLY A N    6  
ATOM 8067  C CA   . GLY A 1 39  ? 8.715   -1.086  6.616   1.00 0.00 ? 39  GLY A CA   6  
ATOM 8068  C C    . GLY A 1 39  ? 7.342   -0.411  6.600   1.00 0.00 ? 39  GLY A C    6  
ATOM 8069  O O    . GLY A 1 39  ? 6.798   -0.077  7.652   1.00 0.00 ? 39  GLY A O    6  
ATOM 8070  H H    . GLY A 1 39  ? 10.083  -0.492  8.070   1.00 0.00 ? 39  GLY A H    6  
ATOM 8071  H HA2  . GLY A 1 39  ? 8.999   -1.363  5.601   1.00 0.00 ? 39  GLY A HA2  6  
ATOM 8072  H HA3  . GLY A 1 39  ? 8.664   -2.007  7.196   1.00 0.00 ? 39  GLY A HA3  6  
ATOM 8073  N N    . ILE A 1 40  ? 6.820   -0.229  5.396   1.00 0.00 ? 40  ILE A N    6  
ATOM 8074  C CA   . ILE A 1 40  ? 5.521   0.400   5.230   1.00 0.00 ? 40  ILE A CA   6  
ATOM 8075  C C    . ILE A 1 40  ? 4.424   -0.601  5.598   1.00 0.00 ? 40  ILE A C    6  
ATOM 8076  O O    . ILE A 1 40  ? 4.293   -1.646  4.961   1.00 0.00 ? 40  ILE A O    6  
ATOM 8077  C CB   . ILE A 1 40  ? 5.381   0.975   3.819   1.00 0.00 ? 40  ILE A CB   6  
ATOM 8078  C CG1  . ILE A 1 40  ? 6.432   2.056   3.560   1.00 0.00 ? 40  ILE A CG1  6  
ATOM 8079  C CG2  . ILE A 1 40  ? 3.960   1.487   3.574   1.00 0.00 ? 40  ILE A CG2  6  
ATOM 8080  C CD1  . ILE A 1 40  ? 5.951   3.420   4.061   1.00 0.00 ? 40  ILE A CD1  6  
ATOM 8081  H H    . ILE A 1 40  ? 7.269   -0.503  4.545   1.00 0.00 ? 40  ILE A H    6  
ATOM 8082  H HA   . ILE A 1 40  ? 5.473   1.237   5.925   1.00 0.00 ? 40  ILE A HA   6  
ATOM 8083  H HB   . ILE A 1 40  ? 5.562   0.173   3.103   1.00 0.00 ? 40  ILE A HB   6  
ATOM 8084  H HG12 . ILE A 1 40  ? 7.364   1.790   4.060   1.00 0.00 ? 40  ILE A HG12 6  
ATOM 8085  H HG13 . ILE A 1 40  ? 6.647   2.112   2.493   1.00 0.00 ? 40  ILE A HG13 6  
ATOM 8086  H HG21 . ILE A 1 40  ? 3.387   0.727   3.042   1.00 0.00 ? 40  ILE A HG21 6  
ATOM 8087  H HG22 . ILE A 1 40  ? 3.481   1.700   4.529   1.00 0.00 ? 40  ILE A HG22 6  
ATOM 8088  H HG23 . ILE A 1 40  ? 4.000   2.397   2.976   1.00 0.00 ? 40  ILE A HG23 6  
ATOM 8089  H HD11 . ILE A 1 40  ? 5.162   3.277   4.800   1.00 0.00 ? 40  ILE A HD11 6  
ATOM 8090  H HD12 . ILE A 1 40  ? 6.784   3.954   4.517   1.00 0.00 ? 40  ILE A HD12 6  
ATOM 8091  H HD13 . ILE A 1 40  ? 5.563   3.999   3.223   1.00 0.00 ? 40  ILE A HD13 6  
ATOM 8092  N N    . TYR A 1 41  ? 3.664   -0.246  6.623   1.00 0.00 ? 41  TYR A N    6  
ATOM 8093  C CA   . TYR A 1 41  ? 2.582   -1.100  7.083   1.00 0.00 ? 41  TYR A CA   6  
ATOM 8094  C C    . TYR A 1 41  ? 1.321   -0.282  7.369   1.00 0.00 ? 41  TYR A C    6  
ATOM 8095  O O    . TYR A 1 41  ? 1.383   0.744   8.046   1.00 0.00 ? 41  TYR A O    6  
ATOM 8096  C CB   . TYR A 1 41  ? 3.071   -1.734  8.387   1.00 0.00 ? 41  TYR A CB   6  
ATOM 8097  C CG   . TYR A 1 41  ? 3.311   -3.242  8.294   1.00 0.00 ? 41  TYR A CG   6  
ATOM 8098  C CD1  . TYR A 1 41  ? 2.270   -4.121  8.515   1.00 0.00 ? 41  TYR A CD1  6  
ATOM 8099  C CD2  . TYR A 1 41  ? 4.568   -3.724  7.990   1.00 0.00 ? 41  TYR A CD2  6  
ATOM 8100  C CE1  . TYR A 1 41  ? 2.496   -5.541  8.427   1.00 0.00 ? 41  TYR A CE1  6  
ATOM 8101  C CE2  . TYR A 1 41  ? 4.794   -5.143  7.903   1.00 0.00 ? 41  TYR A CE2  6  
ATOM 8102  C CZ   . TYR A 1 41  ? 3.747   -5.982  8.126   1.00 0.00 ? 41  TYR A CZ   6  
ATOM 8103  O OH   . TYR A 1 41  ? 3.960   -7.322  8.043   1.00 0.00 ? 41  TYR A OH   6  
ATOM 8104  H H    . TYR A 1 41  ? 3.777   0.605   7.135   1.00 0.00 ? 41  TYR A H    6  
ATOM 8105  H HA   . TYR A 1 41  ? 2.366   -1.823  6.297   1.00 0.00 ? 41  TYR A HA   6  
ATOM 8106  H HB2  . TYR A 1 41  ? 3.998   -1.247  8.691   1.00 0.00 ? 41  TYR A HB2  6  
ATOM 8107  H HB3  . TYR A 1 41  ? 2.338   -1.541  9.171   1.00 0.00 ? 41  TYR A HB3  6  
ATOM 8108  H HD1  . TYR A 1 41  ? 1.277   -3.741  8.755   1.00 0.00 ? 41  TYR A HD1  6  
ATOM 8109  H HD2  . TYR A 1 41  ? 5.390   -3.029  7.816   1.00 0.00 ? 41  TYR A HD2  6  
ATOM 8110  H HE1  . TYR A 1 41  ? 1.683   -6.246  8.599   1.00 0.00 ? 41  TYR A HE1  6  
ATOM 8111  H HE2  . TYR A 1 41  ? 5.782   -5.536  7.664   1.00 0.00 ? 41  TYR A HE2  6  
ATOM 8112  H HH   . TYR A 1 41  ? 4.225   -7.682  8.938   1.00 0.00 ? 41  TYR A HH   6  
ATOM 8113  N N    . VAL A 1 42  ? 0.207   -0.766  6.839   1.00 0.00 ? 42  VAL A N    6  
ATOM 8114  C CA   . VAL A 1 42  ? -1.066  -0.092  7.029   1.00 0.00 ? 42  VAL A CA   6  
ATOM 8115  C C    . VAL A 1 42  ? -1.510  -0.251  8.485   1.00 0.00 ? 42  VAL A C    6  
ATOM 8116  O O    . VAL A 1 42  ? -1.526  -1.361  9.015   1.00 0.00 ? 42  VAL A O    6  
ATOM 8117  C CB   . VAL A 1 42  ? -2.094  -0.625  6.029   1.00 0.00 ? 42  VAL A CB   6  
ATOM 8118  C CG1  . VAL A 1 42  ? -3.463  0.019   6.255   1.00 0.00 ? 42  VAL A CG1  6  
ATOM 8119  C CG2  . VAL A 1 42  ? -1.619  -0.413  4.590   1.00 0.00 ? 42  VAL A CG2  6  
ATOM 8120  H H    . VAL A 1 42  ? 0.166   -1.601  6.290   1.00 0.00 ? 42  VAL A H    6  
ATOM 8121  H HA   . VAL A 1 42  ? -0.912  0.967   6.823   1.00 0.00 ? 42  VAL A HA   6  
ATOM 8122  H HB   . VAL A 1 42  ? -2.197  -1.697  6.193   1.00 0.00 ? 42  VAL A HB   6  
ATOM 8123  H HG11 . VAL A 1 42  ? -4.191  -0.429  5.578   1.00 0.00 ? 42  VAL A HG11 6  
ATOM 8124  H HG12 . VAL A 1 42  ? -3.776  -0.145  7.286   1.00 0.00 ? 42  VAL A HG12 6  
ATOM 8125  H HG13 . VAL A 1 42  ? -3.398  1.090   6.061   1.00 0.00 ? 42  VAL A HG13 6  
ATOM 8126  H HG21 . VAL A 1 42  ? -2.469  -0.488  3.912   1.00 0.00 ? 42  VAL A HG21 6  
ATOM 8127  H HG22 . VAL A 1 42  ? -1.167  0.575   4.498   1.00 0.00 ? 42  VAL A HG22 6  
ATOM 8128  H HG23 . VAL A 1 42  ? -0.882  -1.175  4.334   1.00 0.00 ? 42  VAL A HG23 6  
ATOM 8129  N N    . LYS A 1 43  ? -1.861  0.874   9.089   1.00 0.00 ? 43  LYS A N    6  
ATOM 8130  C CA   . LYS A 1 43  ? -2.304  0.874   10.473  1.00 0.00 ? 43  LYS A CA   6  
ATOM 8131  C C    . LYS A 1 43  ? -3.826  0.725   10.516  1.00 0.00 ? 43  LYS A C    6  
ATOM 8132  O O    . LYS A 1 43  ? -4.368  0.116   11.438  1.00 0.00 ? 43  LYS A O    6  
ATOM 8133  C CB   . LYS A 1 43  ? -1.787  2.116   11.202  1.00 0.00 ? 43  LYS A CB   6  
ATOM 8134  C CG   . LYS A 1 43  ? -2.046  3.381   10.381  1.00 0.00 ? 43  LYS A CG   6  
ATOM 8135  C CD   . LYS A 1 43  ? -2.488  4.537   11.280  1.00 0.00 ? 43  LYS A CD   6  
ATOM 8136  C CE   . LYS A 1 43  ? -1.432  5.643   11.310  1.00 0.00 ? 43  LYS A CE   6  
ATOM 8137  N NZ   . LYS A 1 43  ? -0.943  5.856   12.691  1.00 0.00 ? 43  LYS A NZ   6  
ATOM 8138  H H    . LYS A 1 43  ? -1.845  1.773   8.651   1.00 0.00 ? 43  LYS A H    6  
ATOM 8139  H HA   . LYS A 1 43  ? -1.858  0.006   10.959  1.00 0.00 ? 43  LYS A HA   6  
ATOM 8140  H HB2  . LYS A 1 43  ? -2.274  2.202   12.173  1.00 0.00 ? 43  LYS A HB2  6  
ATOM 8141  H HB3  . LYS A 1 43  ? -0.718  2.012   11.390  1.00 0.00 ? 43  LYS A HB3  6  
ATOM 8142  H HG2  . LYS A 1 43  ? -1.141  3.660   9.842   1.00 0.00 ? 43  LYS A HG2  6  
ATOM 8143  H HG3  . LYS A 1 43  ? -2.814  3.183   9.633   1.00 0.00 ? 43  LYS A HG3  6  
ATOM 8144  H HD2  . LYS A 1 43  ? -3.434  4.941   10.920  1.00 0.00 ? 43  LYS A HD2  6  
ATOM 8145  H HD3  . LYS A 1 43  ? -2.664  4.169   12.291  1.00 0.00 ? 43  LYS A HD3  6  
ATOM 8146  H HE2  . LYS A 1 43  ? -0.599  5.377   10.660  1.00 0.00 ? 43  LYS A HE2  6  
ATOM 8147  H HE3  . LYS A 1 43  ? -1.856  6.569   10.922  1.00 0.00 ? 43  LYS A HE3  6  
ATOM 8148  H HZ1  . LYS A 1 43  ? -1.597  6.421   13.193  1.00 0.00 ? 43  LYS A HZ1  6  
ATOM 8149  H HZ2  . LYS A 1 43  ? -0.845  4.972   13.149  1.00 0.00 ? 43  LYS A HZ2  6  
ATOM 8150  H HZ3  . LYS A 1 43  ? -0.056  6.316   12.663  1.00 0.00 ? 43  LYS A HZ3  6  
ATOM 8151  N N    . SER A 1 44  ? -4.473  1.290   9.508   1.00 0.00 ? 44  SER A N    6  
ATOM 8152  C CA   . SER A 1 44  ? -5.922  1.228   9.419   1.00 0.00 ? 44  SER A CA   6  
ATOM 8153  C C    . SER A 1 44  ? -6.389  1.798   8.078   1.00 0.00 ? 44  SER A C    6  
ATOM 8154  O O    . SER A 1 44  ? -5.589  1.967   7.159   1.00 0.00 ? 44  SER A O    6  
ATOM 8155  C CB   . SER A 1 44  ? -6.578  1.986   10.575  1.00 0.00 ? 44  SER A CB   6  
ATOM 8156  O OG   . SER A 1 44  ? -6.417  3.396   10.448  1.00 0.00 ? 44  SER A OG   6  
ATOM 8157  H H    . SER A 1 44  ? -4.025  1.783   8.762   1.00 0.00 ? 44  SER A H    6  
ATOM 8158  H HA   . SER A 1 44  ? -6.170  0.169   9.492   1.00 0.00 ? 44  SER A HA   6  
ATOM 8159  H HB2  . SER A 1 44  ? -7.640  1.744   10.611  1.00 0.00 ? 44  SER A HB2  6  
ATOM 8160  H HB3  . SER A 1 44  ? -6.144  1.655   11.518  1.00 0.00 ? 44  SER A HB3  6  
ATOM 8161  H HG   . SER A 1 44  ? -7.092  3.870   11.014  1.00 0.00 ? 44  SER A HG   6  
ATOM 8162  N N    . VAL A 1 45  ? -7.682  2.077   8.008   1.00 0.00 ? 45  VAL A N    6  
ATOM 8163  C CA   . VAL A 1 45  ? -8.265  2.624   6.795   1.00 0.00 ? 45  VAL A CA   6  
ATOM 8164  C C    . VAL A 1 45  ? -9.149  3.820   7.153   1.00 0.00 ? 45  VAL A C    6  
ATOM 8165  O O    . VAL A 1 45  ? -9.877  3.784   8.144   1.00 0.00 ? 45  VAL A O    6  
ATOM 8166  C CB   . VAL A 1 45  ? -9.020  1.529   6.037   1.00 0.00 ? 45  VAL A CB   6  
ATOM 8167  C CG1  . VAL A 1 45  ? -8.167  0.964   4.899   1.00 0.00 ? 45  VAL A CG1  6  
ATOM 8168  C CG2  . VAL A 1 45  ? -9.473  0.418   6.986   1.00 0.00 ? 45  VAL A CG2  6  
ATOM 8169  H H    . VAL A 1 45  ? -8.326  1.936   8.760   1.00 0.00 ? 45  VAL A H    6  
ATOM 8170  H HA   . VAL A 1 45  ? -7.447  2.969   6.163   1.00 0.00 ? 45  VAL A HA   6  
ATOM 8171  H HB   . VAL A 1 45  ? -9.910  1.978   5.598   1.00 0.00 ? 45  VAL A HB   6  
ATOM 8172  H HG11 . VAL A 1 45  ? -7.357  0.365   5.315   1.00 0.00 ? 45  VAL A HG11 6  
ATOM 8173  H HG12 . VAL A 1 45  ? -8.788  0.339   4.256   1.00 0.00 ? 45  VAL A HG12 6  
ATOM 8174  H HG13 . VAL A 1 45  ? -7.750  1.784   4.315   1.00 0.00 ? 45  VAL A HG13 6  
ATOM 8175  H HG21 . VAL A 1 45  ? -9.959  0.860   7.857   1.00 0.00 ? 45  VAL A HG21 6  
ATOM 8176  H HG22 . VAL A 1 45  ? -10.177 -0.235  6.471   1.00 0.00 ? 45  VAL A HG22 6  
ATOM 8177  H HG23 . VAL A 1 45  ? -8.608  -0.161  7.308   1.00 0.00 ? 45  VAL A HG23 6  
ATOM 8178  N N    . VAL A 1 46  ? -9.057  4.852   6.327   1.00 0.00 ? 46  VAL A N    6  
ATOM 8179  C CA   . VAL A 1 46  ? -9.839  6.057   6.545   1.00 0.00 ? 46  VAL A CA   6  
ATOM 8180  C C    . VAL A 1 46  ? -11.325 5.696   6.579   1.00 0.00 ? 46  VAL A C    6  
ATOM 8181  O O    . VAL A 1 46  ? -12.149 6.483   7.043   1.00 0.00 ? 46  VAL A O    6  
ATOM 8182  C CB   . VAL A 1 46  ? -9.502  7.099   5.477   1.00 0.00 ? 46  VAL A CB   6  
ATOM 8183  C CG1  . VAL A 1 46  ? -10.612 8.146   5.362   1.00 0.00 ? 46  VAL A CG1  6  
ATOM 8184  C CG2  . VAL A 1 46  ? -8.153  7.761   5.763   1.00 0.00 ? 46  VAL A CG2  6  
ATOM 8185  H H    . VAL A 1 46  ? -8.462  4.873   5.523   1.00 0.00 ? 46  VAL A H    6  
ATOM 8186  H HA   . VAL A 1 46  ? -9.554  6.464   7.515   1.00 0.00 ? 46  VAL A HA   6  
ATOM 8187  H HB   . VAL A 1 46  ? -9.426  6.585   4.519   1.00 0.00 ? 46  VAL A HB   6  
ATOM 8188  H HG11 . VAL A 1 46  ? -10.640 8.747   6.271   1.00 0.00 ? 46  VAL A HG11 6  
ATOM 8189  H HG12 . VAL A 1 46  ? -10.417 8.791   4.505   1.00 0.00 ? 46  VAL A HG12 6  
ATOM 8190  H HG13 . VAL A 1 46  ? -11.571 7.645   5.229   1.00 0.00 ? 46  VAL A HG13 6  
ATOM 8191  H HG21 . VAL A 1 46  ? -8.265  8.845   5.732   1.00 0.00 ? 46  VAL A HG21 6  
ATOM 8192  H HG22 . VAL A 1 46  ? -7.802  7.460   6.750   1.00 0.00 ? 46  VAL A HG22 6  
ATOM 8193  H HG23 . VAL A 1 46  ? -7.428  7.450   5.010   1.00 0.00 ? 46  VAL A HG23 6  
ATOM 8194  N N    . LYS A 1 47  ? -11.624 4.504   6.083   1.00 0.00 ? 47  LYS A N    6  
ATOM 8195  C CA   . LYS A 1 47  ? -12.996 4.029   6.051   1.00 0.00 ? 47  LYS A CA   6  
ATOM 8196  C C    . LYS A 1 47  ? -13.842 4.981   5.202   1.00 0.00 ? 47  LYS A C    6  
ATOM 8197  O O    . LYS A 1 47  ? -14.978 5.292   5.557   1.00 0.00 ? 47  LYS A O    6  
ATOM 8198  C CB   . LYS A 1 47  ? -13.529 3.835   7.472   1.00 0.00 ? 47  LYS A CB   6  
ATOM 8199  C CG   . LYS A 1 47  ? -14.426 2.598   7.557   1.00 0.00 ? 47  LYS A CG   6  
ATOM 8200  C CD   . LYS A 1 47  ? -14.524 2.090   8.997   1.00 0.00 ? 47  LYS A CD   6  
ATOM 8201  C CE   . LYS A 1 47  ? -13.335 1.193   9.345   1.00 0.00 ? 47  LYS A CE   6  
ATOM 8202  N NZ   . LYS A 1 47  ? -13.550 -0.177  8.828   1.00 0.00 ? 47  LYS A NZ   6  
ATOM 8203  H H    . LYS A 1 47  ? -10.948 3.870   5.707   1.00 0.00 ? 47  LYS A H    6  
ATOM 8204  H HA   . LYS A 1 47  ? -12.992 3.050   5.572   1.00 0.00 ? 47  LYS A HA   6  
ATOM 8205  H HB2  . LYS A 1 47  ? -12.695 3.732   8.167   1.00 0.00 ? 47  LYS A HB2  6  
ATOM 8206  H HB3  . LYS A 1 47  ? -14.091 4.717   7.778   1.00 0.00 ? 47  LYS A HB3  6  
ATOM 8207  H HG2  . LYS A 1 47  ? -15.421 2.839   7.184   1.00 0.00 ? 47  LYS A HG2  6  
ATOM 8208  H HG3  . LYS A 1 47  ? -14.028 1.811   6.917   1.00 0.00 ? 47  LYS A HG3  6  
ATOM 8209  H HD2  . LYS A 1 47  ? -14.559 2.936   9.683   1.00 0.00 ? 47  LYS A HD2  6  
ATOM 8210  H HD3  . LYS A 1 47  ? -15.453 1.535   9.128   1.00 0.00 ? 47  LYS A HD3  6  
ATOM 8211  H HE2  . LYS A 1 47  ? -12.421 1.609   8.919   1.00 0.00 ? 47  LYS A HE2  6  
ATOM 8212  H HE3  . LYS A 1 47  ? -13.198 1.163   10.426  1.00 0.00 ? 47  LYS A HE3  6  
ATOM 8213  H HZ1  . LYS A 1 47  ? -14.470 -0.247  8.443   1.00 0.00 ? 47  LYS A HZ1  6  
ATOM 8214  H HZ2  . LYS A 1 47  ? -12.875 -0.375  8.117   1.00 0.00 ? 47  LYS A HZ2  6  
ATOM 8215  H HZ3  . LYS A 1 47  ? -13.450 -0.835  9.575   1.00 0.00 ? 47  LYS A HZ3  6  
ATOM 8216  N N    . GLY A 1 48  ? -13.255 5.417   4.097   1.00 0.00 ? 48  GLY A N    6  
ATOM 8217  C CA   . GLY A 1 48  ? -13.940 6.327   3.195   1.00 0.00 ? 48  GLY A CA   6  
ATOM 8218  C C    . GLY A 1 48  ? -13.211 6.421   1.853   1.00 0.00 ? 48  GLY A C    6  
ATOM 8219  O O    . GLY A 1 48  ? -13.292 7.439   1.169   1.00 0.00 ? 48  GLY A O    6  
ATOM 8220  H H    . GLY A 1 48  ? -12.330 5.160   3.816   1.00 0.00 ? 48  GLY A H    6  
ATOM 8221  H HA2  . GLY A 1 48  ? -14.962 5.986   3.035   1.00 0.00 ? 48  GLY A HA2  6  
ATOM 8222  H HA3  . GLY A 1 48  ? -14.001 7.317   3.649   1.00 0.00 ? 48  GLY A HA3  6  
ATOM 8223  N N    . GLY A 1 49  ? -12.517 5.343   1.517   1.00 0.00 ? 49  GLY A N    6  
ATOM 8224  C CA   . GLY A 1 49  ? -11.775 5.291   0.269   1.00 0.00 ? 49  GLY A CA   6  
ATOM 8225  C C    . GLY A 1 49  ? -11.892 3.910   -0.381  1.00 0.00 ? 49  GLY A C    6  
ATOM 8226  O O    . GLY A 1 49  ? -12.178 2.924   0.296   1.00 0.00 ? 49  GLY A O    6  
ATOM 8227  H H    . GLY A 1 49  ? -12.457 4.519   2.079   1.00 0.00 ? 49  GLY A H    6  
ATOM 8228  H HA2  . GLY A 1 49  ? -12.152 6.051   -0.415  1.00 0.00 ? 49  GLY A HA2  6  
ATOM 8229  H HA3  . GLY A 1 49  ? -10.726 5.521   0.455   1.00 0.00 ? 49  GLY A HA3  6  
ATOM 8230  N N    . ALA A 1 50  ? -11.664 3.885   -1.686  1.00 0.00 ? 50  ALA A N    6  
ATOM 8231  C CA   . ALA A 1 50  ? -11.740 2.642   -2.434  1.00 0.00 ? 50  ALA A CA   6  
ATOM 8232  C C    . ALA A 1 50  ? -11.133 1.511   -1.601  1.00 0.00 ? 50  ALA A C    6  
ATOM 8233  O O    . ALA A 1 50  ? -11.617 0.381   -1.636  1.00 0.00 ? 50  ALA A O    6  
ATOM 8234  C CB   . ALA A 1 50  ? -11.038 2.814   -3.783  1.00 0.00 ? 50  ALA A CB   6  
ATOM 8235  H H    . ALA A 1 50  ? -11.432 4.691   -2.229  1.00 0.00 ? 50  ALA A H    6  
ATOM 8236  H HA   . ALA A 1 50  ? -12.794 2.425   -2.612  1.00 0.00 ? 50  ALA A HA   6  
ATOM 8237  H HB1  . ALA A 1 50  ? -9.960  2.857   -3.628  1.00 0.00 ? 50  ALA A HB1  6  
ATOM 8238  H HB2  . ALA A 1 50  ? -11.279 1.969   -4.428  1.00 0.00 ? 50  ALA A HB2  6  
ATOM 8239  H HB3  . ALA A 1 50  ? -11.375 3.737   -4.253  1.00 0.00 ? 50  ALA A HB3  6  
ATOM 8240  N N    . ALA A 1 51  ? -10.082 1.856   -0.871  1.00 0.00 ? 51  ALA A N    6  
ATOM 8241  C CA   . ALA A 1 51  ? -9.404  0.884   -0.030  1.00 0.00 ? 51  ALA A CA   6  
ATOM 8242  C C    . ALA A 1 51  ? -10.421 0.230   0.908   1.00 0.00 ? 51  ALA A C    6  
ATOM 8243  O O    . ALA A 1 51  ? -10.820 -0.914  0.696   1.00 0.00 ? 51  ALA A O    6  
ATOM 8244  C CB   . ALA A 1 51  ? -8.267  1.571   0.729   1.00 0.00 ? 51  ALA A CB   6  
ATOM 8245  H H    . ALA A 1 51  ? -9.695  2.778   -0.848  1.00 0.00 ? 51  ALA A H    6  
ATOM 8246  H HA   . ALA A 1 51  ? -8.980  0.120   -0.682  1.00 0.00 ? 51  ALA A HA   6  
ATOM 8247  H HB1  . ALA A 1 51  ? -8.677  2.117   1.580   1.00 0.00 ? 51  ALA A HB1  6  
ATOM 8248  H HB2  . ALA A 1 51  ? -7.562  0.820   1.085   1.00 0.00 ? 51  ALA A HB2  6  
ATOM 8249  H HB3  . ALA A 1 51  ? -7.755  2.266   0.065   1.00 0.00 ? 51  ALA A HB3  6  
ATOM 8250  N N    . ASP A 1 52  ? -10.810 0.985   1.925   1.00 0.00 ? 52  ASP A N    6  
ATOM 8251  C CA   . ASP A 1 52  ? -11.773 0.493   2.896   1.00 0.00 ? 52  ASP A CA   6  
ATOM 8252  C C    . ASP A 1 52  ? -13.133 0.320   2.218   1.00 0.00 ? 52  ASP A C    6  
ATOM 8253  O O    . ASP A 1 52  ? -14.068 -0.208  2.818   1.00 0.00 ? 52  ASP A O    6  
ATOM 8254  C CB   . ASP A 1 52  ? -11.943 1.482   4.052   1.00 0.00 ? 52  ASP A CB   6  
ATOM 8255  C CG   . ASP A 1 52  ? -12.125 0.841   5.429   1.00 0.00 ? 52  ASP A CG   6  
ATOM 8256  O OD1  . ASP A 1 52  ? -12.573 -0.326  5.458   1.00 0.00 ? 52  ASP A OD1  6  
ATOM 8257  O OD2  . ASP A 1 52  ? -11.812 1.533   6.422   1.00 0.00 ? 52  ASP A OD2  6  
ATOM 8258  H H    . ASP A 1 52  ? -10.481 1.915   2.090   1.00 0.00 ? 52  ASP A H    6  
ATOM 8259  H HA   . ASP A 1 52  ? -11.362 -0.451  3.254   1.00 0.00 ? 52  ASP A HA   6  
ATOM 8260  H HB2  . ASP A 1 52  ? -11.071 2.134   4.083   1.00 0.00 ? 52  ASP A HB2  6  
ATOM 8261  H HB3  . ASP A 1 52  ? -12.807 2.114   3.845   1.00 0.00 ? 52  ASP A HB3  6  
ATOM 8262  N N    . VAL A 1 53  ? -13.200 0.774   0.975   1.00 0.00 ? 53  VAL A N    6  
ATOM 8263  C CA   . VAL A 1 53  ? -14.430 0.675   0.208   1.00 0.00 ? 53  VAL A CA   6  
ATOM 8264  C C    . VAL A 1 53  ? -14.447 -0.652  -0.553  1.00 0.00 ? 53  VAL A C    6  
ATOM 8265  O O    . VAL A 1 53  ? -15.512 -1.209  -0.813  1.00 0.00 ? 53  VAL A O    6  
ATOM 8266  C CB   . VAL A 1 53  ? -14.574 1.892   -0.709  1.00 0.00 ? 53  VAL A CB   6  
ATOM 8267  C CG1  . VAL A 1 53  ? -14.921 1.465   -2.137  1.00 0.00 ? 53  VAL A CG1  6  
ATOM 8268  C CG2  . VAL A 1 53  ? -15.614 2.871   -0.162  1.00 0.00 ? 53  VAL A CG2  6  
ATOM 8269  H H    . VAL A 1 53  ? -12.435 1.201   0.493   1.00 0.00 ? 53  VAL A H    6  
ATOM 8270  H HA   . VAL A 1 53  ? -15.260 0.685   0.914   1.00 0.00 ? 53  VAL A HA   6  
ATOM 8271  H HB   . VAL A 1 53  ? -13.613 2.405   -0.738  1.00 0.00 ? 53  VAL A HB   6  
ATOM 8272  H HG11 . VAL A 1 53  ? -14.997 2.347   -2.772  1.00 0.00 ? 53  VAL A HG11 6  
ATOM 8273  H HG12 . VAL A 1 53  ? -14.140 0.807   -2.519  1.00 0.00 ? 53  VAL A HG12 6  
ATOM 8274  H HG13 . VAL A 1 53  ? -15.874 0.935   -2.136  1.00 0.00 ? 53  VAL A HG13 6  
ATOM 8275  H HG21 . VAL A 1 53  ? -16.232 3.240   -0.980  1.00 0.00 ? 53  VAL A HG21 6  
ATOM 8276  H HG22 . VAL A 1 53  ? -16.244 2.362   0.568   1.00 0.00 ? 53  VAL A HG22 6  
ATOM 8277  H HG23 . VAL A 1 53  ? -15.108 3.709   0.318   1.00 0.00 ? 53  VAL A HG23 6  
ATOM 8278  N N    . ASP A 1 54  ? -13.254 -1.120  -0.889  1.00 0.00 ? 54  ASP A N    6  
ATOM 8279  C CA   . ASP A 1 54  ? -13.118 -2.371  -1.615  1.00 0.00 ? 54  ASP A CA   6  
ATOM 8280  C C    . ASP A 1 54  ? -13.107 -3.534  -0.621  1.00 0.00 ? 54  ASP A C    6  
ATOM 8281  O O    . ASP A 1 54  ? -12.777 -4.662  -0.983  1.00 0.00 ? 54  ASP A O    6  
ATOM 8282  C CB   . ASP A 1 54  ? -11.808 -2.411  -2.404  1.00 0.00 ? 54  ASP A CB   6  
ATOM 8283  C CG   . ASP A 1 54  ? -11.611 -3.658  -3.269  1.00 0.00 ? 54  ASP A CG   6  
ATOM 8284  O OD1  . ASP A 1 54  ? -12.600 -4.058  -3.920  1.00 0.00 ? 54  ASP A OD1  6  
ATOM 8285  O OD2  . ASP A 1 54  ? -10.477 -4.182  -3.259  1.00 0.00 ? 54  ASP A OD2  6  
ATOM 8286  H H    . ASP A 1 54  ? -12.392 -0.660  -0.674  1.00 0.00 ? 54  ASP A H    6  
ATOM 8287  H HA   . ASP A 1 54  ? -13.975 -2.406  -2.288  1.00 0.00 ? 54  ASP A HA   6  
ATOM 8288  H HB2  . ASP A 1 54  ? -11.760 -1.531  -3.045  1.00 0.00 ? 54  ASP A HB2  6  
ATOM 8289  H HB3  . ASP A 1 54  ? -10.976 -2.339  -1.702  1.00 0.00 ? 54  ASP A HB3  6  
ATOM 8290  N N    . GLY A 1 55  ? -13.472 -3.219  0.613   1.00 0.00 ? 55  GLY A N    6  
ATOM 8291  C CA   . GLY A 1 55  ? -13.508 -4.224  1.663   1.00 0.00 ? 55  GLY A CA   6  
ATOM 8292  C C    . GLY A 1 55  ? -12.349 -5.212  1.515   1.00 0.00 ? 55  GLY A C    6  
ATOM 8293  O O    . GLY A 1 55  ? -12.552 -6.424  1.568   1.00 0.00 ? 55  GLY A O    6  
ATOM 8294  H H    . GLY A 1 55  ? -13.739 -2.299  0.900   1.00 0.00 ? 55  GLY A H    6  
ATOM 8295  H HA2  . GLY A 1 55  ? -13.455 -3.739  2.637   1.00 0.00 ? 55  GLY A HA2  6  
ATOM 8296  H HA3  . GLY A 1 55  ? -14.456 -4.760  1.624   1.00 0.00 ? 55  GLY A HA3  6  
ATOM 8297  N N    . ARG A 1 56  ? -11.160 -4.657  1.333   1.00 0.00 ? 56  ARG A N    6  
ATOM 8298  C CA   . ARG A 1 56  ? -9.969  -5.475  1.178   1.00 0.00 ? 56  ARG A CA   6  
ATOM 8299  C C    . ARG A 1 56  ? -8.787  -4.836  1.911   1.00 0.00 ? 56  ARG A C    6  
ATOM 8300  O O    . ARG A 1 56  ? -7.999  -5.532  2.549   1.00 0.00 ? 56  ARG A O    6  
ATOM 8301  C CB   . ARG A 1 56  ? -9.610  -5.650  -0.299  1.00 0.00 ? 56  ARG A CB   6  
ATOM 8302  C CG   . ARG A 1 56  ? -9.381  -7.125  -0.637  1.00 0.00 ? 56  ARG A CG   6  
ATOM 8303  C CD   . ARG A 1 56  ? -8.760  -7.279  -2.026  1.00 0.00 ? 56  ARG A CD   6  
ATOM 8304  N NE   . ARG A 1 56  ? -9.824  -7.455  -3.040  1.00 0.00 ? 56  ARG A NE   6  
ATOM 8305  C CZ   . ARG A 1 56  ? -9.595  -7.582  -4.354  1.00 0.00 ? 56  ARG A CZ   6  
ATOM 8306  N NH1  . ARG A 1 56  ? -8.340  -7.553  -4.822  1.00 0.00 ? 56  ARG A NH1  6  
ATOM 8307  N NH2  . ARG A 1 56  ? -10.623 -7.737  -5.201  1.00 0.00 ? 56  ARG A NH2  6  
ATOM 8308  H H    . ARG A 1 56  ? -11.003 -3.671  1.291   1.00 0.00 ? 56  ARG A H    6  
ATOM 8309  H HA   . ARG A 1 56  ? -10.231 -6.436  1.620   1.00 0.00 ? 56  ARG A HA   6  
ATOM 8310  H HB2  . ARG A 1 56  ? -10.410 -5.251  -0.922  1.00 0.00 ? 56  ARG A HB2  6  
ATOM 8311  H HB3  . ARG A 1 56  ? -8.711  -5.077  -0.529  1.00 0.00 ? 56  ARG A HB3  6  
ATOM 8312  H HG2  . ARG A 1 56  ? -8.728  -7.576  0.110   1.00 0.00 ? 56  ARG A HG2  6  
ATOM 8313  H HG3  . ARG A 1 56  ? -10.329 -7.662  -0.596  1.00 0.00 ? 56  ARG A HG3  6  
ATOM 8314  H HD2  . ARG A 1 56  ? -8.160  -6.401  -2.265  1.00 0.00 ? 56  ARG A HD2  6  
ATOM 8315  H HD3  . ARG A 1 56  ? -8.088  -8.138  -2.040  1.00 0.00 ? 56  ARG A HD3  6  
ATOM 8316  H HE   . ARG A 1 56  ? -10.772 -7.481  -2.724  1.00 0.00 ? 56  ARG A HE   6  
ATOM 8317  H HH11 . ARG A 1 56  ? -7.574  -7.437  -4.190  1.00 0.00 ? 56  ARG A HH11 6  
ATOM 8318  H HH12 . ARG A 1 56  ? -8.170  -7.648  -5.803  1.00 0.00 ? 56  ARG A HH12 6  
ATOM 8319  H HH21 . ARG A 1 56  ? -11.559 -7.759  -4.851  1.00 0.00 ? 56  ARG A HH21 6  
ATOM 8320  H HH22 . ARG A 1 56  ? -10.452 -7.832  -6.181  1.00 0.00 ? 56  ARG A HH22 6  
ATOM 8321  N N    . LEU A 1 57  ? -8.702  -3.519  1.795   1.00 0.00 ? 57  LEU A N    6  
ATOM 8322  C CA   . LEU A 1 57  ? -7.630  -2.779  2.438   1.00 0.00 ? 57  LEU A CA   6  
ATOM 8323  C C    . LEU A 1 57  ? -7.858  -2.772  3.951   1.00 0.00 ? 57  LEU A C    6  
ATOM 8324  O O    . LEU A 1 57  ? -8.965  -3.038  4.417   1.00 0.00 ? 57  LEU A O    6  
ATOM 8325  C CB   . LEU A 1 57  ? -7.503  -1.381  1.828   1.00 0.00 ? 57  LEU A CB   6  
ATOM 8326  C CG   . LEU A 1 57  ? -6.482  -1.233  0.699   1.00 0.00 ? 57  LEU A CG   6  
ATOM 8327  C CD1  . LEU A 1 57  ? -5.257  -0.445  1.167   1.00 0.00 ? 57  LEU A CD1  6  
ATOM 8328  C CD2  . LEU A 1 57  ? -6.101  -2.597  0.121   1.00 0.00 ? 57  LEU A CD2  6  
ATOM 8329  H H    . LEU A 1 57  ? -9.348  -2.961  1.274   1.00 0.00 ? 57  LEU A H    6  
ATOM 8330  H HA   . LEU A 1 57  ? -6.699  -3.306  2.231   1.00 0.00 ? 57  LEU A HA   6  
ATOM 8331  H HB2  . LEU A 1 57  ? -8.480  -1.081  1.450   1.00 0.00 ? 57  LEU A HB2  6  
ATOM 8332  H HB3  . LEU A 1 57  ? -7.241  -0.683  2.623   1.00 0.00 ? 57  LEU A HB3  6  
ATOM 8333  H HG   . LEU A 1 57  ? -6.944  -0.660  -0.106  1.00 0.00 ? 57  LEU A HG   6  
ATOM 8334  H HD11 . LEU A 1 57  ? -4.431  -0.612  0.475   1.00 0.00 ? 57  LEU A HD11 6  
ATOM 8335  H HD12 . LEU A 1 57  ? -5.497  0.617   1.197   1.00 0.00 ? 57  LEU A HD12 6  
ATOM 8336  H HD13 . LEU A 1 57  ? -4.969  -0.781  2.164   1.00 0.00 ? 57  LEU A HD13 6  
ATOM 8337  H HD21 . LEU A 1 57  ? -5.351  -3.065  0.760   1.00 0.00 ? 57  LEU A HD21 6  
ATOM 8338  H HD22 . LEU A 1 57  ? -6.985  -3.232  0.074   1.00 0.00 ? 57  LEU A HD22 6  
ATOM 8339  H HD23 . LEU A 1 57  ? -5.693  -2.466  -0.881  1.00 0.00 ? 57  LEU A HD23 6  
ATOM 8340  N N    . ALA A 1 58  ? -6.793  -2.464  4.676   1.00 0.00 ? 58  ALA A N    6  
ATOM 8341  C CA   . ALA A 1 58  ? -6.862  -2.419  6.127   1.00 0.00 ? 58  ALA A CA   6  
ATOM 8342  C C    . ALA A 1 58  ? -5.448  -2.507  6.704   1.00 0.00 ? 58  ALA A C    6  
ATOM 8343  O O    . ALA A 1 58  ? -4.475  -2.610  5.959   1.00 0.00 ? 58  ALA A O    6  
ATOM 8344  C CB   . ALA A 1 58  ? -7.769  -3.544  6.630   1.00 0.00 ? 58  ALA A CB   6  
ATOM 8345  H H    . ALA A 1 58  ? -5.896  -2.249  4.289   1.00 0.00 ? 58  ALA A H    6  
ATOM 8346  H HA   . ALA A 1 58  ? -7.301  -1.462  6.408   1.00 0.00 ? 58  ALA A HA   6  
ATOM 8347  H HB1  . ALA A 1 58  ? -7.696  -4.398  5.957   1.00 0.00 ? 58  ALA A HB1  6  
ATOM 8348  H HB2  . ALA A 1 58  ? -7.457  -3.841  7.631   1.00 0.00 ? 58  ALA A HB2  6  
ATOM 8349  H HB3  . ALA A 1 58  ? -8.801  -3.193  6.660   1.00 0.00 ? 58  ALA A HB3  6  
ATOM 8350  N N    . ALA A 1 59  ? -5.380  -2.465  8.027   1.00 0.00 ? 59  ALA A N    6  
ATOM 8351  C CA   . ALA A 1 59  ? -4.101  -2.539  8.713   1.00 0.00 ? 59  ALA A CA   6  
ATOM 8352  C C    . ALA A 1 59  ? -3.411  -3.857  8.354   1.00 0.00 ? 59  ALA A C    6  
ATOM 8353  O O    . ALA A 1 59  ? -4.052  -4.905  8.305   1.00 0.00 ? 59  ALA A O    6  
ATOM 8354  C CB   . ALA A 1 59  ? -4.320  -2.387  10.219  1.00 0.00 ? 59  ALA A CB   6  
ATOM 8355  H H    . ALA A 1 59  ? -6.176  -2.382  8.625   1.00 0.00 ? 59  ALA A H    6  
ATOM 8356  H HA   . ALA A 1 59  ? -3.488  -1.710  8.362   1.00 0.00 ? 59  ALA A HA   6  
ATOM 8357  H HB1  . ALA A 1 59  ? -3.554  -1.731  10.633  1.00 0.00 ? 59  ALA A HB1  6  
ATOM 8358  H HB2  . ALA A 1 59  ? -5.305  -1.957  10.402  1.00 0.00 ? 59  ALA A HB2  6  
ATOM 8359  H HB3  . ALA A 1 59  ? -4.257  -3.365  10.696  1.00 0.00 ? 59  ALA A HB3  6  
ATOM 8360  N N    . GLY A 1 60  ? -2.111  -3.760  8.112   1.00 0.00 ? 60  GLY A N    6  
ATOM 8361  C CA   . GLY A 1 60  ? -1.327  -4.931  7.759   1.00 0.00 ? 60  GLY A CA   6  
ATOM 8362  C C    . GLY A 1 60  ? -1.253  -5.104  6.241   1.00 0.00 ? 60  GLY A C    6  
ATOM 8363  O O    . GLY A 1 60  ? -1.363  -6.220  5.734   1.00 0.00 ? 60  GLY A O    6  
ATOM 8364  H H    . GLY A 1 60  ? -1.597  -2.904  8.154   1.00 0.00 ? 60  GLY A H    6  
ATOM 8365  H HA2  . GLY A 1 60  ? -0.321  -4.835  8.167   1.00 0.00 ? 60  GLY A HA2  6  
ATOM 8366  H HA3  . GLY A 1 60  ? -1.770  -5.819  8.209   1.00 0.00 ? 60  GLY A HA3  6  
ATOM 8367  N N    . ASP A 1 61  ? -1.068  -3.985  5.557   1.00 0.00 ? 61  ASP A N    6  
ATOM 8368  C CA   . ASP A 1 61  ? -0.979  -3.999  4.107   1.00 0.00 ? 61  ASP A CA   6  
ATOM 8369  C C    . ASP A 1 61  ? 0.399   -3.490  3.680   1.00 0.00 ? 61  ASP A C    6  
ATOM 8370  O O    . ASP A 1 61  ? 0.527   -2.368  3.192   1.00 0.00 ? 61  ASP A O    6  
ATOM 8371  C CB   . ASP A 1 61  ? -2.035  -3.085  3.481   1.00 0.00 ? 61  ASP A CB   6  
ATOM 8372  C CG   . ASP A 1 61  ? -3.056  -3.794  2.589   1.00 0.00 ? 61  ASP A CG   6  
ATOM 8373  O OD1  . ASP A 1 61  ? -3.721  -4.716  3.109   1.00 0.00 ? 61  ASP A OD1  6  
ATOM 8374  O OD2  . ASP A 1 61  ? -3.148  -3.398  1.407   1.00 0.00 ? 61  ASP A OD2  6  
ATOM 8375  H H    . ASP A 1 61  ? -0.980  -3.081  5.977   1.00 0.00 ? 61  ASP A H    6  
ATOM 8376  H HA   . ASP A 1 61  ? -1.148  -5.036  3.820   1.00 0.00 ? 61  ASP A HA   6  
ATOM 8377  H HB2  . ASP A 1 61  ? -2.568  -2.571  4.280   1.00 0.00 ? 61  ASP A HB2  6  
ATOM 8378  H HB3  . ASP A 1 61  ? -1.529  -2.321  2.892   1.00 0.00 ? 61  ASP A HB3  6  
ATOM 8379  N N    . GLN A 1 62  ? 1.396   -4.339  3.880   1.00 0.00 ? 62  GLN A N    6  
ATOM 8380  C CA   . GLN A 1 62  ? 2.761   -3.989  3.522   1.00 0.00 ? 62  GLN A CA   6  
ATOM 8381  C C    . GLN A 1 62  ? 2.877   -3.788  2.010   1.00 0.00 ? 62  GLN A C    6  
ATOM 8382  O O    . GLN A 1 62  ? 2.797   -4.748  1.244   1.00 0.00 ? 62  GLN A O    6  
ATOM 8383  C CB   . GLN A 1 62  ? 3.746   -5.053  4.011   1.00 0.00 ? 62  GLN A CB   6  
ATOM 8384  C CG   . GLN A 1 62  ? 5.183   -4.681  3.639   1.00 0.00 ? 62  GLN A CG   6  
ATOM 8385  C CD   . GLN A 1 62  ? 5.936   -5.893  3.088   1.00 0.00 ? 62  GLN A CD   6  
ATOM 8386  O OE1  . GLN A 1 62  ? 5.803   -7.009  3.563   1.00 0.00 ? 62  GLN A OE1  6  
ATOM 8387  N NE2  . GLN A 1 62  ? 6.734   -5.613  2.061   1.00 0.00 ? 62  GLN A NE2  6  
ATOM 8388  H H    . GLN A 1 62  ? 1.284   -5.250  4.278   1.00 0.00 ? 62  GLN A H    6  
ATOM 8389  H HA   . GLN A 1 62  ? 2.963   -3.050  4.037   1.00 0.00 ? 62  GLN A HA   6  
ATOM 8390  H HB2  . GLN A 1 62  ? 3.662   -5.160  5.093   1.00 0.00 ? 62  GLN A HB2  6  
ATOM 8391  H HB3  . GLN A 1 62  ? 3.491   -6.018  3.575   1.00 0.00 ? 62  GLN A HB3  6  
ATOM 8392  H HG2  . GLN A 1 62  ? 5.175   -3.884  2.897   1.00 0.00 ? 62  GLN A HG2  6  
ATOM 8393  H HG3  . GLN A 1 62  ? 5.701   -4.295  4.517   1.00 0.00 ? 62  GLN A HG3  6  
ATOM 8394  H HE21 . GLN A 1 62  ? 6.798   -4.675  1.719   1.00 0.00 ? 62  GLN A HE21 6  
ATOM 8395  H HE22 . GLN A 1 62  ? 7.270   -6.339  1.631   1.00 0.00 ? 62  GLN A HE22 6  
ATOM 8396  N N    . LEU A 1 63  ? 3.066   -2.535  1.624   1.00 0.00 ? 63  LEU A N    6  
ATOM 8397  C CA   . LEU A 1 63  ? 3.194   -2.196  0.217   1.00 0.00 ? 63  LEU A CA   6  
ATOM 8398  C C    . LEU A 1 63  ? 4.631   -2.463  -0.238  1.00 0.00 ? 63  LEU A C    6  
ATOM 8399  O O    . LEU A 1 63  ? 5.562   -1.798  0.213   1.00 0.00 ? 63  LEU A O    6  
ATOM 8400  C CB   . LEU A 1 63  ? 2.727   -0.761  -0.033  1.00 0.00 ? 63  LEU A CB   6  
ATOM 8401  C CG   . LEU A 1 63  ? 1.249   -0.478  0.246   1.00 0.00 ? 63  LEU A CG   6  
ATOM 8402  C CD1  . LEU A 1 63  ? 1.083   0.386   1.498   1.00 0.00 ? 63  LEU A CD1  6  
ATOM 8403  C CD2  . LEU A 1 63  ? 0.570   0.145   -0.975  1.00 0.00 ? 63  LEU A CD2  6  
ATOM 8404  H H    . LEU A 1 63  ? 3.130   -1.760  2.253   1.00 0.00 ? 63  LEU A H    6  
ATOM 8405  H HA   . LEU A 1 63  ? 2.527   -2.854  -0.340  1.00 0.00 ? 63  LEU A HA   6  
ATOM 8406  H HB2  . LEU A 1 63  ? 3.327   -0.091  0.583   1.00 0.00 ? 63  LEU A HB2  6  
ATOM 8407  H HB3  . LEU A 1 63  ? 2.935   -0.508  -1.073  1.00 0.00 ? 63  LEU A HB3  6  
ATOM 8408  H HG   . LEU A 1 63  ? 0.751   -1.428  0.442   1.00 0.00 ? 63  LEU A HG   6  
ATOM 8409  H HD11 . LEU A 1 63  ? 0.023   0.559   1.681   1.00 0.00 ? 63  LEU A HD11 6  
ATOM 8410  H HD12 . LEU A 1 63  ? 1.521   -0.127  2.354   1.00 0.00 ? 63  LEU A HD12 6  
ATOM 8411  H HD13 . LEU A 1 63  ? 1.587   1.341   1.349   1.00 0.00 ? 63  LEU A HD13 6  
ATOM 8412  H HD21 . LEU A 1 63  ? 1.325   0.586   -1.626  1.00 0.00 ? 63  LEU A HD21 6  
ATOM 8413  H HD22 . LEU A 1 63  ? 0.026   -0.626  -1.521  1.00 0.00 ? 63  LEU A HD22 6  
ATOM 8414  H HD23 . LEU A 1 63  ? -0.125  0.919   -0.649  1.00 0.00 ? 63  LEU A HD23 6  
ATOM 8415  N N    . LEU A 1 64  ? 4.765   -3.438  -1.125  1.00 0.00 ? 64  LEU A N    6  
ATOM 8416  C CA   . LEU A 1 64  ? 6.072   -3.801  -1.646  1.00 0.00 ? 64  LEU A CA   6  
ATOM 8417  C C    . LEU A 1 64  ? 6.458   -2.830  -2.764  1.00 0.00 ? 64  LEU A C    6  
ATOM 8418  O O    . LEU A 1 64  ? 7.632   -2.499  -2.925  1.00 0.00 ? 64  LEU A O    6  
ATOM 8419  C CB   . LEU A 1 64  ? 6.088   -5.270  -2.074  1.00 0.00 ? 64  LEU A CB   6  
ATOM 8420  C CG   . LEU A 1 64  ? 7.056   -6.179  -1.313  1.00 0.00 ? 64  LEU A CG   6  
ATOM 8421  C CD1  . LEU A 1 64  ? 6.443   -7.562  -1.086  1.00 0.00 ? 64  LEU A CD1  6  
ATOM 8422  C CD2  . LEU A 1 64  ? 8.407   -6.260  -2.026  1.00 0.00 ? 64  LEU A CD2  6  
ATOM 8423  H H    . LEU A 1 64  ? 4.002   -3.974  -1.487  1.00 0.00 ? 64  LEU A H    6  
ATOM 8424  H HA   . LEU A 1 64  ? 6.789   -3.694  -0.832  1.00 0.00 ? 64  LEU A HA   6  
ATOM 8425  H HB2  . LEU A 1 64  ? 5.081   -5.671  -1.964  1.00 0.00 ? 64  LEU A HB2  6  
ATOM 8426  H HB3  . LEU A 1 64  ? 6.336   -5.316  -3.135  1.00 0.00 ? 64  LEU A HB3  6  
ATOM 8427  H HG   . LEU A 1 64  ? 7.235   -5.741  -0.331  1.00 0.00 ? 64  LEU A HG   6  
ATOM 8428  H HD11 . LEU A 1 64  ? 5.434   -7.452  -0.690  1.00 0.00 ? 64  LEU A HD11 6  
ATOM 8429  H HD12 . LEU A 1 64  ? 6.406   -8.103  -2.032  1.00 0.00 ? 64  LEU A HD12 6  
ATOM 8430  H HD13 . LEU A 1 64  ? 7.054   -8.118  -0.374  1.00 0.00 ? 64  LEU A HD13 6  
ATOM 8431  H HD21 . LEU A 1 64  ? 8.539   -7.259  -2.441  1.00 0.00 ? 64  LEU A HD21 6  
ATOM 8432  H HD22 . LEU A 1 64  ? 8.438   -5.526  -2.830  1.00 0.00 ? 64  LEU A HD22 6  
ATOM 8433  H HD23 . LEU A 1 64  ? 9.206   -6.054  -1.314  1.00 0.00 ? 64  LEU A HD23 6  
ATOM 8434  N N    . SER A 1 65  ? 5.448   -2.401  -3.507  1.00 0.00 ? 65  SER A N    6  
ATOM 8435  C CA   . SER A 1 65  ? 5.668   -1.475  -4.605  1.00 0.00 ? 65  SER A CA   6  
ATOM 8436  C C    . SER A 1 65  ? 4.354   -0.785  -4.978  1.00 0.00 ? 65  SER A C    6  
ATOM 8437  O O    . SER A 1 65  ? 3.275   -1.282  -4.658  1.00 0.00 ? 65  SER A O    6  
ATOM 8438  C CB   . SER A 1 65  ? 6.254   -2.193  -5.822  1.00 0.00 ? 65  SER A CB   6  
ATOM 8439  O OG   . SER A 1 65  ? 5.690   -3.489  -6.001  1.00 0.00 ? 65  SER A OG   6  
ATOM 8440  H H    . SER A 1 65  ? 4.497   -2.676  -3.369  1.00 0.00 ? 65  SER A H    6  
ATOM 8441  H HA   . SER A 1 65  ? 6.388   -0.749  -4.230  1.00 0.00 ? 65  SER A HA   6  
ATOM 8442  H HB2  . SER A 1 65  ? 6.079   -1.594  -6.716  1.00 0.00 ? 65  SER A HB2  6  
ATOM 8443  H HB3  . SER A 1 65  ? 7.335   -2.281  -5.705  1.00 0.00 ? 65  SER A HB3  6  
ATOM 8444  H HG   . SER A 1 65  ? 5.523   -3.658  -6.973  1.00 0.00 ? 65  SER A HG   6  
ATOM 8445  N N    . VAL A 1 66  ? 4.488   0.349   -5.650  1.00 0.00 ? 66  VAL A N    6  
ATOM 8446  C CA   . VAL A 1 66  ? 3.325   1.112   -6.070  1.00 0.00 ? 66  VAL A CA   6  
ATOM 8447  C C    . VAL A 1 66  ? 3.604   1.750   -7.432  1.00 0.00 ? 66  VAL A C    6  
ATOM 8448  O O    . VAL A 1 66  ? 4.571   2.494   -7.587  1.00 0.00 ? 66  VAL A O    6  
ATOM 8449  C CB   . VAL A 1 66  ? 2.955   2.136   -4.995  1.00 0.00 ? 66  VAL A CB   6  
ATOM 8450  C CG1  . VAL A 1 66  ? 1.751   2.975   -5.428  1.00 0.00 ? 66  VAL A CG1  6  
ATOM 8451  C CG2  . VAL A 1 66  ? 2.691   1.450   -3.653  1.00 0.00 ? 66  VAL A CG2  6  
ATOM 8452  H H    . VAL A 1 66  ? 5.369   0.746   -5.906  1.00 0.00 ? 66  VAL A H    6  
ATOM 8453  H HA   . VAL A 1 66  ? 2.494   0.415   -6.173  1.00 0.00 ? 66  VAL A HA   6  
ATOM 8454  H HB   . VAL A 1 66  ? 3.803   2.808   -4.866  1.00 0.00 ? 66  VAL A HB   6  
ATOM 8455  H HG11 . VAL A 1 66  ? 1.746   3.068   -6.514  1.00 0.00 ? 66  VAL A HG11 6  
ATOM 8456  H HG12 . VAL A 1 66  ? 0.832   2.488   -5.101  1.00 0.00 ? 66  VAL A HG12 6  
ATOM 8457  H HG13 . VAL A 1 66  ? 1.818   3.965   -4.979  1.00 0.00 ? 66  VAL A HG13 6  
ATOM 8458  H HG21 . VAL A 1 66  ? 1.905   0.705   -3.774  1.00 0.00 ? 66  VAL A HG21 6  
ATOM 8459  H HG22 . VAL A 1 66  ? 3.603   0.963   -3.308  1.00 0.00 ? 66  VAL A HG22 6  
ATOM 8460  H HG23 . VAL A 1 66  ? 2.377   2.194   -2.920  1.00 0.00 ? 66  VAL A HG23 6  
ATOM 8461  N N    . ASP A 1 67  ? 2.740   1.435   -8.386  1.00 0.00 ? 67  ASP A N    6  
ATOM 8462  C CA   . ASP A 1 67  ? 2.881   1.968   -9.730  1.00 0.00 ? 67  ASP A CA   6  
ATOM 8463  C C    . ASP A 1 67  ? 4.293   1.677   -10.244 1.00 0.00 ? 67  ASP A C    6  
ATOM 8464  O O    . ASP A 1 67  ? 4.866   2.479   -10.979 1.00 0.00 ? 67  ASP A O    6  
ATOM 8465  C CB   . ASP A 1 67  ? 2.675   3.484   -9.746  1.00 0.00 ? 67  ASP A CB   6  
ATOM 8466  C CG   . ASP A 1 67  ? 1.214   3.937   -9.801  1.00 0.00 ? 67  ASP A CG   6  
ATOM 8467  O OD1  . ASP A 1 67  ? 0.676   3.982   -10.929 1.00 0.00 ? 67  ASP A OD1  6  
ATOM 8468  O OD2  . ASP A 1 67  ? 0.669   4.228   -8.715  1.00 0.00 ? 67  ASP A OD2  6  
ATOM 8469  H H    . ASP A 1 67  ? 1.956   0.828   -8.252  1.00 0.00 ? 67  ASP A H    6  
ATOM 8470  H HA   . ASP A 1 67  ? 2.112   1.468   -10.319 1.00 0.00 ? 67  ASP A HA   6  
ATOM 8471  H HB2  . ASP A 1 67  ? 3.137   3.907   -8.855  1.00 0.00 ? 67  ASP A HB2  6  
ATOM 8472  H HB3  . ASP A 1 67  ? 3.201   3.898   -10.606 1.00 0.00 ? 67  ASP A HB3  6  
ATOM 8473  N N    . GLY A 1 68  ? 4.812   0.529   -9.835  1.00 0.00 ? 68  GLY A N    6  
ATOM 8474  C CA   . GLY A 1 68  ? 6.145   0.123   -10.245 1.00 0.00 ? 68  GLY A CA   6  
ATOM 8475  C C    . GLY A 1 68  ? 7.195   0.585   -9.232  1.00 0.00 ? 68  GLY A C    6  
ATOM 8476  O O    . GLY A 1 68  ? 8.215   -0.075  -9.045  1.00 0.00 ? 68  GLY A O    6  
ATOM 8477  H H    . GLY A 1 68  ? 4.338   -0.118  -9.237  1.00 0.00 ? 68  GLY A H    6  
ATOM 8478  H HA2  . GLY A 1 68  ? 6.184   -0.962  -10.345 1.00 0.00 ? 68  GLY A HA2  6  
ATOM 8479  H HA3  . GLY A 1 68  ? 6.372   0.541   -11.226 1.00 0.00 ? 68  GLY A HA3  6  
ATOM 8480  N N    . ARG A 1 69  ? 6.907   1.717   -8.606  1.00 0.00 ? 69  ARG A N    6  
ATOM 8481  C CA   . ARG A 1 69  ? 7.814   2.276   -7.617  1.00 0.00 ? 69  ARG A CA   6  
ATOM 8482  C C    . ARG A 1 69  ? 7.760   1.457   -6.325  1.00 0.00 ? 69  ARG A C    6  
ATOM 8483  O O    . ARG A 1 69  ? 6.712   1.363   -5.689  1.00 0.00 ? 69  ARG A O    6  
ATOM 8484  C CB   . ARG A 1 69  ? 7.459   3.731   -7.305  1.00 0.00 ? 69  ARG A CB   6  
ATOM 8485  C CG   . ARG A 1 69  ? 8.155   4.685   -8.278  1.00 0.00 ? 69  ARG A CG   6  
ATOM 8486  C CD   . ARG A 1 69  ? 7.200   5.127   -9.390  1.00 0.00 ? 69  ARG A CD   6  
ATOM 8487  N NE   . ARG A 1 69  ? 7.644   4.573   -10.688 1.00 0.00 ? 69  ARG A NE   6  
ATOM 8488  C CZ   . ARG A 1 69  ? 8.829   4.840   -11.254 1.00 0.00 ? 69  ARG A CZ   6  
ATOM 8489  N NH1  . ARG A 1 69  ? 9.696   5.656   -10.639 1.00 0.00 ? 69  ARG A NH1  6  
ATOM 8490  N NH2  . ARG A 1 69  ? 9.147   4.292   -12.434 1.00 0.00 ? 69  ARG A NH2  6  
ATOM 8491  H H    . ARG A 1 69  ? 6.075   2.248   -8.764  1.00 0.00 ? 69  ARG A H    6  
ATOM 8492  H HA   . ARG A 1 69  ? 8.800   2.217   -8.078  1.00 0.00 ? 69  ARG A HA   6  
ATOM 8493  H HB2  . ARG A 1 69  ? 6.380   3.867   -7.366  1.00 0.00 ? 69  ARG A HB2  6  
ATOM 8494  H HB3  . ARG A 1 69  ? 7.753   3.970   -6.283  1.00 0.00 ? 69  ARG A HB3  6  
ATOM 8495  H HG2  . ARG A 1 69  ? 8.519   5.559   -7.738  1.00 0.00 ? 69  ARG A HG2  6  
ATOM 8496  H HG3  . ARG A 1 69  ? 9.025   4.194   -8.715  1.00 0.00 ? 69  ARG A HG3  6  
ATOM 8497  H HD2  . ARG A 1 69  ? 6.188   4.789   -9.167  1.00 0.00 ? 69  ARG A HD2  6  
ATOM 8498  H HD3  . ARG A 1 69  ? 7.168   6.215   -9.441  1.00 0.00 ? 69  ARG A HD3  6  
ATOM 8499  H HE   . ARG A 1 69  ? 7.020   3.960   -11.174 1.00 0.00 ? 69  ARG A HE   6  
ATOM 8500  H HH11 . ARG A 1 69  ? 9.459   6.065   -9.757  1.00 0.00 ? 69  ARG A HH11 6  
ATOM 8501  H HH12 . ARG A 1 69  ? 10.580  5.856   -11.061 1.00 0.00 ? 69  ARG A HH12 6  
ATOM 8502  H HH21 . ARG A 1 69  ? 8.500   3.683   -12.894 1.00 0.00 ? 69  ARG A HH21 6  
ATOM 8503  H HH22 . ARG A 1 69  ? 10.031  4.492   -12.857 1.00 0.00 ? 69  ARG A HH22 6  
ATOM 8504  N N    . SER A 1 70  ? 8.903   0.886   -5.977  1.00 0.00 ? 70  SER A N    6  
ATOM 8505  C CA   . SER A 1 70  ? 9.000   0.079   -4.772  1.00 0.00 ? 70  SER A CA   6  
ATOM 8506  C C    . SER A 1 70  ? 8.501   0.876   -3.566  1.00 0.00 ? 70  SER A C    6  
ATOM 8507  O O    . SER A 1 70  ? 8.798   2.063   -3.436  1.00 0.00 ? 70  SER A O    6  
ATOM 8508  C CB   . SER A 1 70  ? 10.437  -0.393  -4.539  1.00 0.00 ? 70  SER A CB   6  
ATOM 8509  O OG   . SER A 1 70  ? 10.788  -1.477  -5.394  1.00 0.00 ? 70  SER A OG   6  
ATOM 8510  H H    . SER A 1 70  ? 9.752   0.968   -6.500  1.00 0.00 ? 70  SER A H    6  
ATOM 8511  H HA   . SER A 1 70  ? 8.359   -0.785  -4.952  1.00 0.00 ? 70  SER A HA   6  
ATOM 8512  H HB2  . SER A 1 70  ? 11.122  0.438   -4.706  1.00 0.00 ? 70  SER A HB2  6  
ATOM 8513  H HB3  . SER A 1 70  ? 10.554  -0.698  -3.499  1.00 0.00 ? 70  SER A HB3  6  
ATOM 8514  H HG   . SER A 1 70  ? 11.781  -1.593  -5.409  1.00 0.00 ? 70  SER A HG   6  
ATOM 8515  N N    . LEU A 1 71  ? 7.750   0.193   -2.714  1.00 0.00 ? 71  LEU A N    6  
ATOM 8516  C CA   . LEU A 1 71  ? 7.207   0.823   -1.523  1.00 0.00 ? 71  LEU A CA   6  
ATOM 8517  C C    . LEU A 1 71  ? 7.691   0.066   -0.285  1.00 0.00 ? 71  LEU A C    6  
ATOM 8518  O O    . LEU A 1 71  ? 7.370   0.440   0.842   1.00 0.00 ? 71  LEU A O    6  
ATOM 8519  C CB   . LEU A 1 71  ? 5.684   0.930   -1.621  1.00 0.00 ? 71  LEU A CB   6  
ATOM 8520  C CG   . LEU A 1 71  ? 5.110   2.348   -1.606  1.00 0.00 ? 71  LEU A CG   6  
ATOM 8521  C CD1  . LEU A 1 71  ? 5.196   2.959   -0.206  1.00 0.00 ? 71  LEU A CD1  6  
ATOM 8522  C CD2  . LEU A 1 71  ? 5.790   3.227   -2.658  1.00 0.00 ? 71  LEU A CD2  6  
ATOM 8523  H H    . LEU A 1 71  ? 7.514   -0.772  -2.828  1.00 0.00 ? 71  LEU A H    6  
ATOM 8524  H HA   . LEU A 1 71  ? 7.600   1.838   -1.483  1.00 0.00 ? 71  LEU A HA   6  
ATOM 8525  H HB2  . LEU A 1 71  ? 5.363   0.440   -2.541  1.00 0.00 ? 71  LEU A HB2  6  
ATOM 8526  H HB3  . LEU A 1 71  ? 5.246   0.373   -0.793  1.00 0.00 ? 71  LEU A HB3  6  
ATOM 8527  H HG   . LEU A 1 71  ? 4.053   2.292   -1.868  1.00 0.00 ? 71  LEU A HG   6  
ATOM 8528  H HD11 . LEU A 1 71  ? 5.857   2.355   0.414   1.00 0.00 ? 71  LEU A HD11 6  
ATOM 8529  H HD12 . LEU A 1 71  ? 5.590   3.974   -0.276  1.00 0.00 ? 71  LEU A HD12 6  
ATOM 8530  H HD13 . LEU A 1 71  ? 4.202   2.985   0.241   1.00 0.00 ? 71  LEU A HD13 6  
ATOM 8531  H HD21 . LEU A 1 71  ? 6.057   4.186   -2.213  1.00 0.00 ? 71  LEU A HD21 6  
ATOM 8532  H HD22 . LEU A 1 71  ? 6.690   2.731   -3.019  1.00 0.00 ? 71  LEU A HD22 6  
ATOM 8533  H HD23 . LEU A 1 71  ? 5.106   3.391   -3.491  1.00 0.00 ? 71  LEU A HD23 6  
ATOM 8534  N N    . VAL A 1 72  ? 8.457   -0.986  -0.536  1.00 0.00 ? 72  VAL A N    6  
ATOM 8535  C CA   . VAL A 1 72  ? 8.989   -1.799  0.545   1.00 0.00 ? 72  VAL A CA   6  
ATOM 8536  C C    . VAL A 1 72  ? 10.072  -1.012  1.284   1.00 0.00 ? 72  VAL A C    6  
ATOM 8537  O O    . VAL A 1 72  ? 11.182  -1.506  1.477   1.00 0.00 ? 72  VAL A O    6  
ATOM 8538  C CB   . VAL A 1 72  ? 9.492   -3.136  -0.005  1.00 0.00 ? 72  VAL A CB   6  
ATOM 8539  C CG1  . VAL A 1 72  ? 10.800  -2.954  -0.777  1.00 0.00 ? 72  VAL A CG1  6  
ATOM 8540  C CG2  . VAL A 1 72  ? 9.656   -4.163  1.117   1.00 0.00 ? 72  VAL A CG2  6  
ATOM 8541  H H    . VAL A 1 72  ? 8.714   -1.285  -1.455  1.00 0.00 ? 72  VAL A H    6  
ATOM 8542  H HA   . VAL A 1 72  ? 8.171   -2.005  1.235   1.00 0.00 ? 72  VAL A HA   6  
ATOM 8543  H HB   . VAL A 1 72  ? 8.743   -3.516  -0.700  1.00 0.00 ? 72  VAL A HB   6  
ATOM 8544  H HG11 . VAL A 1 72  ? 10.873  -3.717  -1.552  1.00 0.00 ? 72  VAL A HG11 6  
ATOM 8545  H HG12 . VAL A 1 72  ? 10.815  -1.966  -1.238  1.00 0.00 ? 72  VAL A HG12 6  
ATOM 8546  H HG13 . VAL A 1 72  ? 11.642  -3.049  -0.093  1.00 0.00 ? 72  VAL A HG13 6  
ATOM 8547  H HG21 . VAL A 1 72  ? 8.732   -4.224  1.692   1.00 0.00 ? 72  VAL A HG21 6  
ATOM 8548  H HG22 . VAL A 1 72  ? 9.881   -5.139  0.686   1.00 0.00 ? 72  VAL A HG22 6  
ATOM 8549  H HG23 . VAL A 1 72  ? 10.472  -3.858  1.772   1.00 0.00 ? 72  VAL A HG23 6  
ATOM 8550  N N    . GLY A 1 73  ? 9.712   0.201   1.678   1.00 0.00 ? 73  GLY A N    6  
ATOM 8551  C CA   . GLY A 1 73  ? 10.639  1.062   2.393   1.00 0.00 ? 73  GLY A CA   6  
ATOM 8552  C C    . GLY A 1 73  ? 10.568  2.498   1.869   1.00 0.00 ? 73  GLY A C    6  
ATOM 8553  O O    . GLY A 1 73  ? 11.574  3.051   1.427   1.00 0.00 ? 73  GLY A O    6  
ATOM 8554  H H    . GLY A 1 73  ? 8.807   0.596   1.517   1.00 0.00 ? 73  GLY A H    6  
ATOM 8555  H HA2  . GLY A 1 73  ? 10.408  1.047   3.458   1.00 0.00 ? 73  GLY A HA2  6  
ATOM 8556  H HA3  . GLY A 1 73  ? 11.654  0.680   2.282   1.00 0.00 ? 73  GLY A HA3  6  
ATOM 8557  N N    . LEU A 1 74  ? 9.371   3.060   1.937   1.00 0.00 ? 74  LEU A N    6  
ATOM 8558  C CA   . LEU A 1 74  ? 9.155   4.421   1.476   1.00 0.00 ? 74  LEU A CA   6  
ATOM 8559  C C    . LEU A 1 74  ? 8.882   5.326   2.679   1.00 0.00 ? 74  LEU A C    6  
ATOM 8560  O O    . LEU A 1 74  ? 8.869   4.862   3.818   1.00 0.00 ? 74  LEU A O    6  
ATOM 8561  C CB   . LEU A 1 74  ? 8.054   4.459   0.414   1.00 0.00 ? 74  LEU A CB   6  
ATOM 8562  C CG   . LEU A 1 74  ? 8.514   4.299   -1.036  1.00 0.00 ? 74  LEU A CG   6  
ATOM 8563  C CD1  . LEU A 1 74  ? 8.435   5.629   -1.787  1.00 0.00 ? 74  LEU A CD1  6  
ATOM 8564  C CD2  . LEU A 1 74  ? 9.914   3.685   -1.102  1.00 0.00 ? 74  LEU A CD2  6  
ATOM 8565  H H    . LEU A 1 74  ? 8.558   2.603   2.298   1.00 0.00 ? 74  LEU A H    6  
ATOM 8566  H HA   . LEU A 1 74  ? 10.076  4.753   0.996   1.00 0.00 ? 74  LEU A HA   6  
ATOM 8567  H HB2  . LEU A 1 74  ? 7.336   3.670   0.636   1.00 0.00 ? 74  LEU A HB2  6  
ATOM 8568  H HB3  . LEU A 1 74  ? 7.524   5.407   0.504   1.00 0.00 ? 74  LEU A HB3  6  
ATOM 8569  H HG   . LEU A 1 74  ? 7.836   3.607   -1.535  1.00 0.00 ? 74  LEU A HG   6  
ATOM 8570  H HD11 . LEU A 1 74  ? 7.391   5.913   -1.915  1.00 0.00 ? 74  LEU A HD11 6  
ATOM 8571  H HD12 . LEU A 1 74  ? 8.953   6.400   -1.216  1.00 0.00 ? 74  LEU A HD12 6  
ATOM 8572  H HD13 . LEU A 1 74  ? 8.905   5.524   -2.764  1.00 0.00 ? 74  LEU A HD13 6  
ATOM 8573  H HD21 . LEU A 1 74  ? 10.105  3.324   -2.113  1.00 0.00 ? 74  LEU A HD21 6  
ATOM 8574  H HD22 . LEU A 1 74  ? 10.655  4.441   -0.841  1.00 0.00 ? 74  LEU A HD22 6  
ATOM 8575  H HD23 . LEU A 1 74  ? 9.981   2.854   -0.400  1.00 0.00 ? 74  LEU A HD23 6  
ATOM 8576  N N    . SER A 1 75  ? 8.669   6.600   2.384   1.00 0.00 ? 75  SER A N    6  
ATOM 8577  C CA   . SER A 1 75  ? 8.396   7.573   3.427   1.00 0.00 ? 75  SER A CA   6  
ATOM 8578  C C    . SER A 1 75  ? 6.963   8.093   3.297   1.00 0.00 ? 75  SER A C    6  
ATOM 8579  O O    . SER A 1 75  ? 6.522   8.439   2.202   1.00 0.00 ? 75  SER A O    6  
ATOM 8580  C CB   . SER A 1 75  ? 9.389   8.736   3.370   1.00 0.00 ? 75  SER A CB   6  
ATOM 8581  O OG   . SER A 1 75  ? 8.746   9.973   3.075   1.00 0.00 ? 75  SER A OG   6  
ATOM 8582  H H    . SER A 1 75  ? 8.680   6.968   1.455   1.00 0.00 ? 75  SER A H    6  
ATOM 8583  H HA   . SER A 1 75  ? 8.523   7.034   4.366   1.00 0.00 ? 75  SER A HA   6  
ATOM 8584  H HB2  . SER A 1 75  ? 9.909   8.816   4.324   1.00 0.00 ? 75  SER A HB2  6  
ATOM 8585  H HB3  . SER A 1 75  ? 10.144  8.530   2.611   1.00 0.00 ? 75  SER A HB3  6  
ATOM 8586  H HG   . SER A 1 75  ? 9.411   10.719  3.102   1.00 0.00 ? 75  SER A HG   6  
ATOM 8587  N N    . GLN A 1 76  ? 6.275   8.131   4.429   1.00 0.00 ? 76  GLN A N    6  
ATOM 8588  C CA   . GLN A 1 76  ? 4.901   8.603   4.454   1.00 0.00 ? 76  GLN A CA   6  
ATOM 8589  C C    . GLN A 1 76  ? 4.732   9.798   3.515   1.00 0.00 ? 76  GLN A C    6  
ATOM 8590  O O    . GLN A 1 76  ? 3.646   10.028  2.985   1.00 0.00 ? 76  GLN A O    6  
ATOM 8591  C CB   . GLN A 1 76  ? 4.470   8.959   5.878   1.00 0.00 ? 76  GLN A CB   6  
ATOM 8592  C CG   . GLN A 1 76  ? 5.297   10.124  6.426   1.00 0.00 ? 76  GLN A CG   6  
ATOM 8593  C CD   . GLN A 1 76  ? 4.981   10.376  7.901   1.00 0.00 ? 76  GLN A CD   6  
ATOM 8594  O OE1  . GLN A 1 76  ? 5.031   9.486   8.734   1.00 0.00 ? 76  GLN A OE1  6  
ATOM 8595  N NE2  . GLN A 1 76  ? 4.652   11.635  8.177   1.00 0.00 ? 76  GLN A NE2  6  
ATOM 8596  H H    . GLN A 1 76  ? 6.641   7.848   5.315   1.00 0.00 ? 76  GLN A H    6  
ATOM 8597  H HA   . GLN A 1 76  ? 4.301   7.765   4.099   1.00 0.00 ? 76  GLN A HA   6  
ATOM 8598  H HB2  . GLN A 1 76  ? 3.413   9.224   5.887   1.00 0.00 ? 76  GLN A HB2  6  
ATOM 8599  H HB3  . GLN A 1 76  ? 4.586   8.090   6.526   1.00 0.00 ? 76  GLN A HB3  6  
ATOM 8600  H HG2  . GLN A 1 76  ? 6.359   9.907   6.310   1.00 0.00 ? 76  GLN A HG2  6  
ATOM 8601  H HG3  . GLN A 1 76  ? 5.091   11.025  5.847   1.00 0.00 ? 76  GLN A HG3  6  
ATOM 8602  H HE21 . GLN A 1 76  ? 4.630   12.317  7.447   1.00 0.00 ? 76  GLN A HE21 6  
ATOM 8603  H HE22 . GLN A 1 76  ? 4.428   11.899  9.115   1.00 0.00 ? 76  GLN A HE22 6  
ATOM 8604  N N    . GLU A 1 77  ? 5.823   10.528  3.336   1.00 0.00 ? 77  GLU A N    6  
ATOM 8605  C CA   . GLU A 1 77  ? 5.810   11.695  2.470   1.00 0.00 ? 77  GLU A CA   6  
ATOM 8606  C C    . GLU A 1 77  ? 5.802   11.265  1.001   1.00 0.00 ? 77  GLU A C    6  
ATOM 8607  O O    . GLU A 1 77  ? 4.931   11.675  0.236   1.00 0.00 ? 77  GLU A O    6  
ATOM 8608  C CB   . GLU A 1 77  ? 6.998   12.612  2.766   1.00 0.00 ? 77  GLU A CB   6  
ATOM 8609  C CG   . GLU A 1 77  ? 6.680   13.567  3.918   1.00 0.00 ? 77  GLU A CG   6  
ATOM 8610  C CD   . GLU A 1 77  ? 7.433   13.165  5.188   1.00 0.00 ? 77  GLU A CD   6  
ATOM 8611  O OE1  . GLU A 1 77  ? 7.418   11.954  5.497   1.00 0.00 ? 77  GLU A OE1  6  
ATOM 8612  O OE2  . GLU A 1 77  ? 8.007   14.077  5.821   1.00 0.00 ? 77  GLU A OE2  6  
ATOM 8613  H H    . GLU A 1 77  ? 6.703   10.335  3.771   1.00 0.00 ? 77  GLU A H    6  
ATOM 8614  H HA   . GLU A 1 77  ? 4.885   12.221  2.707   1.00 0.00 ? 77  GLU A HA   6  
ATOM 8615  H HB2  . GLU A 1 77  ? 7.872   12.011  3.018   1.00 0.00 ? 77  GLU A HB2  6  
ATOM 8616  H HB3  . GLU A 1 77  ? 7.252   13.184  1.874   1.00 0.00 ? 77  GLU A HB3  6  
ATOM 8617  H HG2  . GLU A 1 77  ? 6.951   14.584  3.637   1.00 0.00 ? 77  GLU A HG2  6  
ATOM 8618  H HG3  . GLU A 1 77  ? 5.607   13.564  4.112   1.00 0.00 ? 77  GLU A HG3  6  
ATOM 8619  N N    . ARG A 1 78  ? 6.782   10.444  0.653   1.00 0.00 ? 78  ARG A N    6  
ATOM 8620  C CA   . ARG A 1 78  ? 6.899   9.954   -0.710  1.00 0.00 ? 78  ARG A CA   6  
ATOM 8621  C C    . ARG A 1 78  ? 5.755   8.989   -1.027  1.00 0.00 ? 78  ARG A C    6  
ATOM 8622  O O    . ARG A 1 78  ? 4.978   9.223   -1.952  1.00 0.00 ? 78  ARG A O    6  
ATOM 8623  C CB   . ARG A 1 78  ? 8.234   9.240   -0.926  1.00 0.00 ? 78  ARG A CB   6  
ATOM 8624  C CG   . ARG A 1 78  ? 9.010   9.867   -2.087  1.00 0.00 ? 78  ARG A CG   6  
ATOM 8625  C CD   . ARG A 1 78  ? 10.249  9.038   -2.429  1.00 0.00 ? 78  ARG A CD   6  
ATOM 8626  N NE   . ARG A 1 78  ? 11.336  9.924   -2.902  1.00 0.00 ? 78  ARG A NE   6  
ATOM 8627  C CZ   . ARG A 1 78  ? 12.039  10.754  -2.102  1.00 0.00 ? 78  ARG A CZ   6  
ATOM 8628  N NH1  . ARG A 1 78  ? 11.775  10.817  -0.780  1.00 0.00 ? 78  ARG A NH1  6  
ATOM 8629  N NH2  . ARG A 1 78  ? 12.989  11.502  -2.633  1.00 0.00 ? 78  ARG A NH2  6  
ATOM 8630  H H    . ARG A 1 78  ? 7.486   10.115  1.282   1.00 0.00 ? 78  ARG A H    6  
ATOM 8631  H HA   . ARG A 1 78  ? 6.842   10.847  -1.333  1.00 0.00 ? 78  ARG A HA   6  
ATOM 8632  H HB2  . ARG A 1 78  ? 8.831   9.293   -0.015  1.00 0.00 ? 78  ARG A HB2  6  
ATOM 8633  H HB3  . ARG A 1 78  ? 8.057   8.184   -1.130  1.00 0.00 ? 78  ARG A HB3  6  
ATOM 8634  H HG2  . ARG A 1 78  ? 8.364   9.940   -2.962  1.00 0.00 ? 78  ARG A HG2  6  
ATOM 8635  H HG3  . ARG A 1 78  ? 9.307   10.882  -1.824  1.00 0.00 ? 78  ARG A HG3  6  
ATOM 8636  H HD2  . ARG A 1 78  ? 10.579  8.482   -1.551  1.00 0.00 ? 78  ARG A HD2  6  
ATOM 8637  H HD3  . ARG A 1 78  ? 10.006  8.304   -3.197  1.00 0.00 ? 78  ARG A HD3  6  
ATOM 8638  H HE   . ARG A 1 78  ? 11.563  9.908   -3.876  1.00 0.00 ? 78  ARG A HE   6  
ATOM 8639  H HH11 . ARG A 1 78  ? 11.054  10.247  -0.386  1.00 0.00 ? 78  ARG A HH11 6  
ATOM 8640  H HH12 . ARG A 1 78  ? 12.301  11.434  -0.194  1.00 0.00 ? 78  ARG A HH12 6  
ATOM 8641  H HH21 . ARG A 1 78  ? 13.554  12.140  -2.111  1.00 0.00 ? 78  ARG A HH21 6  
ATOM 8642  N N    . ALA A 1 79  ? 5.687   7.924   -0.241  1.00 0.00 ? 79  ALA A N    6  
ATOM 8643  C CA   . ALA A 1 79  ? 4.650   6.923   -0.426  1.00 0.00 ? 79  ALA A CA   6  
ATOM 8644  C C    . ALA A 1 79  ? 3.305   7.620   -0.636  1.00 0.00 ? 79  ALA A C    6  
ATOM 8645  O O    . ALA A 1 79  ? 2.527   7.228   -1.504  1.00 0.00 ? 79  ALA A O    6  
ATOM 8646  C CB   . ALA A 1 79  ? 4.636   5.975   0.775   1.00 0.00 ? 79  ALA A CB   6  
ATOM 8647  H H    . ALA A 1 79  ? 6.322   7.742   0.509   1.00 0.00 ? 79  ALA A H    6  
ATOM 8648  H HA   . ALA A 1 79  ? 4.897   6.351   -1.321  1.00 0.00 ? 79  ALA A HA   6  
ATOM 8649  H HB1  . ALA A 1 79  ? 4.110   5.058   0.508   1.00 0.00 ? 79  ALA A HB1  6  
ATOM 8650  H HB2  . ALA A 1 79  ? 5.660   5.736   1.062   1.00 0.00 ? 79  ALA A HB2  6  
ATOM 8651  H HB3  . ALA A 1 79  ? 4.127   6.455   1.610   1.00 0.00 ? 79  ALA A HB3  6  
ATOM 8652  N N    . ALA A 1 80  ? 3.071   8.641   0.176   1.00 0.00 ? 80  ALA A N    6  
ATOM 8653  C CA   . ALA A 1 80  ? 1.833   9.396   0.090   1.00 0.00 ? 80  ALA A CA   6  
ATOM 8654  C C    . ALA A 1 80  ? 1.736   10.055  -1.287  1.00 0.00 ? 80  ALA A C    6  
ATOM 8655  O O    . ALA A 1 80  ? 0.718   9.936   -1.967  1.00 0.00 ? 80  ALA A O    6  
ATOM 8656  C CB   . ALA A 1 80  ? 1.776   10.415  1.230   1.00 0.00 ? 80  ALA A CB   6  
ATOM 8657  H H    . ALA A 1 80  ? 3.709   8.953   0.880   1.00 0.00 ? 80  ALA A H    6  
ATOM 8658  H HA   . ALA A 1 80  ? 1.007   8.694   0.206   1.00 0.00 ? 80  ALA A HA   6  
ATOM 8659  H HB1  . ALA A 1 80  ? 0.951   11.107  1.059   1.00 0.00 ? 80  ALA A HB1  6  
ATOM 8660  H HB2  . ALA A 1 80  ? 1.624   9.895   2.176   1.00 0.00 ? 80  ALA A HB2  6  
ATOM 8661  H HB3  . ALA A 1 80  ? 2.714   10.970  1.268   1.00 0.00 ? 80  ALA A HB3  6  
ATOM 8662  N N    . GLU A 1 81  ? 2.810   10.737  -1.658  1.00 0.00 ? 81  GLU A N    6  
ATOM 8663  C CA   . GLU A 1 81  ? 2.860   11.416  -2.942  1.00 0.00 ? 81  GLU A CA   6  
ATOM 8664  C C    . GLU A 1 81  ? 2.558   10.432  -4.074  1.00 0.00 ? 81  GLU A C    6  
ATOM 8665  O O    . GLU A 1 81  ? 1.862   10.773  -5.029  1.00 0.00 ? 81  GLU A O    6  
ATOM 8666  C CB   . GLU A 1 81  ? 4.215   12.095  -3.151  1.00 0.00 ? 81  GLU A CB   6  
ATOM 8667  C CG   . GLU A 1 81  ? 4.369   13.306  -2.229  1.00 0.00 ? 81  GLU A CG   6  
ATOM 8668  C CD   . GLU A 1 81  ? 4.064   14.606  -2.977  1.00 0.00 ? 81  GLU A CD   6  
ATOM 8669  O OE1  . GLU A 1 81  ? 2.866   14.838  -3.247  1.00 0.00 ? 81  GLU A OE1  6  
ATOM 8670  O OE2  . GLU A 1 81  ? 5.037   15.339  -3.260  1.00 0.00 ? 81  GLU A OE2  6  
ATOM 8671  H H    . GLU A 1 81  ? 3.634   10.830  -1.099  1.00 0.00 ? 81  GLU A H    6  
ATOM 8672  H HA   . GLU A 1 81  ? 2.081   12.178  -2.897  1.00 0.00 ? 81  GLU A HA   6  
ATOM 8673  H HB2  . GLU A 1 81  ? 5.016   11.382  -2.958  1.00 0.00 ? 81  GLU A HB2  6  
ATOM 8674  H HB3  . GLU A 1 81  ? 4.311   12.409  -4.190  1.00 0.00 ? 81  GLU A HB3  6  
ATOM 8675  H HG2  . GLU A 1 81  ? 3.698   13.207  -1.377  1.00 0.00 ? 81  GLU A HG2  6  
ATOM 8676  H HG3  . GLU A 1 81  ? 5.384   13.339  -1.834  1.00 0.00 ? 81  GLU A HG3  6  
ATOM 8677  N N    . LEU A 1 82  ? 3.097   9.230   -3.930  1.00 0.00 ? 82  LEU A N    6  
ATOM 8678  C CA   . LEU A 1 82  ? 2.895   8.194   -4.928  1.00 0.00 ? 82  LEU A CA   6  
ATOM 8679  C C    . LEU A 1 82  ? 1.425   7.770   -4.926  1.00 0.00 ? 82  LEU A C    6  
ATOM 8680  O O    . LEU A 1 82  ? 0.810   7.642   -5.984  1.00 0.00 ? 82  LEU A O    6  
ATOM 8681  C CB   . LEU A 1 82  ? 3.869   7.036   -4.705  1.00 0.00 ? 82  LEU A CB   6  
ATOM 8682  C CG   . LEU A 1 82  ? 4.678   6.594   -5.926  1.00 0.00 ? 82  LEU A CG   6  
ATOM 8683  C CD1  . LEU A 1 82  ? 3.758   6.276   -7.106  1.00 0.00 ? 82  LEU A CD1  6  
ATOM 8684  C CD2  . LEU A 1 82  ? 5.737   7.637   -6.289  1.00 0.00 ? 82  LEU A CD2  6  
ATOM 8685  H H    . LEU A 1 82  ? 3.662   8.961   -3.150  1.00 0.00 ? 82  LEU A H    6  
ATOM 8686  H HA   . LEU A 1 82  ? 3.128   8.628   -5.901  1.00 0.00 ? 82  LEU A HA   6  
ATOM 8687  H HB2  . LEU A 1 82  ? 4.566   7.321   -3.916  1.00 0.00 ? 82  LEU A HB2  6  
ATOM 8688  H HB3  . LEU A 1 82  ? 3.305   6.179   -4.337  1.00 0.00 ? 82  LEU A HB3  6  
ATOM 8689  H HG   . LEU A 1 82  ? 5.205   5.675   -5.672  1.00 0.00 ? 82  LEU A HG   6  
ATOM 8690  H HD11 . LEU A 1 82  ? 3.144   7.148   -7.333  1.00 0.00 ? 82  LEU A HD11 6  
ATOM 8691  H HD12 . LEU A 1 82  ? 4.361   6.020   -7.978  1.00 0.00 ? 82  LEU A HD12 6  
ATOM 8692  H HD13 . LEU A 1 82  ? 3.115   5.435   -6.850  1.00 0.00 ? 82  LEU A HD13 6  
ATOM 8693  H HD21 . LEU A 1 82  ? 5.702   8.456   -5.571  1.00 0.00 ? 82  LEU A HD21 6  
ATOM 8694  H HD22 . LEU A 1 82  ? 6.724   7.176   -6.266  1.00 0.00 ? 82  LEU A HD22 6  
ATOM 8695  H HD23 . LEU A 1 82  ? 5.539   8.023   -7.289  1.00 0.00 ? 82  LEU A HD23 6  
ATOM 8696  N N    . MET A 1 83  ? 0.903   7.564   -3.726  1.00 0.00 ? 83  MET A N    6  
ATOM 8697  C CA   . MET A 1 83  ? -0.483  7.157   -3.572  1.00 0.00 ? 83  MET A CA   6  
ATOM 8698  C C    . MET A 1 83  ? -1.434  8.282   -3.984  1.00 0.00 ? 83  MET A C    6  
ATOM 8699  O O    . MET A 1 83  ? -2.622  8.049   -4.198  1.00 0.00 ? 83  MET A O    6  
ATOM 8700  C CB   . MET A 1 83  ? -0.744  6.775   -2.114  1.00 0.00 ? 83  MET A CB   6  
ATOM 8701  C CG   . MET A 1 83  ? -0.141  5.407   -1.789  1.00 0.00 ? 83  MET A CG   6  
ATOM 8702  S SD   . MET A 1 83  ? -1.005  4.671   -0.411  1.00 0.00 ? 83  MET A SD   6  
ATOM 8703  C CE   . MET A 1 83  ? 0.179   4.968   0.892   1.00 0.00 ? 83  MET A CE   6  
ATOM 8704  H H    . MET A 1 83  ? 1.410   7.670   -2.870  1.00 0.00 ? 83  MET A H    6  
ATOM 8705  H HA   . MET A 1 83  ? -0.612  6.301   -4.236  1.00 0.00 ? 83  MET A HA   6  
ATOM 8706  H HB2  . MET A 1 83  ? -0.318  7.531   -1.454  1.00 0.00 ? 83  MET A HB2  6  
ATOM 8707  H HB3  . MET A 1 83  ? -1.818  6.757   -1.926  1.00 0.00 ? 83  MET A HB3  6  
ATOM 8708  H HG2  . MET A 1 83  ? -0.207  4.755   -2.659  1.00 0.00 ? 83  MET A HG2  6  
ATOM 8709  H HG3  . MET A 1 83  ? 0.917   5.514   -1.550  1.00 0.00 ? 83  MET A HG3  6  
ATOM 8710  H HE1  . MET A 1 83  ? 0.700   4.040   1.128   1.00 0.00 ? 83  MET A HE1  6  
ATOM 8711  H HE2  . MET A 1 83  ? 0.901   5.715   0.563   1.00 0.00 ? 83  MET A HE2  6  
ATOM 8712  H HE3  . MET A 1 83  ? -0.340  5.329   1.779   1.00 0.00 ? 83  MET A HE3  6  
ATOM 8713  N N    . THR A 1 84  ? -0.875  9.479   -4.083  1.00 0.00 ? 84  THR A N    6  
ATOM 8714  C CA   . THR A 1 84  ? -1.658  10.642  -4.466  1.00 0.00 ? 84  THR A CA   6  
ATOM 8715  C C    . THR A 1 84  ? -1.992  10.592  -5.958  1.00 0.00 ? 84  THR A C    6  
ATOM 8716  O O    . THR A 1 84  ? -3.108  10.238  -6.336  1.00 0.00 ? 84  THR A O    6  
ATOM 8717  C CB   . THR A 1 84  ? -0.877  11.893  -4.059  1.00 0.00 ? 84  THR A CB   6  
ATOM 8718  O OG1  . THR A 1 84  ? -0.733  11.769  -2.647  1.00 0.00 ? 84  THR A OG1  6  
ATOM 8719  C CG2  . THR A 1 84  ? -1.691  13.176  -4.240  1.00 0.00 ? 84  THR A CG2  6  
ATOM 8720  H H    . THR A 1 84  ? 0.093   9.661   -3.908  1.00 0.00 ? 84  THR A H    6  
ATOM 8721  H HA   . THR A 1 84  ? -2.604  10.612  -3.925  1.00 0.00 ? 84  THR A HA   6  
ATOM 8722  H HB   . THR A 1 84  ? 0.069   11.953  -4.597  1.00 0.00 ? 84  THR A HB   6  
ATOM 8723  H HG1  . THR A 1 84  ? -0.271  10.910  -2.424  1.00 0.00 ? 84  THR A HG1  6  
ATOM 8724  H HG21 . THR A 1 84  ? -1.942  13.588  -3.262  1.00 0.00 ? 84  THR A HG21 6  
ATOM 8725  H HG22 . THR A 1 84  ? -1.103  13.903  -4.800  1.00 0.00 ? 84  THR A HG22 6  
ATOM 8726  H HG23 . THR A 1 84  ? -2.607  12.951  -4.785  1.00 0.00 ? 84  THR A HG23 6  
ATOM 8727  N N    . ARG A 1 85  ? -1.005  10.953  -6.765  1.00 0.00 ? 85  ARG A N    6  
ATOM 8728  C CA   . ARG A 1 85  ? -1.181  10.954  -8.207  1.00 0.00 ? 85  ARG A CA   6  
ATOM 8729  C C    . ARG A 1 85  ? -1.318  9.521   -8.726  1.00 0.00 ? 85  ARG A C    6  
ATOM 8730  O O    . ARG A 1 85  ? -0.513  9.072   -9.541  1.00 0.00 ? 85  ARG A O    6  
ATOM 8731  C CB   . ARG A 1 85  ? 0.001   11.631  -8.905  1.00 0.00 ? 85  ARG A CB   6  
ATOM 8732  C CG   . ARG A 1 85  ? -0.308  13.098  -9.208  1.00 0.00 ? 85  ARG A CG   6  
ATOM 8733  C CD   . ARG A 1 85  ? 0.490   14.027  -8.291  1.00 0.00 ? 85  ARG A CD   6  
ATOM 8734  N NE   . ARG A 1 85  ? -0.347  15.177  -7.882  1.00 0.00 ? 85  ARG A NE   6  
ATOM 8735  C CZ   . ARG A 1 85  ? 0.027   16.096  -6.981  1.00 0.00 ? 85  ARG A CZ   6  
ATOM 8736  N NH1  . ARG A 1 85  ? 1.225   16.005  -6.389  1.00 0.00 ? 85  ARG A NH1  6  
ATOM 8737  N NH2  . ARG A 1 85  ? -0.799  17.105  -6.672  1.00 0.00 ? 85  ARG A NH2  6  
ATOM 8738  H H    . ARG A 1 85  ? -0.101  11.240  -6.449  1.00 0.00 ? 85  ARG A H    6  
ATOM 8739  H HA   . ARG A 1 85  ? -2.095  11.522  -8.376  1.00 0.00 ? 85  ARG A HA   6  
ATOM 8740  H HB2  . ARG A 1 85  ? 0.887   11.565  -8.274  1.00 0.00 ? 85  ARG A HB2  6  
ATOM 8741  H HB3  . ARG A 1 85  ? 0.230   11.105  -9.832  1.00 0.00 ? 85  ARG A HB3  6  
ATOM 8742  H HG2  . ARG A 1 85  ? -0.070  13.317  -10.249 1.00 0.00 ? 85  ARG A HG2  6  
ATOM 8743  H HG3  . ARG A 1 85  ? -1.375  13.283  -9.079  1.00 0.00 ? 85  ARG A HG3  6  
ATOM 8744  H HD2  . ARG A 1 85  ? 0.827   13.481  -7.410  1.00 0.00 ? 85  ARG A HD2  6  
ATOM 8745  H HD3  . ARG A 1 85  ? 1.383   14.382  -8.807  1.00 0.00 ? 85  ARG A HD3  6  
ATOM 8746  H HE   . ARG A 1 85  ? -1.248  15.274  -8.304  1.00 0.00 ? 85  ARG A HE   6  
ATOM 8747  H HH11 . ARG A 1 85  ? 1.841   15.252  -6.620  1.00 0.00 ? 85  ARG A HH11 6  
ATOM 8748  H HH12 . ARG A 1 85  ? 1.504   16.691  -5.717  1.00 0.00 ? 85  ARG A HH12 6  
ATOM 8749  H HH21 . ARG A 1 85  ? -1.693  17.173  -7.113  1.00 0.00 ? 85  ARG A HH21 6  
ATOM 8750  H HH22 . ARG A 1 85  ? -0.520  17.791  -5.999  1.00 0.00 ? 85  ARG A HH22 6  
ATOM 8751  N N    . THR A 1 86  ? -2.345  8.844   -8.234  1.00 0.00 ? 86  THR A N    6  
ATOM 8752  C CA   . THR A 1 86  ? -2.598  7.471   -8.638  1.00 0.00 ? 86  THR A CA   6  
ATOM 8753  C C    . THR A 1 86  ? -3.613  7.431   -9.782  1.00 0.00 ? 86  THR A C    6  
ATOM 8754  O O    . THR A 1 86  ? -3.562  6.542   -10.631 1.00 0.00 ? 86  THR A O    6  
ATOM 8755  C CB   . THR A 1 86  ? -3.046  6.689   -7.401  1.00 0.00 ? 86  THR A CB   6  
ATOM 8756  O OG1  . THR A 1 86  ? -3.483  7.697   -6.493  1.00 0.00 ? 86  THR A OG1  6  
ATOM 8757  C CG2  . THR A 1 86  ? -1.877  6.017   -6.678  1.00 0.00 ? 86  THR A CG2  6  
ATOM 8758  H H    . THR A 1 86  ? -2.995  9.216   -7.572  1.00 0.00 ? 86  THR A H    6  
ATOM 8759  H HA   . THR A 1 86  ? -1.669  7.048   -9.019  1.00 0.00 ? 86  THR A HA   6  
ATOM 8760  H HB   . THR A 1 86  ? -3.815  5.961   -7.659  1.00 0.00 ? 86  THR A HB   6  
ATOM 8761  H HG1  . THR A 1 86  ? -4.407  7.995   -6.731  1.00 0.00 ? 86  THR A HG1  6  
ATOM 8762  H HG21 . THR A 1 86  ? -1.153  6.774   -6.376  1.00 0.00 ? 86  THR A HG21 6  
ATOM 8763  H HG22 . THR A 1 86  ? -2.247  5.495   -5.796  1.00 0.00 ? 86  THR A HG22 6  
ATOM 8764  H HG23 . THR A 1 86  ? -1.397  5.304   -7.348  1.00 0.00 ? 86  THR A HG23 6  
ATOM 8765  N N    . SER A 1 87  ? -4.510  8.405   -9.769  1.00 0.00 ? 87  SER A N    6  
ATOM 8766  C CA   . SER A 1 87  ? -5.535  8.492   -10.796 1.00 0.00 ? 87  SER A CA   6  
ATOM 8767  C C    . SER A 1 87  ? -6.691  7.546   -10.463 1.00 0.00 ? 87  SER A C    6  
ATOM 8768  O O    . SER A 1 87  ? -6.669  6.871   -9.435  1.00 0.00 ? 87  SER A O    6  
ATOM 8769  C CB   . SER A 1 87  ? -4.962  8.165   -12.176 1.00 0.00 ? 87  SER A CB   6  
ATOM 8770  O OG   . SER A 1 87  ? -5.452  9.048   -13.181 1.00 0.00 ? 87  SER A OG   6  
ATOM 8771  H H    . SER A 1 87  ? -4.545  9.125   -9.076  1.00 0.00 ? 87  SER A H    6  
ATOM 8772  H HA   . SER A 1 87  ? -5.873  9.529   -10.780 1.00 0.00 ? 87  SER A HA   6  
ATOM 8773  H HB2  . SER A 1 87  ? -3.874  8.225   -12.140 1.00 0.00 ? 87  SER A HB2  6  
ATOM 8774  H HB3  . SER A 1 87  ? -5.215  7.139   -12.440 1.00 0.00 ? 87  SER A HB3  6  
ATOM 8775  H HG   . SER A 1 87  ? -6.384  9.334   -12.960 1.00 0.00 ? 87  SER A HG   6  
ATOM 8776  N N    . SER A 1 88  ? -7.672  7.527   -11.353 1.00 0.00 ? 88  SER A N    6  
ATOM 8777  C CA   . SER A 1 88  ? -8.834  6.675   -11.167 1.00 0.00 ? 88  SER A CA   6  
ATOM 8778  C C    . SER A 1 88  ? -8.416  5.203   -11.205 1.00 0.00 ? 88  SER A C    6  
ATOM 8779  O O    . SER A 1 88  ? -9.264  4.313   -11.198 1.00 0.00 ? 88  SER A O    6  
ATOM 8780  C CB   . SER A 1 88  ? -9.897  6.952   -12.232 1.00 0.00 ? 88  SER A CB   6  
ATOM 8781  O OG   . SER A 1 88  ? -9.377  6.820   -13.552 1.00 0.00 ? 88  SER A OG   6  
ATOM 8782  H H    . SER A 1 88  ? -7.682  8.079   -12.187 1.00 0.00 ? 88  SER A H    6  
ATOM 8783  H HA   . SER A 1 88  ? -9.229  6.935   -10.185 1.00 0.00 ? 88  SER A HA   6  
ATOM 8784  H HB2  . SER A 1 88  ? -10.731 6.262   -12.100 1.00 0.00 ? 88  SER A HB2  6  
ATOM 8785  H HB3  . SER A 1 88  ? -10.292 7.959   -12.097 1.00 0.00 ? 88  SER A HB3  6  
ATOM 8786  H HG   . SER A 1 88  ? -8.813  7.614   -13.778 1.00 0.00 ? 88  SER A HG   6  
ATOM 8787  N N    . VAL A 1 89  ? -7.108  4.994   -11.244 1.00 0.00 ? 89  VAL A N    6  
ATOM 8788  C CA   . VAL A 1 89  ? -6.567  3.646   -11.283 1.00 0.00 ? 89  VAL A CA   6  
ATOM 8789  C C    . VAL A 1 89  ? -5.377  3.551   -10.325 1.00 0.00 ? 89  VAL A C    6  
ATOM 8790  O O    . VAL A 1 89  ? -4.459  4.367   -10.387 1.00 0.00 ? 89  VAL A O    6  
ATOM 8791  C CB   . VAL A 1 89  ? -6.207  3.268   -12.721 1.00 0.00 ? 89  VAL A CB   6  
ATOM 8792  C CG1  . VAL A 1 89  ? -5.611  4.462   -13.469 1.00 0.00 ? 89  VAL A CG1  6  
ATOM 8793  C CG2  . VAL A 1 89  ? -5.256  2.071   -12.752 1.00 0.00 ? 89  VAL A CG2  6  
ATOM 8794  H H    . VAL A 1 89  ? -6.425  5.724   -11.249 1.00 0.00 ? 89  VAL A H    6  
ATOM 8795  H HA   . VAL A 1 89  ? -7.348  2.968   -10.941 1.00 0.00 ? 89  VAL A HA   6  
ATOM 8796  H HB   . VAL A 1 89  ? -7.126  2.979   -13.231 1.00 0.00 ? 89  VAL A HB   6  
ATOM 8797  H HG11 . VAL A 1 89  ? -6.321  5.289   -13.458 1.00 0.00 ? 89  VAL A HG11 6  
ATOM 8798  H HG12 . VAL A 1 89  ? -4.686  4.771   -12.982 1.00 0.00 ? 89  VAL A HG12 6  
ATOM 8799  H HG13 . VAL A 1 89  ? -5.401  4.177   -14.500 1.00 0.00 ? 89  VAL A HG13 6  
ATOM 8800  H HG21 . VAL A 1 89  ? -5.779  1.182   -12.400 1.00 0.00 ? 89  VAL A HG21 6  
ATOM 8801  H HG22 . VAL A 1 89  ? -4.909  1.908   -13.773 1.00 0.00 ? 89  VAL A HG22 6  
ATOM 8802  H HG23 . VAL A 1 89  ? -4.401  2.269   -12.105 1.00 0.00 ? 89  VAL A HG23 6  
ATOM 8803  N N    . VAL A 1 90  ? -5.433  2.548   -9.462  1.00 0.00 ? 90  VAL A N    6  
ATOM 8804  C CA   . VAL A 1 90  ? -4.372  2.335   -8.492  1.00 0.00 ? 90  VAL A CA   6  
ATOM 8805  C C    . VAL A 1 90  ? -3.878  0.890   -8.591  1.00 0.00 ? 90  VAL A C    6  
ATOM 8806  O O    . VAL A 1 90  ? -4.637  -0.047  -8.348  1.00 0.00 ? 90  VAL A O    6  
ATOM 8807  C CB   . VAL A 1 90  ? -4.862  2.704   -7.091  1.00 0.00 ? 90  VAL A CB   6  
ATOM 8808  C CG1  . VAL A 1 90  ? -3.791  3.481   -6.322  1.00 0.00 ? 90  VAL A CG1  6  
ATOM 8809  C CG2  . VAL A 1 90  ? -6.170  3.495   -7.158  1.00 0.00 ? 90  VAL A CG2  6  
ATOM 8810  H H    . VAL A 1 90  ? -6.184  1.888   -9.418  1.00 0.00 ? 90  VAL A H    6  
ATOM 8811  H HA   . VAL A 1 90  ? -3.552  3.005   -8.750  1.00 0.00 ? 90  VAL A HA   6  
ATOM 8812  H HB   . VAL A 1 90  ? -5.058  1.779   -6.549  1.00 0.00 ? 90  VAL A HB   6  
ATOM 8813  H HG11 . VAL A 1 90  ? -2.822  3.333   -6.800  1.00 0.00 ? 90  VAL A HG11 6  
ATOM 8814  H HG12 . VAL A 1 90  ? -4.039  4.542   -6.325  1.00 0.00 ? 90  VAL A HG12 6  
ATOM 8815  H HG13 . VAL A 1 90  ? -3.748  3.121   -5.294  1.00 0.00 ? 90  VAL A HG13 6  
ATOM 8816  H HG21 . VAL A 1 90  ? -6.916  2.917   -7.703  1.00 0.00 ? 90  VAL A HG21 6  
ATOM 8817  H HG22 . VAL A 1 90  ? -6.529  3.690   -6.147  1.00 0.00 ? 90  VAL A HG22 6  
ATOM 8818  H HG23 . VAL A 1 90  ? -5.997  4.441   -7.671  1.00 0.00 ? 90  VAL A HG23 6  
ATOM 8819  N N    . THR A 1 91  ? -2.610  0.755   -8.949  1.00 0.00 ? 91  THR A N    6  
ATOM 8820  C CA   . THR A 1 91  ? -2.006  -0.559  -9.084  1.00 0.00 ? 91  THR A CA   6  
ATOM 8821  C C    . THR A 1 91  ? -0.751  -0.661  -8.214  1.00 0.00 ? 91  THR A C    6  
ATOM 8822  O O    . THR A 1 91  ? 0.326   -0.228  -8.619  1.00 0.00 ? 91  THR A O    6  
ATOM 8823  C CB   . THR A 1 91  ? -1.737  -0.807  -10.569 1.00 0.00 ? 91  THR A CB   6  
ATOM 8824  O OG1  . THR A 1 91  ? -1.223  -2.135  -10.613 1.00 0.00 ? 91  THR A OG1  6  
ATOM 8825  C CG2  . THR A 1 91  ? -0.592  0.054   -11.108 1.00 0.00 ? 91  THR A CG2  6  
ATOM 8826  H H    . THR A 1 91  ? -1.999  1.523   -9.145  1.00 0.00 ? 91  THR A H    6  
ATOM 8827  H HA   . THR A 1 91  ? -2.713  -1.302  -8.713  1.00 0.00 ? 91  THR A HA   6  
ATOM 8828  H HB   . THR A 1 91  ? -2.643  -0.663  -11.158 1.00 0.00 ? 91  THR A HB   6  
ATOM 8829  H HG1  . THR A 1 91  ? -0.333  -2.172  -10.158 1.00 0.00 ? 91  THR A HG1  6  
ATOM 8830  H HG21 . THR A 1 91  ? 0.360   -0.362  -10.780 1.00 0.00 ? 91  THR A HG21 6  
ATOM 8831  H HG22 . THR A 1 91  ? -0.628  0.065   -12.198 1.00 0.00 ? 91  THR A HG22 6  
ATOM 8832  H HG23 . THR A 1 91  ? -0.694  1.071   -10.731 1.00 0.00 ? 91  THR A HG23 6  
ATOM 8833  N N    . LEU A 1 92  ? -0.933  -1.237  -7.034  1.00 0.00 ? 92  LEU A N    6  
ATOM 8834  C CA   . LEU A 1 92  ? 0.171   -1.401  -6.104  1.00 0.00 ? 92  LEU A CA   6  
ATOM 8835  C C    . LEU A 1 92  ? 0.167   -2.832  -5.563  1.00 0.00 ? 92  LEU A C    6  
ATOM 8836  O O    . LEU A 1 92  ? -0.819  -3.553  -5.709  1.00 0.00 ? 92  LEU A O    6  
ATOM 8837  C CB   . LEU A 1 92  ? 0.115   -0.331  -5.012  1.00 0.00 ? 92  LEU A CB   6  
ATOM 8838  C CG   . LEU A 1 92  ? -1.280  0.175   -4.639  1.00 0.00 ? 92  LEU A CG   6  
ATOM 8839  C CD1  . LEU A 1 92  ? -1.907  0.956   -5.796  1.00 0.00 ? 92  LEU A CD1  6  
ATOM 8840  C CD2  . LEU A 1 92  ? -2.174  -0.975  -4.173  1.00 0.00 ? 92  LEU A CD2  6  
ATOM 8841  H H    . LEU A 1 92  ? -1.813  -1.586  -6.712  1.00 0.00 ? 92  LEU A H    6  
ATOM 8842  H HA   . LEU A 1 92  ? 1.094   -1.245  -6.661  1.00 0.00 ? 92  LEU A HA   6  
ATOM 8843  H HB2  . LEU A 1 92  ? 0.586   -0.731  -4.114  1.00 0.00 ? 92  LEU A HB2  6  
ATOM 8844  H HB3  . LEU A 1 92  ? 0.715   0.520   -5.334  1.00 0.00 ? 92  LEU A HB3  6  
ATOM 8845  H HG   . LEU A 1 92  ? -1.181  0.866   -3.802  1.00 0.00 ? 92  LEU A HG   6  
ATOM 8846  H HD11 . LEU A 1 92  ? -1.195  1.019   -6.619  1.00 0.00 ? 92  LEU A HD11 6  
ATOM 8847  H HD12 . LEU A 1 92  ? -2.808  0.444   -6.134  1.00 0.00 ? 92  LEU A HD12 6  
ATOM 8848  H HD13 . LEU A 1 92  ? -2.164  1.960   -5.460  1.00 0.00 ? 92  LEU A HD13 6  
ATOM 8849  H HD21 . LEU A 1 92  ? -2.836  -0.623  -3.381  1.00 0.00 ? 92  LEU A HD21 6  
ATOM 8850  H HD22 . LEU A 1 92  ? -2.771  -1.335  -5.011  1.00 0.00 ? 92  LEU A HD22 6  
ATOM 8851  H HD23 . LEU A 1 92  ? -1.554  -1.787  -3.794  1.00 0.00 ? 92  LEU A HD23 6  
ATOM 8852  N N    . GLU A 1 93  ? 1.282   -3.202  -4.949  1.00 0.00 ? 93  GLU A N    6  
ATOM 8853  C CA   . GLU A 1 93  ? 1.420   -4.534  -4.385  1.00 0.00 ? 93  GLU A CA   6  
ATOM 8854  C C    . GLU A 1 93  ? 1.450   -4.463  -2.857  1.00 0.00 ? 93  GLU A C    6  
ATOM 8855  O O    . GLU A 1 93  ? 2.175   -3.651  -2.284  1.00 0.00 ? 93  GLU A O    6  
ATOM 8856  C CB   . GLU A 1 93  ? 2.668   -5.232  -4.927  1.00 0.00 ? 93  GLU A CB   6  
ATOM 8857  C CG   . GLU A 1 93  ? 2.530   -5.519  -6.424  1.00 0.00 ? 93  GLU A CG   6  
ATOM 8858  C CD   . GLU A 1 93  ? 3.111   -4.374  -7.257  1.00 0.00 ? 93  GLU A CD   6  
ATOM 8859  O OE1  . GLU A 1 93  ? 2.559   -3.257  -7.149  1.00 0.00 ? 93  GLU A OE1  6  
ATOM 8860  O OE2  . GLU A 1 93  ? 4.092   -4.641  -7.983  1.00 0.00 ? 93  GLU A OE2  6  
ATOM 8861  H H    . GLU A 1 93  ? 2.079   -2.610  -4.834  1.00 0.00 ? 93  GLU A H    6  
ATOM 8862  H HA   . GLU A 1 93  ? 0.535   -5.080  -4.713  1.00 0.00 ? 93  GLU A HA   6  
ATOM 8863  H HB2  . GLU A 1 93  ? 3.544   -4.607  -4.752  1.00 0.00 ? 93  GLU A HB2  6  
ATOM 8864  H HB3  . GLU A 1 93  ? 2.831   -6.165  -4.388  1.00 0.00 ? 93  GLU A HB3  6  
ATOM 8865  H HG2  . GLU A 1 93  ? 3.044   -6.448  -6.669  1.00 0.00 ? 93  GLU A HG2  6  
ATOM 8866  H HG3  . GLU A 1 93  ? 1.479   -5.660  -6.675  1.00 0.00 ? 93  GLU A HG3  6  
ATOM 8867  N N    . VAL A 1 94  ? 0.655   -5.326  -2.241  1.00 0.00 ? 94  VAL A N    6  
ATOM 8868  C CA   . VAL A 1 94  ? 0.583   -5.371  -0.790  1.00 0.00 ? 94  VAL A CA   6  
ATOM 8869  C C    . VAL A 1 94  ? 0.686   -6.825  -0.324  1.00 0.00 ? 94  VAL A C    6  
ATOM 8870  O O    . VAL A 1 94  ? 0.107   -7.720  -0.938  1.00 0.00 ? 94  VAL A O    6  
ATOM 8871  C CB   . VAL A 1 94  ? -0.694  -4.679  -0.308  1.00 0.00 ? 94  VAL A CB   6  
ATOM 8872  C CG1  . VAL A 1 94  ? -0.897  -3.343  -1.026  1.00 0.00 ? 94  VAL A CG1  6  
ATOM 8873  C CG2  . VAL A 1 94  ? -1.911  -5.587  -0.487  1.00 0.00 ? 94  VAL A CG2  6  
ATOM 8874  H H    . VAL A 1 94  ? 0.070   -5.983  -2.714  1.00 0.00 ? 94  VAL A H    6  
ATOM 8875  H HA   . VAL A 1 94  ? 1.436   -4.816  -0.401  1.00 0.00 ? 94  VAL A HA   6  
ATOM 8876  H HB   . VAL A 1 94  ? -0.582  -4.473  0.756   1.00 0.00 ? 94  VAL A HB   6  
ATOM 8877  H HG11 . VAL A 1 94  ? -1.059  -3.522  -2.089  1.00 0.00 ? 94  VAL A HG11 6  
ATOM 8878  H HG12 . VAL A 1 94  ? -1.765  -2.833  -0.607  1.00 0.00 ? 94  VAL A HG12 6  
ATOM 8879  H HG13 . VAL A 1 94  ? -0.011  -2.721  -0.893  1.00 0.00 ? 94  VAL A HG13 6  
ATOM 8880  H HG21 . VAL A 1 94  ? -2.805  -5.070  -0.137  1.00 0.00 ? 94  VAL A HG21 6  
ATOM 8881  H HG22 . VAL A 1 94  ? -2.026  -5.838  -1.541  1.00 0.00 ? 94  VAL A HG22 6  
ATOM 8882  H HG23 . VAL A 1 94  ? -1.771  -6.501  0.091   1.00 0.00 ? 94  VAL A HG23 6  
ATOM 8883  N N    . ALA A 1 95  ? 1.428   -7.015  0.757   1.00 0.00 ? 95  ALA A N    6  
ATOM 8884  C CA   . ALA A 1 95  ? 1.616   -8.344  1.312   1.00 0.00 ? 95  ALA A CA   6  
ATOM 8885  C C    . ALA A 1 95  ? 1.435   -8.288  2.830   1.00 0.00 ? 95  ALA A C    6  
ATOM 8886  O O    . ALA A 1 95  ? 1.435   -7.208  3.420   1.00 0.00 ? 95  ALA A O    6  
ATOM 8887  C CB   . ALA A 1 95  ? 2.991   -8.878  0.908   1.00 0.00 ? 95  ALA A CB   6  
ATOM 8888  H H    . ALA A 1 95  ? 1.896   -6.281  1.250   1.00 0.00 ? 95  ALA A H    6  
ATOM 8889  H HA   . ALA A 1 95  ? 0.849   -8.992  0.887   1.00 0.00 ? 95  ALA A HA   6  
ATOM 8890  H HB1  . ALA A 1 95  ? 3.721   -8.620  1.676   1.00 0.00 ? 95  ALA A HB1  6  
ATOM 8891  H HB2  . ALA A 1 95  ? 2.944   -9.961  0.801   1.00 0.00 ? 95  ALA A HB2  6  
ATOM 8892  H HB3  . ALA A 1 95  ? 3.289   -8.432  -0.041  1.00 0.00 ? 95  ALA A HB3  6  
ATOM 8893  N N    . LYS A 1 96  ? 1.286   -9.465  3.420   1.00 0.00 ? 96  LYS A N    6  
ATOM 8894  C CA   . LYS A 1 96  ? 1.105   -9.563  4.859   1.00 0.00 ? 96  LYS A CA   6  
ATOM 8895  C C    . LYS A 1 96  ? 1.084   -11.038 5.266   1.00 0.00 ? 96  LYS A C    6  
ATOM 8896  O O    . LYS A 1 96  ? 2.093   -11.575 5.719   1.00 0.00 ? 96  LYS A O    6  
ATOM 8897  C CB   . LYS A 1 96  ? -0.139  -8.787  5.297   1.00 0.00 ? 96  LYS A CB   6  
ATOM 8898  C CG   . LYS A 1 96  ? -0.183  -8.635  6.819   1.00 0.00 ? 96  LYS A CG   6  
ATOM 8899  C CD   . LYS A 1 96  ? -1.622  -8.693  7.334   1.00 0.00 ? 96  LYS A CD   6  
ATOM 8900  C CE   . LYS A 1 96  ? -1.658  -8.684  8.863   1.00 0.00 ? 96  LYS A CE   6  
ATOM 8901  N NZ   . LYS A 1 96  ? -3.041  -8.484  9.349   1.00 0.00 ? 96  LYS A NZ   6  
ATOM 8902  H H    . LYS A 1 96  ? 1.287   -10.339 2.934   1.00 0.00 ? 96  LYS A H    6  
ATOM 8903  H HA   . LYS A 1 96  ? 1.965   -9.087  5.330   1.00 0.00 ? 96  LYS A HA   6  
ATOM 8904  H HB2  . LYS A 1 96  ? -0.140  -7.802  4.830   1.00 0.00 ? 96  LYS A HB2  6  
ATOM 8905  H HB3  . LYS A 1 96  ? -1.034  -9.304  4.953   1.00 0.00 ? 96  LYS A HB3  6  
ATOM 8906  H HG2  . LYS A 1 96  ? 0.406   -9.427  7.283   1.00 0.00 ? 96  LYS A HG2  6  
ATOM 8907  H HG3  . LYS A 1 96  ? 0.273   -7.688  7.107   1.00 0.00 ? 96  LYS A HG3  6  
ATOM 8908  H HD2  . LYS A 1 96  ? -2.184  -7.842  6.949   1.00 0.00 ? 96  LYS A HD2  6  
ATOM 8909  H HD3  . LYS A 1 96  ? -2.110  -9.592  6.960   1.00 0.00 ? 96  LYS A HD3  6  
ATOM 8910  H HE2  . LYS A 1 96  ? -1.264  -9.625  9.248   1.00 0.00 ? 96  LYS A HE2  6  
ATOM 8911  H HE3  . LYS A 1 96  ? -1.014  -7.890  9.244   1.00 0.00 ? 96  LYS A HE3  6  
ATOM 8912  H HZ1  . LYS A 1 96  ? -3.019  -8.111  10.276  1.00 0.00 ? 96  LYS A HZ1  6  
ATOM 8913  H HZ2  . LYS A 1 96  ? -3.518  -7.846  8.744   1.00 0.00 ? 96  LYS A HZ2  6  
ATOM 8914  H HZ3  . LYS A 1 96  ? -3.523  -9.360  9.354   1.00 0.00 ? 96  LYS A HZ3  6  
ATOM 8915  N N    . GLN A 1 97  ? -0.078  -11.651 5.091   1.00 0.00 ? 97  GLN A N    6  
ATOM 8916  C CA   . GLN A 1 97  ? -0.244  -13.053 5.434   1.00 0.00 ? 97  GLN A CA   6  
ATOM 8917  C C    . GLN A 1 97  ? -1.612  -13.555 4.970   1.00 0.00 ? 97  GLN A C    6  
ATOM 8918  O O    . GLN A 1 97  ? -1.733  -14.678 4.483   1.00 0.00 ? 97  GLN A O    6  
ATOM 8919  C CB   . GLN A 1 97  ? -0.059  -13.275 6.937   1.00 0.00 ? 97  GLN A CB   6  
ATOM 8920  C CG   . GLN A 1 97  ? -0.908  -12.291 7.744   1.00 0.00 ? 97  GLN A CG   6  
ATOM 8921  C CD   . GLN A 1 97  ? -2.024  -13.019 8.497   1.00 0.00 ? 97  GLN A CD   6  
ATOM 8922  O OE1  . GLN A 1 97  ? -2.742  -13.841 7.951   1.00 0.00 ? 97  GLN A OE1  6  
ATOM 8923  N NE2  . GLN A 1 97  ? -2.130  -12.671 9.776   1.00 0.00 ? 97  GLN A NE2  6  
ATOM 8924  H H    . GLN A 1 97  ? -0.894  -11.207 4.722   1.00 0.00 ? 97  GLN A H    6  
ATOM 8925  H HA   . GLN A 1 97  ? 0.545   -13.578 4.896   1.00 0.00 ? 97  GLN A HA   6  
ATOM 8926  H HB2  . GLN A 1 97  ? -0.337  -14.297 7.194   1.00 0.00 ? 97  GLN A HB2  6  
ATOM 8927  H HB3  . GLN A 1 97  ? 0.992   -13.155 7.199   1.00 0.00 ? 97  GLN A HB3  6  
ATOM 8928  H HG2  . GLN A 1 97  ? -0.276  -11.756 8.453   1.00 0.00 ? 97  GLN A HG2  6  
ATOM 8929  H HG3  . GLN A 1 97  ? -1.341  -11.545 7.077   1.00 0.00 ? 97  GLN A HG3  6  
ATOM 8930  H HE21 . GLN A 1 97  ? -1.509  -11.989 10.162  1.00 0.00 ? 97  GLN A HE21 6  
ATOM 8931  H HE22 . GLN A 1 97  ? -2.831  -13.093 10.352  1.00 0.00 ? 97  GLN A HE22 6  
ATOM 8932  N N    . GLY A 1 98  ? -2.609  -12.698 5.136   1.00 0.00 ? 98  GLY A N    6  
ATOM 8933  C CA   . GLY A 1 98  ? -3.964  -13.041 4.740   1.00 0.00 ? 98  GLY A CA   6  
ATOM 8934  C C    . GLY A 1 98  ? -4.654  -11.856 4.062   1.00 0.00 ? 98  GLY A C    6  
ATOM 8935  O O    . GLY A 1 98  ? -4.307  -10.703 4.315   1.00 0.00 ? 98  GLY A O    6  
ATOM 8936  H H    . GLY A 1 98  ? -2.503  -11.787 5.533   1.00 0.00 ? 98  GLY A H    6  
ATOM 8937  H HA2  . GLY A 1 98  ? -3.944  -13.893 4.060   1.00 0.00 ? 98  GLY A HA2  6  
ATOM 8938  H HA3  . GLY A 1 98  ? -4.537  -13.346 5.616   1.00 0.00 ? 98  GLY A HA3  6  
ATOM 8939  N N    . ALA A 1 99  ? -5.617  -12.180 3.212   1.00 0.00 ? 99  ALA A N    6  
ATOM 8940  C CA   . ALA A 1 99  ? -6.358  -11.156 2.495   1.00 0.00 ? 99  ALA A CA   6  
ATOM 8941  C C    . ALA A 1 99  ? -7.371  -11.824 1.562   1.00 0.00 ? 99  ALA A C    6  
ATOM 8942  O O    . ALA A 1 99  ? -7.260  -11.718 0.342   1.00 0.00 ? 99  ALA A O    6  
ATOM 8943  C CB   . ALA A 1 99  ? -5.380  -10.251 1.741   1.00 0.00 ? 99  ALA A CB   6  
ATOM 8944  H H    . ALA A 1 99  ? -5.893  -13.120 3.011   1.00 0.00 ? 99  ALA A H    6  
ATOM 8945  H HA   . ALA A 1 99  ? -6.894  -10.557 3.231   1.00 0.00 ? 99  ALA A HA   6  
ATOM 8946  H HB1  . ALA A 1 99  ? -4.813  -9.655  2.456   1.00 0.00 ? 99  ALA A HB1  6  
ATOM 8947  H HB2  . ALA A 1 99  ? -4.696  -10.865 1.155   1.00 0.00 ? 99  ALA A HB2  6  
ATOM 8948  H HB3  . ALA A 1 99  ? -5.936  -9.590  1.076   1.00 0.00 ? 99  ALA A HB3  6  
ATOM 8949  N N    . ILE A 1 100 ? -8.335  -12.497 2.173   1.00 0.00 ? 100 ILE A N    6  
ATOM 8950  C CA   . ILE A 1 100 ? -9.366  -13.182 1.413   1.00 0.00 ? 100 ILE A CA   6  
ATOM 8951  C C    . ILE A 1 100 ? -10.031 -12.192 0.455   1.00 0.00 ? 100 ILE A C    6  
ATOM 8952  O O    . ILE A 1 100 ? -9.794  -10.988 0.539   1.00 0.00 ? 100 ILE A O    6  
ATOM 8953  C CB   . ILE A 1 100 ? -10.349 -13.882 2.354   1.00 0.00 ? 100 ILE A CB   6  
ATOM 8954  C CG1  . ILE A 1 100 ? -11.067 -12.869 3.249   1.00 0.00 ? 100 ILE A CG1  6  
ATOM 8955  C CG2  . ILE A 1 100 ? -9.648  -14.971 3.169   1.00 0.00 ? 100 ILE A CG2  6  
ATOM 8956  C CD1  . ILE A 1 100 ? -12.374 -13.449 3.794   1.00 0.00 ? 100 ILE A CD1  6  
ATOM 8957  H H    . ILE A 1 100 ? -8.417  -12.578 3.166   1.00 0.00 ? 100 ILE A H    6  
ATOM 8958  H HA   . ILE A 1 100 ? -8.877  -13.958 0.824   1.00 0.00 ? 100 ILE A HA   6  
ATOM 8959  H HB   . ILE A 1 100 ? -11.111 -14.373 1.748   1.00 0.00 ? 100 ILE A HB   6  
ATOM 8960  H HG12 . ILE A 1 100 ? -10.417 -12.585 4.076   1.00 0.00 ? 100 ILE A HG12 6  
ATOM 8961  H HG13 . ILE A 1 100 ? -11.276 -11.962 2.682   1.00 0.00 ? 100 ILE A HG13 6  
ATOM 8962  H HG21 . ILE A 1 100 ? -9.532  -15.865 2.556   1.00 0.00 ? 100 ILE A HG21 6  
ATOM 8963  H HG22 . ILE A 1 100 ? -8.667  -14.615 3.483   1.00 0.00 ? 100 ILE A HG22 6  
ATOM 8964  H HG23 . ILE A 1 100 ? -10.247 -15.208 4.048   1.00 0.00 ? 100 ILE A HG23 6  
ATOM 8965  H HD11 . ILE A 1 100 ? -13.079 -13.588 2.976   1.00 0.00 ? 100 ILE A HD11 6  
ATOM 8966  H HD12 . ILE A 1 100 ? -12.174 -14.409 4.269   1.00 0.00 ? 100 ILE A HD12 6  
ATOM 8967  H HD13 . ILE A 1 100 ? -12.798 -12.762 4.527   1.00 0.00 ? 100 ILE A HD13 6  
ATOM 8968  N N    . TYR A 1 101 ? -10.849 -12.736 -0.433  1.00 0.00 ? 101 TYR A N    6  
ATOM 8969  C CA   . TYR A 1 101 ? -11.550 -11.915 -1.406  1.00 0.00 ? 101 TYR A CA   6  
ATOM 8970  C C    . TYR A 1 101 ? -12.573 -11.006 -0.722  1.00 0.00 ? 101 TYR A C    6  
ATOM 8971  O O    . TYR A 1 101 ? -13.138 -10.115 -1.354  1.00 0.00 ? 101 TYR A O    6  
ATOM 8972  C CB   . TYR A 1 101 ? -12.286 -12.889 -2.328  1.00 0.00 ? 101 TYR A CB   6  
ATOM 8973  C CG   . TYR A 1 101 ? -13.623 -13.383 -1.772  1.00 0.00 ? 101 TYR A CG   6  
ATOM 8974  C CD1  . TYR A 1 101 ? -14.756 -12.607 -1.908  1.00 0.00 ? 101 TYR A CD1  6  
ATOM 8975  C CD2  . TYR A 1 101 ? -13.695 -14.604 -1.133  1.00 0.00 ? 101 TYR A CD2  6  
ATOM 8976  C CE1  . TYR A 1 101 ? -16.014 -13.072 -1.384  1.00 0.00 ? 101 TYR A CE1  6  
ATOM 8977  C CE2  . TYR A 1 101 ? -14.953 -15.069 -0.609  1.00 0.00 ? 101 TYR A CE2  6  
ATOM 8978  C CZ   . TYR A 1 101 ? -16.051 -14.280 -0.760  1.00 0.00 ? 101 TYR A CZ   6  
ATOM 8979  O OH   . TYR A 1 101 ? -17.239 -14.719 -0.265  1.00 0.00 ? 101 TYR A OH   6  
ATOM 8980  H H    . TYR A 1 101 ? -11.036 -13.716 -0.495  1.00 0.00 ? 101 TYR A H    6  
ATOM 8981  H HA   . TYR A 1 101 ? -10.812 -11.297 -1.919  1.00 0.00 ? 101 TYR A HA   6  
ATOM 8982  H HB2  . TYR A 1 101 ? -12.461 -12.403 -3.288  1.00 0.00 ? 101 TYR A HB2  6  
ATOM 8983  H HB3  . TYR A 1 101 ? -11.644 -13.748 -2.519  1.00 0.00 ? 101 TYR A HB3  6  
ATOM 8984  H HD1  . TYR A 1 101 ? -14.699 -11.642 -2.412  1.00 0.00 ? 101 TYR A HD1  6  
ATOM 8985  H HD2  . TYR A 1 101 ? -12.800 -15.217 -1.026  1.00 0.00 ? 101 TYR A HD2  6  
ATOM 8986  H HE1  . TYR A 1 101 ? -16.917 -12.469 -1.484  1.00 0.00 ? 101 TYR A HE1  6  
ATOM 8987  H HE2  . TYR A 1 101 ? -15.025 -16.032 -0.103  1.00 0.00 ? 101 TYR A HE2  6  
ATOM 8988  H HH   . TYR A 1 101 ? -17.090 -15.216 0.590   1.00 0.00 ? 101 TYR A HH   6  
ATOM 8989  N N    . GLY A 1 1   ? -3.869  -7.886  20.616  1.00 0.00 ? 1   GLY A N    7  
ATOM 8990  C CA   . GLY A 1 1   ? -4.323  -9.143  20.046  1.00 0.00 ? 1   GLY A CA   7  
ATOM 8991  C C    . GLY A 1 1   ? -3.576  -9.458  18.748  1.00 0.00 ? 1   GLY A C    7  
ATOM 8992  O O    . GLY A 1 1   ? -3.936  -8.959  17.683  1.00 0.00 ? 1   GLY A O    7  
ATOM 8993  H H1   . GLY A 1 1   ? -3.469  -7.245  19.961  1.00 0.00 ? 1   GLY A H1   7  
ATOM 8994  H HA2  . GLY A 1 1   ? -4.169  -9.949  20.763  1.00 0.00 ? 1   GLY A HA2  7  
ATOM 8995  H HA3  . GLY A 1 1   ? -5.394  -9.091  19.850  1.00 0.00 ? 1   GLY A HA3  7  
ATOM 8996  N N    . PRO A 1 2   ? -2.523  -10.307 18.883  1.00 0.00 ? 2   PRO A N    7  
ATOM 8997  C CA   . PRO A 1 2   ? -1.722  -10.695 17.734  1.00 0.00 ? 2   PRO A CA   7  
ATOM 8998  C C    . PRO A 1 2   ? -2.469  -11.706 16.862  1.00 0.00 ? 2   PRO A C    7  
ATOM 8999  O O    . PRO A 1 2   ? -3.606  -12.068 17.159  1.00 0.00 ? 2   PRO A O    7  
ATOM 9000  C CB   . PRO A 1 2   ? -0.436  -11.254 18.322  1.00 0.00 ? 2   PRO A CB   7  
ATOM 9001  C CG   . PRO A 1 2   ? -0.750  -11.588 19.771  1.00 0.00 ? 2   PRO A CG   7  
ATOM 9002  C CD   . PRO A 1 2   ? -2.067  -10.918 20.128  1.00 0.00 ? 2   PRO A CD   7  
ATOM 9003  H HA   . PRO A 1 2   ? -1.549  -9.904  17.149  1.00 0.00 ? 2   PRO A HA   7  
ATOM 9004  H HB2  . PRO A 1 2   ? -0.111  -12.141 17.778  1.00 0.00 ? 2   PRO A HB2  7  
ATOM 9005  H HB3  . PRO A 1 2   ? 0.372   -10.526 18.255  1.00 0.00 ? 2   PRO A HB3  7  
ATOM 9006  H HG2  . PRO A 1 2   ? -0.821  -12.667 19.907  1.00 0.00 ? 2   PRO A HG2  7  
ATOM 9007  H HG3  . PRO A 1 2   ? 0.047   -11.235 20.425  1.00 0.00 ? 2   PRO A HG3  7  
ATOM 9008  H HD2  . PRO A 1 2   ? -2.791  -11.643 20.502  1.00 0.00 ? 2   PRO A HD2  7  
ATOM 9009  H HD3  . PRO A 1 2   ? -1.932  -10.171 20.910  1.00 0.00 ? 2   PRO A HD3  7  
ATOM 9010  N N    . LEU A 1 3   ? -1.799  -12.133 15.801  1.00 0.00 ? 3   LEU A N    7  
ATOM 9011  C CA   . LEU A 1 3   ? -2.385  -13.095 14.883  1.00 0.00 ? 3   LEU A CA   7  
ATOM 9012  C C    . LEU A 1 3   ? -1.354  -14.178 14.560  1.00 0.00 ? 3   LEU A C    7  
ATOM 9013  O O    . LEU A 1 3   ? -1.535  -15.340 14.922  1.00 0.00 ? 3   LEU A O    7  
ATOM 9014  C CB   . LEU A 1 3   ? -2.940  -12.385 13.646  1.00 0.00 ? 3   LEU A CB   7  
ATOM 9015  C CG   . LEU A 1 3   ? -3.386  -13.291 12.497  1.00 0.00 ? 3   LEU A CG   7  
ATOM 9016  C CD1  . LEU A 1 3   ? -4.763  -13.896 12.778  1.00 0.00 ? 3   LEU A CD1  7  
ATOM 9017  C CD2  . LEU A 1 3   ? -3.349  -12.543 11.163  1.00 0.00 ? 3   LEU A CD2  7  
ATOM 9018  H H    . LEU A 1 3   ? -0.874  -11.834 15.566  1.00 0.00 ? 3   LEU A H    7  
ATOM 9019  H HA   . LEU A 1 3   ? -3.228  -13.561 15.393  1.00 0.00 ? 3   LEU A HA   7  
ATOM 9020  H HB2  . LEU A 1 3   ? -3.790  -11.776 13.953  1.00 0.00 ? 3   LEU A HB2  7  
ATOM 9021  H HB3  . LEU A 1 3   ? -2.177  -11.703 13.270  1.00 0.00 ? 3   LEU A HB3  7  
ATOM 9022  H HG   . LEU A 1 3   ? -2.680  -14.119 12.421  1.00 0.00 ? 3   LEU A HG   7  
ATOM 9023  H HD11 . LEU A 1 3   ? -4.799  -14.255 13.806  1.00 0.00 ? 3   LEU A HD11 7  
ATOM 9024  H HD12 . LEU A 1 3   ? -5.530  -13.136 12.630  1.00 0.00 ? 3   LEU A HD12 7  
ATOM 9025  H HD13 . LEU A 1 3   ? -4.940  -14.728 12.096  1.00 0.00 ? 3   LEU A HD13 7  
ATOM 9026  H HD21 . LEU A 1 3   ? -2.353  -12.130 11.005  1.00 0.00 ? 3   LEU A HD21 7  
ATOM 9027  H HD22 . LEU A 1 3   ? -3.590  -13.232 10.353  1.00 0.00 ? 3   LEU A HD22 7  
ATOM 9028  H HD23 . LEU A 1 3   ? -4.080  -11.734 11.180  1.00 0.00 ? 3   LEU A HD23 7  
ATOM 9029  N N    . GLY A 1 4   ? -0.295  -13.759 13.882  1.00 0.00 ? 4   GLY A N    7  
ATOM 9030  C CA   . GLY A 1 4   ? 0.764   -14.680 13.506  1.00 0.00 ? 4   GLY A CA   7  
ATOM 9031  C C    . GLY A 1 4   ? 0.708   -14.999 12.011  1.00 0.00 ? 4   GLY A C    7  
ATOM 9032  O O    . GLY A 1 4   ? -0.054  -15.866 11.585  1.00 0.00 ? 4   GLY A O    7  
ATOM 9033  H H    . GLY A 1 4   ? -0.156  -12.813 13.592  1.00 0.00 ? 4   GLY A H    7  
ATOM 9034  H HA2  . GLY A 1 4   ? 1.733   -14.245 13.753  1.00 0.00 ? 4   GLY A HA2  7  
ATOM 9035  H HA3  . GLY A 1 4   ? 0.672   -15.601 14.082  1.00 0.00 ? 4   GLY A HA3  7  
ATOM 9036  N N    . SER A 1 5   ? 1.525   -14.281 11.254  1.00 0.00 ? 5   SER A N    7  
ATOM 9037  C CA   . SER A 1 5   ? 1.578   -14.477 9.815   1.00 0.00 ? 5   SER A CA   7  
ATOM 9038  C C    . SER A 1 5   ? 2.728   -13.664 9.218   1.00 0.00 ? 5   SER A C    7  
ATOM 9039  O O    . SER A 1 5   ? 2.961   -12.524 9.619   1.00 0.00 ? 5   SER A O    7  
ATOM 9040  C CB   . SER A 1 5   ? 0.254   -14.085 9.157   1.00 0.00 ? 5   SER A CB   7  
ATOM 9041  O OG   . SER A 1 5   ? 0.038   -12.677 9.188   1.00 0.00 ? 5   SER A OG   7  
ATOM 9042  H H    . SER A 1 5   ? 2.142   -13.578 11.608  1.00 0.00 ? 5   SER A H    7  
ATOM 9043  H HA   . SER A 1 5   ? 1.751   -15.544 9.675   1.00 0.00 ? 5   SER A HA   7  
ATOM 9044  H HB2  . SER A 1 5   ? 0.247   -14.430 8.123   1.00 0.00 ? 5   SER A HB2  7  
ATOM 9045  H HB3  . SER A 1 5   ? -0.568  -14.589 9.666   1.00 0.00 ? 5   SER A HB3  7  
ATOM 9046  H HG   . SER A 1 5   ? 0.714   -12.240 9.782   1.00 0.00 ? 5   SER A HG   7  
ATOM 9047  N N    . LEU A 1 6   ? 3.417   -14.281 8.270   1.00 0.00 ? 6   LEU A N    7  
ATOM 9048  C CA   . LEU A 1 6   ? 4.538   -13.628 7.614   1.00 0.00 ? 6   LEU A CA   7  
ATOM 9049  C C    . LEU A 1 6   ? 4.753   -14.258 6.236   1.00 0.00 ? 6   LEU A C    7  
ATOM 9050  O O    . LEU A 1 6   ? 4.528   -13.613 5.213   1.00 0.00 ? 6   LEU A O    7  
ATOM 9051  C CB   . LEU A 1 6   ? 5.778   -13.666 8.508   1.00 0.00 ? 6   LEU A CB   7  
ATOM 9052  C CG   . LEU A 1 6   ? 6.676   -12.428 8.462   1.00 0.00 ? 6   LEU A CG   7  
ATOM 9053  C CD1  . LEU A 1 6   ? 6.139   -11.327 9.379   1.00 0.00 ? 6   LEU A CD1  7  
ATOM 9054  C CD2  . LEU A 1 6   ? 8.126   -12.790 8.790   1.00 0.00 ? 6   LEU A CD2  7  
ATOM 9055  H H    . LEU A 1 6   ? 3.221   -15.208 7.949   1.00 0.00 ? 6   LEU A H    7  
ATOM 9056  H HA   . LEU A 1 6   ? 4.271   -12.580 7.477   1.00 0.00 ? 6   LEU A HA   7  
ATOM 9057  H HB2  . LEU A 1 6   ? 5.455   -13.819 9.538   1.00 0.00 ? 6   LEU A HB2  7  
ATOM 9058  H HB3  . LEU A 1 6   ? 6.376   -14.535 8.230   1.00 0.00 ? 6   LEU A HB3  7  
ATOM 9059  H HG   . LEU A 1 6   ? 6.665   -12.035 7.446   1.00 0.00 ? 6   LEU A HG   7  
ATOM 9060  H HD11 . LEU A 1 6   ? 5.280   -11.704 9.934   1.00 0.00 ? 6   LEU A HD11 7  
ATOM 9061  H HD12 . LEU A 1 6   ? 6.919   -11.024 10.078  1.00 0.00 ? 6   LEU A HD12 7  
ATOM 9062  H HD13 . LEU A 1 6   ? 5.836   -10.470 8.778   1.00 0.00 ? 6   LEU A HD13 7  
ATOM 9063  H HD21 . LEU A 1 6   ? 8.308   -13.833 8.530   1.00 0.00 ? 6   LEU A HD21 7  
ATOM 9064  H HD22 . LEU A 1 6   ? 8.799   -12.150 8.219   1.00 0.00 ? 6   LEU A HD22 7  
ATOM 9065  H HD23 . LEU A 1 6   ? 8.305   -12.646 9.856   1.00 0.00 ? 6   LEU A HD23 7  
ATOM 9066  N N    . ARG A 1 7   ? 5.187   -15.510 6.254   1.00 0.00 ? 7   ARG A N    7  
ATOM 9067  C CA   . ARG A 1 7   ? 5.435   -16.233 5.019   1.00 0.00 ? 7   ARG A CA   7  
ATOM 9068  C C    . ARG A 1 7   ? 4.113   -16.668 4.383   1.00 0.00 ? 7   ARG A C    7  
ATOM 9069  O O    . ARG A 1 7   ? 3.338   -17.402 4.995   1.00 0.00 ? 7   ARG A O    7  
ATOM 9070  C CB   . ARG A 1 7   ? 6.304   -17.468 5.269   1.00 0.00 ? 7   ARG A CB   7  
ATOM 9071  C CG   . ARG A 1 7   ? 5.613   -18.439 6.229   1.00 0.00 ? 7   ARG A CG   7  
ATOM 9072  C CD   . ARG A 1 7   ? 6.591   -18.950 7.288   1.00 0.00 ? 7   ARG A CD   7  
ATOM 9073  N NE   . ARG A 1 7   ? 6.909   -20.374 7.038   1.00 0.00 ? 7   ARG A NE   7  
ATOM 9074  C CZ   . ARG A 1 7   ? 7.737   -20.800 6.074   1.00 0.00 ? 7   ARG A CZ   7  
ATOM 9075  N NH1  . ARG A 1 7   ? 8.334   -19.915 5.264   1.00 0.00 ? 7   ARG A NH1  7  
ATOM 9076  N NH2  . ARG A 1 7   ? 7.967   -22.111 5.920   1.00 0.00 ? 7   ARG A NH2  7  
ATOM 9077  H H    . ARG A 1 7   ? 5.367   -16.027 7.090   1.00 0.00 ? 7   ARG A H    7  
ATOM 9078  H HA   . ARG A 1 7   ? 5.962   -15.524 4.381   1.00 0.00 ? 7   ARG A HA   7  
ATOM 9079  H HB2  . ARG A 1 7   ? 6.509   -17.970 4.323   1.00 0.00 ? 7   ARG A HB2  7  
ATOM 9080  H HB3  . ARG A 1 7   ? 7.265   -17.163 5.683   1.00 0.00 ? 7   ARG A HB3  7  
ATOM 9081  H HG2  . ARG A 1 7   ? 4.773   -17.941 6.713   1.00 0.00 ? 7   ARG A HG2  7  
ATOM 9082  H HG3  . ARG A 1 7   ? 5.205   -19.280 5.669   1.00 0.00 ? 7   ARG A HG3  7  
ATOM 9083  H HD2  . ARG A 1 7   ? 7.504   -18.356 7.270   1.00 0.00 ? 7   ARG A HD2  7  
ATOM 9084  H HD3  . ARG A 1 7   ? 6.156   -18.836 8.281   1.00 0.00 ? 7   ARG A HD3  7  
ATOM 9085  H HE   . ARG A 1 7   ? 6.480   -21.061 7.625   1.00 0.00 ? 7   ARG A HE   7  
ATOM 9086  H HH11 . ARG A 1 7   ? 8.162   -18.937 5.379   1.00 0.00 ? 7   ARG A HH11 7  
ATOM 9087  H HH12 . ARG A 1 7   ? 8.952   -20.233 4.545   1.00 0.00 ? 7   ARG A HH12 7  
ATOM 9088  H HH21 . ARG A 1 7   ? 7.522   -22.771 6.525   1.00 0.00 ? 7   ARG A HH21 7  
ATOM 9089  H HH22 . ARG A 1 7   ? 8.585   -22.429 5.201   1.00 0.00 ? 7   ARG A HH22 7  
ATOM 9090  N N    . LYS A 1 8   ? 3.897   -16.198 3.163   1.00 0.00 ? 8   LYS A N    7  
ATOM 9091  C CA   . LYS A 1 8   ? 2.682   -16.530 2.438   1.00 0.00 ? 8   LYS A CA   7  
ATOM 9092  C C    . LYS A 1 8   ? 2.674   -15.789 1.100   1.00 0.00 ? 8   LYS A C    7  
ATOM 9093  O O    . LYS A 1 8   ? 3.474   -14.880 0.884   1.00 0.00 ? 8   LYS A O    7  
ATOM 9094  C CB   . LYS A 1 8   ? 1.450   -16.252 3.302   1.00 0.00 ? 8   LYS A CB   7  
ATOM 9095  C CG   . LYS A 1 8   ? 0.859   -17.553 3.849   1.00 0.00 ? 8   LYS A CG   7  
ATOM 9096  C CD   . LYS A 1 8   ? 0.493   -17.410 5.328   1.00 0.00 ? 8   LYS A CD   7  
ATOM 9097  C CE   . LYS A 1 8   ? -0.739  -18.250 5.671   1.00 0.00 ? 8   LYS A CE   7  
ATOM 9098  N NZ   . LYS A 1 8   ? -0.382  -19.684 5.753   1.00 0.00 ? 8   LYS A NZ   7  
ATOM 9099  H H    . LYS A 1 8   ? 4.532   -15.603 2.673   1.00 0.00 ? 8   LYS A H    7  
ATOM 9100  H HA   . LYS A 1 8   ? 2.701   -17.601 2.240   1.00 0.00 ? 8   LYS A HA   7  
ATOM 9101  H HB2  . LYS A 1 8   ? 1.721   -15.596 4.129   1.00 0.00 ? 8   LYS A HB2  7  
ATOM 9102  H HB3  . LYS A 1 8   ? 0.698   -15.727 2.712   1.00 0.00 ? 8   LYS A HB3  7  
ATOM 9103  H HG2  . LYS A 1 8   ? -0.028  -17.823 3.276   1.00 0.00 ? 8   LYS A HG2  7  
ATOM 9104  H HG3  . LYS A 1 8   ? 1.577   -18.363 3.725   1.00 0.00 ? 8   LYS A HG3  7  
ATOM 9105  H HD2  . LYS A 1 8   ? 1.335   -17.722 5.946   1.00 0.00 ? 8   LYS A HD2  7  
ATOM 9106  H HD3  . LYS A 1 8   ? 0.299   -16.363 5.559   1.00 0.00 ? 8   LYS A HD3  7  
ATOM 9107  H HE2  . LYS A 1 8   ? -1.159  -17.919 6.621   1.00 0.00 ? 8   LYS A HE2  7  
ATOM 9108  H HE3  . LYS A 1 8   ? -1.509  -18.103 4.914   1.00 0.00 ? 8   LYS A HE3  7  
ATOM 9109  H HZ1  . LYS A 1 8   ? 0.578   -19.804 5.499   1.00 0.00 ? 8   LYS A HZ1  7  
ATOM 9110  H HZ2  . LYS A 1 8   ? -0.523  -20.010 6.688   1.00 0.00 ? 8   LYS A HZ2  7  
ATOM 9111  H HZ3  . LYS A 1 8   ? -0.960  -20.207 5.127   1.00 0.00 ? 8   LYS A HZ3  7  
ATOM 9112  N N    . GLU A 1 9   ? 1.761   -16.206 0.235   1.00 0.00 ? 9   GLU A N    7  
ATOM 9113  C CA   . GLU A 1 9   ? 1.638   -15.594 -1.077  1.00 0.00 ? 9   GLU A CA   7  
ATOM 9114  C C    . GLU A 1 9   ? 1.583   -14.070 -0.949  1.00 0.00 ? 9   GLU A C    7  
ATOM 9115  O O    . GLU A 1 9   ? 1.268   -13.544 0.118   1.00 0.00 ? 9   GLU A O    7  
ATOM 9116  C CB   . GLU A 1 9   ? 0.410   -16.126 -1.818  1.00 0.00 ? 9   GLU A CB   7  
ATOM 9117  C CG   . GLU A 1 9   ? 0.795   -17.257 -2.775  1.00 0.00 ? 9   GLU A CG   7  
ATOM 9118  C CD   . GLU A 1 9   ? -0.019  -17.181 -4.068  1.00 0.00 ? 9   GLU A CD   7  
ATOM 9119  O OE1  . GLU A 1 9   ? -0.351  -16.043 -4.464  1.00 0.00 ? 9   GLU A OE1  7  
ATOM 9120  O OE2  . GLU A 1 9   ? -0.290  -18.263 -4.632  1.00 0.00 ? 9   GLU A OE2  7  
ATOM 9121  H H    . GLU A 1 9   ? 1.114   -16.946 0.418   1.00 0.00 ? 9   GLU A H    7  
ATOM 9122  H HA   . GLU A 1 9   ? 2.538   -15.887 -1.619  1.00 0.00 ? 9   GLU A HA   7  
ATOM 9123  H HB2  . GLU A 1 9   ? -0.325  -16.488 -1.099  1.00 0.00 ? 9   GLU A HB2  7  
ATOM 9124  H HB3  . GLU A 1 9   ? -0.061  -15.317 -2.377  1.00 0.00 ? 9   GLU A HB3  7  
ATOM 9125  H HG2  . GLU A 1 9   ? 1.858   -17.197 -3.006  1.00 0.00 ? 9   GLU A HG2  7  
ATOM 9126  H HG3  . GLU A 1 9   ? 0.628   -18.219 -2.292  1.00 0.00 ? 9   GLU A HG3  7  
ATOM 9127  N N    . PRO A 1 10  ? 1.903   -13.386 -2.080  1.00 0.00 ? 10  PRO A N    7  
ATOM 9128  C CA   . PRO A 1 10  ? 1.893   -11.933 -2.104  1.00 0.00 ? 10  PRO A CA   7  
ATOM 9129  C C    . PRO A 1 10  ? 0.461   -11.395 -2.142  1.00 0.00 ? 10  PRO A C    7  
ATOM 9130  O O    . PRO A 1 10  ? -0.489  -12.160 -2.301  1.00 0.00 ? 10  PRO A O    7  
ATOM 9131  C CB   . PRO A 1 10  ? 2.703   -11.554 -3.333  1.00 0.00 ? 10  PRO A CB   7  
ATOM 9132  C CG   . PRO A 1 10  ? 2.743   -12.798 -4.205  1.00 0.00 ? 10  PRO A CG   7  
ATOM 9133  C CD   . PRO A 1 10  ? 2.282   -13.975 -3.361  1.00 0.00 ? 10  PRO A CD   7  
ATOM 9134  H HA   . PRO A 1 10  ? 2.299   -11.569 -1.266  1.00 0.00 ? 10  PRO A HA   7  
ATOM 9135  H HB2  . PRO A 1 10  ? 2.242   -10.720 -3.863  1.00 0.00 ? 10  PRO A HB2  7  
ATOM 9136  H HB3  . PRO A 1 10  ? 3.709   -11.239 -3.056  1.00 0.00 ? 10  PRO A HB3  7  
ATOM 9137  H HG2  . PRO A 1 10  ? 2.097   -12.676 -5.075  1.00 0.00 ? 10  PRO A HG2  7  
ATOM 9138  H HG3  . PRO A 1 10  ? 3.752   -12.970 -4.580  1.00 0.00 ? 10  PRO A HG3  7  
ATOM 9139  H HD2  . PRO A 1 10  ? 1.440   -14.489 -3.825  1.00 0.00 ? 10  PRO A HD2  7  
ATOM 9140  H HD3  . PRO A 1 10  ? 3.077   -14.711 -3.239  1.00 0.00 ? 10  PRO A HD3  7  
ATOM 9141  N N    . GLU A 1 11  ? 0.352   -10.083 -1.994  1.00 0.00 ? 11  GLU A N    7  
ATOM 9142  C CA   . GLU A 1 11  ? -0.948  -9.434  -2.010  1.00 0.00 ? 11  GLU A CA   7  
ATOM 9143  C C    . GLU A 1 11  ? -0.953  -8.279  -3.013  1.00 0.00 ? 11  GLU A C    7  
ATOM 9144  O O    . GLU A 1 11  ? -0.870  -7.115  -2.624  1.00 0.00 ? 11  GLU A O    7  
ATOM 9145  C CB   . GLU A 1 11  ? -1.335  -8.948  -0.612  1.00 0.00 ? 11  GLU A CB   7  
ATOM 9146  C CG   . GLU A 1 11  ? -2.843  -8.709  -0.512  1.00 0.00 ? 11  GLU A CG   7  
ATOM 9147  C CD   . GLU A 1 11  ? -3.161  -7.638  0.533   1.00 0.00 ? 11  GLU A CD   7  
ATOM 9148  O OE1  . GLU A 1 11  ? -2.426  -7.595  1.543   1.00 0.00 ? 11  GLU A OE1  7  
ATOM 9149  O OE2  . GLU A 1 11  ? -4.132  -6.887  0.299   1.00 0.00 ? 11  GLU A OE2  7  
ATOM 9150  H H    . GLU A 1 11  ? 1.130   -9.468  -1.865  1.00 0.00 ? 11  GLU A H    7  
ATOM 9151  H HA   . GLU A 1 11  ? -1.652  -10.203 -2.328  1.00 0.00 ? 11  GLU A HA   7  
ATOM 9152  H HB2  . GLU A 1 11  ? -1.031  -9.686  0.131   1.00 0.00 ? 11  GLU A HB2  7  
ATOM 9153  H HB3  . GLU A 1 11  ? -0.802  -8.026  -0.383  1.00 0.00 ? 11  GLU A HB3  7  
ATOM 9154  H HG2  . GLU A 1 11  ? -3.231  -8.401  -1.483  1.00 0.00 ? 11  GLU A HG2  7  
ATOM 9155  H HG3  . GLU A 1 11  ? -3.346  -9.640  -0.249  1.00 0.00 ? 11  GLU A HG3  7  
ATOM 9156  N N    . ILE A 1 12  ? -1.050  -8.641  -4.284  1.00 0.00 ? 12  ILE A N    7  
ATOM 9157  C CA   . ILE A 1 12  ? -1.066  -7.649  -5.345  1.00 0.00 ? 12  ILE A CA   7  
ATOM 9158  C C    . ILE A 1 12  ? -2.430  -6.956  -5.369  1.00 0.00 ? 12  ILE A C    7  
ATOM 9159  O O    . ILE A 1 12  ? -3.434  -7.567  -5.731  1.00 0.00 ? 12  ILE A O    7  
ATOM 9160  C CB   . ILE A 1 12  ? -0.677  -8.286  -6.680  1.00 0.00 ? 12  ILE A CB   7  
ATOM 9161  C CG1  . ILE A 1 12  ? -1.718  -9.318  -7.120  1.00 0.00 ? 12  ILE A CG1  7  
ATOM 9162  C CG2  . ILE A 1 12  ? 0.730   -8.885  -6.613  1.00 0.00 ? 12  ILE A CG2  7  
ATOM 9163  C CD1  . ILE A 1 12  ? -2.455  -8.851  -8.377  1.00 0.00 ? 12  ILE A CD1  7  
ATOM 9164  H H    . ILE A 1 12  ? -1.117  -9.590  -4.591  1.00 0.00 ? 12  ILE A H    7  
ATOM 9165  H HA   . ILE A 1 12  ? -0.305  -6.905  -5.109  1.00 0.00 ? 12  ILE A HA   7  
ATOM 9166  H HB   . ILE A 1 12  ? -0.658  -7.504  -7.440  1.00 0.00 ? 12  ILE A HB   7  
ATOM 9167  H HG12 . ILE A 1 12  ? -1.230  -10.273 -7.313  1.00 0.00 ? 12  ILE A HG12 7  
ATOM 9168  H HG13 . ILE A 1 12  ? -2.434  -9.483  -6.314  1.00 0.00 ? 12  ILE A HG13 7  
ATOM 9169  H HG21 . ILE A 1 12  ? 1.396   -8.321  -7.265  1.00 0.00 ? 12  ILE A HG21 7  
ATOM 9170  H HG22 . ILE A 1 12  ? 1.097   -8.835  -5.588  1.00 0.00 ? 12  ILE A HG22 7  
ATOM 9171  H HG23 . ILE A 1 12  ? 0.698   -9.925  -6.937  1.00 0.00 ? 12  ILE A HG23 7  
ATOM 9172  H HD11 . ILE A 1 12  ? -1.730  -8.544  -9.130  1.00 0.00 ? 12  ILE A HD11 7  
ATOM 9173  H HD12 . ILE A 1 12  ? -3.061  -9.669  -8.767  1.00 0.00 ? 12  ILE A HD12 7  
ATOM 9174  H HD13 . ILE A 1 12  ? -3.100  -8.008  -8.128  1.00 0.00 ? 12  ILE A HD13 7  
ATOM 9175  N N    . ILE A 1 13  ? -2.422  -5.690  -4.978  1.00 0.00 ? 13  ILE A N    7  
ATOM 9176  C CA   . ILE A 1 13  ? -3.646  -4.907  -4.950  1.00 0.00 ? 13  ILE A CA   7  
ATOM 9177  C C    . ILE A 1 13  ? -3.727  -4.050  -6.215  1.00 0.00 ? 13  ILE A C    7  
ATOM 9178  O O    . ILE A 1 13  ? -2.776  -3.349  -6.556  1.00 0.00 ? 13  ILE A O    7  
ATOM 9179  C CB   . ILE A 1 13  ? -3.736  -4.100  -3.654  1.00 0.00 ? 13  ILE A CB   7  
ATOM 9180  C CG1  . ILE A 1 13  ? -3.867  -5.023  -2.441  1.00 0.00 ? 13  ILE A CG1  7  
ATOM 9181  C CG2  . ILE A 1 13  ? -4.873  -3.078  -3.722  1.00 0.00 ? 13  ILE A CG2  7  
ATOM 9182  C CD1  . ILE A 1 13  ? -4.179  -4.224  -1.174  1.00 0.00 ? 13  ILE A CD1  7  
ATOM 9183  H H    . ILE A 1 13  ? -1.600  -5.200  -4.685  1.00 0.00 ? 13  ILE A H    7  
ATOM 9184  H HA   . ILE A 1 13  ? -4.481  -5.607  -4.953  1.00 0.00 ? 13  ILE A HA   7  
ATOM 9185  H HB   . ILE A 1 13  ? -2.808  -3.541  -3.534  1.00 0.00 ? 13  ILE A HB   7  
ATOM 9186  H HG12 . ILE A 1 13  ? -4.657  -5.753  -2.619  1.00 0.00 ? 13  ILE A HG12 7  
ATOM 9187  H HG13 . ILE A 1 13  ? -2.941  -5.582  -2.304  1.00 0.00 ? 13  ILE A HG13 7  
ATOM 9188  H HG21 . ILE A 1 13  ? -5.830  -3.599  -3.698  1.00 0.00 ? 13  ILE A HG21 7  
ATOM 9189  H HG22 . ILE A 1 13  ? -4.806  -2.402  -2.870  1.00 0.00 ? 13  ILE A HG22 7  
ATOM 9190  H HG23 . ILE A 1 13  ? -4.793  -2.507  -4.646  1.00 0.00 ? 13  ILE A HG23 7  
ATOM 9191  H HD11 . ILE A 1 13  ? -5.258  -4.179  -1.030  1.00 0.00 ? 13  ILE A HD11 7  
ATOM 9192  H HD12 . ILE A 1 13  ? -3.717  -4.710  -0.315  1.00 0.00 ? 13  ILE A HD12 7  
ATOM 9193  H HD13 . ILE A 1 13  ? -3.784  -3.213  -1.276  1.00 0.00 ? 13  ILE A HD13 7  
ATOM 9194  N N    . THR A 1 14  ? -4.872  -4.135  -6.877  1.00 0.00 ? 14  THR A N    7  
ATOM 9195  C CA   . THR A 1 14  ? -5.090  -3.376  -8.096  1.00 0.00 ? 14  THR A CA   7  
ATOM 9196  C C    . THR A 1 14  ? -6.588  -3.208  -8.359  1.00 0.00 ? 14  THR A C    7  
ATOM 9197  O O    . THR A 1 14  ? -7.275  -4.172  -8.693  1.00 0.00 ? 14  THR A O    7  
ATOM 9198  C CB   . THR A 1 14  ? -4.349  -4.085  -9.232  1.00 0.00 ? 14  THR A CB   7  
ATOM 9199  O OG1  . THR A 1 14  ? -4.661  -3.309  -10.387 1.00 0.00 ? 14  THR A OG1  7  
ATOM 9200  C CG2  . THR A 1 14  ? -4.934  -5.464  -9.542  1.00 0.00 ? 14  THR A CG2  7  
ATOM 9201  H H    . THR A 1 14  ? -5.641  -4.708  -6.592  1.00 0.00 ? 14  THR A H    7  
ATOM 9202  H HA   . THR A 1 14  ? -4.675  -2.378  -7.958  1.00 0.00 ? 14  THR A HA   7  
ATOM 9203  H HB   . THR A 1 14  ? -3.283  -4.152  -9.019  1.00 0.00 ? 14  THR A HB   7  
ATOM 9204  H HG1  . THR A 1 14  ? -5.645  -3.335  -10.560 1.00 0.00 ? 14  THR A HG1  7  
ATOM 9205  H HG21 . THR A 1 14  ? -4.245  -6.015  -10.183 1.00 0.00 ? 14  THR A HG21 7  
ATOM 9206  H HG22 . THR A 1 14  ? -5.082  -6.013  -8.612  1.00 0.00 ? 14  THR A HG22 7  
ATOM 9207  H HG23 . THR A 1 14  ? -5.890  -5.348  -10.052 1.00 0.00 ? 14  THR A HG23 7  
ATOM 9208  N N    . VAL A 1 15  ? -7.049  -1.977  -8.199  1.00 0.00 ? 15  VAL A N    7  
ATOM 9209  C CA   . VAL A 1 15  ? -8.453  -1.670  -8.414  1.00 0.00 ? 15  VAL A CA   7  
ATOM 9210  C C    . VAL A 1 15  ? -8.585  -0.227  -8.907  1.00 0.00 ? 15  VAL A C    7  
ATOM 9211  O O    . VAL A 1 15  ? -7.769  0.627   -8.565  1.00 0.00 ? 15  VAL A O    7  
ATOM 9212  C CB   . VAL A 1 15  ? -9.250  -1.941  -7.137  1.00 0.00 ? 15  VAL A CB   7  
ATOM 9213  C CG1  . VAL A 1 15  ? -9.156  -0.758  -6.171  1.00 0.00 ? 15  VAL A CG1  7  
ATOM 9214  C CG2  . VAL A 1 15  ? -10.709 -2.269  -7.460  1.00 0.00 ? 15  VAL A CG2  7  
ATOM 9215  H H    . VAL A 1 15  ? -6.484  -1.198  -7.927  1.00 0.00 ? 15  VAL A H    7  
ATOM 9216  H HA   . VAL A 1 15  ? -8.821  -2.341  -9.191  1.00 0.00 ? 15  VAL A HA   7  
ATOM 9217  H HB   . VAL A 1 15  ? -8.812  -2.810  -6.646  1.00 0.00 ? 15  VAL A HB   7  
ATOM 9218  H HG11 . VAL A 1 15  ? -10.116 -0.245  -6.130  1.00 0.00 ? 15  VAL A HG11 7  
ATOM 9219  H HG12 . VAL A 1 15  ? -8.895  -1.121  -5.177  1.00 0.00 ? 15  VAL A HG12 7  
ATOM 9220  H HG13 . VAL A 1 15  ? -8.388  -0.066  -6.517  1.00 0.00 ? 15  VAL A HG13 7  
ATOM 9221  H HG21 . VAL A 1 15  ? -10.760 -2.801  -8.411  1.00 0.00 ? 15  VAL A HG21 7  
ATOM 9222  H HG22 . VAL A 1 15  ? -11.124 -2.896  -6.671  1.00 0.00 ? 15  VAL A HG22 7  
ATOM 9223  H HG23 . VAL A 1 15  ? -11.283 -1.345  -7.530  1.00 0.00 ? 15  VAL A HG23 7  
ATOM 9224  N N    . THR A 1 16  ? -9.620  0.000   -9.704  1.00 0.00 ? 16  THR A N    7  
ATOM 9225  C CA   . THR A 1 16  ? -9.869  1.324   -10.247 1.00 0.00 ? 16  THR A CA   7  
ATOM 9226  C C    . THR A 1 16  ? -10.389 2.260   -9.154  1.00 0.00 ? 16  THR A C    7  
ATOM 9227  O O    . THR A 1 16  ? -11.485 2.061   -8.631  1.00 0.00 ? 16  THR A O    7  
ATOM 9228  C CB   . THR A 1 16  ? -10.830 1.177   -11.429 1.00 0.00 ? 16  THR A CB   7  
ATOM 9229  O OG1  . THR A 1 16  ? -11.971 0.532   -10.870 1.00 0.00 ? 16  THR A OG1  7  
ATOM 9230  C CG2  . THR A 1 16  ? -10.320 0.188   -12.479 1.00 0.00 ? 16  THR A CG2  7  
ATOM 9231  H H    . THR A 1 16  ? -10.279 -0.701  -9.977  1.00 0.00 ? 16  THR A H    7  
ATOM 9232  H HA   . THR A 1 16  ? -8.923  1.736   -10.597 1.00 0.00 ? 16  THR A HA   7  
ATOM 9233  H HB   . THR A 1 16  ? -11.045 2.146   -11.879 1.00 0.00 ? 16  THR A HB   7  
ATOM 9234  H HG1  . THR A 1 16  ? -12.732 0.560   -11.519 1.00 0.00 ? 16  THR A HG1  7  
ATOM 9235  H HG21 . THR A 1 16  ? -9.974  -0.721  -11.985 1.00 0.00 ? 16  THR A HG21 7  
ATOM 9236  H HG22 . THR A 1 16  ? -11.127 -0.059  -13.168 1.00 0.00 ? 16  THR A HG22 7  
ATOM 9237  H HG23 . THR A 1 16  ? -9.494  0.637   -13.031 1.00 0.00 ? 16  THR A HG23 7  
ATOM 9238  N N    . LEU A 1 17  ? -9.579  3.260   -8.841  1.00 0.00 ? 17  LEU A N    7  
ATOM 9239  C CA   . LEU A 1 17  ? -9.944  4.227   -7.820  1.00 0.00 ? 17  LEU A CA   7  
ATOM 9240  C C    . LEU A 1 17  ? -11.175 5.010   -8.281  1.00 0.00 ? 17  LEU A C    7  
ATOM 9241  O O    . LEU A 1 17  ? -11.994 4.494   -9.040  1.00 0.00 ? 17  LEU A O    7  
ATOM 9242  C CB   . LEU A 1 17  ? -8.747  5.114   -7.470  1.00 0.00 ? 17  LEU A CB   7  
ATOM 9243  C CG   . LEU A 1 17  ? -8.714  5.662   -6.042  1.00 0.00 ? 17  LEU A CG   7  
ATOM 9244  C CD1  . LEU A 1 17  ? -8.611  7.189   -6.043  1.00 0.00 ? 17  LEU A CD1  7  
ATOM 9245  C CD2  . LEU A 1 17  ? -9.917  5.169   -5.237  1.00 0.00 ? 17  LEU A CD2  7  
ATOM 9246  H H    . LEU A 1 17  ? -8.690  3.415   -9.271  1.00 0.00 ? 17  LEU A H    7  
ATOM 9247  H HA   . LEU A 1 17  ? -10.206 3.669   -6.921  1.00 0.00 ? 17  LEU A HA   7  
ATOM 9248  H HB2  . LEU A 1 17  ? -7.835  4.542   -7.640  1.00 0.00 ? 17  LEU A HB2  7  
ATOM 9249  H HB3  . LEU A 1 17  ? -8.729  5.956   -8.162  1.00 0.00 ? 17  LEU A HB3  7  
ATOM 9250  H HG   . LEU A 1 17  ? -7.819  5.280   -5.550  1.00 0.00 ? 17  LEU A HG   7  
ATOM 9251  H HD11 . LEU A 1 17  ? -9.590  7.618   -5.830  1.00 0.00 ? 17  LEU A HD11 7  
ATOM 9252  H HD12 . LEU A 1 17  ? -7.901  7.506   -5.279  1.00 0.00 ? 17  LEU A HD12 7  
ATOM 9253  H HD13 . LEU A 1 17  ? -8.270  7.529   -7.020  1.00 0.00 ? 17  LEU A HD13 7  
ATOM 9254  H HD21 . LEU A 1 17  ? -10.813 5.220   -5.855  1.00 0.00 ? 17  LEU A HD21 7  
ATOM 9255  H HD22 . LEU A 1 17  ? -9.749  4.138   -4.925  1.00 0.00 ? 17  LEU A HD22 7  
ATOM 9256  H HD23 . LEU A 1 17  ? -10.048 5.798   -4.356  1.00 0.00 ? 17  LEU A HD23 7  
ATOM 9257  N N    . LYS A 1 18  ? -11.267 6.242   -7.802  1.00 0.00 ? 18  LYS A N    7  
ATOM 9258  C CA   . LYS A 1 18  ? -12.384 7.101   -8.156  1.00 0.00 ? 18  LYS A CA   7  
ATOM 9259  C C    . LYS A 1 18  ? -13.671 6.529   -7.557  1.00 0.00 ? 18  LYS A C    7  
ATOM 9260  O O    . LYS A 1 18  ? -14.760 7.038   -7.816  1.00 0.00 ? 18  LYS A O    7  
ATOM 9261  C CB   . LYS A 1 18  ? -12.447 7.301   -9.672  1.00 0.00 ? 18  LYS A CB   7  
ATOM 9262  C CG   . LYS A 1 18  ? -12.408 8.787   -10.031 1.00 0.00 ? 18  LYS A CG   7  
ATOM 9263  C CD   . LYS A 1 18  ? -13.375 9.101   -11.174 1.00 0.00 ? 18  LYS A CD   7  
ATOM 9264  C CE   . LYS A 1 18  ? -12.792 10.163  -12.109 1.00 0.00 ? 18  LYS A CE   7  
ATOM 9265  N NZ   . LYS A 1 18  ? -12.831 11.496  -11.467 1.00 0.00 ? 18  LYS A NZ   7  
ATOM 9266  H H    . LYS A 1 18  ? -10.596 6.653   -7.185  1.00 0.00 ? 18  LYS A H    7  
ATOM 9267  H HA   . LYS A 1 18  ? -12.199 8.078   -7.710  1.00 0.00 ? 18  LYS A HA   7  
ATOM 9268  H HB2  . LYS A 1 18  ? -11.612 6.786   -10.146 1.00 0.00 ? 18  LYS A HB2  7  
ATOM 9269  H HB3  . LYS A 1 18  ? -13.361 6.852   -10.063 1.00 0.00 ? 18  LYS A HB3  7  
ATOM 9270  H HG2  . LYS A 1 18  ? -12.667 9.383   -9.156  1.00 0.00 ? 18  LYS A HG2  7  
ATOM 9271  H HG3  . LYS A 1 18  ? -11.395 9.069   -10.319 1.00 0.00 ? 18  LYS A HG3  7  
ATOM 9272  H HD2  . LYS A 1 18  ? -13.586 8.192   -11.737 1.00 0.00 ? 18  LYS A HD2  7  
ATOM 9273  H HD3  . LYS A 1 18  ? -14.324 9.451   -10.767 1.00 0.00 ? 18  LYS A HD3  7  
ATOM 9274  H HE2  . LYS A 1 18  ? -11.764 9.906   -12.365 1.00 0.00 ? 18  LYS A HE2  7  
ATOM 9275  H HE3  . LYS A 1 18  ? -13.357 10.185  -13.041 1.00 0.00 ? 18  LYS A HE3  7  
ATOM 9276  H HZ1  . LYS A 1 18  ? -12.468 11.430  -10.538 1.00 0.00 ? 18  LYS A HZ1  7  
ATOM 9277  H HZ2  . LYS A 1 18  ? -12.276 12.138  -11.997 1.00 0.00 ? 18  LYS A HZ2  7  
ATOM 9278  H HZ3  . LYS A 1 18  ? -13.776 11.822  -11.433 1.00 0.00 ? 18  LYS A HZ3  7  
ATOM 9279  N N    . LYS A 1 19  ? -13.502 5.479   -6.767  1.00 0.00 ? 19  LYS A N    7  
ATOM 9280  C CA   . LYS A 1 19  ? -14.636 4.832   -6.129  1.00 0.00 ? 19  LYS A CA   7  
ATOM 9281  C C    . LYS A 1 19  ? -15.413 5.866   -5.310  1.00 0.00 ? 19  LYS A C    7  
ATOM 9282  O O    . LYS A 1 19  ? -16.204 6.631   -5.860  1.00 0.00 ? 19  LYS A O    7  
ATOM 9283  C CB   . LYS A 1 19  ? -14.175 3.623   -5.313  1.00 0.00 ? 19  LYS A CB   7  
ATOM 9284  C CG   . LYS A 1 19  ? -13.555 2.556   -6.218  1.00 0.00 ? 19  LYS A CG   7  
ATOM 9285  C CD   . LYS A 1 19  ? -13.882 1.150   -5.711  1.00 0.00 ? 19  LYS A CD   7  
ATOM 9286  C CE   . LYS A 1 19  ? -15.356 0.813   -5.944  1.00 0.00 ? 19  LYS A CE   7  
ATOM 9287  N NZ   . LYS A 1 19  ? -15.534 0.140   -7.251  1.00 0.00 ? 19  LYS A NZ   7  
ATOM 9288  H H    . LYS A 1 19  ? -12.612 5.071   -6.561  1.00 0.00 ? 19  LYS A H    7  
ATOM 9289  H HA   . LYS A 1 19  ? -15.287 4.459   -6.919  1.00 0.00 ? 19  LYS A HA   7  
ATOM 9290  H HB2  . LYS A 1 19  ? -13.447 3.939   -4.566  1.00 0.00 ? 19  LYS A HB2  7  
ATOM 9291  H HB3  . LYS A 1 19  ? -15.021 3.200   -4.773  1.00 0.00 ? 19  LYS A HB3  7  
ATOM 9292  H HG2  . LYS A 1 19  ? -13.927 2.676   -7.235  1.00 0.00 ? 19  LYS A HG2  7  
ATOM 9293  H HG3  . LYS A 1 19  ? -12.474 2.690   -6.256  1.00 0.00 ? 19  LYS A HG3  7  
ATOM 9294  H HD2  . LYS A 1 19  ? -13.254 0.420   -6.221  1.00 0.00 ? 19  LYS A HD2  7  
ATOM 9295  H HD3  . LYS A 1 19  ? -13.654 1.080   -4.647  1.00 0.00 ? 19  LYS A HD3  7  
ATOM 9296  H HE2  . LYS A 1 19  ? -15.719 0.167   -5.144  1.00 0.00 ? 19  LYS A HE2  7  
ATOM 9297  H HE3  . LYS A 1 19  ? -15.953 1.724   -5.914  1.00 0.00 ? 19  LYS A HE3  7  
ATOM 9298  H HZ1  . LYS A 1 19  ? -15.098 0.685   -7.968  1.00 0.00 ? 19  LYS A HZ1  7  
ATOM 9299  H HZ2  . LYS A 1 19  ? -15.114 -0.767  -7.218  1.00 0.00 ? 19  LYS A HZ2  7  
ATOM 9300  H HZ3  . LYS A 1 19  ? -16.510 0.049   -7.449  1.00 0.00 ? 19  LYS A HZ3  7  
ATOM 9301  N N    . GLN A 1 20  ? -15.159 5.855   -4.010  1.00 0.00 ? 20  GLN A N    7  
ATOM 9302  C CA   . GLN A 1 20  ? -15.825 6.782   -3.110  1.00 0.00 ? 20  GLN A CA   7  
ATOM 9303  C C    . GLN A 1 20  ? -15.311 8.205   -3.339  1.00 0.00 ? 20  GLN A C    7  
ATOM 9304  O O    . GLN A 1 20  ? -16.066 9.169   -3.216  1.00 0.00 ? 20  GLN A O    7  
ATOM 9305  C CB   . GLN A 1 20  ? -15.638 6.360   -1.651  1.00 0.00 ? 20  GLN A CB   7  
ATOM 9306  C CG   . GLN A 1 20  ? -16.986 6.247   -0.936  1.00 0.00 ? 20  GLN A CG   7  
ATOM 9307  C CD   . GLN A 1 20  ? -17.022 7.135   0.309   1.00 0.00 ? 20  GLN A CD   7  
ATOM 9308  O OE1  . GLN A 1 20  ? -17.784 8.083   0.405   1.00 0.00 ? 20  GLN A OE1  7  
ATOM 9309  N NE2  . GLN A 1 20  ? -16.158 6.777   1.254   1.00 0.00 ? 20  GLN A NE2  7  
ATOM 9310  H H    . GLN A 1 20  ? -14.515 5.230   -3.571  1.00 0.00 ? 20  GLN A H    7  
ATOM 9311  H HA   . GLN A 1 20  ? -16.883 6.725   -3.366  1.00 0.00 ? 20  GLN A HA   7  
ATOM 9312  H HB2  . GLN A 1 20  ? -15.118 5.403   -1.610  1.00 0.00 ? 20  GLN A HB2  7  
ATOM 9313  H HB3  . GLN A 1 20  ? -15.009 7.087   -1.137  1.00 0.00 ? 20  GLN A HB3  7  
ATOM 9314  H HG2  . GLN A 1 20  ? -17.787 6.535   -1.616  1.00 0.00 ? 20  GLN A HG2  7  
ATOM 9315  H HG3  . GLN A 1 20  ? -17.165 5.210   -0.653  1.00 0.00 ? 20  GLN A HG3  7  
ATOM 9316  H HE21 . GLN A 1 20  ? -15.560 5.988   1.113   1.00 0.00 ? 20  GLN A HE21 7  
ATOM 9317  H HE22 . GLN A 1 20  ? -16.106 7.297   2.107   1.00 0.00 ? 20  GLN A HE22 7  
ATOM 9318  N N    . ASN A 1 21  ? -14.031 8.292   -3.670  1.00 0.00 ? 21  ASN A N    7  
ATOM 9319  C CA   . ASN A 1 21  ? -13.408 9.581   -3.917  1.00 0.00 ? 21  ASN A CA   7  
ATOM 9320  C C    . ASN A 1 21  ? -11.891 9.446   -3.774  1.00 0.00 ? 21  ASN A C    7  
ATOM 9321  O O    . ASN A 1 21  ? -11.136 10.199  -4.387  1.00 0.00 ? 21  ASN A O    7  
ATOM 9322  C CB   . ASN A 1 21  ? -13.887 10.627  -2.909  1.00 0.00 ? 21  ASN A CB   7  
ATOM 9323  C CG   . ASN A 1 21  ? -14.831 11.634  -3.569  1.00 0.00 ? 21  ASN A CG   7  
ATOM 9324  O OD1  . ASN A 1 21  ? -14.993 11.672  -4.777  1.00 0.00 ? 21  ASN A OD1  7  
ATOM 9325  N ND2  . ASN A 1 21  ? -15.443 12.445  -2.710  1.00 0.00 ? 21  ASN A ND2  7  
ATOM 9326  H H    . ASN A 1 21  ? -13.424 7.504   -3.768  1.00 0.00 ? 21  ASN A H    7  
ATOM 9327  H HA   . ASN A 1 21  ? -13.708 9.855   -4.929  1.00 0.00 ? 21  ASN A HA   7  
ATOM 9328  H HB2  . ASN A 1 21  ? -14.397 10.134  -2.081  1.00 0.00 ? 21  ASN A HB2  7  
ATOM 9329  H HB3  . ASN A 1 21  ? -13.028 11.151  -2.487  1.00 0.00 ? 21  ASN A HB3  7  
ATOM 9330  H HD21 . ASN A 1 21  ? -15.266 12.361  -1.730  1.00 0.00 ? 21  ASN A HD21 7  
ATOM 9331  H HD22 . ASN A 1 21  ? -16.081 13.139  -3.046  1.00 0.00 ? 21  ASN A HD22 7  
ATOM 9332  N N    . GLY A 1 22  ? -11.489 8.480   -2.961  1.00 0.00 ? 22  GLY A N    7  
ATOM 9333  C CA   . GLY A 1 22  ? -10.076 8.235   -2.729  1.00 0.00 ? 22  GLY A CA   7  
ATOM 9334  C C    . GLY A 1 22  ? -9.841  6.809   -2.229  1.00 0.00 ? 22  GLY A C    7  
ATOM 9335  O O    . GLY A 1 22  ? -10.721 5.956   -2.337  1.00 0.00 ? 22  GLY A O    7  
ATOM 9336  H H    . GLY A 1 22  ? -12.110 7.871   -2.466  1.00 0.00 ? 22  GLY A H    7  
ATOM 9337  H HA2  . GLY A 1 22  ? -9.519  8.397   -3.652  1.00 0.00 ? 22  GLY A HA2  7  
ATOM 9338  H HA3  . GLY A 1 22  ? -9.695  8.948   -1.998  1.00 0.00 ? 22  GLY A HA3  7  
ATOM 9339  N N    . MET A 1 23  ? -8.649  6.593   -1.692  1.00 0.00 ? 23  MET A N    7  
ATOM 9340  C CA   . MET A 1 23  ? -8.287  5.284   -1.175  1.00 0.00 ? 23  MET A CA   7  
ATOM 9341  C C    . MET A 1 23  ? -8.458  5.229   0.344   1.00 0.00 ? 23  MET A C    7  
ATOM 9342  O O    . MET A 1 23  ? -8.351  4.161   0.946   1.00 0.00 ? 23  MET A O    7  
ATOM 9343  C CB   . MET A 1 23  ? -6.832  4.977   -1.537  1.00 0.00 ? 23  MET A CB   7  
ATOM 9344  C CG   . MET A 1 23  ? -5.900  6.089   -1.052  1.00 0.00 ? 23  MET A CG   7  
ATOM 9345  S SD   . MET A 1 23  ? -4.198  5.581   -1.232  1.00 0.00 ? 23  MET A SD   7  
ATOM 9346  C CE   . MET A 1 23  ? -4.045  5.638   -3.010  1.00 0.00 ? 23  MET A CE   7  
ATOM 9347  H H    . MET A 1 23  ? -7.938  7.292   -1.608  1.00 0.00 ? 23  MET A H    7  
ATOM 9348  H HA   . MET A 1 23  ? -8.971  4.582   -1.651  1.00 0.00 ? 23  MET A HA   7  
ATOM 9349  H HB2  . MET A 1 23  ? -6.535  4.028   -1.090  1.00 0.00 ? 23  MET A HB2  7  
ATOM 9350  H HB3  . MET A 1 23  ? -6.738  4.864   -2.617  1.00 0.00 ? 23  MET A HB3  7  
ATOM 9351  H HG2  . MET A 1 23  ? -6.079  7.000   -1.623  1.00 0.00 ? 23  MET A HG2  7  
ATOM 9352  H HG3  . MET A 1 23  ? -6.110  6.321   -0.007  1.00 0.00 ? 23  MET A HG3  7  
ATOM 9353  H HE1  . MET A 1 23  ? -3.022  5.392   -3.295  1.00 0.00 ? 23  MET A HE1  7  
ATOM 9354  H HE2  . MET A 1 23  ? -4.730  4.918   -3.457  1.00 0.00 ? 23  MET A HE2  7  
ATOM 9355  H HE3  . MET A 1 23  ? -4.289  6.640   -3.364  1.00 0.00 ? 23  MET A HE3  7  
ATOM 9356  N N    . GLY A 1 24  ? -8.721  6.392   0.921   1.00 0.00 ? 24  GLY A N    7  
ATOM 9357  C CA   . GLY A 1 24  ? -8.908  6.490   2.359   1.00 0.00 ? 24  GLY A CA   7  
ATOM 9358  C C    . GLY A 1 24  ? -8.198  5.344   3.083   1.00 0.00 ? 24  GLY A C    7  
ATOM 9359  O O    . GLY A 1 24  ? -8.840  4.537   3.754   1.00 0.00 ? 24  GLY A O    7  
ATOM 9360  H H    . GLY A 1 24  ? -8.806  7.256   0.424   1.00 0.00 ? 24  GLY A H    7  
ATOM 9361  H HA2  . GLY A 1 24  ? -8.522  7.444   2.716   1.00 0.00 ? 24  GLY A HA2  7  
ATOM 9362  H HA3  . GLY A 1 24  ? -9.972  6.468   2.593   1.00 0.00 ? 24  GLY A HA3  7  
ATOM 9363  N N    . LEU A 1 25  ? -6.884  5.309   2.922   1.00 0.00 ? 25  LEU A N    7  
ATOM 9364  C CA   . LEU A 1 25  ? -6.080  4.275   3.552   1.00 0.00 ? 25  LEU A CA   7  
ATOM 9365  C C    . LEU A 1 25  ? -5.086  4.925   4.516   1.00 0.00 ? 25  LEU A C    7  
ATOM 9366  O O    . LEU A 1 25  ? -4.406  5.886   4.158   1.00 0.00 ? 25  LEU A O    7  
ATOM 9367  C CB   . LEU A 1 25  ? -5.420  3.390   2.493   1.00 0.00 ? 25  LEU A CB   7  
ATOM 9368  C CG   . LEU A 1 25  ? -4.625  2.193   3.020   1.00 0.00 ? 25  LEU A CG   7  
ATOM 9369  C CD1  . LEU A 1 25  ? -4.093  1.338   1.868   1.00 0.00 ? 25  LEU A CD1  7  
ATOM 9370  C CD2  . LEU A 1 25  ? -3.507  2.648   3.960   1.00 0.00 ? 25  LEU A CD2  7  
ATOM 9371  H H    . LEU A 1 25  ? -6.370  5.969   2.374   1.00 0.00 ? 25  LEU A H    7  
ATOM 9372  H HA   . LEU A 1 25  ? -6.755  3.641   4.127   1.00 0.00 ? 25  LEU A HA   7  
ATOM 9373  H HB2  . LEU A 1 25  ? -6.195  3.019   1.823   1.00 0.00 ? 25  LEU A HB2  7  
ATOM 9374  H HB3  . LEU A 1 25  ? -4.751  4.009   1.895   1.00 0.00 ? 25  LEU A HB3  7  
ATOM 9375  H HG   . LEU A 1 25  ? -5.300  1.565   3.601   1.00 0.00 ? 25  LEU A HG   7  
ATOM 9376  H HD11 . LEU A 1 25  ? -4.483  0.324   1.957   1.00 0.00 ? 25  LEU A HD11 7  
ATOM 9377  H HD12 . LEU A 1 25  ? -4.413  1.768   0.918   1.00 0.00 ? 25  LEU A HD12 7  
ATOM 9378  H HD13 . LEU A 1 25  ? -3.004  1.314   1.906   1.00 0.00 ? 25  LEU A HD13 7  
ATOM 9379  H HD21 . LEU A 1 25  ? -3.866  2.625   4.989   1.00 0.00 ? 25  LEU A HD21 7  
ATOM 9380  H HD22 . LEU A 1 25  ? -2.653  1.979   3.858   1.00 0.00 ? 25  LEU A HD22 7  
ATOM 9381  H HD23 . LEU A 1 25  ? -3.207  3.664   3.703   1.00 0.00 ? 25  LEU A HD23 7  
ATOM 9382  N N    . SER A 1 26  ? -5.033  4.376   5.721   1.00 0.00 ? 26  SER A N    7  
ATOM 9383  C CA   . SER A 1 26  ? -4.133  4.890   6.739   1.00 0.00 ? 26  SER A CA   7  
ATOM 9384  C C    . SER A 1 26  ? -2.879  4.017   6.819   1.00 0.00 ? 26  SER A C    7  
ATOM 9385  O O    . SER A 1 26  ? -2.930  2.895   7.320   1.00 0.00 ? 26  SER A O    7  
ATOM 9386  C CB   . SER A 1 26  ? -4.824  4.953   8.103   1.00 0.00 ? 26  SER A CB   7  
ATOM 9387  O OG   . SER A 1 26  ? -5.801  5.988   8.160   1.00 0.00 ? 26  SER A OG   7  
ATOM 9388  H H    . SER A 1 26  ? -5.589  3.595   6.004   1.00 0.00 ? 26  SER A H    7  
ATOM 9389  H HA   . SER A 1 26  ? -3.878  5.899   6.416   1.00 0.00 ? 26  SER A HA   7  
ATOM 9390  H HB2  . SER A 1 26  ? -5.299  3.994   8.313   1.00 0.00 ? 26  SER A HB2  7  
ATOM 9391  H HB3  . SER A 1 26  ? -4.077  5.116   8.880   1.00 0.00 ? 26  SER A HB3  7  
ATOM 9392  H HG   . SER A 1 26  ? -5.882  6.331   9.095   1.00 0.00 ? 26  SER A HG   7  
ATOM 9393  N N    . ILE A 1 27  ? -1.783  4.566   6.317   1.00 0.00 ? 27  ILE A N    7  
ATOM 9394  C CA   . ILE A 1 27  ? -0.517  3.851   6.325   1.00 0.00 ? 27  ILE A CA   7  
ATOM 9395  C C    . ILE A 1 27  ? 0.216   4.137   7.637   1.00 0.00 ? 27  ILE A C    7  
ATOM 9396  O O    . ILE A 1 27  ? -0.217  4.977   8.424   1.00 0.00 ? 27  ILE A O    7  
ATOM 9397  C CB   . ILE A 1 27  ? 0.299   4.193   5.077   1.00 0.00 ? 27  ILE A CB   7  
ATOM 9398  C CG1  . ILE A 1 27  ? 0.811   5.634   5.135   1.00 0.00 ? 27  ILE A CG1  7  
ATOM 9399  C CG2  . ILE A 1 27  ? -0.505  3.921   3.804   1.00 0.00 ? 27  ILE A CG2  7  
ATOM 9400  C CD1  . ILE A 1 27  ? 1.976   5.841   4.164   1.00 0.00 ? 27  ILE A CD1  7  
ATOM 9401  H H    . ILE A 1 27  ? -1.750  5.479   5.911   1.00 0.00 ? 27  ILE A H    7  
ATOM 9402  H HA   . ILE A 1 27  ? -0.744  2.786   6.280   1.00 0.00 ? 27  ILE A HA   7  
ATOM 9403  H HB   . ILE A 1 27  ? 1.173   3.542   5.052   1.00 0.00 ? 27  ILE A HB   7  
ATOM 9404  H HG12 . ILE A 1 27  ? 0.002   6.321   4.889   1.00 0.00 ? 27  ILE A HG12 7  
ATOM 9405  H HG13 . ILE A 1 27  ? 1.132   5.869   6.149   1.00 0.00 ? 27  ILE A HG13 7  
ATOM 9406  H HG21 . ILE A 1 27  ? -1.398  4.546   3.798   1.00 0.00 ? 27  ILE A HG21 7  
ATOM 9407  H HG22 . ILE A 1 27  ? 0.106   4.152   2.932   1.00 0.00 ? 27  ILE A HG22 7  
ATOM 9408  H HG23 . ILE A 1 27  ? -0.796  2.871   3.776   1.00 0.00 ? 27  ILE A HG23 7  
ATOM 9409  H HD11 . ILE A 1 27  ? 2.156   4.920   3.611   1.00 0.00 ? 27  ILE A HD11 7  
ATOM 9410  H HD12 . ILE A 1 27  ? 1.730   6.642   3.467   1.00 0.00 ? 27  ILE A HD12 7  
ATOM 9411  H HD13 . ILE A 1 27  ? 2.872   6.109   4.724   1.00 0.00 ? 27  ILE A HD13 7  
ATOM 9412  N N    . VAL A 1 28  ? 1.314   3.421   7.832   1.00 0.00 ? 28  VAL A N    7  
ATOM 9413  C CA   . VAL A 1 28  ? 2.111   3.586   9.035   1.00 0.00 ? 28  VAL A CA   7  
ATOM 9414  C C    . VAL A 1 28  ? 3.551   3.152   8.751   1.00 0.00 ? 28  VAL A C    7  
ATOM 9415  O O    . VAL A 1 28  ? 3.818   1.968   8.554   1.00 0.00 ? 28  VAL A O    7  
ATOM 9416  C CB   . VAL A 1 28  ? 1.474   2.820   10.196  1.00 0.00 ? 28  VAL A CB   7  
ATOM 9417  C CG1  . VAL A 1 28  ? 2.388   1.690   10.675  1.00 0.00 ? 28  VAL A CG1  7  
ATOM 9418  C CG2  . VAL A 1 28  ? 1.119   3.763   11.347  1.00 0.00 ? 28  VAL A CG2  7  
ATOM 9419  H H    . VAL A 1 28  ? 1.659   2.739   7.187   1.00 0.00 ? 28  VAL A H    7  
ATOM 9420  H HA   . VAL A 1 28  ? 2.108   4.646   9.289   1.00 0.00 ? 28  VAL A HA   7  
ATOM 9421  H HB   . VAL A 1 28  ? 0.549   2.371   9.833   1.00 0.00 ? 28  VAL A HB   7  
ATOM 9422  H HG11 . VAL A 1 28  ? 3.383   2.088   10.874  1.00 0.00 ? 28  VAL A HG11 7  
ATOM 9423  H HG12 . VAL A 1 28  ? 1.980   1.256   11.588  1.00 0.00 ? 28  VAL A HG12 7  
ATOM 9424  H HG13 . VAL A 1 28  ? 2.451   0.922   9.904   1.00 0.00 ? 28  VAL A HG13 7  
ATOM 9425  H HG21 . VAL A 1 28  ? 1.988   4.369   11.602  1.00 0.00 ? 28  VAL A HG21 7  
ATOM 9426  H HG22 . VAL A 1 28  ? 0.299   4.415   11.043  1.00 0.00 ? 28  VAL A HG22 7  
ATOM 9427  H HG23 . VAL A 1 28  ? 0.815   3.179   12.215  1.00 0.00 ? 28  VAL A HG23 7  
ATOM 9428  N N    . ALA A 1 29  ? 4.440   4.134   8.741   1.00 0.00 ? 29  ALA A N    7  
ATOM 9429  C CA   . ALA A 1 29  ? 5.845   3.869   8.484   1.00 0.00 ? 29  ALA A CA   7  
ATOM 9430  C C    . ALA A 1 29  ? 6.549   5.177   8.118   1.00 0.00 ? 29  ALA A C    7  
ATOM 9431  O O    . ALA A 1 29  ? 5.953   6.250   8.200   1.00 0.00 ? 29  ALA A O    7  
ATOM 9432  C CB   . ALA A 1 29  ? 5.973   2.811   7.386   1.00 0.00 ? 29  ALA A CB   7  
ATOM 9433  H H    . ALA A 1 29  ? 4.214   5.095   8.903   1.00 0.00 ? 29  ALA A H    7  
ATOM 9434  H HA   . ALA A 1 29  ? 6.282   3.476   9.403   1.00 0.00 ? 29  ALA A HA   7  
ATOM 9435  H HB1  . ALA A 1 29  ? 5.171   2.943   6.660   1.00 0.00 ? 29  ALA A HB1  7  
ATOM 9436  H HB2  . ALA A 1 29  ? 6.937   2.919   6.888   1.00 0.00 ? 29  ALA A HB2  7  
ATOM 9437  H HB3  . ALA A 1 29  ? 5.903   1.817   7.829   1.00 0.00 ? 29  ALA A HB3  7  
ATOM 9438  N N    . ALA A 1 30  ? 7.807   5.045   7.723   1.00 0.00 ? 30  ALA A N    7  
ATOM 9439  C CA   . ALA A 1 30  ? 8.598   6.204   7.345   1.00 0.00 ? 30  ALA A CA   7  
ATOM 9440  C C    . ALA A 1 30  ? 10.076  5.812   7.294   1.00 0.00 ? 30  ALA A C    7  
ATOM 9441  O O    . ALA A 1 30  ? 10.595  5.209   8.232   1.00 0.00 ? 30  ALA A O    7  
ATOM 9442  C CB   . ALA A 1 30  ? 8.331   7.347   8.326   1.00 0.00 ? 30  ALA A CB   7  
ATOM 9443  H H    . ALA A 1 30  ? 8.284   4.169   7.660   1.00 0.00 ? 30  ALA A H    7  
ATOM 9444  H HA   . ALA A 1 30  ? 8.278   6.513   6.350   1.00 0.00 ? 30  ALA A HA   7  
ATOM 9445  H HB1  . ALA A 1 30  ? 7.748   6.974   9.168   1.00 0.00 ? 30  ALA A HB1  7  
ATOM 9446  H HB2  . ALA A 1 30  ? 9.279   7.743   8.688   1.00 0.00 ? 30  ALA A HB2  7  
ATOM 9447  H HB3  . ALA A 1 30  ? 7.776   8.137   7.820   1.00 0.00 ? 30  ALA A HB3  7  
ATOM 9448  N N    . LYS A 1 31  ? 10.712  6.170   6.188   1.00 0.00 ? 31  LYS A N    7  
ATOM 9449  C CA   . LYS A 1 31  ? 12.120  5.864   6.002   1.00 0.00 ? 31  LYS A CA   7  
ATOM 9450  C C    . LYS A 1 31  ? 12.966  6.975   6.627   1.00 0.00 ? 31  LYS A C    7  
ATOM 9451  O O    . LYS A 1 31  ? 13.025  8.085   6.102   1.00 0.00 ? 31  LYS A O    7  
ATOM 9452  C CB   . LYS A 1 31  ? 12.424  5.617   4.523   1.00 0.00 ? 31  LYS A CB   7  
ATOM 9453  C CG   . LYS A 1 31  ? 12.106  6.857   3.684   1.00 0.00 ? 31  LYS A CG   7  
ATOM 9454  C CD   . LYS A 1 31  ? 12.468  6.632   2.215   1.00 0.00 ? 31  LYS A CD   7  
ATOM 9455  C CE   . LYS A 1 31  ? 13.330  7.778   1.681   1.00 0.00 ? 31  LYS A CE   7  
ATOM 9456  N NZ   . LYS A 1 31  ? 14.680  7.736   2.285   1.00 0.00 ? 31  LYS A NZ   7  
ATOM 9457  H H    . LYS A 1 31  ? 10.283  6.660   5.429   1.00 0.00 ? 31  LYS A H    7  
ATOM 9458  H HA   . LYS A 1 31  ? 12.325  4.934   6.533   1.00 0.00 ? 31  LYS A HA   7  
ATOM 9459  H HB2  . LYS A 1 31  ? 13.475  5.353   4.403   1.00 0.00 ? 31  LYS A HB2  7  
ATOM 9460  H HB3  . LYS A 1 31  ? 11.840  4.771   4.164   1.00 0.00 ? 31  LYS A HB3  7  
ATOM 9461  H HG2  . LYS A 1 31  ? 11.046  7.095   3.769   1.00 0.00 ? 31  LYS A HG2  7  
ATOM 9462  H HG3  . LYS A 1 31  ? 12.657  7.714   4.071   1.00 0.00 ? 31  LYS A HG3  7  
ATOM 9463  H HD2  . LYS A 1 31  ? 13.005  5.689   2.109   1.00 0.00 ? 31  LYS A HD2  7  
ATOM 9464  H HD3  . LYS A 1 31  ? 11.558  6.549   1.621   1.00 0.00 ? 31  LYS A HD3  7  
ATOM 9465  H HE2  . LYS A 1 31  ? 13.408  7.707   0.596   1.00 0.00 ? 31  LYS A HE2  7  
ATOM 9466  H HE3  . LYS A 1 31  ? 12.855  8.733   1.904   1.00 0.00 ? 31  LYS A HE3  7  
ATOM 9467  H HZ1  . LYS A 1 31  ? 14.809  6.862   2.754   1.00 0.00 ? 31  LYS A HZ1  7  
ATOM 9468  H HZ2  . LYS A 1 31  ? 15.370  7.834   1.568   1.00 0.00 ? 31  LYS A HZ2  7  
ATOM 9469  H HZ3  . LYS A 1 31  ? 14.774  8.483   2.943   1.00 0.00 ? 31  LYS A HZ3  7  
ATOM 9470  N N    . GLY A 1 32  ? 13.600  6.637   7.741   1.00 0.00 ? 32  GLY A N    7  
ATOM 9471  C CA   . GLY A 1 32  ? 14.440  7.592   8.443   1.00 0.00 ? 32  GLY A CA   7  
ATOM 9472  C C    . GLY A 1 32  ? 14.351  7.392   9.957   1.00 0.00 ? 32  GLY A C    7  
ATOM 9473  O O    . GLY A 1 32  ? 13.585  6.555   10.432  1.00 0.00 ? 32  GLY A O    7  
ATOM 9474  H H    . GLY A 1 32  ? 13.547  5.731   8.162   1.00 0.00 ? 32  GLY A H    7  
ATOM 9475  H HA2  . GLY A 1 32  ? 15.475  7.480   8.118   1.00 0.00 ? 32  GLY A HA2  7  
ATOM 9476  H HA3  . GLY A 1 32  ? 14.135  8.607   8.188   1.00 0.00 ? 32  GLY A HA3  7  
ATOM 9477  N N    . ALA A 1 33  ? 15.145  8.174   10.673  1.00 0.00 ? 33  ALA A N    7  
ATOM 9478  C CA   . ALA A 1 33  ? 15.165  8.093   12.124  1.00 0.00 ? 33  ALA A CA   7  
ATOM 9479  C C    . ALA A 1 33  ? 15.410  6.643   12.546  1.00 0.00 ? 33  ALA A C    7  
ATOM 9480  O O    . ALA A 1 33  ? 14.873  6.187   13.554  1.00 0.00 ? 33  ALA A O    7  
ATOM 9481  C CB   . ALA A 1 33  ? 13.854  8.650   12.685  1.00 0.00 ? 33  ALA A CB   7  
ATOM 9482  H H    . ALA A 1 33  ? 15.765  8.853   10.279  1.00 0.00 ? 33  ALA A H    7  
ATOM 9483  H HA   . ALA A 1 33  ? 15.989  8.711   12.479  1.00 0.00 ? 33  ALA A HA   7  
ATOM 9484  H HB1  . ALA A 1 33  ? 14.056  9.197   13.606  1.00 0.00 ? 33  ALA A HB1  7  
ATOM 9485  H HB2  . ALA A 1 33  ? 13.403  9.322   11.955  1.00 0.00 ? 33  ALA A HB2  7  
ATOM 9486  H HB3  . ALA A 1 33  ? 13.170  7.827   12.893  1.00 0.00 ? 33  ALA A HB3  7  
ATOM 9487  N N    . GLY A 1 34  ? 16.223  5.960   11.754  1.00 0.00 ? 34  GLY A N    7  
ATOM 9488  C CA   . GLY A 1 34  ? 16.546  4.571   12.033  1.00 0.00 ? 34  GLY A CA   7  
ATOM 9489  C C    . GLY A 1 34  ? 17.653  4.068   11.103  1.00 0.00 ? 34  GLY A C    7  
ATOM 9490  O O    . GLY A 1 34  ? 18.816  3.999   11.497  1.00 0.00 ? 34  GLY A O    7  
ATOM 9491  H H    . GLY A 1 34  ? 16.656  6.338   10.936  1.00 0.00 ? 34  GLY A H    7  
ATOM 9492  H HA2  . GLY A 1 34  ? 16.864  4.469   13.071  1.00 0.00 ? 34  GLY A HA2  7  
ATOM 9493  H HA3  . GLY A 1 34  ? 15.656  3.955   11.911  1.00 0.00 ? 34  GLY A HA3  7  
ATOM 9494  N N    . GLN A 1 35  ? 17.251  3.729   9.887   1.00 0.00 ? 35  GLN A N    7  
ATOM 9495  C CA   . GLN A 1 35  ? 18.193  3.235   8.898   1.00 0.00 ? 35  GLN A CA   7  
ATOM 9496  C C    . GLN A 1 35  ? 17.835  3.768   7.510   1.00 0.00 ? 35  GLN A C    7  
ATOM 9497  O O    . GLN A 1 35  ? 18.113  3.121   6.501   1.00 0.00 ? 35  GLN A O    7  
ATOM 9498  C CB   . GLN A 1 35  ? 18.241  1.705   8.902   1.00 0.00 ? 35  GLN A CB   7  
ATOM 9499  C CG   . GLN A 1 35  ? 19.663  1.200   8.653   1.00 0.00 ? 35  GLN A CG   7  
ATOM 9500  C CD   . GLN A 1 35  ? 19.984  0.001   9.548   1.00 0.00 ? 35  GLN A CD   7  
ATOM 9501  O OE1  . GLN A 1 35  ? 19.972  0.082   10.765  1.00 0.00 ? 35  GLN A OE1  7  
ATOM 9502  N NE2  . GLN A 1 35  ? 20.271  -1.112  8.879   1.00 0.00 ? 35  GLN A NE2  7  
ATOM 9503  H H    . GLN A 1 35  ? 16.303  3.788   9.575   1.00 0.00 ? 35  GLN A H    7  
ATOM 9504  H HA   . GLN A 1 35  ? 19.165  3.623   9.204   1.00 0.00 ? 35  GLN A HA   7  
ATOM 9505  H HB2  . GLN A 1 35  ? 17.880  1.330   9.860   1.00 0.00 ? 35  GLN A HB2  7  
ATOM 9506  H HB3  . GLN A 1 35  ? 17.573  1.315   8.135   1.00 0.00 ? 35  GLN A HB3  7  
ATOM 9507  H HG2  . GLN A 1 35  ? 19.774  0.917   7.606   1.00 0.00 ? 35  GLN A HG2  7  
ATOM 9508  H HG3  . GLN A 1 35  ? 20.377  2.002   8.844   1.00 0.00 ? 35  GLN A HG3  7  
ATOM 9509  H HE21 . GLN A 1 35  ? 20.264  -1.110  7.879   1.00 0.00 ? 35  GLN A HE21 7  
ATOM 9510  H HE22 . GLN A 1 35  ? 20.495  -1.950  9.376   1.00 0.00 ? 35  GLN A HE22 7  
ATOM 9511  N N    . ASP A 1 36  ? 17.222  4.943   7.502   1.00 0.00 ? 36  ASP A N    7  
ATOM 9512  C CA   . ASP A 1 36  ? 16.823  5.571   6.254   1.00 0.00 ? 36  ASP A CA   7  
ATOM 9513  C C    . ASP A 1 36  ? 15.960  4.596   5.451   1.00 0.00 ? 36  ASP A C    7  
ATOM 9514  O O    . ASP A 1 36  ? 16.086  4.510   4.231   1.00 0.00 ? 36  ASP A O    7  
ATOM 9515  C CB   . ASP A 1 36  ? 18.043  5.933   5.405   1.00 0.00 ? 36  ASP A CB   7  
ATOM 9516  C CG   . ASP A 1 36  ? 17.983  7.310   4.741   1.00 0.00 ? 36  ASP A CG   7  
ATOM 9517  O OD1  . ASP A 1 36  ? 17.150  7.462   3.822   1.00 0.00 ? 36  ASP A OD1  7  
ATOM 9518  O OD2  . ASP A 1 36  ? 18.772  8.181   5.169   1.00 0.00 ? 36  ASP A OD2  7  
ATOM 9519  H H    . ASP A 1 36  ? 17.000  5.463   8.327   1.00 0.00 ? 36  ASP A H    7  
ATOM 9520  H HA   . ASP A 1 36  ? 16.277  6.468   6.547   1.00 0.00 ? 36  ASP A HA   7  
ATOM 9521  H HB2  . ASP A 1 36  ? 18.931  5.887   6.034   1.00 0.00 ? 36  ASP A HB2  7  
ATOM 9522  H HB3  . ASP A 1 36  ? 18.163  5.177   4.628   1.00 0.00 ? 36  ASP A HB3  7  
ATOM 9523  N N    . LYS A 1 37  ? 15.102  3.885   6.169   1.00 0.00 ? 37  LYS A N    7  
ATOM 9524  C CA   . LYS A 1 37  ? 14.219  2.919   5.538   1.00 0.00 ? 37  LYS A CA   7  
ATOM 9525  C C    . LYS A 1 37  ? 13.379  2.225   6.613   1.00 0.00 ? 37  LYS A C    7  
ATOM 9526  O O    . LYS A 1 37  ? 13.909  1.782   7.630   1.00 0.00 ? 37  LYS A O    7  
ATOM 9527  C CB   . LYS A 1 37  ? 15.019  1.952   4.664   1.00 0.00 ? 37  LYS A CB   7  
ATOM 9528  C CG   . LYS A 1 37  ? 14.989  2.387   3.197   1.00 0.00 ? 37  LYS A CG   7  
ATOM 9529  C CD   . LYS A 1 37  ? 16.396  2.381   2.595   1.00 0.00 ? 37  LYS A CD   7  
ATOM 9530  C CE   . LYS A 1 37  ? 16.599  3.579   1.665   1.00 0.00 ? 37  LYS A CE   7  
ATOM 9531  N NZ   . LYS A 1 37  ? 17.449  3.202   0.513   1.00 0.00 ? 37  LYS A NZ   7  
ATOM 9532  H H    . LYS A 1 37  ? 15.006  3.961   7.161   1.00 0.00 ? 37  LYS A H    7  
ATOM 9533  H HA   . LYS A 1 37  ? 13.549  3.471   4.879   1.00 0.00 ? 37  LYS A HA   7  
ATOM 9534  H HB2  . LYS A 1 37  ? 16.050  1.908   5.013   1.00 0.00 ? 37  LYS A HB2  7  
ATOM 9535  H HB3  . LYS A 1 37  ? 14.608  0.947   4.757   1.00 0.00 ? 37  LYS A HB3  7  
ATOM 9536  H HG2  . LYS A 1 37  ? 14.344  1.717   2.629   1.00 0.00 ? 37  LYS A HG2  7  
ATOM 9537  H HG3  . LYS A 1 37  ? 14.560  3.386   3.119   1.00 0.00 ? 37  LYS A HG3  7  
ATOM 9538  H HD2  . LYS A 1 37  ? 17.137  2.406   3.393   1.00 0.00 ? 37  LYS A HD2  7  
ATOM 9539  H HD3  . LYS A 1 37  ? 16.555  1.455   2.042   1.00 0.00 ? 37  LYS A HD3  7  
ATOM 9540  H HE2  . LYS A 1 37  ? 15.633  3.938   1.309   1.00 0.00 ? 37  LYS A HE2  7  
ATOM 9541  H HE3  . LYS A 1 37  ? 17.062  4.399   2.213   1.00 0.00 ? 37  LYS A HE3  7  
ATOM 9542  H HZ1  . LYS A 1 37  ? 18.380  3.537   0.662   1.00 0.00 ? 37  LYS A HZ1  7  
ATOM 9543  H HZ2  . LYS A 1 37  ? 17.464  2.206   0.421   1.00 0.00 ? 37  LYS A HZ2  7  
ATOM 9544  H HZ3  . LYS A 1 37  ? 17.078  3.609   -0.322  1.00 0.00 ? 37  LYS A HZ3  7  
ATOM 9545  N N    . LEU A 1 38  ? 12.082  2.153   6.350   1.00 0.00 ? 38  LEU A N    7  
ATOM 9546  C CA   . LEU A 1 38  ? 11.164  1.520   7.282   1.00 0.00 ? 38  LEU A CA   7  
ATOM 9547  C C    . LEU A 1 38  ? 10.135  0.701   6.500   1.00 0.00 ? 38  LEU A C    7  
ATOM 9548  O O    . LEU A 1 38  ? 9.839   1.008   5.346   1.00 0.00 ? 38  LEU A O    7  
ATOM 9549  C CB   . LEU A 1 38  ? 10.541  2.564   8.212   1.00 0.00 ? 38  LEU A CB   7  
ATOM 9550  C CG   . LEU A 1 38  ? 9.760   2.015   9.407   1.00 0.00 ? 38  LEU A CG   7  
ATOM 9551  C CD1  . LEU A 1 38  ? 9.662   3.057   10.523  1.00 0.00 ? 38  LEU A CD1  7  
ATOM 9552  C CD2  . LEU A 1 38  ? 8.383   1.506   8.976   1.00 0.00 ? 38  LEU A CD2  7  
ATOM 9553  H H    . LEU A 1 38  ? 11.659  2.516   5.520   1.00 0.00 ? 38  LEU A H    7  
ATOM 9554  H HA   . LEU A 1 38  ? 11.746  0.841   7.904   1.00 0.00 ? 38  LEU A HA   7  
ATOM 9555  H HB2  . LEU A 1 38  ? 11.337  3.208   8.587   1.00 0.00 ? 38  LEU A HB2  7  
ATOM 9556  H HB3  . LEU A 1 38  ? 9.873   3.192   7.624   1.00 0.00 ? 38  LEU A HB3  7  
ATOM 9557  H HG   . LEU A 1 38  ? 10.307  1.163   9.811   1.00 0.00 ? 38  LEU A HG   7  
ATOM 9558  H HD11 . LEU A 1 38  ? 10.512  3.737   10.461  1.00 0.00 ? 38  LEU A HD11 7  
ATOM 9559  H HD12 . LEU A 1 38  ? 8.737   3.623   10.412  1.00 0.00 ? 38  LEU A HD12 7  
ATOM 9560  H HD13 . LEU A 1 38  ? 9.668   2.556   11.491  1.00 0.00 ? 38  LEU A HD13 7  
ATOM 9561  H HD21 . LEU A 1 38  ? 7.618   1.936   9.622   1.00 0.00 ? 38  LEU A HD21 7  
ATOM 9562  H HD22 . LEU A 1 38  ? 8.195   1.800   7.943   1.00 0.00 ? 38  LEU A HD22 7  
ATOM 9563  H HD23 . LEU A 1 38  ? 8.357   0.419   9.055   1.00 0.00 ? 38  LEU A HD23 7  
ATOM 9564  N N    . GLY A 1 39  ? 9.618   -0.325  7.160   1.00 0.00 ? 39  GLY A N    7  
ATOM 9565  C CA   . GLY A 1 39  ? 8.628   -1.190  6.541   1.00 0.00 ? 39  GLY A CA   7  
ATOM 9566  C C    . GLY A 1 39  ? 7.258   -0.511  6.495   1.00 0.00 ? 39  GLY A C    7  
ATOM 9567  O O    . GLY A 1 39  ? 6.686   -0.188  7.535   1.00 0.00 ? 39  GLY A O    7  
ATOM 9568  H H    . GLY A 1 39  ? 9.864   -0.568  8.098   1.00 0.00 ? 39  GLY A H    7  
ATOM 9569  H HA2  . GLY A 1 39  ? 8.945   -1.447  5.530   1.00 0.00 ? 39  GLY A HA2  7  
ATOM 9570  H HA3  . GLY A 1 39  ? 8.557   -2.124  7.099   1.00 0.00 ? 39  GLY A HA3  7  
ATOM 9571  N N    . ILE A 1 40  ? 6.771   -0.315  5.278   1.00 0.00 ? 40  ILE A N    7  
ATOM 9572  C CA   . ILE A 1 40  ? 5.479   0.320   5.083   1.00 0.00 ? 40  ILE A CA   7  
ATOM 9573  C C    . ILE A 1 40  ? 4.371   -0.648  5.502   1.00 0.00 ? 40  ILE A C    7  
ATOM 9574  O O    . ILE A 1 40  ? 4.206   -1.707  4.899   1.00 0.00 ? 40  ILE A O    7  
ATOM 9575  C CB   . ILE A 1 40  ? 5.343   0.825   3.645   1.00 0.00 ? 40  ILE A CB   7  
ATOM 9576  C CG1  . ILE A 1 40  ? 6.425   1.857   3.321   1.00 0.00 ? 40  ILE A CG1  7  
ATOM 9577  C CG2  . ILE A 1 40  ? 3.936   1.370   3.387   1.00 0.00 ? 40  ILE A CG2  7  
ATOM 9578  C CD1  . ILE A 1 40  ? 6.095   3.213   3.946   1.00 0.00 ? 40  ILE A CD1  7  
ATOM 9579  H H    . ILE A 1 40  ? 7.243   -0.581  4.438   1.00 0.00 ? 40  ILE A H    7  
ATOM 9580  H HA   . ILE A 1 40  ? 5.442   1.192   5.736   1.00 0.00 ? 40  ILE A HA   7  
ATOM 9581  H HB   . ILE A 1 40  ? 5.490   -0.018  2.971   1.00 0.00 ? 40  ILE A HB   7  
ATOM 9582  H HG12 . ILE A 1 40  ? 7.389   1.506   3.692   1.00 0.00 ? 40  ILE A HG12 7  
ATOM 9583  H HG13 . ILE A 1 40  ? 6.519   1.963   2.240   1.00 0.00 ? 40  ILE A HG13 7  
ATOM 9584  H HG21 . ILE A 1 40  ? 3.232   0.541   3.320   1.00 0.00 ? 40  ILE A HG21 7  
ATOM 9585  H HG22 . ILE A 1 40  ? 3.646   2.029   4.205   1.00 0.00 ? 40  ILE A HG22 7  
ATOM 9586  H HG23 . ILE A 1 40  ? 3.929   1.929   2.451   1.00 0.00 ? 40  ILE A HG23 7  
ATOM 9587  H HD11 . ILE A 1 40  ? 6.972   3.596   4.469   1.00 0.00 ? 40  ILE A HD11 7  
ATOM 9588  H HD12 . ILE A 1 40  ? 5.805   3.914   3.163   1.00 0.00 ? 40  ILE A HD12 7  
ATOM 9589  H HD13 . ILE A 1 40  ? 5.273   3.098   4.653   1.00 0.00 ? 40  ILE A HD13 7  
ATOM 9590  N N    . TYR A 1 41  ? 3.641   -0.250  6.534   1.00 0.00 ? 41  TYR A N    7  
ATOM 9591  C CA   . TYR A 1 41  ? 2.553   -1.069  7.041   1.00 0.00 ? 41  TYR A CA   7  
ATOM 9592  C C    . TYR A 1 41  ? 1.311   -0.221  7.320   1.00 0.00 ? 41  TYR A C    7  
ATOM 9593  O O    . TYR A 1 41  ? 1.398   0.816   7.975   1.00 0.00 ? 41  TYR A O    7  
ATOM 9594  C CB   . TYR A 1 41  ? 3.054   -1.667  8.357   1.00 0.00 ? 41  TYR A CB   7  
ATOM 9595  C CG   . TYR A 1 41  ? 2.702   -3.144  8.544   1.00 0.00 ? 41  TYR A CG   7  
ATOM 9596  C CD1  . TYR A 1 41  ? 2.914   -4.039  7.515   1.00 0.00 ? 41  TYR A CD1  7  
ATOM 9597  C CD2  . TYR A 1 41  ? 2.173   -3.581  9.741   1.00 0.00 ? 41  TYR A CD2  7  
ATOM 9598  C CE1  . TYR A 1 41  ? 2.583   -5.430  7.691   1.00 0.00 ? 41  TYR A CE1  7  
ATOM 9599  C CE2  . TYR A 1 41  ? 1.841   -4.972  9.917   1.00 0.00 ? 41  TYR A CE2  7  
ATOM 9600  C CZ   . TYR A 1 41  ? 2.063   -5.827  8.883   1.00 0.00 ? 41  TYR A CZ   7  
ATOM 9601  O OH   . TYR A 1 41  ? 1.750   -7.140  9.049   1.00 0.00 ? 41  TYR A OH   7  
ATOM 9602  H H    . TYR A 1 41  ? 3.782   0.613   7.019   1.00 0.00 ? 41  TYR A H    7  
ATOM 9603  H HA   . TYR A 1 41  ? 2.312   -1.815  6.283   1.00 0.00 ? 41  TYR A HA   7  
ATOM 9604  H HB2  . TYR A 1 41  ? 4.137   -1.553  8.408   1.00 0.00 ? 41  TYR A HB2  7  
ATOM 9605  H HB3  . TYR A 1 41  ? 2.635   -1.097  9.186   1.00 0.00 ? 41  TYR A HB3  7  
ATOM 9606  H HD1  . TYR A 1 41  ? 3.332   -3.694  6.570   1.00 0.00 ? 41  TYR A HD1  7  
ATOM 9607  H HD2  . TYR A 1 41  ? 2.005   -2.874  10.554  1.00 0.00 ? 41  TYR A HD2  7  
ATOM 9608  H HE1  . TYR A 1 41  ? 2.745   -6.147  6.887   1.00 0.00 ? 41  TYR A HE1  7  
ATOM 9609  H HE2  . TYR A 1 41  ? 1.422   -5.330  10.857  1.00 0.00 ? 41  TYR A HE2  7  
ATOM 9610  H HH   . TYR A 1 41  ? 2.529   -7.631  9.439   1.00 0.00 ? 41  TYR A HH   7  
ATOM 9611  N N    . VAL A 1 42  ? 0.184   -0.693  6.808   1.00 0.00 ? 42  VAL A N    7  
ATOM 9612  C CA   . VAL A 1 42  ? -1.074  0.010   6.993   1.00 0.00 ? 42  VAL A CA   7  
ATOM 9613  C C    . VAL A 1 42  ? -1.511  -0.113  8.454   1.00 0.00 ? 42  VAL A C    7  
ATOM 9614  O O    . VAL A 1 42  ? -1.517  -1.209  9.014   1.00 0.00 ? 42  VAL A O    7  
ATOM 9615  C CB   . VAL A 1 42  ? -2.119  -0.520  6.010   1.00 0.00 ? 42  VAL A CB   7  
ATOM 9616  C CG1  . VAL A 1 42  ? -3.519  -0.023  6.377   1.00 0.00 ? 42  VAL A CG1  7  
ATOM 9617  C CG2  . VAL A 1 42  ? -1.762  -0.140  4.572   1.00 0.00 ? 42  VAL A CG2  7  
ATOM 9618  H H    . VAL A 1 42  ? 0.122   -1.537  6.276   1.00 0.00 ? 42  VAL A H    7  
ATOM 9619  H HA   . VAL A 1 42  ? -0.900  1.062   6.767   1.00 0.00 ? 42  VAL A HA   7  
ATOM 9620  H HB   . VAL A 1 42  ? -2.122  -1.608  6.078   1.00 0.00 ? 42  VAL A HB   7  
ATOM 9621  H HG11 . VAL A 1 42  ? -4.252  -0.795  6.142   1.00 0.00 ? 42  VAL A HG11 7  
ATOM 9622  H HG12 . VAL A 1 42  ? -3.557  0.201   7.443   1.00 0.00 ? 42  VAL A HG12 7  
ATOM 9623  H HG13 . VAL A 1 42  ? -3.745  0.878   5.807   1.00 0.00 ? 42  VAL A HG13 7  
ATOM 9624  H HG21 . VAL A 1 42  ? -2.670  -0.098  3.970   1.00 0.00 ? 42  VAL A HG21 7  
ATOM 9625  H HG22 . VAL A 1 42  ? -1.276  0.836   4.564   1.00 0.00 ? 42  VAL A HG22 7  
ATOM 9626  H HG23 . VAL A 1 42  ? -1.084  -0.886  4.156   1.00 0.00 ? 42  VAL A HG23 7  
ATOM 9627  N N    . LYS A 1 43  ? -1.867  1.026   9.030   1.00 0.00 ? 43  LYS A N    7  
ATOM 9628  C CA   . LYS A 1 43  ? -2.305  1.059   10.415  1.00 0.00 ? 43  LYS A CA   7  
ATOM 9629  C C    . LYS A 1 43  ? -3.827  0.913   10.468  1.00 0.00 ? 43  LYS A C    7  
ATOM 9630  O O    . LYS A 1 43  ? -4.366  0.333   11.410  1.00 0.00 ? 43  LYS A O    7  
ATOM 9631  C CB   . LYS A 1 43  ? -1.783  2.318   11.112  1.00 0.00 ? 43  LYS A CB   7  
ATOM 9632  C CG   . LYS A 1 43  ? -2.246  3.580   10.381  1.00 0.00 ? 43  LYS A CG   7  
ATOM 9633  C CD   . LYS A 1 43  ? -3.087  4.468   11.300  1.00 0.00 ? 43  LYS A CD   7  
ATOM 9634  C CE   . LYS A 1 43  ? -2.355  5.773   11.622  1.00 0.00 ? 43  LYS A CE   7  
ATOM 9635  N NZ   . LYS A 1 43  ? -3.014  6.473   12.747  1.00 0.00 ? 43  LYS A NZ   7  
ATOM 9636  H H    . LYS A 1 43  ? -1.860  1.912   8.568   1.00 0.00 ? 43  LYS A H    7  
ATOM 9637  H HA   . LYS A 1 43  ? -1.858  0.203   10.920  1.00 0.00 ? 43  LYS A HA   7  
ATOM 9638  H HB2  . LYS A 1 43  ? -2.136  2.340   12.143  1.00 0.00 ? 43  LYS A HB2  7  
ATOM 9639  H HB3  . LYS A 1 43  ? -0.694  2.293   11.148  1.00 0.00 ? 43  LYS A HB3  7  
ATOM 9640  H HG2  . LYS A 1 43  ? -1.379  4.137   10.025  1.00 0.00 ? 43  LYS A HG2  7  
ATOM 9641  H HG3  . LYS A 1 43  ? -2.830  3.303   9.503   1.00 0.00 ? 43  LYS A HG3  7  
ATOM 9642  H HD2  . LYS A 1 43  ? -4.042  4.691   10.824  1.00 0.00 ? 43  LYS A HD2  7  
ATOM 9643  H HD3  . LYS A 1 43  ? -3.309  3.935   12.224  1.00 0.00 ? 43  LYS A HD3  7  
ATOM 9644  H HE2  . LYS A 1 43  ? -1.317  5.561   11.877  1.00 0.00 ? 43  LYS A HE2  7  
ATOM 9645  H HE3  . LYS A 1 43  ? -2.343  6.416   10.742  1.00 0.00 ? 43  LYS A HE3  7  
ATOM 9646  H HZ1  . LYS A 1 43  ? -3.775  5.919   13.085  1.00 0.00 ? 43  LYS A HZ1  7  
ATOM 9647  H HZ2  . LYS A 1 43  ? -2.353  6.617   13.483  1.00 0.00 ? 43  LYS A HZ2  7  
ATOM 9648  H HZ3  . LYS A 1 43  ? -3.360  7.357   12.432  1.00 0.00 ? 43  LYS A HZ3  7  
ATOM 9649  N N    . SER A 1 44  ? -4.477  1.449   9.446   1.00 0.00 ? 44  SER A N    7  
ATOM 9650  C CA   . SER A 1 44  ? -5.926  1.385   9.364   1.00 0.00 ? 44  SER A CA   7  
ATOM 9651  C C    . SER A 1 44  ? -6.400  1.947   8.023   1.00 0.00 ? 44  SER A C    7  
ATOM 9652  O O    . SER A 1 44  ? -5.621  2.043   7.076   1.00 0.00 ? 44  SER A O    7  
ATOM 9653  C CB   . SER A 1 44  ? -6.577  2.149   10.519  1.00 0.00 ? 44  SER A CB   7  
ATOM 9654  O OG   . SER A 1 44  ? -6.431  3.559   10.377  1.00 0.00 ? 44  SER A OG   7  
ATOM 9655  H H    . SER A 1 44  ? -4.031  1.919   8.684   1.00 0.00 ? 44  SER A H    7  
ATOM 9656  H HA   . SER A 1 44  ? -6.174  0.327   9.444   1.00 0.00 ? 44  SER A HA   7  
ATOM 9657  H HB2  . SER A 1 44  ? -7.637  1.897   10.568  1.00 0.00 ? 44  SER A HB2  7  
ATOM 9658  H HB3  . SER A 1 44  ? -6.130  1.831   11.461  1.00 0.00 ? 44  SER A HB3  7  
ATOM 9659  H HG   . SER A 1 44  ? -6.335  3.985   11.276  1.00 0.00 ? 44  SER A HG   7  
ATOM 9660  N N    . VAL A 1 45  ? -7.675  2.305   7.984   1.00 0.00 ? 45  VAL A N    7  
ATOM 9661  C CA   . VAL A 1 45  ? -8.262  2.856   6.774   1.00 0.00 ? 45  VAL A CA   7  
ATOM 9662  C C    . VAL A 1 45  ? -9.119  4.070   7.135   1.00 0.00 ? 45  VAL A C    7  
ATOM 9663  O O    . VAL A 1 45  ? -9.821  4.061   8.146   1.00 0.00 ? 45  VAL A O    7  
ATOM 9664  C CB   . VAL A 1 45  ? -9.045  1.771   6.032   1.00 0.00 ? 45  VAL A CB   7  
ATOM 9665  C CG1  . VAL A 1 45  ? -8.224  1.196   4.876   1.00 0.00 ? 45  VAL A CG1  7  
ATOM 9666  C CG2  . VAL A 1 45  ? -9.492  0.665   6.990   1.00 0.00 ? 45  VAL A CG2  7  
ATOM 9667  H H    . VAL A 1 45  ? -8.302  2.224   8.759   1.00 0.00 ? 45  VAL A H    7  
ATOM 9668  H HA   . VAL A 1 45  ? -7.445  3.182   6.131   1.00 0.00 ? 45  VAL A HA   7  
ATOM 9669  H HB   . VAL A 1 45  ? -9.939  2.231   5.612   1.00 0.00 ? 45  VAL A HB   7  
ATOM 9670  H HG11 . VAL A 1 45  ? -8.181  1.923   4.064   1.00 0.00 ? 45  VAL A HG11 7  
ATOM 9671  H HG12 . VAL A 1 45  ? -7.213  0.978   5.221   1.00 0.00 ? 45  VAL A HG12 7  
ATOM 9672  H HG13 . VAL A 1 45  ? -8.692  0.279   4.518   1.00 0.00 ? 45  VAL A HG13 7  
ATOM 9673  H HG21 . VAL A 1 45  ? -9.945  1.111   7.874   1.00 0.00 ? 45  VAL A HG21 7  
ATOM 9674  H HG22 . VAL A 1 45  ? -10.220 0.025   6.491   1.00 0.00 ? 45  VAL A HG22 7  
ATOM 9675  H HG23 . VAL A 1 45  ? -8.628  0.069   7.286   1.00 0.00 ? 45  VAL A HG23 7  
ATOM 9676  N N    . VAL A 1 46  ? -9.035  5.087   6.290   1.00 0.00 ? 46  VAL A N    7  
ATOM 9677  C CA   . VAL A 1 46  ? -9.794  6.306   6.507   1.00 0.00 ? 46  VAL A CA   7  
ATOM 9678  C C    . VAL A 1 46  ? -11.277 5.959   6.655   1.00 0.00 ? 46  VAL A C    7  
ATOM 9679  O O    . VAL A 1 46  ? -12.062 6.769   7.146   1.00 0.00 ? 46  VAL A O    7  
ATOM 9680  C CB   . VAL A 1 46  ? -9.523  7.300   5.376   1.00 0.00 ? 46  VAL A CB   7  
ATOM 9681  C CG1  . VAL A 1 46  ? -10.641 8.340   5.280   1.00 0.00 ? 46  VAL A CG1  7  
ATOM 9682  C CG2  . VAL A 1 46  ? -8.161  7.974   5.554   1.00 0.00 ? 46  VAL A CG2  7  
ATOM 9683  H H    . VAL A 1 46  ? -8.462  5.086   5.470   1.00 0.00 ? 46  VAL A H    7  
ATOM 9684  H HA   . VAL A 1 46  ? -9.444  6.751   7.439   1.00 0.00 ? 46  VAL A HA   7  
ATOM 9685  H HB   . VAL A 1 46  ? -9.501  6.744   4.439   1.00 0.00 ? 46  VAL A HB   7  
ATOM 9686  H HG11 . VAL A 1 46  ? -10.617 8.982   6.161   1.00 0.00 ? 46  VAL A HG11 7  
ATOM 9687  H HG12 . VAL A 1 46  ? -10.498 8.946   4.385   1.00 0.00 ? 46  VAL A HG12 7  
ATOM 9688  H HG13 . VAL A 1 46  ? -11.605 7.834   5.226   1.00 0.00 ? 46  VAL A HG13 7  
ATOM 9689  H HG21 . VAL A 1 46  ? -7.760  7.730   6.538   1.00 0.00 ? 46  VAL A HG21 7  
ATOM 9690  H HG22 . VAL A 1 46  ? -7.476  7.618   4.785   1.00 0.00 ? 46  VAL A HG22 7  
ATOM 9691  H HG23 . VAL A 1 46  ? -8.276  9.055   5.466   1.00 0.00 ? 46  VAL A HG23 7  
ATOM 9692  N N    . LYS A 1 47  ? -11.616 4.754   6.220   1.00 0.00 ? 47  LYS A N    7  
ATOM 9693  C CA   . LYS A 1 47  ? -12.991 4.290   6.298   1.00 0.00 ? 47  LYS A CA   7  
ATOM 9694  C C    . LYS A 1 47  ? -13.885 5.218   5.475   1.00 0.00 ? 47  LYS A C    7  
ATOM 9695  O O    . LYS A 1 47  ? -14.991 5.555   5.895   1.00 0.00 ? 47  LYS A O    7  
ATOM 9696  C CB   . LYS A 1 47  ? -13.427 4.150   7.758   1.00 0.00 ? 47  LYS A CB   7  
ATOM 9697  C CG   . LYS A 1 47  ? -14.671 3.267   7.876   1.00 0.00 ? 47  LYS A CG   7  
ATOM 9698  C CD   . LYS A 1 47  ? -14.718 2.565   9.235   1.00 0.00 ? 47  LYS A CD   7  
ATOM 9699  C CE   . LYS A 1 47  ? -14.957 1.063   9.068   1.00 0.00 ? 47  LYS A CE   7  
ATOM 9700  N NZ   . LYS A 1 47  ? -15.997 0.596   10.012  1.00 0.00 ? 47  LYS A NZ   7  
ATOM 9701  H H    . LYS A 1 47  ? -10.971 4.101   5.822   1.00 0.00 ? 47  LYS A H    7  
ATOM 9702  H HA   . LYS A 1 47  ? -13.025 3.295   5.855   1.00 0.00 ? 47  LYS A HA   7  
ATOM 9703  H HB2  . LYS A 1 47  ? -12.616 3.722   8.345   1.00 0.00 ? 47  LYS A HB2  7  
ATOM 9704  H HB3  . LYS A 1 47  ? -13.636 5.136   8.174   1.00 0.00 ? 47  LYS A HB3  7  
ATOM 9705  H HG2  . LYS A 1 47  ? -15.567 3.875   7.745   1.00 0.00 ? 47  LYS A HG2  7  
ATOM 9706  H HG3  . LYS A 1 47  ? -14.671 2.524   7.079   1.00 0.00 ? 47  LYS A HG3  7  
ATOM 9707  H HD2  . LYS A 1 47  ? -13.781 2.731   9.766   1.00 0.00 ? 47  LYS A HD2  7  
ATOM 9708  H HD3  . LYS A 1 47  ? -15.512 2.998   9.844   1.00 0.00 ? 47  LYS A HD3  7  
ATOM 9709  H HE2  . LYS A 1 47  ? -15.265 0.849   8.044   1.00 0.00 ? 47  LYS A HE2  7  
ATOM 9710  H HE3  . LYS A 1 47  ? -14.029 0.520   9.242   1.00 0.00 ? 47  LYS A HE3  7  
ATOM 9711  H HZ1  . LYS A 1 47  ? -16.354 -0.286  9.705   1.00 0.00 ? 47  LYS A HZ1  7  
ATOM 9712  H HZ2  . LYS A 1 47  ? -15.599 0.496   10.924  1.00 0.00 ? 47  LYS A HZ2  7  
ATOM 9713  H HZ3  . LYS A 1 47  ? -16.742 1.263   10.045  1.00 0.00 ? 47  LYS A HZ3  7  
ATOM 9714  N N    . GLY A 1 48  ? -13.373 5.606   4.316   1.00 0.00 ? 48  GLY A N    7  
ATOM 9715  C CA   . GLY A 1 48  ? -14.112 6.489   3.429   1.00 0.00 ? 48  GLY A CA   7  
ATOM 9716  C C    . GLY A 1 48  ? -13.445 6.570   2.055   1.00 0.00 ? 48  GLY A C    7  
ATOM 9717  O O    . GLY A 1 48  ? -13.529 7.594   1.379   1.00 0.00 ? 48  GLY A O    7  
ATOM 9718  H H    . GLY A 1 48  ? -12.473 5.328   3.981   1.00 0.00 ? 48  GLY A H    7  
ATOM 9719  H HA2  . GLY A 1 48  ? -15.135 6.129   3.321   1.00 0.00 ? 48  GLY A HA2  7  
ATOM 9720  H HA3  . GLY A 1 48  ? -14.170 7.486   3.868   1.00 0.00 ? 48  GLY A HA3  7  
ATOM 9721  N N    . GLY A 1 49  ? -12.798 5.476   1.681   1.00 0.00 ? 49  GLY A N    7  
ATOM 9722  C CA   . GLY A 1 49  ? -12.117 5.409   0.400   1.00 0.00 ? 49  GLY A CA   7  
ATOM 9723  C C    . GLY A 1 49  ? -12.238 4.013   -0.214  1.00 0.00 ? 49  GLY A C    7  
ATOM 9724  O O    . GLY A 1 49  ? -12.549 3.049   0.484   1.00 0.00 ? 49  GLY A O    7  
ATOM 9725  H H    . GLY A 1 49  ? -12.735 4.647   2.237   1.00 0.00 ? 49  GLY A H    7  
ATOM 9726  H HA2  . GLY A 1 49  ? -12.542 6.147   -0.281  1.00 0.00 ? 49  GLY A HA2  7  
ATOM 9727  H HA3  . GLY A 1 49  ? -11.065 5.664   0.529   1.00 0.00 ? 49  GLY A HA3  7  
ATOM 9728  N N    . ALA A 1 50  ? -11.986 3.948   -1.513  1.00 0.00 ? 50  ALA A N    7  
ATOM 9729  C CA   . ALA A 1 50  ? -12.062 2.686   -2.228  1.00 0.00 ? 50  ALA A CA   7  
ATOM 9730  C C    . ALA A 1 50  ? -11.479 1.573   -1.355  1.00 0.00 ? 50  ALA A C    7  
ATOM 9731  O O    . ALA A 1 50  ? -11.981 0.450   -1.357  1.00 0.00 ? 50  ALA A O    7  
ATOM 9732  C CB   . ALA A 1 50  ? -11.338 2.814   -3.570  1.00 0.00 ? 50  ALA A CB   7  
ATOM 9733  H H    . ALA A 1 50  ? -11.733 4.737   -2.074  1.00 0.00 ? 50  ALA A H    7  
ATOM 9734  H HA   . ALA A 1 50  ? -13.115 2.475   -2.417  1.00 0.00 ? 50  ALA A HA   7  
ATOM 9735  H HB1  . ALA A 1 50  ? -11.737 2.080   -4.270  1.00 0.00 ? 50  ALA A HB1  7  
ATOM 9736  H HB2  . ALA A 1 50  ? -11.488 3.817   -3.970  1.00 0.00 ? 50  ALA A HB2  7  
ATOM 9737  H HB3  . ALA A 1 50  ? -10.272 2.637   -3.426  1.00 0.00 ? 50  ALA A HB3  7  
ATOM 9738  N N    . ALA A 1 51  ? -10.428 1.925   -0.629  1.00 0.00 ? 51  ALA A N    7  
ATOM 9739  C CA   . ALA A 1 51  ? -9.771  0.970   0.247   1.00 0.00 ? 51  ALA A CA   7  
ATOM 9740  C C    . ALA A 1 51  ? -10.806 0.354   1.191   1.00 0.00 ? 51  ALA A C    7  
ATOM 9741  O O    . ALA A 1 51  ? -11.279 -0.757  0.959   1.00 0.00 ? 51  ALA A O    7  
ATOM 9742  C CB   . ALA A 1 51  ? -8.635  1.665   1.001   1.00 0.00 ? 51  ALA A CB   7  
ATOM 9743  H H    . ALA A 1 51  ? -10.026 2.840   -0.633  1.00 0.00 ? 51  ALA A H    7  
ATOM 9744  H HA   . ALA A 1 51  ? -9.347  0.183   -0.377  1.00 0.00 ? 51  ALA A HA   7  
ATOM 9745  H HB1  . ALA A 1 51  ? -8.067  0.926   1.565   1.00 0.00 ? 51  ALA A HB1  7  
ATOM 9746  H HB2  . ALA A 1 51  ? -7.978  2.163   0.288   1.00 0.00 ? 51  ALA A HB2  7  
ATOM 9747  H HB3  . ALA A 1 51  ? -9.053  2.403   1.686   1.00 0.00 ? 51  ALA A HB3  7  
ATOM 9748  N N    . ASP A 1 52  ? -11.127 1.104   2.235   1.00 0.00 ? 52  ASP A N    7  
ATOM 9749  C CA   . ASP A 1 52  ? -12.097 0.646   3.215   1.00 0.00 ? 52  ASP A CA   7  
ATOM 9750  C C    . ASP A 1 52  ? -13.459 0.480   2.538   1.00 0.00 ? 52  ASP A C    7  
ATOM 9751  O O    . ASP A 1 52  ? -14.394 -0.049  3.138   1.00 0.00 ? 52  ASP A O    7  
ATOM 9752  C CB   . ASP A 1 52  ? -12.254 1.659   4.350   1.00 0.00 ? 52  ASP A CB   7  
ATOM 9753  C CG   . ASP A 1 52  ? -12.321 1.053   5.754   1.00 0.00 ? 52  ASP A CG   7  
ATOM 9754  O OD1  . ASP A 1 52  ? -12.902 -0.048  5.869   1.00 0.00 ? 52  ASP A OD1  7  
ATOM 9755  O OD2  . ASP A 1 52  ? -11.790 1.704   6.679   1.00 0.00 ? 52  ASP A OD2  7  
ATOM 9756  H H    . ASP A 1 52  ? -10.737 2.007   2.416   1.00 0.00 ? 52  ASP A H    7  
ATOM 9757  H HA   . ASP A 1 52  ? -11.701 -0.297  3.592   1.00 0.00 ? 52  ASP A HA   7  
ATOM 9758  H HB2  . ASP A 1 52  ? -11.417 2.357   4.312   1.00 0.00 ? 52  ASP A HB2  7  
ATOM 9759  H HB3  . ASP A 1 52  ? -13.161 2.239   4.177   1.00 0.00 ? 52  ASP A HB3  7  
ATOM 9760  N N    . VAL A 1 53  ? -13.529 0.941   1.298   1.00 0.00 ? 53  VAL A N    7  
ATOM 9761  C CA   . VAL A 1 53  ? -14.761 0.850   0.534   1.00 0.00 ? 53  VAL A CA   7  
ATOM 9762  C C    . VAL A 1 53  ? -14.790 -0.479  -0.222  1.00 0.00 ? 53  VAL A C    7  
ATOM 9763  O O    . VAL A 1 53  ? -15.857 -1.050  -0.440  1.00 0.00 ? 53  VAL A O    7  
ATOM 9764  C CB   . VAL A 1 53  ? -14.896 2.065   -0.387  1.00 0.00 ? 53  VAL A CB   7  
ATOM 9765  C CG1  . VAL A 1 53  ? -15.567 1.680   -1.707  1.00 0.00 ? 53  VAL A CG1  7  
ATOM 9766  C CG2  . VAL A 1 53  ? -15.658 3.196   0.306   1.00 0.00 ? 53  VAL A CG2  7  
ATOM 9767  H H    . VAL A 1 53  ? -12.764 1.370   0.818   1.00 0.00 ? 53  VAL A H    7  
ATOM 9768  H HA   . VAL A 1 53  ? -15.589 0.870   1.242   1.00 0.00 ? 53  VAL A HA   7  
ATOM 9769  H HB   . VAL A 1 53  ? -13.893 2.427   -0.614  1.00 0.00 ? 53  VAL A HB   7  
ATOM 9770  H HG11 . VAL A 1 53  ? -16.069 2.551   -2.127  1.00 0.00 ? 53  VAL A HG11 7  
ATOM 9771  H HG12 . VAL A 1 53  ? -14.812 1.323   -2.408  1.00 0.00 ? 53  VAL A HG12 7  
ATOM 9772  H HG13 . VAL A 1 53  ? -16.297 0.891   -1.527  1.00 0.00 ? 53  VAL A HG13 7  
ATOM 9773  H HG21 . VAL A 1 53  ? -16.605 3.365   -0.208  1.00 0.00 ? 53  VAL A HG21 7  
ATOM 9774  H HG22 . VAL A 1 53  ? -15.852 2.922   1.343   1.00 0.00 ? 53  VAL A HG22 7  
ATOM 9775  H HG23 . VAL A 1 53  ? -15.061 4.108   0.277   1.00 0.00 ? 53  VAL A HG23 7  
ATOM 9776  N N    . ASP A 1 54  ? -13.604 -0.934  -0.602  1.00 0.00 ? 54  ASP A N    7  
ATOM 9777  C CA   . ASP A 1 54  ? -13.481 -2.185  -1.329  1.00 0.00 ? 54  ASP A CA   7  
ATOM 9778  C C    . ASP A 1 54  ? -13.403 -3.344  -0.332  1.00 0.00 ? 54  ASP A C    7  
ATOM 9779  O O    . ASP A 1 54  ? -13.114 -4.477  -0.714  1.00 0.00 ? 54  ASP A O    7  
ATOM 9780  C CB   . ASP A 1 54  ? -12.208 -2.206  -2.178  1.00 0.00 ? 54  ASP A CB   7  
ATOM 9781  C CG   . ASP A 1 54  ? -11.944 -3.519  -2.916  1.00 0.00 ? 54  ASP A CG   7  
ATOM 9782  O OD1  . ASP A 1 54  ? -12.866 -3.962  -3.634  1.00 0.00 ? 54  ASP A OD1  7  
ATOM 9783  O OD2  . ASP A 1 54  ? -10.826 -4.051  -2.746  1.00 0.00 ? 54  ASP A OD2  7  
ATOM 9784  H H    . ASP A 1 54  ? -12.741 -0.463  -0.421  1.00 0.00 ? 54  ASP A H    7  
ATOM 9785  H HA   . ASP A 1 54  ? -14.367 -2.238  -1.961  1.00 0.00 ? 54  ASP A HA   7  
ATOM 9786  H HB2  . ASP A 1 54  ? -12.265 -1.400  -2.910  1.00 0.00 ? 54  ASP A HB2  7  
ATOM 9787  H HB3  . ASP A 1 54  ? -11.356 -1.991  -1.533  1.00 0.00 ? 54  ASP A HB3  7  
ATOM 9788  N N    . GLY A 1 55  ? -13.665 -3.019  0.925   1.00 0.00 ? 55  GLY A N    7  
ATOM 9789  C CA   . GLY A 1 55  ? -13.628 -4.018  1.979   1.00 0.00 ? 55  GLY A CA   7  
ATOM 9790  C C    . GLY A 1 55  ? -12.483 -5.008  1.756   1.00 0.00 ? 55  GLY A C    7  
ATOM 9791  O O    . GLY A 1 55  ? -12.656 -6.213  1.935   1.00 0.00 ? 55  GLY A O    7  
ATOM 9792  H H    . GLY A 1 55  ? -13.899 -2.095  1.227   1.00 0.00 ? 55  GLY A H    7  
ATOM 9793  H HA2  . GLY A 1 55  ? -13.507 -3.528  2.945   1.00 0.00 ? 55  GLY A HA2  7  
ATOM 9794  H HA3  . GLY A 1 55  ? -14.576 -4.555  2.010   1.00 0.00 ? 55  GLY A HA3  7  
ATOM 9795  N N    . ARG A 1 56  ? -11.339 -4.463  1.370   1.00 0.00 ? 56  ARG A N    7  
ATOM 9796  C CA   . ARG A 1 56  ? -10.165 -5.283  1.121   1.00 0.00 ? 56  ARG A CA   7  
ATOM 9797  C C    . ARG A 1 56  ? -8.945  -4.694  1.832   1.00 0.00 ? 56  ARG A C    7  
ATOM 9798  O O    . ARG A 1 56  ? -8.134  -5.430  2.393   1.00 0.00 ? 56  ARG A O    7  
ATOM 9799  C CB   . ARG A 1 56  ? -9.874  -5.387  -0.377  1.00 0.00 ? 56  ARG A CB   7  
ATOM 9800  C CG   . ARG A 1 56  ? -9.168  -6.703  -0.709  1.00 0.00 ? 56  ARG A CG   7  
ATOM 9801  C CD   . ARG A 1 56  ? -8.642  -6.697  -2.146  1.00 0.00 ? 56  ARG A CD   7  
ATOM 9802  N NE   . ARG A 1 56  ? -7.930  -7.962  -2.430  1.00 0.00 ? 56  ARG A NE   7  
ATOM 9803  C CZ   . ARG A 1 56  ? -7.296  -8.226  -3.580  1.00 0.00 ? 56  ARG A CZ   7  
ATOM 9804  N NH1  . ARG A 1 56  ? -7.281  -7.313  -4.561  1.00 0.00 ? 56  ARG A NH1  7  
ATOM 9805  N NH2  . ARG A 1 56  ? -6.676  -9.402  -3.750  1.00 0.00 ? 56  ARG A NH2  7  
ATOM 9806  H H    . ARG A 1 56  ? -11.207 -3.482  1.228   1.00 0.00 ? 56  ARG A H    7  
ATOM 9807  H HA   . ARG A 1 56  ? -10.420 -6.263  1.525   1.00 0.00 ? 56  ARG A HA   7  
ATOM 9808  H HB2  . ARG A 1 56  ? -10.805 -5.318  -0.938  1.00 0.00 ? 56  ARG A HB2  7  
ATOM 9809  H HB3  . ARG A 1 56  ? -9.251  -4.548  -0.689  1.00 0.00 ? 56  ARG A HB3  7  
ATOM 9810  H HG2  . ARG A 1 56  ? -8.341  -6.862  -0.016  1.00 0.00 ? 56  ARG A HG2  7  
ATOM 9811  H HG3  . ARG A 1 56  ? -9.860  -7.535  -0.575  1.00 0.00 ? 56  ARG A HG3  7  
ATOM 9812  H HD2  . ARG A 1 56  ? -9.469  -6.571  -2.844  1.00 0.00 ? 56  ARG A HD2  7  
ATOM 9813  H HD3  . ARG A 1 56  ? -7.970  -5.851  -2.292  1.00 0.00 ? 56  ARG A HD3  7  
ATOM 9814  H HE   . ARG A 1 56  ? -7.921  -8.665  -1.718  1.00 0.00 ? 56  ARG A HE   7  
ATOM 9815  H HH11 . ARG A 1 56  ? -7.743  -6.435  -4.435  1.00 0.00 ? 56  ARG A HH11 7  
ATOM 9816  H HH12 . ARG A 1 56  ? -6.808  -7.510  -5.420  1.00 0.00 ? 56  ARG A HH12 7  
ATOM 9817  H HH21 . ARG A 1 56  ? -6.687  -10.083 -3.018  1.00 0.00 ? 56  ARG A HH21 7  
ATOM 9818  H HH22 . ARG A 1 56  ? -6.203  -9.598  -4.609  1.00 0.00 ? 56  ARG A HH22 7  
ATOM 9819  N N    . LEU A 1 57  ? -8.854  -3.373  1.785   1.00 0.00 ? 57  LEU A N    7  
ATOM 9820  C CA   . LEU A 1 57  ? -7.746  -2.677  2.418   1.00 0.00 ? 57  LEU A CA   7  
ATOM 9821  C C    . LEU A 1 57  ? -7.988  -2.609  3.927   1.00 0.00 ? 57  LEU A C    7  
ATOM 9822  O O    . LEU A 1 57  ? -9.123  -2.733  4.384   1.00 0.00 ? 57  LEU A O    7  
ATOM 9823  C CB   . LEU A 1 57  ? -7.531  -1.310  1.767   1.00 0.00 ? 57  LEU A CB   7  
ATOM 9824  C CG   . LEU A 1 57  ? -6.453  -1.244  0.683   1.00 0.00 ? 57  LEU A CG   7  
ATOM 9825  C CD1  . LEU A 1 57  ? -6.262  0.190   0.186   1.00 0.00 ? 57  LEU A CD1  7  
ATOM 9826  C CD2  . LEU A 1 57  ? -5.142  -1.860  1.176   1.00 0.00 ? 57  LEU A CD2  7  
ATOM 9827  H H    . LEU A 1 57  ? -9.518  -2.783  1.327   1.00 0.00 ? 57  LEU A H    7  
ATOM 9828  H HA   . LEU A 1 57  ? -6.846  -3.265  2.238   1.00 0.00 ? 57  LEU A HA   7  
ATOM 9829  H HB2  . LEU A 1 57  ? -8.476  -0.984  1.332   1.00 0.00 ? 57  LEU A HB2  7  
ATOM 9830  H HB3  . LEU A 1 57  ? -7.277  -0.594  2.548   1.00 0.00 ? 57  LEU A HB3  7  
ATOM 9831  H HG   . LEU A 1 57  ? -6.788  -1.838  -0.167  1.00 0.00 ? 57  LEU A HG   7  
ATOM 9832  H HD11 . LEU A 1 57  ? -7.102  0.469   -0.451  1.00 0.00 ? 57  LEU A HD11 7  
ATOM 9833  H HD12 . LEU A 1 57  ? -6.212  0.866   1.039   1.00 0.00 ? 57  LEU A HD12 7  
ATOM 9834  H HD13 . LEU A 1 57  ? -5.336  0.255   -0.386  1.00 0.00 ? 57  LEU A HD13 7  
ATOM 9835  H HD21 . LEU A 1 57  ? -4.301  -1.311  0.753   1.00 0.00 ? 57  LEU A HD21 7  
ATOM 9836  H HD22 . LEU A 1 57  ? -5.101  -1.805  2.264   1.00 0.00 ? 57  LEU A HD22 7  
ATOM 9837  H HD23 . LEU A 1 57  ? -5.090  -2.903  0.863   1.00 0.00 ? 57  LEU A HD23 7  
ATOM 9838  N N    . ALA A 1 58  ? -6.902  -2.412  4.660   1.00 0.00 ? 58  ALA A N    7  
ATOM 9839  C CA   . ALA A 1 58  ? -6.981  -2.325  6.108   1.00 0.00 ? 58  ALA A CA   7  
ATOM 9840  C C    . ALA A 1 58  ? -5.598  -2.588  6.707   1.00 0.00 ? 58  ALA A C    7  
ATOM 9841  O O    . ALA A 1 58  ? -4.726  -3.146  6.043   1.00 0.00 ? 58  ALA A O    7  
ATOM 9842  C CB   . ALA A 1 58  ? -8.035  -3.309  6.621   1.00 0.00 ? 58  ALA A CB   7  
ATOM 9843  H H    . ALA A 1 58  ? -5.982  -2.312  4.280   1.00 0.00 ? 58  ALA A H    7  
ATOM 9844  H HA   . ALA A 1 58  ? -7.293  -1.313  6.364   1.00 0.00 ? 58  ALA A HA   7  
ATOM 9845  H HB1  . ALA A 1 58  ? -9.009  -2.821  6.639   1.00 0.00 ? 58  ALA A HB1  7  
ATOM 9846  H HB2  . ALA A 1 58  ? -8.075  -4.176  5.961   1.00 0.00 ? 58  ALA A HB2  7  
ATOM 9847  H HB3  . ALA A 1 58  ? -7.771  -3.631  7.628   1.00 0.00 ? 58  ALA A HB3  7  
ATOM 9848  N N    . ALA A 1 59  ? -5.441  -2.172  7.955   1.00 0.00 ? 59  ALA A N    7  
ATOM 9849  C CA   . ALA A 1 59  ? -4.178  -2.355  8.651   1.00 0.00 ? 59  ALA A CA   7  
ATOM 9850  C C    . ALA A 1 59  ? -3.579  -3.709  8.264   1.00 0.00 ? 59  ALA A C    7  
ATOM 9851  O O    . ALA A 1 59  ? -4.257  -4.733  8.328   1.00 0.00 ? 59  ALA A O    7  
ATOM 9852  C CB   . ALA A 1 59  ? -4.403  -2.227  10.159  1.00 0.00 ? 59  ALA A CB   7  
ATOM 9853  H H    . ALA A 1 59  ? -6.155  -1.719  8.488   1.00 0.00 ? 59  ALA A H    7  
ATOM 9854  H HA   . ALA A 1 59  ? -3.503  -1.563  8.328   1.00 0.00 ? 59  ALA A HA   7  
ATOM 9855  H HB1  . ALA A 1 59  ? -5.407  -1.844  10.346  1.00 0.00 ? 59  ALA A HB1  7  
ATOM 9856  H HB2  . ALA A 1 59  ? -4.294  -3.205  10.627  1.00 0.00 ? 59  ALA A HB2  7  
ATOM 9857  H HB3  . ALA A 1 59  ? -3.668  -1.540  10.579  1.00 0.00 ? 59  ALA A HB3  7  
ATOM 9858  N N    . GLY A 1 60  ? -2.314  -3.670  7.871   1.00 0.00 ? 60  GLY A N    7  
ATOM 9859  C CA   . GLY A 1 60  ? -1.616  -4.880  7.474   1.00 0.00 ? 60  GLY A CA   7  
ATOM 9860  C C    . GLY A 1 60  ? -1.512  -4.979  5.951   1.00 0.00 ? 60  GLY A C    7  
ATOM 9861  O O    . GLY A 1 60  ? -1.788  -6.029  5.372   1.00 0.00 ? 60  GLY A O    7  
ATOM 9862  H H    . GLY A 1 60  ? -1.770  -2.832  7.822   1.00 0.00 ? 60  GLY A H    7  
ATOM 9863  H HA2  . GLY A 1 60  ? -0.618  -4.889  7.912   1.00 0.00 ? 60  GLY A HA2  7  
ATOM 9864  H HA3  . GLY A 1 60  ? -2.142  -5.752  7.863   1.00 0.00 ? 60  GLY A HA3  7  
ATOM 9865  N N    . ASP A 1 61  ? -1.113  -3.870  5.344   1.00 0.00 ? 61  ASP A N    7  
ATOM 9866  C CA   . ASP A 1 61  ? -0.970  -3.818  3.899   1.00 0.00 ? 61  ASP A CA   7  
ATOM 9867  C C    . ASP A 1 61  ? 0.427   -3.301  3.548   1.00 0.00 ? 61  ASP A C    7  
ATOM 9868  O O    . ASP A 1 61  ? 0.620   -2.101  3.363   1.00 0.00 ? 61  ASP A O    7  
ATOM 9869  C CB   . ASP A 1 61  ? -1.995  -2.868  3.277   1.00 0.00 ? 61  ASP A CB   7  
ATOM 9870  C CG   . ASP A 1 61  ? -3.015  -3.534  2.351   1.00 0.00 ? 61  ASP A CG   7  
ATOM 9871  O OD1  . ASP A 1 61  ? -3.842  -4.308  2.880   1.00 0.00 ? 61  ASP A OD1  7  
ATOM 9872  O OD2  . ASP A 1 61  ? -2.944  -3.254  1.135   1.00 0.00 ? 61  ASP A OD2  7  
ATOM 9873  H H    . ASP A 1 61  ? -0.891  -3.020  5.822   1.00 0.00 ? 61  ASP A H    7  
ATOM 9874  H HA   . ASP A 1 61  ? -1.134  -4.840  3.558   1.00 0.00 ? 61  ASP A HA   7  
ATOM 9875  H HB2  . ASP A 1 61  ? -2.532  -2.362  4.080   1.00 0.00 ? 61  ASP A HB2  7  
ATOM 9876  H HB3  . ASP A 1 61  ? -1.463  -2.101  2.716   1.00 0.00 ? 61  ASP A HB3  7  
ATOM 9877  N N    . GLN A 1 62  ? 1.365   -4.233  3.468   1.00 0.00 ? 62  GLN A N    7  
ATOM 9878  C CA   . GLN A 1 62  ? 2.738   -3.887  3.143   1.00 0.00 ? 62  GLN A CA   7  
ATOM 9879  C C    . GLN A 1 62  ? 2.914   -3.780  1.626   1.00 0.00 ? 62  GLN A C    7  
ATOM 9880  O O    . GLN A 1 62  ? 2.874   -4.786  0.920   1.00 0.00 ? 62  GLN A O    7  
ATOM 9881  C CB   . GLN A 1 62  ? 3.716   -4.903  3.737   1.00 0.00 ? 62  GLN A CB   7  
ATOM 9882  C CG   . GLN A 1 62  ? 5.164   -4.497  3.459   1.00 0.00 ? 62  GLN A CG   7  
ATOM 9883  C CD   . GLN A 1 62  ? 5.949   -4.341  4.764   1.00 0.00 ? 62  GLN A CD   7  
ATOM 9884  O OE1  . GLN A 1 62  ? 5.682   -3.475  5.579   1.00 0.00 ? 62  GLN A OE1  7  
ATOM 9885  N NE2  . GLN A 1 62  ? 6.930   -5.227  4.914   1.00 0.00 ? 62  GLN A NE2  7  
ATOM 9886  H H    . GLN A 1 62  ? 1.200   -5.208  3.620   1.00 0.00 ? 62  GLN A H    7  
ATOM 9887  H HA   . GLN A 1 62  ? 2.909   -2.915  3.605   1.00 0.00 ? 62  GLN A HA   7  
ATOM 9888  H HB2  . GLN A 1 62  ? 3.556   -4.981  4.812   1.00 0.00 ? 62  GLN A HB2  7  
ATOM 9889  H HB3  . GLN A 1 62  ? 3.523   -5.889  3.314   1.00 0.00 ? 62  GLN A HB3  7  
ATOM 9890  H HG2  . GLN A 1 62  ? 5.642   -5.249  2.831   1.00 0.00 ? 62  GLN A HG2  7  
ATOM 9891  H HG3  . GLN A 1 62  ? 5.183   -3.559  2.905   1.00 0.00 ? 62  GLN A HG3  7  
ATOM 9892  H HE21 . GLN A 1 62  ? 7.097   -5.913  4.206   1.00 0.00 ? 62  GLN A HE21 7  
ATOM 9893  H HE22 . GLN A 1 62  ? 7.501   -5.206  5.735   1.00 0.00 ? 62  GLN A HE22 7  
ATOM 9894  N N    . LEU A 1 63  ? 3.104   -2.550  1.170   1.00 0.00 ? 63  LEU A N    7  
ATOM 9895  C CA   . LEU A 1 63  ? 3.285   -2.298  -0.249  1.00 0.00 ? 63  LEU A CA   7  
ATOM 9896  C C    . LEU A 1 63  ? 4.780   -2.290  -0.574  1.00 0.00 ? 63  LEU A C    7  
ATOM 9897  O O    . LEU A 1 63  ? 5.522   -1.444  -0.079  1.00 0.00 ? 63  LEU A O    7  
ATOM 9898  C CB   . LEU A 1 63  ? 2.559   -1.017  -0.663  1.00 0.00 ? 63  LEU A CB   7  
ATOM 9899  C CG   . LEU A 1 63  ? 2.242   -0.032  0.464   1.00 0.00 ? 63  LEU A CG   7  
ATOM 9900  C CD1  . LEU A 1 63  ? 1.956   1.364   -0.092  1.00 0.00 ? 63  LEU A CD1  7  
ATOM 9901  C CD2  . LEU A 1 63  ? 1.095   -0.547  1.336   1.00 0.00 ? 63  LEU A CD2  7  
ATOM 9902  H H    . LEU A 1 63  ? 3.135   -1.737  1.751   1.00 0.00 ? 63  LEU A H    7  
ATOM 9903  H HA   . LEU A 1 63  ? 2.819   -3.122  -0.789  1.00 0.00 ? 63  LEU A HA   7  
ATOM 9904  H HB2  . LEU A 1 63  ? 3.167   -0.503  -1.407  1.00 0.00 ? 63  LEU A HB2  7  
ATOM 9905  H HB3  . LEU A 1 63  ? 1.624   -1.294  -1.150  1.00 0.00 ? 63  LEU A HB3  7  
ATOM 9906  H HG   . LEU A 1 63  ? 3.120   0.050   1.104   1.00 0.00 ? 63  LEU A HG   7  
ATOM 9907  H HD11 . LEU A 1 63  ? 2.695   2.067   0.293   1.00 0.00 ? 63  LEU A HD11 7  
ATOM 9908  H HD12 . LEU A 1 63  ? 2.011   1.340   -1.181  1.00 0.00 ? 63  LEU A HD12 7  
ATOM 9909  H HD13 . LEU A 1 63  ? 0.959   1.681   0.215   1.00 0.00 ? 63  LEU A HD13 7  
ATOM 9910  H HD21 . LEU A 1 63  ? 0.159   -0.092  1.011   1.00 0.00 ? 63  LEU A HD21 7  
ATOM 9911  H HD22 . LEU A 1 63  ? 1.025   -1.631  1.241   1.00 0.00 ? 63  LEU A HD22 7  
ATOM 9912  H HD23 . LEU A 1 63  ? 1.284   -0.285  2.377   1.00 0.00 ? 63  LEU A HD23 7  
ATOM 9913  N N    . LEU A 1 64  ? 5.178   -3.243  -1.405  1.00 0.00 ? 64  LEU A N    7  
ATOM 9914  C CA   . LEU A 1 64  ? 6.571   -3.356  -1.802  1.00 0.00 ? 64  LEU A CA   7  
ATOM 9915  C C    . LEU A 1 64  ? 6.860   -2.357  -2.923  1.00 0.00 ? 64  LEU A C    7  
ATOM 9916  O O    . LEU A 1 64  ? 8.003   -1.943  -3.112  1.00 0.00 ? 64  LEU A O    7  
ATOM 9917  C CB   . LEU A 1 64  ? 6.908   -4.803  -2.166  1.00 0.00 ? 64  LEU A CB   7  
ATOM 9918  C CG   . LEU A 1 64  ? 7.845   -5.536  -1.203  1.00 0.00 ? 64  LEU A CG   7  
ATOM 9919  C CD1  . LEU A 1 64  ? 7.050   -6.319  -0.155  1.00 0.00 ? 64  LEU A CD1  7  
ATOM 9920  C CD2  . LEU A 1 64  ? 8.825   -6.430  -1.965  1.00 0.00 ? 64  LEU A CD2  7  
ATOM 9921  H H    . LEU A 1 64  ? 4.568   -3.928  -1.803  1.00 0.00 ? 64  LEU A H    7  
ATOM 9922  H HA   . LEU A 1 64  ? 7.180   -3.091  -0.937  1.00 0.00 ? 64  LEU A HA   7  
ATOM 9923  H HB2  . LEU A 1 64  ? 5.978   -5.366  -2.235  1.00 0.00 ? 64  LEU A HB2  7  
ATOM 9924  H HB3  . LEU A 1 64  ? 7.361   -4.812  -3.157  1.00 0.00 ? 64  LEU A HB3  7  
ATOM 9925  H HG   . LEU A 1 64  ? 8.436   -4.792  -0.668  1.00 0.00 ? 64  LEU A HG   7  
ATOM 9926  H HD11 . LEU A 1 64  ? 7.634   -7.178  0.176   1.00 0.00 ? 64  LEU A HD11 7  
ATOM 9927  H HD12 . LEU A 1 64  ? 6.838   -5.674  0.697   1.00 0.00 ? 64  LEU A HD12 7  
ATOM 9928  H HD13 . LEU A 1 64  ? 6.113   -6.663  -0.592  1.00 0.00 ? 64  LEU A HD13 7  
ATOM 9929  H HD21 . LEU A 1 64  ? 9.841   -6.064  -1.816  1.00 0.00 ? 64  LEU A HD21 7  
ATOM 9930  H HD22 . LEU A 1 64  ? 8.749   -7.452  -1.593  1.00 0.00 ? 64  LEU A HD22 7  
ATOM 9931  H HD23 . LEU A 1 64  ? 8.583   -6.411  -3.027  1.00 0.00 ? 64  LEU A HD23 7  
ATOM 9932  N N    . SER A 1 65  ? 5.804   -1.997  -3.639  1.00 0.00 ? 65  SER A N    7  
ATOM 9933  C CA   . SER A 1 65  ? 5.930   -1.054  -4.737  1.00 0.00 ? 65  SER A CA   7  
ATOM 9934  C C    . SER A 1 65  ? 4.548   -0.551  -5.156  1.00 0.00 ? 65  SER A C    7  
ATOM 9935  O O    . SER A 1 65  ? 3.543   -1.223  -4.928  1.00 0.00 ? 65  SER A O    7  
ATOM 9936  C CB   . SER A 1 65  ? 6.648   -1.689  -5.929  1.00 0.00 ? 65  SER A CB   7  
ATOM 9937  O OG   . SER A 1 65  ? 7.688   -2.572  -5.518  1.00 0.00 ? 65  SER A OG   7  
ATOM 9938  H H    . SER A 1 65  ? 4.878   -2.338  -3.479  1.00 0.00 ? 65  SER A H    7  
ATOM 9939  H HA   . SER A 1 65  ? 6.533   -0.234  -4.346  1.00 0.00 ? 65  SER A HA   7  
ATOM 9940  H HB2  . SER A 1 65  ? 5.927   -2.237  -6.536  1.00 0.00 ? 65  SER A HB2  7  
ATOM 9941  H HB3  . SER A 1 65  ? 7.066   -0.906  -6.561  1.00 0.00 ? 65  SER A HB3  7  
ATOM 9942  H HG   . SER A 1 65  ? 7.311   -3.478  -5.323  1.00 0.00 ? 65  SER A HG   7  
ATOM 9943  N N    . VAL A 1 66  ? 4.540   0.627   -5.762  1.00 0.00 ? 66  VAL A N    7  
ATOM 9944  C CA   . VAL A 1 66  ? 3.297   1.228   -6.215  1.00 0.00 ? 66  VAL A CA   7  
ATOM 9945  C C    . VAL A 1 66  ? 3.537   1.944   -7.546  1.00 0.00 ? 66  VAL A C    7  
ATOM 9946  O O    . VAL A 1 66  ? 4.455   2.755   -7.662  1.00 0.00 ? 66  VAL A O    7  
ATOM 9947  C CB   . VAL A 1 66  ? 2.737   2.152   -5.132  1.00 0.00 ? 66  VAL A CB   7  
ATOM 9948  C CG1  . VAL A 1 66  ? 1.342   2.654   -5.508  1.00 0.00 ? 66  VAL A CG1  7  
ATOM 9949  C CG2  . VAL A 1 66  ? 2.720   1.453   -3.771  1.00 0.00 ? 66  VAL A CG2  7  
ATOM 9950  H H    . VAL A 1 66  ? 5.362   1.168   -5.944  1.00 0.00 ? 66  VAL A H    7  
ATOM 9951  H HA   . VAL A 1 66  ? 2.581   0.422   -6.375  1.00 0.00 ? 66  VAL A HA   7  
ATOM 9952  H HB   . VAL A 1 66  ? 3.395   3.017   -5.056  1.00 0.00 ? 66  VAL A HB   7  
ATOM 9953  H HG11 . VAL A 1 66  ? 1.038   2.209   -6.455  1.00 0.00 ? 66  VAL A HG11 7  
ATOM 9954  H HG12 . VAL A 1 66  ? 0.632   2.372   -4.730  1.00 0.00 ? 66  VAL A HG12 7  
ATOM 9955  H HG13 . VAL A 1 66  ? 1.361   3.740   -5.606  1.00 0.00 ? 66  VAL A HG13 7  
ATOM 9956  H HG21 . VAL A 1 66  ? 1.969   1.919   -3.133  1.00 0.00 ? 66  VAL A HG21 7  
ATOM 9957  H HG22 . VAL A 1 66  ? 2.479   0.399   -3.906  1.00 0.00 ? 66  VAL A HG22 7  
ATOM 9958  H HG23 . VAL A 1 66  ? 3.701   1.544   -3.303  1.00 0.00 ? 66  VAL A HG23 7  
ATOM 9959  N N    . ASP A 1 67  ? 2.696   1.618   -8.517  1.00 0.00 ? 67  ASP A N    7  
ATOM 9960  C CA   . ASP A 1 67  ? 2.806   2.220   -9.835  1.00 0.00 ? 67  ASP A CA   7  
ATOM 9961  C C    . ASP A 1 67  ? 4.215   1.985   -10.383 1.00 0.00 ? 67  ASP A C    7  
ATOM 9962  O O    . ASP A 1 67  ? 4.760   2.834   -11.086 1.00 0.00 ? 67  ASP A O    7  
ATOM 9963  C CB   . ASP A 1 67  ? 2.569   3.731   -9.772  1.00 0.00 ? 67  ASP A CB   7  
ATOM 9964  C CG   . ASP A 1 67  ? 1.113   4.149   -9.560  1.00 0.00 ? 67  ASP A CG   7  
ATOM 9965  O OD1  . ASP A 1 67  ? 0.367   4.136   -10.564 1.00 0.00 ? 67  ASP A OD1  7  
ATOM 9966  O OD2  . ASP A 1 67  ? 0.777   4.471   -8.400  1.00 0.00 ? 67  ASP A OD2  7  
ATOM 9967  H H    . ASP A 1 67  ? 1.953   0.958   -8.414  1.00 0.00 ? 67  ASP A H    7  
ATOM 9968  H HA   . ASP A 1 67  ? 2.038   1.734   -10.436 1.00 0.00 ? 67  ASP A HA   7  
ATOM 9969  H HB2  . ASP A 1 67  ? 3.171   4.144   -8.963  1.00 0.00 ? 67  ASP A HB2  7  
ATOM 9970  H HB3  . ASP A 1 67  ? 2.929   4.179   -10.698 1.00 0.00 ? 67  ASP A HB3  7  
ATOM 9971  N N    . GLY A 1 68  ? 4.763   0.829   -10.040 1.00 0.00 ? 68  GLY A N    7  
ATOM 9972  C CA   . GLY A 1 68  ? 6.098   0.471   -10.489 1.00 0.00 ? 68  GLY A CA   7  
ATOM 9973  C C    . GLY A 1 68  ? 7.159   0.975   -9.509  1.00 0.00 ? 68  GLY A C    7  
ATOM 9974  O O    . GLY A 1 68  ? 8.221   0.370   -9.372  1.00 0.00 ? 68  GLY A O    7  
ATOM 9975  H H    . GLY A 1 68  ? 4.312   0.144   -9.467  1.00 0.00 ? 68  GLY A H    7  
ATOM 9976  H HA2  . GLY A 1 68  ? 6.174   -0.612  -10.588 1.00 0.00 ? 68  GLY A HA2  7  
ATOM 9977  H HA3  . GLY A 1 68  ? 6.279   0.895   -11.476 1.00 0.00 ? 68  GLY A HA3  7  
ATOM 9978  N N    . ARG A 1 69  ? 6.836   2.080   -8.852  1.00 0.00 ? 69  ARG A N    7  
ATOM 9979  C CA   . ARG A 1 69  ? 7.748   2.672   -7.889  1.00 0.00 ? 69  ARG A CA   7  
ATOM 9980  C C    . ARG A 1 69  ? 7.737   1.872   -6.585  1.00 0.00 ? 69  ARG A C    7  
ATOM 9981  O O    . ARG A 1 69  ? 6.708   1.780   -5.918  1.00 0.00 ? 69  ARG A O    7  
ATOM 9982  C CB   . ARG A 1 69  ? 7.368   4.124   -7.591  1.00 0.00 ? 69  ARG A CB   7  
ATOM 9983  C CG   . ARG A 1 69  ? 8.563   5.057   -7.797  1.00 0.00 ? 69  ARG A CG   7  
ATOM 9984  C CD   . ARG A 1 69  ? 8.532   5.688   -9.191  1.00 0.00 ? 69  ARG A CD   7  
ATOM 9985  N NE   . ARG A 1 69  ? 8.591   7.162   -9.081  1.00 0.00 ? 69  ARG A NE   7  
ATOM 9986  C CZ   . ARG A 1 69  ? 9.590   7.832   -8.490  1.00 0.00 ? 69  ARG A CZ   7  
ATOM 9987  N NH1  . ARG A 1 69  ? 10.619  7.164   -7.952  1.00 0.00 ? 69  ARG A NH1  7  
ATOM 9988  N NH2  . ARG A 1 69  ? 9.559   9.171   -8.436  1.00 0.00 ? 69  ARG A NH2  7  
ATOM 9989  H H    . ARG A 1 69  ? 5.970   2.567   -8.969  1.00 0.00 ? 69  ARG A H    7  
ATOM 9990  H HA   . ARG A 1 69  ? 8.726   2.628   -8.368  1.00 0.00 ? 69  ARG A HA   7  
ATOM 9991  H HB2  . ARG A 1 69  ? 6.547   4.430   -8.241  1.00 0.00 ? 69  ARG A HB2  7  
ATOM 9992  H HB3  . ARG A 1 69  ? 7.010   4.207   -6.565  1.00 0.00 ? 69  ARG A HB3  7  
ATOM 9993  H HG2  . ARG A 1 69  ? 8.552   5.841   -7.040  1.00 0.00 ? 69  ARG A HG2  7  
ATOM 9994  H HG3  . ARG A 1 69  ? 9.491   4.500   -7.667  1.00 0.00 ? 69  ARG A HG3  7  
ATOM 9995  H HD2  . ARG A 1 69  ? 9.373   5.325   -9.782  1.00 0.00 ? 69  ARG A HD2  7  
ATOM 9996  H HD3  . ARG A 1 69  ? 7.624   5.390   -9.714  1.00 0.00 ? 69  ARG A HD3  7  
ATOM 9997  H HE   . ARG A 1 69  ? 7.838   7.692   -9.472  1.00 0.00 ? 69  ARG A HE   7  
ATOM 9998  H HH11 . ARG A 1 69  ? 10.642  6.165   -7.992  1.00 0.00 ? 69  ARG A HH11 7  
ATOM 9999  H HH12 . ARG A 1 69  ? 11.365  7.664   -7.511  1.00 0.00 ? 69  ARG A HH12 7  
ATOM 10000 H HH21 . ARG A 1 69  ? 8.791   9.670   -8.838  1.00 0.00 ? 69  ARG A HH21 7  
ATOM 10001 H HH22 . ARG A 1 69  ? 10.305  9.671   -7.995  1.00 0.00 ? 69  ARG A HH22 7  
ATOM 10002 N N    . SER A 1 70  ? 8.894   1.312   -6.262  1.00 0.00 ? 70  SER A N    7  
ATOM 10003 C CA   . SER A 1 70  ? 9.031   0.523   -5.050  1.00 0.00 ? 70  SER A CA   7  
ATOM 10004 C C    . SER A 1 70  ? 8.668   1.371   -3.829  1.00 0.00 ? 70  SER A C    7  
ATOM 10005 O O    . SER A 1 70  ? 9.040   2.540   -3.749  1.00 0.00 ? 70  SER A O    7  
ATOM 10006 C CB   . SER A 1 70  ? 10.450  -0.030  -4.910  1.00 0.00 ? 70  SER A CB   7  
ATOM 10007 O OG   . SER A 1 70  ? 11.388  0.988   -4.569  1.00 0.00 ? 70  SER A OG   7  
ATOM 10008 H H    . SER A 1 70  ? 9.726   1.392   -6.811  1.00 0.00 ? 70  SER A H    7  
ATOM 10009 H HA   . SER A 1 70  ? 8.329   -0.304  -5.164  1.00 0.00 ? 70  SER A HA   7  
ATOM 10010 H HB2  . SER A 1 70  ? 10.464  -0.806  -4.144  1.00 0.00 ? 70  SER A HB2  7  
ATOM 10011 H HB3  . SER A 1 70  ? 10.751  -0.501  -5.846  1.00 0.00 ? 70  SER A HB3  7  
ATOM 10012 H HG   . SER A 1 70  ? 11.444  1.083   -3.575  1.00 0.00 ? 70  SER A HG   7  
ATOM 10013 N N    . LEU A 1 71  ? 7.946   0.747   -2.909  1.00 0.00 ? 71  LEU A N    7  
ATOM 10014 C CA   . LEU A 1 71  ? 7.529   1.430   -1.696  1.00 0.00 ? 71  LEU A CA   7  
ATOM 10015 C C    . LEU A 1 71  ? 8.066   0.674   -0.480  1.00 0.00 ? 71  LEU A C    7  
ATOM 10016 O O    . LEU A 1 71  ? 7.806   1.058   0.659   1.00 0.00 ? 71  LEU A O    7  
ATOM 10017 C CB   . LEU A 1 71  ? 6.011   1.618   -1.683  1.00 0.00 ? 71  LEU A CB   7  
ATOM 10018 C CG   . LEU A 1 71  ? 5.511   3.053   -1.861  1.00 0.00 ? 71  LEU A CG   7  
ATOM 10019 C CD1  . LEU A 1 71  ? 5.300   3.380   -3.341  1.00 0.00 ? 71  LEU A CD1  7  
ATOM 10020 C CD2  . LEU A 1 71  ? 4.248   3.301   -1.033  1.00 0.00 ? 71  LEU A CD2  7  
ATOM 10021 H H    . LEU A 1 71  ? 7.648   -0.204  -2.982  1.00 0.00 ? 71  LEU A H    7  
ATOM 10022 H HA   . LEU A 1 71  ? 7.977   2.424   -1.710  1.00 0.00 ? 71  LEU A HA   7  
ATOM 10023 H HB2  . LEU A 1 71  ? 5.581   1.004   -2.474  1.00 0.00 ? 71  LEU A HB2  7  
ATOM 10024 H HB3  . LEU A 1 71  ? 5.626   1.236   -0.737  1.00 0.00 ? 71  LEU A HB3  7  
ATOM 10025 H HG   . LEU A 1 71  ? 6.279   3.731   -1.488  1.00 0.00 ? 71  LEU A HG   7  
ATOM 10026 H HD11 . LEU A 1 71  ? 4.315   3.827   -3.477  1.00 0.00 ? 71  LEU A HD11 7  
ATOM 10027 H HD12 . LEU A 1 71  ? 6.066   4.082   -3.671  1.00 0.00 ? 71  LEU A HD12 7  
ATOM 10028 H HD13 . LEU A 1 71  ? 5.369   2.465   -3.928  1.00 0.00 ? 71  LEU A HD13 7  
ATOM 10029 H HD21 . LEU A 1 71  ? 3.426   2.712   -1.440  1.00 0.00 ? 71  LEU A HD21 7  
ATOM 10030 H HD22 . LEU A 1 71  ? 4.429   3.009   0.001   1.00 0.00 ? 71  LEU A HD22 7  
ATOM 10031 H HD23 . LEU A 1 71  ? 3.990   4.360   -1.072  1.00 0.00 ? 71  LEU A HD23 7  
ATOM 10032 N N    . VAL A 1 72  ? 8.805   -0.389  -0.763  1.00 0.00 ? 72  VAL A N    7  
ATOM 10033 C CA   . VAL A 1 72  ? 9.381   -1.203  0.294   1.00 0.00 ? 72  VAL A CA   7  
ATOM 10034 C C    . VAL A 1 72  ? 10.457  -0.397  1.024   1.00 0.00 ? 72  VAL A C    7  
ATOM 10035 O O    . VAL A 1 72  ? 11.591  -0.853  1.166   1.00 0.00 ? 72  VAL A O    7  
ATOM 10036 C CB   . VAL A 1 72  ? 9.910   -2.517  -0.286  1.00 0.00 ? 72  VAL A CB   7  
ATOM 10037 C CG1  . VAL A 1 72  ? 11.195  -2.286  -1.083  1.00 0.00 ? 72  VAL A CG1  7  
ATOM 10038 C CG2  . VAL A 1 72  ? 10.126  -3.555  0.816   1.00 0.00 ? 72  VAL A CG2  7  
ATOM 10039 H H    . VAL A 1 72  ? 9.012   -0.695  -1.692  1.00 0.00 ? 72  VAL A H    7  
ATOM 10040 H HA   . VAL A 1 72  ? 8.583   -1.441  0.997   1.00 0.00 ? 72  VAL A HA   7  
ATOM 10041 H HB   . VAL A 1 72  ? 9.157   -2.907  -0.971  1.00 0.00 ? 72  VAL A HB   7  
ATOM 10042 H HG11 . VAL A 1 72  ? 11.340  -1.217  -1.238  1.00 0.00 ? 72  VAL A HG11 7  
ATOM 10043 H HG12 . VAL A 1 72  ? 12.043  -2.691  -0.530  1.00 0.00 ? 72  VAL A HG12 7  
ATOM 10044 H HG13 . VAL A 1 72  ? 11.119  -2.786  -2.049  1.00 0.00 ? 72  VAL A HG13 7  
ATOM 10045 H HG21 . VAL A 1 72  ? 9.296   -3.515  1.521   1.00 0.00 ? 72  VAL A HG21 7  
ATOM 10046 H HG22 . VAL A 1 72  ? 10.178  -4.550  0.373   1.00 0.00 ? 72  VAL A HG22 7  
ATOM 10047 H HG23 . VAL A 1 72  ? 11.058  -3.341  1.339   1.00 0.00 ? 72  VAL A HG23 7  
ATOM 10048 N N    . GLY A 1 73  ? 10.064  0.788   1.468   1.00 0.00 ? 73  GLY A N    7  
ATOM 10049 C CA   . GLY A 1 73  ? 10.980  1.662   2.181   1.00 0.00 ? 73  GLY A CA   7  
ATOM 10050 C C    . GLY A 1 73  ? 10.805  3.117   1.739   1.00 0.00 ? 73  GLY A C    7  
ATOM 10051 O O    . GLY A 1 73  ? 11.786  3.835   1.554   1.00 0.00 ? 73  GLY A O    7  
ATOM 10052 H H    . GLY A 1 73  ? 9.140   1.152   1.349   1.00 0.00 ? 73  GLY A H    7  
ATOM 10053 H HA2  . GLY A 1 73  ? 10.807  1.580   3.254   1.00 0.00 ? 73  GLY A HA2  7  
ATOM 10054 H HA3  . GLY A 1 73  ? 12.007  1.344   1.999   1.00 0.00 ? 73  GLY A HA3  7  
ATOM 10055 N N    . LEU A 1 74  ? 9.549   3.507   1.585   1.00 0.00 ? 74  LEU A N    7  
ATOM 10056 C CA   . LEU A 1 74  ? 9.232   4.863   1.169   1.00 0.00 ? 74  LEU A CA   7  
ATOM 10057 C C    . LEU A 1 74  ? 8.609   5.620   2.343   1.00 0.00 ? 74  LEU A C    7  
ATOM 10058 O O    . LEU A 1 74  ? 7.734   5.095   3.030   1.00 0.00 ? 74  LEU A O    7  
ATOM 10059 C CB   . LEU A 1 74  ? 8.358   4.848   -0.087  1.00 0.00 ? 74  LEU A CB   7  
ATOM 10060 C CG   . LEU A 1 74  ? 9.093   5.026   -1.417  1.00 0.00 ? 74  LEU A CG   7  
ATOM 10061 C CD1  . LEU A 1 74  ? 8.105   5.260   -2.562  1.00 0.00 ? 74  LEU A CD1  7  
ATOM 10062 C CD2  . LEU A 1 74  ? 10.136  6.140   -1.323  1.00 0.00 ? 74  LEU A CD2  7  
ATOM 10063 H H    . LEU A 1 74  ? 8.756   2.917   1.738   1.00 0.00 ? 74  LEU A H    7  
ATOM 10064 H HA   . LEU A 1 74  ? 10.170  5.351   0.903   1.00 0.00 ? 74  LEU A HA   7  
ATOM 10065 H HB2  . LEU A 1 74  ? 7.816   3.903   -0.117  1.00 0.00 ? 74  LEU A HB2  7  
ATOM 10066 H HB3  . LEU A 1 74  ? 7.614   5.640   0.003   1.00 0.00 ? 74  LEU A HB3  7  
ATOM 10067 H HG   . LEU A 1 74  ? 9.627   4.102   -1.638  1.00 0.00 ? 74  LEU A HG   7  
ATOM 10068 H HD11 . LEU A 1 74  ? 7.962   4.332   -3.115  1.00 0.00 ? 74  LEU A HD11 7  
ATOM 10069 H HD12 . LEU A 1 74  ? 7.149   5.591   -2.155  1.00 0.00 ? 74  LEU A HD12 7  
ATOM 10070 H HD13 . LEU A 1 74  ? 8.499   6.025   -3.231  1.00 0.00 ? 74  LEU A HD13 7  
ATOM 10071 H HD21 . LEU A 1 74  ? 10.201  6.659   -2.280  1.00 0.00 ? 74  LEU A HD21 7  
ATOM 10072 H HD22 . LEU A 1 74  ? 9.844   6.847   -0.546  1.00 0.00 ? 74  LEU A HD22 7  
ATOM 10073 H HD23 . LEU A 1 74  ? 11.107  5.710   -1.077  1.00 0.00 ? 74  LEU A HD23 7  
ATOM 10074 N N    . SER A 1 75  ? 9.083   6.841   2.538   1.00 0.00 ? 75  SER A N    7  
ATOM 10075 C CA   . SER A 1 75  ? 8.583   7.675   3.618   1.00 0.00 ? 75  SER A CA   7  
ATOM 10076 C C    . SER A 1 75  ? 7.123   8.050   3.356   1.00 0.00 ? 75  SER A C    7  
ATOM 10077 O O    . SER A 1 75  ? 6.730   8.267   2.210   1.00 0.00 ? 75  SER A O    7  
ATOM 10078 C CB   . SER A 1 75  ? 9.434   8.936   3.779   1.00 0.00 ? 75  SER A CB   7  
ATOM 10079 O OG   . SER A 1 75  ? 8.639   10.086  4.056   1.00 0.00 ? 75  SER A OG   7  
ATOM 10080 H H    . SER A 1 75  ? 9.795   7.261   1.975   1.00 0.00 ? 75  SER A H    7  
ATOM 10081 H HA   . SER A 1 75  ? 8.666   7.064   4.516   1.00 0.00 ? 75  SER A HA   7  
ATOM 10082 H HB2  . SER A 1 75  ? 10.151  8.789   4.587   1.00 0.00 ? 75  SER A HB2  7  
ATOM 10083 H HB3  . SER A 1 75  ? 10.010  9.104   2.869   1.00 0.00 ? 75  SER A HB3  7  
ATOM 10084 H HG   . SER A 1 75  ? 8.440   10.576  3.207   1.00 0.00 ? 75  SER A HG   7  
ATOM 10085 N N    . GLN A 1 76  ? 6.359   8.116   4.436   1.00 0.00 ? 76  GLN A N    7  
ATOM 10086 C CA   . GLN A 1 76  ? 4.951   8.462   4.338   1.00 0.00 ? 76  GLN A CA   7  
ATOM 10087 C C    . GLN A 1 76  ? 4.748   9.572   3.305   1.00 0.00 ? 76  GLN A C    7  
ATOM 10088 O O    . GLN A 1 76  ? 3.890   9.462   2.431   1.00 0.00 ? 76  GLN A O    7  
ATOM 10089 C CB   . GLN A 1 76  ? 4.391   8.871   5.701   1.00 0.00 ? 76  GLN A CB   7  
ATOM 10090 C CG   . GLN A 1 76  ? 2.861   8.857   5.691   1.00 0.00 ? 76  GLN A CG   7  
ATOM 10091 C CD   . GLN A 1 76  ? 2.298   9.622   6.890   1.00 0.00 ? 76  GLN A CD   7  
ATOM 10092 O OE1  . GLN A 1 76  ? 2.272   10.842  6.924   1.00 0.00 ? 76  GLN A OE1  7  
ATOM 10093 N NE2  . GLN A 1 76  ? 1.849   8.842   7.869   1.00 0.00 ? 76  GLN A NE2  7  
ATOM 10094 H H    . GLN A 1 76  ? 6.687   7.939   5.364   1.00 0.00 ? 76  GLN A H    7  
ATOM 10095 H HA   . GLN A 1 76  ? 4.453   7.551   4.005   1.00 0.00 ? 76  GLN A HA   7  
ATOM 10096 H HB2  . GLN A 1 76  ? 4.760   8.192   6.469   1.00 0.00 ? 76  GLN A HB2  7  
ATOM 10097 H HB3  . GLN A 1 76  ? 4.747   9.868   5.960   1.00 0.00 ? 76  GLN A HB3  7  
ATOM 10098 H HG2  . GLN A 1 76  ? 2.495   9.302   4.766   1.00 0.00 ? 76  GLN A HG2  7  
ATOM 10099 H HG3  . GLN A 1 76  ? 2.503   7.827   5.712   1.00 0.00 ? 76  GLN A HG3  7  
ATOM 10100 H HE21 . GLN A 1 76  ? 1.899   7.847   7.777   1.00 0.00 ? 76  GLN A HE21 7  
ATOM 10101 H HE22 . GLN A 1 76  ? 1.461   9.249   8.696   1.00 0.00 ? 76  GLN A HE22 7  
ATOM 10102 N N    . GLU A 1 77  ? 5.553   10.616  3.440   1.00 0.00 ? 77  GLU A N    7  
ATOM 10103 C CA   . GLU A 1 77  ? 5.472   11.746  2.530   1.00 0.00 ? 77  GLU A CA   7  
ATOM 10104 C C    . GLU A 1 77  ? 5.598   11.270  1.081   1.00 0.00 ? 77  GLU A C    7  
ATOM 10105 O O    . GLU A 1 77  ? 4.792   11.641  0.230   1.00 0.00 ? 77  GLU A O    7  
ATOM 10106 C CB   . GLU A 1 77  ? 6.538   12.793  2.859   1.00 0.00 ? 77  GLU A CB   7  
ATOM 10107 C CG   . GLU A 1 77  ? 6.281   13.427  4.227   1.00 0.00 ? 77  GLU A CG   7  
ATOM 10108 C CD   . GLU A 1 77  ? 5.748   14.854  4.078   1.00 0.00 ? 77  GLU A CD   7  
ATOM 10109 O OE1  . GLU A 1 77  ? 6.594   15.766  3.957   1.00 0.00 ? 77  GLU A OE1  7  
ATOM 10110 O OE2  . GLU A 1 77  ? 4.506   15.000  4.088   1.00 0.00 ? 77  GLU A OE2  7  
ATOM 10111 H H    . GLU A 1 77  ? 6.248   10.698  4.154   1.00 0.00 ? 77  GLU A H    7  
ATOM 10112 H HA   . GLU A 1 77  ? 4.485   12.179  2.692   1.00 0.00 ? 77  GLU A HA   7  
ATOM 10113 H HB2  . GLU A 1 77  ? 7.524   12.328  2.849   1.00 0.00 ? 77  GLU A HB2  7  
ATOM 10114 H HB3  . GLU A 1 77  ? 6.543   13.566  2.090   1.00 0.00 ? 77  GLU A HB3  7  
ATOM 10115 H HG2  . GLU A 1 77  ? 5.563   12.823  4.782   1.00 0.00 ? 77  GLU A HG2  7  
ATOM 10116 H HG3  . GLU A 1 77  ? 7.204   13.439  4.806   1.00 0.00 ? 77  GLU A HG3  7  
ATOM 10117 N N    . ARG A 1 78  ? 6.617   10.456  0.846   1.00 0.00 ? 78  ARG A N    7  
ATOM 10118 C CA   . ARG A 1 78  ? 6.860   9.926   -0.485  1.00 0.00 ? 78  ARG A CA   7  
ATOM 10119 C C    . ARG A 1 78  ? 5.741   8.961   -0.884  1.00 0.00 ? 78  ARG A C    7  
ATOM 10120 O O    . ARG A 1 78  ? 4.973   9.242   -1.802  1.00 0.00 ? 78  ARG A O    7  
ATOM 10121 C CB   . ARG A 1 78  ? 8.202   9.195   -0.550  1.00 0.00 ? 78  ARG A CB   7  
ATOM 10122 C CG   . ARG A 1 78  ? 9.280   10.082  -1.176  1.00 0.00 ? 78  ARG A CG   7  
ATOM 10123 C CD   . ARG A 1 78  ? 9.867   11.045  -0.142  1.00 0.00 ? 78  ARG A CD   7  
ATOM 10124 N NE   . ARG A 1 78  ? 9.411   12.425  -0.419  1.00 0.00 ? 78  ARG A NE   7  
ATOM 10125 C CZ   . ARG A 1 78  ? 10.026  13.533  0.046   1.00 0.00 ? 78  ARG A CZ   7  
ATOM 10126 N NH1  . ARG A 1 78  ? 11.130  13.432  0.816   1.00 0.00 ? 78  ARG A NH1  7  
ATOM 10127 N NH2  . ARG A 1 78  ? 9.531   14.717  -0.264  1.00 0.00 ? 78  ARG A NH2  7  
ATOM 10128 H H    . ARG A 1 78  ? 7.269   10.160  1.545   1.00 0.00 ? 78  ARG A H    7  
ATOM 10129 H HA   . ARG A 1 78  ? 6.874   10.801  -1.135  1.00 0.00 ? 78  ARG A HA   7  
ATOM 10130 H HB2  . ARG A 1 78  ? 8.508   8.898   0.453   1.00 0.00 ? 78  ARG A HB2  7  
ATOM 10131 H HB3  . ARG A 1 78  ? 8.094   8.280   -1.133  1.00 0.00 ? 78  ARG A HB3  7  
ATOM 10132 H HG2  . ARG A 1 78  ? 10.073  9.459   -1.590  1.00 0.00 ? 78  ARG A HG2  7  
ATOM 10133 H HG3  . ARG A 1 78  ? 8.854   10.648  -2.005  1.00 0.00 ? 78  ARG A HG3  7  
ATOM 10134 H HD2  . ARG A 1 78  ? 9.561   10.746  0.860   1.00 0.00 ? 78  ARG A HD2  7  
ATOM 10135 H HD3  . ARG A 1 78  ? 10.956  11.000  -0.169  1.00 0.00 ? 78  ARG A HD3  7  
ATOM 10136 H HE   . ARG A 1 78  ? 8.595   12.544  -0.986  1.00 0.00 ? 78  ARG A HE   7  
ATOM 10137 H HH11 . ARG A 1 78  ? 11.498  12.531  1.046   1.00 0.00 ? 78  ARG A HH11 7  
ATOM 10138 H HH12 . ARG A 1 78  ? 11.579  14.258  1.156   1.00 0.00 ? 78  ARG A HH12 7  
ATOM 10139 H HH21 . ARG A 1 78  ? 9.925   15.584  0.039   1.00 0.00 ? 78  ARG A HH21 7  
ATOM 10140 N N    . ALA A 1 79  ? 5.685   7.844   -0.173  1.00 0.00 ? 79  ALA A N    7  
ATOM 10141 C CA   . ALA A 1 79  ? 4.674   6.837   -0.442  1.00 0.00 ? 79  ALA A CA   7  
ATOM 10142 C C    . ALA A 1 79  ? 3.322   7.521   -0.655  1.00 0.00 ? 79  ALA A C    7  
ATOM 10143 O O    . ALA A 1 79  ? 2.560   7.136   -1.540  1.00 0.00 ? 79  ALA A O    7  
ATOM 10144 C CB   . ALA A 1 79  ? 4.641   5.826   0.707   1.00 0.00 ? 79  ALA A CB   7  
ATOM 10145 H H    . ALA A 1 79  ? 6.314   7.624   0.572   1.00 0.00 ? 79  ALA A H    7  
ATOM 10146 H HA   . ALA A 1 79  ? 4.957   6.318   -1.358  1.00 0.00 ? 79  ALA A HA   7  
ATOM 10147 H HB1  . ALA A 1 79  ? 3.616   5.493   0.869   1.00 0.00 ? 79  ALA A HB1  7  
ATOM 10148 H HB2  . ALA A 1 79  ? 5.266   4.970   0.455   1.00 0.00 ? 79  ALA A HB2  7  
ATOM 10149 H HB3  . ALA A 1 79  ? 5.018   6.297   1.615   1.00 0.00 ? 79  ALA A HB3  7  
ATOM 10150 N N    . ALA A 1 80  ? 3.066   8.524   0.173   1.00 0.00 ? 80  ALA A N    7  
ATOM 10151 C CA   . ALA A 1 80  ? 1.819   9.265   0.086   1.00 0.00 ? 80  ALA A CA   7  
ATOM 10152 C C    . ALA A 1 80  ? 1.743   9.969   -1.270  1.00 0.00 ? 80  ALA A C    7  
ATOM 10153 O O    . ALA A 1 80  ? 0.728   9.885   -1.960  1.00 0.00 ? 80  ALA A O    7  
ATOM 10154 C CB   . ALA A 1 80  ? 1.726   10.245  1.257   1.00 0.00 ? 80  ALA A CB   7  
ATOM 10155 H H    . ALA A 1 80  ? 3.691   8.830   0.890   1.00 0.00 ? 80  ALA A H    7  
ATOM 10156 H HA   . ALA A 1 80  ? 1.001   8.549   0.161   1.00 0.00 ? 80  ALA A HA   7  
ATOM 10157 H HB1  . ALA A 1 80  ? 2.615   10.876  1.276   1.00 0.00 ? 80  ALA A HB1  7  
ATOM 10158 H HB2  . ALA A 1 80  ? 0.840   10.870  1.139   1.00 0.00 ? 80  ALA A HB2  7  
ATOM 10159 H HB3  . ALA A 1 80  ? 1.656   9.689   2.192   1.00 0.00 ? 80  ALA A HB3  7  
ATOM 10160 N N    . GLU A 1 81  ? 2.829   10.647  -1.612  1.00 0.00 ? 81  GLU A N    7  
ATOM 10161 C CA   . GLU A 1 81  ? 2.897   11.364  -2.873  1.00 0.00 ? 81  GLU A CA   7  
ATOM 10162 C C    . GLU A 1 81  ? 2.571   10.425  -4.037  1.00 0.00 ? 81  GLU A C    7  
ATOM 10163 O O    . GLU A 1 81  ? 1.900   10.821  -4.989  1.00 0.00 ? 81  GLU A O    7  
ATOM 10164 C CB   . GLU A 1 81  ? 4.269   12.014  -3.061  1.00 0.00 ? 81  GLU A CB   7  
ATOM 10165 C CG   . GLU A 1 81  ? 4.265   12.970  -4.256  1.00 0.00 ? 81  GLU A CG   7  
ATOM 10166 C CD   . GLU A 1 81  ? 4.469   14.416  -3.802  1.00 0.00 ? 81  GLU A CD   7  
ATOM 10167 O OE1  . GLU A 1 81  ? 5.357   14.623  -2.946  1.00 0.00 ? 81  GLU A OE1  7  
ATOM 10168 O OE2  . GLU A 1 81  ? 3.734   15.284  -4.321  1.00 0.00 ? 81  GLU A OE2  7  
ATOM 10169 H H    . GLU A 1 81  ? 3.650   10.710  -1.045  1.00 0.00 ? 81  GLU A H    7  
ATOM 10170 H HA   . GLU A 1 81  ? 2.139   12.145  -2.804  1.00 0.00 ? 81  GLU A HA   7  
ATOM 10171 H HB2  . GLU A 1 81  ? 4.545   12.558  -2.157  1.00 0.00 ? 81  GLU A HB2  7  
ATOM 10172 H HB3  . GLU A 1 81  ? 5.024   11.242  -3.211  1.00 0.00 ? 81  GLU A HB3  7  
ATOM 10173 H HG2  . GLU A 1 81  ? 5.054   12.689  -4.953  1.00 0.00 ? 81  GLU A HG2  7  
ATOM 10174 H HG3  . GLU A 1 81  ? 3.320   12.883  -4.792  1.00 0.00 ? 81  GLU A HG3  7  
ATOM 10175 N N    . LEU A 1 82  ? 3.062   9.200   -3.921  1.00 0.00 ? 82  LEU A N    7  
ATOM 10176 C CA   . LEU A 1 82  ? 2.832   8.202   -4.952  1.00 0.00 ? 82  LEU A CA   7  
ATOM 10177 C C    . LEU A 1 82  ? 1.360   7.782   -4.929  1.00 0.00 ? 82  LEU A C    7  
ATOM 10178 O O    . LEU A 1 82  ? 0.698   7.775   -5.965  1.00 0.00 ? 82  LEU A O    7  
ATOM 10179 C CB   . LEU A 1 82  ? 3.807   7.033   -4.793  1.00 0.00 ? 82  LEU A CB   7  
ATOM 10180 C CG   . LEU A 1 82  ? 4.736   6.769   -5.980  1.00 0.00 ? 82  LEU A CG   7  
ATOM 10181 C CD1  . LEU A 1 82  ? 6.164   6.490   -5.506  1.00 0.00 ? 82  LEU A CD1  7  
ATOM 10182 C CD2  . LEU A 1 82  ? 4.193   5.643   -6.861  1.00 0.00 ? 82  LEU A CD2  7  
ATOM 10183 H H    . LEU A 1 82  ? 3.607   8.887   -3.144  1.00 0.00 ? 82  LEU A H    7  
ATOM 10184 H HA   . LEU A 1 82  ? 3.043   8.670   -5.913  1.00 0.00 ? 82  LEU A HA   7  
ATOM 10185 H HB2  . LEU A 1 82  ? 4.420   7.215   -3.910  1.00 0.00 ? 82  LEU A HB2  7  
ATOM 10186 H HB3  . LEU A 1 82  ? 3.230   6.129   -4.600  1.00 0.00 ? 82  LEU A HB3  7  
ATOM 10187 H HG   . LEU A 1 82  ? 4.771   7.670   -6.593  1.00 0.00 ? 82  LEU A HG   7  
ATOM 10188 H HD11 . LEU A 1 82  ? 6.403   7.143   -4.667  1.00 0.00 ? 82  LEU A HD11 7  
ATOM 10189 H HD12 . LEU A 1 82  ? 6.245   5.449   -5.192  1.00 0.00 ? 82  LEU A HD12 7  
ATOM 10190 H HD13 . LEU A 1 82  ? 6.860   6.678   -6.323  1.00 0.00 ? 82  LEU A HD13 7  
ATOM 10191 H HD21 . LEU A 1 82  ? 3.878   6.052   -7.821  1.00 0.00 ? 82  LEU A HD21 7  
ATOM 10192 H HD22 . LEU A 1 82  ? 4.974   4.899   -7.022  1.00 0.00 ? 82  LEU A HD22 7  
ATOM 10193 H HD23 . LEU A 1 82  ? 3.341   5.174   -6.368  1.00 0.00 ? 82  LEU A HD23 7  
ATOM 10194 N N    . MET A 1 83  ? 0.893   7.443   -3.737  1.00 0.00 ? 83  MET A N    7  
ATOM 10195 C CA   . MET A 1 83  ? -0.488  7.023   -3.566  1.00 0.00 ? 83  MET A CA   7  
ATOM 10196 C C    . MET A 1 83  ? -1.453  8.156   -3.920  1.00 0.00 ? 83  MET A C    7  
ATOM 10197 O O    . MET A 1 83  ? -2.644  7.923   -4.118  1.00 0.00 ? 83  MET A O    7  
ATOM 10198 C CB   . MET A 1 83  ? -0.715  6.593   -2.116  1.00 0.00 ? 83  MET A CB   7  
ATOM 10199 C CG   . MET A 1 83  ? -0.793  5.069   -2.002  1.00 0.00 ? 83  MET A CG   7  
ATOM 10200 S SD   . MET A 1 83  ? 0.227   4.505   -0.650  1.00 0.00 ? 83  MET A SD   7  
ATOM 10201 C CE   . MET A 1 83  ? -0.628  5.263   0.721   1.00 0.00 ? 83  MET A CE   7  
ATOM 10202 H H    . MET A 1 83  ? 1.439   7.451   -2.899  1.00 0.00 ? 83  MET A H    7  
ATOM 10203 H HA   . MET A 1 83  ? -0.627  6.189   -4.254  1.00 0.00 ? 83  MET A HA   7  
ATOM 10204 H HB2  . MET A 1 83  ? 0.096   6.967   -1.490  1.00 0.00 ? 83  MET A HB2  7  
ATOM 10205 H HB3  . MET A 1 83  ? -1.637  7.037   -1.741  1.00 0.00 ? 83  MET A HB3  7  
ATOM 10206 H HG2  . MET A 1 83  ? -1.826  4.761   -1.841  1.00 0.00 ? 83  MET A HG2  7  
ATOM 10207 H HG3  . MET A 1 83  ? -0.464  4.609   -2.933  1.00 0.00 ? 83  MET A HG3  7  
ATOM 10208 H HE1  . MET A 1 83  ? -1.171  6.140   0.371   1.00 0.00 ? 83  MET A HE1  7  
ATOM 10209 H HE2  . MET A 1 83  ? -1.330  4.549   1.151   1.00 0.00 ? 83  MET A HE2  7  
ATOM 10210 H HE3  . MET A 1 83  ? 0.095   5.563   1.480   1.00 0.00 ? 83  MET A HE3  7  
ATOM 10211 N N    . THR A 1 84  ? -0.903  9.360   -3.989  1.00 0.00 ? 84  THR A N    7  
ATOM 10212 C CA   . THR A 1 84  ? -1.700  10.530  -4.316  1.00 0.00 ? 84  THR A CA   7  
ATOM 10213 C C    . THR A 1 84  ? -2.130  10.489  -5.783  1.00 0.00 ? 84  THR A C    7  
ATOM 10214 O O    . THR A 1 84  ? -3.258  10.106  -6.093  1.00 0.00 ? 84  THR A O    7  
ATOM 10215 C CB   . THR A 1 84  ? -0.884  11.773  -3.956  1.00 0.00 ? 84  THR A CB   7  
ATOM 10216 O OG1  . THR A 1 84  ? -0.722  11.685  -2.543  1.00 0.00 ? 84  THR A OG1  7  
ATOM 10217 C CG2  . THR A 1 84  ? -1.672  13.069  -4.160  1.00 0.00 ? 84  THR A CG2  7  
ATOM 10218 H H    . THR A 1 84  ? 0.067   9.541   -3.826  1.00 0.00 ? 84  THR A H    7  
ATOM 10219 H HA   . THR A 1 84  ? -2.609  10.504  -3.715  1.00 0.00 ? 84  THR A HA   7  
ATOM 10220 H HB   . THR A 1 84  ? 0.054   11.796  -4.509  1.00 0.00 ? 84  THR A HB   7  
ATOM 10221 H HG1  . THR A 1 84  ? -1.616  11.658  -2.097  1.00 0.00 ? 84  THR A HG1  7  
ATOM 10222 H HG21 . THR A 1 84  ? -1.755  13.279  -5.227  1.00 0.00 ? 84  THR A HG21 7  
ATOM 10223 H HG22 . THR A 1 84  ? -2.668  12.960  -3.733  1.00 0.00 ? 84  THR A HG22 7  
ATOM 10224 H HG23 . THR A 1 84  ? -1.153  13.891  -3.667  1.00 0.00 ? 84  THR A HG23 7  
ATOM 10225 N N    . ARG A 1 85  ? -1.210  10.889  -6.648  1.00 0.00 ? 85  ARG A N    7  
ATOM 10226 C CA   . ARG A 1 85  ? -1.480  10.903  -8.076  1.00 0.00 ? 85  ARG A CA   7  
ATOM 10227 C C    . ARG A 1 85  ? -1.576  9.473   -8.612  1.00 0.00 ? 85  ARG A C    7  
ATOM 10228 O O    . ARG A 1 85  ? -0.829  9.093   -9.513  1.00 0.00 ? 85  ARG A O    7  
ATOM 10229 C CB   . ARG A 1 85  ? -0.385  11.654  -8.836  1.00 0.00 ? 85  ARG A CB   7  
ATOM 10230 C CG   . ARG A 1 85  ? -0.471  13.159  -8.577  1.00 0.00 ? 85  ARG A CG   7  
ATOM 10231 C CD   . ARG A 1 85  ? 0.892   13.725  -8.172  1.00 0.00 ? 85  ARG A CD   7  
ATOM 10232 N NE   . ARG A 1 85  ? 0.822   15.200  -8.084  1.00 0.00 ? 85  ARG A NE   7  
ATOM 10233 C CZ   . ARG A 1 85  ? 1.726   15.959  -7.449  1.00 0.00 ? 85  ARG A CZ   7  
ATOM 10234 N NH1  . ARG A 1 85  ? 2.774   15.386  -6.843  1.00 0.00 ? 85  ARG A NH1  7  
ATOM 10235 N NH2  . ARG A 1 85  ? 1.582   17.291  -7.421  1.00 0.00 ? 85  ARG A NH2  7  
ATOM 10236 H H    . ARG A 1 85  ? -0.296  11.199  -6.388  1.00 0.00 ? 85  ARG A H    7  
ATOM 10237 H HA   . ARG A 1 85  ? -2.433  11.423  -8.174  1.00 0.00 ? 85  ARG A HA   7  
ATOM 10238 H HB2  . ARG A 1 85  ? 0.594   11.284  -8.531  1.00 0.00 ? 85  ARG A HB2  7  
ATOM 10239 H HB3  . ARG A 1 85  ? -0.480  11.459  -9.904  1.00 0.00 ? 85  ARG A HB3  7  
ATOM 10240 H HG2  . ARG A 1 85  ? -0.827  13.667  -9.474  1.00 0.00 ? 85  ARG A HG2  7  
ATOM 10241 H HG3  . ARG A 1 85  ? -1.199  13.355  -7.789  1.00 0.00 ? 85  ARG A HG3  7  
ATOM 10242 H HD2  . ARG A 1 85  ? 1.196   13.309  -7.211  1.00 0.00 ? 85  ARG A HD2  7  
ATOM 10243 H HD3  . ARG A 1 85  ? 1.648   13.431  -8.900  1.00 0.00 ? 85  ARG A HD3  7  
ATOM 10244 H HE   . ARG A 1 85  ? 0.052   15.660  -8.526  1.00 0.00 ? 85  ARG A HE   7  
ATOM 10245 H HH11 . ARG A 1 85  ? 2.882   14.392  -6.864  1.00 0.00 ? 85  ARG A HH11 7  
ATOM 10246 H HH12 . ARG A 1 85  ? 3.449   15.952  -6.369  1.00 0.00 ? 85  ARG A HH12 7  
ATOM 10247 H HH21 . ARG A 1 85  ? 0.799   17.719  -7.874  1.00 0.00 ? 85  ARG A HH21 7  
ATOM 10248 H HH22 . ARG A 1 85  ? 2.256   17.857  -6.947  1.00 0.00 ? 85  ARG A HH22 7  
ATOM 10249 N N    . THR A 1 86  ? -2.500  8.720   -8.035  1.00 0.00 ? 86  THR A N    7  
ATOM 10250 C CA   . THR A 1 86  ? -2.703  7.340   -8.444  1.00 0.00 ? 86  THR A CA   7  
ATOM 10251 C C    . THR A 1 86  ? -3.709  7.267   -9.594  1.00 0.00 ? 86  THR A C    7  
ATOM 10252 O O    . THR A 1 86  ? -3.622  6.383   -10.445 1.00 0.00 ? 86  THR A O    7  
ATOM 10253 C CB   . THR A 1 86  ? -3.129  6.540   -7.212  1.00 0.00 ? 86  THR A CB   7  
ATOM 10254 O OG1  . THR A 1 86  ? -3.604  7.529   -6.303  1.00 0.00 ? 86  THR A OG1  7  
ATOM 10255 C CG2  . THR A 1 86  ? -1.941  5.906   -6.485  1.00 0.00 ? 86  THR A CG2  7  
ATOM 10256 H H    . THR A 1 86  ? -3.103  9.036   -7.303  1.00 0.00 ? 86  THR A H    7  
ATOM 10257 H HA   . THR A 1 86  ? -1.757  6.951   -8.821  1.00 0.00 ? 86  THR A HA   7  
ATOM 10258 H HB   . THR A 1 86  ? -3.872  5.786   -7.475  1.00 0.00 ? 86  THR A HB   7  
ATOM 10259 H HG1  . THR A 1 86  ? -4.541  7.789   -6.539  1.00 0.00 ? 86  THR A HG1  7  
ATOM 10260 H HG21 . THR A 1 86  ? -1.582  5.049   -7.055  1.00 0.00 ? 86  THR A HG21 7  
ATOM 10261 H HG22 . THR A 1 86  ? -1.141  6.640   -6.389  1.00 0.00 ? 86  THR A HG22 7  
ATOM 10262 H HG23 . THR A 1 86  ? -2.255  5.577   -5.494  1.00 0.00 ? 86  THR A HG23 7  
ATOM 10263 N N    . SER A 1 87  ? -4.641  8.208   -9.583  1.00 0.00 ? 87  SER A N    7  
ATOM 10264 C CA   . SER A 1 87  ? -5.663  8.262   -10.615 1.00 0.00 ? 87  SER A CA   7  
ATOM 10265 C C    . SER A 1 87  ? -6.785  7.273   -10.292 1.00 0.00 ? 87  SER A C    7  
ATOM 10266 O O    . SER A 1 87  ? -6.745  6.598   -9.265  1.00 0.00 ? 87  SER A O    7  
ATOM 10267 C CB   . SER A 1 87  ? -5.070  7.961   -11.993 1.00 0.00 ? 87  SER A CB   7  
ATOM 10268 O OG   . SER A 1 87  ? -5.498  8.901   -12.975 1.00 0.00 ? 87  SER A OG   7  
ATOM 10269 H H    . SER A 1 87  ? -4.705  8.924   -8.888  1.00 0.00 ? 87  SER A H    7  
ATOM 10270 H HA   . SER A 1 87  ? -6.038  9.285   -10.597 1.00 0.00 ? 87  SER A HA   7  
ATOM 10271 H HB2  . SER A 1 87  ? -3.982  7.972   -11.930 1.00 0.00 ? 87  SER A HB2  7  
ATOM 10272 H HB3  . SER A 1 87  ? -5.362  6.957   -12.301 1.00 0.00 ? 87  SER A HB3  7  
ATOM 10273 H HG   . SER A 1 87  ? -6.490  9.013   -12.932 1.00 0.00 ? 87  SER A HG   7  
ATOM 10274 N N    . SER A 1 88  ? -7.759  7.220   -11.188 1.00 0.00 ? 88  SER A N    7  
ATOM 10275 C CA   . SER A 1 88  ? -8.890  6.325   -11.012 1.00 0.00 ? 88  SER A CA   7  
ATOM 10276 C C    . SER A 1 88  ? -8.422  4.870   -11.081 1.00 0.00 ? 88  SER A C    7  
ATOM 10277 O O    . SER A 1 88  ? -9.239  3.955   -11.166 1.00 0.00 ? 88  SER A O    7  
ATOM 10278 C CB   . SER A 1 88  ? -9.969  6.586   -12.065 1.00 0.00 ? 88  SER A CB   7  
ATOM 10279 O OG   . SER A 1 88  ? -9.455  6.491   -13.390 1.00 0.00 ? 88  SER A OG   7  
ATOM 10280 H H    . SER A 1 88  ? -7.784  7.773   -12.021 1.00 0.00 ? 88  SER A H    7  
ATOM 10281 H HA   . SER A 1 88  ? -9.287  6.553   -10.022 1.00 0.00 ? 88  SER A HA   7  
ATOM 10282 H HB2  . SER A 1 88  ? -10.780 5.869   -11.939 1.00 0.00 ? 88  SER A HB2  7  
ATOM 10283 H HB3  . SER A 1 88  ? -10.394 7.578   -11.911 1.00 0.00 ? 88  SER A HB3  7  
ATOM 10284 H HG   . SER A 1 88  ? -9.808  5.669   -13.837 1.00 0.00 ? 88  SER A HG   7  
ATOM 10285 N N    . VAL A 1 89  ? -7.109  4.702   -11.041 1.00 0.00 ? 89  VAL A N    7  
ATOM 10286 C CA   . VAL A 1 89  ? -6.522  3.374   -11.098 1.00 0.00 ? 89  VAL A CA   7  
ATOM 10287 C C    . VAL A 1 89  ? -5.310  3.316   -10.166 1.00 0.00 ? 89  VAL A C    7  
ATOM 10288 O O    . VAL A 1 89  ? -4.424  4.166   -10.240 1.00 0.00 ? 89  VAL A O    7  
ATOM 10289 C CB   . VAL A 1 89  ? -6.181  3.014   -12.545 1.00 0.00 ? 89  VAL A CB   7  
ATOM 10290 C CG1  . VAL A 1 89  ? -5.540  4.200   -13.269 1.00 0.00 ? 89  VAL A CG1  7  
ATOM 10291 C CG2  . VAL A 1 89  ? -5.277  1.781   -12.605 1.00 0.00 ? 89  VAL A CG2  7  
ATOM 10292 H H    . VAL A 1 89  ? -6.451  5.452   -10.972 1.00 0.00 ? 89  VAL A H    7  
ATOM 10293 H HA   . VAL A 1 89  ? -7.272  2.667   -10.742 1.00 0.00 ? 89  VAL A HA   7  
ATOM 10294 H HB   . VAL A 1 89  ? -7.112  2.772   -13.058 1.00 0.00 ? 89  VAL A HB   7  
ATOM 10295 H HG11 . VAL A 1 89  ? -6.154  5.089   -13.124 1.00 0.00 ? 89  VAL A HG11 7  
ATOM 10296 H HG12 . VAL A 1 89  ? -4.543  4.377   -12.864 1.00 0.00 ? 89  VAL A HG12 7  
ATOM 10297 H HG13 . VAL A 1 89  ? -5.466  3.979   -14.334 1.00 0.00 ? 89  VAL A HG13 7  
ATOM 10298 H HG21 . VAL A 1 89  ? -4.859  1.685   -13.608 1.00 0.00 ? 89  VAL A HG21 7  
ATOM 10299 H HG22 . VAL A 1 89  ? -4.467  1.889   -11.883 1.00 0.00 ? 89  VAL A HG22 7  
ATOM 10300 H HG23 . VAL A 1 89  ? -5.860  0.891   -12.368 1.00 0.00 ? 89  VAL A HG23 7  
ATOM 10301 N N    . VAL A 1 90  ? -5.309  2.304   -9.310  1.00 0.00 ? 90  VAL A N    7  
ATOM 10302 C CA   . VAL A 1 90  ? -4.221  2.125   -8.365  1.00 0.00 ? 90  VAL A CA   7  
ATOM 10303 C C    . VAL A 1 90  ? -3.722  0.680   -8.437  1.00 0.00 ? 90  VAL A C    7  
ATOM 10304 O O    . VAL A 1 90  ? -4.463  -0.253  -8.132  1.00 0.00 ? 90  VAL A O    7  
ATOM 10305 C CB   . VAL A 1 90  ? -4.674  2.531   -6.961  1.00 0.00 ? 90  VAL A CB   7  
ATOM 10306 C CG1  . VAL A 1 90  ? -3.541  3.220   -6.197  1.00 0.00 ? 90  VAL A CG1  7  
ATOM 10307 C CG2  . VAL A 1 90  ? -5.915  3.424   -7.023  1.00 0.00 ? 90  VAL A CG2  7  
ATOM 10308 H H    . VAL A 1 90  ? -6.033  1.617   -9.256  1.00 0.00 ? 90  VAL A H    7  
ATOM 10309 H HA   . VAL A 1 90  ? -3.411  2.791   -8.665  1.00 0.00 ? 90  VAL A HA   7  
ATOM 10310 H HB   . VAL A 1 90  ? -4.940  1.624   -6.419  1.00 0.00 ? 90  VAL A HB   7  
ATOM 10311 H HG11 . VAL A 1 90  ? -3.716  4.295   -6.179  1.00 0.00 ? 90  VAL A HG11 7  
ATOM 10312 H HG12 . VAL A 1 90  ? -3.508  2.840   -5.176  1.00 0.00 ? 90  VAL A HG12 7  
ATOM 10313 H HG13 . VAL A 1 90  ? -2.592  3.014   -6.692  1.00 0.00 ? 90  VAL A HG13 7  
ATOM 10314 H HG21 . VAL A 1 90  ? -6.148  3.791   -6.023  1.00 0.00 ? 90  VAL A HG21 7  
ATOM 10315 H HG22 . VAL A 1 90  ? -5.723  4.268   -7.685  1.00 0.00 ? 90  VAL A HG22 7  
ATOM 10316 H HG23 . VAL A 1 90  ? -6.758  2.847   -7.404  1.00 0.00 ? 90  VAL A HG23 7  
ATOM 10317 N N    . THR A 1 91  ? -2.468  0.540   -8.842  1.00 0.00 ? 91  THR A N    7  
ATOM 10318 C CA   . THR A 1 91  ? -1.861  -0.775  -8.958  1.00 0.00 ? 91  THR A CA   7  
ATOM 10319 C C    . THR A 1 91  ? -0.561  -0.835  -8.155  1.00 0.00 ? 91  THR A C    7  
ATOM 10320 O O    . THR A 1 91  ? 0.473   -0.341  -8.602  1.00 0.00 ? 91  THR A O    7  
ATOM 10321 C CB   . THR A 1 91  ? -1.671  -1.078  -10.446 1.00 0.00 ? 91  THR A CB   7  
ATOM 10322 O OG1  . THR A 1 91  ? -1.553  -2.497  -10.498 1.00 0.00 ? 91  THR A OG1  7  
ATOM 10323 C CG2  . THR A 1 91  ? -0.329  -0.573  -10.979 1.00 0.00 ? 91  THR A CG2  7  
ATOM 10324 H H    . THR A 1 91  ? -1.871  1.304   -9.088  1.00 0.00 ? 91  THR A H    7  
ATOM 10325 H HA   . THR A 1 91  ? -2.541  -1.507  -8.522  1.00 0.00 ? 91  THR A HA   7  
ATOM 10326 H HB   . THR A 1 91  ? -2.498  -0.680  -11.033 1.00 0.00 ? 91  THR A HB   7  
ATOM 10327 H HG1  . THR A 1 91  ? -0.778  -2.797  -9.942  1.00 0.00 ? 91  THR A HG1  7  
ATOM 10328 H HG21 . THR A 1 91  ? -0.142  0.432   -10.600 1.00 0.00 ? 91  THR A HG21 7  
ATOM 10329 H HG22 . THR A 1 91  ? 0.467   -1.240  -10.650 1.00 0.00 ? 91  THR A HG22 7  
ATOM 10330 H HG23 . THR A 1 91  ? -0.357  -0.551  -12.069 1.00 0.00 ? 91  THR A HG23 7  
ATOM 10331 N N    . LEU A 1 92  ? -0.655  -1.445  -6.982  1.00 0.00 ? 92  LEU A N    7  
ATOM 10332 C CA   . LEU A 1 92  ? 0.502   -1.576  -6.112  1.00 0.00 ? 92  LEU A CA   7  
ATOM 10333 C C    . LEU A 1 92  ? 0.625   -3.030  -5.651  1.00 0.00 ? 92  LEU A C    7  
ATOM 10334 O O    . LEU A 1 92  ? -0.360  -3.766  -5.638  1.00 0.00 ? 92  LEU A O    7  
ATOM 10335 C CB   . LEU A 1 92  ? 0.424   -0.570  -4.962  1.00 0.00 ? 92  LEU A CB   7  
ATOM 10336 C CG   . LEU A 1 92  ? -0.982  -0.116  -4.562  1.00 0.00 ? 92  LEU A CG   7  
ATOM 10337 C CD1  . LEU A 1 92  ? -1.629  0.709   -5.676  1.00 0.00 ? 92  LEU A CD1  7  
ATOM 10338 C CD2  . LEU A 1 92  ? -1.848  -1.310  -4.155  1.00 0.00 ? 92  LEU A CD2  7  
ATOM 10339 H H    . LEU A 1 92  ? -1.499  -1.844  -6.626  1.00 0.00 ? 92  LEU A H    7  
ATOM 10340 H HA   . LEU A 1 92  ? 1.384   -1.325  -6.701  1.00 0.00 ? 92  LEU A HA   7  
ATOM 10341 H HB2  . LEU A 1 92  ? 0.904   -1.010  -4.088  1.00 0.00 ? 92  LEU A HB2  7  
ATOM 10342 H HB3  . LEU A 1 92  ? 1.004   0.310   -5.236  1.00 0.00 ? 92  LEU A HB3  7  
ATOM 10343 H HG   . LEU A 1 92  ? -0.896  0.532   -3.690  1.00 0.00 ? 92  LEU A HG   7  
ATOM 10344 H HD11 . LEU A 1 92  ? -1.916  1.685   -5.286  1.00 0.00 ? 92  LEU A HD11 7  
ATOM 10345 H HD12 . LEU A 1 92  ? -0.918  0.839   -6.492  1.00 0.00 ? 92  LEU A HD12 7  
ATOM 10346 H HD13 . LEU A 1 92  ? -2.514  0.190   -6.045  1.00 0.00 ? 92  LEU A HD13 7  
ATOM 10347 H HD21 . LEU A 1 92  ? -2.807  -1.255  -4.671  1.00 0.00 ? 92  LEU A HD21 7  
ATOM 10348 H HD22 . LEU A 1 92  ? -1.342  -2.236  -4.427  1.00 0.00 ? 92  LEU A HD22 7  
ATOM 10349 H HD23 . LEU A 1 92  ? -2.013  -1.288  -3.078  1.00 0.00 ? 92  LEU A HD23 7  
ATOM 10350 N N    . GLU A 1 93  ? 1.843   -3.399  -5.283  1.00 0.00 ? 93  GLU A N    7  
ATOM 10351 C CA   . GLU A 1 93  ? 2.108   -4.751  -4.822  1.00 0.00 ? 93  GLU A CA   7  
ATOM 10352 C C    . GLU A 1 93  ? 2.154   -4.791  -3.293  1.00 0.00 ? 93  GLU A C    7  
ATOM 10353 O O    . GLU A 1 93  ? 3.164   -4.434  -2.690  1.00 0.00 ? 93  GLU A O    7  
ATOM 10354 C CB   . GLU A 1 93  ? 3.406   -5.292  -5.424  1.00 0.00 ? 93  GLU A CB   7  
ATOM 10355 C CG   . GLU A 1 93  ? 3.158   -5.902  -6.805  1.00 0.00 ? 93  GLU A CG   7  
ATOM 10356 C CD   . GLU A 1 93  ? 2.827   -4.817  -7.832  1.00 0.00 ? 93  GLU A CD   7  
ATOM 10357 O OE1  . GLU A 1 93  ? 3.415   -3.721  -7.709  1.00 0.00 ? 93  GLU A OE1  7  
ATOM 10358 O OE2  . GLU A 1 93  ? 1.994   -5.109  -8.717  1.00 0.00 ? 93  GLU A OE2  7  
ATOM 10359 H H    . GLU A 1 93  ? 2.639   -2.794  -5.297  1.00 0.00 ? 93  GLU A H    7  
ATOM 10360 H HA   . GLU A 1 93  ? 1.271   -5.350  -5.183  1.00 0.00 ? 93  GLU A HA   7  
ATOM 10361 H HB2  . GLU A 1 93  ? 4.137   -4.486  -5.504  1.00 0.00 ? 93  GLU A HB2  7  
ATOM 10362 H HB3  . GLU A 1 93  ? 3.833   -6.044  -4.762  1.00 0.00 ? 93  GLU A HB3  7  
ATOM 10363 H HG2  . GLU A 1 93  ? 4.041   -6.454  -7.126  1.00 0.00 ? 93  GLU A HG2  7  
ATOM 10364 H HG3  . GLU A 1 93  ? 2.338   -6.617  -6.749  1.00 0.00 ? 93  GLU A HG3  7  
ATOM 10365 N N    . VAL A 1 94  ? 1.048   -5.230  -2.711  1.00 0.00 ? 94  VAL A N    7  
ATOM 10366 C CA   . VAL A 1 94  ? 0.949   -5.321  -1.264  1.00 0.00 ? 94  VAL A CA   7  
ATOM 10367 C C    . VAL A 1 94  ? 1.149   -6.776  -0.834  1.00 0.00 ? 94  VAL A C    7  
ATOM 10368 O O    . VAL A 1 94  ? 1.178   -7.676  -1.673  1.00 0.00 ? 94  VAL A O    7  
ATOM 10369 C CB   . VAL A 1 94  ? -0.383  -4.736  -0.792  1.00 0.00 ? 94  VAL A CB   7  
ATOM 10370 C CG1  . VAL A 1 94  ? -0.310  -4.322  0.679   1.00 0.00 ? 94  VAL A CG1  7  
ATOM 10371 C CG2  . VAL A 1 94  ? -0.808  -3.558  -1.672  1.00 0.00 ? 94  VAL A CG2  7  
ATOM 10372 H H    . VAL A 1 94  ? 0.230   -5.518  -3.209  1.00 0.00 ? 94  VAL A H    7  
ATOM 10373 H HA   . VAL A 1 94  ? 1.752   -4.717  -0.841  1.00 0.00 ? 94  VAL A HA   7  
ATOM 10374 H HB   . VAL A 1 94  ? -1.142  -5.513  -0.884  1.00 0.00 ? 94  VAL A HB   7  
ATOM 10375 H HG11 . VAL A 1 94  ? -0.920  -4.999  1.277   1.00 0.00 ? 94  VAL A HG11 7  
ATOM 10376 H HG12 . VAL A 1 94  ? 0.724   -4.369  1.019   1.00 0.00 ? 94  VAL A HG12 7  
ATOM 10377 H HG13 . VAL A 1 94  ? -0.683  -3.304  0.789   1.00 0.00 ? 94  VAL A HG13 7  
ATOM 10378 H HG21 . VAL A 1 94  ? -0.082  -2.751  -1.574  1.00 0.00 ? 94  VAL A HG21 7  
ATOM 10379 H HG22 . VAL A 1 94  ? -0.854  -3.881  -2.713  1.00 0.00 ? 94  VAL A HG22 7  
ATOM 10380 H HG23 . VAL A 1 94  ? -1.789  -3.204  -1.357  1.00 0.00 ? 94  VAL A HG23 7  
ATOM 10381 N N    . ALA A 1 95  ? 1.281   -6.961  0.471   1.00 0.00 ? 95  ALA A N    7  
ATOM 10382 C CA   . ALA A 1 95  ? 1.477   -8.291  1.022   1.00 0.00 ? 95  ALA A CA   7  
ATOM 10383 C C    . ALA A 1 95  ? 1.046   -8.299  2.490   1.00 0.00 ? 95  ALA A C    7  
ATOM 10384 O O    . ALA A 1 95  ? 1.106   -7.272  3.164   1.00 0.00 ? 95  ALA A O    7  
ATOM 10385 C CB   . ALA A 1 95  ? 2.937   -8.709  0.840   1.00 0.00 ? 95  ALA A CB   7  
ATOM 10386 H H    . ALA A 1 95  ? 1.256   -6.224  1.146   1.00 0.00 ? 95  ALA A H    7  
ATOM 10387 H HA   . ALA A 1 95  ? 0.843   -8.979  0.462   1.00 0.00 ? 95  ALA A HA   7  
ATOM 10388 H HB1  . ALA A 1 95  ? 3.541   -8.278  1.639   1.00 0.00 ? 95  ALA A HB1  7  
ATOM 10389 H HB2  . ALA A 1 95  ? 3.011   -9.796  0.876   1.00 0.00 ? 95  ALA A HB2  7  
ATOM 10390 H HB3  . ALA A 1 95  ? 3.301   -8.351  -0.123  1.00 0.00 ? 95  ALA A HB3  7  
ATOM 10391 N N    . LYS A 1 96  ? 0.621   -9.470  2.942   1.00 0.00 ? 96  LYS A N    7  
ATOM 10392 C CA   . LYS A 1 96  ? 0.180   -9.625  4.318   1.00 0.00 ? 96  LYS A CA   7  
ATOM 10393 C C    . LYS A 1 96  ? 0.067   -11.114 4.648   1.00 0.00 ? 96  LYS A C    7  
ATOM 10394 O O    . LYS A 1 96  ? 0.843   -11.638 5.447   1.00 0.00 ? 96  LYS A O    7  
ATOM 10395 C CB   . LYS A 1 96  ? -1.112  -8.842  4.558   1.00 0.00 ? 96  LYS A CB   7  
ATOM 10396 C CG   . LYS A 1 96  ? -1.601  -9.019  5.997   1.00 0.00 ? 96  LYS A CG   7  
ATOM 10397 C CD   . LYS A 1 96  ? -3.012  -9.612  6.028   1.00 0.00 ? 96  LYS A CD   7  
ATOM 10398 C CE   . LYS A 1 96  ? -3.996  -8.648  6.693   1.00 0.00 ? 96  LYS A CE   7  
ATOM 10399 N NZ   . LYS A 1 96  ? -4.927  -9.386  7.576   1.00 0.00 ? 96  LYS A NZ   7  
ATOM 10400 H H    . LYS A 1 96  ? 0.575   -10.300 2.388   1.00 0.00 ? 96  LYS A H    7  
ATOM 10401 H HA   . LYS A 1 96  ? 0.946   -9.186  4.958   1.00 0.00 ? 96  LYS A HA   7  
ATOM 10402 H HB2  . LYS A 1 96  ? -0.944  -7.784  4.356   1.00 0.00 ? 96  LYS A HB2  7  
ATOM 10403 H HB3  . LYS A 1 96  ? -1.881  -9.181  3.864   1.00 0.00 ? 96  LYS A HB3  7  
ATOM 10404 H HG2  . LYS A 1 96  ? -0.917  -9.672  6.540   1.00 0.00 ? 96  LYS A HG2  7  
ATOM 10405 H HG3  . LYS A 1 96  ? -1.596  -8.057  6.508   1.00 0.00 ? 96  LYS A HG3  7  
ATOM 10406 H HD2  . LYS A 1 96  ? -3.341  -9.829  5.011   1.00 0.00 ? 96  LYS A HD2  7  
ATOM 10407 H HD3  . LYS A 1 96  ? -3.001  -10.558 6.568   1.00 0.00 ? 96  LYS A HD3  7  
ATOM 10408 H HE2  . LYS A 1 96  ? -3.451  -7.903  7.272   1.00 0.00 ? 96  LYS A HE2  7  
ATOM 10409 H HE3  . LYS A 1 96  ? -4.559  -8.110  5.931   1.00 0.00 ? 96  LYS A HE3  7  
ATOM 10410 H HZ1  . LYS A 1 96  ? -4.403  -9.932  8.231   1.00 0.00 ? 96  LYS A HZ1  7  
ATOM 10411 H HZ2  . LYS A 1 96  ? -5.504  -8.736  8.071   1.00 0.00 ? 96  LYS A HZ2  7  
ATOM 10412 H HZ3  . LYS A 1 96  ? -5.502  -9.990  7.024   1.00 0.00 ? 96  LYS A HZ3  7  
ATOM 10413 N N    . GLN A 1 97  ? -0.905  -11.756 4.017   1.00 0.00 ? 97  GLN A N    7  
ATOM 10414 C CA   . GLN A 1 97  ? -1.130  -13.175 4.233   1.00 0.00 ? 97  GLN A CA   7  
ATOM 10415 C C    . GLN A 1 97  ? -1.476  -13.865 2.912   1.00 0.00 ? 97  GLN A C    7  
ATOM 10416 O O    . GLN A 1 97  ? -1.444  -13.239 1.854   1.00 0.00 ? 97  GLN A O    7  
ATOM 10417 C CB   . GLN A 1 97  ? -2.226  -13.404 5.276   1.00 0.00 ? 97  GLN A CB   7  
ATOM 10418 C CG   . GLN A 1 97  ? -3.599  -13.021 4.720   1.00 0.00 ? 97  GLN A CG   7  
ATOM 10419 C CD   . GLN A 1 97  ? -4.633  -12.909 5.843   1.00 0.00 ? 97  GLN A CD   7  
ATOM 10420 O OE1  . GLN A 1 97  ? -4.417  -13.334 6.966   1.00 0.00 ? 97  GLN A OE1  7  
ATOM 10421 N NE2  . GLN A 1 97  ? -5.765  -12.314 5.478   1.00 0.00 ? 97  GLN A NE2  7  
ATOM 10422 H H    . GLN A 1 97  ? -1.532  -11.322 3.369   1.00 0.00 ? 97  GLN A H    7  
ATOM 10423 H HA   . GLN A 1 97  ? -0.186  -13.562 4.617   1.00 0.00 ? 97  GLN A HA   7  
ATOM 10424 H HB2  . GLN A 1 97  ? -2.231  -14.450 5.579   1.00 0.00 ? 97  GLN A HB2  7  
ATOM 10425 H HB3  . GLN A 1 97  ? -2.013  -12.814 6.168   1.00 0.00 ? 97  GLN A HB3  7  
ATOM 10426 H HG2  . GLN A 1 97  ? -3.529  -12.072 4.189   1.00 0.00 ? 97  GLN A HG2  7  
ATOM 10427 H HG3  . GLN A 1 97  ? -3.923  -13.769 3.996   1.00 0.00 ? 97  GLN A HG3  7  
ATOM 10428 H HE21 . GLN A 1 97  ? -5.878  -11.987 4.540   1.00 0.00 ? 97  GLN A HE21 7  
ATOM 10429 H HE22 . GLN A 1 97  ? -6.503  -12.193 6.142   1.00 0.00 ? 97  GLN A HE22 7  
ATOM 10430 N N    . GLY A 1 98  ? -1.800  -15.145 3.018   1.00 0.00 ? 98  GLY A N    7  
ATOM 10431 C CA   . GLY A 1 98  ? -2.152  -15.927 1.845   1.00 0.00 ? 98  GLY A CA   7  
ATOM 10432 C C    . GLY A 1 98  ? -3.671  -16.046 1.701   1.00 0.00 ? 98  GLY A C    7  
ATOM 10433 O O    . GLY A 1 98  ? -4.375  -16.280 2.682   1.00 0.00 ? 98  GLY A O    7  
ATOM 10434 H H    . GLY A 1 98  ? -1.824  -15.647 3.883   1.00 0.00 ? 98  GLY A H    7  
ATOM 10435 H HA2  . GLY A 1 98  ? -1.735  -15.460 0.953   1.00 0.00 ? 98  GLY A HA2  7  
ATOM 10436 H HA3  . GLY A 1 98  ? -1.712  -16.921 1.920   1.00 0.00 ? 98  GLY A HA3  7  
ATOM 10437 N N    . ALA A 1 99  ? -4.132  -15.879 0.470   1.00 0.00 ? 99  ALA A N    7  
ATOM 10438 C CA   . ALA A 1 99  ? -5.554  -15.965 0.185   1.00 0.00 ? 99  ALA A CA   7  
ATOM 10439 C C    . ALA A 1 99  ? -5.795  -15.638 -1.290  1.00 0.00 ? 99  ALA A C    7  
ATOM 10440 O O    . ALA A 1 99  ? -5.592  -14.503 -1.719  1.00 0.00 ? 99  ALA A O    7  
ATOM 10441 C CB   . ALA A 1 99  ? -6.320  -15.029 1.122   1.00 0.00 ? 99  ALA A CB   7  
ATOM 10442 H H    . ALA A 1 99  ? -3.552  -15.689 -0.323  1.00 0.00 ? 99  ALA A H    7  
ATOM 10443 H HA   . ALA A 1 99  ? -5.870  -16.990 0.377   1.00 0.00 ? 99  ALA A HA   7  
ATOM 10444 H HB1  . ALA A 1 99  ? -6.749  -15.607 1.941   1.00 0.00 ? 99  ALA A HB1  7  
ATOM 10445 H HB2  . ALA A 1 99  ? -5.638  -14.280 1.524   1.00 0.00 ? 99  ALA A HB2  7  
ATOM 10446 H HB3  . ALA A 1 99  ? -7.118  -14.535 0.569   1.00 0.00 ? 99  ALA A HB3  7  
ATOM 10447 N N    . ILE A 1 100 ? -6.223  -16.653 -2.026  1.00 0.00 ? 100 ILE A N    7  
ATOM 10448 C CA   . ILE A 1 100 ? -6.494  -16.487 -3.444  1.00 0.00 ? 100 ILE A CA   7  
ATOM 10449 C C    . ILE A 1 100 ? -7.253  -17.711 -3.960  1.00 0.00 ? 100 ILE A C    7  
ATOM 10450 O O    . ILE A 1 100 ? -7.346  -18.725 -3.270  1.00 0.00 ? 100 ILE A O    7  
ATOM 10451 C CB   . ILE A 1 100 ? -5.199  -16.200 -4.207  1.00 0.00 ? 100 ILE A CB   7  
ATOM 10452 C CG1  . ILE A 1 100 ? -5.494  -15.596 -5.581  1.00 0.00 ? 100 ILE A CG1  7  
ATOM 10453 C CG2  . ILE A 1 100 ? -4.332  -17.457 -4.308  1.00 0.00 ? 100 ILE A CG2  7  
ATOM 10454 C CD1  . ILE A 1 100 ? -4.463  -14.525 -5.942  1.00 0.00 ? 100 ILE A CD1  7  
ATOM 10455 H H    . ILE A 1 100 ? -6.385  -17.573 -1.669  1.00 0.00 ? 100 ILE A H    7  
ATOM 10456 H HA   . ILE A 1 100 ? -7.134  -15.612 -3.554  1.00 0.00 ? 100 ILE A HA   7  
ATOM 10457 H HB   . ILE A 1 100 ? -4.629  -15.460 -3.645  1.00 0.00 ? 100 ILE A HB   7  
ATOM 10458 H HG12 . ILE A 1 100 ? -5.489  -16.381 -6.336  1.00 0.00 ? 100 ILE A HG12 7  
ATOM 10459 H HG13 . ILE A 1 100 ? -6.493  -15.159 -5.583  1.00 0.00 ? 100 ILE A HG13 7  
ATOM 10460 H HG21 . ILE A 1 100 ? -3.317  -17.176 -4.587  1.00 0.00 ? 100 ILE A HG21 7  
ATOM 10461 H HG22 . ILE A 1 100 ? -4.316  -17.966 -3.344  1.00 0.00 ? 100 ILE A HG22 7  
ATOM 10462 H HG23 . ILE A 1 100 ? -4.746  -18.124 -5.064  1.00 0.00 ? 100 ILE A HG23 7  
ATOM 10463 H HD11 . ILE A 1 100 ? -4.970  -13.576 -6.117  1.00 0.00 ? 100 ILE A HD11 7  
ATOM 10464 H HD12 . ILE A 1 100 ? -3.754  -14.412 -5.122  1.00 0.00 ? 100 ILE A HD12 7  
ATOM 10465 H HD13 . ILE A 1 100 ? -3.930  -14.824 -6.845  1.00 0.00 ? 100 ILE A HD13 7  
ATOM 10466 N N    . TYR A 1 101 ? -7.777  -17.576 -5.170  1.00 0.00 ? 101 TYR A N    7  
ATOM 10467 C CA   . TYR A 1 101 ? -8.525  -18.658 -5.787  1.00 0.00 ? 101 TYR A CA   7  
ATOM 10468 C C    . TYR A 1 101 ? -8.280  -18.704 -7.296  1.00 0.00 ? 101 TYR A C    7  
ATOM 10469 O O    . TYR A 1 101 ? -7.738  -17.760 -7.869  1.00 0.00 ? 101 TYR A O    7  
ATOM 10470 C CB   . TYR A 1 101 ? -10.001 -18.349 -5.531  1.00 0.00 ? 101 TYR A CB   7  
ATOM 10471 C CG   . TYR A 1 101 ? -10.967 -19.335 -6.192  1.00 0.00 ? 101 TYR A CG   7  
ATOM 10472 C CD1  . TYR A 1 101 ? -10.777 -20.693 -6.042  1.00 0.00 ? 101 TYR A CD1  7  
ATOM 10473 C CD2  . TYR A 1 101 ? -12.028 -18.865 -6.940  1.00 0.00 ? 101 TYR A CD2  7  
ATOM 10474 C CE1  . TYR A 1 101 ? -11.686 -21.620 -6.664  1.00 0.00 ? 101 TYR A CE1  7  
ATOM 10475 C CE2  . TYR A 1 101 ? -12.937 -19.792 -7.563  1.00 0.00 ? 101 TYR A CE2  7  
ATOM 10476 C CZ   . TYR A 1 101 ? -12.721 -21.124 -7.394  1.00 0.00 ? 101 TYR A CZ   7  
ATOM 10477 O OH   . TYR A 1 101 ? -13.579 -22.000 -7.983  1.00 0.00 ? 101 TYR A OH   7  
ATOM 10478 H H    . TYR A 1 101 ? -7.697  -16.748 -5.725  1.00 0.00 ? 101 TYR A H    7  
ATOM 10479 H HA   . TYR A 1 101 ? -8.189  -19.595 -5.343  1.00 0.00 ? 101 TYR A HA   7  
ATOM 10480 H HB2  . TYR A 1 101 ? -10.181 -18.347 -4.456  1.00 0.00 ? 101 TYR A HB2  7  
ATOM 10481 H HB3  . TYR A 1 101 ? -10.220 -17.344 -5.892  1.00 0.00 ? 101 TYR A HB3  7  
ATOM 10482 H HD1  . TYR A 1 101 ? -9.940  -21.064 -5.451  1.00 0.00 ? 101 TYR A HD1  7  
ATOM 10483 H HD2  . TYR A 1 101 ? -12.177 -17.791 -7.059  1.00 0.00 ? 101 TYR A HD2  7  
ATOM 10484 H HE1  . TYR A 1 101 ? -11.548 -22.696 -6.554  1.00 0.00 ? 101 TYR A HE1  7  
ATOM 10485 H HE2  . TYR A 1 101 ? -13.778 -19.434 -8.156  1.00 0.00 ? 101 TYR A HE2  7  
ATOM 10486 H HH   . TYR A 1 101 ? -13.107 -22.512 -8.700  1.00 0.00 ? 101 TYR A HH   7  
ATOM 10487 N N    . GLY A 1 1   ? 8.721   -12.528 4.408   1.00 0.00 ? 1   GLY A N    8  
ATOM 10488 C CA   . GLY A 1 1   ? 9.611   -12.389 3.267   1.00 0.00 ? 1   GLY A CA   8  
ATOM 10489 C C    . GLY A 1 1   ? 9.155   -11.251 2.352   1.00 0.00 ? 1   GLY A C    8  
ATOM 10490 O O    . GLY A 1 1   ? 8.316   -11.452 1.475   1.00 0.00 ? 1   GLY A O    8  
ATOM 10491 H H1   . GLY A 1 1   ? 8.740   -13.424 4.851   1.00 0.00 ? 1   GLY A H1   8  
ATOM 10492 H HA2  . GLY A 1 1   ? 10.626  -12.198 3.614   1.00 0.00 ? 1   GLY A HA2  8  
ATOM 10493 H HA3  . GLY A 1 1   ? 9.636   -13.324 2.706   1.00 0.00 ? 1   GLY A HA3  8  
ATOM 10494 N N    . PRO A 1 2   ? 9.744   -10.049 2.594   1.00 0.00 ? 2   PRO A N    8  
ATOM 10495 C CA   . PRO A 1 2   ? 9.407   -8.878  1.802   1.00 0.00 ? 2   PRO A CA   8  
ATOM 10496 C C    . PRO A 1 2   ? 10.048  -8.951  0.415   1.00 0.00 ? 2   PRO A C    8  
ATOM 10497 O O    . PRO A 1 2   ? 10.902  -8.132  0.078   1.00 0.00 ? 2   PRO A O    8  
ATOM 10498 C CB   . PRO A 1 2   ? 9.898   -7.695  2.621   1.00 0.00 ? 2   PRO A CB   8  
ATOM 10499 C CG   . PRO A 1 2   ? 10.900  -8.262  3.614   1.00 0.00 ? 2   PRO A CG   8  
ATOM 10500 C CD   . PRO A 1 2   ? 10.741  -9.774  3.624   1.00 0.00 ? 2   PRO A CD   8  
ATOM 10501 H HA   . PRO A 1 2   ? 8.421   -8.837  1.646   1.00 0.00 ? 2   PRO A HA   8  
ATOM 10502 H HB2  . PRO A 1 2   ? 10.363  -6.944  1.983   1.00 0.00 ? 2   PRO A HB2  8  
ATOM 10503 H HB3  . PRO A 1 2   ? 9.071   -7.207  3.137   1.00 0.00 ? 2   PRO A HB3  8  
ATOM 10504 H HG2  . PRO A 1 2   ? 11.916  -7.987  3.331   1.00 0.00 ? 2   PRO A HG2  8  
ATOM 10505 H HG3  . PRO A 1 2   ? 10.725  -7.853  4.609   1.00 0.00 ? 2   PRO A HG3  8  
ATOM 10506 H HD2  . PRO A 1 2   ? 11.685  -10.272 3.404   1.00 0.00 ? 2   PRO A HD2  8  
ATOM 10507 H HD3  . PRO A 1 2   ? 10.412  -10.131 4.600   1.00 0.00 ? 2   PRO A HD3  8  
ATOM 10508 N N    . LEU A 1 3   ? 9.612   -9.940  -0.352  1.00 0.00 ? 3   LEU A N    8  
ATOM 10509 C CA   . LEU A 1 3   ? 10.133  -10.131 -1.695  1.00 0.00 ? 3   LEU A CA   8  
ATOM 10510 C C    . LEU A 1 3   ? 9.382   -11.282 -2.369  1.00 0.00 ? 3   LEU A C    8  
ATOM 10511 O O    . LEU A 1 3   ? 9.342   -12.393 -1.844  1.00 0.00 ? 3   LEU A O    8  
ATOM 10512 C CB   . LEU A 1 3   ? 11.650  -10.324 -1.659  1.00 0.00 ? 3   LEU A CB   8  
ATOM 10513 C CG   . LEU A 1 3   ? 12.157  -11.500 -0.822  1.00 0.00 ? 3   LEU A CG   8  
ATOM 10514 C CD1  . LEU A 1 3   ? 13.132  -12.364 -1.624  1.00 0.00 ? 3   LEU A CD1  8  
ATOM 10515 C CD2  . LEU A 1 3   ? 12.771  -11.013 0.493   1.00 0.00 ? 3   LEU A CD2  8  
ATOM 10516 H H    . LEU A 1 3   ? 8.918   -10.602 -0.069  1.00 0.00 ? 3   LEU A H    8  
ATOM 10517 H HA   . LEU A 1 3   ? 9.937   -9.216  -2.254  1.00 0.00 ? 3   LEU A HA   8  
ATOM 10518 H HB2  . LEU A 1 3   ? 12.004  -10.452 -2.682  1.00 0.00 ? 3   LEU A HB2  8  
ATOM 10519 H HB3  . LEU A 1 3   ? 12.104  -9.410  -1.277  1.00 0.00 ? 3   LEU A HB3  8  
ATOM 10520 H HG   . LEU A 1 3   ? 11.305  -12.129 -0.565  1.00 0.00 ? 3   LEU A HG   8  
ATOM 10521 H HD11 . LEU A 1 3   ? 12.715  -12.559 -2.612  1.00 0.00 ? 3   LEU A HD11 8  
ATOM 10522 H HD12 . LEU A 1 3   ? 14.082  -11.841 -1.727  1.00 0.00 ? 3   LEU A HD12 8  
ATOM 10523 H HD13 . LEU A 1 3   ? 13.292  -13.309 -1.105  1.00 0.00 ? 3   LEU A HD13 8  
ATOM 10524 H HD21 . LEU A 1 3   ? 12.650  -11.781 1.257   1.00 0.00 ? 3   LEU A HD21 8  
ATOM 10525 H HD22 . LEU A 1 3   ? 13.832  -10.812 0.345   1.00 0.00 ? 3   LEU A HD22 8  
ATOM 10526 H HD23 . LEU A 1 3   ? 12.269  -10.100 0.812   1.00 0.00 ? 3   LEU A HD23 8  
ATOM 10527 N N    . GLY A 1 4   ? 8.807   -10.975 -3.522  1.00 0.00 ? 4   GLY A N    8  
ATOM 10528 C CA   . GLY A 1 4   ? 8.060   -11.969 -4.273  1.00 0.00 ? 4   GLY A CA   8  
ATOM 10529 C C    . GLY A 1 4   ? 6.772   -11.372 -4.843  1.00 0.00 ? 4   GLY A C    8  
ATOM 10530 O O    . GLY A 1 4   ? 6.512   -10.181 -4.684  1.00 0.00 ? 4   GLY A O    8  
ATOM 10531 H H    . GLY A 1 4   ? 8.844   -10.068 -3.942  1.00 0.00 ? 4   GLY A H    8  
ATOM 10532 H HA2  . GLY A 1 4   ? 8.676   -12.355 -5.085  1.00 0.00 ? 4   GLY A HA2  8  
ATOM 10533 H HA3  . GLY A 1 4   ? 7.819   -12.813 -3.627  1.00 0.00 ? 4   GLY A HA3  8  
ATOM 10534 N N    . SER A 1 5   ? 5.999   -12.228 -5.496  1.00 0.00 ? 5   SER A N    8  
ATOM 10535 C CA   . SER A 1 5   ? 4.744   -11.800 -6.090  1.00 0.00 ? 5   SER A CA   8  
ATOM 10536 C C    . SER A 1 5   ? 3.785   -12.988 -6.199  1.00 0.00 ? 5   SER A C    8  
ATOM 10537 O O    . SER A 1 5   ? 4.219   -14.132 -6.323  1.00 0.00 ? 5   SER A O    8  
ATOM 10538 C CB   . SER A 1 5   ? 4.972   -11.174 -7.467  1.00 0.00 ? 5   SER A CB   8  
ATOM 10539 O OG   . SER A 1 5   ? 5.092   -12.160 -8.489  1.00 0.00 ? 5   SER A OG   8  
ATOM 10540 H H    . SER A 1 5   ? 6.218   -13.196 -5.621  1.00 0.00 ? 5   SER A H    8  
ATOM 10541 H HA   . SER A 1 5   ? 4.345   -11.047 -5.411  1.00 0.00 ? 5   SER A HA   8  
ATOM 10542 H HB2  . SER A 1 5   ? 4.143   -10.507 -7.703  1.00 0.00 ? 5   SER A HB2  8  
ATOM 10543 H HB3  . SER A 1 5   ? 5.875   -10.565 -7.443  1.00 0.00 ? 5   SER A HB3  8  
ATOM 10544 H HG   . SER A 1 5   ? 5.396   -13.027 -8.094  1.00 0.00 ? 5   SER A HG   8  
ATOM 10545 N N    . LEU A 1 6   ? 2.498   -12.675 -6.148  1.00 0.00 ? 6   LEU A N    8  
ATOM 10546 C CA   . LEU A 1 6   ? 1.474   -13.701 -6.240  1.00 0.00 ? 6   LEU A CA   8  
ATOM 10547 C C    . LEU A 1 6   ? 0.397   -13.254 -7.229  1.00 0.00 ? 6   LEU A C    8  
ATOM 10548 O O    . LEU A 1 6   ? 0.442   -12.135 -7.738  1.00 0.00 ? 6   LEU A O    8  
ATOM 10549 C CB   . LEU A 1 6   ? 0.931   -14.041 -4.850  1.00 0.00 ? 6   LEU A CB   8  
ATOM 10550 C CG   . LEU A 1 6   ? 1.141   -15.482 -4.382  1.00 0.00 ? 6   LEU A CG   8  
ATOM 10551 C CD1  . LEU A 1 6   ? 0.410   -16.468 -5.295  1.00 0.00 ? 6   LEU A CD1  8  
ATOM 10552 C CD2  . LEU A 1 6   ? 2.631   -15.808 -4.262  1.00 0.00 ? 6   LEU A CD2  8  
ATOM 10553 H H    . LEU A 1 6   ? 2.153   -11.742 -6.047  1.00 0.00 ? 6   LEU A H    8  
ATOM 10554 H HA   . LEU A 1 6   ? 1.949   -14.602 -6.629  1.00 0.00 ? 6   LEU A HA   8  
ATOM 10555 H HB2  . LEU A 1 6   ? 1.396   -13.373 -4.126  1.00 0.00 ? 6   LEU A HB2  8  
ATOM 10556 H HB3  . LEU A 1 6   ? -0.138  -13.828 -4.838  1.00 0.00 ? 6   LEU A HB3  8  
ATOM 10557 H HG   . LEU A 1 6   ? 0.708   -15.584 -3.386  1.00 0.00 ? 6   LEU A HG   8  
ATOM 10558 H HD11 . LEU A 1 6   ? 0.495   -17.475 -4.885  1.00 0.00 ? 6   LEU A HD11 8  
ATOM 10559 H HD12 . LEU A 1 6   ? -0.642  -16.191 -5.361  1.00 0.00 ? 6   LEU A HD12 8  
ATOM 10560 H HD13 . LEU A 1 6   ? 0.856   -16.441 -6.289  1.00 0.00 ? 6   LEU A HD13 8  
ATOM 10561 H HD21 . LEU A 1 6   ? 3.068   -15.881 -5.258  1.00 0.00 ? 6   LEU A HD21 8  
ATOM 10562 H HD22 . LEU A 1 6   ? 3.132   -15.018 -3.703  1.00 0.00 ? 6   LEU A HD22 8  
ATOM 10563 H HD23 . LEU A 1 6   ? 2.755   -16.757 -3.741  1.00 0.00 ? 6   LEU A HD23 8  
ATOM 10564 N N    . ARG A 1 7   ? -0.548  -14.151 -7.472  1.00 0.00 ? 7   ARG A N    8  
ATOM 10565 C CA   . ARG A 1 7   ? -1.635  -13.863 -8.392  1.00 0.00 ? 7   ARG A CA   8  
ATOM 10566 C C    . ARG A 1 7   ? -2.935  -14.495 -7.891  1.00 0.00 ? 7   ARG A C    8  
ATOM 10567 O O    . ARG A 1 7   ? -3.157  -15.691 -8.069  1.00 0.00 ? 7   ARG A O    8  
ATOM 10568 C CB   . ARG A 1 7   ? -1.326  -14.393 -9.794  1.00 0.00 ? 7   ARG A CB   8  
ATOM 10569 C CG   . ARG A 1 7   ? -1.928  -13.485 -10.868 1.00 0.00 ? 7   ARG A CG   8  
ATOM 10570 C CD   . ARG A 1 7   ? -0.837  -12.904 -11.770 1.00 0.00 ? 7   ARG A CD   8  
ATOM 10571 N NE   . ARG A 1 7   ? -0.786  -13.649 -13.047 1.00 0.00 ? 7   ARG A NE   8  
ATOM 10572 C CZ   . ARG A 1 7   ? -1.625  -13.442 -14.072 1.00 0.00 ? 7   ARG A CZ   8  
ATOM 10573 N NH1  . ARG A 1 7   ? -2.584  -12.512 -13.975 1.00 0.00 ? 7   ARG A NH1  8  
ATOM 10574 N NH2  . ARG A 1 7   ? -1.504  -14.166 -15.193 1.00 0.00 ? 7   ARG A NH2  8  
ATOM 10575 H H    . ARG A 1 7   ? -0.577  -15.059 -7.054  1.00 0.00 ? 7   ARG A H    8  
ATOM 10576 H HA   . ARG A 1 7   ? -1.707  -12.776 -8.406  1.00 0.00 ? 7   ARG A HA   8  
ATOM 10577 H HB2  . ARG A 1 7   ? -0.247  -14.459 -9.932  1.00 0.00 ? 7   ARG A HB2  8  
ATOM 10578 H HB3  . ARG A 1 7   ? -1.723  -15.402 -9.901  1.00 0.00 ? 7   ARG A HB3  8  
ATOM 10579 H HG2  . ARG A 1 7   ? -2.640  -14.051 -11.470 1.00 0.00 ? 7   ARG A HG2  8  
ATOM 10580 H HG3  . ARG A 1 7   ? -2.484  -12.675 -10.395 1.00 0.00 ? 7   ARG A HG3  8  
ATOM 10581 H HD2  . ARG A 1 7   ? -1.036  -11.850 -11.962 1.00 0.00 ? 7   ARG A HD2  8  
ATOM 10582 H HD3  . ARG A 1 7   ? 0.129   -12.960 -11.268 1.00 0.00 ? 7   ARG A HD3  8  
ATOM 10583 H HE   . ARG A 1 7   ? -0.082  -14.351 -13.153 1.00 0.00 ? 7   ARG A HE   8  
ATOM 10584 H HH11 . ARG A 1 7   ? -2.674  -11.972 -13.138 1.00 0.00 ? 7   ARG A HH11 8  
ATOM 10585 H HH12 . ARG A 1 7   ? -3.210  -12.358 -14.739 1.00 0.00 ? 7   ARG A HH12 8  
ATOM 10586 H HH21 . ARG A 1 7   ? -0.788  -14.861 -15.265 1.00 0.00 ? 7   ARG A HH21 8  
ATOM 10587 H HH22 . ARG A 1 7   ? -2.130  -14.012 -15.958 1.00 0.00 ? 7   ARG A HH22 8  
ATOM 10588 N N    . LYS A 1 8   ? -3.761  -13.662 -7.274  1.00 0.00 ? 8   LYS A N    8  
ATOM 10589 C CA   . LYS A 1 8   ? -5.033  -14.123 -6.746  1.00 0.00 ? 8   LYS A CA   8  
ATOM 10590 C C    . LYS A 1 8   ? -5.802  -12.934 -6.166  1.00 0.00 ? 8   LYS A C    8  
ATOM 10591 O O    . LYS A 1 8   ? -7.017  -12.837 -6.330  1.00 0.00 ? 8   LYS A O    8  
ATOM 10592 C CB   . LYS A 1 8   ? -4.818  -15.262 -5.747  1.00 0.00 ? 8   LYS A CB   8  
ATOM 10593 C CG   . LYS A 1 8   ? -5.498  -16.547 -6.225  1.00 0.00 ? 8   LYS A CG   8  
ATOM 10594 C CD   . LYS A 1 8   ? -4.804  -17.782 -5.648  1.00 0.00 ? 8   LYS A CD   8  
ATOM 10595 C CE   . LYS A 1 8   ? -5.393  -19.066 -6.235  1.00 0.00 ? 8   LYS A CE   8  
ATOM 10596 N NZ   . LYS A 1 8   ? -5.782  -19.999 -5.154  1.00 0.00 ? 8   LYS A NZ   8  
ATOM 10597 H H    . LYS A 1 8   ? -3.573  -12.690 -7.134  1.00 0.00 ? 8   LYS A H    8  
ATOM 10598 H HA   . LYS A 1 8   ? -5.605  -14.530 -7.581  1.00 0.00 ? 8   LYS A HA   8  
ATOM 10599 H HB2  . LYS A 1 8   ? -3.750  -15.439 -5.617  1.00 0.00 ? 8   LYS A HB2  8  
ATOM 10600 H HB3  . LYS A 1 8   ? -5.214  -14.976 -4.773  1.00 0.00 ? 8   LYS A HB3  8  
ATOM 10601 H HG2  . LYS A 1 8   ? -6.546  -16.540 -5.924  1.00 0.00 ? 8   LYS A HG2  8  
ATOM 10602 H HG3  . LYS A 1 8   ? -5.479  -16.589 -7.314  1.00 0.00 ? 8   LYS A HG3  8  
ATOM 10603 H HD2  . LYS A 1 8   ? -3.736  -17.737 -5.862  1.00 0.00 ? 8   LYS A HD2  8  
ATOM 10604 H HD3  . LYS A 1 8   ? -4.911  -17.791 -4.563  1.00 0.00 ? 8   LYS A HD3  8  
ATOM 10605 H HE2  . LYS A 1 8   ? -6.263  -18.827 -6.847  1.00 0.00 ? 8   LYS A HE2  8  
ATOM 10606 H HE3  . LYS A 1 8   ? -4.664  -19.542 -6.890  1.00 0.00 ? 8   LYS A HE3  8  
ATOM 10607 H HZ1  . LYS A 1 8   ? -4.959  -20.390 -4.739  1.00 0.00 ? 8   LYS A HZ1  8  
ATOM 10608 H HZ2  . LYS A 1 8   ? -6.303  -19.505 -4.458  1.00 0.00 ? 8   LYS A HZ2  8  
ATOM 10609 H HZ3  . LYS A 1 8   ? -6.344  -20.734 -5.534  1.00 0.00 ? 8   LYS A HZ3  8  
ATOM 10610 N N    . GLU A 1 9   ? -5.061  -12.060 -5.501  1.00 0.00 ? 9   GLU A N    8  
ATOM 10611 C CA   . GLU A 1 9   ? -5.658  -10.881 -4.896  1.00 0.00 ? 9   GLU A CA   8  
ATOM 10612 C C    . GLU A 1 9   ? -4.624  -10.140 -4.046  1.00 0.00 ? 9   GLU A C    8  
ATOM 10613 O O    . GLU A 1 9   ? -4.374  -8.955  -4.259  1.00 0.00 ? 9   GLU A O    8  
ATOM 10614 C CB   . GLU A 1 9   ? -6.887  -11.254 -4.065  1.00 0.00 ? 9   GLU A CB   8  
ATOM 10615 C CG   . GLU A 1 9   ? -8.159  -10.655 -4.668  1.00 0.00 ? 9   GLU A CG   8  
ATOM 10616 C CD   . GLU A 1 9   ? -8.204  -9.139  -4.459  1.00 0.00 ? 9   GLU A CD   8  
ATOM 10617 O OE1  . GLU A 1 9   ? -8.447  -8.733  -3.302  1.00 0.00 ? 9   GLU A OE1  8  
ATOM 10618 O OE2  . GLU A 1 9   ? -7.994  -8.422  -5.461  1.00 0.00 ? 9   GLU A OE2  8  
ATOM 10619 H H    . GLU A 1 9   ? -4.073  -12.146 -5.373  1.00 0.00 ? 9   GLU A H    8  
ATOM 10620 H HA   . GLU A 1 9   ? -5.969  -10.253 -5.731  1.00 0.00 ? 9   GLU A HA   8  
ATOM 10621 H HB2  . GLU A 1 9   ? -6.980  -12.338 -4.014  1.00 0.00 ? 9   GLU A HB2  8  
ATOM 10622 H HB3  . GLU A 1 9   ? -6.761  -10.896 -3.043  1.00 0.00 ? 9   GLU A HB3  8  
ATOM 10623 H HG2  . GLU A 1 9   ? -8.202  -10.880 -5.733  1.00 0.00 ? 9   GLU A HG2  8  
ATOM 10624 H HG3  . GLU A 1 9   ? -9.034  -11.114 -4.209  1.00 0.00 ? 9   GLU A HG3  8  
ATOM 10625 N N    . PRO A 1 10  ? -4.036  -10.889 -3.075  1.00 0.00 ? 10  PRO A N    8  
ATOM 10626 C CA   . PRO A 1 10  ? -3.035  -10.316 -2.191  1.00 0.00 ? 10  PRO A CA   8  
ATOM 10627 C C    . PRO A 1 10  ? -1.699  -10.143 -2.915  1.00 0.00 ? 10  PRO A C    8  
ATOM 10628 O O    . PRO A 1 10  ? -1.512  -10.663 -4.014  1.00 0.00 ? 10  PRO A O    8  
ATOM 10629 C CB   . PRO A 1 10  ? -2.953  -11.275 -1.015  1.00 0.00 ? 10  PRO A CB   8  
ATOM 10630 C CG   . PRO A 1 10  ? -3.565  -12.580 -1.498  1.00 0.00 ? 10  PRO A CG   8  
ATOM 10631 C CD   . PRO A 1 10  ? -4.307  -12.296 -2.794  1.00 0.00 ? 10  PRO A CD   8  
ATOM 10632 H HA   . PRO A 1 10  ? -3.311  -9.399  -1.903  1.00 0.00 ? 10  PRO A HA   8  
ATOM 10633 H HB2  . PRO A 1 10  ? -1.920  -11.421 -0.701  1.00 0.00 ? 10  PRO A HB2  8  
ATOM 10634 H HB3  . PRO A 1 10  ? -3.496  -10.885 -0.154  1.00 0.00 ? 10  PRO A HB3  8  
ATOM 10635 H HG2  . PRO A 1 10  ? -2.789  -13.329 -1.659  1.00 0.00 ? 10  PRO A HG2  8  
ATOM 10636 H HG3  . PRO A 1 10  ? -4.246  -12.984 -0.749  1.00 0.00 ? 10  PRO A HG3  8  
ATOM 10637 H HD2  . PRO A 1 10  ? -3.954  -12.936 -3.602  1.00 0.00 ? 10  PRO A HD2  8  
ATOM 10638 H HD3  . PRO A 1 10  ? -5.376  -12.479 -2.686  1.00 0.00 ? 10  PRO A HD3  8  
ATOM 10639 N N    . GLU A 1 11  ? -0.803  -9.410  -2.270  1.00 0.00 ? 11  GLU A N    8  
ATOM 10640 C CA   . GLU A 1 11  ? 0.511   -9.162  -2.839  1.00 0.00 ? 11  GLU A CA   8  
ATOM 10641 C C    . GLU A 1 11  ? 0.439   -8.032  -3.868  1.00 0.00 ? 11  GLU A C    8  
ATOM 10642 O O    . GLU A 1 11  ? 1.125   -7.020  -3.733  1.00 0.00 ? 11  GLU A O    8  
ATOM 10643 C CB   . GLU A 1 11  ? 1.088   -10.435 -3.462  1.00 0.00 ? 11  GLU A CB   8  
ATOM 10644 C CG   . GLU A 1 11  ? 2.537   -10.653 -3.020  1.00 0.00 ? 11  GLU A CG   8  
ATOM 10645 C CD   . GLU A 1 11  ? 2.597   -11.325 -1.647  1.00 0.00 ? 11  GLU A CD   8  
ATOM 10646 O OE1  . GLU A 1 11  ? 2.510   -12.572 -1.622  1.00 0.00 ? 11  GLU A OE1  8  
ATOM 10647 O OE2  . GLU A 1 11  ? 2.728   -10.578 -0.654  1.00 0.00 ? 11  GLU A OE2  8  
ATOM 10648 H H    . GLU A 1 11  ? -0.962  -8.991  -1.376  1.00 0.00 ? 11  GLU A H    8  
ATOM 10649 H HA   . GLU A 1 11  ? 1.138   -8.859  -2.000  1.00 0.00 ? 11  GLU A HA   8  
ATOM 10650 H HB2  . GLU A 1 11  ? 0.483   -11.293 -3.170  1.00 0.00 ? 11  GLU A HB2  8  
ATOM 10651 H HB3  . GLU A 1 11  ? 1.042   -10.366 -4.548  1.00 0.00 ? 11  GLU A HB3  8  
ATOM 10652 H HG2  . GLU A 1 11  ? 3.056   -11.269 -3.754  1.00 0.00 ? 11  GLU A HG2  8  
ATOM 10653 H HG3  . GLU A 1 11  ? 3.057   -9.696  -2.983  1.00 0.00 ? 11  GLU A HG3  8  
ATOM 10654 N N    . ILE A 1 12  ? -0.398  -8.243  -4.873  1.00 0.00 ? 12  ILE A N    8  
ATOM 10655 C CA   . ILE A 1 12  ? -0.569  -7.255  -5.925  1.00 0.00 ? 12  ILE A CA   8  
ATOM 10656 C C    . ILE A 1 12  ? -2.047  -6.872  -6.024  1.00 0.00 ? 12  ILE A C    8  
ATOM 10657 O O    . ILE A 1 12  ? -2.846  -7.609  -6.600  1.00 0.00 ? 12  ILE A O    8  
ATOM 10658 C CB   . ILE A 1 12  ? 0.024   -7.765  -7.240  1.00 0.00 ? 12  ILE A CB   8  
ATOM 10659 C CG1  . ILE A 1 12  ? -0.427  -6.898  -8.417  1.00 0.00 ? 12  ILE A CG1  8  
ATOM 10660 C CG2  . ILE A 1 12  ? -0.310  -9.242  -7.456  1.00 0.00 ? 12  ILE A CG2  8  
ATOM 10661 C CD1  . ILE A 1 12  ? 0.677   -6.785  -9.471  1.00 0.00 ? 12  ILE A CD1  8  
ATOM 10662 H H    . ILE A 1 12  ? -0.953  -9.069  -4.976  1.00 0.00 ? 12  ILE A H    8  
ATOM 10663 H HA   . ILE A 1 12  ? -0.001  -6.370  -5.637  1.00 0.00 ? 12  ILE A HA   8  
ATOM 10664 H HB   . ILE A 1 12  ? 1.109   -7.686  -7.179  1.00 0.00 ? 12  ILE A HB   8  
ATOM 10665 H HG12 . ILE A 1 12  ? -1.322  -7.327  -8.868  1.00 0.00 ? 12  ILE A HG12 8  
ATOM 10666 H HG13 . ILE A 1 12  ? -0.696  -5.904  -8.059  1.00 0.00 ? 12  ILE A HG13 8  
ATOM 10667 H HG21 . ILE A 1 12  ? -0.005  -9.541  -8.459  1.00 0.00 ? 12  ILE A HG21 8  
ATOM 10668 H HG22 . ILE A 1 12  ? 0.221   -9.846  -6.720  1.00 0.00 ? 12  ILE A HG22 8  
ATOM 10669 H HG23 . ILE A 1 12  ? -1.384  -9.392  -7.343  1.00 0.00 ? 12  ILE A HG23 8  
ATOM 10670 H HD11 . ILE A 1 12  ? 1.648   -6.756  -8.977  1.00 0.00 ? 12  ILE A HD11 8  
ATOM 10671 H HD12 . ILE A 1 12  ? 0.634   -7.648  -10.136 1.00 0.00 ? 12  ILE A HD12 8  
ATOM 10672 H HD13 . ILE A 1 12  ? 0.535   -5.873  -10.049 1.00 0.00 ? 12  ILE A HD13 8  
ATOM 10673 N N    . ILE A 1 13  ? -2.366  -5.720  -5.453  1.00 0.00 ? 13  ILE A N    8  
ATOM 10674 C CA   . ILE A 1 13  ? -3.734  -5.230  -5.469  1.00 0.00 ? 13  ILE A CA   8  
ATOM 10675 C C    . ILE A 1 13  ? -3.860  -4.117  -6.512  1.00 0.00 ? 13  ILE A C    8  
ATOM 10676 O O    . ILE A 1 13  ? -3.031  -3.209  -6.559  1.00 0.00 ? 13  ILE A O    8  
ATOM 10677 C CB   . ILE A 1 13  ? -4.169  -4.809  -4.064  1.00 0.00 ? 13  ILE A CB   8  
ATOM 10678 C CG1  . ILE A 1 13  ? -3.417  -3.556  -3.610  1.00 0.00 ? 13  ILE A CG1  8  
ATOM 10679 C CG2  . ILE A 1 13  ? -4.013  -5.963  -3.073  1.00 0.00 ? 13  ILE A CG2  8  
ATOM 10680 C CD1  . ILE A 1 13  ? -4.139  -2.875  -2.445  1.00 0.00 ? 13  ILE A CD1  8  
ATOM 10681 H H    . ILE A 1 13  ? -1.710  -5.127  -4.986  1.00 0.00 ? 13  ILE A H    8  
ATOM 10682 H HA   . ILE A 1 13  ? -4.374  -6.059  -5.770  1.00 0.00 ? 13  ILE A HA   8  
ATOM 10683 H HB   . ILE A 1 13  ? -5.228  -4.554  -4.097  1.00 0.00 ? 13  ILE A HB   8  
ATOM 10684 H HG12 . ILE A 1 13  ? -2.405  -3.826  -3.307  1.00 0.00 ? 13  ILE A HG12 8  
ATOM 10685 H HG13 . ILE A 1 13  ? -3.326  -2.860  -4.443  1.00 0.00 ? 13  ILE A HG13 8  
ATOM 10686 H HG21 . ILE A 1 13  ? -4.317  -5.633  -2.080  1.00 0.00 ? 13  ILE A HG21 8  
ATOM 10687 H HG22 . ILE A 1 13  ? -4.639  -6.799  -3.386  1.00 0.00 ? 13  ILE A HG22 8  
ATOM 10688 H HG23 . ILE A 1 13  ? -2.970  -6.280  -3.046  1.00 0.00 ? 13  ILE A HG23 8  
ATOM 10689 H HD11 . ILE A 1 13  ? -3.797  -3.305  -1.504  1.00 0.00 ? 13  ILE A HD11 8  
ATOM 10690 H HD12 . ILE A 1 13  ? -3.922  -1.807  -2.458  1.00 0.00 ? 13  ILE A HD12 8  
ATOM 10691 H HD13 . ILE A 1 13  ? -5.214  -3.029  -2.545  1.00 0.00 ? 13  ILE A HD13 8  
ATOM 10692 N N    . THR A 1 14  ? -4.903  -4.224  -7.321  1.00 0.00 ? 14  THR A N    8  
ATOM 10693 C CA   . THR A 1 14  ? -5.148  -3.238  -8.360  1.00 0.00 ? 14  THR A CA   8  
ATOM 10694 C C    . THR A 1 14  ? -6.651  -3.002  -8.528  1.00 0.00 ? 14  THR A C    8  
ATOM 10695 O O    . THR A 1 14  ? -7.389  -3.916  -8.894  1.00 0.00 ? 14  THR A O    8  
ATOM 10696 C CB   . THR A 1 14  ? -4.461  -3.718  -9.640  1.00 0.00 ? 14  THR A CB   8  
ATOM 10697 O OG1  . THR A 1 14  ? -5.339  -4.718  -10.150 1.00 0.00 ? 14  THR A OG1  8  
ATOM 10698 C CG2  . THR A 1 14  ? -3.160  -4.472  -9.358  1.00 0.00 ? 14  THR A CG2  8  
ATOM 10699 H H    . THR A 1 14  ? -5.573  -4.965  -7.276  1.00 0.00 ? 14  THR A H    8  
ATOM 10700 H HA   . THR A 1 14  ? -4.710  -2.291  -8.045  1.00 0.00 ? 14  THR A HA   8  
ATOM 10701 H HB   . THR A 1 14  ? -4.290  -2.888  -10.325 1.00 0.00 ? 14  THR A HB   8  
ATOM 10702 H HG1  . THR A 1 14  ? -6.140  -4.290  -10.567 1.00 0.00 ? 14  THR A HG1  8  
ATOM 10703 H HG21 . THR A 1 14  ? -2.429  -3.788  -8.928  1.00 0.00 ? 14  THR A HG21 8  
ATOM 10704 H HG22 . THR A 1 14  ? -3.355  -5.284  -8.657  1.00 0.00 ? 14  THR A HG22 8  
ATOM 10705 H HG23 . THR A 1 14  ? -2.769  -4.883  -10.289 1.00 0.00 ? 14  THR A HG23 8  
ATOM 10706 N N    . VAL A 1 15  ? -7.059  -1.772  -8.253  1.00 0.00 ? 15  VAL A N    8  
ATOM 10707 C CA   . VAL A 1 15  ? -8.460  -1.406  -8.370  1.00 0.00 ? 15  VAL A CA   8  
ATOM 10708 C C    . VAL A 1 15  ? -8.566  0.020   -8.916  1.00 0.00 ? 15  VAL A C    8  
ATOM 10709 O O    . VAL A 1 15  ? -7.714  0.861   -8.635  1.00 0.00 ? 15  VAL A O    8  
ATOM 10710 C CB   . VAL A 1 15  ? -9.161  -1.583  -7.021  1.00 0.00 ? 15  VAL A CB   8  
ATOM 10711 C CG1  . VAL A 1 15  ? -9.279  -3.064  -6.656  1.00 0.00 ? 15  VAL A CG1  8  
ATOM 10712 C CG2  . VAL A 1 15  ? -8.439  -0.802  -5.921  1.00 0.00 ? 15  VAL A CG2  8  
ATOM 10713 H H    . VAL A 1 15  ? -6.452  -1.035  -7.957  1.00 0.00 ? 15  VAL A H    8  
ATOM 10714 H HA   . VAL A 1 15  ? -8.921  -2.089  -9.082  1.00 0.00 ? 15  VAL A HA   8  
ATOM 10715 H HB   . VAL A 1 15  ? -10.169 -1.179  -7.112  1.00 0.00 ? 15  VAL A HB   8  
ATOM 10716 H HG11 . VAL A 1 15  ? -9.191  -3.669  -7.558  1.00 0.00 ? 15  VAL A HG11 8  
ATOM 10717 H HG12 . VAL A 1 15  ? -8.484  -3.331  -5.960  1.00 0.00 ? 15  VAL A HG12 8  
ATOM 10718 H HG13 . VAL A 1 15  ? -10.247 -3.246  -6.189  1.00 0.00 ? 15  VAL A HG13 8  
ATOM 10719 H HG21 . VAL A 1 15  ? -8.781  -1.149  -4.946  1.00 0.00 ? 15  VAL A HG21 8  
ATOM 10720 H HG22 . VAL A 1 15  ? -7.365  -0.962  -6.008  1.00 0.00 ? 15  VAL A HG22 8  
ATOM 10721 H HG23 . VAL A 1 15  ? -8.658  0.261   -6.026  1.00 0.00 ? 15  VAL A HG23 8  
ATOM 10722 N N    . THR A 1 16  ? -9.620  0.247   -9.686  1.00 0.00 ? 16  THR A N    8  
ATOM 10723 C CA   . THR A 1 16  ? -9.848  1.556   -10.274 1.00 0.00 ? 16  THR A CA   8  
ATOM 10724 C C    . THR A 1 16  ? -10.357 2.536   -9.215  1.00 0.00 ? 16  THR A C    8  
ATOM 10725 O O    . THR A 1 16  ? -11.469 2.387   -8.709  1.00 0.00 ? 16  THR A O    8  
ATOM 10726 C CB   . THR A 1 16  ? -10.808 1.384   -11.453 1.00 0.00 ? 16  THR A CB   8  
ATOM 10727 O OG1  . THR A 1 16  ? -11.977 0.817   -10.869 1.00 0.00 ? 16  THR A OG1  8  
ATOM 10728 C CG2  . THR A 1 16  ? -10.333 0.320   -12.444 1.00 0.00 ? 16  THR A CG2  8  
ATOM 10729 H H    . THR A 1 16  ? -10.308 -0.442  -9.910  1.00 0.00 ? 16  THR A H    8  
ATOM 10730 H HA   . THR A 1 16  ? -8.894  1.942   -10.634 1.00 0.00 ? 16  THR A HA   8  
ATOM 10731 H HB   . THR A 1 16  ? -10.981 2.336   -11.957 1.00 0.00 ? 16  THR A HB   8  
ATOM 10732 H HG1  . THR A 1 16  ? -12.652 0.618   -11.579 1.00 0.00 ? 16  THR A HG1  8  
ATOM 10733 H HG21 . THR A 1 16  ? -10.677 -0.661  -12.117 1.00 0.00 ? 16  THR A HG21 8  
ATOM 10734 H HG22 . THR A 1 16  ? -10.739 0.536   -13.432 1.00 0.00 ? 16  THR A HG22 8  
ATOM 10735 H HG23 . THR A 1 16  ? -9.244  0.326   -12.490 1.00 0.00 ? 16  THR A HG23 8  
ATOM 10736 N N    . LEU A 1 17  ? -9.519  3.515   -8.909  1.00 0.00 ? 17  LEU A N    8  
ATOM 10737 C CA   . LEU A 1 17  ? -9.870  4.519   -7.919  1.00 0.00 ? 17  LEU A CA   8  
ATOM 10738 C C    . LEU A 1 17  ? -11.125 5.264   -8.376  1.00 0.00 ? 17  LEU A C    8  
ATOM 10739 O O    . LEU A 1 17  ? -11.977 4.693   -9.056  1.00 0.00 ? 17  LEU A O    8  
ATOM 10740 C CB   . LEU A 1 17  ? -8.678  5.436   -7.640  1.00 0.00 ? 17  LEU A CB   8  
ATOM 10741 C CG   . LEU A 1 17  ? -8.643  6.089   -6.256  1.00 0.00 ? 17  LEU A CG   8  
ATOM 10742 C CD1  . LEU A 1 17  ? -8.567  7.613   -6.370  1.00 0.00 ? 17  LEU A CD1  8  
ATOM 10743 C CD2  . LEU A 1 17  ? -9.832  5.636   -5.406  1.00 0.00 ? 17  LEU A CD2  8  
ATOM 10744 H H    . LEU A 1 17  ? -8.616  3.629   -9.325  1.00 0.00 ? 17  LEU A H    8  
ATOM 10745 H HA   . LEU A 1 17  ? -10.098 3.996   -6.990  1.00 0.00 ? 17  LEU A HA   8  
ATOM 10746 H HB2  . LEU A 1 17  ? -7.762  4.860   -7.771  1.00 0.00 ? 17  LEU A HB2  8  
ATOM 10747 H HB3  . LEU A 1 17  ? -8.668  6.225   -8.392  1.00 0.00 ? 17  LEU A HB3  8  
ATOM 10748 H HG   . LEU A 1 17  ? -7.738  5.759   -5.745  1.00 0.00 ? 17  LEU A HG   8  
ATOM 10749 H HD11 . LEU A 1 17  ? -7.788  7.988   -5.707  1.00 0.00 ? 17  LEU A HD11 8  
ATOM 10750 H HD12 . LEU A 1 17  ? -8.333  7.889   -7.398  1.00 0.00 ? 17  LEU A HD12 8  
ATOM 10751 H HD13 . LEU A 1 17  ? -9.526  8.046   -6.087  1.00 0.00 ? 17  LEU A HD13 8  
ATOM 10752 H HD21 . LEU A 1 17  ? -10.720 5.561   -6.034  1.00 0.00 ? 17  LEU A HD21 8  
ATOM 10753 H HD22 . LEU A 1 17  ? -9.615  4.662   -4.967  1.00 0.00 ? 17  LEU A HD22 8  
ATOM 10754 H HD23 . LEU A 1 17  ? -10.008 6.362   -4.612  1.00 0.00 ? 17  LEU A HD23 8  
ATOM 10755 N N    . LYS A 1 18  ? -11.200 6.528   -7.986  1.00 0.00 ? 18  LYS A N    8  
ATOM 10756 C CA   . LYS A 1 18  ? -12.337 7.357   -8.348  1.00 0.00 ? 18  LYS A CA   8  
ATOM 10757 C C    . LYS A 1 18  ? -13.607 6.774   -7.724  1.00 0.00 ? 18  LYS A C    8  
ATOM 10758 O O    . LYS A 1 18  ? -14.714 7.209   -8.038  1.00 0.00 ? 18  LYS A O    8  
ATOM 10759 C CB   . LYS A 1 18  ? -12.418 7.522   -9.867  1.00 0.00 ? 18  LYS A CB   8  
ATOM 10760 C CG   . LYS A 1 18  ? -13.269 8.737   -10.242 1.00 0.00 ? 18  LYS A CG   8  
ATOM 10761 C CD   . LYS A 1 18  ? -13.980 8.517   -11.578 1.00 0.00 ? 18  LYS A CD   8  
ATOM 10762 C CE   . LYS A 1 18  ? -15.176 7.576   -11.415 1.00 0.00 ? 18  LYS A CE   8  
ATOM 10763 N NZ   . LYS A 1 18  ? -15.932 7.474   -12.683 1.00 0.00 ? 18  LYS A NZ   8  
ATOM 10764 H H    . LYS A 1 18  ? -10.503 6.984   -7.433  1.00 0.00 ? 18  LYS A H    8  
ATOM 10765 H HA   . LYS A 1 18  ? -12.168 8.347   -7.925  1.00 0.00 ? 18  LYS A HA   8  
ATOM 10766 H HB2  . LYS A 1 18  ? -11.415 7.635   -10.278 1.00 0.00 ? 18  LYS A HB2  8  
ATOM 10767 H HB3  . LYS A 1 18  ? -12.845 6.623   -10.311 1.00 0.00 ? 18  LYS A HB3  8  
ATOM 10768 H HG2  . LYS A 1 18  ? -14.006 8.924   -9.460  1.00 0.00 ? 18  LYS A HG2  8  
ATOM 10769 H HG3  . LYS A 1 18  ? -12.637 9.623   -10.303 1.00 0.00 ? 18  LYS A HG3  8  
ATOM 10770 H HD2  . LYS A 1 18  ? -14.318 9.474   -11.977 1.00 0.00 ? 18  LYS A HD2  8  
ATOM 10771 H HD3  . LYS A 1 18  ? -13.281 8.099   -12.302 1.00 0.00 ? 18  LYS A HD3  8  
ATOM 10772 H HE2  . LYS A 1 18  ? -14.830 6.588   -11.111 1.00 0.00 ? 18  LYS A HE2  8  
ATOM 10773 H HE3  . LYS A 1 18  ? -15.829 7.942   -10.623 1.00 0.00 ? 18  LYS A HE3  8  
ATOM 10774 H HZ1  . LYS A 1 18  ? -16.907 7.609   -12.502 1.00 0.00 ? 18  LYS A HZ1  8  
ATOM 10775 H HZ2  . LYS A 1 18  ? -15.612 8.176   -13.319 1.00 0.00 ? 18  LYS A HZ2  8  
ATOM 10776 H HZ3  . LYS A 1 18  ? -15.790 6.570   -13.084 1.00 0.00 ? 18  LYS A HZ3  8  
ATOM 10777 N N    . LYS A 1 19  ? -13.405 5.797   -6.851  1.00 0.00 ? 19  LYS A N    8  
ATOM 10778 C CA   . LYS A 1 19  ? -14.520 5.150   -6.181  1.00 0.00 ? 19  LYS A CA   8  
ATOM 10779 C C    . LYS A 1 19  ? -15.321 6.198   -5.406  1.00 0.00 ? 19  LYS A C    8  
ATOM 10780 O O    . LYS A 1 19  ? -15.897 7.108   -6.000  1.00 0.00 ? 19  LYS A O    8  
ATOM 10781 C CB   . LYS A 1 19  ? -14.024 3.991   -5.315  1.00 0.00 ? 19  LYS A CB   8  
ATOM 10782 C CG   . LYS A 1 19  ? -13.443 2.870   -6.179  1.00 0.00 ? 19  LYS A CG   8  
ATOM 10783 C CD   . LYS A 1 19  ? -13.865 1.497   -5.653  1.00 0.00 ? 19  LYS A CD   8  
ATOM 10784 C CE   . LYS A 1 19  ? -13.844 0.451   -6.769  1.00 0.00 ? 19  LYS A CE   8  
ATOM 10785 N NZ   . LYS A 1 19  ? -15.143 -0.254  -6.844  1.00 0.00 ? 19  LYS A NZ   8  
ATOM 10786 H H    . LYS A 1 19  ? -12.502 5.449   -6.602  1.00 0.00 ? 19  LYS A H    8  
ATOM 10787 H HA   . LYS A 1 19  ? -15.162 4.725   -6.952  1.00 0.00 ? 19  LYS A HA   8  
ATOM 10788 H HB2  . LYS A 1 19  ? -13.265 4.349   -4.619  1.00 0.00 ? 19  LYS A HB2  8  
ATOM 10789 H HB3  . LYS A 1 19  ? -14.847 3.603   -4.714  1.00 0.00 ? 19  LYS A HB3  8  
ATOM 10790 H HG2  . LYS A 1 19  ? -13.780 2.988   -7.209  1.00 0.00 ? 19  LYS A HG2  8  
ATOM 10791 H HG3  . LYS A 1 19  ? -12.355 2.940   -6.190  1.00 0.00 ? 19  LYS A HG3  8  
ATOM 10792 H HD2  . LYS A 1 19  ? -13.196 1.190   -4.849  1.00 0.00 ? 19  LYS A HD2  8  
ATOM 10793 H HD3  . LYS A 1 19  ? -14.867 1.559   -5.227  1.00 0.00 ? 19  LYS A HD3  8  
ATOM 10794 H HE2  . LYS A 1 19  ? -13.629 0.933   -7.723  1.00 0.00 ? 19  LYS A HE2  8  
ATOM 10795 H HE3  . LYS A 1 19  ? -13.043 -0.267  -6.588  1.00 0.00 ? 19  LYS A HE3  8  
ATOM 10796 H HZ1  . LYS A 1 19  ? -14.984 -1.241  -6.891  1.00 0.00 ? 19  LYS A HZ1  8  
ATOM 10797 H HZ2  . LYS A 1 19  ? -15.685 -0.042  -6.031  1.00 0.00 ? 19  LYS A HZ2  8  
ATOM 10798 H HZ3  . LYS A 1 19  ? -15.637 0.043   -7.661  1.00 0.00 ? 19  LYS A HZ3  8  
ATOM 10799 N N    . GLN A 1 20  ? -15.332 6.035   -4.091  1.00 0.00 ? 20  GLN A N    8  
ATOM 10800 C CA   . GLN A 1 20  ? -16.053 6.956   -3.228  1.00 0.00 ? 20  GLN A CA   8  
ATOM 10801 C C    . GLN A 1 20  ? -15.344 8.311   -3.189  1.00 0.00 ? 20  GLN A C    8  
ATOM 10802 O O    . GLN A 1 20  ? -15.893 9.288   -2.683  1.00 0.00 ? 20  GLN A O    8  
ATOM 10803 C CB   . GLN A 1 20  ? -16.211 6.378   -1.820  1.00 0.00 ? 20  GLN A CB   8  
ATOM 10804 C CG   . GLN A 1 20  ? -17.420 5.443   -1.744  1.00 0.00 ? 20  GLN A CG   8  
ATOM 10805 C CD   . GLN A 1 20  ? -18.110 5.550   -0.383  1.00 0.00 ? 20  GLN A CD   8  
ATOM 10806 O OE1  . GLN A 1 20  ? -19.325 5.521   -0.270  1.00 0.00 ? 20  GLN A OE1  8  
ATOM 10807 N NE2  . GLN A 1 20  ? -17.271 5.675   0.641   1.00 0.00 ? 20  GLN A NE2  8  
ATOM 10808 H H    . GLN A 1 20  ? -14.860 5.292   -3.616  1.00 0.00 ? 20  GLN A H    8  
ATOM 10809 H HA   . GLN A 1 20  ? -17.038 7.066   -3.682  1.00 0.00 ? 20  GLN A HA   8  
ATOM 10810 H HB2  . GLN A 1 20  ? -15.308 5.834   -1.543  1.00 0.00 ? 20  GLN A HB2  8  
ATOM 10811 H HB3  . GLN A 1 20  ? -16.328 7.189   -1.102  1.00 0.00 ? 20  GLN A HB3  8  
ATOM 10812 H HG2  . GLN A 1 20  ? -18.127 5.692   -2.535  1.00 0.00 ? 20  GLN A HG2  8  
ATOM 10813 H HG3  . GLN A 1 20  ? -17.100 4.415   -1.914  1.00 0.00 ? 20  GLN A HG3  8  
ATOM 10814 H HE21 . GLN A 1 20  ? -16.284 5.692   0.480   1.00 0.00 ? 20  GLN A HE21 8  
ATOM 10815 H HE22 . GLN A 1 20  ? -17.627 5.752   1.573   1.00 0.00 ? 20  GLN A HE22 8  
ATOM 10816 N N    . ASN A 1 21  ? -14.134 8.326   -3.728  1.00 0.00 ? 21  ASN A N    8  
ATOM 10817 C CA   . ASN A 1 21  ? -13.344 9.546   -3.761  1.00 0.00 ? 21  ASN A CA   8  
ATOM 10818 C C    . ASN A 1 21  ? -11.865 9.186   -3.918  1.00 0.00 ? 21  ASN A C    8  
ATOM 10819 O O    . ASN A 1 21  ? -11.271 9.432   -4.966  1.00 0.00 ? 21  ASN A O    8  
ATOM 10820 C CB   . ASN A 1 21  ? -13.503 10.339  -2.462  1.00 0.00 ? 21  ASN A CB   8  
ATOM 10821 C CG   . ASN A 1 21  ? -14.404 11.558  -2.672  1.00 0.00 ? 21  ASN A CG   8  
ATOM 10822 O OD1  . ASN A 1 21  ? -14.534 12.086  -3.764  1.00 0.00 ? 21  ASN A OD1  8  
ATOM 10823 N ND2  . ASN A 1 21  ? -15.017 11.974  -1.567  1.00 0.00 ? 21  ASN A ND2  8  
ATOM 10824 H H    . ASN A 1 21  ? -13.694 7.527   -4.138  1.00 0.00 ? 21  ASN A H    8  
ATOM 10825 H HA   . ASN A 1 21  ? -13.728 10.113  -4.609  1.00 0.00 ? 21  ASN A HA   8  
ATOM 10826 H HB2  . ASN A 1 21  ? -13.926 9.698   -1.689  1.00 0.00 ? 21  ASN A HB2  8  
ATOM 10827 H HB3  . ASN A 1 21  ? -12.524 10.663  -2.108  1.00 0.00 ? 21  ASN A HB3  8  
ATOM 10828 H HD21 . ASN A 1 21  ? -14.867 11.495  -0.702  1.00 0.00 ? 21  ASN A HD21 8  
ATOM 10829 H HD22 . ASN A 1 21  ? -15.628 12.765  -1.601  1.00 0.00 ? 21  ASN A HD22 8  
ATOM 10830 N N    . GLY A 1 22  ? -11.314 8.611   -2.859  1.00 0.00 ? 22  GLY A N    8  
ATOM 10831 C CA   . GLY A 1 22  ? -9.916  8.215   -2.866  1.00 0.00 ? 22  GLY A CA   8  
ATOM 10832 C C    . GLY A 1 22  ? -9.751  6.774   -2.380  1.00 0.00 ? 22  GLY A C    8  
ATOM 10833 O O    . GLY A 1 22  ? -10.648 5.950   -2.555  1.00 0.00 ? 22  GLY A O    8  
ATOM 10834 H H    . GLY A 1 22  ? -11.804 8.415   -2.010  1.00 0.00 ? 22  GLY A H    8  
ATOM 10835 H HA2  . GLY A 1 22  ? -9.512  8.311   -3.874  1.00 0.00 ? 22  GLY A HA2  8  
ATOM 10836 H HA3  . GLY A 1 22  ? -9.341  8.886   -2.227  1.00 0.00 ? 22  GLY A HA3  8  
ATOM 10837 N N    . MET A 1 23  ? -8.599  6.514   -1.780  1.00 0.00 ? 23  MET A N    8  
ATOM 10838 C CA   . MET A 1 23  ? -8.306  5.186   -1.267  1.00 0.00 ? 23  MET A CA   8  
ATOM 10839 C C    . MET A 1 23  ? -8.567  5.109   0.239   1.00 0.00 ? 23  MET A C    8  
ATOM 10840 O O    . MET A 1 23  ? -8.556  4.025   0.820   1.00 0.00 ? 23  MET A O    8  
ATOM 10841 C CB   . MET A 1 23  ? -6.842  4.842   -1.549  1.00 0.00 ? 23  MET A CB   8  
ATOM 10842 C CG   . MET A 1 23  ? -5.910  5.934   -1.020  1.00 0.00 ? 23  MET A CG   8  
ATOM 10843 S SD   . MET A 1 23  ? -4.210  5.407   -1.160  1.00 0.00 ? 23  MET A SD   8  
ATOM 10844 C CE   . MET A 1 23  ? -3.962  5.623   -2.914  1.00 0.00 ? 23  MET A CE   8  
ATOM 10845 H H    . MET A 1 23  ? -7.875  7.189   -1.641  1.00 0.00 ? 23  MET A H    8  
ATOM 10846 H HA   . MET A 1 23  ? -8.981  4.513   -1.795  1.00 0.00 ? 23  MET A HA   8  
ATOM 10847 H HB2  . MET A 1 23  ? -6.592  3.889   -1.083  1.00 0.00 ? 23  MET A HB2  8  
ATOM 10848 H HB3  . MET A 1 23  ? -6.693  4.721   -2.622  1.00 0.00 ? 23  MET A HB3  8  
ATOM 10849 H HG2  . MET A 1 23  ? -6.061  6.856   -1.581  1.00 0.00 ? 23  MET A HG2  8  
ATOM 10850 H HG3  . MET A 1 23  ? -6.147  6.152   0.022   1.00 0.00 ? 23  MET A HG3  8  
ATOM 10851 H HE1  . MET A 1 23  ? -2.949  5.319   -3.178  1.00 0.00 ? 23  MET A HE1  8  
ATOM 10852 H HE2  . MET A 1 23  ? -4.679  5.011   -3.461  1.00 0.00 ? 23  MET A HE2  8  
ATOM 10853 H HE3  . MET A 1 23  ? -4.107  6.671   -3.175  1.00 0.00 ? 23  MET A HE3  8  
ATOM 10854 N N    . GLY A 1 24  ? -8.797  6.274   0.827   1.00 0.00 ? 24  GLY A N    8  
ATOM 10855 C CA   . GLY A 1 24  ? -9.061  6.352   2.254   1.00 0.00 ? 24  GLY A CA   8  
ATOM 10856 C C    . GLY A 1 24  ? -8.327  5.243   3.009   1.00 0.00 ? 24  GLY A C    8  
ATOM 10857 O O    . GLY A 1 24  ? -8.956  4.398   3.644   1.00 0.00 ? 24  GLY A O    8  
ATOM 10858 H H    . GLY A 1 24  ? -8.805  7.151   0.347   1.00 0.00 ? 24  GLY A H    8  
ATOM 10859 H HA2  . GLY A 1 24  ? -8.747  7.325   2.632   1.00 0.00 ? 24  GLY A HA2  8  
ATOM 10860 H HA3  . GLY A 1 24  ? -10.133 6.272   2.433   1.00 0.00 ? 24  GLY A HA3  8  
ATOM 10861 N N    . LEU A 1 25  ? -7.006  5.282   2.916   1.00 0.00 ? 25  LEU A N    8  
ATOM 10862 C CA   . LEU A 1 25  ? -6.179  4.290   3.582   1.00 0.00 ? 25  LEU A CA   8  
ATOM 10863 C C    . LEU A 1 25  ? -5.218  4.995   4.542   1.00 0.00 ? 25  LEU A C    8  
ATOM 10864 O O    . LEU A 1 25  ? -4.631  6.019   4.196   1.00 0.00 ? 25  LEU A O    8  
ATOM 10865 C CB   . LEU A 1 25  ? -5.478  3.399   2.555   1.00 0.00 ? 25  LEU A CB   8  
ATOM 10866 C CG   . LEU A 1 25  ? -4.638  2.253   3.124   1.00 0.00 ? 25  LEU A CG   8  
ATOM 10867 C CD1  . LEU A 1 25  ? -4.210  1.286   2.018   1.00 0.00 ? 25  LEU A CD1  8  
ATOM 10868 C CD2  . LEU A 1 25  ? -3.442  2.789   3.911   1.00 0.00 ? 25  LEU A CD2  8  
ATOM 10869 H H    . LEU A 1 25  ? -6.502  5.973   2.398   1.00 0.00 ? 25  LEU A H    8  
ATOM 10870 H HA   . LEU A 1 25  ? -6.842  3.651   4.165   1.00 0.00 ? 25  LEU A HA   8  
ATOM 10871 H HB2  . LEU A 1 25  ? -6.235  2.975   1.895   1.00 0.00 ? 25  LEU A HB2  8  
ATOM 10872 H HB3  . LEU A 1 25  ? -4.833  4.026   1.940   1.00 0.00 ? 25  LEU A HB3  8  
ATOM 10873 H HG   . LEU A 1 25  ? -5.257  1.690   3.822   1.00 0.00 ? 25  LEU A HG   8  
ATOM 10874 H HD11 . LEU A 1 25  ? -3.137  1.107   2.088   1.00 0.00 ? 25  LEU A HD11 8  
ATOM 10875 H HD12 . LEU A 1 25  ? -4.745  0.343   2.132   1.00 0.00 ? 25  LEU A HD12 8  
ATOM 10876 H HD13 . LEU A 1 25  ? -4.443  1.720   1.045   1.00 0.00 ? 25  LEU A HD13 8  
ATOM 10877 H HD21 . LEU A 1 25  ? -3.704  2.860   4.967   1.00 0.00 ? 25  LEU A HD21 8  
ATOM 10878 H HD22 . LEU A 1 25  ? -2.595  2.112   3.792   1.00 0.00 ? 25  LEU A HD22 8  
ATOM 10879 H HD23 . LEU A 1 25  ? -3.173  3.777   3.537   1.00 0.00 ? 25  LEU A HD23 8  
ATOM 10880 N N    . SER A 1 26  ? -5.088  4.419   5.728   1.00 0.00 ? 26  SER A N    8  
ATOM 10881 C CA   . SER A 1 26  ? -4.209  4.980   6.740   1.00 0.00 ? 26  SER A CA   8  
ATOM 10882 C C    . SER A 1 26  ? -2.932  4.143   6.845   1.00 0.00 ? 26  SER A C    8  
ATOM 10883 O O    . SER A 1 26  ? -2.959  3.026   7.359   1.00 0.00 ? 26  SER A O    8  
ATOM 10884 C CB   . SER A 1 26  ? -4.909  5.054   8.098   1.00 0.00 ? 26  SER A CB   8  
ATOM 10885 O OG   . SER A 1 26  ? -4.020  5.459   9.135   1.00 0.00 ? 26  SER A OG   8  
ATOM 10886 H H    . SER A 1 26  ? -5.570  3.587   6.001   1.00 0.00 ? 26  SER A H    8  
ATOM 10887 H HA   . SER A 1 26  ? -3.978  5.988   6.395   1.00 0.00 ? 26  SER A HA   8  
ATOM 10888 H HB2  . SER A 1 26  ? -5.741  5.755   8.039   1.00 0.00 ? 26  SER A HB2  8  
ATOM 10889 H HB3  . SER A 1 26  ? -5.330  4.079   8.342   1.00 0.00 ? 26  SER A HB3  8  
ATOM 10890 H HG   . SER A 1 26  ? -3.556  4.661   9.520   1.00 0.00 ? 26  SER A HG   8  
ATOM 10891 N N    . ILE A 1 27  ? -1.845  4.716   6.350   1.00 0.00 ? 27  ILE A N    8  
ATOM 10892 C CA   . ILE A 1 27  ? -0.561  4.037   6.382   1.00 0.00 ? 27  ILE A CA   8  
ATOM 10893 C C    . ILE A 1 27  ? 0.125   4.315   7.721   1.00 0.00 ? 27  ILE A C    8  
ATOM 10894 O O    . ILE A 1 27  ? -0.352  5.129   8.509   1.00 0.00 ? 27  ILE A O    8  
ATOM 10895 C CB   . ILE A 1 27  ? 0.282   4.427   5.166   1.00 0.00 ? 27  ILE A CB   8  
ATOM 10896 C CG1  . ILE A 1 27  ? 0.729   5.888   5.254   1.00 0.00 ? 27  ILE A CG1  8  
ATOM 10897 C CG2  . ILE A 1 27  ? -0.465  4.134   3.864   1.00 0.00 ? 27  ILE A CG2  8  
ATOM 10898 C CD1  . ILE A 1 27  ? 1.928   6.151   4.341   1.00 0.00 ? 27  ILE A CD1  8  
ATOM 10899 H H    . ILE A 1 27  ? -1.832  5.625   5.933   1.00 0.00 ? 27  ILE A H    8  
ATOM 10900 H HA   . ILE A 1 27  ? -0.755  2.967   6.309   1.00 0.00 ? 27  ILE A HA   8  
ATOM 10901 H HB   . ILE A 1 27  ? 1.184   3.814   5.164   1.00 0.00 ? 27  ILE A HB   8  
ATOM 10902 H HG12 . ILE A 1 27  ? -0.097  6.542   4.973   1.00 0.00 ? 27  ILE A HG12 8  
ATOM 10903 H HG13 . ILE A 1 27  ? 0.991   6.130   6.284   1.00 0.00 ? 27  ILE A HG13 8  
ATOM 10904 H HG21 . ILE A 1 27  ? -1.406  4.684   3.853   1.00 0.00 ? 27  ILE A HG21 8  
ATOM 10905 H HG22 . ILE A 1 27  ? 0.146   4.444   3.016   1.00 0.00 ? 27  ILE A HG22 8  
ATOM 10906 H HG23 . ILE A 1 27  ? -0.669  3.065   3.794   1.00 0.00 ? 27  ILE A HG23 8  
ATOM 10907 H HD11 . ILE A 1 27  ? 2.276   5.208   3.918   1.00 0.00 ? 27  ILE A HD11 8  
ATOM 10908 H HD12 . ILE A 1 27  ? 1.631   6.823   3.536   1.00 0.00 ? 27  ILE A HD12 8  
ATOM 10909 H HD13 . ILE A 1 27  ? 2.731   6.608   4.919   1.00 0.00 ? 27  ILE A HD13 8  
ATOM 10910 N N    . VAL A 1 28  ? 1.235   3.623   7.936   1.00 0.00 ? 28  VAL A N    8  
ATOM 10911 C CA   . VAL A 1 28  ? 1.991   3.786   9.166   1.00 0.00 ? 28  VAL A CA   8  
ATOM 10912 C C    . VAL A 1 28  ? 3.441   3.360   8.927   1.00 0.00 ? 28  VAL A C    8  
ATOM 10913 O O    . VAL A 1 28  ? 3.720   2.180   8.725   1.00 0.00 ? 28  VAL A O    8  
ATOM 10914 C CB   . VAL A 1 28  ? 1.319   3.010   10.300  1.00 0.00 ? 28  VAL A CB   8  
ATOM 10915 C CG1  . VAL A 1 28  ? 2.215   1.871   10.791  1.00 0.00 ? 28  VAL A CG1  8  
ATOM 10916 C CG2  . VAL A 1 28  ? 0.937   3.943   11.451  1.00 0.00 ? 28  VAL A CG2  8  
ATOM 10917 H H    . VAL A 1 28  ? 1.616   2.963   7.289   1.00 0.00 ? 28  VAL A H    8  
ATOM 10918 H HA   . VAL A 1 28  ? 1.974   4.845   9.425   1.00 0.00 ? 28  VAL A HA   8  
ATOM 10919 H HB   . VAL A 1 28  ? 0.402   2.570   9.908   1.00 0.00 ? 28  VAL A HB   8  
ATOM 10920 H HG11 . VAL A 1 28  ? 1.781   1.429   11.688  1.00 0.00 ? 28  VAL A HG11 8  
ATOM 10921 H HG12 . VAL A 1 28  ? 2.295   1.111   10.014  1.00 0.00 ? 28  VAL A HG12 8  
ATOM 10922 H HG13 . VAL A 1 28  ? 3.206   2.262   11.021  1.00 0.00 ? 28  VAL A HG13 8  
ATOM 10923 H HG21 . VAL A 1 28  ? 0.751   3.354   12.350  1.00 0.00 ? 28  VAL A HG21 8  
ATOM 10924 H HG22 . VAL A 1 28  ? 1.753   4.642   11.638  1.00 0.00 ? 28  VAL A HG22 8  
ATOM 10925 H HG23 . VAL A 1 28  ? 0.037   4.497   11.187  1.00 0.00 ? 28  VAL A HG23 8  
ATOM 10926 N N    . ALA A 1 29  ? 4.327   4.346   8.960   1.00 0.00 ? 29  ALA A N    8  
ATOM 10927 C CA   . ALA A 1 29  ? 5.741   4.088   8.750   1.00 0.00 ? 29  ALA A CA   8  
ATOM 10928 C C    . ALA A 1 29  ? 6.436   5.387   8.340   1.00 0.00 ? 29  ALA A C    8  
ATOM 10929 O O    . ALA A 1 29  ? 5.849   6.465   8.428   1.00 0.00 ? 29  ALA A O    8  
ATOM 10930 C CB   . ALA A 1 29  ? 5.909   2.982   7.706   1.00 0.00 ? 29  ALA A CB   8  
ATOM 10931 H H    . ALA A 1 29  ? 4.092   5.303   9.125   1.00 0.00 ? 29  ALA A H    8  
ATOM 10932 H HA   . ALA A 1 29  ? 6.160   3.744   9.696   1.00 0.00 ? 29  ALA A HA   8  
ATOM 10933 H HB1  . ALA A 1 29  ? 5.089   3.030   6.990   1.00 0.00 ? 29  ALA A HB1  8  
ATOM 10934 H HB2  . ALA A 1 29  ? 6.856   3.117   7.183   1.00 0.00 ? 29  ALA A HB2  8  
ATOM 10935 H HB3  . ALA A 1 29  ? 5.903   2.011   8.201   1.00 0.00 ? 29  ALA A HB3  8  
ATOM 10936 N N    . ALA A 1 30  ? 7.678   5.244   7.900   1.00 0.00 ? 30  ALA A N    8  
ATOM 10937 C CA   . ALA A 1 30  ? 8.460   6.393   7.476   1.00 0.00 ? 30  ALA A CA   8  
ATOM 10938 C C    . ALA A 1 30  ? 9.932   5.991   7.367   1.00 0.00 ? 30  ALA A C    8  
ATOM 10939 O O    . ALA A 1 30  ? 10.513  5.482   8.325   1.00 0.00 ? 30  ALA A O    8  
ATOM 10940 C CB   . ALA A 1 30  ? 8.242   7.548   8.455   1.00 0.00 ? 30  ALA A CB   8  
ATOM 10941 H H    . ALA A 1 30  ? 8.149   4.364   7.832   1.00 0.00 ? 30  ALA A H    8  
ATOM 10942 H HA   . ALA A 1 30  ? 8.100   6.694   6.492   1.00 0.00 ? 30  ALA A HA   8  
ATOM 10943 H HB1  . ALA A 1 30  ? 7.699   7.187   9.329   1.00 0.00 ? 30  ALA A HB1  8  
ATOM 10944 H HB2  . ALA A 1 30  ? 9.207   7.947   8.767   1.00 0.00 ? 30  ALA A HB2  8  
ATOM 10945 H HB3  . ALA A 1 30  ? 7.664   8.333   7.968   1.00 0.00 ? 30  ALA A HB3  8  
ATOM 10946 N N    . LYS A 1 31  ? 10.493  6.233   6.192   1.00 0.00 ? 31  LYS A N    8  
ATOM 10947 C CA   . LYS A 1 31  ? 11.887  5.903   5.945   1.00 0.00 ? 31  LYS A CA   8  
ATOM 10948 C C    . LYS A 1 31  ? 12.767  7.082   6.362   1.00 0.00 ? 31  LYS A C    8  
ATOM 10949 O O    . LYS A 1 31  ? 12.785  8.115   5.695   1.00 0.00 ? 31  LYS A O    8  
ATOM 10950 C CB   . LYS A 1 31  ? 12.086  5.470   4.491   1.00 0.00 ? 31  LYS A CB   8  
ATOM 10951 C CG   . LYS A 1 31  ? 13.555  5.584   4.082   1.00 0.00 ? 31  LYS A CG   8  
ATOM 10952 C CD   . LYS A 1 31  ? 13.758  6.720   3.076   1.00 0.00 ? 31  LYS A CD   8  
ATOM 10953 C CE   . LYS A 1 31  ? 15.241  6.901   2.745   1.00 0.00 ? 31  LYS A CE   8  
ATOM 10954 N NZ   . LYS A 1 31  ? 15.610  8.333   2.789   1.00 0.00 ? 31  LYS A NZ   8  
ATOM 10955 H H    . LYS A 1 31  ? 10.014  6.647   5.418   1.00 0.00 ? 31  LYS A H    8  
ATOM 10956 H HA   . LYS A 1 31  ? 12.135  5.047   6.573   1.00 0.00 ? 31  LYS A HA   8  
ATOM 10957 H HB2  . LYS A 1 31  ? 11.747  4.442   4.364   1.00 0.00 ? 31  LYS A HB2  8  
ATOM 10958 H HB3  . LYS A 1 31  ? 11.473  6.090   3.837   1.00 0.00 ? 31  LYS A HB3  8  
ATOM 10959 H HG2  . LYS A 1 31  ? 14.170  5.762   4.964   1.00 0.00 ? 31  LYS A HG2  8  
ATOM 10960 H HG3  . LYS A 1 31  ? 13.889  4.643   3.645   1.00 0.00 ? 31  LYS A HG3  8  
ATOM 10961 H HD2  . LYS A 1 31  ? 13.201  6.506   2.164   1.00 0.00 ? 31  LYS A HD2  8  
ATOM 10962 H HD3  . LYS A 1 31  ? 13.357  7.647   3.484   1.00 0.00 ? 31  LYS A HD3  8  
ATOM 10963 H HE2  . LYS A 1 31  ? 15.849  6.340   3.455   1.00 0.00 ? 31  LYS A HE2  8  
ATOM 10964 H HE3  . LYS A 1 31  ? 15.451  6.495   1.756   1.00 0.00 ? 31  LYS A HE3  8  
ATOM 10965 H HZ1  . LYS A 1 31  ? 16.540  8.427   3.144   1.00 0.00 ? 31  LYS A HZ1  8  
ATOM 10966 H HZ2  . LYS A 1 31  ? 15.565  8.718   1.867   1.00 0.00 ? 31  LYS A HZ2  8  
ATOM 10967 H HZ3  . LYS A 1 31  ? 14.975  8.823   3.387   1.00 0.00 ? 31  LYS A HZ3  8  
ATOM 10968 N N    . GLY A 1 32  ? 13.478  6.889   7.464   1.00 0.00 ? 32  GLY A N    8  
ATOM 10969 C CA   . GLY A 1 32  ? 14.359  7.924   7.978   1.00 0.00 ? 32  GLY A CA   8  
ATOM 10970 C C    . GLY A 1 32  ? 14.668  7.696   9.459   1.00 0.00 ? 32  GLY A C    8  
ATOM 10971 O O    . GLY A 1 32  ? 13.795  7.286   10.223  1.00 0.00 ? 32  GLY A O    8  
ATOM 10972 H H    . GLY A 1 32  ? 13.458  6.046   8.001   1.00 0.00 ? 32  GLY A H    8  
ATOM 10973 H HA2  . GLY A 1 32  ? 15.287  7.933   7.406   1.00 0.00 ? 32  GLY A HA2  8  
ATOM 10974 H HA3  . GLY A 1 32  ? 13.893  8.901   7.846   1.00 0.00 ? 32  GLY A HA3  8  
ATOM 10975 N N    . ALA A 1 33  ? 15.912  7.971   9.820   1.00 0.00 ? 33  ALA A N    8  
ATOM 10976 C CA   . ALA A 1 33  ? 16.347  7.800   11.196  1.00 0.00 ? 33  ALA A CA   8  
ATOM 10977 C C    . ALA A 1 33  ? 16.158  6.339   11.609  1.00 0.00 ? 33  ALA A C    8  
ATOM 10978 O O    . ALA A 1 33  ? 15.826  6.054   12.758  1.00 0.00 ? 33  ALA A O    8  
ATOM 10979 C CB   . ALA A 1 33  ? 15.576  8.766   12.098  1.00 0.00 ? 33  ALA A CB   8  
ATOM 10980 H H    . ALA A 1 33  ? 16.616  8.304   9.192   1.00 0.00 ? 33  ALA A H    8  
ATOM 10981 H HA   . ALA A 1 33  ? 17.408  8.048   11.242  1.00 0.00 ? 33  ALA A HA   8  
ATOM 10982 H HB1  . ALA A 1 33  ? 15.163  9.575   11.496  1.00 0.00 ? 33  ALA A HB1  8  
ATOM 10983 H HB2  . ALA A 1 33  ? 14.766  8.232   12.594  1.00 0.00 ? 33  ALA A HB2  8  
ATOM 10984 H HB3  . ALA A 1 33  ? 16.251  9.179   12.848  1.00 0.00 ? 33  ALA A HB3  8  
ATOM 10985 N N    . GLY A 1 34  ? 16.378  5.453   10.649  1.00 0.00 ? 34  GLY A N    8  
ATOM 10986 C CA   . GLY A 1 34  ? 16.235  4.029   10.898  1.00 0.00 ? 34  GLY A CA   8  
ATOM 10987 C C    . GLY A 1 34  ? 17.228  3.223   10.058  1.00 0.00 ? 34  GLY A C    8  
ATOM 10988 O O    . GLY A 1 34  ? 18.388  3.072   10.437  1.00 0.00 ? 34  GLY A O    8  
ATOM 10989 H H    . GLY A 1 34  ? 16.647  5.694   9.717   1.00 0.00 ? 34  GLY A H    8  
ATOM 10990 H HA2  . GLY A 1 34  ? 16.398  3.823   11.956  1.00 0.00 ? 34  GLY A HA2  8  
ATOM 10991 H HA3  . GLY A 1 34  ? 15.218  3.715   10.666  1.00 0.00 ? 34  GLY A HA3  8  
ATOM 10992 N N    . GLN A 1 35  ? 16.735  2.727   8.932   1.00 0.00 ? 35  GLN A N    8  
ATOM 10993 C CA   . GLN A 1 35  ? 17.565  1.941   8.035   1.00 0.00 ? 35  GLN A CA   8  
ATOM 10994 C C    . GLN A 1 35  ? 17.373  2.407   6.590   1.00 0.00 ? 35  GLN A C    8  
ATOM 10995 O O    . GLN A 1 35  ? 17.530  1.623   5.655   1.00 0.00 ? 35  GLN A O    8  
ATOM 10996 C CB   . GLN A 1 35  ? 17.260  0.448   8.174   1.00 0.00 ? 35  GLN A CB   8  
ATOM 10997 C CG   . GLN A 1 35  ? 18.337  -0.397  7.490   1.00 0.00 ? 35  GLN A CG   8  
ATOM 10998 C CD   . GLN A 1 35  ? 18.292  -1.845  7.982   1.00 0.00 ? 35  GLN A CD   8  
ATOM 10999 O OE1  . GLN A 1 35  ? 18.183  -2.123  9.165   1.00 0.00 ? 35  GLN A OE1  8  
ATOM 11000 N NE2  . GLN A 1 35  ? 18.380  -2.749  7.010   1.00 0.00 ? 35  GLN A NE2  8  
ATOM 11001 H H    . GLN A 1 35  ? 15.790  2.855   8.631   1.00 0.00 ? 35  GLN A H    8  
ATOM 11002 H HA   . GLN A 1 35  ? 18.591  2.127   8.351   1.00 0.00 ? 35  GLN A HA   8  
ATOM 11003 H HB2  . GLN A 1 35  ? 17.201  0.182   9.230   1.00 0.00 ? 35  GLN A HB2  8  
ATOM 11004 H HB3  . GLN A 1 35  ? 16.287  0.229   7.735   1.00 0.00 ? 35  GLN A HB3  8  
ATOM 11005 H HG2  . GLN A 1 35  ? 18.192  -0.371  6.410   1.00 0.00 ? 35  GLN A HG2  8  
ATOM 11006 H HG3  . GLN A 1 35  ? 19.320  0.028   7.691   1.00 0.00 ? 35  GLN A HG3  8  
ATOM 11007 H HE21 . GLN A 1 35  ? 18.467  -2.454  6.059   1.00 0.00 ? 35  GLN A HE21 8  
ATOM 11008 H HE22 . GLN A 1 35  ? 18.360  -3.724  7.231   1.00 0.00 ? 35  GLN A HE22 8  
ATOM 11009 N N    . ASP A 1 36  ? 17.037  3.681   6.453   1.00 0.00 ? 36  ASP A N    8  
ATOM 11010 C CA   . ASP A 1 36  ? 16.823  4.261   5.138   1.00 0.00 ? 36  ASP A CA   8  
ATOM 11011 C C    . ASP A 1 36  ? 15.806  3.413   4.371   1.00 0.00 ? 36  ASP A C    8  
ATOM 11012 O O    . ASP A 1 36  ? 15.957  3.191   3.170   1.00 0.00 ? 36  ASP A O    8  
ATOM 11013 C CB   . ASP A 1 36  ? 18.122  4.288   4.329   1.00 0.00 ? 36  ASP A CB   8  
ATOM 11014 C CG   . ASP A 1 36  ? 19.301  4.974   5.022   1.00 0.00 ? 36  ASP A CG   8  
ATOM 11015 O OD1  . ASP A 1 36  ? 19.031  5.754   5.961   1.00 0.00 ? 36  ASP A OD1  8  
ATOM 11016 O OD2  . ASP A 1 36  ? 20.445  4.703   4.598   1.00 0.00 ? 36  ASP A OD2  8  
ATOM 11017 H H    . ASP A 1 36  ? 16.912  4.312   7.218   1.00 0.00 ? 36  ASP A H    8  
ATOM 11018 H HA   . ASP A 1 36  ? 16.465  5.273   5.326   1.00 0.00 ? 36  ASP A HA   8  
ATOM 11019 H HB2  . ASP A 1 36  ? 18.406  3.263   4.092   1.00 0.00 ? 36  ASP A HB2  8  
ATOM 11020 H HB3  . ASP A 1 36  ? 17.932  4.793   3.382   1.00 0.00 ? 36  ASP A HB3  8  
ATOM 11021 N N    . LYS A 1 37  ? 14.793  2.962   5.096   1.00 0.00 ? 37  LYS A N    8  
ATOM 11022 C CA   . LYS A 1 37  ? 13.752  2.143   4.498   1.00 0.00 ? 37  LYS A CA   8  
ATOM 11023 C C    . LYS A 1 37  ? 12.943  1.466   5.607   1.00 0.00 ? 37  LYS A C    8  
ATOM 11024 O O    . LYS A 1 37  ? 13.341  0.421   6.120   1.00 0.00 ? 37  LYS A O    8  
ATOM 11025 C CB   . LYS A 1 37  ? 14.353  1.163   3.489   1.00 0.00 ? 37  LYS A CB   8  
ATOM 11026 C CG   . LYS A 1 37  ? 13.582  -0.158  3.481   1.00 0.00 ? 37  LYS A CG   8  
ATOM 11027 C CD   . LYS A 1 37  ? 13.831  -0.930  2.184   1.00 0.00 ? 37  LYS A CD   8  
ATOM 11028 C CE   . LYS A 1 37  ? 15.308  -1.299  2.040   1.00 0.00 ? 37  LYS A CE   8  
ATOM 11029 N NZ   . LYS A 1 37  ? 15.720  -1.246  0.620   1.00 0.00 ? 37  LYS A NZ   8  
ATOM 11030 H H    . LYS A 1 37  ? 14.678  3.147   6.071   1.00 0.00 ? 37  LYS A H    8  
ATOM 11031 H HA   . LYS A 1 37  ? 13.090  2.809   3.945   1.00 0.00 ? 37  LYS A HA   8  
ATOM 11032 H HB2  . LYS A 1 37  ? 14.336  1.605   2.493   1.00 0.00 ? 37  LYS A HB2  8  
ATOM 11033 H HB3  . LYS A 1 37  ? 15.398  0.977   3.737   1.00 0.00 ? 37  LYS A HB3  8  
ATOM 11034 H HG2  . LYS A 1 37  ? 13.885  -0.765  4.334   1.00 0.00 ? 37  LYS A HG2  8  
ATOM 11035 H HG3  . LYS A 1 37  ? 12.515  0.039   3.592   1.00 0.00 ? 37  LYS A HG3  8  
ATOM 11036 H HD2  . LYS A 1 37  ? 13.223  -1.835  2.173   1.00 0.00 ? 37  LYS A HD2  8  
ATOM 11037 H HD3  . LYS A 1 37  ? 13.518  -0.327  1.332   1.00 0.00 ? 37  LYS A HD3  8  
ATOM 11038 H HE2  . LYS A 1 37  ? 15.919  -0.613  2.628   1.00 0.00 ? 37  LYS A HE2  8  
ATOM 11039 H HE3  . LYS A 1 37  ? 15.480  -2.299  2.438   1.00 0.00 ? 37  LYS A HE3  8  
ATOM 11040 H HZ1  . LYS A 1 37  ? 15.680  -0.301  0.296   1.00 0.00 ? 37  LYS A HZ1  8  
ATOM 11041 H HZ2  . LYS A 1 37  ? 16.655  -1.589  0.531   1.00 0.00 ? 37  LYS A HZ2  8  
ATOM 11042 H HZ3  . LYS A 1 37  ? 15.104  -1.813  0.073   1.00 0.00 ? 37  LYS A HZ3  8  
ATOM 11043 N N    . LEU A 1 38  ? 11.823  2.089   5.943   1.00 0.00 ? 38  LEU A N    8  
ATOM 11044 C CA   . LEU A 1 38  ? 10.955  1.559   6.981   1.00 0.00 ? 38  LEU A CA   8  
ATOM 11045 C C    . LEU A 1 38  ? 9.935   0.609   6.351   1.00 0.00 ? 38  LEU A C    8  
ATOM 11046 O O    . LEU A 1 38  ? 9.634   0.715   5.163   1.00 0.00 ? 38  LEU A O    8  
ATOM 11047 C CB   . LEU A 1 38  ? 10.322  2.698   7.783   1.00 0.00 ? 38  LEU A CB   8  
ATOM 11048 C CG   . LEU A 1 38  ? 10.814  2.859   9.222   1.00 0.00 ? 38  LEU A CG   8  
ATOM 11049 C CD1  . LEU A 1 38  ? 12.100  3.686   9.273   1.00 0.00 ? 38  LEU A CD1  8  
ATOM 11050 C CD2  . LEU A 1 38  ? 9.719   3.447   10.114  1.00 0.00 ? 38  LEU A CD2  8  
ATOM 11051 H H    . LEU A 1 38  ? 11.507  2.938   5.520   1.00 0.00 ? 38  LEU A H    8  
ATOM 11052 H HA   . LEU A 1 38  ? 11.579  0.988   7.669   1.00 0.00 ? 38  LEU A HA   8  
ATOM 11053 H HB2  . LEU A 1 38  ? 10.501  3.633   7.252   1.00 0.00 ? 38  LEU A HB2  8  
ATOM 11054 H HB3  . LEU A 1 38  ? 9.243   2.545   7.804   1.00 0.00 ? 38  LEU A HB3  8  
ATOM 11055 H HG   . LEU A 1 38  ? 11.052  1.870   9.615   1.00 0.00 ? 38  LEU A HG   8  
ATOM 11056 H HD11 . LEU A 1 38  ? 12.014  4.444   10.051  1.00 0.00 ? 38  LEU A HD11 8  
ATOM 11057 H HD12 . LEU A 1 38  ? 12.944  3.033   9.493   1.00 0.00 ? 38  LEU A HD12 8  
ATOM 11058 H HD13 . LEU A 1 38  ? 12.258  4.171   8.309   1.00 0.00 ? 38  LEU A HD13 8  
ATOM 11059 H HD21 . LEU A 1 38  ? 9.476   2.740   10.906  1.00 0.00 ? 38  LEU A HD21 8  
ATOM 11060 H HD22 . LEU A 1 38  ? 10.071  4.380   10.555  1.00 0.00 ? 38  LEU A HD22 8  
ATOM 11061 H HD23 . LEU A 1 38  ? 8.829   3.642   9.515   1.00 0.00 ? 38  LEU A HD23 8  
ATOM 11062 N N    . GLY A 1 39  ? 9.430   -0.297  7.175   1.00 0.00 ? 39  GLY A N    8  
ATOM 11063 C CA   . GLY A 1 39  ? 8.449   -1.265  6.713   1.00 0.00 ? 39  GLY A CA   8  
ATOM 11064 C C    . GLY A 1 39  ? 7.062   -0.629  6.599   1.00 0.00 ? 39  GLY A C    8  
ATOM 11065 O O    . GLY A 1 39  ? 6.259   -0.713  7.526   1.00 0.00 ? 39  GLY A O    8  
ATOM 11066 H H    . GLY A 1 39  ? 9.680   -0.377  8.140   1.00 0.00 ? 39  GLY A H    8  
ATOM 11067 H HA2  . GLY A 1 39  ? 8.752   -1.661  5.744   1.00 0.00 ? 39  GLY A HA2  8  
ATOM 11068 H HA3  . GLY A 1 39  ? 8.411   -2.108  7.403   1.00 0.00 ? 39  GLY A HA3  8  
ATOM 11069 N N    . ILE A 1 40  ? 6.825   -0.006  5.454   1.00 0.00 ? 40  ILE A N    8  
ATOM 11070 C CA   . ILE A 1 40  ? 5.549   0.644   5.207   1.00 0.00 ? 40  ILE A CA   8  
ATOM 11071 C C    . ILE A 1 40  ? 4.414   -0.332  5.523   1.00 0.00 ? 40  ILE A C    8  
ATOM 11072 O O    . ILE A 1 40  ? 4.209   -1.307  4.800   1.00 0.00 ? 40  ILE A O    8  
ATOM 11073 C CB   . ILE A 1 40  ? 5.500   1.204   3.784   1.00 0.00 ? 40  ILE A CB   8  
ATOM 11074 C CG1  . ILE A 1 40  ? 6.740   2.049   3.484   1.00 0.00 ? 40  ILE A CG1  8  
ATOM 11075 C CG2  . ILE A 1 40  ? 4.204   1.982   3.545   1.00 0.00 ? 40  ILE A CG2  8  
ATOM 11076 C CD1  . ILE A 1 40  ? 7.080   2.961   4.664   1.00 0.00 ? 40  ILE A CD1  8  
ATOM 11077 H H    . ILE A 1 40  ? 7.484   0.058   4.705   1.00 0.00 ? 40  ILE A H    8  
ATOM 11078 H HA   . ILE A 1 40  ? 5.476   1.491   5.889   1.00 0.00 ? 40  ILE A HA   8  
ATOM 11079 H HB   . ILE A 1 40  ? 5.505   0.366   3.086   1.00 0.00 ? 40  ILE A HB   8  
ATOM 11080 H HG12 . ILE A 1 40  ? 7.585   1.396   3.268   1.00 0.00 ? 40  ILE A HG12 8  
ATOM 11081 H HG13 . ILE A 1 40  ? 6.566   2.652   2.592   1.00 0.00 ? 40  ILE A HG13 8  
ATOM 11082 H HG21 . ILE A 1 40  ? 3.799   2.315   4.500   1.00 0.00 ? 40  ILE A HG21 8  
ATOM 11083 H HG22 . ILE A 1 40  ? 4.411   2.848   2.917   1.00 0.00 ? 40  ILE A HG22 8  
ATOM 11084 H HG23 . ILE A 1 40  ? 3.480   1.337   3.047   1.00 0.00 ? 40  ILE A HG23 8  
ATOM 11085 H HD11 . ILE A 1 40  ? 7.610   2.388   5.425   1.00 0.00 ? 40  ILE A HD11 8  
ATOM 11086 H HD12 . ILE A 1 40  ? 7.711   3.780   4.320   1.00 0.00 ? 40  ILE A HD12 8  
ATOM 11087 H HD13 . ILE A 1 40  ? 6.160   3.365   5.089   1.00 0.00 ? 40  ILE A HD13 8  
ATOM 11088 N N    . TYR A 1 41  ? 3.706   -0.037  6.603   1.00 0.00 ? 41  TYR A N    8  
ATOM 11089 C CA   . TYR A 1 41  ? 2.597   -0.876  7.024   1.00 0.00 ? 41  TYR A CA   8  
ATOM 11090 C C    . TYR A 1 41  ? 1.354   -0.035  7.320   1.00 0.00 ? 41  TYR A C    8  
ATOM 11091 O O    . TYR A 1 41  ? 1.442   0.996   7.985   1.00 0.00 ? 41  TYR A O    8  
ATOM 11092 C CB   . TYR A 1 41  ? 3.053   -1.562  8.313   1.00 0.00 ? 41  TYR A CB   8  
ATOM 11093 C CG   . TYR A 1 41  ? 3.157   -3.085  8.204   1.00 0.00 ? 41  TYR A CG   8  
ATOM 11094 C CD1  . TYR A 1 41  ? 4.238   -3.659  7.567   1.00 0.00 ? 41  TYR A CD1  8  
ATOM 11095 C CD2  . TYR A 1 41  ? 2.170   -3.884  8.745   1.00 0.00 ? 41  TYR A CD2  8  
ATOM 11096 C CE1  . TYR A 1 41  ? 4.336   -5.092  7.464   1.00 0.00 ? 41  TYR A CE1  8  
ATOM 11097 C CE2  . TYR A 1 41  ? 2.269   -5.317  8.642   1.00 0.00 ? 41  TYR A CE2  8  
ATOM 11098 C CZ   . TYR A 1 41  ? 3.347   -5.850  8.007   1.00 0.00 ? 41  TYR A CZ   8  
ATOM 11099 O OH   . TYR A 1 41  ? 3.439   -7.204  7.911   1.00 0.00 ? 41  TYR A OH   8  
ATOM 11100 H H    . TYR A 1 41  ? 3.879   0.758   7.185   1.00 0.00 ? 41  TYR A H    8  
ATOM 11101 H HA   . TYR A 1 41  ? 2.373   -1.569  6.213   1.00 0.00 ? 41  TYR A HA   8  
ATOM 11102 H HB2  . TYR A 1 41  ? 4.025   -1.162  8.602   1.00 0.00 ? 41  TYR A HB2  8  
ATOM 11103 H HB3  . TYR A 1 41  ? 2.355   -1.312  9.112   1.00 0.00 ? 41  TYR A HB3  8  
ATOM 11104 H HD1  . TYR A 1 41  ? 5.018   -3.027  7.140   1.00 0.00 ? 41  TYR A HD1  8  
ATOM 11105 H HD2  . TYR A 1 41  ? 1.317   -3.431  9.248   1.00 0.00 ? 41  TYR A HD2  8  
ATOM 11106 H HE1  . TYR A 1 41  ? 5.185   -5.558  6.963   1.00 0.00 ? 41  TYR A HE1  8  
ATOM 11107 H HE2  . TYR A 1 41  ? 1.496   -5.960  9.064   1.00 0.00 ? 41  TYR A HE2  8  
ATOM 11108 H HH   . TYR A 1 41  ? 3.726   -7.590  8.788   1.00 0.00 ? 41  TYR A HH   8  
ATOM 11109 N N    . VAL A 1 42  ? 0.225   -0.506  6.811   1.00 0.00 ? 42  VAL A N    8  
ATOM 11110 C CA   . VAL A 1 42  ? -1.034  0.190   7.012   1.00 0.00 ? 42  VAL A CA   8  
ATOM 11111 C C    . VAL A 1 42  ? -1.462  0.049   8.475   1.00 0.00 ? 42  VAL A C    8  
ATOM 11112 O O    . VAL A 1 42  ? -1.450  -1.051  9.025   1.00 0.00 ? 42  VAL A O    8  
ATOM 11113 C CB   . VAL A 1 42  ? -2.084  -0.332  6.030   1.00 0.00 ? 42  VAL A CB   8  
ATOM 11114 C CG1  . VAL A 1 42  ? -3.473  0.210   6.372   1.00 0.00 ? 42  VAL A CG1  8  
ATOM 11115 C CG2  . VAL A 1 42  ? -1.703  0.008   4.587   1.00 0.00 ? 42  VAL A CG2  8  
ATOM 11116 H H    . VAL A 1 42  ? 0.162   -1.345  6.271   1.00 0.00 ? 42  VAL A H    8  
ATOM 11117 H HA   . VAL A 1 42  ? -0.865  1.245   6.796   1.00 0.00 ? 42  VAL A HA   8  
ATOM 11118 H HB   . VAL A 1 42  ? -2.117  -1.418  6.120   1.00 0.00 ? 42  VAL A HB   8  
ATOM 11119 H HG11 . VAL A 1 42  ? -3.563  1.234   6.010   1.00 0.00 ? 42  VAL A HG11 8  
ATOM 11120 H HG12 . VAL A 1 42  ? -4.233  -0.411  5.897   1.00 0.00 ? 42  VAL A HG12 8  
ATOM 11121 H HG13 . VAL A 1 42  ? -3.614  0.192   7.453   1.00 0.00 ? 42  VAL A HG13 8  
ATOM 11122 H HG21 . VAL A 1 42  ? -1.147  -0.823  4.153   1.00 0.00 ? 42  VAL A HG21 8  
ATOM 11123 H HG22 . VAL A 1 42  ? -2.607  0.184   4.005   1.00 0.00 ? 42  VAL A HG22 8  
ATOM 11124 H HG23 . VAL A 1 42  ? -1.084  0.905   4.577   1.00 0.00 ? 42  VAL A HG23 8  
ATOM 11125 N N    . LYS A 1 43  ? -1.829  1.179   9.062   1.00 0.00 ? 43  LYS A N    8  
ATOM 11126 C CA   . LYS A 1 43  ? -2.260  1.195   10.450  1.00 0.00 ? 43  LYS A CA   8  
ATOM 11127 C C    . LYS A 1 43  ? -3.780  1.031   10.510  1.00 0.00 ? 43  LYS A C    8  
ATOM 11128 O O    . LYS A 1 43  ? -4.310  0.465   11.464  1.00 0.00 ? 43  LYS A O    8  
ATOM 11129 C CB   . LYS A 1 43  ? -1.748  2.453   11.154  1.00 0.00 ? 43  LYS A CB   8  
ATOM 11130 C CG   . LYS A 1 43  ? -2.586  2.765   12.396  1.00 0.00 ? 43  LYS A CG   8  
ATOM 11131 C CD   . LYS A 1 43  ? -3.744  3.704   12.054  1.00 0.00 ? 43  LYS A CD   8  
ATOM 11132 C CE   . LYS A 1 43  ? -3.332  5.168   12.224  1.00 0.00 ? 43  LYS A CE   8  
ATOM 11133 N NZ   . LYS A 1 43  ? -3.902  5.725   13.471  1.00 0.00 ? 43  LYS A NZ   8  
ATOM 11134 H H    . LYS A 1 43  ? -1.837  2.069   8.607   1.00 0.00 ? 43  LYS A H    8  
ATOM 11135 H HA   . LYS A 1 43  ? -1.801  0.339   10.944  1.00 0.00 ? 43  LYS A HA   8  
ATOM 11136 H HB2  . LYS A 1 43  ? -0.705  2.316   11.440  1.00 0.00 ? 43  LYS A HB2  8  
ATOM 11137 H HB3  . LYS A 1 43  ? -1.782  3.298   10.467  1.00 0.00 ? 43  LYS A HB3  8  
ATOM 11138 H HG2  . LYS A 1 43  ? -2.977  1.838   12.818  1.00 0.00 ? 43  LYS A HG2  8  
ATOM 11139 H HG3  . LYS A 1 43  ? -1.956  3.221   13.159  1.00 0.00 ? 43  LYS A HG3  8  
ATOM 11140 H HD2  . LYS A 1 43  ? -4.067  3.531   11.028  1.00 0.00 ? 43  LYS A HD2  8  
ATOM 11141 H HD3  . LYS A 1 43  ? -4.597  3.486   12.698  1.00 0.00 ? 43  LYS A HD3  8  
ATOM 11142 H HE2  . LYS A 1 43  ? -2.245  5.245   12.248  1.00 0.00 ? 43  LYS A HE2  8  
ATOM 11143 H HE3  . LYS A 1 43  ? -3.674  5.750   11.369  1.00 0.00 ? 43  LYS A HE3  8  
ATOM 11144 H HZ1  . LYS A 1 43  ? -3.868  5.033   14.192  1.00 0.00 ? 43  LYS A HZ1  8  
ATOM 11145 H HZ2  . LYS A 1 43  ? -3.371  6.525   13.752  1.00 0.00 ? 43  LYS A HZ2  8  
ATOM 11146 H HZ3  . LYS A 1 43  ? -4.852  5.995   13.312  1.00 0.00 ? 43  LYS A HZ3  8  
ATOM 11147 N N    . SER A 1 44  ? -4.439  1.538   9.478   1.00 0.00 ? 44  SER A N    8  
ATOM 11148 C CA   . SER A 1 44  ? -5.887  1.456   9.401   1.00 0.00 ? 44  SER A CA   8  
ATOM 11149 C C    . SER A 1 44  ? -6.369  1.957   8.038   1.00 0.00 ? 44  SER A C    8  
ATOM 11150 O O    . SER A 1 44  ? -5.593  2.016   7.085   1.00 0.00 ? 44  SER A O    8  
ATOM 11151 C CB   . SER A 1 44  ? -6.545  2.260   10.525  1.00 0.00 ? 44  SER A CB   8  
ATOM 11152 O OG   . SER A 1 44  ? -6.660  3.641   10.196  1.00 0.00 ? 44  SER A OG   8  
ATOM 11153 H H    . SER A 1 44  ? -4.000  1.998   8.705   1.00 0.00 ? 44  SER A H    8  
ATOM 11154 H HA   . SER A 1 44  ? -6.123  0.399   9.525   1.00 0.00 ? 44  SER A HA   8  
ATOM 11155 H HB2  . SER A 1 44  ? -7.535  1.852   10.730  1.00 0.00 ? 44  SER A HB2  8  
ATOM 11156 H HB3  . SER A 1 44  ? -5.960  2.151   11.438  1.00 0.00 ? 44  SER A HB3  8  
ATOM 11157 H HG   . SER A 1 44  ? -5.777  4.095   10.314  1.00 0.00 ? 44  SER A HG   8  
ATOM 11158 N N    . VAL A 1 45  ? -7.646  2.305   7.989   1.00 0.00 ? 45  VAL A N    8  
ATOM 11159 C CA   . VAL A 1 45  ? -8.240  2.799   6.758   1.00 0.00 ? 45  VAL A CA   8  
ATOM 11160 C C    . VAL A 1 45  ? -9.202  3.943   7.085   1.00 0.00 ? 45  VAL A C    8  
ATOM 11161 O O    . VAL A 1 45  ? -9.928  3.884   8.076   1.00 0.00 ? 45  VAL A O    8  
ATOM 11162 C CB   . VAL A 1 45  ? -8.912  1.650   6.003   1.00 0.00 ? 45  VAL A CB   8  
ATOM 11163 C CG1  . VAL A 1 45  ? -7.973  1.065   4.947   1.00 0.00 ? 45  VAL A CG1  8  
ATOM 11164 C CG2  . VAL A 1 45  ? -9.394  0.566   6.970   1.00 0.00 ? 45  VAL A CG2  8  
ATOM 11165 H H    . VAL A 1 45  ? -8.271  2.253   8.768   1.00 0.00 ? 45  VAL A H    8  
ATOM 11166 H HA   . VAL A 1 45  ? -7.434  3.185   6.136   1.00 0.00 ? 45  VAL A HA   8  
ATOM 11167 H HB   . VAL A 1 45  ? -9.785  2.052   5.489   1.00 0.00 ? 45  VAL A HB   8  
ATOM 11168 H HG11 . VAL A 1 45  ? -8.398  0.141   4.554   1.00 0.00 ? 45  VAL A HG11 8  
ATOM 11169 H HG12 . VAL A 1 45  ? -7.847  1.781   4.135   1.00 0.00 ? 45  VAL A HG12 8  
ATOM 11170 H HG13 . VAL A 1 45  ? -7.003  0.854   5.399   1.00 0.00 ? 45  VAL A HG13 8  
ATOM 11171 H HG21 . VAL A 1 45  ? -9.671  1.023   7.919   1.00 0.00 ? 45  VAL A HG21 8  
ATOM 11172 H HG22 . VAL A 1 45  ? -10.259 0.058   6.544   1.00 0.00 ? 45  VAL A HG22 8  
ATOM 11173 H HG23 . VAL A 1 45  ? -8.593  -0.156  7.134   1.00 0.00 ? 45  VAL A HG23 8  
ATOM 11174 N N    . VAL A 1 46  ? -9.177  4.956   6.232   1.00 0.00 ? 46  VAL A N    8  
ATOM 11175 C CA   . VAL A 1 46  ? -10.037 6.112   6.417   1.00 0.00 ? 46  VAL A CA   8  
ATOM 11176 C C    . VAL A 1 46  ? -11.490 5.647   6.532   1.00 0.00 ? 46  VAL A C    8  
ATOM 11177 O O    . VAL A 1 46  ? -12.350 6.395   6.996   1.00 0.00 ? 46  VAL A O    8  
ATOM 11178 C CB   . VAL A 1 46  ? -9.819  7.115   5.283   1.00 0.00 ? 46  VAL A CB   8  
ATOM 11179 C CG1  . VAL A 1 46  ? -11.006 8.073   5.161   1.00 0.00 ? 46  VAL A CG1  8  
ATOM 11180 C CG2  . VAL A 1 46  ? -8.510  7.885   5.476   1.00 0.00 ? 46  VAL A CG2  8  
ATOM 11181 H H    . VAL A 1 46  ? -8.583  4.996   5.428   1.00 0.00 ? 46  VAL A H    8  
ATOM 11182 H HA   . VAL A 1 46  ? -9.747  6.592   7.352   1.00 0.00 ? 46  VAL A HA   8  
ATOM 11183 H HB   . VAL A 1 46  ? -9.743  6.555   4.351   1.00 0.00 ? 46  VAL A HB   8  
ATOM 11184 H HG11 . VAL A 1 46  ? -11.019 8.745   6.019   1.00 0.00 ? 46  VAL A HG11 8  
ATOM 11185 H HG12 . VAL A 1 46  ? -10.910 8.656   4.245   1.00 0.00 ? 46  VAL A HG12 8  
ATOM 11186 H HG13 . VAL A 1 46  ? -11.933 7.501   5.133   1.00 0.00 ? 46  VAL A HG13 8  
ATOM 11187 H HG21 . VAL A 1 46  ? -7.770  7.528   4.760   1.00 0.00 ? 46  VAL A HG21 8  
ATOM 11188 H HG22 . VAL A 1 46  ? -8.688  8.948   5.316   1.00 0.00 ? 46  VAL A HG22 8  
ATOM 11189 H HG23 . VAL A 1 46  ? -8.142  7.726   6.489   1.00 0.00 ? 46  VAL A HG23 8  
ATOM 11190 N N    . LYS A 1 47  ? -11.720 4.415   6.103   1.00 0.00 ? 47  LYS A N    8  
ATOM 11191 C CA   . LYS A 1 47  ? -13.054 3.842   6.151   1.00 0.00 ? 47  LYS A CA   8  
ATOM 11192 C C    . LYS A 1 47  ? -14.000 4.689   5.298   1.00 0.00 ? 47  LYS A C    8  
ATOM 11193 O O    . LYS A 1 47  ? -15.142 4.933   5.686   1.00 0.00 ? 47  LYS A O    8  
ATOM 11194 C CB   . LYS A 1 47  ? -13.514 3.679   7.601   1.00 0.00 ? 47  LYS A CB   8  
ATOM 11195 C CG   . LYS A 1 47  ? -14.428 2.461   7.753   1.00 0.00 ? 47  LYS A CG   8  
ATOM 11196 C CD   . LYS A 1 47  ? -13.872 1.484   8.792   1.00 0.00 ? 47  LYS A CD   8  
ATOM 11197 C CE   . LYS A 1 47  ? -14.396 1.815   10.191  1.00 0.00 ? 47  LYS A CE   8  
ATOM 11198 N NZ   . LYS A 1 47  ? -14.770 0.577   10.910  1.00 0.00 ? 47  LYS A NZ   8  
ATOM 11199 H H    . LYS A 1 47  ? -11.015 3.814   5.727   1.00 0.00 ? 47  LYS A H    8  
ATOM 11200 H HA   . LYS A 1 47  ? -12.997 2.844   5.717   1.00 0.00 ? 47  LYS A HA   8  
ATOM 11201 H HB2  . LYS A 1 47  ? -12.647 3.570   8.253   1.00 0.00 ? 47  LYS A HB2  8  
ATOM 11202 H HB3  . LYS A 1 47  ? -14.043 4.576   7.922   1.00 0.00 ? 47  LYS A HB3  8  
ATOM 11203 H HG2  . LYS A 1 47  ? -15.425 2.785   8.050   1.00 0.00 ? 47  LYS A HG2  8  
ATOM 11204 H HG3  . LYS A 1 47  ? -14.530 1.956   6.792   1.00 0.00 ? 47  LYS A HG3  8  
ATOM 11205 H HD2  . LYS A 1 47  ? -14.154 0.465   8.526   1.00 0.00 ? 47  LYS A HD2  8  
ATOM 11206 H HD3  . LYS A 1 47  ? -12.783 1.525   8.788   1.00 0.00 ? 47  LYS A HD3  8  
ATOM 11207 H HE2  . LYS A 1 47  ? -13.633 2.354   10.753  1.00 0.00 ? 47  LYS A HE2  8  
ATOM 11208 H HE3  . LYS A 1 47  ? -15.261 2.475   10.115  1.00 0.00 ? 47  LYS A HE3  8  
ATOM 11209 H HZ1  . LYS A 1 47  ? -14.868 0.775   11.886  1.00 0.00 ? 47  LYS A HZ1  8  
ATOM 11210 H HZ2  . LYS A 1 47  ? -15.638 0.233   10.552  1.00 0.00 ? 47  LYS A HZ2  8  
ATOM 11211 H HZ3  . LYS A 1 47  ? -14.059 -0.113  10.779  1.00 0.00 ? 47  LYS A HZ3  8  
ATOM 11212 N N    . GLY A 1 48  ? -13.490 5.114   4.151   1.00 0.00 ? 48  GLY A N    8  
ATOM 11213 C CA   . GLY A 1 48  ? -14.276 5.928   3.239   1.00 0.00 ? 48  GLY A CA   8  
ATOM 11214 C C    . GLY A 1 48  ? -13.562 6.090   1.896   1.00 0.00 ? 48  GLY A C    8  
ATOM 11215 O O    . GLY A 1 48  ? -13.725 7.106   1.221   1.00 0.00 ? 48  GLY A O    8  
ATOM 11216 H H    . GLY A 1 48  ? -12.561 4.911   3.843   1.00 0.00 ? 48  GLY A H    8  
ATOM 11217 H HA2  . GLY A 1 48  ? -15.251 5.467   3.083   1.00 0.00 ? 48  GLY A HA2  8  
ATOM 11218 H HA3  . GLY A 1 48  ? -14.453 6.908   3.682   1.00 0.00 ? 48  GLY A HA3  8  
ATOM 11219 N N    . GLY A 1 49  ? -12.785 5.075   1.548   1.00 0.00 ? 49  GLY A N    8  
ATOM 11220 C CA   . GLY A 1 49  ? -12.046 5.092   0.297   1.00 0.00 ? 49  GLY A CA   8  
ATOM 11221 C C    . GLY A 1 49  ? -11.975 3.693   -0.317  1.00 0.00 ? 49  GLY A C    8  
ATOM 11222 O O    . GLY A 1 49  ? -12.290 2.704   0.343   1.00 0.00 ? 49  GLY A O    8  
ATOM 11223 H H    . GLY A 1 49  ? -12.658 4.253   2.103   1.00 0.00 ? 49  GLY A H    8  
ATOM 11224 H HA2  . GLY A 1 49  ? -12.524 5.777   -0.403  1.00 0.00 ? 49  GLY A HA2  8  
ATOM 11225 H HA3  . GLY A 1 49  ? -11.037 5.468   0.472   1.00 0.00 ? 49  GLY A HA3  8  
ATOM 11226 N N    . ALA A 1 50  ? -11.558 3.654   -1.575  1.00 0.00 ? 50  ALA A N    8  
ATOM 11227 C CA   . ALA A 1 50  ? -11.442 2.392   -2.286  1.00 0.00 ? 50  ALA A CA   8  
ATOM 11228 C C    . ALA A 1 50  ? -10.881 1.329   -1.340  1.00 0.00 ? 50  ALA A C    8  
ATOM 11229 O O    . ALA A 1 50  ? -11.292 0.170   -1.389  1.00 0.00 ? 50  ALA A O    8  
ATOM 11230 C CB   . ALA A 1 50  ? -10.570 2.585   -3.528  1.00 0.00 ? 50  ALA A CB   8  
ATOM 11231 H H    . ALA A 1 50  ? -11.304 4.463   -2.105  1.00 0.00 ? 50  ALA A H    8  
ATOM 11232 H HA   . ALA A 1 50  ? -12.442 2.096   -2.601  1.00 0.00 ? 50  ALA A HA   8  
ATOM 11233 H HB1  . ALA A 1 50  ? -10.600 1.681   -4.137  1.00 0.00 ? 50  ALA A HB1  8  
ATOM 11234 H HB2  . ALA A 1 50  ? -10.948 3.427   -4.110  1.00 0.00 ? 50  ALA A HB2  8  
ATOM 11235 H HB3  . ALA A 1 50  ? -9.543  2.785   -3.224  1.00 0.00 ? 50  ALA A HB3  8  
ATOM 11236 N N    . ALA A 1 51  ? -9.951  1.760   -0.500  1.00 0.00 ? 51  ALA A N    8  
ATOM 11237 C CA   . ALA A 1 51  ? -9.330  0.859   0.456   1.00 0.00 ? 51  ALA A CA   8  
ATOM 11238 C C    . ALA A 1 51  ? -10.419 0.141   1.256   1.00 0.00 ? 51  ALA A C    8  
ATOM 11239 O O    . ALA A 1 51  ? -10.789 -0.987  0.935   1.00 0.00 ? 51  ALA A O    8  
ATOM 11240 C CB   . ALA A 1 51  ? -8.372  1.646   1.351   1.00 0.00 ? 51  ALA A CB   8  
ATOM 11241 H H    . ALA A 1 51  ? -9.623  2.704   -0.467  1.00 0.00 ? 51  ALA A H    8  
ATOM 11242 H HA   . ALA A 1 51  ? -8.758  0.121   -0.107  1.00 0.00 ? 51  ALA A HA   8  
ATOM 11243 H HB1  . ALA A 1 51  ? -8.936  2.372   1.937   1.00 0.00 ? 51  ALA A HB1  8  
ATOM 11244 H HB2  . ALA A 1 51  ? -7.856  0.960   2.023   1.00 0.00 ? 51  ALA A HB2  8  
ATOM 11245 H HB3  . ALA A 1 51  ? -7.641  2.167   0.732   1.00 0.00 ? 51  ALA A HB3  8  
ATOM 11246 N N    . ASP A 1 52  ? -10.903 0.826   2.282   1.00 0.00 ? 52  ASP A N    8  
ATOM 11247 C CA   . ASP A 1 52  ? -11.942 0.268   3.131   1.00 0.00 ? 52  ASP A CA   8  
ATOM 11248 C C    . ASP A 1 52  ? -13.210 0.052   2.302   1.00 0.00 ? 52  ASP A C    8  
ATOM 11249 O O    . ASP A 1 52  ? -14.174 -0.544  2.779   1.00 0.00 ? 52  ASP A O    8  
ATOM 11250 C CB   . ASP A 1 52  ? -12.284 1.218   4.279   1.00 0.00 ? 52  ASP A CB   8  
ATOM 11251 C CG   . ASP A 1 52  ? -12.620 0.534   5.606   1.00 0.00 ? 52  ASP A CG   8  
ATOM 11252 O OD1  . ASP A 1 52  ? -13.294 -0.517  5.548   1.00 0.00 ? 52  ASP A OD1  8  
ATOM 11253 O OD2  . ASP A 1 52  ? -12.195 1.078   6.648   1.00 0.00 ? 52  ASP A OD2  8  
ATOM 11254 H H    . ASP A 1 52  ? -10.597 1.743   2.537   1.00 0.00 ? 52  ASP A H    8  
ATOM 11255 H HA   . ASP A 1 52  ? -11.529 -0.666  3.512   1.00 0.00 ? 52  ASP A HA   8  
ATOM 11256 H HB2  . ASP A 1 52  ? -11.442 1.891   4.438   1.00 0.00 ? 52  ASP A HB2  8  
ATOM 11257 H HB3  . ASP A 1 52  ? -13.132 1.834   3.981   1.00 0.00 ? 52  ASP A HB3  8  
ATOM 11258 N N    . VAL A 1 53  ? -13.167 0.548   1.074   1.00 0.00 ? 53  VAL A N    8  
ATOM 11259 C CA   . VAL A 1 53  ? -14.301 0.417   0.174   1.00 0.00 ? 53  VAL A CA   8  
ATOM 11260 C C    . VAL A 1 53  ? -14.175 -0.891  -0.609  1.00 0.00 ? 53  VAL A C    8  
ATOM 11261 O O    . VAL A 1 53  ? -15.181 -1.499  -0.975  1.00 0.00 ? 53  VAL A O    8  
ATOM 11262 C CB   . VAL A 1 53  ? -14.397 1.648   -0.729  1.00 0.00 ? 53  VAL A CB   8  
ATOM 11263 C CG1  . VAL A 1 53  ? -15.034 1.293   -2.074  1.00 0.00 ? 53  VAL A CG1  8  
ATOM 11264 C CG2  . VAL A 1 53  ? -15.166 2.776   -0.039  1.00 0.00 ? 53  VAL A CG2  8  
ATOM 11265 H H    . VAL A 1 53  ? -12.379 1.031   0.693   1.00 0.00 ? 53  VAL A H    8  
ATOM 11266 H HA   . VAL A 1 53  ? -15.202 0.375   0.785   1.00 0.00 ? 53  VAL A HA   8  
ATOM 11267 H HB   . VAL A 1 53  ? -13.384 2.002   -0.922  1.00 0.00 ? 53  VAL A HB   8  
ATOM 11268 H HG11 . VAL A 1 53  ? -15.107 2.189   -2.689  1.00 0.00 ? 53  VAL A HG11 8  
ATOM 11269 H HG12 . VAL A 1 53  ? -14.418 0.552   -2.583  1.00 0.00 ? 53  VAL A HG12 8  
ATOM 11270 H HG13 . VAL A 1 53  ? -16.031 0.884   -1.907  1.00 0.00 ? 53  VAL A HG13 8  
ATOM 11271 H HG21 . VAL A 1 53  ? -15.114 3.678   -0.649  1.00 0.00 ? 53  VAL A HG21 8  
ATOM 11272 H HG22 . VAL A 1 53  ? -16.208 2.481   0.086   1.00 0.00 ? 53  VAL A HG22 8  
ATOM 11273 H HG23 . VAL A 1 53  ? -14.724 2.972   0.938   1.00 0.00 ? 53  VAL A HG23 8  
ATOM 11274 N N    . ASP A 1 54  ? -12.933 -1.286  -0.845  1.00 0.00 ? 54  ASP A N    8  
ATOM 11275 C CA   . ASP A 1 54  ? -12.663 -2.511  -1.578  1.00 0.00 ? 54  ASP A CA   8  
ATOM 11276 C C    . ASP A 1 54  ? -12.650 -3.691  -0.605  1.00 0.00 ? 54  ASP A C    8  
ATOM 11277 O O    . ASP A 1 54  ? -12.284 -4.805  -0.978  1.00 0.00 ? 54  ASP A O    8  
ATOM 11278 C CB   . ASP A 1 54  ? -11.299 -2.452  -2.268  1.00 0.00 ? 54  ASP A CB   8  
ATOM 11279 C CG   . ASP A 1 54  ? -11.007 -3.608  -3.226  1.00 0.00 ? 54  ASP A CG   8  
ATOM 11280 O OD1  . ASP A 1 54  ? -11.848 -3.827  -4.124  1.00 0.00 ? 54  ASP A OD1  8  
ATOM 11281 O OD2  . ASP A 1 54  ? -9.949  -4.248  -3.038  1.00 0.00 ? 54  ASP A OD2  8  
ATOM 11282 H H    . ASP A 1 54  ? -12.121 -0.786  -0.544  1.00 0.00 ? 54  ASP A H    8  
ATOM 11283 H HA   . ASP A 1 54  ? -13.464 -2.587  -2.314  1.00 0.00 ? 54  ASP A HA   8  
ATOM 11284 H HB2  . ASP A 1 54  ? -11.228 -1.515  -2.820  1.00 0.00 ? 54  ASP A HB2  8  
ATOM 11285 H HB3  . ASP A 1 54  ? -10.523 -2.429  -1.502  1.00 0.00 ? 54  ASP A HB3  8  
ATOM 11286 N N    . GLY A 1 55  ? -13.053 -3.407  0.625   1.00 0.00 ? 55  GLY A N    8  
ATOM 11287 C CA   . GLY A 1 55  ? -13.092 -4.431  1.655   1.00 0.00 ? 55  GLY A CA   8  
ATOM 11288 C C    . GLY A 1 55  ? -11.878 -5.356  1.555   1.00 0.00 ? 55  GLY A C    8  
ATOM 11289 O O    . GLY A 1 55  ? -11.988 -6.559  1.785   1.00 0.00 ? 55  GLY A O    8  
ATOM 11290 H H    . GLY A 1 55  ? -13.349 -2.499  0.921   1.00 0.00 ? 55  GLY A H    8  
ATOM 11291 H HA2  . GLY A 1 55  ? -13.117 -3.962  2.639   1.00 0.00 ? 55  GLY A HA2  8  
ATOM 11292 H HA3  . GLY A 1 55  ? -14.007 -5.015  1.558   1.00 0.00 ? 55  GLY A HA3  8  
ATOM 11293 N N    . ARG A 1 56  ? -10.746 -4.759  1.212   1.00 0.00 ? 56  ARG A N    8  
ATOM 11294 C CA   . ARG A 1 56  ? -9.512  -5.514  1.079   1.00 0.00 ? 56  ARG A CA   8  
ATOM 11295 C C    . ARG A 1 56  ? -8.371  -4.799  1.805   1.00 0.00 ? 56  ARG A C    8  
ATOM 11296 O O    . ARG A 1 56  ? -7.522  -5.442  2.421   1.00 0.00 ? 56  ARG A O    8  
ATOM 11297 C CB   . ARG A 1 56  ? -9.134  -5.698  -0.392  1.00 0.00 ? 56  ARG A CB   8  
ATOM 11298 C CG   . ARG A 1 56  ? -8.801  -7.160  -0.694  1.00 0.00 ? 56  ARG A CG   8  
ATOM 11299 C CD   . ARG A 1 56  ? -10.048 -8.040  -0.586  1.00 0.00 ? 56  ARG A CD   8  
ATOM 11300 N NE   . ARG A 1 56  ? -10.103 -8.677  0.749   1.00 0.00 ? 56  ARG A NE   8  
ATOM 11301 C CZ   . ARG A 1 56  ? -9.295  -9.671  1.142   1.00 0.00 ? 56  ARG A CZ   8  
ATOM 11302 N NH1  . ARG A 1 56  ? -8.364  -10.147 0.304   1.00 0.00 ? 56  ARG A NH1  8  
ATOM 11303 N NH2  . ARG A 1 56  ? -9.417  -10.188 2.372   1.00 0.00 ? 56  ARG A NH2  8  
ATOM 11304 H H    . ARG A 1 56  ? -10.664 -3.779  1.027   1.00 0.00 ? 56  ARG A H    8  
ATOM 11305 H HA   . ARG A 1 56  ? -9.724  -6.479  1.538   1.00 0.00 ? 56  ARG A HA   8  
ATOM 11306 H HB2  . ARG A 1 56  ? -9.958  -5.370  -1.026  1.00 0.00 ? 56  ARG A HB2  8  
ATOM 11307 H HB3  . ARG A 1 56  ? -8.278  -5.068  -0.633  1.00 0.00 ? 56  ARG A HB3  8  
ATOM 11308 H HG2  . ARG A 1 56  ? -8.380  -7.241  -1.697  1.00 0.00 ? 56  ARG A HG2  8  
ATOM 11309 H HG3  . ARG A 1 56  ? -8.040  -7.514  0.001   1.00 0.00 ? 56  ARG A HG3  8  
ATOM 11310 H HD2  . ARG A 1 56  ? -10.942 -7.440  -0.749  1.00 0.00 ? 56  ARG A HD2  8  
ATOM 11311 H HD3  . ARG A 1 56  ? -10.032 -8.805  -1.362  1.00 0.00 ? 56  ARG A HD3  8  
ATOM 11312 H HE   . ARG A 1 56  ? -10.787 -8.345  1.399   1.00 0.00 ? 56  ARG A HE   8  
ATOM 11313 H HH11 . ARG A 1 56  ? -8.272  -9.761  -0.614  1.00 0.00 ? 56  ARG A HH11 8  
ATOM 11314 H HH12 . ARG A 1 56  ? -7.760  -10.889 0.597   1.00 0.00 ? 56  ARG A HH12 8  
ATOM 11315 H HH21 . ARG A 1 56  ? -10.112 -9.832  2.997   1.00 0.00 ? 56  ARG A HH21 8  
ATOM 11316 H HH22 . ARG A 1 56  ? -8.813  -10.929 2.665   1.00 0.00 ? 56  ARG A HH22 8  
ATOM 11317 N N    . LEU A 1 57  ? -8.387  -3.477  1.709   1.00 0.00 ? 57  LEU A N    8  
ATOM 11318 C CA   . LEU A 1 57  ? -7.364  -2.668  2.349   1.00 0.00 ? 57  LEU A CA   8  
ATOM 11319 C C    . LEU A 1 57  ? -7.610  -2.643  3.859   1.00 0.00 ? 57  LEU A C    8  
ATOM 11320 O O    . LEU A 1 57  ? -8.735  -2.850  4.312   1.00 0.00 ? 57  LEU A O    8  
ATOM 11321 C CB   . LEU A 1 57  ? -7.306  -1.277  1.714   1.00 0.00 ? 57  LEU A CB   8  
ATOM 11322 C CG   . LEU A 1 57  ? -6.648  -1.198  0.334   1.00 0.00 ? 57  LEU A CG   8  
ATOM 11323 C CD1  . LEU A 1 57  ? -7.557  -1.794  -0.742  1.00 0.00 ? 57  LEU A CD1  8  
ATOM 11324 C CD2  . LEU A 1 57  ? -6.237  0.239   0.005   1.00 0.00 ? 57  LEU A CD2  8  
ATOM 11325 H H    . LEU A 1 57  ? -9.081  -2.962  1.206   1.00 0.00 ? 57  LEU A H    8  
ATOM 11326 H HA   . LEU A 1 57  ? -6.404  -3.148  2.163   1.00 0.00 ? 57  LEU A HA   8  
ATOM 11327 H HB2  . LEU A 1 57  ? -8.323  -0.894  1.632   1.00 0.00 ? 57  LEU A HB2  8  
ATOM 11328 H HB3  . LEU A 1 57  ? -6.768  -0.613  2.390   1.00 0.00 ? 57  LEU A HB3  8  
ATOM 11329 H HG   . LEU A 1 57  ? -5.738  -1.797  0.355   1.00 0.00 ? 57  LEU A HG   8  
ATOM 11330 H HD11 . LEU A 1 57  ? -7.517  -1.173  -1.637  1.00 0.00 ? 57  LEU A HD11 8  
ATOM 11331 H HD12 . LEU A 1 57  ? -7.221  -2.802  -0.984  1.00 0.00 ? 57  LEU A HD12 8  
ATOM 11332 H HD13 . LEU A 1 57  ? -8.582  -1.832  -0.372  1.00 0.00 ? 57  LEU A HD13 8  
ATOM 11333 H HD21 . LEU A 1 57  ? -6.957  0.674   -0.688  1.00 0.00 ? 57  LEU A HD21 8  
ATOM 11334 H HD22 . LEU A 1 57  ? -6.212  0.829   0.921   1.00 0.00 ? 57  LEU A HD22 8  
ATOM 11335 H HD23 . LEU A 1 57  ? -5.247  0.237   -0.453  1.00 0.00 ? 57  LEU A HD23 8  
ATOM 11336 N N    . ALA A 1 58  ? -6.539  -2.389  4.597   1.00 0.00 ? 58  ALA A N    8  
ATOM 11337 C CA   . ALA A 1 58  ? -6.625  -2.335  6.047   1.00 0.00 ? 58  ALA A CA   8  
ATOM 11338 C C    . ALA A 1 58  ? -5.218  -2.430  6.640   1.00 0.00 ? 58  ALA A C    8  
ATOM 11339 O O    . ALA A 1 58  ? -4.244  -2.614  5.911   1.00 0.00 ? 58  ALA A O    8  
ATOM 11340 C CB   . ALA A 1 58  ? -7.544  -3.452  6.546   1.00 0.00 ? 58  ALA A CB   8  
ATOM 11341 H H    . ALA A 1 58  ? -5.628  -2.223  4.221   1.00 0.00 ? 58  ALA A H    8  
ATOM 11342 H HA   . ALA A 1 58  ? -7.061  -1.374  6.318   1.00 0.00 ? 58  ALA A HA   8  
ATOM 11343 H HB1  . ALA A 1 58  ? -7.543  -4.272  5.828   1.00 0.00 ? 58  ALA A HB1  8  
ATOM 11344 H HB2  . ALA A 1 58  ? -7.187  -3.813  7.510   1.00 0.00 ? 58  ALA A HB2  8  
ATOM 11345 H HB3  . ALA A 1 58  ? -8.558  -3.067  6.655   1.00 0.00 ? 58  ALA A HB3  8  
ATOM 11346 N N    . ALA A 1 59  ? -5.156  -2.299  7.957   1.00 0.00 ? 59  ALA A N    8  
ATOM 11347 C CA   . ALA A 1 59  ? -3.884  -2.367  8.656   1.00 0.00 ? 59  ALA A CA   8  
ATOM 11348 C C    . ALA A 1 59  ? -3.157  -3.653  8.260   1.00 0.00 ? 59  ALA A C    8  
ATOM 11349 O O    . ALA A 1 59  ? -3.773  -4.714  8.161   1.00 0.00 ? 59  ALA A O    8  
ATOM 11350 C CB   . ALA A 1 59  ? -4.125  -2.275  10.164  1.00 0.00 ? 59  ALA A CB   8  
ATOM 11351 H H    . ALA A 1 59  ? -5.952  -2.149  8.542   1.00 0.00 ? 59  ALA A H    8  
ATOM 11352 H HA   . ALA A 1 59  ? -3.287  -1.511  8.343   1.00 0.00 ? 59  ALA A HA   8  
ATOM 11353 H HB1  . ALA A 1 59  ? -3.601  -1.406  10.564  1.00 0.00 ? 59  ALA A HB1  8  
ATOM 11354 H HB2  . ALA A 1 59  ? -5.193  -2.175  10.356  1.00 0.00 ? 59  ALA A HB2  8  
ATOM 11355 H HB3  . ALA A 1 59  ? -3.752  -3.178  10.648  1.00 0.00 ? 59  ALA A HB3  8  
ATOM 11356 N N    . GLY A 1 60  ? -1.857  -3.518  8.043   1.00 0.00 ? 60  GLY A N    8  
ATOM 11357 C CA   . GLY A 1 60  ? -1.039  -4.656  7.659   1.00 0.00 ? 60  GLY A CA   8  
ATOM 11358 C C    . GLY A 1 60  ? -0.801  -4.675  6.148   1.00 0.00 ? 60  GLY A C    8  
ATOM 11359 O O    . GLY A 1 60  ? 0.024   -5.444  5.656   1.00 0.00 ? 60  GLY A O    8  
ATOM 11360 H H    . GLY A 1 60  ? -1.363  -2.652  8.125   1.00 0.00 ? 60  GLY A H    8  
ATOM 11361 H HA2  . GLY A 1 60  ? -0.083  -4.614  8.182   1.00 0.00 ? 60  GLY A HA2  8  
ATOM 11362 H HA3  . GLY A 1 60  ? -1.529  -5.580  7.965   1.00 0.00 ? 60  GLY A HA3  8  
ATOM 11363 N N    . ASP A 1 61  ? -1.537  -3.820  5.454   1.00 0.00 ? 61  ASP A N    8  
ATOM 11364 C CA   . ASP A 1 61  ? -1.416  -3.729  4.009   1.00 0.00 ? 61  ASP A CA   8  
ATOM 11365 C C    . ASP A 1 61  ? -0.038  -3.168  3.651   1.00 0.00 ? 61  ASP A C    8  
ATOM 11366 O O    . ASP A 1 61  ? 0.064   -2.115  3.025   1.00 0.00 ? 61  ASP A O    8  
ATOM 11367 C CB   . ASP A 1 61  ? -2.474  -2.790  3.426   1.00 0.00 ? 61  ASP A CB   8  
ATOM 11368 C CG   . ASP A 1 61  ? -3.599  -3.484  2.655   1.00 0.00 ? 61  ASP A CG   8  
ATOM 11369 O OD1  . ASP A 1 61  ? -3.902  -4.642  3.013   1.00 0.00 ? 61  ASP A OD1  8  
ATOM 11370 O OD2  . ASP A 1 61  ? -4.131  -2.839  1.725   1.00 0.00 ? 61  ASP A OD2  8  
ATOM 11371 H H    . ASP A 1 61  ? -2.205  -3.198  5.862   1.00 0.00 ? 61  ASP A H    8  
ATOM 11372 H HA   . ASP A 1 61  ? -1.559  -4.746  3.645   1.00 0.00 ? 61  ASP A HA   8  
ATOM 11373 H HB2  . ASP A 1 61  ? -2.913  -2.212  4.239   1.00 0.00 ? 61  ASP A HB2  8  
ATOM 11374 H HB3  . ASP A 1 61  ? -1.981  -2.081  2.760   1.00 0.00 ? 61  ASP A HB3  8  
ATOM 11375 N N    . GLN A 1 62  ? 0.988   -3.897  4.065   1.00 0.00 ? 62  GLN A N    8  
ATOM 11376 C CA   . GLN A 1 62  ? 2.356   -3.486  3.796   1.00 0.00 ? 62  GLN A CA   8  
ATOM 11377 C C    . GLN A 1 62  ? 2.572   -3.316  2.291   1.00 0.00 ? 62  GLN A C    8  
ATOM 11378 O O    . GLN A 1 62  ? 2.596   -4.296  1.549   1.00 0.00 ? 62  GLN A O    8  
ATOM 11379 C CB   . GLN A 1 62  ? 3.354   -4.485  4.385   1.00 0.00 ? 62  GLN A CB   8  
ATOM 11380 C CG   . GLN A 1 62  ? 4.793   -4.081  4.056   1.00 0.00 ? 62  GLN A CG   8  
ATOM 11381 C CD   . GLN A 1 62  ? 5.576   -5.262  3.478   1.00 0.00 ? 62  GLN A CD   8  
ATOM 11382 O OE1  . GLN A 1 62  ? 5.356   -5.698  2.360   1.00 0.00 ? 62  GLN A OE1  8  
ATOM 11383 N NE2  . GLN A 1 62  ? 6.499   -5.752  4.300   1.00 0.00 ? 62  GLN A NE2  8  
ATOM 11384 H H    . GLN A 1 62  ? 0.896   -4.753  4.575   1.00 0.00 ? 62  GLN A H    8  
ATOM 11385 H HA   . GLN A 1 62  ? 2.473   -2.526  4.298   1.00 0.00 ? 62  GLN A HA   8  
ATOM 11386 H HB2  . GLN A 1 62  ? 3.226   -4.539  5.466   1.00 0.00 ? 62  GLN A HB2  8  
ATOM 11387 H HB3  . GLN A 1 62  ? 3.153   -5.481  3.990   1.00 0.00 ? 62  GLN A HB3  8  
ATOM 11388 H HG2  . GLN A 1 62  ? 4.788   -3.258  3.340   1.00 0.00 ? 62  GLN A HG2  8  
ATOM 11389 H HG3  . GLN A 1 62  ? 5.287   -3.717  4.956   1.00 0.00 ? 62  GLN A HG3  8  
ATOM 11390 H HE21 . GLN A 1 62  ? 6.628   -5.347  5.206   1.00 0.00 ? 62  GLN A HE21 8  
ATOM 11391 H HE22 . GLN A 1 62  ? 7.064   -6.526  4.013   1.00 0.00 ? 62  GLN A HE22 8  
ATOM 11392 N N    . LEU A 1 63  ? 2.725   -2.064  1.886   1.00 0.00 ? 63  LEU A N    8  
ATOM 11393 C CA   . LEU A 1 63  ? 2.939   -1.752  0.483   1.00 0.00 ? 63  LEU A CA   8  
ATOM 11394 C C    . LEU A 1 63  ? 4.420   -1.935  0.145   1.00 0.00 ? 63  LEU A C    8  
ATOM 11395 O O    . LEU A 1 63  ? 5.269   -1.190  0.633   1.00 0.00 ? 63  LEU A O    8  
ATOM 11396 C CB   . LEU A 1 63  ? 2.401   -0.358  0.156   1.00 0.00 ? 63  LEU A CB   8  
ATOM 11397 C CG   . LEU A 1 63  ? 0.952   -0.086  0.563   1.00 0.00 ? 63  LEU A CG   8  
ATOM 11398 C CD1  . LEU A 1 63  ? 0.889   0.730   1.856   1.00 0.00 ? 63  LEU A CD1  8  
ATOM 11399 C CD2  . LEU A 1 63  ? 0.179   0.584   -0.576  1.00 0.00 ? 63  LEU A CD2  8  
ATOM 11400 H H    . LEU A 1 63  ? 2.705   -1.272  2.497   1.00 0.00 ? 63  LEU A H    8  
ATOM 11401 H HA   . LEU A 1 63  ? 2.360   -2.466  -0.102  1.00 0.00 ? 63  LEU A HA   8  
ATOM 11402 H HB2  . LEU A 1 63  ? 3.039   0.380   0.643   1.00 0.00 ? 63  LEU A HB2  8  
ATOM 11403 H HB3  . LEU A 1 63  ? 2.492   -0.198  -0.918  1.00 0.00 ? 63  LEU A HB3  8  
ATOM 11404 H HG   . LEU A 1 63  ? 0.467   -1.042  0.761   1.00 0.00 ? 63  LEU A HG   8  
ATOM 11405 H HD11 . LEU A 1 63  ? 1.041   1.785   1.627   1.00 0.00 ? 63  LEU A HD11 8  
ATOM 11406 H HD12 . LEU A 1 63  ? -0.087  0.596   2.322   1.00 0.00 ? 63  LEU A HD12 8  
ATOM 11407 H HD13 . LEU A 1 63  ? 1.668   0.389   2.538   1.00 0.00 ? 63  LEU A HD13 8  
ATOM 11408 H HD21 . LEU A 1 63  ? -0.715  1.063   -0.176  1.00 0.00 ? 63  LEU A HD21 8  
ATOM 11409 H HD22 . LEU A 1 63  ? 0.811   1.334   -1.051  1.00 0.00 ? 63  LEU A HD22 8  
ATOM 11410 H HD23 . LEU A 1 63  ? -0.109  -0.167  -1.311  1.00 0.00 ? 63  LEU A HD23 8  
ATOM 11411 N N    . LEU A 1 64  ? 4.686   -2.930  -0.688  1.00 0.00 ? 64  LEU A N    8  
ATOM 11412 C CA   . LEU A 1 64  ? 6.049   -3.220  -1.098  1.00 0.00 ? 64  LEU A CA   8  
ATOM 11413 C C    . LEU A 1 64  ? 6.451   -2.270  -2.227  1.00 0.00 ? 64  LEU A C    8  
ATOM 11414 O O    . LEU A 1 64  ? 7.628   -1.949  -2.384  1.00 0.00 ? 64  LEU A O    8  
ATOM 11415 C CB   . LEU A 1 64  ? 6.198   -4.700  -1.457  1.00 0.00 ? 64  LEU A CB   8  
ATOM 11416 C CG   . LEU A 1 64  ? 7.019   -5.548  -0.483  1.00 0.00 ? 64  LEU A CG   8  
ATOM 11417 C CD1  . LEU A 1 64  ? 6.391   -6.930  -0.296  1.00 0.00 ? 64  LEU A CD1  8  
ATOM 11418 C CD2  . LEU A 1 64  ? 8.479   -5.637  -0.931  1.00 0.00 ? 64  LEU A CD2  8  
ATOM 11419 H H    . LEU A 1 64  ? 3.990   -3.532  -1.081  1.00 0.00 ? 64  LEU A H    8  
ATOM 11420 H HA   . LEU A 1 64  ? 6.695   -3.031  -0.240  1.00 0.00 ? 64  LEU A HA   8  
ATOM 11421 H HB2  . LEU A 1 64  ? 5.202   -5.136  -1.536  1.00 0.00 ? 64  LEU A HB2  8  
ATOM 11422 H HB3  . LEU A 1 64  ? 6.655   -4.770  -2.444  1.00 0.00 ? 64  LEU A HB3  8  
ATOM 11423 H HG   . LEU A 1 64  ? 7.010   -5.056  0.490   1.00 0.00 ? 64  LEU A HG   8  
ATOM 11424 H HD11 . LEU A 1 64  ? 6.463   -7.223  0.752   1.00 0.00 ? 64  LEU A HD11 8  
ATOM 11425 H HD12 . LEU A 1 64  ? 5.343   -6.897  -0.593  1.00 0.00 ? 64  LEU A HD12 8  
ATOM 11426 H HD13 . LEU A 1 64  ? 6.921   -7.656  -0.912  1.00 0.00 ? 64  LEU A HD13 8  
ATOM 11427 H HD21 . LEU A 1 64  ? 8.535   -6.155  -1.889  1.00 0.00 ? 64  LEU A HD21 8  
ATOM 11428 H HD22 . LEU A 1 64  ? 8.889   -4.632  -1.037  1.00 0.00 ? 64  LEU A HD22 8  
ATOM 11429 H HD23 . LEU A 1 64  ? 9.055   -6.187  -0.187  1.00 0.00 ? 64  LEU A HD23 8  
ATOM 11430 N N    . SER A 1 65  ? 5.450   -1.847  -2.986  1.00 0.00 ? 65  SER A N    8  
ATOM 11431 C CA   . SER A 1 65  ? 5.685   -0.940  -4.096  1.00 0.00 ? 65  SER A CA   8  
ATOM 11432 C C    . SER A 1 65  ? 4.351   -0.443  -4.656  1.00 0.00 ? 65  SER A C    8  
ATOM 11433 O O    . SER A 1 65  ? 3.337   -1.133  -4.560  1.00 0.00 ? 65  SER A O    8  
ATOM 11434 C CB   . SER A 1 65  ? 6.503   -1.617  -5.197  1.00 0.00 ? 65  SER A CB   8  
ATOM 11435 O OG   . SER A 1 65  ? 7.497   -2.488  -4.664  1.00 0.00 ? 65  SER A OG   8  
ATOM 11436 H H    . SER A 1 65  ? 4.496   -2.113  -2.851  1.00 0.00 ? 65  SER A H    8  
ATOM 11437 H HA   . SER A 1 65  ? 6.256   -0.112  -3.677  1.00 0.00 ? 65  SER A HA   8  
ATOM 11438 H HB2  . SER A 1 65  ? 5.837   -2.183  -5.849  1.00 0.00 ? 65  SER A HB2  8  
ATOM 11439 H HB3  . SER A 1 65  ? 6.981   -0.856  -5.814  1.00 0.00 ? 65  SER A HB3  8  
ATOM 11440 H HG   . SER A 1 65  ? 8.074   -2.840  -5.401  1.00 0.00 ? 65  SER A HG   8  
ATOM 11441 N N    . VAL A 1 66  ? 4.394   0.751   -5.230  1.00 0.00 ? 66  VAL A N    8  
ATOM 11442 C CA   . VAL A 1 66  ? 3.201   1.349   -5.805  1.00 0.00 ? 66  VAL A CA   8  
ATOM 11443 C C    . VAL A 1 66  ? 3.525   1.877   -7.204  1.00 0.00 ? 66  VAL A C    8  
ATOM 11444 O O    . VAL A 1 66  ? 4.516   2.580   -7.392  1.00 0.00 ? 66  VAL A O    8  
ATOM 11445 C CB   . VAL A 1 66  ? 2.654   2.429   -4.870  1.00 0.00 ? 66  VAL A CB   8  
ATOM 11446 C CG1  . VAL A 1 66  ? 1.343   3.007   -5.408  1.00 0.00 ? 66  VAL A CG1  8  
ATOM 11447 C CG2  . VAL A 1 66  ? 2.473   1.886   -3.451  1.00 0.00 ? 66  VAL A CG2  8  
ATOM 11448 H H    . VAL A 1 66  ? 5.222   1.306   -5.304  1.00 0.00 ? 66  VAL A H    8  
ATOM 11449 H HA   . VAL A 1 66  ? 2.449   0.564   -5.891  1.00 0.00 ? 66  VAL A HA   8  
ATOM 11450 H HB   . VAL A 1 66  ? 3.384   3.238   -4.828  1.00 0.00 ? 66  VAL A HB   8  
ATOM 11451 H HG11 . VAL A 1 66  ? 1.235   2.744   -6.460  1.00 0.00 ? 66  VAL A HG11 8  
ATOM 11452 H HG12 . VAL A 1 66  ? 0.506   2.596   -4.843  1.00 0.00 ? 66  VAL A HG12 8  
ATOM 11453 H HG13 . VAL A 1 66  ? 1.354   4.092   -5.304  1.00 0.00 ? 66  VAL A HG13 8  
ATOM 11454 H HG21 . VAL A 1 66  ? 2.475   2.714   -2.742  1.00 0.00 ? 66  VAL A HG21 8  
ATOM 11455 H HG22 . VAL A 1 66  ? 1.524   1.354   -3.385  1.00 0.00 ? 66  VAL A HG22 8  
ATOM 11456 H HG23 . VAL A 1 66  ? 3.290   1.204   -3.216  1.00 0.00 ? 66  VAL A HG23 8  
ATOM 11457 N N    . ASP A 1 67  ? 2.669   1.518   -8.150  1.00 0.00 ? 67  ASP A N    8  
ATOM 11458 C CA   . ASP A 1 67  ? 2.852   1.946   -9.526  1.00 0.00 ? 67  ASP A CA   8  
ATOM 11459 C C    . ASP A 1 67  ? 4.265   1.584   -9.986  1.00 0.00 ? 67  ASP A C    8  
ATOM 11460 O O    . ASP A 1 67  ? 4.876   2.316   -10.762 1.00 0.00 ? 67  ASP A O    8  
ATOM 11461 C CB   . ASP A 1 67  ? 2.686   3.462   -9.657  1.00 0.00 ? 67  ASP A CB   8  
ATOM 11462 C CG   . ASP A 1 67  ? 1.239   3.948   -9.751  1.00 0.00 ? 67  ASP A CG   8  
ATOM 11463 O OD1  . ASP A 1 67  ? 0.580   3.978   -8.689  1.00 0.00 ? 67  ASP A OD1  8  
ATOM 11464 O OD2  . ASP A 1 67  ? 0.823   4.280   -10.882 1.00 0.00 ? 67  ASP A OD2  8  
ATOM 11465 H H    . ASP A 1 67  ? 1.865   0.945   -7.989  1.00 0.00 ? 67  ASP A H    8  
ATOM 11466 H HA   . ASP A 1 67  ? 2.082   1.424   -10.094 1.00 0.00 ? 67  ASP A HA   8  
ATOM 11467 H HB2  . ASP A 1 67  ? 3.160   3.940   -8.800  1.00 0.00 ? 67  ASP A HB2  8  
ATOM 11468 H HB3  . ASP A 1 67  ? 3.224   3.795   -10.545 1.00 0.00 ? 67  ASP A HB3  8  
ATOM 11469 N N    . GLY A 1 68  ? 4.744   0.454   -9.486  1.00 0.00 ? 68  GLY A N    8  
ATOM 11470 C CA   . GLY A 1 68  ? 6.074   -0.015  -9.836  1.00 0.00 ? 68  GLY A CA   8  
ATOM 11471 C C    . GLY A 1 68  ? 7.123   0.545   -8.873  1.00 0.00 ? 68  GLY A C    8  
ATOM 11472 O O    . GLY A 1 68  ? 8.119   -0.116  -8.582  1.00 0.00 ? 68  GLY A O    8  
ATOM 11473 H H    . GLY A 1 68  ? 4.240   -0.136  -8.855  1.00 0.00 ? 68  GLY A H    8  
ATOM 11474 H HA2  . GLY A 1 68  ? 6.097   -1.104  -9.812  1.00 0.00 ? 68  GLY A HA2  8  
ATOM 11475 H HA3  . GLY A 1 68  ? 6.313   0.286   -10.856 1.00 0.00 ? 68  GLY A HA3  8  
ATOM 11476 N N    . ARG A 1 69  ? 6.864   1.757   -8.406  1.00 0.00 ? 69  ARG A N    8  
ATOM 11477 C CA   . ARG A 1 69  ? 7.773   2.414   -7.483  1.00 0.00 ? 69  ARG A CA   8  
ATOM 11478 C C    . ARG A 1 69  ? 7.756   1.705   -6.127  1.00 0.00 ? 69  ARG A C    8  
ATOM 11479 O O    . ARG A 1 69  ? 6.718   1.641   -5.470  1.00 0.00 ? 69  ARG A O    8  
ATOM 11480 C CB   . ARG A 1 69  ? 7.395   3.883   -7.288  1.00 0.00 ? 69  ARG A CB   8  
ATOM 11481 C CG   . ARG A 1 69  ? 8.638   4.743   -7.049  1.00 0.00 ? 69  ARG A CG   8  
ATOM 11482 C CD   . ARG A 1 69  ? 9.614   4.634   -8.222  1.00 0.00 ? 69  ARG A CD   8  
ATOM 11483 N NE   . ARG A 1 69  ? 10.788  3.823   -7.829  1.00 0.00 ? 69  ARG A NE   8  
ATOM 11484 C CZ   . ARG A 1 69  ? 11.604  4.127   -6.810  1.00 0.00 ? 69  ARG A CZ   8  
ATOM 11485 N NH1  . ARG A 1 69  ? 11.379  5.225   -6.076  1.00 0.00 ? 69  ARG A NH1  8  
ATOM 11486 N NH2  . ARG A 1 69  ? 12.646  3.333   -6.526  1.00 0.00 ? 69  ARG A NH2  8  
ATOM 11487 H H    . ARG A 1 69  ? 6.051   2.288   -8.648  1.00 0.00 ? 69  ARG A H    8  
ATOM 11488 H HA   . ARG A 1 69  ? 8.753   2.335   -7.954  1.00 0.00 ? 69  ARG A HA   8  
ATOM 11489 H HB2  . ARG A 1 69  ? 6.862   4.245   -8.167  1.00 0.00 ? 69  ARG A HB2  8  
ATOM 11490 H HB3  . ARG A 1 69  ? 6.714   3.978   -6.441  1.00 0.00 ? 69  ARG A HB3  8  
ATOM 11491 H HG2  . ARG A 1 69  ? 8.344   5.783   -6.911  1.00 0.00 ? 69  ARG A HG2  8  
ATOM 11492 H HG3  . ARG A 1 69  ? 9.131   4.427   -6.129  1.00 0.00 ? 69  ARG A HG3  8  
ATOM 11493 H HD2  . ARG A 1 69  ? 9.117   4.178   -9.078  1.00 0.00 ? 69  ARG A HD2  8  
ATOM 11494 H HD3  . ARG A 1 69  ? 9.935   5.628   -8.532  1.00 0.00 ? 69  ARG A HD3  8  
ATOM 11495 H HE   . ARG A 1 69  ? 10.985  2.997   -8.357  1.00 0.00 ? 69  ARG A HE   8  
ATOM 11496 H HH11 . ARG A 1 69  ? 10.601  5.817   -6.288  1.00 0.00 ? 69  ARG A HH11 8  
ATOM 11497 H HH12 . ARG A 1 69  ? 11.988  5.451   -5.316  1.00 0.00 ? 69  ARG A HH12 8  
ATOM 11498 H HH21 . ARG A 1 69  ? 12.814  2.514   -7.075  1.00 0.00 ? 69  ARG A HH21 8  
ATOM 11499 H HH22 . ARG A 1 69  ? 13.255  3.560   -5.766  1.00 0.00 ? 69  ARG A HH22 8  
ATOM 11500 N N    . SER A 1 70  ? 8.917   1.192   -5.748  1.00 0.00 ? 70  SER A N    8  
ATOM 11501 C CA   . SER A 1 70  ? 9.048   0.491   -4.482  1.00 0.00 ? 70  SER A CA   8  
ATOM 11502 C C    . SER A 1 70  ? 8.519   1.364   -3.343  1.00 0.00 ? 70  SER A C    8  
ATOM 11503 O O    . SER A 1 70  ? 8.768   2.568   -3.312  1.00 0.00 ? 70  SER A O    8  
ATOM 11504 C CB   . SER A 1 70  ? 10.503  0.098   -4.218  1.00 0.00 ? 70  SER A CB   8  
ATOM 11505 O OG   . SER A 1 70  ? 10.936  -0.954  -5.077  1.00 0.00 ? 70  SER A OG   8  
ATOM 11506 H H    . SER A 1 70  ? 9.756   1.249   -6.289  1.00 0.00 ? 70  SER A H    8  
ATOM 11507 H HA   . SER A 1 70  ? 8.442   -0.410  -4.587  1.00 0.00 ? 70  SER A HA   8  
ATOM 11508 H HB2  . SER A 1 70  ? 11.144  0.968   -4.359  1.00 0.00 ? 70  SER A HB2  8  
ATOM 11509 H HB3  . SER A 1 70  ? 10.611  -0.214  -3.180  1.00 0.00 ? 70  SER A HB3  8  
ATOM 11510 H HG   . SER A 1 70  ? 10.356  -1.759  -4.950  1.00 0.00 ? 70  SER A HG   8  
ATOM 11511 N N    . LEU A 1 71  ? 7.798   0.723   -2.435  1.00 0.00 ? 71  LEU A N    8  
ATOM 11512 C CA   . LEU A 1 71  ? 7.231   1.427   -1.297  1.00 0.00 ? 71  LEU A CA   8  
ATOM 11513 C C    . LEU A 1 71  ? 7.753   0.798   -0.003  1.00 0.00 ? 71  LEU A C    8  
ATOM 11514 O O    . LEU A 1 71  ? 7.496   1.308   1.087   1.00 0.00 ? 71  LEU A O    8  
ATOM 11515 C CB   . LEU A 1 71  ? 5.705   1.459   -1.392  1.00 0.00 ? 71  LEU A CB   8  
ATOM 11516 C CG   . LEU A 1 71  ? 5.038   2.788   -1.030  1.00 0.00 ? 71  LEU A CG   8  
ATOM 11517 C CD1  . LEU A 1 71  ? 5.027   3.740   -2.228  1.00 0.00 ? 71  LEU A CD1  8  
ATOM 11518 C CD2  . LEU A 1 71  ? 3.634   2.561   -0.465  1.00 0.00 ? 71  LEU A CD2  8  
ATOM 11519 H H    . LEU A 1 71  ? 7.599   -0.256  -2.468  1.00 0.00 ? 71  LEU A H    8  
ATOM 11520 H HA   . LEU A 1 71  ? 7.579   2.459   -1.344  1.00 0.00 ? 71  LEU A HA   8  
ATOM 11521 H HB2  . LEU A 1 71  ? 5.419   1.198   -2.411  1.00 0.00 ? 71  LEU A HB2  8  
ATOM 11522 H HB3  . LEU A 1 71  ? 5.303   0.684   -0.740  1.00 0.00 ? 71  LEU A HB3  8  
ATOM 11523 H HG   . LEU A 1 71  ? 5.628   3.264   -0.246  1.00 0.00 ? 71  LEU A HG   8  
ATOM 11524 H HD11 . LEU A 1 71  ? 5.521   4.672   -1.955  1.00 0.00 ? 71  LEU A HD11 8  
ATOM 11525 H HD12 . LEU A 1 71  ? 5.555   3.280   -3.063  1.00 0.00 ? 71  LEU A HD12 8  
ATOM 11526 H HD13 . LEU A 1 71  ? 3.997   3.946   -2.519  1.00 0.00 ? 71  LEU A HD13 8  
ATOM 11527 H HD21 . LEU A 1 71  ? 3.142   1.766   -1.025  1.00 0.00 ? 71  LEU A HD21 8  
ATOM 11528 H HD22 . LEU A 1 71  ? 3.707   2.276   0.584   1.00 0.00 ? 71  LEU A HD22 8  
ATOM 11529 H HD23 . LEU A 1 71  ? 3.055   3.480   -0.553  1.00 0.00 ? 71  LEU A HD23 8  
ATOM 11530 N N    . VAL A 1 72  ? 8.476   -0.300  -0.166  1.00 0.00 ? 72  VAL A N    8  
ATOM 11531 C CA   . VAL A 1 72  ? 9.037   -1.003  0.975   1.00 0.00 ? 72  VAL A CA   8  
ATOM 11532 C C    . VAL A 1 72  ? 10.145  -0.153  1.599   1.00 0.00 ? 72  VAL A C    8  
ATOM 11533 O O    . VAL A 1 72  ? 11.277  -0.612  1.744   1.00 0.00 ? 72  VAL A O    8  
ATOM 11534 C CB   . VAL A 1 72  ? 9.516   -2.392  0.550   1.00 0.00 ? 72  VAL A CB   8  
ATOM 11535 C CG1  . VAL A 1 72  ? 10.601  -2.292  -0.524  1.00 0.00 ? 72  VAL A CG1  8  
ATOM 11536 C CG2  . VAL A 1 72  ? 10.011  -3.195  1.755   1.00 0.00 ? 72  VAL A CG2  8  
ATOM 11537 H H    . VAL A 1 72  ? 8.681   -0.708  -1.056  1.00 0.00 ? 72  VAL A H    8  
ATOM 11538 H HA   . VAL A 1 72  ? 8.239   -1.131  1.707   1.00 0.00 ? 72  VAL A HA   8  
ATOM 11539 H HB   . VAL A 1 72  ? 8.667   -2.923  0.120   1.00 0.00 ? 72  VAL A HB   8  
ATOM 11540 H HG11 . VAL A 1 72  ? 11.357  -1.572  -0.211  1.00 0.00 ? 72  VAL A HG11 8  
ATOM 11541 H HG12 . VAL A 1 72  ? 11.066  -3.269  -0.664  1.00 0.00 ? 72  VAL A HG12 8  
ATOM 11542 H HG13 . VAL A 1 72  ? 10.154  -1.965  -1.463  1.00 0.00 ? 72  VAL A HG13 8  
ATOM 11543 H HG21 . VAL A 1 72  ? 10.117  -4.243  1.475   1.00 0.00 ? 72  VAL A HG21 8  
ATOM 11544 H HG22 . VAL A 1 72  ? 10.975  -2.805  2.080   1.00 0.00 ? 72  VAL A HG22 8  
ATOM 11545 H HG23 . VAL A 1 72  ? 9.291   -3.108  2.569   1.00 0.00 ? 72  VAL A HG23 8  
ATOM 11546 N N    . GLY A 1 73  ? 9.780   1.071   1.952   1.00 0.00 ? 73  GLY A N    8  
ATOM 11547 C CA   . GLY A 1 73  ? 10.730  1.990   2.557   1.00 0.00 ? 73  GLY A CA   8  
ATOM 11548 C C    . GLY A 1 73  ? 10.542  3.408   2.015   1.00 0.00 ? 73  GLY A C    8  
ATOM 11549 O O    . GLY A 1 73  ? 11.517  4.117   1.769   1.00 0.00 ? 73  GLY A O    8  
ATOM 11550 H H    . GLY A 1 73