data_1Y00
# 
_entry.id   1Y00 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1Y00         
RCSB  RCSB030943   
WWPDB D_1000030943 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          CSRA_ECOLI 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1Y00 
_pdbx_database_status.recvd_initial_deposition_date   2004-11-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gutierrez, P.'                                                     1 
'Li, Y.'                                                            2 
'Osborne, M.J.'                                                     3 
'Liu, Q.'                                                           4 
'Gehring, K.'                                                       5 
'Montreal-Kingston Bacterial Structural Genomics Initiative (BSGI)' 6 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the carbon storage regulator protein CsrA from Escherichia coli.' 
_citation.journal_abbrev            J.Bacteriol. 
_citation.journal_volume            187 
_citation.page_first                3496 
_citation.page_last                 3501 
_citation.year                      2005 
_citation.journal_id_ASTM           JOBAAY 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9193 
_citation.journal_id_CSD            0767 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15866937 
_citation.pdbx_database_id_DOI      10.1128/JB.187.10.3496-3501.2005 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gutierrez, P.'    1 
primary 'Li, Y.'           2 
primary 'Osborne, M.J.'    3 
primary 'Pomerantseva, E.' 4 
primary 'Liu, Q.'          5 
primary 'Gehring, K.'      6 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Carbon storage regulator' 
_entity.formula_weight             6864.880 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQQSSY 
_entity_poly.pdbx_seq_one_letter_code_can   MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQQSSY 
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         CSRA_ECOLI 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  LEU n 
1 3  ILE n 
1 4  LEU n 
1 5  THR n 
1 6  ARG n 
1 7  ARG n 
1 8  VAL n 
1 9  GLY n 
1 10 GLU n 
1 11 THR n 
1 12 LEU n 
1 13 MET n 
1 14 ILE n 
1 15 GLY n 
1 16 ASP n 
1 17 GLU n 
1 18 VAL n 
1 19 THR n 
1 20 VAL n 
1 21 THR n 
1 22 VAL n 
1 23 LEU n 
1 24 GLY n 
1 25 VAL n 
1 26 LYS n 
1 27 GLY n 
1 28 ASN n 
1 29 GLN n 
1 30 VAL n 
1 31 ARG n 
1 32 ILE n 
1 33 GLY n 
1 34 VAL n 
1 35 ASN n 
1 36 ALA n 
1 37 PRO n 
1 38 LYS n 
1 39 GLU n 
1 40 VAL n 
1 41 SER n 
1 42 VAL n 
1 43 HIS n 
1 44 ARG n 
1 45 GLU n 
1 46 GLU n 
1 47 ILE n 
1 48 TYR n 
1 49 GLN n 
1 50 ARG n 
1 51 ILE n 
1 52 GLN n 
1 53 ALA n 
1 54 GLU n 
1 55 LYS n 
1 56 SER n 
1 57 GLN n 
1 58 GLN n 
1 59 SER n 
1 60 SER n 
1 61 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 csrA 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CSRA_ECOLI 
_struct_ref.pdbx_db_accession          P69913 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQQSSY 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1Y00 A 1 ? 61 ? P69913 1 ? 61 ? 1 61 
2 1 1Y00 B 1 ? 61 ? P69913 1 ? 61 ? 1 61 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 HNCACB                       
2 1 1 CBCACONH                     
3 2 2 '3D-edited Noesy'            
4 2 2 '3D-edited Tocsy'            
5 3 3 '13C filter edited 3d NOESY' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         303 
_pdbx_nmr_exptl_sample_conditions.pressure            1 
_pdbx_nmr_exptl_sample_conditions.pH                  4.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '300 mM NaCl' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '2mM CsrA 15N, 13C, 50mM Na-Acetate buffer, 300mM NaCl, 10% d20, 90% H20'                 '10% d20, 90% H20' 
2 '2mM CsrA 15N, 50mM Na-Acetate buffer, 300mM NaCl, 10% d20, 90% H20'                      '10% d20, 90% H20' 
3 '2mM mixed 15N,13C/Unlabelled CsrA, 50mM Na-Acetate buffer, 300mM NaCl, 10% d20, 90% H20' '10% d20, 90% H20' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             UNITY 
_pdbx_nmr_spectrometer.field_strength    600 
# 
_pdbx_nmr_refine.entry_id           1Y00 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1Y00 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1Y00 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
CNS     1.1 'structure solution' 'brunger, A.T.' 1 
NMRview ?   'data analysis'      'Johnson, B.A.' 2 
NMRPipe ?   processing           'delaglio, F.'  3 
CNS     1.1 refinement           'brunger, A.T.' 4 
# 
_exptl.entry_id          1Y00 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1Y00 
_struct.title                     'Solution structure of the Carbon Storage Regulator protein CsrA' 
_struct.pdbx_descriptor           'Carbon storage regulator' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1Y00 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN' 
_struct_keywords.text            
;Carbon storage regulation, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, Structural Genomics, RNA BINDING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 45 ? GLN A 52 ? GLU A 45 GLN A 52 1 ? 8 
HELX_P HELX_P2 2 GLU B 45 ? GLN B 52 ? GLU B 45 GLN B 52 1 ? 8 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 3 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 2  ? ARG A 6  ? LEU A 2  ARG A 6  
A 2 VAL B 30 ? ASN B 35 ? VAL B 30 ASN B 35 
A 3 THR B 19 ? THR B 21 ? THR B 19 THR B 21 
B 1 MET A 13 ? GLY A 15 ? MET A 13 GLY A 15 
B 2 SER B 41 ? HIS B 43 ? SER B 41 HIS B 43 
C 1 THR A 19 ? THR A 21 ? THR A 19 THR A 21 
C 2 VAL A 30 ? ASN A 35 ? VAL A 30 ASN A 35 
C 3 LEU B 2  ? ARG B 6  ? LEU B 2  ARG B 6  
D 1 SER A 41 ? HIS A 43 ? SER A 41 HIS A 43 
D 2 MET B 13 ? GLY B 15 ? MET B 13 GLY B 15 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 2  ? N LEU A 2  O VAL B 34 ? O VAL B 34 
A 2 3 O GLY B 33 ? O GLY B 33 N THR B 21 ? N THR B 21 
B 1 2 N MET A 13 ? N MET A 13 O HIS B 43 ? O HIS B 43 
C 1 2 N THR A 21 ? N THR A 21 O GLY A 33 ? O GLY A 33 
C 2 3 N VAL A 34 ? N VAL A 34 O LEU B 2  ? O LEU B 2  
D 1 2 N HIS A 43 ? N HIS A 43 O MET B 13 ? O MET B 13 
# 
_database_PDB_matrix.entry_id          1Y00 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1Y00 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1  ? -2.664  -10.749 -5.738  1.00 0.00 ? 1  MET A N    1  
ATOM 2     C CA   . MET A 1 1  ? -2.649  -10.957 -4.266  1.00 0.00 ? 1  MET A CA   1  
ATOM 3     C C    . MET A 1 1  ? -1.238  -11.238 -3.763  1.00 0.00 ? 1  MET A C    1  
ATOM 4     O O    . MET A 1 1  ? -0.707  -12.332 -3.956  1.00 0.00 ? 1  MET A O    1  
ATOM 5     C CB   . MET A 1 1  ? -3.571  -12.131 -3.928  1.00 0.00 ? 1  MET A CB   1  
ATOM 6     C CG   . MET A 1 1  ? -4.917  -12.073 -4.634  1.00 0.00 ? 1  MET A CG   1  
ATOM 7     S SD   . MET A 1 1  ? -5.026  -13.221 -6.021  1.00 0.00 ? 1  MET A SD   1  
ATOM 8     C CE   . MET A 1 1  ? -5.126  -14.787 -5.158  1.00 0.00 ? 1  MET A CE   1  
ATOM 9     H H1   . MET A 1 1  ? -3.544  -10.250 -5.979  1.00 0.00 ? 1  MET A H1   1  
ATOM 10    H H2   . MET A 1 1  ? -2.626  -11.685 -6.191  1.00 0.00 ? 1  MET A H2   1  
ATOM 11    H H3   . MET A 1 1  ? -1.831  -10.177 -5.986  1.00 0.00 ? 1  MET A H3   1  
ATOM 12    H HA   . MET A 1 1  ? -3.022  -10.063 -3.788  1.00 0.00 ? 1  MET A HA   1  
ATOM 13    H HB2  . MET A 1 1  ? -3.080  -13.051 -4.209  1.00 0.00 ? 1  MET A HB2  1  
ATOM 14    H HB3  . MET A 1 1  ? -3.748  -12.139 -2.863  1.00 0.00 ? 1  MET A HB3  1  
ATOM 15    H HG2  . MET A 1 1  ? -5.692  -12.318 -3.922  1.00 0.00 ? 1  MET A HG2  1  
ATOM 16    H HG3  . MET A 1 1  ? -5.073  -11.070 -5.001  1.00 0.00 ? 1  MET A HG3  1  
ATOM 17    H HE1  . MET A 1 1  ? -4.465  -14.770 -4.304  1.00 0.00 ? 1  MET A HE1  1  
ATOM 18    H HE2  . MET A 1 1  ? -4.834  -15.584 -5.824  1.00 0.00 ? 1  MET A HE2  1  
ATOM 19    H HE3  . MET A 1 1  ? -6.141  -14.949 -4.824  1.00 0.00 ? 1  MET A HE3  1  
ATOM 20    N N    . LEU A 1 2  ? -0.634  -10.246 -3.116  1.00 0.00 ? 2  LEU A N    1  
ATOM 21    C CA   . LEU A 1 2  ? 0.716   -10.391 -2.585  1.00 0.00 ? 2  LEU A CA   1  
ATOM 22    C C    . LEU A 1 2  ? 0.730   -10.191 -1.073  1.00 0.00 ? 2  LEU A C    1  
ATOM 23    O O    . LEU A 1 2  ? 0.485   -9.088  -0.584  1.00 0.00 ? 2  LEU A O    1  
ATOM 24    C CB   . LEU A 1 2  ? 1.657   -9.386  -3.251  1.00 0.00 ? 2  LEU A CB   1  
ATOM 25    C CG   . LEU A 1 2  ? 2.118   -9.765  -4.660  1.00 0.00 ? 2  LEU A CG   1  
ATOM 26    C CD1  . LEU A 1 2  ? 1.123   -9.269  -5.698  1.00 0.00 ? 2  LEU A CD1  1  
ATOM 27    C CD2  . LEU A 1 2  ? 3.504   -9.203  -4.936  1.00 0.00 ? 2  LEU A CD2  1  
ATOM 28    H H    . LEU A 1 2  ? -1.109  -9.396  -2.992  1.00 0.00 ? 2  LEU A H    1  
ATOM 29    H HA   . LEU A 1 2  ? 1.057   -11.391 -2.809  1.00 0.00 ? 2  LEU A HA   1  
ATOM 30    H HB2  . LEU A 1 2  ? 1.152   -8.432  -3.304  1.00 0.00 ? 2  LEU A HB2  1  
ATOM 31    H HB3  . LEU A 1 2  ? 2.533   -9.277  -2.629  1.00 0.00 ? 2  LEU A HB3  1  
ATOM 32    H HG   . LEU A 1 2  ? 2.171   -10.841 -4.736  1.00 0.00 ? 2  LEU A HG   1  
ATOM 33    H HD11 . LEU A 1 2  ? 1.650   -8.997  -6.600  1.00 0.00 ? 2  LEU A HD11 1  
ATOM 34    H HD12 . LEU A 1 2  ? 0.599   -8.407  -5.312  1.00 0.00 ? 2  LEU A HD12 1  
ATOM 35    H HD13 . LEU A 1 2  ? 0.413   -10.053 -5.919  1.00 0.00 ? 2  LEU A HD13 1  
ATOM 36    H HD21 . LEU A 1 2  ? 4.085   -9.930  -5.482  1.00 0.00 ? 2  LEU A HD21 1  
ATOM 37    H HD22 . LEU A 1 2  ? 3.995   -8.979  -4.000  1.00 0.00 ? 2  LEU A HD22 1  
ATOM 38    H HD23 . LEU A 1 2  ? 3.416   -8.299  -5.521  1.00 0.00 ? 2  LEU A HD23 1  
ATOM 39    N N    . ILE A 1 3  ? 1.027   -11.257 -0.335  1.00 0.00 ? 3  ILE A N    1  
ATOM 40    C CA   . ILE A 1 3  ? 1.082   -11.180 1.120   1.00 0.00 ? 3  ILE A CA   1  
ATOM 41    C C    . ILE A 1 3  ? 2.525   -11.185 1.606   1.00 0.00 ? 3  ILE A C    1  
ATOM 42    O O    . ILE A 1 3  ? 3.209   -12.207 1.557   1.00 0.00 ? 3  ILE A O    1  
ATOM 43    C CB   . ILE A 1 3  ? 0.298   -12.328 1.792   1.00 0.00 ? 3  ILE A CB   1  
ATOM 44    C CG1  . ILE A 1 3  ? 0.246   -12.118 3.307   1.00 0.00 ? 3  ILE A CG1  1  
ATOM 45    C CG2  . ILE A 1 3  ? 0.917   -13.677 1.461   1.00 0.00 ? 3  ILE A CG2  1  
ATOM 46    C CD1  . ILE A 1 3  ? -1.051  -12.579 3.937   1.00 0.00 ? 3  ILE A CD1  1  
ATOM 47    H H    . ILE A 1 3  ? 1.225   -12.109 -0.778  1.00 0.00 ? 3  ILE A H    1  
ATOM 48    H HA   . ILE A 1 3  ? 0.628   -10.248 1.413   1.00 0.00 ? 3  ILE A HA   1  
ATOM 49    H HB   . ILE A 1 3  ? -0.708  -12.320 1.403   1.00 0.00 ? 3  ILE A HB   1  
ATOM 50    H HG12 . ILE A 1 3  ? 1.053   -12.668 3.768   1.00 0.00 ? 3  ILE A HG12 1  
ATOM 51    H HG13 . ILE A 1 3  ? 0.365   -11.065 3.522   1.00 0.00 ? 3  ILE A HG13 1  
ATOM 52    H HG21 . ILE A 1 3  ? 1.793   -13.832 2.073   1.00 0.00 ? 3  ILE A HG21 1  
ATOM 53    H HG22 . ILE A 1 3  ? 1.197   -13.700 0.419   1.00 0.00 ? 3  ILE A HG22 1  
ATOM 54    H HG23 . ILE A 1 3  ? 0.198   -14.459 1.659   1.00 0.00 ? 3  ILE A HG23 1  
ATOM 55    H HD11 . ILE A 1 3  ? -1.185  -13.635 3.749   1.00 0.00 ? 3  ILE A HD11 1  
ATOM 56    H HD12 . ILE A 1 3  ? -1.875  -12.029 3.508   1.00 0.00 ? 3  ILE A HD12 1  
ATOM 57    H HD13 . ILE A 1 3  ? -1.018  -12.404 5.004   1.00 0.00 ? 3  ILE A HD13 1  
ATOM 58    N N    . LEU A 1 4  ? 2.979   -10.029 2.076   1.00 0.00 ? 4  LEU A N    1  
ATOM 59    C CA   . LEU A 1 4  ? 4.339   -9.886  2.575   1.00 0.00 ? 4  LEU A CA   1  
ATOM 60    C C    . LEU A 1 4  ? 4.346   -9.360  4.006   1.00 0.00 ? 4  LEU A C    1  
ATOM 61    O O    . LEU A 1 4  ? 3.748   -8.322  4.301   1.00 0.00 ? 4  LEU A O    1  
ATOM 62    C CB   . LEU A 1 4  ? 5.141   -8.951  1.666   1.00 0.00 ? 4  LEU A CB   1  
ATOM 63    C CG   . LEU A 1 4  ? 6.152   -9.647  0.752   1.00 0.00 ? 4  LEU A CG   1  
ATOM 64    C CD1  . LEU A 1 4  ? 7.334   -10.162 1.559   1.00 0.00 ? 4  LEU A CD1  1  
ATOM 65    C CD2  . LEU A 1 4  ? 5.489   -10.783 -0.013  1.00 0.00 ? 4  LEU A CD2  1  
ATOM 66    H H    . LEU A 1 4  ? 2.378   -9.255  2.098   1.00 0.00 ? 4  LEU A H    1  
ATOM 67    H HA   . LEU A 1 4  ? 4.798   -10.863 2.564   1.00 0.00 ? 4  LEU A HA   1  
ATOM 68    H HB2  . LEU A 1 4  ? 4.445   -8.403  1.047   1.00 0.00 ? 4  LEU A HB2  1  
ATOM 69    H HB3  . LEU A 1 4  ? 5.676   -8.248  2.286   1.00 0.00 ? 4  LEU A HB3  1  
ATOM 70    H HG   . LEU A 1 4  ? 6.526   -8.933  0.033   1.00 0.00 ? 4  LEU A HG   1  
ATOM 71    H HD11 . LEU A 1 4  ? 7.027   -10.327 2.581   1.00 0.00 ? 4  LEU A HD11 1  
ATOM 72    H HD12 . LEU A 1 4  ? 8.131   -9.434  1.535   1.00 0.00 ? 4  LEU A HD12 1  
ATOM 73    H HD13 . LEU A 1 4  ? 7.682   -11.091 1.134   1.00 0.00 ? 4  LEU A HD13 1  
ATOM 74    H HD21 . LEU A 1 4  ? 4.424   -10.607 -0.067  1.00 0.00 ? 4  LEU A HD21 1  
ATOM 75    H HD22 . LEU A 1 4  ? 5.674   -11.716 0.498   1.00 0.00 ? 4  LEU A HD22 1  
ATOM 76    H HD23 . LEU A 1 4  ? 5.897   -10.832 -1.011  1.00 0.00 ? 4  LEU A HD23 1  
ATOM 77    N N    . THR A 1 5  ? 5.020   -10.076 4.897   1.00 0.00 ? 5  THR A N    1  
ATOM 78    C CA   . THR A 1 5  ? 5.098   -9.661  6.290   1.00 0.00 ? 5  THR A CA   1  
ATOM 79    C C    . THR A 1 5  ? 5.742   -8.286  6.399   1.00 0.00 ? 5  THR A C    1  
ATOM 80    O O    . THR A 1 5  ? 6.635   -7.946  5.623   1.00 0.00 ? 5  THR A O    1  
ATOM 81    C CB   . THR A 1 5  ? 5.894   -10.670 7.114   1.00 0.00 ? 5  THR A CB   1  
ATOM 82    O OG1  . THR A 1 5  ? 6.024   -11.899 6.421   1.00 0.00 ? 5  THR A OG1  1  
ATOM 83    C CG2  . THR A 1 5  ? 5.264   -10.962 8.456   1.00 0.00 ? 5  THR A CG2  1  
ATOM 84    H H    . THR A 1 5  ? 5.469   -10.900 4.614   1.00 0.00 ? 5  THR A H    1  
ATOM 85    H HA   . THR A 1 5  ? 4.091   -9.606  6.676   1.00 0.00 ? 5  THR A HA   1  
ATOM 86    H HB   . THR A 1 5  ? 6.884   -10.272 7.294   1.00 0.00 ? 5  THR A HB   1  
ATOM 87    H HG1  . THR A 1 5  ? 6.737   -12.412 6.809   1.00 0.00 ? 5  THR A HG1  1  
ATOM 88    H HG21 . THR A 1 5  ? 5.250   -10.059 9.050   1.00 0.00 ? 5  THR A HG21 1  
ATOM 89    H HG22 . THR A 1 5  ? 5.838   -11.721 8.966   1.00 0.00 ? 5  THR A HG22 1  
ATOM 90    H HG23 . THR A 1 5  ? 4.253   -11.311 8.311   1.00 0.00 ? 5  THR A HG23 1  
ATOM 91    N N    . ARG A 1 6  ? 5.282   -7.498  7.358   1.00 0.00 ? 6  ARG A N    1  
ATOM 92    C CA   . ARG A 1 6  ? 5.813   -6.161  7.557   1.00 0.00 ? 6  ARG A CA   1  
ATOM 93    C C    . ARG A 1 6  ? 5.597   -5.687  8.989   1.00 0.00 ? 6  ARG A C    1  
ATOM 94    O O    . ARG A 1 6  ? 4.594   -6.017  9.626   1.00 0.00 ? 6  ARG A O    1  
ATOM 95    C CB   . ARG A 1 6  ? 5.158   -5.184  6.578   1.00 0.00 ? 6  ARG A CB   1  
ATOM 96    C CG   . ARG A 1 6  ? 6.146   -4.485  5.659   1.00 0.00 ? 6  ARG A CG   1  
ATOM 97    C CD   . ARG A 1 6  ? 7.214   -3.744  6.447   1.00 0.00 ? 6  ARG A CD   1  
ATOM 98    N NE   . ARG A 1 6  ? 8.436   -4.534  6.593   1.00 0.00 ? 6  ARG A NE   1  
ATOM 99    C CZ   . ARG A 1 6  ? 9.398   -4.592  5.675   1.00 0.00 ? 6  ARG A CZ   1  
ATOM 100   N NH1  . ARG A 1 6  ? 9.288   -3.911  4.541   1.00 0.00 ? 6  ARG A NH1  1  
ATOM 101   N NH2  . ARG A 1 6  ? 10.475  -5.335  5.891   1.00 0.00 ? 6  ARG A NH2  1  
ATOM 102   H H    . ARG A 1 6  ? 4.565   -7.821  7.943   1.00 0.00 ? 6  ARG A H    1  
ATOM 103   H HA   . ARG A 1 6  ? 6.874   -6.195  7.358   1.00 0.00 ? 6  ARG A HA   1  
ATOM 104   H HB2  . ARG A 1 6  ? 4.455   -5.728  5.964   1.00 0.00 ? 6  ARG A HB2  1  
ATOM 105   H HB3  . ARG A 1 6  ? 4.625   -4.430  7.138   1.00 0.00 ? 6  ARG A HB3  1  
ATOM 106   H HG2  . ARG A 1 6  ? 6.624   -5.223  5.031   1.00 0.00 ? 6  ARG A HG2  1  
ATOM 107   H HG3  . ARG A 1 6  ? 5.610   -3.778  5.044   1.00 0.00 ? 6  ARG A HG3  1  
ATOM 108   H HD2  . ARG A 1 6  ? 7.450   -2.825  5.933   1.00 0.00 ? 6  ARG A HD2  1  
ATOM 109   H HD3  . ARG A 1 6  ? 6.825   -3.515  7.428   1.00 0.00 ? 6  ARG A HD3  1  
ATOM 110   H HE   . ARG A 1 6  ? 8.545   -5.048  7.420   1.00 0.00 ? 6  ARG A HE   1  
ATOM 111   H HH11 . ARG A 1 6  ? 8.479   -3.349  4.370   1.00 0.00 ? 6  ARG A HH11 1  
ATOM 112   H HH12 . ARG A 1 6  ? 10.015  -3.960  3.856   1.00 0.00 ? 6  ARG A HH12 1  
ATOM 113   H HH21 . ARG A 1 6  ? 10.564  -5.850  6.743   1.00 0.00 ? 6  ARG A HH21 1  
ATOM 114   H HH22 . ARG A 1 6  ? 11.198  -5.380  5.201   1.00 0.00 ? 6  ARG A HH22 1  
ATOM 115   N N    . ARG A 1 7  ? 6.552   -4.905  9.477   1.00 0.00 ? 7  ARG A N    1  
ATOM 116   C CA   . ARG A 1 7  ? 6.501   -4.355  10.825  1.00 0.00 ? 7  ARG A CA   1  
ATOM 117   C C    . ARG A 1 7  ? 7.780   -3.586  11.126  1.00 0.00 ? 7  ARG A C    1  
ATOM 118   O O    . ARG A 1 7  ? 8.642   -4.054  11.870  1.00 0.00 ? 7  ARG A O    1  
ATOM 119   C CB   . ARG A 1 7  ? 6.290   -5.460  11.861  1.00 0.00 ? 7  ARG A CB   1  
ATOM 120   C CG   . ARG A 1 7  ? 5.486   -5.006  13.069  1.00 0.00 ? 7  ARG A CG   1  
ATOM 121   C CD   . ARG A 1 7  ? 6.018   -5.615  14.356  1.00 0.00 ? 7  ARG A CD   1  
ATOM 122   N NE   . ARG A 1 7  ? 5.151   -5.328  15.496  1.00 0.00 ? 7  ARG A NE   1  
ATOM 123   C CZ   . ARG A 1 7  ? 5.150   -6.034  16.625  1.00 0.00 ? 7  ARG A CZ   1  
ATOM 124   N NH1  . ARG A 1 7  ? 5.970   -7.067  16.771  1.00 0.00 ? 7  ARG A NH1  1  
ATOM 125   N NH2  . ARG A 1 7  ? 4.328   -5.704  17.611  1.00 0.00 ? 7  ARG A NH2  1  
ATOM 126   H H    . ARG A 1 7  ? 7.318   -4.688  8.908   1.00 0.00 ? 7  ARG A H    1  
ATOM 127   H HA   . ARG A 1 7  ? 5.669   -3.670  10.868  1.00 0.00 ? 7  ARG A HA   1  
ATOM 128   H HB2  . ARG A 1 7  ? 5.765   -6.280  11.392  1.00 0.00 ? 7  ARG A HB2  1  
ATOM 129   H HB3  . ARG A 1 7  ? 7.253   -5.807  12.203  1.00 0.00 ? 7  ARG A HB3  1  
ATOM 130   H HG2  . ARG A 1 7  ? 5.541   -3.928  13.142  1.00 0.00 ? 7  ARG A HG2  1  
ATOM 131   H HG3  . ARG A 1 7  ? 4.457   -5.307  12.937  1.00 0.00 ? 7  ARG A HG3  1  
ATOM 132   H HD2  . ARG A 1 7  ? 6.088   -6.686  14.230  1.00 0.00 ? 7  ARG A HD2  1  
ATOM 133   H HD3  . ARG A 1 7  ? 7.001   -5.211  14.551  1.00 0.00 ? 7  ARG A HD3  1  
ATOM 134   H HE   . ARG A 1 7  ? 4.536   -4.569  15.416  1.00 0.00 ? 7  ARG A HE   1  
ATOM 135   H HH11 . ARG A 1 7  ? 6.594   -7.321  16.032  1.00 0.00 ? 7  ARG A HH11 1  
ATOM 136   H HH12 . ARG A 1 7  ? 5.964   -7.593  17.621  1.00 0.00 ? 7  ARG A HH12 1  
ATOM 137   H HH21 . ARG A 1 7  ? 3.708   -4.926  17.507  1.00 0.00 ? 7  ARG A HH21 1  
ATOM 138   H HH22 . ARG A 1 7  ? 4.326   -6.234  18.459  1.00 0.00 ? 7  ARG A HH22 1  
ATOM 139   N N    . VAL A 1 8  ? 7.892   -2.402  10.532  1.00 0.00 ? 8  VAL A N    1  
ATOM 140   C CA   . VAL A 1 8  ? 9.061   -1.548  10.717  1.00 0.00 ? 8  VAL A CA   1  
ATOM 141   C C    . VAL A 1 8  ? 8.950   -0.290  9.860   1.00 0.00 ? 8  VAL A C    1  
ATOM 142   O O    . VAL A 1 8  ? 8.932   0.826   10.378  1.00 0.00 ? 8  VAL A O    1  
ATOM 143   C CB   . VAL A 1 8  ? 10.379  -2.279  10.369  1.00 0.00 ? 8  VAL A CB   1  
ATOM 144   C CG1  . VAL A 1 8  ? 11.043  -2.813  11.630  1.00 0.00 ? 8  VAL A CG1  1  
ATOM 145   C CG2  . VAL A 1 8  ? 10.140  -3.405  9.369   1.00 0.00 ? 8  VAL A CG2  1  
ATOM 146   H H    . VAL A 1 8  ? 7.163   -2.092  9.955   1.00 0.00 ? 8  VAL A H    1  
ATOM 147   H HA   . VAL A 1 8  ? 9.098   -1.258  11.757  1.00 0.00 ? 8  VAL A HA   1  
ATOM 148   H HB   . VAL A 1 8  ? 11.052  -1.565  9.916   1.00 0.00 ? 8  VAL A HB   1  
ATOM 149   H HG11 . VAL A 1 8  ? 10.624  -2.319  12.494  1.00 0.00 ? 8  VAL A HG11 1  
ATOM 150   H HG12 . VAL A 1 8  ? 12.105  -2.621  11.586  1.00 0.00 ? 8  VAL A HG12 1  
ATOM 151   H HG13 . VAL A 1 8  ? 10.872  -3.876  11.705  1.00 0.00 ? 8  VAL A HG13 1  
ATOM 152   H HG21 . VAL A 1 8  ? 9.236   -3.209  8.814   1.00 0.00 ? 8  VAL A HG21 1  
ATOM 153   H HG22 . VAL A 1 8  ? 10.041  -4.341  9.899   1.00 0.00 ? 8  VAL A HG22 1  
ATOM 154   H HG23 . VAL A 1 8  ? 10.976  -3.464  8.688   1.00 0.00 ? 8  VAL A HG23 1  
ATOM 155   N N    . GLY A 1 9  ? 8.875   -0.479  8.545   1.00 0.00 ? 9  GLY A N    1  
ATOM 156   C CA   . GLY A 1 9  ? 8.766   0.649   7.639   1.00 0.00 ? 9  GLY A CA   1  
ATOM 157   C C    . GLY A 1 9  ? 8.845   0.239   6.180   1.00 0.00 ? 9  GLY A C    1  
ATOM 158   O O    . GLY A 1 9  ? 9.906   0.326   5.562   1.00 0.00 ? 9  GLY A O    1  
ATOM 159   H H    . GLY A 1 9  ? 8.894   -1.391  8.188   1.00 0.00 ? 9  GLY A H    1  
ATOM 160   H HA2  . GLY A 1 9  ? 7.821   1.143   7.811   1.00 0.00 ? 9  GLY A HA2  1  
ATOM 161   H HA3  . GLY A 1 9  ? 9.566   1.343   7.849   1.00 0.00 ? 9  GLY A HA3  1  
ATOM 162   N N    . GLU A 1 10 ? 7.719   -0.206  5.628   1.00 0.00 ? 10 GLU A N    1  
ATOM 163   C CA   . GLU A 1 10 ? 7.667   -0.625  4.231   1.00 0.00 ? 10 GLU A CA   1  
ATOM 164   C C    . GLU A 1 10 ? 7.752   0.586   3.304   1.00 0.00 ? 10 GLU A C    1  
ATOM 165   O O    . GLU A 1 10 ? 8.173   1.665   3.721   1.00 0.00 ? 10 GLU A O    1  
ATOM 166   C CB   . GLU A 1 10 ? 6.382   -1.412  3.961   1.00 0.00 ? 10 GLU A CB   1  
ATOM 167   C CG   . GLU A 1 10 ? 6.555   -2.535  2.949   1.00 0.00 ? 10 GLU A CG   1  
ATOM 168   C CD   . GLU A 1 10 ? 5.348   -2.695  2.045   1.00 0.00 ? 10 GLU A CD   1  
ATOM 169   O OE1  . GLU A 1 10 ? 4.815   -1.666  1.578   1.00 0.00 ? 10 GLU A OE1  1  
ATOM 170   O OE2  . GLU A 1 10 ? 4.935   -3.849  1.805   1.00 0.00 ? 10 GLU A OE2  1  
ATOM 171   H H    . GLU A 1 10 ? 6.905   -0.248  6.171   1.00 0.00 ? 10 GLU A H    1  
ATOM 172   H HA   . GLU A 1 10 ? 8.517   -1.265  4.046   1.00 0.00 ? 10 GLU A HA   1  
ATOM 173   H HB2  . GLU A 1 10 ? 6.036   -1.844  4.889   1.00 0.00 ? 10 GLU A HB2  1  
ATOM 174   H HB3  . GLU A 1 10 ? 5.629   -0.733  3.588   1.00 0.00 ? 10 GLU A HB3  1  
ATOM 175   H HG2  . GLU A 1 10 ? 7.417   -2.320  2.336   1.00 0.00 ? 10 GLU A HG2  1  
ATOM 176   H HG3  . GLU A 1 10 ? 6.715   -3.461  3.479   1.00 0.00 ? 10 GLU A HG3  1  
ATOM 177   N N    . THR A 1 11 ? 7.350   0.407   2.046   1.00 0.00 ? 11 THR A N    1  
ATOM 178   C CA   . THR A 1 11 ? 7.383   1.493   1.069   1.00 0.00 ? 11 THR A CA   1  
ATOM 179   C C    . THR A 1 11 ? 7.052   0.982   -0.330  1.00 0.00 ? 11 THR A C    1  
ATOM 180   O O    . THR A 1 11 ? 7.946   0.605   -1.088  1.00 0.00 ? 11 THR A O    1  
ATOM 181   C CB   . THR A 1 11 ? 8.758   2.167   1.060   1.00 0.00 ? 11 THR A CB   1  
ATOM 182   O OG1  . THR A 1 11 ? 8.914   2.975   -0.093  1.00 0.00 ? 11 THR A OG1  1  
ATOM 183   C CG2  . THR A 1 11 ? 9.908   1.182   1.088   1.00 0.00 ? 11 THR A CG2  1  
ATOM 184   H H    . THR A 1 11 ? 7.020   -0.471  1.769   1.00 0.00 ? 11 THR A H    1  
ATOM 185   H HA   . THR A 1 11 ? 6.639   2.220   1.358   1.00 0.00 ? 11 THR A HA   1  
ATOM 186   H HB   . THR A 1 11 ? 8.844   2.800   1.932   1.00 0.00 ? 11 THR A HB   1  
ATOM 187   H HG1  . THR A 1 11 ? 9.784   3.381   -0.085  1.00 0.00 ? 11 THR A HG1  1  
ATOM 188   H HG21 . THR A 1 11 ? 10.117  0.902   2.110   1.00 0.00 ? 11 THR A HG21 1  
ATOM 189   H HG22 . THR A 1 11 ? 10.784  1.639   0.653   1.00 0.00 ? 11 THR A HG22 1  
ATOM 190   H HG23 . THR A 1 11 ? 9.642   0.302   0.522   1.00 0.00 ? 11 THR A HG23 1  
ATOM 191   N N    . LEU A 1 12 ? 5.767   0.984   -0.673  1.00 0.00 ? 12 LEU A N    1  
ATOM 192   C CA   . LEU A 1 12 ? 5.330   0.532   -1.990  1.00 0.00 ? 12 LEU A CA   1  
ATOM 193   C C    . LEU A 1 12 ? 4.824   1.714   -2.809  1.00 0.00 ? 12 LEU A C    1  
ATOM 194   O O    . LEU A 1 12 ? 4.348   2.703   -2.252  1.00 0.00 ? 12 LEU A O    1  
ATOM 195   C CB   . LEU A 1 12 ? 4.241   -0.547  -1.860  1.00 0.00 ? 12 LEU A CB   1  
ATOM 196   C CG   . LEU A 1 12 ? 2.790   -0.043  -1.812  1.00 0.00 ? 12 LEU A CG   1  
ATOM 197   C CD1  . LEU A 1 12 ? 1.888   -0.925  -2.663  1.00 0.00 ? 12 LEU A CD1  1  
ATOM 198   C CD2  . LEU A 1 12 ? 2.288   0.001   -0.378  1.00 0.00 ? 12 LEU A CD2  1  
ATOM 199   H H    . LEU A 1 12 ? 5.099   1.306   -0.032  1.00 0.00 ? 12 LEU A H    1  
ATOM 200   H HA   . LEU A 1 12 ? 6.187   0.107   -2.492  1.00 0.00 ? 12 LEU A HA   1  
ATOM 201   H HB2  . LEU A 1 12 ? 4.336   -1.219  -2.699  1.00 0.00 ? 12 LEU A HB2  1  
ATOM 202   H HB3  . LEU A 1 12 ? 4.431   -1.106  -0.956  1.00 0.00 ? 12 LEU A HB3  1  
ATOM 203   H HG   . LEU A 1 12 ? 2.744   0.958   -2.213  1.00 0.00 ? 12 LEU A HG   1  
ATOM 204   H HD11 . LEU A 1 12 ? 2.484   -1.449  -3.396  1.00 0.00 ? 12 LEU A HD11 1  
ATOM 205   H HD12 . LEU A 1 12 ? 1.155   -0.311  -3.167  1.00 0.00 ? 12 LEU A HD12 1  
ATOM 206   H HD13 . LEU A 1 12 ? 1.384   -1.641  -2.031  1.00 0.00 ? 12 LEU A HD13 1  
ATOM 207   H HD21 . LEU A 1 12 ? 2.287   -0.996  0.035   1.00 0.00 ? 12 LEU A HD21 1  
ATOM 208   H HD22 . LEU A 1 12 ? 1.284   0.399   -0.362  1.00 0.00 ? 12 LEU A HD22 1  
ATOM 209   H HD23 . LEU A 1 12 ? 2.935   0.635   0.209   1.00 0.00 ? 12 LEU A HD23 1  
ATOM 210   N N    . MET A 1 13 ? 4.926   1.615   -4.130  1.00 0.00 ? 13 MET A N    1  
ATOM 211   C CA   . MET A 1 13 ? 4.473   2.693   -4.996  1.00 0.00 ? 13 MET A CA   1  
ATOM 212   C C    . MET A 1 13 ? 3.621   2.167   -6.146  1.00 0.00 ? 13 MET A C    1  
ATOM 213   O O    . MET A 1 13 ? 4.143   1.679   -7.147  1.00 0.00 ? 13 MET A O    1  
ATOM 214   C CB   . MET A 1 13 ? 5.671   3.468   -5.547  1.00 0.00 ? 13 MET A CB   1  
ATOM 215   C CG   . MET A 1 13 ? 5.281   4.649   -6.422  1.00 0.00 ? 13 MET A CG   1  
ATOM 216   S SD   . MET A 1 13 ? 6.392   4.870   -7.825  1.00 0.00 ? 13 MET A SD   1  
ATOM 217   C CE   . MET A 1 13 ? 5.224   4.888   -9.182  1.00 0.00 ? 13 MET A CE   1  
ATOM 218   H H    . MET A 1 13 ? 5.316   0.808   -4.526  1.00 0.00 ? 13 MET A H    1  
ATOM 219   H HA   . MET A 1 13 ? 3.872   3.361   -4.399  1.00 0.00 ? 13 MET A HA   1  
ATOM 220   H HB2  . MET A 1 13 ? 6.256   3.840   -4.718  1.00 0.00 ? 13 MET A HB2  1  
ATOM 221   H HB3  . MET A 1 13 ? 6.280   2.797   -6.134  1.00 0.00 ? 13 MET A HB3  1  
ATOM 222   H HG2  . MET A 1 13 ? 4.281   4.488   -6.796  1.00 0.00 ? 13 MET A HG2  1  
ATOM 223   H HG3  . MET A 1 13 ? 5.299   5.546   -5.821  1.00 0.00 ? 13 MET A HG3  1  
ATOM 224   H HE1  . MET A 1 13 ? 5.124   3.890   -9.585  1.00 0.00 ? 13 MET A HE1  1  
ATOM 225   H HE2  . MET A 1 13 ? 5.579   5.554   -9.955  1.00 0.00 ? 13 MET A HE2  1  
ATOM 226   H HE3  . MET A 1 13 ? 4.263   5.230   -8.826  1.00 0.00 ? 13 MET A HE3  1  
ATOM 227   N N    . ILE A 1 14 ? 2.306   2.288   -6.000  1.00 0.00 ? 14 ILE A N    1  
ATOM 228   C CA   . ILE A 1 14 ? 1.377   1.844   -7.030  1.00 0.00 ? 14 ILE A CA   1  
ATOM 229   C C    . ILE A 1 14 ? 0.687   3.045   -7.673  1.00 0.00 ? 14 ILE A C    1  
ATOM 230   O O    . ILE A 1 14 ? 0.120   3.891   -6.983  1.00 0.00 ? 14 ILE A O    1  
ATOM 231   C CB   . ILE A 1 14 ? 0.320   0.874   -6.454  1.00 0.00 ? 14 ILE A CB   1  
ATOM 232   C CG1  . ILE A 1 14 ? -0.627  0.381   -7.559  1.00 0.00 ? 14 ILE A CG1  1  
ATOM 233   C CG2  . ILE A 1 14 ? -0.453  1.530   -5.317  1.00 0.00 ? 14 ILE A CG2  1  
ATOM 234   C CD1  . ILE A 1 14 ? -1.682  1.387   -7.975  1.00 0.00 ? 14 ILE A CD1  1  
ATOM 235   H H    . ILE A 1 14 ? 1.953   2.695   -5.183  1.00 0.00 ? 14 ILE A H    1  
ATOM 236   H HA   . ILE A 1 14 ? 1.945   1.320   -7.785  1.00 0.00 ? 14 ILE A HA   1  
ATOM 237   H HB   . ILE A 1 14 ? 0.844   0.024   -6.044  1.00 0.00 ? 14 ILE A HB   1  
ATOM 238   H HG12 . ILE A 1 14 ? -0.047  0.135   -8.435  1.00 0.00 ? 14 ILE A HG12 1  
ATOM 239   H HG13 . ILE A 1 14 ? -1.136  -0.508  -7.213  1.00 0.00 ? 14 ILE A HG13 1  
ATOM 240   H HG21 . ILE A 1 14 ? -0.208  1.038   -4.386  1.00 0.00 ? 14 ILE A HG21 1  
ATOM 241   H HG22 . ILE A 1 14 ? -1.513  1.441   -5.501  1.00 0.00 ? 14 ILE A HG22 1  
ATOM 242   H HG23 . ILE A 1 14 ? -0.185  2.574   -5.251  1.00 0.00 ? 14 ILE A HG23 1  
ATOM 243   H HD11 . ILE A 1 14 ? -1.640  2.247   -7.324  1.00 0.00 ? 14 ILE A HD11 1  
ATOM 244   H HD12 . ILE A 1 14 ? -2.659  0.932   -7.908  1.00 0.00 ? 14 ILE A HD12 1  
ATOM 245   H HD13 . ILE A 1 14 ? -1.501  1.699   -8.993  1.00 0.00 ? 14 ILE A HD13 1  
ATOM 246   N N    . GLY A 1 15 ? 0.746   3.118   -8.998  1.00 0.00 ? 15 GLY A N    1  
ATOM 247   C CA   . GLY A 1 15 ? 0.133   4.225   -9.710  1.00 0.00 ? 15 GLY A CA   1  
ATOM 248   C C    . GLY A 1 15 ? 1.115   4.912   -10.640 1.00 0.00 ? 15 GLY A C    1  
ATOM 249   O O    . GLY A 1 15 ? 1.415   4.400   -11.720 1.00 0.00 ? 15 GLY A O    1  
ATOM 250   H H    . GLY A 1 15 ? 1.212   2.417   -9.500  1.00 0.00 ? 15 GLY A H    1  
ATOM 251   H HA2  . GLY A 1 15 ? -0.697  3.850   -10.291 1.00 0.00 ? 15 GLY A HA2  1  
ATOM 252   H HA3  . GLY A 1 15 ? -0.236  4.946   -8.994  1.00 0.00 ? 15 GLY A HA3  1  
ATOM 253   N N    . ASP A 1 16 ? 1.621   6.070   -10.223 1.00 0.00 ? 16 ASP A N    1  
ATOM 254   C CA   . ASP A 1 16 ? 2.579   6.815   -11.036 1.00 0.00 ? 16 ASP A CA   1  
ATOM 255   C C    . ASP A 1 16 ? 3.286   7.914   -10.237 1.00 0.00 ? 16 ASP A C    1  
ATOM 256   O O    . ASP A 1 16 ? 3.878   8.818   -10.825 1.00 0.00 ? 16 ASP A O    1  
ATOM 257   C CB   . ASP A 1 16 ? 1.873   7.430   -12.247 1.00 0.00 ? 16 ASP A CB   1  
ATOM 258   C CG   . ASP A 1 16 ? 1.979   6.557   -13.482 1.00 0.00 ? 16 ASP A CG   1  
ATOM 259   O OD1  . ASP A 1 16 ? 3.106   6.380   -13.989 1.00 0.00 ? 16 ASP A OD1  1  
ATOM 260   O OD2  . ASP A 1 16 ? 0.934   6.052   -13.943 1.00 0.00 ? 16 ASP A OD2  1  
ATOM 261   H H    . ASP A 1 16 ? 1.345   6.429   -9.354  1.00 0.00 ? 16 ASP A H    1  
ATOM 262   H HA   . ASP A 1 16 ? 3.321   6.115   -11.389 1.00 0.00 ? 16 ASP A HA   1  
ATOM 263   H HB2  . ASP A 1 16 ? 0.827   7.567   -12.015 1.00 0.00 ? 16 ASP A HB2  1  
ATOM 264   H HB3  . ASP A 1 16 ? 2.317   8.389   -12.467 1.00 0.00 ? 16 ASP A HB3  1  
ATOM 265   N N    . GLU A 1 17 ? 3.233   7.829   -8.903  1.00 0.00 ? 17 GLU A N    1  
ATOM 266   C CA   . GLU A 1 17 ? 3.878   8.818   -8.028  1.00 0.00 ? 17 GLU A CA   1  
ATOM 267   C C    . GLU A 1 17 ? 3.256   8.799   -6.634  1.00 0.00 ? 17 GLU A C    1  
ATOM 268   O O    . GLU A 1 17 ? 2.721   9.806   -6.170  1.00 0.00 ? 17 GLU A O    1  
ATOM 269   C CB   . GLU A 1 17 ? 3.769   10.233  -8.612  1.00 0.00 ? 17 GLU A CB   1  
ATOM 270   C CG   . GLU A 1 17 ? 2.388   10.567  -9.154  1.00 0.00 ? 17 GLU A CG   1  
ATOM 271   C CD   . GLU A 1 17 ? 2.441   11.243  -10.510 1.00 0.00 ? 17 GLU A CD   1  
ATOM 272   O OE1  . GLU A 1 17 ? 2.693   12.466  -10.554 1.00 0.00 ? 17 GLU A OE1  1  
ATOM 273   O OE2  . GLU A 1 17 ? 2.230   10.551  -11.528 1.00 0.00 ? 17 GLU A OE2  1  
ATOM 274   H H    . GLU A 1 17 ? 2.756   7.080   -8.491  1.00 0.00 ? 17 GLU A H    1  
ATOM 275   H HA   . GLU A 1 17 ? 4.922   8.552   -7.945  1.00 0.00 ? 17 GLU A HA   1  
ATOM 276   H HB2  . GLU A 1 17 ? 4.008   10.947  -7.837  1.00 0.00 ? 17 GLU A HB2  1  
ATOM 277   H HB3  . GLU A 1 17 ? 4.484   10.337  -9.414  1.00 0.00 ? 17 GLU A HB3  1  
ATOM 278   H HG2  . GLU A 1 17 ? 1.821   9.653   -9.247  1.00 0.00 ? 17 GLU A HG2  1  
ATOM 279   H HG3  . GLU A 1 17 ? 1.893   11.227  -8.457  1.00 0.00 ? 17 GLU A HG3  1  
ATOM 280   N N    . VAL A 1 18 ? 3.316   7.649   -5.970  1.00 0.00 ? 18 VAL A N    1  
ATOM 281   C CA   . VAL A 1 18 ? 2.750   7.506   -4.645  1.00 0.00 ? 18 VAL A CA   1  
ATOM 282   C C    . VAL A 1 18 ? 3.814   7.100   -3.616  1.00 0.00 ? 18 VAL A C    1  
ATOM 283   O O    . VAL A 1 18 ? 5.005   7.327   -3.823  1.00 0.00 ? 18 VAL A O    1  
ATOM 284   C CB   . VAL A 1 18 ? 1.617   6.467   -4.668  1.00 0.00 ? 18 VAL A CB   1  
ATOM 285   C CG1  . VAL A 1 18 ? 0.609   6.796   -5.761  1.00 0.00 ? 18 VAL A CG1  1  
ATOM 286   C CG2  . VAL A 1 18 ? 2.176   5.062   -4.847  1.00 0.00 ? 18 VAL A CG2  1  
ATOM 287   H H    . VAL A 1 18 ? 3.741   6.876   -6.383  1.00 0.00 ? 18 VAL A H    1  
ATOM 288   H HA   . VAL A 1 18 ? 2.329   8.459   -4.357  1.00 0.00 ? 18 VAL A HA   1  
ATOM 289   H HB   . VAL A 1 18 ? 1.112   6.509   -3.727  1.00 0.00 ? 18 VAL A HB   1  
ATOM 290   H HG11 . VAL A 1 18 ? 0.833   7.767   -6.177  1.00 0.00 ? 18 VAL A HG11 1  
ATOM 291   H HG12 . VAL A 1 18 ? -0.386  6.805   -5.341  1.00 0.00 ? 18 VAL A HG12 1  
ATOM 292   H HG13 . VAL A 1 18 ? 0.665   6.049   -6.540  1.00 0.00 ? 18 VAL A HG13 1  
ATOM 293   H HG21 . VAL A 1 18 ? 3.245   5.114   -4.989  1.00 0.00 ? 18 VAL A HG21 1  
ATOM 294   H HG22 . VAL A 1 18 ? 1.722   4.600   -5.709  1.00 0.00 ? 18 VAL A HG22 1  
ATOM 295   H HG23 . VAL A 1 18 ? 1.959   4.473   -3.967  1.00 0.00 ? 18 VAL A HG23 1  
ATOM 296   N N    . THR A 1 19 ? 3.369   6.498   -2.511  1.00 0.00 ? 19 THR A N    1  
ATOM 297   C CA   . THR A 1 19 ? 4.262   6.050   -1.442  1.00 0.00 ? 19 THR A CA   1  
ATOM 298   C C    . THR A 1 19 ? 3.447   5.690   -0.203  1.00 0.00 ? 19 THR A C    1  
ATOM 299   O O    . THR A 1 19 ? 2.949   6.568   0.495   1.00 0.00 ? 19 THR A O    1  
ATOM 300   C CB   . THR A 1 19 ? 5.289   7.134   -1.089  1.00 0.00 ? 19 THR A CB   1  
ATOM 301   O OG1  . THR A 1 19 ? 4.841   8.412   -1.506  1.00 0.00 ? 19 THR A OG1  1  
ATOM 302   C CG2  . THR A 1 19 ? 6.648   6.897   -1.712  1.00 0.00 ? 19 THR A CG2  1  
ATOM 303   H H    . THR A 1 19 ? 2.409   6.341   -2.410  1.00 0.00 ? 19 THR A H    1  
ATOM 304   H HA   . THR A 1 19 ? 4.781   5.168   -1.788  1.00 0.00 ? 19 THR A HA   1  
ATOM 305   H HB   . THR A 1 19 ? 5.419   7.156   -0.016  1.00 0.00 ? 19 THR A HB   1  
ATOM 306   H HG1  . THR A 1 19 ? 3.914   8.517   -1.278  1.00 0.00 ? 19 THR A HG1  1  
ATOM 307   H HG21 . THR A 1 19 ? 6.635   5.968   -2.262  1.00 0.00 ? 19 THR A HG21 1  
ATOM 308   H HG22 . THR A 1 19 ? 7.396   6.845   -0.935  1.00 0.00 ? 19 THR A HG22 1  
ATOM 309   H HG23 . THR A 1 19 ? 6.883   7.710   -2.384  1.00 0.00 ? 19 THR A HG23 1  
ATOM 310   N N    . VAL A 1 20 ? 3.301   4.398   0.065   1.00 0.00 ? 20 VAL A N    1  
ATOM 311   C CA   . VAL A 1 20 ? 2.529   3.950   1.219   1.00 0.00 ? 20 VAL A CA   1  
ATOM 312   C C    . VAL A 1 20 ? 3.361   3.071   2.149   1.00 0.00 ? 20 VAL A C    1  
ATOM 313   O O    . VAL A 1 20 ? 3.766   1.968   1.780   1.00 0.00 ? 20 VAL A O    1  
ATOM 314   C CB   . VAL A 1 20 ? 1.276   3.168   0.781   1.00 0.00 ? 20 VAL A CB   1  
ATOM 315   C CG1  . VAL A 1 20 ? 0.399   2.840   1.980   1.00 0.00 ? 20 VAL A CG1  1  
ATOM 316   C CG2  . VAL A 1 20 ? 0.495   3.953   -0.261  1.00 0.00 ? 20 VAL A CG2  1  
ATOM 317   H H    . VAL A 1 20 ? 3.716   3.733   -0.524  1.00 0.00 ? 20 VAL A H    1  
ATOM 318   H HA   . VAL A 1 20 ? 2.204   4.829   1.761   1.00 0.00 ? 20 VAL A HA   1  
ATOM 319   H HB   . VAL A 1 20 ? 1.596   2.240   0.334   1.00 0.00 ? 20 VAL A HB   1  
ATOM 320   H HG11 . VAL A 1 20 ? 0.996   2.861   2.880   1.00 0.00 ? 20 VAL A HG11 1  
ATOM 321   H HG12 . VAL A 1 20 ? -0.029  1.856   1.855   1.00 0.00 ? 20 VAL A HG12 1  
ATOM 322   H HG13 . VAL A 1 20 ? -0.393  3.569   2.057   1.00 0.00 ? 20 VAL A HG13 1  
ATOM 323   H HG21 . VAL A 1 20 ? 0.694   5.008   -0.140  1.00 0.00 ? 20 VAL A HG21 1  
ATOM 324   H HG22 . VAL A 1 20 ? -0.561  3.768   -0.134  1.00 0.00 ? 20 VAL A HG22 1  
ATOM 325   H HG23 . VAL A 1 20 ? 0.799   3.641   -1.249  1.00 0.00 ? 20 VAL A HG23 1  
ATOM 326   N N    . THR A 1 21 ? 3.609   3.566   3.359   1.00 0.00 ? 21 THR A N    1  
ATOM 327   C CA   . THR A 1 21 ? 4.388   2.825   4.345   1.00 0.00 ? 21 THR A CA   1  
ATOM 328   C C    . THR A 1 21 ? 3.479   2.232   5.419   1.00 0.00 ? 21 THR A C    1  
ATOM 329   O O    . THR A 1 21 ? 2.792   2.960   6.137   1.00 0.00 ? 21 THR A O    1  
ATOM 330   C CB   . THR A 1 21 ? 5.433   3.735   4.992   1.00 0.00 ? 21 THR A CB   1  
ATOM 331   O OG1  . THR A 1 21 ? 6.252   3.003   5.885   1.00 0.00 ? 21 THR A OG1  1  
ATOM 332   C CG2  . THR A 1 21 ? 4.828   4.888   5.763   1.00 0.00 ? 21 THR A CG2  1  
ATOM 333   H H    . THR A 1 21 ? 3.261   4.452   3.592   1.00 0.00 ? 21 THR A H    1  
ATOM 334   H HA   . THR A 1 21 ? 4.892   2.020   3.833   1.00 0.00 ? 21 THR A HA   1  
ATOM 335   H HB   . THR A 1 21 ? 6.063   4.150   4.217   1.00 0.00 ? 21 THR A HB   1  
ATOM 336   H HG1  . THR A 1 21 ? 5.699   2.542   6.521   1.00 0.00 ? 21 THR A HG1  1  
ATOM 337   H HG21 . THR A 1 21 ? 3.773   4.955   5.542   1.00 0.00 ? 21 THR A HG21 1  
ATOM 338   H HG22 . THR A 1 21 ? 5.316   5.808   5.478   1.00 0.00 ? 21 THR A HG22 1  
ATOM 339   H HG23 . THR A 1 21 ? 4.963   4.722   6.822   1.00 0.00 ? 21 THR A HG23 1  
ATOM 340   N N    . VAL A 1 22 ? 3.475   0.906   5.519   1.00 0.00 ? 22 VAL A N    1  
ATOM 341   C CA   . VAL A 1 22 ? 2.646   0.214   6.500   1.00 0.00 ? 22 VAL A CA   1  
ATOM 342   C C    . VAL A 1 22 ? 3.405   -0.023  7.804   1.00 0.00 ? 22 VAL A C    1  
ATOM 343   O O    . VAL A 1 22 ? 3.653   -1.167  8.187   1.00 0.00 ? 22 VAL A O    1  
ATOM 344   C CB   . VAL A 1 22 ? 2.144   -1.137  5.956   1.00 0.00 ? 22 VAL A CB   1  
ATOM 345   C CG1  . VAL A 1 22 ? 1.140   -0.922  4.834   1.00 0.00 ? 22 VAL A CG1  1  
ATOM 346   C CG2  . VAL A 1 22 ? 3.312   -1.988  5.480   1.00 0.00 ? 22 VAL A CG2  1  
ATOM 347   H H    . VAL A 1 22 ? 4.040   0.380   4.915   1.00 0.00 ? 22 VAL A H    1  
ATOM 348   H HA   . VAL A 1 22 ? 1.786   0.836   6.706   1.00 0.00 ? 22 VAL A HA   1  
ATOM 349   H HB   . VAL A 1 22 ? 1.646   -1.663  6.758   1.00 0.00 ? 22 VAL A HB   1  
ATOM 350   H HG11 . VAL A 1 22 ? 1.562   -0.257  4.095   1.00 0.00 ? 22 VAL A HG11 1  
ATOM 351   H HG12 . VAL A 1 22 ? 0.238   -0.486  5.237   1.00 0.00 ? 22 VAL A HG12 1  
ATOM 352   H HG13 . VAL A 1 22 ? 0.906   -1.870  4.373   1.00 0.00 ? 22 VAL A HG13 1  
ATOM 353   H HG21 . VAL A 1 22 ? 3.536   -1.749  4.451   1.00 0.00 ? 22 VAL A HG21 1  
ATOM 354   H HG22 . VAL A 1 22 ? 3.051   -3.033  5.559   1.00 0.00 ? 22 VAL A HG22 1  
ATOM 355   H HG23 . VAL A 1 22 ? 4.178   -1.786  6.093   1.00 0.00 ? 22 VAL A HG23 1  
ATOM 356   N N    . LEU A 1 23 ? 3.771   1.075   8.472   1.00 0.00 ? 23 LEU A N    1  
ATOM 357   C CA   . LEU A 1 23 ? 4.510   1.034   9.744   1.00 0.00 ? 23 LEU A CA   1  
ATOM 358   C C    . LEU A 1 23 ? 4.528   -0.364  10.369  1.00 0.00 ? 23 LEU A C    1  
ATOM 359   O O    . LEU A 1 23 ? 5.564   -1.029  10.388  1.00 0.00 ? 23 LEU A O    1  
ATOM 360   C CB   . LEU A 1 23 ? 3.906   2.039   10.728  1.00 0.00 ? 23 LEU A CB   1  
ATOM 361   C CG   . LEU A 1 23 ? 4.895   2.642   11.726  1.00 0.00 ? 23 LEU A CG   1  
ATOM 362   C CD1  . LEU A 1 23 ? 5.372   1.578   12.703  1.00 0.00 ? 23 LEU A CD1  1  
ATOM 363   C CD2  . LEU A 1 23 ? 6.074   3.268   10.997  1.00 0.00 ? 23 LEU A CD2  1  
ATOM 364   H H    . LEU A 1 23 ? 3.541   1.948   8.091   1.00 0.00 ? 23 LEU A H    1  
ATOM 365   H HA   . LEU A 1 23 ? 5.528   1.327   9.535   1.00 0.00 ? 23 LEU A HA   1  
ATOM 366   H HB2  . LEU A 1 23 ? 3.464   2.845   10.160  1.00 0.00 ? 23 LEU A HB2  1  
ATOM 367   H HB3  . LEU A 1 23 ? 3.126   1.543   11.284  1.00 0.00 ? 23 LEU A HB3  1  
ATOM 368   H HG   . LEU A 1 23 ? 4.396   3.419   12.290  1.00 0.00 ? 23 LEU A HG   1  
ATOM 369   H HD11 . LEU A 1 23 ? 4.584   0.857   12.859  1.00 0.00 ? 23 LEU A HD11 1  
ATOM 370   H HD12 . LEU A 1 23 ? 5.628   2.042   13.644  1.00 0.00 ? 23 LEU A HD12 1  
ATOM 371   H HD13 . LEU A 1 23 ? 6.240   1.079   12.299  1.00 0.00 ? 23 LEU A HD13 1  
ATOM 372   H HD21 . LEU A 1 23 ? 6.850   2.528   10.867  1.00 0.00 ? 23 LEU A HD21 1  
ATOM 373   H HD22 . LEU A 1 23 ? 6.457   4.095   11.576  1.00 0.00 ? 23 LEU A HD22 1  
ATOM 374   H HD23 . LEU A 1 23 ? 5.751   3.624   10.030  1.00 0.00 ? 23 LEU A HD23 1  
ATOM 375   N N    . GLY A 1 24 ? 3.377   -0.810  10.867  1.00 0.00 ? 24 GLY A N    1  
ATOM 376   C CA   . GLY A 1 24 ? 3.290   -2.130  11.469  1.00 0.00 ? 24 GLY A CA   1  
ATOM 377   C C    . GLY A 1 24 ? 3.563   -2.127  12.963  1.00 0.00 ? 24 GLY A C    1  
ATOM 378   O O    . GLY A 1 24 ? 2.837   -2.758  13.731  1.00 0.00 ? 24 GLY A O    1  
ATOM 379   H H    . GLY A 1 24 ? 2.579   -0.243  10.817  1.00 0.00 ? 24 GLY A H    1  
ATOM 380   H HA2  . GLY A 1 24 ? 2.300   -2.524  11.299  1.00 0.00 ? 24 GLY A HA2  1  
ATOM 381   H HA3  . GLY A 1 24 ? 4.006   -2.777  10.986  1.00 0.00 ? 24 GLY A HA3  1  
ATOM 382   N N    . VAL A 1 25 ? 4.613   -1.423  13.377  1.00 0.00 ? 25 VAL A N    1  
ATOM 383   C CA   . VAL A 1 25 ? 4.977   -1.352  14.786  1.00 0.00 ? 25 VAL A CA   1  
ATOM 384   C C    . VAL A 1 25 ? 4.194   -0.253  15.494  1.00 0.00 ? 25 VAL A C    1  
ATOM 385   O O    . VAL A 1 25 ? 4.028   0.843   14.960  1.00 0.00 ? 25 VAL A O    1  
ATOM 386   C CB   . VAL A 1 25 ? 6.486   -1.088  14.978  1.00 0.00 ? 25 VAL A CB   1  
ATOM 387   C CG1  . VAL A 1 25 ? 6.970   -1.693  16.287  1.00 0.00 ? 25 VAL A CG1  1  
ATOM 388   C CG2  . VAL A 1 25 ? 7.291   -1.629  13.804  1.00 0.00 ? 25 VAL A CG2  1  
ATOM 389   H H    . VAL A 1 25 ? 5.157   -0.950  12.723  1.00 0.00 ? 25 VAL A H    1  
ATOM 390   H HA   . VAL A 1 25 ? 4.738   -2.300  15.234  1.00 0.00 ? 25 VAL A HA   1  
ATOM 391   H HB   . VAL A 1 25 ? 6.638   -0.019  15.028  1.00 0.00 ? 25 VAL A HB   1  
ATOM 392   H HG11 . VAL A 1 25 ? 6.333   -2.522  16.557  1.00 0.00 ? 25 VAL A HG11 1  
ATOM 393   H HG12 . VAL A 1 25 ? 6.936   -0.945  17.064  1.00 0.00 ? 25 VAL A HG12 1  
ATOM 394   H HG13 . VAL A 1 25 ? 7.985   -2.043  16.168  1.00 0.00 ? 25 VAL A HG13 1  
ATOM 395   H HG21 . VAL A 1 25 ? 6.969   -2.634  13.579  1.00 0.00 ? 25 VAL A HG21 1  
ATOM 396   H HG22 . VAL A 1 25 ? 8.341   -1.637  14.060  1.00 0.00 ? 25 VAL A HG22 1  
ATOM 397   H HG23 . VAL A 1 25 ? 7.136   -0.999  12.941  1.00 0.00 ? 25 VAL A HG23 1  
ATOM 398   N N    . LYS A 1 26 ? 3.710   -0.546  16.700  1.00 0.00 ? 26 LYS A N    1  
ATOM 399   C CA   . LYS A 1 26 ? 2.940   0.423   17.475  1.00 0.00 ? 26 LYS A CA   1  
ATOM 400   C C    . LYS A 1 26 ? 2.404   -0.222  18.751  1.00 0.00 ? 26 LYS A C    1  
ATOM 401   O O    . LYS A 1 26 ? 2.406   -1.445  18.884  1.00 0.00 ? 26 LYS A O    1  
ATOM 402   C CB   . LYS A 1 26 ? 1.777   0.976   16.648  1.00 0.00 ? 26 LYS A CB   1  
ATOM 403   C CG   . LYS A 1 26 ? 1.588   2.477   16.790  1.00 0.00 ? 26 LYS A CG   1  
ATOM 404   C CD   . LYS A 1 26 ? 2.527   3.246   15.874  1.00 0.00 ? 26 LYS A CD   1  
ATOM 405   C CE   . LYS A 1 26 ? 2.559   4.725   16.224  1.00 0.00 ? 26 LYS A CE   1  
ATOM 406   N NZ   . LYS A 1 26 ? 3.892   5.331   15.956  1.00 0.00 ? 26 LYS A NZ   1  
ATOM 407   H H    . LYS A 1 26 ? 3.869   -1.430  17.090  1.00 0.00 ? 26 LYS A H    1  
ATOM 408   H HA   . LYS A 1 26 ? 3.600   1.234   17.744  1.00 0.00 ? 26 LYS A HA   1  
ATOM 409   H HB2  . LYS A 1 26 ? 1.949   0.754   15.606  1.00 0.00 ? 26 LYS A HB2  1  
ATOM 410   H HB3  . LYS A 1 26 ? 0.866   0.489   16.962  1.00 0.00 ? 26 LYS A HB3  1  
ATOM 411   H HG2  . LYS A 1 26 ? 0.569   2.728   16.537  1.00 0.00 ? 26 LYS A HG2  1  
ATOM 412   H HG3  . LYS A 1 26 ? 1.787   2.759   17.814  1.00 0.00 ? 26 LYS A HG3  1  
ATOM 413   H HD2  . LYS A 1 26 ? 3.523   2.841   15.974  1.00 0.00 ? 26 LYS A HD2  1  
ATOM 414   H HD3  . LYS A 1 26 ? 2.190   3.133   14.854  1.00 0.00 ? 26 LYS A HD3  1  
ATOM 415   H HE2  . LYS A 1 26 ? 1.815   5.238   15.633  1.00 0.00 ? 26 LYS A HE2  1  
ATOM 416   H HE3  . LYS A 1 26 ? 2.326   4.839   17.273  1.00 0.00 ? 26 LYS A HE3  1  
ATOM 417   H HZ1  . LYS A 1 26 ? 4.403   4.771   15.243  1.00 0.00 ? 26 LYS A HZ1  1  
ATOM 418   H HZ2  . LYS A 1 26 ? 4.456   5.356   16.829  1.00 0.00 ? 26 LYS A HZ2  1  
ATOM 419   H HZ3  . LYS A 1 26 ? 3.779   6.302   15.602  1.00 0.00 ? 26 LYS A HZ3  1  
ATOM 420   N N    . GLY A 1 27 ? 1.946   0.608   19.685  1.00 0.00 ? 27 GLY A N    1  
ATOM 421   C CA   . GLY A 1 27 ? 1.409   0.098   20.937  1.00 0.00 ? 27 GLY A CA   1  
ATOM 422   C C    . GLY A 1 27 ? 0.302   -0.920  20.722  1.00 0.00 ? 27 GLY A C    1  
ATOM 423   O O    . GLY A 1 27 ? 0.563   -2.057  20.330  1.00 0.00 ? 27 GLY A O    1  
ATOM 424   H H    . GLY A 1 27 ? 1.970   1.573   19.517  1.00 0.00 ? 27 GLY A H    1  
ATOM 425   H HA2  . GLY A 1 27 ? 2.207   -0.368  21.496  1.00 0.00 ? 27 GLY A HA2  1  
ATOM 426   H HA3  . GLY A 1 27 ? 1.016   0.924   21.511  1.00 0.00 ? 27 GLY A HA3  1  
ATOM 427   N N    . ASN A 1 28 ? -0.939  -0.512  20.971  1.00 0.00 ? 28 ASN A N    1  
ATOM 428   C CA   . ASN A 1 28 ? -2.084  -1.398  20.791  1.00 0.00 ? 28 ASN A CA   1  
ATOM 429   C C    . ASN A 1 28 ? -2.631  -1.273  19.373  1.00 0.00 ? 28 ASN A C    1  
ATOM 430   O O    . ASN A 1 28 ? -2.976  -2.268  18.735  1.00 0.00 ? 28 ASN A O    1  
ATOM 431   C CB   . ASN A 1 28 ? -3.179  -1.068  21.807  1.00 0.00 ? 28 ASN A CB   1  
ATOM 432   C CG   . ASN A 1 28 ? -3.073  -1.907  23.065  1.00 0.00 ? 28 ASN A CG   1  
ATOM 433   O OD1  . ASN A 1 28 ? -3.614  -3.010  23.137  1.00 0.00 ? 28 ASN A OD1  1  
ATOM 434   N ND2  . ASN A 1 28 ? -2.372  -1.386  24.065  1.00 0.00 ? 28 ASN A ND2  1  
ATOM 435   H H    . ASN A 1 28 ? -1.090  0.407   21.277  1.00 0.00 ? 28 ASN A H    1  
ATOM 436   H HA   . ASN A 1 28 ? -1.749  -2.412  20.949  1.00 0.00 ? 28 ASN A HA   1  
ATOM 437   H HB2  . ASN A 1 28 ? -3.103  -0.027  22.083  1.00 0.00 ? 28 ASN A HB2  1  
ATOM 438   H HB3  . ASN A 1 28 ? -4.145  -1.247  21.357  1.00 0.00 ? 28 ASN A HB3  1  
ATOM 439   H HD21 . ASN A 1 28 ? -1.969  -0.502  23.937  1.00 0.00 ? 28 ASN A HD21 1  
ATOM 440   H HD22 . ASN A 1 28 ? -2.286  -1.907  24.891  1.00 0.00 ? 28 ASN A HD22 1  
ATOM 441   N N    . GLN A 1 29 ? -2.692  -0.040  18.887  1.00 0.00 ? 29 GLN A N    1  
ATOM 442   C CA   . GLN A 1 29 ? -3.179  0.240   17.542  1.00 0.00 ? 29 GLN A CA   1  
ATOM 443   C C    . GLN A 1 29 ? -2.009  0.585   16.627  1.00 0.00 ? 29 GLN A C    1  
ATOM 444   O O    . GLN A 1 29 ? -1.109  1.326   17.020  1.00 0.00 ? 29 GLN A O    1  
ATOM 445   C CB   . GLN A 1 29 ? -4.187  1.390   17.572  1.00 0.00 ? 29 GLN A CB   1  
ATOM 446   C CG   . GLN A 1 29 ? -5.424  1.138   16.725  1.00 0.00 ? 29 GLN A CG   1  
ATOM 447   C CD   . GLN A 1 29 ? -6.411  0.204   17.397  1.00 0.00 ? 29 GLN A CD   1  
ATOM 448   O OE1  . GLN A 1 29 ? -6.548  -0.957  17.010  1.00 0.00 ? 29 GLN A OE1  1  
ATOM 449   N NE2  . GLN A 1 29 ? -7.106  0.707   18.411  1.00 0.00 ? 29 GLN A NE2  1  
ATOM 450   H H    . GLN A 1 29 ? -2.391  0.706   19.448  1.00 0.00 ? 29 GLN A H    1  
ATOM 451   H HA   . GLN A 1 29 ? -3.666  -0.650  17.171  1.00 0.00 ? 29 GLN A HA   1  
ATOM 452   H HB2  . GLN A 1 29 ? -4.504  1.549   18.592  1.00 0.00 ? 29 GLN A HB2  1  
ATOM 453   H HB3  . GLN A 1 29 ? -3.705  2.286   17.211  1.00 0.00 ? 29 GLN A HB3  1  
ATOM 454   H HG2  . GLN A 1 29 ? -5.915  2.081   16.538  1.00 0.00 ? 29 GLN A HG2  1  
ATOM 455   H HG3  . GLN A 1 29 ? -5.118  0.700   15.786  1.00 0.00 ? 29 GLN A HG3  1  
ATOM 456   H HE21 . GLN A 1 29 ? -6.945  1.640   18.664  1.00 0.00 ? 29 GLN A HE21 1  
ATOM 457   H HE22 . GLN A 1 29 ? -7.751  0.125   18.864  1.00 0.00 ? 29 GLN A HE22 1  
ATOM 458   N N    . VAL A 1 30 ? -2.011  0.038   15.415  1.00 0.00 ? 30 VAL A N    1  
ATOM 459   C CA   . VAL A 1 30 ? -0.927  0.291   14.474  1.00 0.00 ? 30 VAL A CA   1  
ATOM 460   C C    . VAL A 1 30 ? -1.249  1.463   13.557  1.00 0.00 ? 30 VAL A C    1  
ATOM 461   O O    . VAL A 1 30 ? -2.164  1.392   12.740  1.00 0.00 ? 30 VAL A O    1  
ATOM 462   C CB   . VAL A 1 30 ? -0.629  -0.951  13.612  1.00 0.00 ? 30 VAL A CB   1  
ATOM 463   C CG1  . VAL A 1 30 ? 0.630   -0.738  12.787  1.00 0.00 ? 30 VAL A CG1  1  
ATOM 464   C CG2  . VAL A 1 30 ? -0.500  -2.192  14.485  1.00 0.00 ? 30 VAL A CG2  1  
ATOM 465   H H    . VAL A 1 30 ? -2.750  -0.555  15.151  1.00 0.00 ? 30 VAL A H    1  
ATOM 466   H HA   . VAL A 1 30 ? -0.041  0.527   15.043  1.00 0.00 ? 30 VAL A HA   1  
ATOM 467   H HB   . VAL A 1 30 ? -1.457  -1.099  12.934  1.00 0.00 ? 30 VAL A HB   1  
ATOM 468   H HG11 . VAL A 1 30 ? 0.365   -0.320  11.827  1.00 0.00 ? 30 VAL A HG11 1  
ATOM 469   H HG12 . VAL A 1 30 ? 1.129   -1.684  12.642  1.00 0.00 ? 30 VAL A HG12 1  
ATOM 470   H HG13 . VAL A 1 30 ? 1.290   -0.059  13.305  1.00 0.00 ? 30 VAL A HG13 1  
ATOM 471   H HG21 . VAL A 1 30 ? -1.076  -2.997  14.053  1.00 0.00 ? 30 VAL A HG21 1  
ATOM 472   H HG22 . VAL A 1 30 ? -0.871  -1.977  15.476  1.00 0.00 ? 30 VAL A HG22 1  
ATOM 473   H HG23 . VAL A 1 30 ? 0.538   -2.484  14.545  1.00 0.00 ? 30 VAL A HG23 1  
ATOM 474   N N    . ARG A 1 31 ? -0.483  2.541   13.694  1.00 0.00 ? 31 ARG A N    1  
ATOM 475   C CA   . ARG A 1 31 ? -0.680  3.723   12.880  1.00 0.00 ? 31 ARG A CA   1  
ATOM 476   C C    . ARG A 1 31 ? -0.141  3.502   11.472  1.00 0.00 ? 31 ARG A C    1  
ATOM 477   O O    . ARG A 1 31 ? 1.066   3.572   11.241  1.00 0.00 ? 31 ARG A O    1  
ATOM 478   C CB   . ARG A 1 31 ? 0.006   4.932   13.522  1.00 0.00 ? 31 ARG A CB   1  
ATOM 479   C CG   . ARG A 1 31 ? -0.832  6.199   13.478  1.00 0.00 ? 31 ARG A CG   1  
ATOM 480   C CD   . ARG A 1 31 ? -1.786  6.278   14.660  1.00 0.00 ? 31 ARG A CD   1  
ATOM 481   N NE   . ARG A 1 31 ? -2.343  7.618   14.825  1.00 0.00 ? 31 ARG A NE   1  
ATOM 482   C CZ   . ARG A 1 31 ? -1.693  8.626   15.403  1.00 0.00 ? 31 ARG A CZ   1  
ATOM 483   N NH1  . ARG A 1 31 ? -0.463  8.450   15.871  1.00 0.00 ? 31 ARG A NH1  1  
ATOM 484   N NH2  . ARG A 1 31 ? -2.274  9.813   15.514  1.00 0.00 ? 31 ARG A NH2  1  
ATOM 485   H H    . ARG A 1 31 ? 0.232   2.539   14.351  1.00 0.00 ? 31 ARG A H    1  
ATOM 486   H HA   . ARG A 1 31 ? -1.734  3.905   12.829  1.00 0.00 ? 31 ARG A HA   1  
ATOM 487   H HB2  . ARG A 1 31 ? 0.219   4.703   14.556  1.00 0.00 ? 31 ARG A HB2  1  
ATOM 488   H HB3  . ARG A 1 31 ? 0.935   5.122   13.006  1.00 0.00 ? 31 ARG A HB3  1  
ATOM 489   H HG2  . ARG A 1 31 ? -0.175  7.055   13.501  1.00 0.00 ? 31 ARG A HG2  1  
ATOM 490   H HG3  . ARG A 1 31 ? -1.406  6.207   12.563  1.00 0.00 ? 31 ARG A HG3  1  
ATOM 491   H HD2  . ARG A 1 31 ? -2.594  5.580   14.501  1.00 0.00 ? 31 ARG A HD2  1  
ATOM 492   H HD3  . ARG A 1 31 ? -1.249  6.007   15.557  1.00 0.00 ? 31 ARG A HD3  1  
ATOM 493   H HE   . ARG A 1 31 ? -3.250  7.776   14.488  1.00 0.00 ? 31 ARG A HE   1  
ATOM 494   H HH11 . ARG A 1 31 ? -0.019  7.558   15.791  1.00 0.00 ? 31 ARG A HH11 1  
ATOM 495   H HH12 . ARG A 1 31 ? 0.019   9.211   16.304  1.00 0.00 ? 31 ARG A HH12 1  
ATOM 496   H HH21 . ARG A 1 31 ? -3.200  9.951   15.163  1.00 0.00 ? 31 ARG A HH21 1  
ATOM 497   H HH22 . ARG A 1 31 ? -1.786  10.570  15.949  1.00 0.00 ? 31 ARG A HH22 1  
ATOM 498   N N    . ILE A 1 32 ? -1.040  3.215   10.539  1.00 0.00 ? 32 ILE A N    1  
ATOM 499   C CA   . ILE A 1 32 ? -0.648  2.962   9.159   1.00 0.00 ? 32 ILE A CA   1  
ATOM 500   C C    . ILE A 1 32 ? -0.571  4.264   8.369   1.00 0.00 ? 32 ILE A C    1  
ATOM 501   O O    . ILE A 1 32 ? -1.481  5.091   8.428   1.00 0.00 ? 32 ILE A O    1  
ATOM 502   C CB   . ILE A 1 32 ? -1.638  1.996   8.477   1.00 0.00 ? 32 ILE A CB   1  
ATOM 503   C CG1  . ILE A 1 32 ? -1.964  0.827   9.417   1.00 0.00 ? 32 ILE A CG1  1  
ATOM 504   C CG2  . ILE A 1 32 ? -1.066  1.489   7.160   1.00 0.00 ? 32 ILE A CG2  1  
ATOM 505   C CD1  . ILE A 1 32 ? -0.801  -0.117  9.636   1.00 0.00 ? 32 ILE A CD1  1  
ATOM 506   H H    . ILE A 1 32 ? -1.989  3.150   10.787  1.00 0.00 ? 32 ILE A H    1  
ATOM 507   H HA   . ILE A 1 32 ? 0.328   2.498   9.167   1.00 0.00 ? 32 ILE A HA   1  
ATOM 508   H HB   . ILE A 1 32 ? -2.545  2.539   8.261   1.00 0.00 ? 32 ILE A HB   1  
ATOM 509   H HG12 . ILE A 1 32 ? -2.254  1.221   10.381  1.00 0.00 ? 32 ILE A HG12 1  
ATOM 510   H HG13 . ILE A 1 32 ? -2.784  0.256   9.008   1.00 0.00 ? 32 ILE A HG13 1  
ATOM 511   H HG21 . ILE A 1 32 ? -1.309  0.444   7.040   1.00 0.00 ? 32 ILE A HG21 1  
ATOM 512   H HG22 . ILE A 1 32 ? 0.007   1.611   7.163   1.00 0.00 ? 32 ILE A HG22 1  
ATOM 513   H HG23 . ILE A 1 32 ? -1.490  2.053   6.343   1.00 0.00 ? 32 ILE A HG23 1  
ATOM 514   H HD11 . ILE A 1 32 ? 0.050   0.438   10.000  1.00 0.00 ? 32 ILE A HD11 1  
ATOM 515   H HD12 . ILE A 1 32 ? -0.546  -0.596  8.702   1.00 0.00 ? 32 ILE A HD12 1  
ATOM 516   H HD13 . ILE A 1 32 ? -1.079  -0.867  10.362  1.00 0.00 ? 32 ILE A HD13 1  
ATOM 517   N N    . GLY A 1 33 ? 0.530   4.447   7.642   1.00 0.00 ? 33 GLY A N    1  
ATOM 518   C CA   . GLY A 1 33 ? 0.713   5.660   6.867   1.00 0.00 ? 33 GLY A CA   1  
ATOM 519   C C    . GLY A 1 33 ? 0.566   5.439   5.377   1.00 0.00 ? 33 GLY A C    1  
ATOM 520   O O    . GLY A 1 33 ? 1.302   4.652   4.782   1.00 0.00 ? 33 GLY A O    1  
ATOM 521   H H    . GLY A 1 33 ? 1.229   3.759   7.637   1.00 0.00 ? 33 GLY A H    1  
ATOM 522   H HA2  . GLY A 1 33 ? -0.017  6.386   7.181   1.00 0.00 ? 33 GLY A HA2  1  
ATOM 523   H HA3  . GLY A 1 33 ? 1.700   6.052   7.064   1.00 0.00 ? 33 GLY A HA3  1  
ATOM 524   N N    . VAL A 1 34 ? -0.386  6.142   4.772   1.00 0.00 ? 34 VAL A N    1  
ATOM 525   C CA   . VAL A 1 34 ? -0.627  6.025   3.341   1.00 0.00 ? 34 VAL A CA   1  
ATOM 526   C C    . VAL A 1 34 ? -0.396  7.356   2.632   1.00 0.00 ? 34 VAL A C    1  
ATOM 527   O O    . VAL A 1 34 ? -1.228  8.261   2.700   1.00 0.00 ? 34 VAL A O    1  
ATOM 528   C CB   . VAL A 1 34 ? -2.062  5.547   3.050   1.00 0.00 ? 34 VAL A CB   1  
ATOM 529   C CG1  . VAL A 1 34 ? -2.223  5.194   1.580   1.00 0.00 ? 34 VAL A CG1  1  
ATOM 530   C CG2  . VAL A 1 34 ? -2.420  4.362   3.935   1.00 0.00 ? 34 VAL A CG2  1  
ATOM 531   H H    . VAL A 1 34 ? -0.939  6.755   5.299   1.00 0.00 ? 34 VAL A H    1  
ATOM 532   H HA   . VAL A 1 34 ? 0.061   5.293   2.945   1.00 0.00 ? 34 VAL A HA   1  
ATOM 533   H HB   . VAL A 1 34 ? -2.742  6.356   3.278   1.00 0.00 ? 34 VAL A HB   1  
ATOM 534   H HG11 . VAL A 1 34 ? -1.413  5.631   1.013   1.00 0.00 ? 34 VAL A HG11 1  
ATOM 535   H HG12 . VAL A 1 34 ? -3.164  5.579   1.217   1.00 0.00 ? 34 VAL A HG12 1  
ATOM 536   H HG13 . VAL A 1 34 ? -2.204  4.120   1.463   1.00 0.00 ? 34 VAL A HG13 1  
ATOM 537   H HG21 . VAL A 1 34 ? -2.119  4.569   4.951   1.00 0.00 ? 34 VAL A HG21 1  
ATOM 538   H HG22 . VAL A 1 34 ? -1.908  3.480   3.579   1.00 0.00 ? 34 VAL A HG22 1  
ATOM 539   H HG23 . VAL A 1 34 ? -3.487  4.197   3.902   1.00 0.00 ? 34 VAL A HG23 1  
ATOM 540   N N    . ASN A 1 35 ? 0.738   7.466   1.949   1.00 0.00 ? 35 ASN A N    1  
ATOM 541   C CA   . ASN A 1 35 ? 1.071   8.685   1.221   1.00 0.00 ? 35 ASN A CA   1  
ATOM 542   C C    . ASN A 1 35 ? 0.754   8.523   -0.261  1.00 0.00 ? 35 ASN A C    1  
ATOM 543   O O    . ASN A 1 35 ? 1.444   7.806   -0.984  1.00 0.00 ? 35 ASN A O    1  
ATOM 544   C CB   . ASN A 1 35 ? 2.548   9.043   1.411   1.00 0.00 ? 35 ASN A CB   1  
ATOM 545   C CG   . ASN A 1 35 ? 2.758   10.524  1.653   1.00 0.00 ? 35 ASN A CG   1  
ATOM 546   O OD1  . ASN A 1 35 ? 1.822   11.319  1.563   1.00 0.00 ? 35 ASN A OD1  1  
ATOM 547   N ND2  . ASN A 1 35 ? 3.992   10.904  1.962   1.00 0.00 ? 35 ASN A ND2  1  
ATOM 548   H H    . ASN A 1 35 ? 1.359   6.708   1.938   1.00 0.00 ? 35 ASN A H    1  
ATOM 549   H HA   . ASN A 1 35 ? 0.463   9.483   1.620   1.00 0.00 ? 35 ASN A HA   1  
ATOM 550   H HB2  . ASN A 1 35 ? 2.938   8.500   2.259   1.00 0.00 ? 35 ASN A HB2  1  
ATOM 551   H HB3  . ASN A 1 35 ? 3.097   8.761   0.525   1.00 0.00 ? 35 ASN A HB3  1  
ATOM 552   H HD21 . ASN A 1 35 ? 4.688   10.216  2.015   1.00 0.00 ? 35 ASN A HD21 1  
ATOM 553   H HD22 . ASN A 1 35 ? 4.157   11.857  2.123   1.00 0.00 ? 35 ASN A HD22 1  
ATOM 554   N N    . ALA A 1 36 ? -0.303  9.191   -0.703  1.00 0.00 ? 36 ALA A N    1  
ATOM 555   C CA   . ALA A 1 36 ? -0.723  9.119   -2.097  1.00 0.00 ? 36 ALA A CA   1  
ATOM 556   C C    . ALA A 1 36 ? -1.238  10.465  -2.601  1.00 0.00 ? 36 ALA A C    1  
ATOM 557   O O    . ALA A 1 36 ? -1.877  11.213  -1.861  1.00 0.00 ? 36 ALA A O    1  
ATOM 558   C CB   . ALA A 1 36 ? -1.791  8.049   -2.268  1.00 0.00 ? 36 ALA A CB   1  
ATOM 559   H H    . ALA A 1 36 ? -0.810  9.736   -0.068  1.00 0.00 ? 36 ALA A H    1  
ATOM 560   H HA   . ALA A 1 36 ? 0.135   8.830   -2.685  1.00 0.00 ? 36 ALA A HA   1  
ATOM 561   H HB1  . ALA A 1 36 ? -1.631  7.527   -3.200  1.00 0.00 ? 36 ALA A HB1  1  
ATOM 562   H HB2  . ALA A 1 36 ? -2.766  8.512   -2.277  1.00 0.00 ? 36 ALA A HB2  1  
ATOM 563   H HB3  . ALA A 1 36 ? -1.732  7.348   -1.449  1.00 0.00 ? 36 ALA A HB3  1  
ATOM 564   N N    . PRO A 1 37 ? -0.968  10.787  -3.880  1.00 0.00 ? 37 PRO A N    1  
ATOM 565   C CA   . PRO A 1 37 ? -1.408  12.042  -4.490  1.00 0.00 ? 37 PRO A CA   1  
ATOM 566   C C    . PRO A 1 37 ? -2.867  11.987  -4.928  1.00 0.00 ? 37 PRO A C    1  
ATOM 567   O O    . PRO A 1 37 ? -3.412  10.910  -5.166  1.00 0.00 ? 37 PRO A O    1  
ATOM 568   C CB   . PRO A 1 37 ? -0.493  12.166  -5.705  1.00 0.00 ? 37 PRO A CB   1  
ATOM 569   C CG   . PRO A 1 37 ? -0.224  10.758  -6.108  1.00 0.00 ? 37 PRO A CG   1  
ATOM 570   C CD   . PRO A 1 37 ? -0.215  9.949   -4.835  1.00 0.00 ? 37 PRO A CD   1  
ATOM 571   H HA   . PRO A 1 37 ? -1.257  12.883  -3.830  1.00 0.00 ? 37 PRO A HA   1  
ATOM 572   H HB2  . PRO A 1 37 ? -0.998  12.715  -6.487  1.00 0.00 ? 37 PRO A HB2  1  
ATOM 573   H HB3  . PRO A 1 37 ? 0.416   12.677  -5.426  1.00 0.00 ? 37 PRO A HB3  1  
ATOM 574   H HG2  . PRO A 1 37 ? -1.006  10.410  -6.767  1.00 0.00 ? 37 PRO A HG2  1  
ATOM 575   H HG3  . PRO A 1 37 ? 0.735   10.694  -6.599  1.00 0.00 ? 37 PRO A HG3  1  
ATOM 576   H HD2  . PRO A 1 37 ? -0.710  9.001   -4.988  1.00 0.00 ? 37 PRO A HD2  1  
ATOM 577   H HD3  . PRO A 1 37 ? 0.798   9.794   -4.495  1.00 0.00 ? 37 PRO A HD3  1  
ATOM 578   N N    . LYS A 1 38 ? -3.495  13.153  -5.032  1.00 0.00 ? 38 LYS A N    1  
ATOM 579   C CA   . LYS A 1 38 ? -4.893  13.231  -5.441  1.00 0.00 ? 38 LYS A CA   1  
ATOM 580   C C    . LYS A 1 38 ? -5.014  13.437  -6.950  1.00 0.00 ? 38 LYS A C    1  
ATOM 581   O O    . LYS A 1 38 ? -5.923  14.122  -7.418  1.00 0.00 ? 38 LYS A O    1  
ATOM 582   C CB   . LYS A 1 38 ? -5.599  14.368  -4.702  1.00 0.00 ? 38 LYS A CB   1  
ATOM 583   C CG   . LYS A 1 38 ? -5.449  14.297  -3.191  1.00 0.00 ? 38 LYS A CG   1  
ATOM 584   C CD   . LYS A 1 38 ? -5.286  15.679  -2.581  1.00 0.00 ? 38 LYS A CD   1  
ATOM 585   C CE   . LYS A 1 38 ? -4.956  15.598  -1.099  1.00 0.00 ? 38 LYS A CE   1  
ATOM 586   N NZ   . LYS A 1 38 ? -6.041  14.938  -0.323  1.00 0.00 ? 38 LYS A NZ   1  
ATOM 587   H H    . LYS A 1 38 ? -3.009  13.979  -4.829  1.00 0.00 ? 38 LYS A H    1  
ATOM 588   H HA   . LYS A 1 38 ? -5.366  12.296  -5.180  1.00 0.00 ? 38 LYS A HA   1  
ATOM 589   H HB2  . LYS A 1 38 ? -5.190  15.309  -5.039  1.00 0.00 ? 38 LYS A HB2  1  
ATOM 590   H HB3  . LYS A 1 38 ? -6.652  14.337  -4.940  1.00 0.00 ? 38 LYS A HB3  1  
ATOM 591   H HG2  . LYS A 1 38 ? -6.330  13.832  -2.773  1.00 0.00 ? 38 LYS A HG2  1  
ATOM 592   H HG3  . LYS A 1 38 ? -4.579  13.703  -2.953  1.00 0.00 ? 38 LYS A HG3  1  
ATOM 593   H HD2  . LYS A 1 38 ? -4.486  16.195  -3.090  1.00 0.00 ? 38 LYS A HD2  1  
ATOM 594   H HD3  . LYS A 1 38 ? -6.208  16.228  -2.706  1.00 0.00 ? 38 LYS A HD3  1  
ATOM 595   H HE2  . LYS A 1 38 ? -4.043  15.034  -0.977  1.00 0.00 ? 38 LYS A HE2  1  
ATOM 596   H HE3  . LYS A 1 38 ? -4.812  16.600  -0.720  1.00 0.00 ? 38 LYS A HE3  1  
ATOM 597   H HZ1  . LYS A 1 38 ? -6.953  15.060  -0.809  1.00 0.00 ? 38 LYS A HZ1  1  
ATOM 598   H HZ2  . LYS A 1 38 ? -6.108  15.356  0.626   1.00 0.00 ? 38 LYS A HZ2  1  
ATOM 599   H HZ3  . LYS A 1 38 ? -5.844  13.921  -0.228  1.00 0.00 ? 38 LYS A HZ3  1  
ATOM 600   N N    . GLU A 1 39 ? -4.095  12.842  -7.707  1.00 0.00 ? 39 GLU A N    1  
ATOM 601   C CA   . GLU A 1 39 ? -4.107  12.965  -9.160  1.00 0.00 ? 39 GLU A CA   1  
ATOM 602   C C    . GLU A 1 39 ? -4.713  11.723  -9.807  1.00 0.00 ? 39 GLU A C    1  
ATOM 603   O O    . GLU A 1 39 ? -5.525  11.824  -10.726 1.00 0.00 ? 39 GLU A O    1  
ATOM 604   C CB   . GLU A 1 39 ? -2.687  13.185  -9.684  1.00 0.00 ? 39 GLU A CB   1  
ATOM 605   C CG   . GLU A 1 39 ? -2.634  13.952  -10.995 1.00 0.00 ? 39 GLU A CG   1  
ATOM 606   C CD   . GLU A 1 39 ? -1.497  14.953  -11.040 1.00 0.00 ? 39 GLU A CD   1  
ATOM 607   O OE1  . GLU A 1 39 ? -1.502  15.894  -10.219 1.00 0.00 ? 39 GLU A OE1  1  
ATOM 608   O OE2  . GLU A 1 39 ? -0.600  14.795  -11.895 1.00 0.00 ? 39 GLU A OE2  1  
ATOM 609   H H    . GLU A 1 39 ? -3.393  12.308  -7.282  1.00 0.00 ? 39 GLU A H    1  
ATOM 610   H HA   . GLU A 1 39 ? -4.712  13.821  -9.416  1.00 0.00 ? 39 GLU A HA   1  
ATOM 611   H HB2  . GLU A 1 39 ? -2.124  13.738  -8.946  1.00 0.00 ? 39 GLU A HB2  1  
ATOM 612   H HB3  . GLU A 1 39 ? -2.218  12.224  -9.836  1.00 0.00 ? 39 GLU A HB3  1  
ATOM 613   H HG2  . GLU A 1 39 ? -2.506  13.248  -11.805 1.00 0.00 ? 39 GLU A HG2  1  
ATOM 614   H HG3  . GLU A 1 39 ? -3.567  14.482  -11.125 1.00 0.00 ? 39 GLU A HG3  1  
ATOM 615   N N    . VAL A 1 40 ? -4.317  10.551  -9.317  1.00 0.00 ? 40 VAL A N    1  
ATOM 616   C CA   . VAL A 1 40 ? -4.827  9.292   -9.846  1.00 0.00 ? 40 VAL A CA   1  
ATOM 617   C C    . VAL A 1 40 ? -6.092  8.868   -9.108  1.00 0.00 ? 40 VAL A C    1  
ATOM 618   O O    . VAL A 1 40 ? -6.338  9.300   -7.982  1.00 0.00 ? 40 VAL A O    1  
ATOM 619   C CB   . VAL A 1 40 ? -3.777  8.167   -9.744  1.00 0.00 ? 40 VAL A CB   1  
ATOM 620   C CG1  . VAL A 1 40 ? -4.265  6.914   -10.454 1.00 0.00 ? 40 VAL A CG1  1  
ATOM 621   C CG2  . VAL A 1 40 ? -2.445  8.628   -10.317 1.00 0.00 ? 40 VAL A CG2  1  
ATOM 622   H H    . VAL A 1 40 ? -3.671  10.534  -8.580  1.00 0.00 ? 40 VAL A H    1  
ATOM 623   H HA   . VAL A 1 40 ? -5.064  9.441   -10.890 1.00 0.00 ? 40 VAL A HA   1  
ATOM 624   H HB   . VAL A 1 40 ? -3.631  7.927   -8.700  1.00 0.00 ? 40 VAL A HB   1  
ATOM 625   H HG11 . VAL A 1 40 ? -4.946  6.377   -9.810  1.00 0.00 ? 40 VAL A HG11 1  
ATOM 626   H HG12 . VAL A 1 40 ? -3.421  6.283   -10.692 1.00 0.00 ? 40 VAL A HG12 1  
ATOM 627   H HG13 . VAL A 1 40 ? -4.775  7.192   -11.365 1.00 0.00 ? 40 VAL A HG13 1  
ATOM 628   H HG21 . VAL A 1 40 ? -1.907  9.191   -9.569  1.00 0.00 ? 40 VAL A HG21 1  
ATOM 629   H HG22 . VAL A 1 40 ? -2.622  9.252   -11.180 1.00 0.00 ? 40 VAL A HG22 1  
ATOM 630   H HG23 . VAL A 1 40 ? -1.862  7.767   -10.609 1.00 0.00 ? 40 VAL A HG23 1  
ATOM 631   N N    . SER A 1 41 ? -6.896  8.023   -9.748  1.00 0.00 ? 41 SER A N    1  
ATOM 632   C CA   . SER A 1 41 ? -8.137  7.550   -9.146  1.00 0.00 ? 41 SER A CA   1  
ATOM 633   C C    . SER A 1 41 ? -7.860  6.818   -7.838  1.00 0.00 ? 41 SER A C    1  
ATOM 634   O O    . SER A 1 41 ? -7.517  5.635   -7.839  1.00 0.00 ? 41 SER A O    1  
ATOM 635   C CB   . SER A 1 41 ? -8.879  6.628   -10.114 1.00 0.00 ? 41 SER A CB   1  
ATOM 636   O OG   . SER A 1 41 ? -10.281 6.710   -9.924  1.00 0.00 ? 41 SER A OG   1  
ATOM 637   H H    . SER A 1 41 ? -6.650  7.713   -10.645 1.00 0.00 ? 41 SER A H    1  
ATOM 638   H HA   . SER A 1 41 ? -8.754  8.412   -8.938  1.00 0.00 ? 41 SER A HA   1  
ATOM 639   H HB2  . SER A 1 41 ? -8.649  6.914   -11.129 1.00 0.00 ? 41 SER A HB2  1  
ATOM 640   H HB3  . SER A 1 41 ? -8.565  5.608   -9.948  1.00 0.00 ? 41 SER A HB3  1  
ATOM 641   H HG   . SER A 1 41 ? -10.513 6.328   -9.074  1.00 0.00 ? 41 SER A HG   1  
ATOM 642   N N    . VAL A 1 42 ? -8.012  7.526   -6.723  1.00 0.00 ? 42 VAL A N    1  
ATOM 643   C CA   . VAL A 1 42 ? -7.781  6.940   -5.409  1.00 0.00 ? 42 VAL A CA   1  
ATOM 644   C C    . VAL A 1 42 ? -9.025  7.052   -4.528  1.00 0.00 ? 42 VAL A C    1  
ATOM 645   O O    . VAL A 1 42 ? -9.505  8.153   -4.258  1.00 0.00 ? 42 VAL A O    1  
ATOM 646   C CB   . VAL A 1 42 ? -6.593  7.616   -4.696  1.00 0.00 ? 42 VAL A CB   1  
ATOM 647   C CG1  . VAL A 1 42 ? -6.872  9.094   -4.468  1.00 0.00 ? 42 VAL A CG1  1  
ATOM 648   C CG2  . VAL A 1 42 ? -6.286  6.914   -3.381  1.00 0.00 ? 42 VAL A CG2  1  
ATOM 649   H H    . VAL A 1 42 ? -8.294  8.463   -6.781  1.00 0.00 ? 42 VAL A H    1  
ATOM 650   H HA   . VAL A 1 42 ? -7.541  5.896   -5.549  1.00 0.00 ? 42 VAL A HA   1  
ATOM 651   H HB   . VAL A 1 42 ? -5.724  7.533   -5.333  1.00 0.00 ? 42 VAL A HB   1  
ATOM 652   H HG11 . VAL A 1 42 ? -7.599  9.205   -3.676  1.00 0.00 ? 42 VAL A HG11 1  
ATOM 653   H HG12 . VAL A 1 42 ? -7.260  9.532   -5.376  1.00 0.00 ? 42 VAL A HG12 1  
ATOM 654   H HG13 . VAL A 1 42 ? -5.957  9.595   -4.189  1.00 0.00 ? 42 VAL A HG13 1  
ATOM 655   H HG21 . VAL A 1 42 ? -5.255  7.088   -3.112  1.00 0.00 ? 42 VAL A HG21 1  
ATOM 656   H HG22 . VAL A 1 42 ? -6.455  5.853   -3.492  1.00 0.00 ? 42 VAL A HG22 1  
ATOM 657   H HG23 . VAL A 1 42 ? -6.931  7.302   -2.607  1.00 0.00 ? 42 VAL A HG23 1  
ATOM 658   N N    . HIS A 1 43 ? -9.539  5.912   -4.075  1.00 0.00 ? 43 HIS A N    1  
ATOM 659   C CA   . HIS A 1 43 ? -10.719 5.889   -3.219  1.00 0.00 ? 43 HIS A CA   1  
ATOM 660   C C    . HIS A 1 43 ? -10.393 5.222   -1.888  1.00 0.00 ? 43 HIS A C    1  
ATOM 661   O O    . HIS A 1 43 ? -9.728  4.186   -1.852  1.00 0.00 ? 43 HIS A O    1  
ATOM 662   C CB   . HIS A 1 43 ? -11.865 5.148   -3.911  1.00 0.00 ? 43 HIS A CB   1  
ATOM 663   C CG   . HIS A 1 43 ? -13.206 5.775   -3.683  1.00 0.00 ? 43 HIS A CG   1  
ATOM 664   N ND1  . HIS A 1 43 ? -14.299 5.530   -4.487  1.00 0.00 ? 43 HIS A ND1  1  
ATOM 665   C CD2  . HIS A 1 43 ? -13.629 6.642   -2.732  1.00 0.00 ? 43 HIS A CD2  1  
ATOM 666   C CE1  . HIS A 1 43 ? -15.335 6.218   -4.044  1.00 0.00 ? 43 HIS A CE1  1  
ATOM 667   N NE2  . HIS A 1 43 ? -14.956 6.901   -2.980  1.00 0.00 ? 43 HIS A NE2  1  
ATOM 668   H H    . HIS A 1 43 ? -9.114  5.063   -4.316  1.00 0.00 ? 43 HIS A H    1  
ATOM 669   H HA   . HIS A 1 43 ? -11.017 6.910   -3.035  1.00 0.00 ? 43 HIS A HA   1  
ATOM 670   H HB2  . HIS A 1 43 ? -11.683 5.132   -4.975  1.00 0.00 ? 43 HIS A HB2  1  
ATOM 671   H HB3  . HIS A 1 43 ? -11.904 4.134   -3.542  1.00 0.00 ? 43 HIS A HB3  1  
ATOM 672   H HD2  . HIS A 1 43 ? -13.035 7.053   -1.929  1.00 0.00 ? 43 HIS A HD2  1  
ATOM 673   H HE1  . HIS A 1 43 ? -16.325 6.220   -4.477  1.00 0.00 ? 43 HIS A HE1  1  
ATOM 674   H HE2  . HIS A 1 43 ? -15.551 7.424   -2.403  1.00 0.00 ? 43 HIS A HE2  1  
ATOM 675   N N    . ARG A 1 44 ? -10.862 5.815   -0.795  1.00 0.00 ? 44 ARG A N    1  
ATOM 676   C CA   . ARG A 1 44 ? -10.614 5.271   0.535   1.00 0.00 ? 44 ARG A CA   1  
ATOM 677   C C    . ARG A 1 44 ? -11.800 5.543   1.455   1.00 0.00 ? 44 ARG A C    1  
ATOM 678   O O    . ARG A 1 44 ? -12.815 6.091   1.026   1.00 0.00 ? 44 ARG A O    1  
ATOM 679   C CB   . ARG A 1 44 ? -9.344  5.883   1.130   1.00 0.00 ? 44 ARG A CB   1  
ATOM 680   C CG   . ARG A 1 44 ? -8.062  5.236   0.631   1.00 0.00 ? 44 ARG A CG   1  
ATOM 681   C CD   . ARG A 1 44 ? -7.034  6.277   0.215   1.00 0.00 ? 44 ARG A CD   1  
ATOM 682   N NE   . ARG A 1 44 ? -6.179  6.677   1.330   1.00 0.00 ? 44 ARG A NE   1  
ATOM 683   C CZ   . ARG A 1 44 ? -5.075  7.408   1.193   1.00 0.00 ? 44 ARG A CZ   1  
ATOM 684   N NH1  . ARG A 1 44 ? -4.689  7.821   -0.008  1.00 0.00 ? 44 ARG A NH1  1  
ATOM 685   N NH2  . ARG A 1 44 ? -4.355  7.728   2.259   1.00 0.00 ? 44 ARG A NH2  1  
ATOM 686   H H    . ARG A 1 44 ? -11.391 6.635   -0.876  1.00 0.00 ? 44 ARG A H    1  
ATOM 687   H HA   . ARG A 1 44 ? -10.481 4.203   0.440   1.00 0.00 ? 44 ARG A HA   1  
ATOM 688   H HB2  . ARG A 1 44 ? -9.314  6.933   0.878   1.00 0.00 ? 44 ARG A HB2  1  
ATOM 689   H HB3  . ARG A 1 44 ? -9.378  5.782   2.205   1.00 0.00 ? 44 ARG A HB3  1  
ATOM 690   H HG2  . ARG A 1 44 ? -7.645  4.630   1.422   1.00 0.00 ? 44 ARG A HG2  1  
ATOM 691   H HG3  . ARG A 1 44 ? -8.293  4.611   -0.219  1.00 0.00 ? 44 ARG A HG3  1  
ATOM 692   H HD2  . ARG A 1 44 ? -6.417  5.862   -0.568  1.00 0.00 ? 44 ARG A HD2  1  
ATOM 693   H HD3  . ARG A 1 44 ? -7.553  7.147   -0.159  1.00 0.00 ? 44 ARG A HD3  1  
ATOM 694   H HE   . ARG A 1 44 ? -6.441  6.386   2.229   1.00 0.00 ? 44 ARG A HE   1  
ATOM 695   H HH11 . ARG A 1 44 ? -5.228  7.584   -0.817  1.00 0.00 ? 44 ARG A HH11 1  
ATOM 696   H HH12 . ARG A 1 44 ? -3.860  8.371   -0.105  1.00 0.00 ? 44 ARG A HH12 1  
ATOM 697   H HH21 . ARG A 1 44 ? -4.642  7.420   3.167   1.00 0.00 ? 44 ARG A HH21 1  
ATOM 698   H HH22 . ARG A 1 44 ? -3.526  8.278   2.156   1.00 0.00 ? 44 ARG A HH22 1  
ATOM 699   N N    . GLU A 1 45 ? -11.666 5.162   2.721   1.00 0.00 ? 45 GLU A N    1  
ATOM 700   C CA   . GLU A 1 45 ? -12.730 5.374   3.695   1.00 0.00 ? 45 GLU A CA   1  
ATOM 701   C C    . GLU A 1 45 ? -13.069 6.857   3.809   1.00 0.00 ? 45 GLU A C    1  
ATOM 702   O O    . GLU A 1 45 ? -12.179 7.703   3.901   1.00 0.00 ? 45 GLU A O    1  
ATOM 703   C CB   . GLU A 1 45 ? -12.319 4.824   5.063   1.00 0.00 ? 45 GLU A CB   1  
ATOM 704   C CG   . GLU A 1 45 ? -13.450 4.128   5.803   1.00 0.00 ? 45 GLU A CG   1  
ATOM 705   C CD   . GLU A 1 45 ? -13.013 2.825   6.444   1.00 0.00 ? 45 GLU A CD   1  
ATOM 706   O OE1  . GLU A 1 45 ? -12.372 2.875   7.515   1.00 0.00 ? 45 GLU A OE1  1  
ATOM 707   O OE2  . GLU A 1 45 ? -13.311 1.754   5.874   1.00 0.00 ? 45 GLU A OE2  1  
ATOM 708   H H    . GLU A 1 45 ? -10.833 4.732   3.008   1.00 0.00 ? 45 GLU A H    1  
ATOM 709   H HA   . GLU A 1 45 ? -13.605 4.842   3.351   1.00 0.00 ? 45 GLU A HA   1  
ATOM 710   H HB2  . GLU A 1 45 ? -11.516 4.115   4.927   1.00 0.00 ? 45 GLU A HB2  1  
ATOM 711   H HB3  . GLU A 1 45 ? -11.966 5.640   5.676   1.00 0.00 ? 45 GLU A HB3  1  
ATOM 712   H HG2  . GLU A 1 45 ? -13.815 4.786   6.577   1.00 0.00 ? 45 GLU A HG2  1  
ATOM 713   H HG3  . GLU A 1 45 ? -14.246 3.920   5.104   1.00 0.00 ? 45 GLU A HG3  1  
ATOM 714   N N    . GLU A 1 46 ? -14.362 7.167   3.795   1.00 0.00 ? 46 GLU A N    1  
ATOM 715   C CA   . GLU A 1 46 ? -14.819 8.549   3.891   1.00 0.00 ? 46 GLU A CA   1  
ATOM 716   C C    . GLU A 1 46 ? -14.191 9.259   5.087   1.00 0.00 ? 46 GLU A C    1  
ATOM 717   O O    . GLU A 1 46 ? -13.493 10.259  4.928   1.00 0.00 ? 46 GLU A O    1  
ATOM 718   C CB   . GLU A 1 46 ? -16.345 8.595   3.999   1.00 0.00 ? 46 GLU A CB   1  
ATOM 719   C CG   . GLU A 1 46 ? -17.041 8.854   2.673   1.00 0.00 ? 46 GLU A CG   1  
ATOM 720   C CD   . GLU A 1 46 ? -18.373 9.559   2.842   1.00 0.00 ? 46 GLU A CD   1  
ATOM 721   O OE1  . GLU A 1 46 ? -19.079 9.264   3.829   1.00 0.00 ? 46 GLU A OE1  1  
ATOM 722   O OE2  . GLU A 1 46 ? -18.710 10.404  1.987   1.00 0.00 ? 46 GLU A OE2  1  
ATOM 723   H H    . GLU A 1 46 ? -15.026 6.451   3.714   1.00 0.00 ? 46 GLU A H    1  
ATOM 724   H HA   . GLU A 1 46 ? -14.518 9.059   2.988   1.00 0.00 ? 46 GLU A HA   1  
ATOM 725   H HB2  . GLU A 1 46 ? -16.695 7.649   4.386   1.00 0.00 ? 46 GLU A HB2  1  
ATOM 726   H HB3  . GLU A 1 46 ? -16.624 9.380   4.686   1.00 0.00 ? 46 GLU A HB3  1  
ATOM 727   H HG2  . GLU A 1 46 ? -16.401 9.471   2.060   1.00 0.00 ? 46 GLU A HG2  1  
ATOM 728   H HG3  . GLU A 1 46 ? -17.210 7.909   2.178   1.00 0.00 ? 46 GLU A HG3  1  
ATOM 729   N N    . ILE A 1 47 ? -14.446 8.736   6.283   1.00 0.00 ? 47 ILE A N    1  
ATOM 730   C CA   . ILE A 1 47 ? -13.909 9.322   7.507   1.00 0.00 ? 47 ILE A CA   1  
ATOM 731   C C    . ILE A 1 47 ? -12.388 9.451   7.445   1.00 0.00 ? 47 ILE A C    1  
ATOM 732   O O    . ILE A 1 47 ? -11.823 10.469  7.848   1.00 0.00 ? 47 ILE A O    1  
ATOM 733   C CB   . ILE A 1 47 ? -14.298 8.487   8.745   1.00 0.00 ? 47 ILE A CB   1  
ATOM 734   C CG1  . ILE A 1 47 ? -13.851 9.191   10.029  1.00 0.00 ? 47 ILE A CG1  1  
ATOM 735   C CG2  . ILE A 1 47 ? -13.694 7.092   8.661   1.00 0.00 ? 47 ILE A CG2  1  
ATOM 736   C CD1  . ILE A 1 47 ? -14.945 10.007  10.681  1.00 0.00 ? 47 ILE A CD1  1  
ATOM 737   H H    . ILE A 1 47 ? -15.010 7.938   6.345   1.00 0.00 ? 47 ILE A H    1  
ATOM 738   H HA   . ILE A 1 47 ? -14.338 10.306  7.619   1.00 0.00 ? 47 ILE A HA   1  
ATOM 739   H HB   . ILE A 1 47 ? -15.372 8.384   8.757   1.00 0.00 ? 47 ILE A HB   1  
ATOM 740   H HG12 . ILE A 1 47 ? -13.520 8.451   10.742  1.00 0.00 ? 47 ILE A HG12 1  
ATOM 741   H HG13 . ILE A 1 47 ? -13.031 9.856   9.801   1.00 0.00 ? 47 ILE A HG13 1  
ATOM 742   H HG21 . ILE A 1 47 ? -13.716 6.751   7.636   1.00 0.00 ? 47 ILE A HG21 1  
ATOM 743   H HG22 . ILE A 1 47 ? -14.267 6.414   9.277   1.00 0.00 ? 47 ILE A HG22 1  
ATOM 744   H HG23 . ILE A 1 47 ? -12.673 7.120   9.010   1.00 0.00 ? 47 ILE A HG23 1  
ATOM 745   H HD11 . ILE A 1 47 ? -15.658 10.317  9.932   1.00 0.00 ? 47 ILE A HD11 1  
ATOM 746   H HD12 . ILE A 1 47 ? -14.513 10.880  11.149  1.00 0.00 ? 47 ILE A HD12 1  
ATOM 747   H HD13 . ILE A 1 47 ? -15.444 9.408   11.428  1.00 0.00 ? 47 ILE A HD13 1  
ATOM 748   N N    . TYR A 1 48 ? -11.730 8.410   6.940   1.00 0.00 ? 48 TYR A N    1  
ATOM 749   C CA   . TYR A 1 48 ? -10.272 8.400   6.828   1.00 0.00 ? 48 TYR A CA   1  
ATOM 750   C C    . TYR A 1 48 ? -9.749  9.705   6.233   1.00 0.00 ? 48 TYR A C    1  
ATOM 751   O O    . TYR A 1 48 ? -9.086  10.488  6.915   1.00 0.00 ? 48 TYR A O    1  
ATOM 752   C CB   . TYR A 1 48 ? -9.815  7.219   5.968   1.00 0.00 ? 48 TYR A CB   1  
ATOM 753   C CG   . TYR A 1 48 ? -9.531  5.962   6.761   1.00 0.00 ? 48 TYR A CG   1  
ATOM 754   C CD1  . TYR A 1 48 ? -10.364 5.571   7.801   1.00 0.00 ? 48 TYR A CD1  1  
ATOM 755   C CD2  . TYR A 1 48 ? -8.430  5.168   6.467   1.00 0.00 ? 48 TYR A CD2  1  
ATOM 756   C CE1  . TYR A 1 48 ? -10.107 4.423   8.527   1.00 0.00 ? 48 TYR A CE1  1  
ATOM 757   C CE2  . TYR A 1 48 ? -8.167  4.019   7.188   1.00 0.00 ? 48 TYR A CE2  1  
ATOM 758   C CZ   . TYR A 1 48 ? -9.008  3.651   8.217   1.00 0.00 ? 48 TYR A CZ   1  
ATOM 759   O OH   . TYR A 1 48 ? -8.749  2.508   8.937   1.00 0.00 ? 48 TYR A OH   1  
ATOM 760   H H    . TYR A 1 48 ? -12.236 7.628   6.638   1.00 0.00 ? 48 TYR A H    1  
ATOM 761   H HA   . TYR A 1 48 ? -9.867  8.285   7.821   1.00 0.00 ? 48 TYR A HA   1  
ATOM 762   H HB2  . TYR A 1 48 ? -10.584 6.988   5.247   1.00 0.00 ? 48 TYR A HB2  1  
ATOM 763   H HB3  . TYR A 1 48 ? -8.911  7.493   5.445   1.00 0.00 ? 48 TYR A HB3  1  
ATOM 764   H HD1  . TYR A 1 48 ? -11.224 6.177   8.042   1.00 0.00 ? 48 TYR A HD1  1  
ATOM 765   H HD2  . TYR A 1 48 ? -7.773  5.459   5.660   1.00 0.00 ? 48 TYR A HD2  1  
ATOM 766   H HE1  . TYR A 1 48 ? -10.766 4.135   9.333   1.00 0.00 ? 48 TYR A HE1  1  
ATOM 767   H HE2  . TYR A 1 48 ? -7.306  3.414   6.944   1.00 0.00 ? 48 TYR A HE2  1  
ATOM 768   H HH   . TYR A 1 48 ? -7.979  2.647   9.493   1.00 0.00 ? 48 TYR A HH   1  
ATOM 769   N N    . GLN A 1 49 ? -10.044 9.932   4.957   1.00 0.00 ? 49 GLN A N    1  
ATOM 770   C CA   . GLN A 1 49 ? -9.595  11.140  4.273   1.00 0.00 ? 49 GLN A CA   1  
ATOM 771   C C    . GLN A 1 49 ? -10.334 12.377  4.780   1.00 0.00 ? 49 GLN A C    1  
ATOM 772   O O    . GLN A 1 49 ? -9.856  13.500  4.623   1.00 0.00 ? 49 GLN A O    1  
ATOM 773   C CB   . GLN A 1 49 ? -9.798  10.997  2.763   1.00 0.00 ? 49 GLN A CB   1  
ATOM 774   C CG   . GLN A 1 49 ? -11.179 10.492  2.379   1.00 0.00 ? 49 GLN A CG   1  
ATOM 775   C CD   . GLN A 1 49 ? -11.635 11.012  1.029   1.00 0.00 ? 49 GLN A CD   1  
ATOM 776   O OE1  . GLN A 1 49 ? -11.243 10.489  -0.014  1.00 0.00 ? 49 GLN A OE1  1  
ATOM 777   N NE2  . GLN A 1 49 ? -12.467 12.046  1.044   1.00 0.00 ? 49 GLN A NE2  1  
ATOM 778   H H    . GLN A 1 49 ? -10.572 9.272   4.459   1.00 0.00 ? 49 GLN A H    1  
ATOM 779   H HA   . GLN A 1 49 ? -8.540  11.258  4.474   1.00 0.00 ? 49 GLN A HA   1  
ATOM 780   H HB2  . GLN A 1 49 ? -9.650  11.961  2.299   1.00 0.00 ? 49 GLN A HB2  1  
ATOM 781   H HB3  . GLN A 1 49 ? -9.065  10.305  2.376   1.00 0.00 ? 49 GLN A HB3  1  
ATOM 782   H HG2  . GLN A 1 49 ? -11.157 9.413   2.343   1.00 0.00 ? 49 GLN A HG2  1  
ATOM 783   H HG3  . GLN A 1 49 ? -11.887 10.812  3.130   1.00 0.00 ? 49 GLN A HG3  1  
ATOM 784   H HE21 . GLN A 1 49 ? -12.737 12.411  1.912   1.00 0.00 ? 49 GLN A HE21 1  
ATOM 785   H HE22 . GLN A 1 49 ? -12.778 12.402  0.185   1.00 0.00 ? 49 GLN A HE22 1  
ATOM 786   N N    . ARG A 1 50 ? -11.501 12.170  5.384   1.00 0.00 ? 50 ARG A N    1  
ATOM 787   C CA   . ARG A 1 50 ? -12.298 13.276  5.904   1.00 0.00 ? 50 ARG A CA   1  
ATOM 788   C C    . ARG A 1 50 ? -11.591 13.974  7.063   1.00 0.00 ? 50 ARG A C    1  
ATOM 789   O O    . ARG A 1 50 ? -11.870 15.135  7.361   1.00 0.00 ? 50 ARG A O    1  
ATOM 790   C CB   . ARG A 1 50 ? -13.671 12.774  6.359   1.00 0.00 ? 50 ARG A CB   1  
ATOM 791   C CG   . ARG A 1 50 ? -14.775 13.009  5.340   1.00 0.00 ? 50 ARG A CG   1  
ATOM 792   C CD   . ARG A 1 50 ? -16.002 12.162  5.642   1.00 0.00 ? 50 ARG A CD   1  
ATOM 793   N NE   . ARG A 1 50 ? -16.456 12.326  7.023   1.00 0.00 ? 50 ARG A NE   1  
ATOM 794   C CZ   . ARG A 1 50 ? -17.530 13.029  7.381   1.00 0.00 ? 50 ARG A CZ   1  
ATOM 795   N NH1  . ARG A 1 50 ? -18.270 13.649  6.469   1.00 0.00 ? 50 ARG A NH1  1  
ATOM 796   N NH2  . ARG A 1 50 ? -17.864 13.115  8.662   1.00 0.00 ? 50 ARG A NH2  1  
ATOM 797   H H    . ARG A 1 50 ? -11.836 11.256  5.479   1.00 0.00 ? 50 ARG A H    1  
ATOM 798   H HA   . ARG A 1 50 ? -12.435 13.985  5.103   1.00 0.00 ? 50 ARG A HA   1  
ATOM 799   H HB2  . ARG A 1 50 ? -13.607 11.715  6.550   1.00 0.00 ? 50 ARG A HB2  1  
ATOM 800   H HB3  . ARG A 1 50 ? -13.942 13.279  7.275   1.00 0.00 ? 50 ARG A HB3  1  
ATOM 801   H HG2  . ARG A 1 50 ? -15.056 14.051  5.361   1.00 0.00 ? 50 ARG A HG2  1  
ATOM 802   H HG3  . ARG A 1 50 ? -14.405 12.753  4.358   1.00 0.00 ? 50 ARG A HG3  1  
ATOM 803   H HD2  . ARG A 1 50 ? -16.796 12.451  4.972   1.00 0.00 ? 50 ARG A HD2  1  
ATOM 804   H HD3  . ARG A 1 50 ? -15.755 11.125  5.476   1.00 0.00 ? 50 ARG A HD3  1  
ATOM 805   H HE   . ARG A 1 50 ? -15.932 11.884  7.723   1.00 0.00 ? 50 ARG A HE   1  
ATOM 806   H HH11 . ARG A 1 50 ? -18.027 13.594  5.502   1.00 0.00 ? 50 ARG A HH11 1  
ATOM 807   H HH12 . ARG A 1 50 ? -19.073 14.174  6.751   1.00 0.00 ? 50 ARG A HH12 1  
ATOM 808   H HH21 . ARG A 1 50 ? -17.311 12.653  9.355   1.00 0.00 ? 50 ARG A HH21 1  
ATOM 809   H HH22 . ARG A 1 50 ? -18.669 13.643  8.934   1.00 0.00 ? 50 ARG A HH22 1  
ATOM 810   N N    . ILE A 1 51 ? -10.681 13.261  7.721   1.00 0.00 ? 51 ILE A N    1  
ATOM 811   C CA   . ILE A 1 51 ? -9.948  13.824  8.850   1.00 0.00 ? 51 ILE A CA   1  
ATOM 812   C C    . ILE A 1 51 ? -8.479  14.065  8.510   1.00 0.00 ? 51 ILE A C    1  
ATOM 813   O O    . ILE A 1 51 ? -7.810  14.867  9.160   1.00 0.00 ? 51 ILE A O    1  
ATOM 814   C CB   . ILE A 1 51 ? -10.033 12.908  10.086  1.00 0.00 ? 51 ILE A CB   1  
ATOM 815   C CG1  . ILE A 1 51 ? -9.428  11.536  9.780   1.00 0.00 ? 51 ILE A CG1  1  
ATOM 816   C CG2  . ILE A 1 51 ? -11.477 12.766  10.542  1.00 0.00 ? 51 ILE A CG2  1  
ATOM 817   C CD1  . ILE A 1 51 ? -9.014  10.769  11.018  1.00 0.00 ? 51 ILE A CD1  1  
ATOM 818   H H    . ILE A 1 51 ? -10.503 12.338  7.446   1.00 0.00 ? 51 ILE A H    1  
ATOM 819   H HA   . ILE A 1 51 ? -10.406 14.770  9.102   1.00 0.00 ? 51 ILE A HA   1  
ATOM 820   H HB   . ILE A 1 51 ? -9.473  13.369  10.886  1.00 0.00 ? 51 ILE A HB   1  
ATOM 821   H HG12 . ILE A 1 51 ? -10.156 10.940  9.249   1.00 0.00 ? 51 ILE A HG12 1  
ATOM 822   H HG13 . ILE A 1 51 ? -8.554  11.665  9.159   1.00 0.00 ? 51 ILE A HG13 1  
ATOM 823   H HG21 . ILE A 1 51 ? -11.502 12.580  11.605  1.00 0.00 ? 51 ILE A HG21 1  
ATOM 824   H HG22 . ILE A 1 51 ? -11.939 11.941  10.021  1.00 0.00 ? 51 ILE A HG22 1  
ATOM 825   H HG23 . ILE A 1 51 ? -12.014 13.677  10.323  1.00 0.00 ? 51 ILE A HG23 1  
ATOM 826   H HD11 . ILE A 1 51 ? -8.056  11.131  11.362  1.00 0.00 ? 51 ILE A HD11 1  
ATOM 827   H HD12 . ILE A 1 51 ? -8.938  9.718   10.783  1.00 0.00 ? 51 ILE A HD12 1  
ATOM 828   H HD13 . ILE A 1 51 ? -9.751  10.912  11.794  1.00 0.00 ? 51 ILE A HD13 1  
ATOM 829   N N    . GLN A 1 52 ? -7.978  13.366  7.495   1.00 0.00 ? 52 GLN A N    1  
ATOM 830   C CA   . GLN A 1 52 ? -6.584  13.512  7.089   1.00 0.00 ? 52 GLN A CA   1  
ATOM 831   C C    . GLN A 1 52 ? -6.463  14.278  5.773   1.00 0.00 ? 52 GLN A C    1  
ATOM 832   O O    . GLN A 1 52 ? -5.798  15.312  5.705   1.00 0.00 ? 52 GLN A O    1  
ATOM 833   C CB   . GLN A 1 52 ? -5.928  12.136  6.954   1.00 0.00 ? 52 GLN A CB   1  
ATOM 834   C CG   . GLN A 1 52 ? -4.556  12.051  7.602   1.00 0.00 ? 52 GLN A CG   1  
ATOM 835   C CD   . GLN A 1 52 ? -4.577  12.453  9.063   1.00 0.00 ? 52 GLN A CD   1  
ATOM 836   O OE1  . GLN A 1 52 ? -4.875  11.641  9.938   1.00 0.00 ? 52 GLN A OE1  1  
ATOM 837   N NE2  . GLN A 1 52 ? -4.259  13.714  9.335   1.00 0.00 ? 52 GLN A NE2  1  
ATOM 838   H H    . GLN A 1 52 ? -8.554  12.736  7.013   1.00 0.00 ? 52 GLN A H    1  
ATOM 839   H HA   . GLN A 1 52 ? -6.072  14.068  7.860   1.00 0.00 ? 52 GLN A HA   1  
ATOM 840   H HB2  . GLN A 1 52 ? -6.567  11.399  7.417   1.00 0.00 ? 52 GLN A HB2  1  
ATOM 841   H HB3  . GLN A 1 52 ? -5.822  11.900  5.905   1.00 0.00 ? 52 GLN A HB3  1  
ATOM 842   H HG2  . GLN A 1 52 ? -4.200  11.034  7.529   1.00 0.00 ? 52 GLN A HG2  1  
ATOM 843   H HG3  . GLN A 1 52 ? -3.880  12.707  7.072   1.00 0.00 ? 52 GLN A HG3  1  
ATOM 844   H HE21 . GLN A 1 52 ? -4.032  14.305  8.588   1.00 0.00 ? 52 GLN A HE21 1  
ATOM 845   H HE22 . GLN A 1 52 ? -4.264  14.001  10.272  1.00 0.00 ? 52 GLN A HE22 1  
ATOM 846   N N    . ALA A 1 53 ? -7.102  13.760  4.730   1.00 0.00 ? 53 ALA A N    1  
ATOM 847   C CA   . ALA A 1 53 ? -7.059  14.388  3.416   1.00 0.00 ? 53 ALA A CA   1  
ATOM 848   C C    . ALA A 1 53 ? -7.767  15.739  3.420   1.00 0.00 ? 53 ALA A C    1  
ATOM 849   O O    . ALA A 1 53 ? -7.123  16.787  3.371   1.00 0.00 ? 53 ALA A O    1  
ATOM 850   C CB   . ALA A 1 53 ? -7.673  13.468  2.371   1.00 0.00 ? 53 ALA A CB   1  
ATOM 851   H H    . ALA A 1 53 ? -7.610  12.932  4.847   1.00 0.00 ? 53 ALA A H    1  
ATOM 852   H HA   . ALA A 1 53 ? -6.022  14.540  3.158   1.00 0.00 ? 53 ALA A HA   1  
ATOM 853   H HB1  . ALA A 1 53 ? -7.793  12.479  2.789   1.00 0.00 ? 53 ALA A HB1  1  
ATOM 854   H HB2  . ALA A 1 53 ? -7.024  13.418  1.510   1.00 0.00 ? 53 ALA A HB2  1  
ATOM 855   H HB3  . ALA A 1 53 ? -8.637  13.851  2.073   1.00 0.00 ? 53 ALA A HB3  1  
ATOM 856   N N    . GLU A 1 54 ? -9.095  15.709  3.472   1.00 0.00 ? 54 GLU A N    1  
ATOM 857   C CA   . GLU A 1 54 ? -9.885  16.934  3.475   1.00 0.00 ? 54 GLU A CA   1  
ATOM 858   C C    . GLU A 1 54 ? -10.672 17.077  4.773   1.00 0.00 ? 54 GLU A C    1  
ATOM 859   O O    . GLU A 1 54 ? -11.399 16.169  5.175   1.00 0.00 ? 54 GLU A O    1  
ATOM 860   C CB   . GLU A 1 54 ? -10.840 16.954  2.280   1.00 0.00 ? 54 GLU A CB   1  
ATOM 861   C CG   . GLU A 1 54 ? -10.240 17.586  1.034   1.00 0.00 ? 54 GLU A CG   1  
ATOM 862   C CD   . GLU A 1 54 ? -10.116 16.607  -0.117  1.00 0.00 ? 54 GLU A CD   1  
ATOM 863   O OE1  . GLU A 1 54 ? -11.135 15.981  -0.477  1.00 0.00 ? 54 GLU A OE1  1  
ATOM 864   O OE2  . GLU A 1 54 ? -8.999  16.465  -0.659  1.00 0.00 ? 54 GLU A OE2  1  
ATOM 865   H H    . GLU A 1 54 ? -9.554  14.843  3.506   1.00 0.00 ? 54 GLU A H    1  
ATOM 866   H HA   . GLU A 1 54 ? -9.204  17.767  3.391   1.00 0.00 ? 54 GLU A HA   1  
ATOM 867   H HB2  . GLU A 1 54 ? -11.123 15.939  2.043   1.00 0.00 ? 54 GLU A HB2  1  
ATOM 868   H HB3  . GLU A 1 54 ? -11.725 17.512  2.550   1.00 0.00 ? 54 GLU A HB3  1  
ATOM 869   H HG2  . GLU A 1 54 ? -10.870 18.405  0.722   1.00 0.00 ? 54 GLU A HG2  1  
ATOM 870   H HG3  . GLU A 1 54 ? -9.256  17.962  1.276   1.00 0.00 ? 54 GLU A HG3  1  
ATOM 871   N N    . LYS A 1 55 ? -10.518 18.227  5.423   1.00 0.00 ? 55 LYS A N    1  
ATOM 872   C CA   . LYS A 1 55 ? -11.203 18.503  6.669   1.00 0.00 ? 55 LYS A CA   1  
ATOM 873   C C    . LYS A 1 55 ? -12.716 18.496  6.475   1.00 0.00 ? 55 LYS A C    1  
ATOM 874   O O    . LYS A 1 55 ? -13.308 19.512  6.111   1.00 0.00 ? 55 LYS A O    1  
ATOM 875   C CB   . LYS A 1 55 ? -10.754 19.851  7.235   1.00 0.00 ? 55 LYS A CB   1  
ATOM 876   C CG   . LYS A 1 55 ? -10.853 20.994  6.237   1.00 0.00 ? 55 LYS A CG   1  
ATOM 877   C CD   . LYS A 1 55 ? -9.500  21.319  5.625   1.00 0.00 ? 55 LYS A CD   1  
ATOM 878   C CE   . LYS A 1 55 ? -9.297  22.820  5.486   1.00 0.00 ? 55 LYS A CE   1  
ATOM 879   N NZ   . LYS A 1 55 ? -8.629  23.173  4.203   1.00 0.00 ? 55 LYS A NZ   1  
ATOM 880   H H    . LYS A 1 55 ? -9.930  18.903  5.056   1.00 0.00 ? 55 LYS A H    1  
ATOM 881   H HA   . LYS A 1 55 ? -10.932 17.729  7.357   1.00 0.00 ? 55 LYS A HA   1  
ATOM 882   H HB2  . LYS A 1 55 ? -11.371 20.093  8.088   1.00 0.00 ? 55 LYS A HB2  1  
ATOM 883   H HB3  . LYS A 1 55 ? -9.727  19.770  7.557   1.00 0.00 ? 55 LYS A HB3  1  
ATOM 884   H HG2  . LYS A 1 55 ? -11.535 20.713  5.449   1.00 0.00 ? 55 LYS A HG2  1  
ATOM 885   H HG3  . LYS A 1 55 ? -11.229 21.870  6.745   1.00 0.00 ? 55 LYS A HG3  1  
ATOM 886   H HD2  . LYS A 1 55 ? -8.723  20.919  6.259   1.00 0.00 ? 55 LYS A HD2  1  
ATOM 887   H HD3  . LYS A 1 55 ? -9.440  20.865  4.647   1.00 0.00 ? 55 LYS A HD3  1  
ATOM 888   H HE2  . LYS A 1 55 ? -10.260 23.306  5.526   1.00 0.00 ? 55 LYS A HE2  1  
ATOM 889   H HE3  . LYS A 1 55 ? -8.686  23.165  6.307   1.00 0.00 ? 55 LYS A HE3  1  
ATOM 890   H HZ1  . LYS A 1 55 ? -9.341  23.417  3.485   1.00 0.00 ? 55 LYS A HZ1  1  
ATOM 891   H HZ2  . LYS A 1 55 ? -8.067  22.369  3.859   1.00 0.00 ? 55 LYS A HZ2  1  
ATOM 892   H HZ3  . LYS A 1 55 ? -7.998  23.989  4.341   1.00 0.00 ? 55 LYS A HZ3  1  
ATOM 893   N N    . SER A 1 56 ? -13.335 17.345  6.714   1.00 0.00 ? 56 SER A N    1  
ATOM 894   C CA   . SER A 1 56 ? -14.781 17.205  6.561   1.00 0.00 ? 56 SER A CA   1  
ATOM 895   C C    . SER A 1 56 ? -15.527 18.341  7.256   1.00 0.00 ? 56 SER A C    1  
ATOM 896   O O    . SER A 1 56 ? -16.384 18.990  6.656   1.00 0.00 ? 56 SER A O    1  
ATOM 897   C CB   . SER A 1 56 ? -15.242 15.861  7.122   1.00 0.00 ? 56 SER A CB   1  
ATOM 898   O OG   . SER A 1 56 ? -16.447 15.439  6.508   1.00 0.00 ? 56 SER A OG   1  
ATOM 899   H H    . SER A 1 56 ? -12.807 16.569  6.996   1.00 0.00 ? 56 SER A H    1  
ATOM 900   H HA   . SER A 1 56 ? -15.005 17.237  5.505   1.00 0.00 ? 56 SER A HA   1  
ATOM 901   H HB2  . SER A 1 56 ? -14.482 15.117  6.941   1.00 0.00 ? 56 SER A HB2  1  
ATOM 902   H HB3  . SER A 1 56 ? -15.408 15.954  8.186   1.00 0.00 ? 56 SER A HB3  1  
ATOM 903   H HG   . SER A 1 56 ? -16.373 15.540  5.556   1.00 0.00 ? 56 SER A HG   1  
ATOM 904   N N    . GLN A 1 57 ? -15.197 18.575  8.521   1.00 0.00 ? 57 GLN A N    1  
ATOM 905   C CA   . GLN A 1 57 ? -15.838 19.633  9.292   1.00 0.00 ? 57 GLN A CA   1  
ATOM 906   C C    . GLN A 1 57 ? -14.850 20.284  10.256  1.00 0.00 ? 57 GLN A C    1  
ATOM 907   O O    . GLN A 1 57 ? -14.434 21.424  10.054  1.00 0.00 ? 57 GLN A O    1  
ATOM 908   C CB   . GLN A 1 57 ? -17.037 19.076  10.064  1.00 0.00 ? 57 GLN A CB   1  
ATOM 909   C CG   . GLN A 1 57 ? -17.869 20.146  10.752  1.00 0.00 ? 57 GLN A CG   1  
ATOM 910   C CD   . GLN A 1 57 ? -18.777 19.578  11.825  1.00 0.00 ? 57 GLN A CD   1  
ATOM 911   O OE1  . GLN A 1 57 ? -18.598 19.848  13.012  1.00 0.00 ? 57 GLN A OE1  1  
ATOM 912   N NE2  . GLN A 1 57 ? -19.758 18.785  11.411  1.00 0.00 ? 57 GLN A NE2  1  
ATOM 913   H H    . GLN A 1 57 ? -14.506 18.025  8.945   1.00 0.00 ? 57 GLN A H    1  
ATOM 914   H HA   . GLN A 1 57 ? -16.188 20.382  8.597   1.00 0.00 ? 57 GLN A HA   1  
ATOM 915   H HB2  . GLN A 1 57 ? -17.675 18.542  9.376   1.00 0.00 ? 57 GLN A HB2  1  
ATOM 916   H HB3  . GLN A 1 57 ? -16.679 18.389  10.816  1.00 0.00 ? 57 GLN A HB3  1  
ATOM 917   H HG2  . GLN A 1 57 ? -17.204 20.864  11.208  1.00 0.00 ? 57 GLN A HG2  1  
ATOM 918   H HG3  . GLN A 1 57 ? -18.479 20.642  10.010  1.00 0.00 ? 57 GLN A HG3  1  
ATOM 919   H HE21 . GLN A 1 57 ? -19.840 18.613  10.450  1.00 0.00 ? 57 GLN A HE21 1  
ATOM 920   H HE22 . GLN A 1 57 ? -20.360 18.403  12.084  1.00 0.00 ? 57 GLN A HE22 1  
ATOM 921   N N    . GLN A 1 58 ? -14.477 19.552  11.302  1.00 0.00 ? 58 GLN A N    1  
ATOM 922   C CA   . GLN A 1 58 ? -13.537 20.061  12.294  1.00 0.00 ? 58 GLN A CA   1  
ATOM 923   C C    . GLN A 1 58 ? -13.267 19.018  13.374  1.00 0.00 ? 58 GLN A C    1  
ATOM 924   O O    . GLN A 1 58 ? -13.977 18.018  13.478  1.00 0.00 ? 58 GLN A O    1  
ATOM 925   C CB   . GLN A 1 58 ? -14.076 21.342  12.934  1.00 0.00 ? 58 GLN A CB   1  
ATOM 926   C CG   . GLN A 1 58 ? -15.409 21.155  13.640  1.00 0.00 ? 58 GLN A CG   1  
ATOM 927   C CD   . GLN A 1 58 ? -15.855 22.400  14.382  1.00 0.00 ? 58 GLN A CD   1  
ATOM 928   O OE1  . GLN A 1 58 ? -15.766 23.512  13.862  1.00 0.00 ? 58 GLN A OE1  1  
ATOM 929   N NE2  . GLN A 1 58 ? -16.338 22.217  15.606  1.00 0.00 ? 58 GLN A NE2  1  
ATOM 930   H H    . GLN A 1 58 ? -14.842 18.649  11.408  1.00 0.00 ? 58 GLN A H    1  
ATOM 931   H HA   . GLN A 1 58 ? -12.610 20.285  11.788  1.00 0.00 ? 58 GLN A HA   1  
ATOM 932   H HB2  . GLN A 1 58 ? -13.358 21.700  13.656  1.00 0.00 ? 58 GLN A HB2  1  
ATOM 933   H HB3  . GLN A 1 58 ? -14.202 22.090  12.165  1.00 0.00 ? 58 GLN A HB3  1  
ATOM 934   H HG2  . GLN A 1 58 ? -16.160 20.905  12.905  1.00 0.00 ? 58 GLN A HG2  1  
ATOM 935   H HG3  . GLN A 1 58 ? -15.316 20.345  14.348  1.00 0.00 ? 58 GLN A HG3  1  
ATOM 936   H HE21 . GLN A 1 58 ? -16.379 21.303  15.956  1.00 0.00 ? 58 GLN A HE21 1  
ATOM 937   H HE22 . GLN A 1 58 ? -16.634 23.005  16.109  1.00 0.00 ? 58 GLN A HE22 1  
ATOM 938   N N    . SER A 1 59 ? -12.236 19.261  14.178  1.00 0.00 ? 59 SER A N    1  
ATOM 939   C CA   . SER A 1 59 ? -11.870 18.346  15.253  1.00 0.00 ? 59 SER A CA   1  
ATOM 940   C C    . SER A 1 59 ? -11.319 19.112  16.451  1.00 0.00 ? 59 SER A C    1  
ATOM 941   O O    . SER A 1 59 ? -10.745 20.191  16.299  1.00 0.00 ? 59 SER A O    1  
ATOM 942   C CB   . SER A 1 59 ? -10.835 17.333  14.760  1.00 0.00 ? 59 SER A CB   1  
ATOM 943   O OG   . SER A 1 59 ? -9.594  17.961  14.490  1.00 0.00 ? 59 SER A OG   1  
ATOM 944   H H    . SER A 1 59 ? -11.709 20.077  14.045  1.00 0.00 ? 59 SER A H    1  
ATOM 945   H HA   . SER A 1 59 ? -12.762 17.818  15.557  1.00 0.00 ? 59 SER A HA   1  
ATOM 946   H HB2  . SER A 1 59 ? -10.685 16.578  15.517  1.00 0.00 ? 59 SER A HB2  1  
ATOM 947   H HB3  . SER A 1 59 ? -11.194 16.867  13.854  1.00 0.00 ? 59 SER A HB3  1  
ATOM 948   H HG   . SER A 1 59 ? -9.692  18.557  13.744  1.00 0.00 ? 59 SER A HG   1  
ATOM 949   N N    . SER A 1 60 ? -11.496 18.550  17.642  1.00 0.00 ? 60 SER A N    1  
ATOM 950   C CA   . SER A 1 60 ? -11.015 19.183  18.864  1.00 0.00 ? 60 SER A CA   1  
ATOM 951   C C    . SER A 1 60 ? -9.675  18.594  19.292  1.00 0.00 ? 60 SER A C    1  
ATOM 952   O O    . SER A 1 60 ? -9.563  17.392  19.533  1.00 0.00 ? 60 SER A O    1  
ATOM 953   C CB   . SER A 1 60 ? -12.040 19.015  19.988  1.00 0.00 ? 60 SER A CB   1  
ATOM 954   O OG   . SER A 1 60 ? -11.775 19.906  21.058  1.00 0.00 ? 60 SER A OG   1  
ATOM 955   H H    . SER A 1 60 ? -11.960 17.689  17.701  1.00 0.00 ? 60 SER A H    1  
ATOM 956   H HA   . SER A 1 60 ? -10.884 20.236  18.663  1.00 0.00 ? 60 SER A HA   1  
ATOM 957   H HB2  . SER A 1 60 ? -13.029 19.219  19.604  1.00 0.00 ? 60 SER A HB2  1  
ATOM 958   H HB3  . SER A 1 60 ? -12.001 18.002  20.360  1.00 0.00 ? 60 SER A HB3  1  
ATOM 959   H HG   . SER A 1 60 ? -11.691 20.799  20.718  1.00 0.00 ? 60 SER A HG   1  
ATOM 960   N N    . TYR A 1 61 ? -8.661  19.449  19.384  1.00 0.00 ? 61 TYR A N    1  
ATOM 961   C CA   . TYR A 1 61 ? -7.328  19.013  19.782  1.00 0.00 ? 61 TYR A CA   1  
ATOM 962   C C    . TYR A 1 61 ? -6.516  20.180  20.335  1.00 0.00 ? 61 TYR A C    1  
ATOM 963   O O    . TYR A 1 61 ? -6.647  21.299  19.795  1.00 0.00 ? 61 TYR A O    1  
ATOM 964   C CB   . TYR A 1 61 ? -6.599  18.383  18.593  1.00 0.00 ? 61 TYR A CB   1  
ATOM 965   C CG   . TYR A 1 61 ? -5.992  17.032  18.901  1.00 0.00 ? 61 TYR A CG   1  
ATOM 966   C CD1  . TYR A 1 61 ? -6.779  15.888  18.937  1.00 0.00 ? 61 TYR A CD1  1  
ATOM 967   C CD2  . TYR A 1 61 ? -4.633  16.902  19.155  1.00 0.00 ? 61 TYR A CD2  1  
ATOM 968   C CE1  . TYR A 1 61 ? -6.228  14.652  19.219  1.00 0.00 ? 61 TYR A CE1  1  
ATOM 969   C CE2  . TYR A 1 61 ? -4.074  15.670  19.436  1.00 0.00 ? 61 TYR A CE2  1  
ATOM 970   C CZ   . TYR A 1 61 ? -4.876  14.549  19.467  1.00 0.00 ? 61 TYR A CZ   1  
ATOM 971   O OH   . TYR A 1 61 ? -4.324  13.320  19.747  1.00 0.00 ? 61 TYR A OH   1  
ATOM 972   O OXT  . TYR A 1 61 ? -5.758  19.966  21.304  1.00 0.00 ? 61 TYR A OXT  1  
ATOM 973   H H    . TYR A 1 61 ? -8.813  20.395  19.177  1.00 0.00 ? 61 TYR A H    1  
ATOM 974   H HA   . TYR A 1 61 ? -7.442  18.270  20.558  1.00 0.00 ? 61 TYR A HA   1  
ATOM 975   H HB2  . TYR A 1 61 ? -7.297  18.253  17.779  1.00 0.00 ? 61 TYR A HB2  1  
ATOM 976   H HB3  . TYR A 1 61 ? -5.803  19.041  18.276  1.00 0.00 ? 61 TYR A HB3  1  
ATOM 977   H HD1  . TYR A 1 61 ? -7.838  15.972  18.742  1.00 0.00 ? 61 TYR A HD1  1  
ATOM 978   H HD2  . TYR A 1 61 ? -4.007  17.783  19.130  1.00 0.00 ? 61 TYR A HD2  1  
ATOM 979   H HE1  . TYR A 1 61 ? -6.856  13.774  19.242  1.00 0.00 ? 61 TYR A HE1  1  
ATOM 980   H HE2  . TYR A 1 61 ? -3.015  15.589  19.631  1.00 0.00 ? 61 TYR A HE2  1  
ATOM 981   H HH   . TYR A 1 61 ? -4.922  12.820  20.307  1.00 0.00 ? 61 TYR A HH   1  
ATOM 982   N N    . MET B 1 1  ? 0.133   12.945  2.686   1.00 0.00 ? 1  MET B N    1  
ATOM 983   C CA   . MET B 1 1  ? 0.477   12.156  3.899   1.00 0.00 ? 1  MET B CA   1  
ATOM 984   C C    . MET B 1 1  ? -0.752  11.927  4.773   1.00 0.00 ? 1  MET B C    1  
ATOM 985   O O    . MET B 1 1  ? -1.217  12.838  5.457   1.00 0.00 ? 1  MET B O    1  
ATOM 986   C CB   . MET B 1 1  ? 1.549   12.912  4.688   1.00 0.00 ? 1  MET B CB   1  
ATOM 987   C CG   . MET B 1 1  ? 2.685   13.437  3.824   1.00 0.00 ? 1  MET B CG   1  
ATOM 988   S SD   . MET B 1 1  ? 2.569   15.211  3.523   1.00 0.00 ? 1  MET B SD   1  
ATOM 989   C CE   . MET B 1 1  ? 3.000   15.857  5.137   1.00 0.00 ? 1  MET B CE   1  
ATOM 990   H H1   . MET B 1 1  ? 0.887   12.795  1.987   1.00 0.00 ? 1  MET B H1   1  
ATOM 991   H H2   . MET B 1 1  ? 0.072   13.945  2.966   1.00 0.00 ? 1  MET B H2   1  
ATOM 992   H H3   . MET B 1 1  ? -0.780  12.598  2.331   1.00 0.00 ? 1  MET B H3   1  
ATOM 993   H HA   . MET B 1 1  ? 0.871   11.201  3.588   1.00 0.00 ? 1  MET B HA   1  
ATOM 994   H HB2  . MET B 1 1  ? 1.087   13.751  5.187   1.00 0.00 ? 1  MET B HB2  1  
ATOM 995   H HB3  . MET B 1 1  ? 1.967   12.248  5.430   1.00 0.00 ? 1  MET B HB3  1  
ATOM 996   H HG2  . MET B 1 1  ? 3.621   13.232  4.323   1.00 0.00 ? 1  MET B HG2  1  
ATOM 997   H HG3  . MET B 1 1  ? 2.665   12.922  2.875   1.00 0.00 ? 1  MET B HG3  1  
ATOM 998   H HE1  . MET B 1 1  ? 2.554   15.240  5.903   1.00 0.00 ? 1  MET B HE1  1  
ATOM 999   H HE2  . MET B 1 1  ? 2.631   16.868  5.230   1.00 0.00 ? 1  MET B HE2  1  
ATOM 1000  H HE3  . MET B 1 1  ? 4.074   15.854  5.251   1.00 0.00 ? 1  MET B HE3  1  
ATOM 1001  N N    . LEU B 1 2  ? -1.272  10.704  4.747   1.00 0.00 ? 2  LEU B N    1  
ATOM 1002  C CA   . LEU B 1 2  ? -2.446  10.357  5.541   1.00 0.00 ? 2  LEU B CA   1  
ATOM 1003  C C    . LEU B 1 2  ? -2.127  9.232   6.520   1.00 0.00 ? 2  LEU B C    1  
ATOM 1004  O O    . LEU B 1 2  ? -1.871  8.099   6.112   1.00 0.00 ? 2  LEU B O    1  
ATOM 1005  C CB   . LEU B 1 2  ? -3.598  9.939   4.625   1.00 0.00 ? 2  LEU B CB   1  
ATOM 1006  C CG   . LEU B 1 2  ? -4.337  11.094  3.946   1.00 0.00 ? 2  LEU B CG   1  
ATOM 1007  C CD1  . LEU B 1 2  ? -3.655  11.469  2.640   1.00 0.00 ? 2  LEU B CD1  1  
ATOM 1008  C CD2  . LEU B 1 2  ? -5.793  10.724  3.703   1.00 0.00 ? 2  LEU B CD2  1  
ATOM 1009  H H    . LEU B 1 2  ? -0.856  10.017  4.183   1.00 0.00 ? 2  LEU B H    1  
ATOM 1010  H HA   . LEU B 1 2  ? -2.742  11.233  6.099   1.00 0.00 ? 2  LEU B HA   1  
ATOM 1011  H HB2  . LEU B 1 2  ? -3.203  9.290   3.858   1.00 0.00 ? 2  LEU B HB2  1  
ATOM 1012  H HB3  . LEU B 1 2  ? -4.312  9.381   5.212   1.00 0.00 ? 2  LEU B HB3  1  
ATOM 1013  H HG   . LEU B 1 2  ? -4.314  11.958  4.594   1.00 0.00 ? 2  LEU B HG   1  
ATOM 1014  H HD11 . LEU B 1 2  ? -4.397  11.795  1.927   1.00 0.00 ? 2  LEU B HD11 1  
ATOM 1015  H HD12 . LEU B 1 2  ? -3.132  10.609  2.247   1.00 0.00 ? 2  LEU B HD12 1  
ATOM 1016  H HD13 . LEU B 1 2  ? -2.950  12.268  2.818   1.00 0.00 ? 2  LEU B HD13 1  
ATOM 1017  H HD21 . LEU B 1 2  ? -6.420  11.580  3.905   1.00 0.00 ? 2  LEU B HD21 1  
ATOM 1018  H HD22 . LEU B 1 2  ? -6.072  9.911   4.356   1.00 0.00 ? 2  LEU B HD22 1  
ATOM 1019  H HD23 . LEU B 1 2  ? -5.920  10.419  2.675   1.00 0.00 ? 2  LEU B HD23 1  
ATOM 1020  N N    . ILE B 1 3  ? -2.154  9.544   7.813   1.00 0.00 ? 3  ILE B N    1  
ATOM 1021  C CA   . ILE B 1 3  ? -1.878  8.546   8.839   1.00 0.00 ? 3  ILE B CA   1  
ATOM 1022  C C    . ILE B 1 3  ? -3.164  8.113   9.530   1.00 0.00 ? 3  ILE B C    1  
ATOM 1023  O O    . ILE B 1 3  ? -3.751  8.864   10.309  1.00 0.00 ? 3  ILE B O    1  
ATOM 1024  C CB   . ILE B 1 3  ? -0.865  9.055   9.887   1.00 0.00 ? 3  ILE B CB   1  
ATOM 1025  C CG1  . ILE B 1 3  ? -0.483  7.926   10.847  1.00 0.00 ? 3  ILE B CG1  1  
ATOM 1026  C CG2  . ILE B 1 3  ? -1.425  10.242  10.655  1.00 0.00 ? 3  ILE B CG2  1  
ATOM 1027  C CD1  . ILE B 1 3  ? 0.959   7.983   11.304  1.00 0.00 ? 3  ILE B CD1  1  
ATOM 1028  H H    . ILE B 1 3  ? -2.375  10.460  8.082   1.00 0.00 ? 3  ILE B H    1  
ATOM 1029  H HA   . ILE B 1 3  ? -1.450  7.686   8.350   1.00 0.00 ? 3  ILE B HA   1  
ATOM 1030  H HB   . ILE B 1 3  ? 0.021   9.384   9.365   1.00 0.00 ? 3  ILE B HB   1  
ATOM 1031  H HG12 . ILE B 1 3  ? -1.111  7.979   11.723  1.00 0.00 ? 3  ILE B HG12 1  
ATOM 1032  H HG13 . ILE B 1 3  ? -0.639  6.976   10.355  1.00 0.00 ? 3  ILE B HG13 1  
ATOM 1033  H HG21 . ILE B 1 3  ? -2.119  9.891   11.404  1.00 0.00 ? 3  ILE B HG21 1  
ATOM 1034  H HG22 . ILE B 1 3  ? -1.935  10.905  9.973   1.00 0.00 ? 3  ILE B HG22 1  
ATOM 1035  H HG23 . ILE B 1 3  ? -0.615  10.771  11.136  1.00 0.00 ? 3  ILE B HG23 1  
ATOM 1036  H HD11 . ILE B 1 3  ? 1.137   8.919   11.814  1.00 0.00 ? 3  ILE B HD11 1  
ATOM 1037  H HD12 . ILE B 1 3  ? 1.613   7.911   10.447  1.00 0.00 ? 3  ILE B HD12 1  
ATOM 1038  H HD13 . ILE B 1 3  ? 1.159   7.162   11.978  1.00 0.00 ? 3  ILE B HD13 1  
ATOM 1039  N N    . LEU B 1 4  ? -3.594  6.892   9.235   1.00 0.00 ? 4  LEU B N    1  
ATOM 1040  C CA   . LEU B 1 4  ? -4.809  6.347   9.823   1.00 0.00 ? 4  LEU B CA   1  
ATOM 1041  C C    . LEU B 1 4  ? -4.531  5.025   10.531  1.00 0.00 ? 4  LEU B C    1  
ATOM 1042  O O    . LEU B 1 4  ? -3.973  4.097   9.941   1.00 0.00 ? 4  LEU B O    1  
ATOM 1043  C CB   . LEU B 1 4  ? -5.877  6.150   8.743   1.00 0.00 ? 4  LEU B CB   1  
ATOM 1044  C CG   . LEU B 1 4  ? -7.008  7.180   8.755   1.00 0.00 ? 4  LEU B CG   1  
ATOM 1045  C CD1  . LEU B 1 4  ? -7.923  6.953   9.949   1.00 0.00 ? 4  LEU B CD1  1  
ATOM 1046  C CD2  . LEU B 1 4  ? -6.444  8.594   8.774   1.00 0.00 ? 4  LEU B CD2  1  
ATOM 1047  H H    . LEU B 1 4  ? -3.073  6.340   8.616   1.00 0.00 ? 4  LEU B H    1  
ATOM 1048  H HA   . LEU B 1 4  ? -5.174  7.058   10.548  1.00 0.00 ? 4  LEU B HA   1  
ATOM 1049  H HB2  . LEU B 1 4  ? -5.393  6.190   7.778   1.00 0.00 ? 4  LEU B HB2  1  
ATOM 1050  H HB3  . LEU B 1 4  ? -6.313  5.170   8.868   1.00 0.00 ? 4  LEU B HB3  1  
ATOM 1051  H HG   . LEU B 1 4  ? -7.598  7.067   7.857   1.00 0.00 ? 4  LEU B HG   1  
ATOM 1052  H HD11 . LEU B 1 4  ? -7.376  6.448   10.731  1.00 0.00 ? 4  LEU B HD11 1  
ATOM 1053  H HD12 . LEU B 1 4  ? -8.764  6.346   9.648   1.00 0.00 ? 4  LEU B HD12 1  
ATOM 1054  H HD13 . LEU B 1 4  ? -8.279  7.904   10.316  1.00 0.00 ? 4  LEU B HD13 1  
ATOM 1055  H HD21 . LEU B 1 4  ? -5.440  8.586   8.375   1.00 0.00 ? 4  LEU B HD21 1  
ATOM 1056  H HD22 . LEU B 1 4  ? -6.426  8.961   9.789   1.00 0.00 ? 4  LEU B HD22 1  
ATOM 1057  H HD23 . LEU B 1 4  ? -7.067  9.237   8.169   1.00 0.00 ? 4  LEU B HD23 1  
ATOM 1058  N N    . THR B 1 5  ? -4.918  4.941   11.798  1.00 0.00 ? 5  THR B N    1  
ATOM 1059  C CA   . THR B 1 5  ? -4.707  3.723   12.567  1.00 0.00 ? 5  THR B CA   1  
ATOM 1060  C C    . THR B 1 5  ? -5.424  2.551   11.911  1.00 0.00 ? 5  THR B C    1  
ATOM 1061  O O    . THR B 1 5  ? -6.497  2.714   11.331  1.00 0.00 ? 5  THR B O    1  
ATOM 1062  C CB   . THR B 1 5  ? -5.202  3.894   14.002  1.00 0.00 ? 5  THR B CB   1  
ATOM 1063  O OG1  . THR B 1 5  ? -5.383  5.263   14.315  1.00 0.00 ? 5  THR B OG1  1  
ATOM 1064  C CG2  . THR B 1 5  ? -4.257  3.307   15.024  1.00 0.00 ? 5  THR B CG2  1  
ATOM 1065  H H    . THR B 1 5  ? -5.347  5.711   12.224  1.00 0.00 ? 5  THR B H    1  
ATOM 1066  H HA   . THR B 1 5  ? -3.647  3.519   12.582  1.00 0.00 ? 5  THR B HA   1  
ATOM 1067  H HB   . THR B 1 5  ? -6.154  3.390   14.105  1.00 0.00 ? 5  THR B HB   1  
ATOM 1068  H HG1  . THR B 1 5  ? -5.940  5.343   15.093  1.00 0.00 ? 5  THR B HG1  1  
ATOM 1069  H HG21 . THR B 1 5  ? -4.184  2.239   14.874  1.00 0.00 ? 5  THR B HG21 1  
ATOM 1070  H HG22 . THR B 1 5  ? -4.631  3.508   16.016  1.00 0.00 ? 5  THR B HG22 1  
ATOM 1071  H HG23 . THR B 1 5  ? -3.280  3.753   14.909  1.00 0.00 ? 5  THR B HG23 1  
ATOM 1072  N N    . ARG B 1 6  ? -4.824  1.374   12.001  1.00 0.00 ? 6  ARG B N    1  
ATOM 1073  C CA   . ARG B 1 6  ? -5.408  0.183   11.409  1.00 0.00 ? 6  ARG B CA   1  
ATOM 1074  C C    . ARG B 1 6  ? -4.909  -1.080  12.101  1.00 0.00 ? 6  ARG B C    1  
ATOM 1075  O O    . ARG B 1 6  ? -3.761  -1.152  12.547  1.00 0.00 ? 6  ARG B O    1  
ATOM 1076  C CB   . ARG B 1 6  ? -5.083  0.125   9.915   1.00 0.00 ? 6  ARG B CB   1  
ATOM 1077  C CG   . ARG B 1 6  ? -6.313  0.098   9.023   1.00 0.00 ? 6  ARG B CG   1  
ATOM 1078  C CD   . ARG B 1 6  ? -7.229  -1.065  9.369   1.00 0.00 ? 6  ARG B CD   1  
ATOM 1079  N NE   . ARG B 1 6  ? -8.312  -0.662  10.265  1.00 0.00 ? 6  ARG B NE   1  
ATOM 1080  C CZ   . ARG B 1 6  ? -9.452  -0.110  9.853   1.00 0.00 ? 6  ARG B CZ   1  
ATOM 1081  N NH1  . ARG B 1 6  ? -9.665  0.110   8.561   1.00 0.00 ? 6  ARG B NH1  1  
ATOM 1082  N NH2  . ARG B 1 6  ? -10.382 0.225   10.737  1.00 0.00 ? 6  ARG B NH2  1  
ATOM 1083  H H    . ARG B 1 6  ? -3.967  1.305   12.471  1.00 0.00 ? 6  ARG B H    1  
ATOM 1084  H HA   . ARG B 1 6  ? -6.479  0.245   11.530  1.00 0.00 ? 6  ARG B HA   1  
ATOM 1085  H HB2  . ARG B 1 6  ? -4.496  0.993   9.653   1.00 0.00 ? 6  ARG B HB2  1  
ATOM 1086  H HB3  . ARG B 1 6  ? -4.502  -0.764  9.716   1.00 0.00 ? 6  ARG B HB3  1  
ATOM 1087  H HG2  . ARG B 1 6  ? -6.857  1.021   9.148   1.00 0.00 ? 6  ARG B HG2  1  
ATOM 1088  H HG3  . ARG B 1 6  ? -5.995  0.001   7.995   1.00 0.00 ? 6  ARG B HG3  1  
ATOM 1089  H HD2  . ARG B 1 6  ? -7.656  -1.455  8.456   1.00 0.00 ? 6  ARG B HD2  1  
ATOM 1090  H HD3  . ARG B 1 6  ? -6.645  -1.836  9.848   1.00 0.00 ? 6  ARG B HD3  1  
ATOM 1091  H HE   . ARG B 1 6  ? -8.183  -0.811  11.224  1.00 0.00 ? 6  ARG B HE   1  
ATOM 1092  H HH11 . ARG B 1 6  ? -8.969  -0.139  7.889   1.00 0.00 ? 6  ARG B HH11 1  
ATOM 1093  H HH12 . ARG B 1 6  ? -10.523 0.525   8.261   1.00 0.00 ? 6  ARG B HH12 1  
ATOM 1094  H HH21 . ARG B 1 6  ? -10.227 0.062   11.711  1.00 0.00 ? 6  ARG B HH21 1  
ATOM 1095  H HH22 . ARG B 1 6  ? -11.238 0.640   10.429  1.00 0.00 ? 6  ARG B HH22 1  
ATOM 1096  N N    . ARG B 1 7  ? -5.789  -2.071  12.176  1.00 0.00 ? 7  ARG B N    1  
ATOM 1097  C CA   . ARG B 1 7  ? -5.475  -3.352  12.795  1.00 0.00 ? 7  ARG B CA   1  
ATOM 1098  C C    . ARG B 1 7  ? -6.712  -4.240  12.816  1.00 0.00 ? 7  ARG B C    1  
ATOM 1099  O O    . ARG B 1 7  ? -7.336  -4.435  13.858  1.00 0.00 ? 7  ARG B O    1  
ATOM 1100  C CB   . ARG B 1 7  ? -4.937  -3.158  14.213  1.00 0.00 ? 7  ARG B CB   1  
ATOM 1101  C CG   . ARG B 1 7  ? -3.918  -4.211  14.618  1.00 0.00 ? 7  ARG B CG   1  
ATOM 1102  C CD   . ARG B 1 7  ? -4.085  -4.619  16.073  1.00 0.00 ? 7  ARG B CD   1  
ATOM 1103  N NE   . ARG B 1 7  ? -3.006  -5.497  16.521  1.00 0.00 ? 7  ARG B NE   1  
ATOM 1104  C CZ   . ARG B 1 7  ? -2.684  -5.685  17.799  1.00 0.00 ? 7  ARG B CZ   1  
ATOM 1105  N NH1  . ARG B 1 7  ? -3.356  -5.062  18.759  1.00 0.00 ? 7  ARG B NH1  1  
ATOM 1106  N NH2  . ARG B 1 7  ? -1.687  -6.499  18.118  1.00 0.00 ? 7  ARG B NH2  1  
ATOM 1107  H H    . ARG B 1 7  ? -6.681  -1.936  11.797  1.00 0.00 ? 7  ARG B H    1  
ATOM 1108  H HA   . ARG B 1 7  ? -4.718  -3.830  12.194  1.00 0.00 ? 7  ARG B HA   1  
ATOM 1109  H HB2  . ARG B 1 7  ? -4.466  -2.187  14.276  1.00 0.00 ? 7  ARG B HB2  1  
ATOM 1110  H HB3  . ARG B 1 7  ? -5.762  -3.196  14.909  1.00 0.00 ? 7  ARG B HB3  1  
ATOM 1111  H HG2  . ARG B 1 7  ? -4.047  -5.084  13.992  1.00 0.00 ? 7  ARG B HG2  1  
ATOM 1112  H HG3  . ARG B 1 7  ? -2.925  -3.809  14.478  1.00 0.00 ? 7  ARG B HG3  1  
ATOM 1113  H HD2  . ARG B 1 7  ? -4.090  -3.729  16.685  1.00 0.00 ? 7  ARG B HD2  1  
ATOM 1114  H HD3  . ARG B 1 7  ? -5.027  -5.137  16.183  1.00 0.00 ? 7  ARG B HD3  1  
ATOM 1115  H HE   . ARG B 1 7  ? -2.493  -5.970  15.833  1.00 0.00 ? 7  ARG B HE   1  
ATOM 1116  H HH11 . ARG B 1 7  ? -4.109  -4.447  18.526  1.00 0.00 ? 7  ARG B HH11 1  
ATOM 1117  H HH12 . ARG B 1 7  ? -3.108  -5.208  19.717  1.00 0.00 ? 7  ARG B HH12 1  
ATOM 1118  H HH21 . ARG B 1 7  ? -1.178  -6.971  17.398  1.00 0.00 ? 7  ARG B HH21 1  
ATOM 1119  H HH22 . ARG B 1 7  ? -1.444  -6.641  19.078  1.00 0.00 ? 7  ARG B HH22 1  
ATOM 1120  N N    . VAL B 1 8  ? -7.058  -4.770  11.647  1.00 0.00 ? 8  VAL B N    1  
ATOM 1121  C CA   . VAL B 1 8  ? -8.222  -5.639  11.503  1.00 0.00 ? 8  VAL B CA   1  
ATOM 1122  C C    . VAL B 1 8  ? -8.421  -6.036  10.043  1.00 0.00 ? 8  VAL B C    1  
ATOM 1123  O O    . VAL B 1 8  ? -8.379  -7.217  9.700   1.00 0.00 ? 8  VAL B O    1  
ATOM 1124  C CB   . VAL B 1 8  ? -9.518  -4.971  12.024  1.00 0.00 ? 8  VAL B CB   1  
ATOM 1125  C CG1  . VAL B 1 8  ? -9.824  -5.432  13.440  1.00 0.00 ? 8  VAL B CG1  1  
ATOM 1126  C CG2  . VAL B 1 8  ? -9.420  -3.451  11.961  1.00 0.00 ? 8  VAL B CG2  1  
ATOM 1127  H H    . VAL B 1 8  ? -6.511  -4.573  10.859  1.00 0.00 ? 8  VAL B H    1  
ATOM 1128  H HA   . VAL B 1 8  ? -8.043  -6.532  12.085  1.00 0.00 ? 8  VAL B HA   1  
ATOM 1129  H HB   . VAL B 1 8  ? -10.335 -5.282  11.389  1.00 0.00 ? 8  VAL B HB   1  
ATOM 1130  H HG11 . VAL B 1 8  ? -9.261  -6.328  13.658  1.00 0.00 ? 8  VAL B HG11 1  
ATOM 1131  H HG12 . VAL B 1 8  ? -10.880 -5.641  13.530  1.00 0.00 ? 8  VAL B HG12 1  
ATOM 1132  H HG13 . VAL B 1 8  ? -9.550  -4.656  14.139  1.00 0.00 ? 8  VAL B HG13 1  
ATOM 1133  H HG21 . VAL B 1 8  ? -8.688  -3.166  11.220  1.00 0.00 ? 8  VAL B HG21 1  
ATOM 1134  H HG22 . VAL B 1 8  ? -9.121  -3.070  12.927  1.00 0.00 ? 8  VAL B HG22 1  
ATOM 1135  H HG23 . VAL B 1 8  ? -10.382 -3.040  11.694  1.00 0.00 ? 8  VAL B HG23 1  
ATOM 1136  N N    . GLY B 1 9  ? -8.635  -5.040  9.187   1.00 0.00 ? 9  GLY B N    1  
ATOM 1137  C CA   . GLY B 1 9  ? -8.835  -5.308  7.774   1.00 0.00 ? 9  GLY B CA   1  
ATOM 1138  C C    . GLY B 1 9  ? -9.213  -4.065  6.991   1.00 0.00 ? 9  GLY B C    1  
ATOM 1139  O O    . GLY B 1 9  ? -10.391 -3.825  6.728   1.00 0.00 ? 9  GLY B O    1  
ATOM 1140  H H    . GLY B 1 9  ? -8.658  -4.118  9.516   1.00 0.00 ? 9  GLY B H    1  
ATOM 1141  H HA2  . GLY B 1 9  ? -7.922  -5.714  7.364   1.00 0.00 ? 9  GLY B HA2  1  
ATOM 1142  H HA3  . GLY B 1 9  ? -9.621  -6.041  7.667   1.00 0.00 ? 9  GLY B HA3  1  
ATOM 1143  N N    . GLU B 1 10 ? -8.212  -3.275  6.613   1.00 0.00 ? 10 GLU B N    1  
ATOM 1144  C CA   . GLU B 1 10 ? -8.447  -2.054  5.850   1.00 0.00 ? 10 GLU B CA   1  
ATOM 1145  C C    . GLU B 1 10 ? -8.848  -2.388  4.413   1.00 0.00 ? 10 GLU B C    1  
ATOM 1146  O O    . GLU B 1 10 ? -9.252  -3.513  4.122   1.00 0.00 ? 10 GLU B O    1  
ATOM 1147  C CB   . GLU B 1 10 ? -7.196  -1.171  5.861   1.00 0.00 ? 10 GLU B CB   1  
ATOM 1148  C CG   . GLU B 1 10 ? -7.501  0.319   5.883   1.00 0.00 ? 10 GLU B CG   1  
ATOM 1149  C CD   . GLU B 1 10 ? -6.527  1.125   5.047   1.00 0.00 ? 10 GLU B CD   1  
ATOM 1150  O OE1  . GLU B 1 10 ? -6.207  0.688   3.922   1.00 0.00 ? 10 GLU B OE1  1  
ATOM 1151  O OE2  . GLU B 1 10 ? -6.083  2.193   5.518   1.00 0.00 ? 10 GLU B OE2  1  
ATOM 1152  H H    . GLU B 1 10 ? -7.293  -3.522  6.849   1.00 0.00 ? 10 GLU B H    1  
ATOM 1153  H HA   . GLU B 1 10 ? -9.259  -1.520  6.322   1.00 0.00 ? 10 GLU B HA   1  
ATOM 1154  H HB2  . GLU B 1 10 ? -6.610  -1.409  6.737   1.00 0.00 ? 10 GLU B HB2  1  
ATOM 1155  H HB3  . GLU B 1 10 ? -6.611  -1.384  4.979   1.00 0.00 ? 10 GLU B HB3  1  
ATOM 1156  H HG2  . GLU B 1 10 ? -8.497  0.475   5.496   1.00 0.00 ? 10 GLU B HG2  1  
ATOM 1157  H HG3  . GLU B 1 10 ? -7.455  0.670   6.903   1.00 0.00 ? 10 GLU B HG3  1  
ATOM 1158  N N    . THR B 1 11 ? -8.733  -1.409  3.516   1.00 0.00 ? 11 THR B N    1  
ATOM 1159  C CA   . THR B 1 11 ? -9.083  -1.610  2.113   1.00 0.00 ? 11 THR B CA   1  
ATOM 1160  C C    . THR B 1 11 ? -9.042  -0.294  1.343   1.00 0.00 ? 11 THR B C    1  
ATOM 1161  O O    . THR B 1 11 ? -10.051 0.404   1.237   1.00 0.00 ? 11 THR B O    1  
ATOM 1162  C CB   . THR B 1 11 ? -10.477 -2.236  1.991   1.00 0.00 ? 11 THR B CB   1  
ATOM 1163  O OG1  . THR B 1 11 ? -10.963 -2.123  0.665   1.00 0.00 ? 11 THR B OG1  1  
ATOM 1164  C CG2  . THR B 1 11 ? -11.499 -1.602  2.910   1.00 0.00 ? 11 THR B CG2  1  
ATOM 1165  H H    . THR B 1 11 ? -8.402  -0.534  3.802   1.00 0.00 ? 11 THR B H    1  
ATOM 1166  H HA   . THR B 1 11 ? -8.358  -2.286  1.685   1.00 0.00 ? 11 THR B HA   1  
ATOM 1167  H HB   . THR B 1 11 ? -10.412 -3.285  2.241   1.00 0.00 ? 11 THR B HB   1  
ATOM 1168  H HG1  . THR B 1 11 ? -11.839 -2.512  0.611   1.00 0.00 ? 11 THR B HG1  1  
ATOM 1169  H HG21 . THR B 1 11 ? -11.442 -2.064  3.885   1.00 0.00 ? 11 THR B HG21 1  
ATOM 1170  H HG22 . THR B 1 11 ? -12.489 -1.746  2.501   1.00 0.00 ? 11 THR B HG22 1  
ATOM 1171  H HG23 . THR B 1 11 ? -11.297 -0.545  3.000   1.00 0.00 ? 11 THR B HG23 1  
ATOM 1172  N N    . LEU B 1 12 ? -7.876  0.035   0.795   1.00 0.00 ? 12 LEU B N    1  
ATOM 1173  C CA   . LEU B 1 12 ? -7.717  1.262   0.021   1.00 0.00 ? 12 LEU B CA   1  
ATOM 1174  C C    . LEU B 1 12 ? -7.517  0.933   -1.454  1.00 0.00 ? 12 LEU B C    1  
ATOM 1175  O O    . LEU B 1 12 ? -7.012  -0.138  -1.792  1.00 0.00 ? 12 LEU B O    1  
ATOM 1176  C CB   . LEU B 1 12 ? -6.539  2.094   0.559   1.00 0.00 ? 12 LEU B CB   1  
ATOM 1177  C CG   . LEU B 1 12 ? -5.165  1.804   -0.065  1.00 0.00 ? 12 LEU B CG   1  
ATOM 1178  C CD1  . LEU B 1 12 ? -4.412  3.099   -0.328  1.00 0.00 ? 12 LEU B CD1  1  
ATOM 1179  C CD2  . LEU B 1 12 ? -4.351  0.892   0.838   1.00 0.00 ? 12 LEU B CD2  1  
ATOM 1180  H H    . LEU B 1 12 ? -7.108  -0.565  0.902   1.00 0.00 ? 12 LEU B H    1  
ATOM 1181  H HA   . LEU B 1 12 ? -8.627  1.836   0.126   1.00 0.00 ? 12 LEU B HA   1  
ATOM 1182  H HB2  . LEU B 1 12 ? -6.767  3.137   0.398   1.00 0.00 ? 12 LEU B HB2  1  
ATOM 1183  H HB3  . LEU B 1 12 ? -6.467  1.923   1.623   1.00 0.00 ? 12 LEU B HB3  1  
ATOM 1184  H HG   . LEU B 1 12 ? -5.298  1.303   -1.011  1.00 0.00 ? 12 LEU B HG   1  
ATOM 1185  H HD11 . LEU B 1 12 ? -5.113  3.918   -0.390  1.00 0.00 ? 12 LEU B HD11 1  
ATOM 1186  H HD12 . LEU B 1 12 ? -3.870  3.018   -1.260  1.00 0.00 ? 12 LEU B HD12 1  
ATOM 1187  H HD13 . LEU B 1 12 ? -3.716  3.281   0.477   1.00 0.00 ? 12 LEU B HD13 1  
ATOM 1188  H HD21 . LEU B 1 12 ? -4.170  1.386   1.780   1.00 0.00 ? 12 LEU B HD21 1  
ATOM 1189  H HD22 . LEU B 1 12 ? -3.408  0.664   0.362   1.00 0.00 ? 12 LEU B HD22 1  
ATOM 1190  H HD23 . LEU B 1 12 ? -4.897  -0.024  1.009   1.00 0.00 ? 12 LEU B HD23 1  
ATOM 1191  N N    . MET B 1 13 ? -7.913  1.848   -2.331  1.00 0.00 ? 13 MET B N    1  
ATOM 1192  C CA   . MET B 1 13 ? -7.765  1.622   -3.761  1.00 0.00 ? 13 MET B CA   1  
ATOM 1193  C C    . MET B 1 13 ? -7.160  2.835   -4.460  1.00 0.00 ? 13 MET B C    1  
ATOM 1194  O O    . MET B 1 13 ? -7.855  3.805   -4.758  1.00 0.00 ? 13 MET B O    1  
ATOM 1195  C CB   . MET B 1 13 ? -9.120  1.283   -4.385  1.00 0.00 ? 13 MET B CB   1  
ATOM 1196  C CG   . MET B 1 13 ? -9.046  0.981   -5.873  1.00 0.00 ? 13 MET B CG   1  
ATOM 1197  S SD   . MET B 1 13 ? -10.466 1.619   -6.784  1.00 0.00 ? 13 MET B SD   1  
ATOM 1198  C CE   . MET B 1 13 ? -9.648  2.577   -8.057  1.00 0.00 ? 13 MET B CE   1  
ATOM 1199  H H    . MET B 1 13 ? -8.313  2.684   -2.012  1.00 0.00 ? 13 MET B H    1  
ATOM 1200  H HA   . MET B 1 13 ? -7.103  0.781   -3.893  1.00 0.00 ? 13 MET B HA   1  
ATOM 1201  H HB2  . MET B 1 13 ? -9.528  0.418   -3.884  1.00 0.00 ? 13 MET B HB2  1  
ATOM 1202  H HB3  . MET B 1 13 ? -9.789  2.119   -4.242  1.00 0.00 ? 13 MET B HB3  1  
ATOM 1203  H HG2  . MET B 1 13 ? -8.149  1.429   -6.274  1.00 0.00 ? 13 MET B HG2  1  
ATOM 1204  H HG3  . MET B 1 13 ? -9.002  -0.090  -6.007  1.00 0.00 ? 13 MET B HG3  1  
ATOM 1205  H HE1  . MET B 1 13 ? -9.558  3.604   -7.733  1.00 0.00 ? 13 MET B HE1  1  
ATOM 1206  H HE2  . MET B 1 13 ? -10.228 2.536   -8.967  1.00 0.00 ? 13 MET B HE2  1  
ATOM 1207  H HE3  . MET B 1 13 ? -8.664  2.170   -8.238  1.00 0.00 ? 13 MET B HE3  1  
ATOM 1208  N N    . ILE B 1 14 ? -5.863  2.762   -4.735  1.00 0.00 ? 14 ILE B N    1  
ATOM 1209  C CA   . ILE B 1 14 ? -5.161  3.841   -5.416  1.00 0.00 ? 14 ILE B CA   1  
ATOM 1210  C C    . ILE B 1 14 ? -4.745  3.399   -6.817  1.00 0.00 ? 14 ILE B C    1  
ATOM 1211  O O    . ILE B 1 14 ? -4.108  2.360   -6.988  1.00 0.00 ? 14 ILE B O    1  
ATOM 1212  C CB   . ILE B 1 14 ? -3.921  4.300   -4.617  1.00 0.00 ? 14 ILE B CB   1  
ATOM 1213  C CG1  . ILE B 1 14 ? -3.216  5.467   -5.326  1.00 0.00 ? 14 ILE B CG1  1  
ATOM 1214  C CG2  . ILE B 1 14 ? -2.966  3.136   -4.385  1.00 0.00 ? 14 ILE B CG2  1  
ATOM 1215  C CD1  . ILE B 1 14 ? -2.375  5.058   -6.520  1.00 0.00 ? 14 ILE B CD1  1  
ATOM 1216  H H    . ILE B 1 14 ? -5.366  1.957   -4.480  1.00 0.00 ? 14 ILE B H    1  
ATOM 1217  H HA   . ILE B 1 14 ? -5.842  4.677   -5.500  1.00 0.00 ? 14 ILE B HA   1  
ATOM 1218  H HB   . ILE B 1 14 ? -4.262  4.639   -3.649  1.00 0.00 ? 14 ILE B HB   1  
ATOM 1219  H HG12 . ILE B 1 14 ? -3.960  6.167   -5.674  1.00 0.00 ? 14 ILE B HG12 1  
ATOM 1220  H HG13 . ILE B 1 14 ? -2.567  5.964   -4.619  1.00 0.00 ? 14 ILE B HG13 1  
ATOM 1221  H HG21 . ILE B 1 14 ? -2.946  2.892   -3.333  1.00 0.00 ? 14 ILE B HG21 1  
ATOM 1222  H HG22 . ILE B 1 14 ? -1.973  3.413   -4.708  1.00 0.00 ? 14 ILE B HG22 1  
ATOM 1223  H HG23 . ILE B 1 14 ? -3.300  2.276   -4.946  1.00 0.00 ? 14 ILE B HG23 1  
ATOM 1224  H HD11 . ILE B 1 14 ? -2.340  3.981   -6.586  1.00 0.00 ? 14 ILE B HD11 1  
ATOM 1225  H HD12 . ILE B 1 14 ? -1.374  5.445   -6.404  1.00 0.00 ? 14 ILE B HD12 1  
ATOM 1226  H HD13 . ILE B 1 14 ? -2.813  5.460   -7.422  1.00 0.00 ? 14 ILE B HD13 1  
ATOM 1227  N N    . GLY B 1 15 ? -5.114  4.189   -7.818  1.00 0.00 ? 15 GLY B N    1  
ATOM 1228  C CA   . GLY B 1 15 ? -4.779  3.857   -9.192  1.00 0.00 ? 15 GLY B CA   1  
ATOM 1229  C C    . GLY B 1 15 ? -6.004  3.847   -10.086 1.00 0.00 ? 15 GLY B C    1  
ATOM 1230  O O    . GLY B 1 15 ? -6.500  4.905   -10.477 1.00 0.00 ? 15 GLY B O    1  
ATOM 1231  H H    . GLY B 1 15 ? -5.621  5.006   -7.627  1.00 0.00 ? 15 GLY B H    1  
ATOM 1232  H HA2  . GLY B 1 15 ? -4.076  4.586   -9.567  1.00 0.00 ? 15 GLY B HA2  1  
ATOM 1233  H HA3  . GLY B 1 15 ? -4.318  2.879   -9.218  1.00 0.00 ? 15 GLY B HA3  1  
ATOM 1234  N N    . ASP B 1 16 ? -6.498  2.654   -10.409 1.00 0.00 ? 16 ASP B N    1  
ATOM 1235  C CA   . ASP B 1 16 ? -7.677  2.528   -11.260 1.00 0.00 ? 16 ASP B CA   1  
ATOM 1236  C C    . ASP B 1 16 ? -8.273  1.117   -11.219 1.00 0.00 ? 16 ASP B C    1  
ATOM 1237  O O    . ASP B 1 16 ? -9.059  0.755   -12.094 1.00 0.00 ? 16 ASP B O    1  
ATOM 1238  C CB   . ASP B 1 16 ? -7.325  2.898   -12.702 1.00 0.00 ? 16 ASP B CB   1  
ATOM 1239  C CG   . ASP B 1 16 ? -7.638  4.347   -13.020 1.00 0.00 ? 16 ASP B CG   1  
ATOM 1240  O OD1  . ASP B 1 16 ? -8.833  4.711   -13.016 1.00 0.00 ? 16 ASP B OD1  1  
ATOM 1241  O OD2  . ASP B 1 16 ? -6.688  5.118   -13.273 1.00 0.00 ? 16 ASP B OD2  1  
ATOM 1242  H H    . ASP B 1 16 ? -6.061  1.847   -10.068 1.00 0.00 ? 16 ASP B H    1  
ATOM 1243  H HA   . ASP B 1 16 ? -8.418  3.224   -10.897 1.00 0.00 ? 16 ASP B HA   1  
ATOM 1244  H HB2  . ASP B 1 16 ? -6.270  2.734   -12.862 1.00 0.00 ? 16 ASP B HB2  1  
ATOM 1245  H HB3  . ASP B 1 16 ? -7.889  2.271   -13.377 1.00 0.00 ? 16 ASP B HB3  1  
ATOM 1246  N N    . GLU B 1 17 ? -7.906  0.329   -10.202 1.00 0.00 ? 17 GLU B N    1  
ATOM 1247  C CA   . GLU B 1 17 ? -8.415  -1.041  -10.049 1.00 0.00 ? 17 GLU B CA   1  
ATOM 1248  C C    . GLU B 1 17 ? -7.487  -1.870  -9.162  1.00 0.00 ? 17 GLU B C    1  
ATOM 1249  O O    . GLU B 1 17 ? -6.948  -2.889  -9.594  1.00 0.00 ? 17 GLU B O    1  
ATOM 1250  C CB   . GLU B 1 17 ? -8.565  -1.735  -11.410 1.00 0.00 ? 17 GLU B CB   1  
ATOM 1251  C CG   . GLU B 1 17 ? -7.380  -1.522  -12.340 1.00 0.00 ? 17 GLU B CG   1  
ATOM 1252  C CD   . GLU B 1 17 ? -7.802  -1.170  -13.753 1.00 0.00 ? 17 GLU B CD   1  
ATOM 1253  O OE1  . GLU B 1 17 ? -8.161  -2.095  -14.513 1.00 0.00 ? 17 GLU B OE1  1  
ATOM 1254  O OE2  . GLU B 1 17 ? -7.773  0.029   -14.101 1.00 0.00 ? 17 GLU B OE2  1  
ATOM 1255  H H    . GLU B 1 17 ? -7.286  0.675   -9.529  1.00 0.00 ? 17 GLU B H    1  
ATOM 1256  H HA   . GLU B 1 17 ? -9.384  -0.982  -9.577  1.00 0.00 ? 17 GLU B HA   1  
ATOM 1257  H HB2  . GLU B 1 17 ? -8.679  -2.797  -11.248 1.00 0.00 ? 17 GLU B HB2  1  
ATOM 1258  H HB3  . GLU B 1 17 ? -9.452  -1.359  -11.898 1.00 0.00 ? 17 GLU B HB3  1  
ATOM 1259  H HG2  . GLU B 1 17 ? -6.773  -0.718  -11.952 1.00 0.00 ? 17 GLU B HG2  1  
ATOM 1260  H HG3  . GLU B 1 17 ? -6.796  -2.430  -12.370 1.00 0.00 ? 17 GLU B HG3  1  
ATOM 1261  N N    . VAL B 1 18 ? -7.295  -1.426  -7.924  1.00 0.00 ? 18 VAL B N    1  
ATOM 1262  C CA   . VAL B 1 18 ? -6.427  -2.121  -6.995  1.00 0.00 ? 18 VAL B CA   1  
ATOM 1263  C C    . VAL B 1 18 ? -7.186  -2.563  -5.738  1.00 0.00 ? 18 VAL B C    1  
ATOM 1264  O O    . VAL B 1 18 ? -8.408  -2.705  -5.759  1.00 0.00 ? 18 VAL B O    1  
ATOM 1265  C CB   . VAL B 1 18 ? -5.246  -1.217  -6.606  1.00 0.00 ? 18 VAL B CB   1  
ATOM 1266  C CG1  . VAL B 1 18 ? -4.550  -0.679  -7.848  1.00 0.00 ? 18 VAL B CG1  1  
ATOM 1267  C CG2  . VAL B 1 18 ? -5.708  -0.080  -5.705  1.00 0.00 ? 18 VAL B CG2  1  
ATOM 1268  H H    . VAL B 1 18 ? -7.735  -0.608  -7.631  1.00 0.00 ? 18 VAL B H    1  
ATOM 1269  H HA   . VAL B 1 18 ? -6.035  -2.995  -7.494  1.00 0.00 ? 18 VAL B HA   1  
ATOM 1270  H HB   . VAL B 1 18 ? -4.542  -1.811  -6.062  1.00 0.00 ? 18 VAL B HB   1  
ATOM 1271  H HG11 . VAL B 1 18 ? -4.945  -1.170  -8.725  1.00 0.00 ? 18 VAL B HG11 1  
ATOM 1272  H HG12 . VAL B 1 18 ? -3.489  -0.870  -7.777  1.00 0.00 ? 18 VAL B HG12 1  
ATOM 1273  H HG13 . VAL B 1 18 ? -4.719  0.385   -7.924  1.00 0.00 ? 18 VAL B HG13 1  
ATOM 1274  H HG21 . VAL B 1 18 ? -6.781  -0.120  -5.596  1.00 0.00 ? 18 VAL B HG21 1  
ATOM 1275  H HG22 . VAL B 1 18 ? -5.427  0.865   -6.143  1.00 0.00 ? 18 VAL B HG22 1  
ATOM 1276  H HG23 . VAL B 1 18 ? -5.244  -0.179  -4.733  1.00 0.00 ? 18 VAL B HG23 1  
ATOM 1277  N N    . THR B 1 19 ? -6.449  -2.777  -4.645  1.00 0.00 ? 19 THR B N    1  
ATOM 1278  C CA   . THR B 1 19 ? -7.029  -3.200  -3.370  1.00 0.00 ? 19 THR B CA   1  
ATOM 1279  C C    . THR B 1 19 ? -5.922  -3.651  -2.422  1.00 0.00 ? 19 THR B C    1  
ATOM 1280  O O    . THR B 1 19 ? -5.353  -4.726  -2.592  1.00 0.00 ? 19 THR B O    1  
ATOM 1281  C CB   . THR B 1 19 ? -8.036  -4.340  -3.572  1.00 0.00 ? 19 THR B CB   1  
ATOM 1282  O OG1  . THR B 1 19 ? -7.807  -5.006  -4.801  1.00 0.00 ? 19 THR B OG1  1  
ATOM 1283  C CG2  . THR B 1 19 ? -9.477  -3.875  -3.561  1.00 0.00 ? 19 THR B CG2  1  
ATOM 1284  H H    . THR B 1 19 ? -5.481  -2.640  -4.693  1.00 0.00 ? 19 THR B H    1  
ATOM 1285  H HA   . THR B 1 19 ? -7.536  -2.350  -2.937  1.00 0.00 ? 19 THR B HA   1  
ATOM 1286  H HB   . THR B 1 19 ? -7.916  -5.057  -2.772  1.00 0.00 ? 19 THR B HB   1  
ATOM 1287  H HG1  . THR B 1 19 ? -6.866  -5.153  -4.916  1.00 0.00 ? 19 THR B HG1  1  
ATOM 1288  H HG21 . THR B 1 19 ? -9.511  -2.813  -3.369  1.00 0.00 ? 19 THR B HG21 1  
ATOM 1289  H HG22 . THR B 1 19 ? -10.018 -4.399  -2.787  1.00 0.00 ? 19 THR B HG22 1  
ATOM 1290  H HG23 . THR B 1 19 ? -9.929  -4.082  -4.520  1.00 0.00 ? 19 THR B HG23 1  
ATOM 1291  N N    . VAL B 1 20 ? -5.608  -2.827  -1.429  1.00 0.00 ? 20 VAL B N    1  
ATOM 1292  C CA   . VAL B 1 20 ? -4.555  -3.162  -0.477  1.00 0.00 ? 20 VAL B CA   1  
ATOM 1293  C C    . VAL B 1 20 ? -5.072  -3.162  0.960   1.00 0.00 ? 20 VAL B C    1  
ATOM 1294  O O    . VAL B 1 20 ? -5.455  -2.119  1.492   1.00 0.00 ? 20 VAL B O    1  
ATOM 1295  C CB   . VAL B 1 20 ? -3.375  -2.178  -0.583  1.00 0.00 ? 20 VAL B CB   1  
ATOM 1296  C CG1  . VAL B 1 20 ? -2.220  -2.624  0.301   1.00 0.00 ? 20 VAL B CG1  1  
ATOM 1297  C CG2  . VAL B 1 20 ? -2.926  -2.039  -2.030  1.00 0.00 ? 20 VAL B CG2  1  
ATOM 1298  H H    . VAL B 1 20 ? -6.089  -1.978  -1.337  1.00 0.00 ? 20 VAL B H    1  
ATOM 1299  H HA   . VAL B 1 20 ? -4.190  -4.152  -0.720  1.00 0.00 ? 20 VAL B HA   1  
ATOM 1300  H HB   . VAL B 1 20 ? -3.708  -1.211  -0.239  1.00 0.00 ? 20 VAL B HB   1  
ATOM 1301  H HG11 . VAL B 1 20 ? -2.592  -3.269  1.083   1.00 0.00 ? 20 VAL B HG11 1  
ATOM 1302  H HG12 . VAL B 1 20 ? -1.750  -1.757  0.743   1.00 0.00 ? 20 VAL B HG12 1  
ATOM 1303  H HG13 . VAL B 1 20 ? -1.496  -3.160  -0.294  1.00 0.00 ? 20 VAL B HG13 1  
ATOM 1304  H HG21 . VAL B 1 20 ? -3.181  -2.937  -2.573  1.00 0.00 ? 20 VAL B HG21 1  
ATOM 1305  H HG22 . VAL B 1 20 ? -1.857  -1.890  -2.062  1.00 0.00 ? 20 VAL B HG22 1  
ATOM 1306  H HG23 . VAL B 1 20 ? -3.422  -1.192  -2.481  1.00 0.00 ? 20 VAL B HG23 1  
ATOM 1307  N N    . THR B 1 21 ? -5.075  -4.337  1.582   1.00 0.00 ? 21 THR B N    1  
ATOM 1308  C CA   . THR B 1 21 ? -5.539  -4.473  2.959   1.00 0.00 ? 21 THR B CA   1  
ATOM 1309  C C    . THR B 1 21 ? -4.359  -4.634  3.915   1.00 0.00 ? 21 THR B C    1  
ATOM 1310  O O    . THR B 1 21 ? -3.590  -5.591  3.813   1.00 0.00 ? 21 THR B O    1  
ATOM 1311  C CB   . THR B 1 21 ? -6.481  -5.671  3.087   1.00 0.00 ? 21 THR B CB   1  
ATOM 1312  O OG1  . THR B 1 21 ? -7.005  -5.758  4.400   1.00 0.00 ? 21 THR B OG1  1  
ATOM 1313  C CG2  . THR B 1 21 ? -5.815  -6.993  2.771   1.00 0.00 ? 21 THR B CG2  1  
ATOM 1314  H H    . THR B 1 21 ? -4.760  -5.132  1.103   1.00 0.00 ? 21 THR B H    1  
ATOM 1315  H HA   . THR B 1 21 ? -6.077  -3.574  3.219   1.00 0.00 ? 21 THR B HA   1  
ATOM 1316  H HB   . THR B 1 21 ? -7.305  -5.543  2.401   1.00 0.00 ? 21 THR B HB   1  
ATOM 1317  H HG1  . THR B 1 21 ? -6.283  -5.768  5.033   1.00 0.00 ? 21 THR B HG1  1  
ATOM 1318  H HG21 . THR B 1 21 ? -4.850  -6.811  2.323   1.00 0.00 ? 21 THR B HG21 1  
ATOM 1319  H HG22 . THR B 1 21 ? -6.432  -7.552  2.084   1.00 0.00 ? 21 THR B HG22 1  
ATOM 1320  H HG23 . THR B 1 21 ? -5.688  -7.559  3.682   1.00 0.00 ? 21 THR B HG23 1  
ATOM 1321  N N    . VAL B 1 22 ? -4.219  -3.688  4.839   1.00 0.00 ? 22 VAL B N    1  
ATOM 1322  C CA   . VAL B 1 22 ? -3.129  -3.721  5.809   1.00 0.00 ? 22 VAL B CA   1  
ATOM 1323  C C    . VAL B 1 22 ? -3.543  -4.443  7.090   1.00 0.00 ? 22 VAL B C    1  
ATOM 1324  O O    . VAL B 1 22 ? -3.597  -3.839  8.161   1.00 0.00 ? 22 VAL B O    1  
ATOM 1325  C CB   . VAL B 1 22 ? -2.652  -2.300  6.164   1.00 0.00 ? 22 VAL B CB   1  
ATOM 1326  C CG1  . VAL B 1 22 ? -1.956  -1.657  4.974   1.00 0.00 ? 22 VAL B CG1  1  
ATOM 1327  C CG2  . VAL B 1 22 ? -3.821  -1.446  6.633   1.00 0.00 ? 22 VAL B CG2  1  
ATOM 1328  H H    . VAL B 1 22 ? -4.860  -2.948  4.867   1.00 0.00 ? 22 VAL B H    1  
ATOM 1329  H HA   . VAL B 1 22 ? -2.302  -4.253  5.362   1.00 0.00 ? 22 VAL B HA   1  
ATOM 1330  H HB   . VAL B 1 22 ? -1.940  -2.372  6.973   1.00 0.00 ? 22 VAL B HB   1  
ATOM 1331  H HG11 . VAL B 1 22 ? -2.594  -1.724  4.105   1.00 0.00 ? 22 VAL B HG11 1  
ATOM 1332  H HG12 . VAL B 1 22 ? -1.027  -2.171  4.780   1.00 0.00 ? 22 VAL B HG12 1  
ATOM 1333  H HG13 . VAL B 1 22 ? -1.755  -0.618  5.193   1.00 0.00 ? 22 VAL B HG13 1  
ATOM 1334  H HG21 . VAL B 1 22 ? -4.296  -0.986  5.779   1.00 0.00 ? 22 VAL B HG21 1  
ATOM 1335  H HG22 . VAL B 1 22 ? -3.461  -0.678  7.302   1.00 0.00 ? 22 VAL B HG22 1  
ATOM 1336  H HG23 . VAL B 1 22 ? -4.536  -2.068  7.151   1.00 0.00 ? 22 VAL B HG23 1  
ATOM 1337  N N    . LEU B 1 23 ? -3.838  -5.740  6.957   1.00 0.00 ? 23 LEU B N    1  
ATOM 1338  C CA   . LEU B 1 23 ? -4.258  -6.590  8.082   1.00 0.00 ? 23 LEU B CA   1  
ATOM 1339  C C    . LEU B 1 23 ? -4.011  -5.928  9.442   1.00 0.00 ? 23 LEU B C    1  
ATOM 1340  O O    . LEU B 1 23 ? -4.953  -5.523  10.122  1.00 0.00 ? 23 LEU B O    1  
ATOM 1341  C CB   . LEU B 1 23 ? -3.532  -7.935  8.016   1.00 0.00 ? 23 LEU B CB   1  
ATOM 1342  C CG   . LEU B 1 23 ? -4.310  -9.120  8.586   1.00 0.00 ? 23 LEU B CG   1  
ATOM 1343  C CD1  . LEU B 1 23 ? -4.456  -8.979  10.094  1.00 0.00 ? 23 LEU B CD1  1  
ATOM 1344  C CD2  . LEU B 1 23 ? -5.676  -9.229  7.924   1.00 0.00 ? 23 LEU B CD2  1  
ATOM 1345  H H    . LEU B 1 23 ? -3.778  -6.140  6.064   1.00 0.00 ? 23 LEU B H    1  
ATOM 1346  H HA   . LEU B 1 23 ? -5.318  -6.766  7.977   1.00 0.00 ? 23 LEU B HA   1  
ATOM 1347  H HB2  . LEU B 1 23 ? -3.303  -8.146  6.981   1.00 0.00 ? 23 LEU B HB2  1  
ATOM 1348  H HB3  . LEU B 1 23 ? -2.604  -7.849  8.561   1.00 0.00 ? 23 LEU B HB3  1  
ATOM 1349  H HG   . LEU B 1 23 ? -3.764  -10.033 8.384   1.00 0.00 ? 23 LEU B HG   1  
ATOM 1350  H HD11 . LEU B 1 23 ? -3.595  -8.463  10.489  1.00 0.00 ? 23 LEU B HD11 1  
ATOM 1351  H HD12 . LEU B 1 23 ? -4.527  -9.959  10.543  1.00 0.00 ? 23 LEU B HD12 1  
ATOM 1352  H HD13 . LEU B 1 23 ? -5.349  -8.413  10.320  1.00 0.00 ? 23 LEU B HD13 1  
ATOM 1353  H HD21 . LEU B 1 23 ? -6.395  -8.649  8.483   1.00 0.00 ? 23 LEU B HD21 1  
ATOM 1354  H HD22 . LEU B 1 23 ? -5.985  -10.264 7.904   1.00 0.00 ? 23 LEU B HD22 1  
ATOM 1355  H HD23 . LEU B 1 23 ? -5.617  -8.852  6.913   1.00 0.00 ? 23 LEU B HD23 1  
ATOM 1356  N N    . GLY B 1 24 ? -2.742  -5.810  9.826   1.00 0.00 ? 24 GLY B N    1  
ATOM 1357  C CA   . GLY B 1 24 ? -2.406  -5.184  11.094  1.00 0.00 ? 24 GLY B CA   1  
ATOM 1358  C C    . GLY B 1 24 ? -2.326  -6.171  12.247  1.00 0.00 ? 24 GLY B C    1  
ATOM 1359  O O    . GLY B 1 24 ? -1.391  -6.122  13.046  1.00 0.00 ? 24 GLY B O    1  
ATOM 1360  H H    . GLY B 1 24 ? -2.029  -6.141  9.241   1.00 0.00 ? 24 GLY B H    1  
ATOM 1361  H HA2  . GLY B 1 24 ? -1.451  -4.690  10.995  1.00 0.00 ? 24 GLY B HA2  1  
ATOM 1362  H HA3  . GLY B 1 24 ? -3.156  -4.443  11.323  1.00 0.00 ? 24 GLY B HA3  1  
ATOM 1363  N N    . VAL B 1 25 ? -3.308  -7.062  12.339  1.00 0.00 ? 25 VAL B N    1  
ATOM 1364  C CA   . VAL B 1 25 ? -3.342  -8.053  13.408  1.00 0.00 ? 25 VAL B CA   1  
ATOM 1365  C C    . VAL B 1 25 ? -2.514  -9.278  13.038  1.00 0.00 ? 25 VAL B C    1  
ATOM 1366  O O    . VAL B 1 25 ? -2.570  -9.754  11.905  1.00 0.00 ? 25 VAL B O    1  
ATOM 1367  C CB   . VAL B 1 25 ? -4.783  -8.507  13.727  1.00 0.00 ? 25 VAL B CB   1  
ATOM 1368  C CG1  . VAL B 1 25 ? -4.898  -8.928  15.183  1.00 0.00 ? 25 VAL B CG1  1  
ATOM 1369  C CG2  . VAL B 1 25 ? -5.788  -7.409  13.402  1.00 0.00 ? 25 VAL B CG2  1  
ATOM 1370  H H    . VAL B 1 25 ? -4.027  -7.049  11.683  1.00 0.00 ? 25 VAL B H    1  
ATOM 1371  H HA   . VAL B 1 25 ? -2.925  -7.598  14.289  1.00 0.00 ? 25 VAL B HA   1  
ATOM 1372  H HB   . VAL B 1 25 ? -5.010  -9.365  13.111  1.00 0.00 ? 25 VAL B HB   1  
ATOM 1373  H HG11 . VAL B 1 25 ? -4.147  -8.416  15.766  1.00 0.00 ? 25 VAL B HG11 1  
ATOM 1374  H HG12 . VAL B 1 25 ? -4.749  -9.995  15.262  1.00 0.00 ? 25 VAL B HG12 1  
ATOM 1375  H HG13 . VAL B 1 25 ? -5.879  -8.673  15.556  1.00 0.00 ? 25 VAL B HG13 1  
ATOM 1376  H HG21 . VAL B 1 25 ? -5.441  -6.471  13.809  1.00 0.00 ? 25 VAL B HG21 1  
ATOM 1377  H HG22 . VAL B 1 25 ? -6.745  -7.658  13.836  1.00 0.00 ? 25 VAL B HG22 1  
ATOM 1378  H HG23 . VAL B 1 25 ? -5.890  -7.321  12.330  1.00 0.00 ? 25 VAL B HG23 1  
ATOM 1379  N N    . LYS B 1 26 ? -1.742  -9.788  13.995  1.00 0.00 ? 26 LYS B N    1  
ATOM 1380  C CA   . LYS B 1 26 ? -0.899  -10.958 13.762  1.00 0.00 ? 26 LYS B CA   1  
ATOM 1381  C C    . LYS B 1 26 ? -0.030  -11.241 14.984  1.00 0.00 ? 26 LYS B C    1  
ATOM 1382  O O    . LYS B 1 26 ? 0.104   -10.395 15.868  1.00 0.00 ? 26 LYS B O    1  
ATOM 1383  C CB   . LYS B 1 26 ? -0.010  -10.747 12.533  1.00 0.00 ? 26 LYS B CB   1  
ATOM 1384  C CG   . LYS B 1 26 ? 0.077   -11.966 11.629  1.00 0.00 ? 26 LYS B CG   1  
ATOM 1385  C CD   . LYS B 1 26 ? -1.110  -12.043 10.682  1.00 0.00 ? 26 LYS B CD   1  
ATOM 1386  C CE   . LYS B 1 26 ? -1.187  -13.397 9.995   1.00 0.00 ? 26 LYS B CE   1  
ATOM 1387  N NZ   . LYS B 1 26 ? -2.594  -13.800 9.717   1.00 0.00 ? 26 LYS B NZ   1  
ATOM 1388  H H    . LYS B 1 26 ? -1.730  -9.379  14.886  1.00 0.00 ? 26 LYS B H    1  
ATOM 1389  H HA   . LYS B 1 26 ? -1.547  -11.805 13.589  1.00 0.00 ? 26 LYS B HA   1  
ATOM 1390  H HB2  . LYS B 1 26 ? -0.399  -9.924  11.954  1.00 0.00 ? 26 LYS B HB2  1  
ATOM 1391  H HB3  . LYS B 1 26 ? 0.987   -10.501 12.865  1.00 0.00 ? 26 LYS B HB3  1  
ATOM 1392  H HG2  . LYS B 1 26 ? 0.984   -11.907 11.047  1.00 0.00 ? 26 LYS B HG2  1  
ATOM 1393  H HG3  . LYS B 1 26 ? 0.096   -12.856 12.241  1.00 0.00 ? 26 LYS B HG3  1  
ATOM 1394  H HD2  . LYS B 1 26 ? -2.018  -11.884 11.245  1.00 0.00 ? 26 LYS B HD2  1  
ATOM 1395  H HD3  . LYS B 1 26 ? -1.010  -11.273 9.931   1.00 0.00 ? 26 LYS B HD3  1  
ATOM 1396  H HE2  . LYS B 1 26 ? -0.647  -13.344 9.062   1.00 0.00 ? 26 LYS B HE2  1  
ATOM 1397  H HE3  . LYS B 1 26 ? -0.729  -14.137 10.634  1.00 0.00 ? 26 LYS B HE3  1  
ATOM 1398  H HZ1  . LYS B 1 26 ? -3.205  -12.959 9.674   1.00 0.00 ? 26 LYS B HZ1  1  
ATOM 1399  H HZ2  . LYS B 1 26 ? -2.941  -14.428 10.469  1.00 0.00 ? 26 LYS B HZ2  1  
ATOM 1400  H HZ3  . LYS B 1 26 ? -2.649  -14.303 8.808   1.00 0.00 ? 26 LYS B HZ3  1  
ATOM 1401  N N    . GLY B 1 27 ? 0.559   -12.434 15.027  1.00 0.00 ? 27 GLY B N    1  
ATOM 1402  C CA   . GLY B 1 27 ? 1.412   -12.804 16.146  1.00 0.00 ? 27 GLY B CA   1  
ATOM 1403  C C    . GLY B 1 27 ? 2.522   -11.796 16.387  1.00 0.00 ? 27 GLY B C    1  
ATOM 1404  O O    . GLY B 1 27 ? 2.276   -10.701 16.892  1.00 0.00 ? 27 GLY B O    1  
ATOM 1405  H H    . GLY B 1 27 ? 0.414   -13.063 14.290  1.00 0.00 ? 27 GLY B H    1  
ATOM 1406  H HA2  . GLY B 1 27 ? 0.807   -12.877 17.037  1.00 0.00 ? 27 GLY B HA2  1  
ATOM 1407  H HA3  . GLY B 1 27 ? 1.854   -13.768 15.944  1.00 0.00 ? 27 GLY B HA3  1  
ATOM 1408  N N    . ASN B 1 28 ? 3.747   -12.161 16.020  1.00 0.00 ? 28 ASN B N    1  
ATOM 1409  C CA   . ASN B 1 28 ? 4.892   -11.272 16.194  1.00 0.00 ? 28 ASN B CA   1  
ATOM 1410  C C    . ASN B 1 28 ? 5.084   -10.409 14.952  1.00 0.00 ? 28 ASN B C    1  
ATOM 1411  O O    . ASN B 1 28 ? 5.356   -9.212  15.046  1.00 0.00 ? 28 ASN B O    1  
ATOM 1412  C CB   . ASN B 1 28 ? 6.159   -12.082 16.471  1.00 0.00 ? 28 ASN B CB   1  
ATOM 1413  C CG   . ASN B 1 28 ? 6.418   -12.261 17.954  1.00 0.00 ? 28 ASN B CG   1  
ATOM 1414  O OD1  . ASN B 1 28 ? 7.054   -11.421 18.591  1.00 0.00 ? 28 ASN B OD1  1  
ATOM 1415  N ND2  . ASN B 1 28 ? 5.926   -13.361 18.512  1.00 0.00 ? 28 ASN B ND2  1  
ATOM 1416  H H    . ASN B 1 28 ? 3.886   -13.044 15.619  1.00 0.00 ? 28 ASN B H    1  
ATOM 1417  H HA   . ASN B 1 28 ? 4.690   -10.630 17.039  1.00 0.00 ? 28 ASN B HA   1  
ATOM 1418  H HB2  . ASN B 1 28 ? 6.060   -13.059 16.022  1.00 0.00 ? 28 ASN B HB2  1  
ATOM 1419  H HB3  . ASN B 1 28 ? 7.007   -11.574 16.035  1.00 0.00 ? 28 ASN B HB3  1  
ATOM 1420  H HD21 . ASN B 1 28 ? 5.430   -13.986 17.944  1.00 0.00 ? 28 ASN B HD21 1  
ATOM 1421  H HD22 . ASN B 1 28 ? 6.078   -13.502 19.470  1.00 0.00 ? 28 ASN B HD22 1  
ATOM 1422  N N    . GLN B 1 29 ? 4.926   -11.031 13.790  1.00 0.00 ? 29 GLN B N    1  
ATOM 1423  C CA   . GLN B 1 29 ? 5.063   -10.338 12.515  1.00 0.00 ? 29 GLN B CA   1  
ATOM 1424  C C    . GLN B 1 29 ? 3.688   -10.112 11.895  1.00 0.00 ? 29 GLN B C    1  
ATOM 1425  O O    . GLN B 1 29 ? 2.843   -11.006 11.913  1.00 0.00 ? 29 GLN B O    1  
ATOM 1426  C CB   . GLN B 1 29 ? 5.948   -11.146 11.565  1.00 0.00 ? 29 GLN B CB   1  
ATOM 1427  C CG   . GLN B 1 29 ? 6.973   -10.304 10.823  1.00 0.00 ? 29 GLN B CG   1  
ATOM 1428  C CD   . GLN B 1 29 ? 8.165   -9.940  11.687  1.00 0.00 ? 29 GLN B CD   1  
ATOM 1429  O OE1  . GLN B 1 29 ? 8.308   -8.796  12.118  1.00 0.00 ? 29 GLN B OE1  1  
ATOM 1430  N NE2  . GLN B 1 29 ? 9.029   -10.915 11.943  1.00 0.00 ? 29 GLN B NE2  1  
ATOM 1431  H H    . GLN B 1 29 ? 4.699   -11.985 13.791  1.00 0.00 ? 29 GLN B H    1  
ATOM 1432  H HA   . GLN B 1 29 ? 5.525   -9.380  12.703  1.00 0.00 ? 29 GLN B HA   1  
ATOM 1433  H HB2  . GLN B 1 29 ? 6.477   -11.896 12.136  1.00 0.00 ? 29 GLN B HB2  1  
ATOM 1434  H HB3  . GLN B 1 29 ? 5.321   -11.638 10.837  1.00 0.00 ? 29 GLN B HB3  1  
ATOM 1435  H HG2  . GLN B 1 29 ? 7.325   -10.859 9.967   1.00 0.00 ? 29 GLN B HG2  1  
ATOM 1436  H HG3  . GLN B 1 29 ? 6.497   -9.393  10.489  1.00 0.00 ? 29 GLN B HG3  1  
ATOM 1437  H HE21 . GLN B 1 29 ? 8.851   -11.802 11.566  1.00 0.00 ? 29 GLN B HE21 1  
ATOM 1438  H HE22 . GLN B 1 29 ? 9.809   -10.708 12.499  1.00 0.00 ? 29 GLN B HE22 1  
ATOM 1439  N N    . VAL B 1 30 ? 3.457   -8.916  11.361  1.00 0.00 ? 30 VAL B N    1  
ATOM 1440  C CA   . VAL B 1 30 ? 2.167   -8.598  10.761  1.00 0.00 ? 30 VAL B CA   1  
ATOM 1441  C C    . VAL B 1 30 ? 2.168   -8.873  9.263   1.00 0.00 ? 30 VAL B C    1  
ATOM 1442  O O    . VAL B 1 30 ? 2.873   -8.216  8.502   1.00 0.00 ? 30 VAL B O    1  
ATOM 1443  C CB   . VAL B 1 30 ? 1.787   -7.124  10.998  1.00 0.00 ? 30 VAL B CB   1  
ATOM 1444  C CG1  . VAL B 1 30 ? 0.358   -6.863  10.548  1.00 0.00 ? 30 VAL B CG1  1  
ATOM 1445  C CG2  . VAL B 1 30 ? 1.969   -6.751  12.463  1.00 0.00 ? 30 VAL B CG2  1  
ATOM 1446  H H    . VAL B 1 30 ? 4.163   -8.233  11.378  1.00 0.00 ? 30 VAL B H    1  
ATOM 1447  H HA   . VAL B 1 30 ? 1.420   -9.219  11.230  1.00 0.00 ? 30 VAL B HA   1  
ATOM 1448  H HB   . VAL B 1 30 ? 2.444   -6.504  10.406  1.00 0.00 ? 30 VAL B HB   1  
ATOM 1449  H HG11 . VAL B 1 30 ? 0.357   -6.542  9.518   1.00 0.00 ? 30 VAL B HG11 1  
ATOM 1450  H HG12 . VAL B 1 30 ? -0.078  -6.092  11.166  1.00 0.00 ? 30 VAL B HG12 1  
ATOM 1451  H HG13 . VAL B 1 30 ? -0.221  -7.770  10.643  1.00 0.00 ? 30 VAL B HG13 1  
ATOM 1452  H HG21 . VAL B 1 30 ? 2.497   -5.811  12.531  1.00 0.00 ? 30 VAL B HG21 1  
ATOM 1453  H HG22 . VAL B 1 30 ? 2.539   -7.519  12.964  1.00 0.00 ? 30 VAL B HG22 1  
ATOM 1454  H HG23 . VAL B 1 30 ? 1.002   -6.655  12.934  1.00 0.00 ? 30 VAL B HG23 1  
ATOM 1455  N N    . ARG B 1 31 ? 1.365   -9.847  8.848   1.00 0.00 ? 31 ARG B N    1  
ATOM 1456  C CA   . ARG B 1 31 ? 1.266   -10.208 7.448   1.00 0.00 ? 31 ARG B CA   1  
ATOM 1457  C C    . ARG B 1 31 ? 0.438   -9.181  6.686   1.00 0.00 ? 31 ARG B C    1  
ATOM 1458  O O    . ARG B 1 31 ? -0.791  -9.189  6.750   1.00 0.00 ? 31 ARG B O    1  
ATOM 1459  C CB   . ARG B 1 31 ? 0.646   -11.599 7.299   1.00 0.00 ? 31 ARG B CB   1  
ATOM 1460  C CG   . ARG B 1 31 ? 1.339   -12.464 6.259   1.00 0.00 ? 31 ARG B CG   1  
ATOM 1461  C CD   . ARG B 1 31 ? 2.529   -13.202 6.851   1.00 0.00 ? 31 ARG B CD   1  
ATOM 1462  N NE   . ARG B 1 31 ? 2.993   -14.281 5.982   1.00 0.00 ? 31 ARG B NE   1  
ATOM 1463  C CZ   . ARG B 1 31 ? 2.410   -15.475 5.907   1.00 0.00 ? 31 ARG B CZ   1  
ATOM 1464  N NH1  . ARG B 1 31 ? 1.341   -15.748 6.645   1.00 0.00 ? 31 ARG B NH1  1  
ATOM 1465  N NH2  . ARG B 1 31 ? 2.896   -16.400 5.091   1.00 0.00 ? 31 ARG B NH2  1  
ATOM 1466  H H    . ARG B 1 31 ? 0.822   -10.329 9.493   1.00 0.00 ? 31 ARG B H    1  
ATOM 1467  H HA   . ARG B 1 31 ? 2.260   -10.223 7.051   1.00 0.00 ? 31 ARG B HA   1  
ATOM 1468  H HB2  . ARG B 1 31 ? 0.697   -12.108 8.250   1.00 0.00 ? 31 ARG B HB2  1  
ATOM 1469  H HB3  . ARG B 1 31 ? -0.390  -11.492 7.014   1.00 0.00 ? 31 ARG B HB3  1  
ATOM 1470  H HG2  . ARG B 1 31 ? 0.634   -13.187 5.877   1.00 0.00 ? 31 ARG B HG2  1  
ATOM 1471  H HG3  . ARG B 1 31 ? 1.684   -11.833 5.452   1.00 0.00 ? 31 ARG B HG3  1  
ATOM 1472  H HD2  . ARG B 1 31 ? 3.336   -12.499 6.997   1.00 0.00 ? 31 ARG B HD2  1  
ATOM 1473  H HD3  . ARG B 1 31 ? 2.240   -13.619 7.804   1.00 0.00 ? 31 ARG B HD3  1  
ATOM 1474  H HE   . ARG B 1 31 ? 3.780   -14.107 5.425   1.00 0.00 ? 31 ARG B HE   1  
ATOM 1475  H HH11 . ARG B 1 31 ? 0.968   -15.055 7.262   1.00 0.00 ? 31 ARG B HH11 1  
ATOM 1476  H HH12 . ARG B 1 31 ? 0.908   -16.647 6.584   1.00 0.00 ? 31 ARG B HH12 1  
ATOM 1477  H HH21 . ARG B 1 31 ? 3.701   -16.201 4.532   1.00 0.00 ? 31 ARG B HH21 1  
ATOM 1478  H HH22 . ARG B 1 31 ? 2.459   -17.298 5.035   1.00 0.00 ? 31 ARG B HH22 1  
ATOM 1479  N N    . ILE B 1 32 ? 1.118   -8.285  5.981   1.00 0.00 ? 32 ILE B N    1  
ATOM 1480  C CA   . ILE B 1 32 ? 0.441   -7.240  5.226   1.00 0.00 ? 32 ILE B CA   1  
ATOM 1481  C C    . ILE B 1 32 ? 0.073   -7.730  3.830   1.00 0.00 ? 32 ILE B C    1  
ATOM 1482  O O    . ILE B 1 32 ? 0.897   -8.320  3.132   1.00 0.00 ? 32 ILE B O    1  
ATOM 1483  C CB   . ILE B 1 32 ? 1.326   -5.981  5.119   1.00 0.00 ? 32 ILE B CB   1  
ATOM 1484  C CG1  . ILE B 1 32 ? 1.960   -5.668  6.482   1.00 0.00 ? 32 ILE B CG1  1  
ATOM 1485  C CG2  . ILE B 1 32 ? 0.511   -4.798  4.615   1.00 0.00 ? 32 ILE B CG2  1  
ATOM 1486  C CD1  . ILE B 1 32 ? 0.964   -5.189  7.517   1.00 0.00 ? 32 ILE B CD1  1  
ATOM 1487  H H    . ILE B 1 32 ? 2.101   -8.314  5.985   1.00 0.00 ? 32 ILE B H    1  
ATOM 1488  H HA   . ILE B 1 32 ? -0.463  -6.976  5.755   1.00 0.00 ? 32 ILE B HA   1  
ATOM 1489  H HB   . ILE B 1 32 ? 2.109   -6.178  4.403   1.00 0.00 ? 32 ILE B HB   1  
ATOM 1490  H HG12 . ILE B 1 32 ? 2.430   -6.562  6.867   1.00 0.00 ? 32 ILE B HG12 1  
ATOM 1491  H HG13 . ILE B 1 32 ? 2.709   -4.899  6.361   1.00 0.00 ? 32 ILE B HG13 1  
ATOM 1492  H HG21 . ILE B 1 32 ? 0.809   -3.904  5.143   1.00 0.00 ? 32 ILE B HG21 1  
ATOM 1493  H HG22 . ILE B 1 32 ? -0.539  -4.985  4.787   1.00 0.00 ? 32 ILE B HG22 1  
ATOM 1494  H HG23 . ILE B 1 32 ? 0.685   -4.666  3.557   1.00 0.00 ? 32 ILE B HG23 1  
ATOM 1495  H HD11 . ILE B 1 32 ? 0.175   -5.919  7.623   1.00 0.00 ? 32 ILE B HD11 1  
ATOM 1496  H HD12 . ILE B 1 32 ? 0.542   -4.246  7.202   1.00 0.00 ? 32 ILE B HD12 1  
ATOM 1497  H HD13 . ILE B 1 32 ? 1.465   -5.060  8.466   1.00 0.00 ? 32 ILE B HD13 1  
ATOM 1498  N N    . GLY B 1 33 ? -1.178  -7.497  3.435   1.00 0.00 ? 33 GLY B N    1  
ATOM 1499  C CA   . GLY B 1 33 ? -1.638  -7.938  2.131   1.00 0.00 ? 33 GLY B CA   1  
ATOM 1500  C C    . GLY B 1 33 ? -1.821  -6.800  1.150   1.00 0.00 ? 33 GLY B C    1  
ATOM 1501  O O    . GLY B 1 33 ? -2.604  -5.881  1.392   1.00 0.00 ? 33 GLY B O    1  
ATOM 1502  H H    . GLY B 1 33 ? -1.797  -7.029  4.034   1.00 0.00 ? 33 GLY B H    1  
ATOM 1503  H HA2  . GLY B 1 33 ? -0.921  -8.630  1.726   1.00 0.00 ? 33 GLY B HA2  1  
ATOM 1504  H HA3  . GLY B 1 33 ? -2.583  -8.447  2.251   1.00 0.00 ? 33 GLY B HA3  1  
ATOM 1505  N N    . VAL B 1 34 ? -1.098  -6.864  0.037   1.00 0.00 ? 34 VAL B N    1  
ATOM 1506  C CA   . VAL B 1 34 ? -1.185  -5.835  -0.989  1.00 0.00 ? 34 VAL B CA   1  
ATOM 1507  C C    . VAL B 1 34 ? -1.686  -6.413  -2.309  1.00 0.00 ? 34 VAL B C    1  
ATOM 1508  O O    . VAL B 1 34 ? -0.941  -7.075  -3.033  1.00 0.00 ? 34 VAL B O    1  
ATOM 1509  C CB   . VAL B 1 34 ? 0.181   -5.162  -1.225  1.00 0.00 ? 34 VAL B CB   1  
ATOM 1510  C CG1  . VAL B 1 34 ? 0.027   -3.934  -2.109  1.00 0.00 ? 34 VAL B CG1  1  
ATOM 1511  C CG2  . VAL B 1 34 ? 0.833   -4.797  0.100   1.00 0.00 ? 34 VAL B CG2  1  
ATOM 1512  H H    . VAL B 1 34 ? -0.492  -7.622  -0.099  1.00 0.00 ? 34 VAL B H    1  
ATOM 1513  H HA   . VAL B 1 34 ? -1.880  -5.082  -0.648  1.00 0.00 ? 34 VAL B HA   1  
ATOM 1514  H HB   . VAL B 1 34 ? 0.822   -5.866  -1.735  1.00 0.00 ? 34 VAL B HB   1  
ATOM 1515  H HG11 . VAL B 1 34 ? -0.926  -3.972  -2.617  1.00 0.00 ? 34 VAL B HG11 1  
ATOM 1516  H HG12 . VAL B 1 34 ? 0.823   -3.913  -2.839  1.00 0.00 ? 34 VAL B HG12 1  
ATOM 1517  H HG13 . VAL B 1 34 ? 0.074   -3.043  -1.501  1.00 0.00 ? 34 VAL B HG13 1  
ATOM 1518  H HG21 . VAL B 1 34 ? 0.758   -5.633  0.779   1.00 0.00 ? 34 VAL B HG21 1  
ATOM 1519  H HG22 . VAL B 1 34 ? 0.330   -3.941  0.525   1.00 0.00 ? 34 VAL B HG22 1  
ATOM 1520  H HG23 . VAL B 1 34 ? 1.873   -4.559  -0.064  1.00 0.00 ? 34 VAL B HG23 1  
ATOM 1521  N N    . ASN B 1 35 ? -2.953  -6.154  -2.616  1.00 0.00 ? 35 ASN B N    1  
ATOM 1522  C CA   . ASN B 1 35 ? -3.548  -6.644  -3.854  1.00 0.00 ? 35 ASN B CA   1  
ATOM 1523  C C    . ASN B 1 35 ? -3.568  -5.540  -4.907  1.00 0.00 ? 35 ASN B C    1  
ATOM 1524  O O    . ASN B 1 35 ? -4.342  -4.589  -4.814  1.00 0.00 ? 35 ASN B O    1  
ATOM 1525  C CB   . ASN B 1 35 ? -4.966  -7.164  -3.605  1.00 0.00 ? 35 ASN B CB   1  
ATOM 1526  C CG   . ASN B 1 35 ? -5.240  -8.466  -4.332  1.00 0.00 ? 35 ASN B CG   1  
ATOM 1527  O OD1  . ASN B 1 35 ? -4.422  -8.933  -5.124  1.00 0.00 ? 35 ASN B OD1  1  
ATOM 1528  N ND2  . ASN B 1 35 ? -6.398  -9.060  -4.065  1.00 0.00 ? 35 ASN B ND2  1  
ATOM 1529  H H    . ASN B 1 35 ? -3.492  -5.624  -1.994  1.00 0.00 ? 35 ASN B H    1  
ATOM 1530  H HA   . ASN B 1 35 ? -2.934  -7.456  -4.216  1.00 0.00 ? 35 ASN B HA   1  
ATOM 1531  H HB2  . ASN B 1 35 ? -5.101  -7.330  -2.547  1.00 0.00 ? 35 ASN B HB2  1  
ATOM 1532  H HB3  . ASN B 1 35 ? -5.679  -6.428  -3.944  1.00 0.00 ? 35 ASN B HB3  1  
ATOM 1533  H HD21 . ASN B 1 35 ? -7.002  -8.630  -3.424  1.00 0.00 ? 35 ASN B HD21 1  
ATOM 1534  H HD22 . ASN B 1 35 ? -6.603  -9.902  -4.521  1.00 0.00 ? 35 ASN B HD22 1  
ATOM 1535  N N    . ALA B 1 36 ? -2.703  -5.675  -5.903  1.00 0.00 ? 36 ALA B N    1  
ATOM 1536  C CA   . ALA B 1 36 ? -2.612  -4.688  -6.972  1.00 0.00 ? 36 ALA B CA   1  
ATOM 1537  C C    . ALA B 1 36 ? -2.344  -5.345  -8.324  1.00 0.00 ? 36 ALA B C    1  
ATOM 1538  O O    . ALA B 1 36 ? -1.619  -6.335  -8.411  1.00 0.00 ? 36 ALA B O    1  
ATOM 1539  C CB   . ALA B 1 36 ? -1.525  -3.672  -6.656  1.00 0.00 ? 36 ALA B CB   1  
ATOM 1540  H H    . ALA B 1 36 ? -2.112  -6.455  -5.906  1.00 0.00 ? 36 ALA B H    1  
ATOM 1541  H HA   . ALA B 1 36 ? -3.555  -4.164  -7.018  1.00 0.00 ? 36 ALA B HA   1  
ATOM 1542  H HB1  . ALA B 1 36 ? -1.849  -2.689  -6.965  1.00 0.00 ? 36 ALA B HB1  1  
ATOM 1543  H HB2  . ALA B 1 36 ? -0.621  -3.935  -7.185  1.00 0.00 ? 36 ALA B HB2  1  
ATOM 1544  H HB3  . ALA B 1 36 ? -1.332  -3.669  -5.593  1.00 0.00 ? 36 ALA B HB3  1  
ATOM 1545  N N    . PRO B 1 37 ? -2.929  -4.792  -9.403  1.00 0.00 ? 37 PRO B N    1  
ATOM 1546  C CA   . PRO B 1 37 ? -2.751  -5.317  -10.757 1.00 0.00 ? 37 PRO B CA   1  
ATOM 1547  C C    . PRO B 1 37 ? -1.433  -4.870  -11.378 1.00 0.00 ? 37 PRO B C    1  
ATOM 1548  O O    . PRO B 1 37 ? -0.867  -3.849  -10.986 1.00 0.00 ? 37 PRO B O    1  
ATOM 1549  C CB   . PRO B 1 37 ? -3.929  -4.710  -11.513 1.00 0.00 ? 37 PRO B CB   1  
ATOM 1550  C CG   . PRO B 1 37 ? -4.162  -3.401  -10.840 1.00 0.00 ? 37 PRO B CG   1  
ATOM 1551  C CD   . PRO B 1 37 ? -3.807  -3.604  -9.388  1.00 0.00 ? 37 PRO B CD   1  
ATOM 1552  H HA   . PRO B 1 37 ? -2.817  -6.395  -10.780 1.00 0.00 ? 37 PRO B HA   1  
ATOM 1553  H HB2  . PRO B 1 37 ? -3.667  -4.582  -12.553 1.00 0.00 ? 37 PRO B HB2  1  
ATOM 1554  H HB3  . PRO B 1 37 ? -4.790  -5.356  -11.427 1.00 0.00 ? 37 PRO B HB3  1  
ATOM 1555  H HG2  . PRO B 1 37 ? -3.526  -2.646  -11.279 1.00 0.00 ? 37 PRO B HG2  1  
ATOM 1556  H HG3  . PRO B 1 37 ? -5.199  -3.119  -10.936 1.00 0.00 ? 37 PRO B HG3  1  
ATOM 1557  H HD2  . PRO B 1 37 ? -3.281  -2.742  -9.005  1.00 0.00 ? 37 PRO B HD2  1  
ATOM 1558  H HD3  . PRO B 1 37 ? -4.698  -3.792  -8.807  1.00 0.00 ? 37 PRO B HD3  1  
ATOM 1559  N N    . LYS B 1 38 ? -0.948  -5.636  -12.348 1.00 0.00 ? 38 LYS B N    1  
ATOM 1560  C CA   . LYS B 1 38 ? 0.305   -5.312  -13.020 1.00 0.00 ? 38 LYS B CA   1  
ATOM 1561  C C    . LYS B 1 38 ? 0.057   -4.490  -14.283 1.00 0.00 ? 38 LYS B C    1  
ATOM 1562  O O    . LYS B 1 38 ? 0.771   -4.633  -15.275 1.00 0.00 ? 38 LYS B O    1  
ATOM 1563  C CB   . LYS B 1 38 ? 1.062   -6.594  -13.374 1.00 0.00 ? 38 LYS B CB   1  
ATOM 1564  C CG   . LYS B 1 38 ? 1.272   -7.523  -12.189 1.00 0.00 ? 38 LYS B CG   1  
ATOM 1565  C CD   . LYS B 1 38 ? 1.136   -8.981  -12.594 1.00 0.00 ? 38 LYS B CD   1  
ATOM 1566  C CE   . LYS B 1 38 ? 1.165   -9.900  -11.384 1.00 0.00 ? 38 LYS B CE   1  
ATOM 1567  N NZ   . LYS B 1 38 ? 2.453   -9.803  -10.642 1.00 0.00 ? 38 LYS B NZ   1  
ATOM 1568  H H    . LYS B 1 38 ? -1.444  -6.437  -12.619 1.00 0.00 ? 38 LYS B H    1  
ATOM 1569  H HA   . LYS B 1 38 ? 0.904   -4.729  -12.338 1.00 0.00 ? 38 LYS B HA   1  
ATOM 1570  H HB2  . LYS B 1 38 ? 0.508   -7.129  -14.130 1.00 0.00 ? 38 LYS B HB2  1  
ATOM 1571  H HB3  . LYS B 1 38 ? 2.031   -6.327  -13.771 1.00 0.00 ? 38 LYS B HB3  1  
ATOM 1572  H HG2  . LYS B 1 38 ? 2.262   -7.361  -11.788 1.00 0.00 ? 38 LYS B HG2  1  
ATOM 1573  H HG3  . LYS B 1 38 ? 0.534   -7.298  -11.433 1.00 0.00 ? 38 LYS B HG3  1  
ATOM 1574  H HD2  . LYS B 1 38 ? 0.199   -9.115  -13.113 1.00 0.00 ? 38 LYS B HD2  1  
ATOM 1575  H HD3  . LYS B 1 38 ? 1.954   -9.240  -13.251 1.00 0.00 ? 38 LYS B HD3  1  
ATOM 1576  H HE2  . LYS B 1 38 ? 0.357   -9.627  -10.721 1.00 0.00 ? 38 LYS B HE2  1  
ATOM 1577  H HE3  . LYS B 1 38 ? 1.027   -10.918 -11.717 1.00 0.00 ? 38 LYS B HE3  1  
ATOM 1578  H HZ1  . LYS B 1 38 ? 3.214   -9.506  -11.286 1.00 0.00 ? 38 LYS B HZ1  1  
ATOM 1579  H HZ2  . LYS B 1 38 ? 2.701   -10.726 -10.234 1.00 0.00 ? 38 LYS B HZ2  1  
ATOM 1580  H HZ3  . LYS B 1 38 ? 2.371   -9.107  -9.874  1.00 0.00 ? 38 LYS B HZ3  1  
ATOM 1581  N N    . GLU B 1 39 ? -0.957  -3.629  -14.241 1.00 0.00 ? 39 GLU B N    1  
ATOM 1582  C CA   . GLU B 1 39 ? -1.292  -2.788  -15.384 1.00 0.00 ? 39 GLU B CA   1  
ATOM 1583  C C    . GLU B 1 39 ? -0.747  -1.375  -15.198 1.00 0.00 ? 39 GLU B C    1  
ATOM 1584  O O    . GLU B 1 39 ? -0.180  -0.792  -16.123 1.00 0.00 ? 39 GLU B O    1  
ATOM 1585  C CB   . GLU B 1 39 ? -2.808  -2.740  -15.581 1.00 0.00 ? 39 GLU B CB   1  
ATOM 1586  C CG   . GLU B 1 39 ? -3.227  -2.486  -17.020 1.00 0.00 ? 39 GLU B CG   1  
ATOM 1587  C CD   . GLU B 1 39 ? -4.426  -3.317  -17.433 1.00 0.00 ? 39 GLU B CD   1  
ATOM 1588  O OE1  . GLU B 1 39 ? -4.312  -4.561  -17.439 1.00 0.00 ? 39 GLU B OE1  1  
ATOM 1589  O OE2  . GLU B 1 39 ? -5.479  -2.724  -17.749 1.00 0.00 ? 39 GLU B OE2  1  
ATOM 1590  H H    . GLU B 1 39 ? -1.494  -3.556  -13.426 1.00 0.00 ? 39 GLU B H    1  
ATOM 1591  H HA   . GLU B 1 39 ? -0.838  -3.224  -16.261 1.00 0.00 ? 39 GLU B HA   1  
ATOM 1592  H HB2  . GLU B 1 39 ? -3.231  -3.683  -15.268 1.00 0.00 ? 39 GLU B HB2  1  
ATOM 1593  H HB3  . GLU B 1 39 ? -3.215  -1.951  -14.966 1.00 0.00 ? 39 GLU B HB3  1  
ATOM 1594  H HG2  . GLU B 1 39 ? -3.478  -1.441  -17.129 1.00 0.00 ? 39 GLU B HG2  1  
ATOM 1595  H HG3  . GLU B 1 39 ? -2.399  -2.726  -17.670 1.00 0.00 ? 39 GLU B HG3  1  
ATOM 1596  N N    . VAL B 1 40 ? -0.918  -0.831  -13.997 1.00 0.00 ? 40 VAL B N    1  
ATOM 1597  C CA   . VAL B 1 40 ? -0.437  0.511   -13.692 1.00 0.00 ? 40 VAL B CA   1  
ATOM 1598  C C    . VAL B 1 40 ? 0.996   0.468   -13.173 1.00 0.00 ? 40 VAL B C    1  
ATOM 1599  O O    . VAL B 1 40 ? 1.457   -0.563  -12.685 1.00 0.00 ? 40 VAL B O    1  
ATOM 1600  C CB   . VAL B 1 40 ? -1.335  1.212   -12.652 1.00 0.00 ? 40 VAL B CB   1  
ATOM 1601  C CG1  . VAL B 1 40 ? -0.918  2.664   -12.478 1.00 0.00 ? 40 VAL B CG1  1  
ATOM 1602  C CG2  . VAL B 1 40 ? -2.798  1.116   -13.059 1.00 0.00 ? 40 VAL B CG2  1  
ATOM 1603  H H    . VAL B 1 40 ? -1.374  -1.346  -13.299 1.00 0.00 ? 40 VAL B H    1  
ATOM 1604  H HA   . VAL B 1 40 ? -0.461  1.089   -14.605 1.00 0.00 ? 40 VAL B HA   1  
ATOM 1605  H HB   . VAL B 1 40 ? -1.215  0.712   -11.702 1.00 0.00 ? 40 VAL B HB   1  
ATOM 1606  H HG11 . VAL B 1 40 ? -0.064  2.718   -11.820 1.00 0.00 ? 40 VAL B HG11 1  
ATOM 1607  H HG12 . VAL B 1 40 ? -1.737  3.225   -12.052 1.00 0.00 ? 40 VAL B HG12 1  
ATOM 1608  H HG13 . VAL B 1 40 ? -0.658  3.082   -13.440 1.00 0.00 ? 40 VAL B HG13 1  
ATOM 1609  H HG21 . VAL B 1 40 ? -3.195  0.160   -12.750 1.00 0.00 ? 40 VAL B HG21 1  
ATOM 1610  H HG22 . VAL B 1 40 ? -2.879  1.210   -14.132 1.00 0.00 ? 40 VAL B HG22 1  
ATOM 1611  H HG23 . VAL B 1 40 ? -3.357  1.909   -12.585 1.00 0.00 ? 40 VAL B HG23 1  
ATOM 1612  N N    . SER B 1 41 ? 1.699   1.591   -13.283 1.00 0.00 ? 41 SER B N    1  
ATOM 1613  C CA   . SER B 1 41 ? 3.082   1.671   -12.825 1.00 0.00 ? 41 SER B CA   1  
ATOM 1614  C C    . SER B 1 41 ? 3.177   1.364   -11.335 1.00 0.00 ? 41 SER B C    1  
ATOM 1615  O O    . SER B 1 41 ? 2.947   2.236   -10.497 1.00 0.00 ? 41 SER B O    1  
ATOM 1616  C CB   . SER B 1 41 ? 3.657   3.059   -13.111 1.00 0.00 ? 41 SER B CB   1  
ATOM 1617  O OG   . SER B 1 41 ? 5.052   2.994   -13.349 1.00 0.00 ? 41 SER B OG   1  
ATOM 1618  H H    . SER B 1 41 ? 1.281   2.383   -13.681 1.00 0.00 ? 41 SER B H    1  
ATOM 1619  H HA   . SER B 1 41 ? 3.654   0.934   -13.369 1.00 0.00 ? 41 SER B HA   1  
ATOM 1620  H HB2  . SER B 1 41 ? 3.175   3.473   -13.984 1.00 0.00 ? 41 SER B HB2  1  
ATOM 1621  H HB3  . SER B 1 41 ? 3.478   3.702   -12.262 1.00 0.00 ? 41 SER B HB3  1  
ATOM 1622  H HG   . SER B 1 41 ? 5.506   2.759   -12.536 1.00 0.00 ? 41 SER B HG   1  
ATOM 1623  N N    . VAL B 1 42 ? 3.522   0.122   -11.010 1.00 0.00 ? 42 VAL B N    1  
ATOM 1624  C CA   . VAL B 1 42 ? 3.651   -0.296  -9.621  1.00 0.00 ? 42 VAL B CA   1  
ATOM 1625  C C    . VAL B 1 42 ? 5.051   -0.842  -9.336  1.00 0.00 ? 42 VAL B C    1  
ATOM 1626  O O    . VAL B 1 42 ? 5.484   -1.812  -9.957  1.00 0.00 ? 42 VAL B O    1  
ATOM 1627  C CB   . VAL B 1 42 ? 2.606   -1.371  -9.260  1.00 0.00 ? 42 VAL B CB   1  
ATOM 1628  C CG1  . VAL B 1 42 ? 2.803   -2.619  -10.107 1.00 0.00 ? 42 VAL B CG1  1  
ATOM 1629  C CG2  . VAL B 1 42 ? 2.673   -1.707  -7.777  1.00 0.00 ? 42 VAL B CG2  1  
ATOM 1630  H H    . VAL B 1 42 ? 3.701   -0.530  -11.720 1.00 0.00 ? 42 VAL B H    1  
ATOM 1631  H HA   . VAL B 1 42 ? 3.476   0.568   -8.997  1.00 0.00 ? 42 VAL B HA   1  
ATOM 1632  H HB   . VAL B 1 42 ? 1.624   -0.973  -9.471  1.00 0.00 ? 42 VAL B HB   1  
ATOM 1633  H HG11 . VAL B 1 42 ? 3.680   -3.150  -9.768  1.00 0.00 ? 42 VAL B HG11 1  
ATOM 1634  H HG12 . VAL B 1 42 ? 2.932   -2.335  -11.142 1.00 0.00 ? 42 VAL B HG12 1  
ATOM 1635  H HG13 . VAL B 1 42 ? 1.937   -3.258  -10.014 1.00 0.00 ? 42 VAL B HG13 1  
ATOM 1636  H HG21 . VAL B 1 42 ? 1.721   -2.101  -7.454  1.00 0.00 ? 42 VAL B HG21 1  
ATOM 1637  H HG22 . VAL B 1 42 ? 2.902   -0.814  -7.215  1.00 0.00 ? 42 VAL B HG22 1  
ATOM 1638  H HG23 . VAL B 1 42 ? 3.443   -2.446  -7.610  1.00 0.00 ? 42 VAL B HG23 1  
ATOM 1639  N N    . HIS B 1 43 ? 5.751   -0.220  -8.391  1.00 0.00 ? 43 HIS B N    1  
ATOM 1640  C CA   . HIS B 1 43 ? 7.094   -0.652  -8.024  1.00 0.00 ? 43 HIS B CA   1  
ATOM 1641  C C    . HIS B 1 43 ? 7.143   -1.027  -6.547  1.00 0.00 ? 43 HIS B C    1  
ATOM 1642  O O    . HIS B 1 43 ? 6.595   -0.319  -5.702  1.00 0.00 ? 43 HIS B O    1  
ATOM 1643  C CB   . HIS B 1 43 ? 8.109   0.455   -8.318  1.00 0.00 ? 43 HIS B CB   1  
ATOM 1644  C CG   . HIS B 1 43 ? 9.408   -0.054  -8.863  1.00 0.00 ? 43 HIS B CG   1  
ATOM 1645  N ND1  . HIS B 1 43 ? 10.302  0.743   -9.545  1.00 0.00 ? 43 HIS B ND1  1  
ATOM 1646  C CD2  . HIS B 1 43 ? 9.963   -1.289  -8.824  1.00 0.00 ? 43 HIS B CD2  1  
ATOM 1647  C CE1  . HIS B 1 43 ? 11.350  0.023   -9.903  1.00 0.00 ? 43 HIS B CE1  1  
ATOM 1648  N NE2  . HIS B 1 43 ? 11.170  -1.213  -9.477  1.00 0.00 ? 43 HIS B NE2  1  
ATOM 1649  H H    . HIS B 1 43 ? 5.356   0.545   -7.924  1.00 0.00 ? 43 HIS B H    1  
ATOM 1650  H HA   . HIS B 1 43 ? 7.338   -1.522  -8.614  1.00 0.00 ? 43 HIS B HA   1  
ATOM 1651  H HB2  . HIS B 1 43 ? 7.689   1.136   -9.043  1.00 0.00 ? 43 HIS B HB2  1  
ATOM 1652  H HB3  . HIS B 1 43 ? 8.319   0.993   -7.405  1.00 0.00 ? 43 HIS B HB3  1  
ATOM 1653  H HD2  . HIS B 1 43 ? 9.537   -2.169  -8.364  1.00 0.00 ? 43 HIS B HD2  1  
ATOM 1654  H HE1  . HIS B 1 43 ? 12.209  0.385   -10.450 1.00 0.00 ? 43 HIS B HE1  1  
ATOM 1655  H HE2  . HIS B 1 43 ? 11.834  -1.931  -9.529  1.00 0.00 ? 43 HIS B HE2  1  
ATOM 1656  N N    . ARG B 1 44 ? 7.799   -2.141  -6.238  1.00 0.00 ? 44 ARG B N    1  
ATOM 1657  C CA   . ARG B 1 44 ? 7.912   -2.602  -4.859  1.00 0.00 ? 44 ARG B CA   1  
ATOM 1658  C C    . ARG B 1 44 ? 9.251   -3.299  -4.636  1.00 0.00 ? 44 ARG B C    1  
ATOM 1659  O O    . ARG B 1 44 ? 10.088  -3.354  -5.536  1.00 0.00 ? 44 ARG B O    1  
ATOM 1660  C CB   . ARG B 1 44 ? 6.766   -3.560  -4.525  1.00 0.00 ? 44 ARG B CB   1  
ATOM 1661  C CG   . ARG B 1 44 ? 5.464   -2.856  -4.177  1.00 0.00 ? 44 ARG B CG   1  
ATOM 1662  C CD   . ARG B 1 44 ? 4.283   -3.470  -4.913  1.00 0.00 ? 44 ARG B CD   1  
ATOM 1663  N NE   . ARG B 1 44 ? 3.677   -4.564  -4.158  1.00 0.00 ? 44 ARG B NE   1  
ATOM 1664  C CZ   . ARG B 1 44 ? 2.513   -5.127  -4.474  1.00 0.00 ? 44 ARG B CZ   1  
ATOM 1665  N NH1  . ARG B 1 44 ? 1.826   -4.703  -5.527  1.00 0.00 ? 44 ARG B NH1  1  
ATOM 1666  N NH2  . ARG B 1 44 ? 2.033   -6.118  -3.734  1.00 0.00 ? 44 ARG B NH2  1  
ATOM 1667  H H    . ARG B 1 44 ? 8.223   -2.668  -6.946  1.00 0.00 ? 44 ARG B H    1  
ATOM 1668  H HA   . ARG B 1 44 ? 7.853   -1.740  -4.212  1.00 0.00 ? 44 ARG B HA   1  
ATOM 1669  H HB2  . ARG B 1 44 ? 6.589   -4.200  -5.377  1.00 0.00 ? 44 ARG B HB2  1  
ATOM 1670  H HB3  . ARG B 1 44 ? 7.056   -4.170  -3.683  1.00 0.00 ? 44 ARG B HB3  1  
ATOM 1671  H HG2  . ARG B 1 44 ? 5.294   -2.939  -3.114  1.00 0.00 ? 44 ARG B HG2  1  
ATOM 1672  H HG3  . ARG B 1 44 ? 5.545   -1.815  -4.450  1.00 0.00 ? 44 ARG B HG3  1  
ATOM 1673  H HD2  . ARG B 1 44 ? 3.539   -2.703  -5.076  1.00 0.00 ? 44 ARG B HD2  1  
ATOM 1674  H HD3  . ARG B 1 44 ? 4.624   -3.847  -5.865  1.00 0.00 ? 44 ARG B HD3  1  
ATOM 1675  H HE   . ARG B 1 44 ? 4.163   -4.897  -3.375  1.00 0.00 ? 44 ARG B HE   1  
ATOM 1676  H HH11 . ARG B 1 44 ? 2.182   -3.956  -6.090  1.00 0.00 ? 44 ARG B HH11 1  
ATOM 1677  H HH12 . ARG B 1 44 ? 0.952   -5.130  -5.760  1.00 0.00 ? 44 ARG B HH12 1  
ATOM 1678  H HH21 . ARG B 1 44 ? 2.547   -6.442  -2.939  1.00 0.00 ? 44 ARG B HH21 1  
ATOM 1679  H HH22 . ARG B 1 44 ? 1.159   -6.541  -3.971  1.00 0.00 ? 44 ARG B HH22 1  
ATOM 1680  N N    . GLU B 1 45 ? 9.446   -3.834  -3.435  1.00 0.00 ? 45 GLU B N    1  
ATOM 1681  C CA   . GLU B 1 45 ? 10.684  -4.531  -3.105  1.00 0.00 ? 45 GLU B CA   1  
ATOM 1682  C C    . GLU B 1 45 ? 10.911  -5.704  -4.053  1.00 0.00 ? 45 GLU B C    1  
ATOM 1683  O O    . GLU B 1 45 ? 9.997   -6.483  -4.324  1.00 0.00 ? 45 GLU B O    1  
ATOM 1684  C CB   . GLU B 1 45 ? 10.648  -5.026  -1.658  1.00 0.00 ? 45 GLU B CB   1  
ATOM 1685  C CG   . GLU B 1 45 ? 11.975  -4.875  -0.930  1.00 0.00 ? 45 GLU B CG   1  
ATOM 1686  C CD   . GLU B 1 45 ? 11.811  -4.332  0.476   1.00 0.00 ? 45 GLU B CD   1  
ATOM 1687  O OE1  . GLU B 1 45 ? 11.433  -5.113  1.374   1.00 0.00 ? 45 GLU B OE1  1  
ATOM 1688  O OE2  . GLU B 1 45 ? 12.060  -3.125  0.679   1.00 0.00 ? 45 GLU B OE2  1  
ATOM 1689  H H    . GLU B 1 45 ? 8.741   -3.763  -2.758  1.00 0.00 ? 45 GLU B H    1  
ATOM 1690  H HA   . GLU B 1 45 ? 11.498  -3.830  -3.217  1.00 0.00 ? 45 GLU B HA   1  
ATOM 1691  H HB2  . GLU B 1 45 ? 9.899   -4.467  -1.116  1.00 0.00 ? 45 GLU B HB2  1  
ATOM 1692  H HB3  . GLU B 1 45 ? 10.377  -6.072  -1.653  1.00 0.00 ? 45 GLU B HB3  1  
ATOM 1693  H HG2  . GLU B 1 45 ? 12.451  -5.842  -0.872  1.00 0.00 ? 45 GLU B HG2  1  
ATOM 1694  H HG3  . GLU B 1 45 ? 12.603  -4.199  -1.491  1.00 0.00 ? 45 GLU B HG3  1  
ATOM 1695  N N    . GLU B 1 46 ? 12.134  -5.821  -4.561  1.00 0.00 ? 46 GLU B N    1  
ATOM 1696  C CA   . GLU B 1 46 ? 12.481  -6.895  -5.485  1.00 0.00 ? 46 GLU B CA   1  
ATOM 1697  C C    . GLU B 1 46 ? 12.087  -8.258  -4.922  1.00 0.00 ? 46 GLU B C    1  
ATOM 1698  O O    . GLU B 1 46 ? 11.289  -8.978  -5.520  1.00 0.00 ? 46 GLU B O    1  
ATOM 1699  C CB   . GLU B 1 46 ? 13.981  -6.869  -5.788  1.00 0.00 ? 46 GLU B CB   1  
ATOM 1700  C CG   . GLU B 1 46 ? 14.327  -6.155  -7.084  1.00 0.00 ? 46 GLU B CG   1  
ATOM 1701  C CD   . GLU B 1 46 ? 15.597  -6.685  -7.721  1.00 0.00 ? 46 GLU B CD   1  
ATOM 1702  O OE1  . GLU B 1 46 ? 16.535  -7.035  -6.973  1.00 0.00 ? 46 GLU B OE1  1  
ATOM 1703  O OE2  . GLU B 1 46 ? 15.654  -6.751  -8.967  1.00 0.00 ? 46 GLU B OE2  1  
ATOM 1704  H H    . GLU B 1 46 ? 12.821  -5.166  -4.313  1.00 0.00 ? 46 GLU B H    1  
ATOM 1705  H HA   . GLU B 1 46 ? 11.937  -6.729  -6.403  1.00 0.00 ? 46 GLU B HA   1  
ATOM 1706  H HB2  . GLU B 1 46 ? 14.491  -6.367  -4.978  1.00 0.00 ? 46 GLU B HB2  1  
ATOM 1707  H HB3  . GLU B 1 46 ? 14.342  -7.885  -5.854  1.00 0.00 ? 46 GLU B HB3  1  
ATOM 1708  H HG2  . GLU B 1 46 ? 13.513  -6.285  -7.780  1.00 0.00 ? 46 GLU B HG2  1  
ATOM 1709  H HG3  . GLU B 1 46 ? 14.458  -5.103  -6.877  1.00 0.00 ? 46 GLU B HG3  1  
ATOM 1710  N N    . ILE B 1 47 ? 12.655  -8.607  -3.771  1.00 0.00 ? 47 ILE B N    1  
ATOM 1711  C CA   . ILE B 1 47 ? 12.367  -9.885  -3.129  1.00 0.00 ? 47 ILE B CA   1  
ATOM 1712  C C    . ILE B 1 47 ? 10.867  -10.074 -2.906  1.00 0.00 ? 47 ILE B C    1  
ATOM 1713  O O    . ILE B 1 47 ? 10.326  -11.157 -3.136  1.00 0.00 ? 47 ILE B O    1  
ATOM 1714  C CB   . ILE B 1 47 ? 13.101  -10.011 -1.778  1.00 0.00 ? 47 ILE B CB   1  
ATOM 1715  C CG1  . ILE B 1 47 ? 12.904  -11.411 -1.190  1.00 0.00 ? 47 ILE B CG1  1  
ATOM 1716  C CG2  . ILE B 1 47 ? 12.617  -8.947  -0.804  1.00 0.00 ? 47 ILE B CG2  1  
ATOM 1717  C CD1  . ILE B 1 47 ? 14.045  -12.358 -1.490  1.00 0.00 ? 47 ILE B CD1  1  
ATOM 1718  H H    . ILE B 1 47 ? 13.285  -7.990  -3.342  1.00 0.00 ? 47 ILE B H    1  
ATOM 1719  H HA   . ILE B 1 47 ? 12.724  -10.670 -3.779  1.00 0.00 ? 47 ILE B HA   1  
ATOM 1720  H HB   . ILE B 1 47 ? 14.154  -9.849  -1.952  1.00 0.00 ? 47 ILE B HB   1  
ATOM 1721  H HG12 . ILE B 1 47 ? 12.812  -11.334 -0.117  1.00 0.00 ? 47 ILE B HG12 1  
ATOM 1722  H HG13 . ILE B 1 47 ? 12.000  -11.841 -1.594  1.00 0.00 ? 47 ILE B HG13 1  
ATOM 1723  H HG21 . ILE B 1 47 ? 12.430  -8.028  -1.339  1.00 0.00 ? 47 ILE B HG21 1  
ATOM 1724  H HG22 . ILE B 1 47 ? 13.372  -8.778  -0.050  1.00 0.00 ? 47 ILE B HG22 1  
ATOM 1725  H HG23 . ILE B 1 47 ? 11.705  -9.280  -0.331  1.00 0.00 ? 47 ILE B HG23 1  
ATOM 1726  H HD11 . ILE B 1 47 ? 14.537  -12.052 -2.401  1.00 0.00 ? 47 ILE B HD11 1  
ATOM 1727  H HD12 . ILE B 1 47 ? 13.660  -13.360 -1.608  1.00 0.00 ? 47 ILE B HD12 1  
ATOM 1728  H HD13 . ILE B 1 47 ? 14.753  -12.339 -0.674  1.00 0.00 ? 47 ILE B HD13 1  
ATOM 1729  N N    . TYR B 1 48 ? 10.202  -9.013  -2.455  1.00 0.00 ? 48 TYR B N    1  
ATOM 1730  C CA   . TYR B 1 48 ? 8.765   -9.058  -2.194  1.00 0.00 ? 48 TYR B CA   1  
ATOM 1731  C C    . TYR B 1 48 ? 8.008   -9.714  -3.346  1.00 0.00 ? 48 TYR B C    1  
ATOM 1732  O O    . TYR B 1 48 ? 7.456   -10.805 -3.198  1.00 0.00 ? 48 TYR B O    1  
ATOM 1733  C CB   . TYR B 1 48 ? 8.225   -7.645  -1.958  1.00 0.00 ? 48 TYR B CB   1  
ATOM 1734  C CG   . TYR B 1 48 ? 8.241   -7.222  -0.505  1.00 0.00 ? 48 TYR B CG   1  
ATOM 1735  C CD1  . TYR B 1 48 ? 9.321   -7.522  0.315   1.00 0.00 ? 48 TYR B CD1  1  
ATOM 1736  C CD2  . TYR B 1 48 ? 7.174   -6.523  0.045   1.00 0.00 ? 48 TYR B CD2  1  
ATOM 1737  C CE1  . TYR B 1 48 ? 9.338   -7.136  1.642   1.00 0.00 ? 48 TYR B CE1  1  
ATOM 1738  C CE2  . TYR B 1 48 ? 7.183   -6.134  1.371   1.00 0.00 ? 48 TYR B CE2  1  
ATOM 1739  C CZ   . TYR B 1 48 ? 8.267   -6.443  2.165   1.00 0.00 ? 48 TYR B CZ   1  
ATOM 1740  O OH   . TYR B 1 48 ? 8.280   -6.057  3.486   1.00 0.00 ? 48 TYR B OH   1  
ATOM 1741  H H    . TYR B 1 48 ? 10.691  -8.180  -2.289  1.00 0.00 ? 48 TYR B H    1  
ATOM 1742  H HA   . TYR B 1 48 ? 8.611   -9.644  -1.300  1.00 0.00 ? 48 TYR B HA   1  
ATOM 1743  H HB2  . TYR B 1 48 ? 8.824   -6.941  -2.513  1.00 0.00 ? 48 TYR B HB2  1  
ATOM 1744  H HB3  . TYR B 1 48 ? 7.204   -7.596  -2.307  1.00 0.00 ? 48 TYR B HB3  1  
ATOM 1745  H HD1  . TYR B 1 48 ? 10.159  -8.064  -0.098  1.00 0.00 ? 48 TYR B HD1  1  
ATOM 1746  H HD2  . TYR B 1 48 ? 6.326   -6.282  -0.580  1.00 0.00 ? 48 TYR B HD2  1  
ATOM 1747  H HE1  . TYR B 1 48 ? 10.187  -7.379  2.263   1.00 0.00 ? 48 TYR B HE1  1  
ATOM 1748  H HE2  . TYR B 1 48 ? 6.344   -5.591  1.780   1.00 0.00 ? 48 TYR B HE2  1  
ATOM 1749  H HH   . TYR B 1 48 ? 7.651   -6.587  3.980   1.00 0.00 ? 48 TYR B HH   1  
ATOM 1750  N N    . GLN B 1 49 ? 7.981   -9.042  -4.492  1.00 0.00 ? 49 GLN B N    1  
ATOM 1751  C CA   . GLN B 1 49 ? 7.284   -9.561  -5.664  1.00 0.00 ? 49 GLN B CA   1  
ATOM 1752  C C    . GLN B 1 49 ? 8.011   -10.766 -6.260  1.00 0.00 ? 49 GLN B C    1  
ATOM 1753  O O    . GLN B 1 49 ? 7.416   -11.560 -6.986  1.00 0.00 ? 49 GLN B O    1  
ATOM 1754  C CB   . GLN B 1 49 ? 7.144   -8.465  -6.723  1.00 0.00 ? 49 GLN B CB   1  
ATOM 1755  C CG   . GLN B 1 49 ? 8.438   -7.715  -6.998  1.00 0.00 ? 49 GLN B CG   1  
ATOM 1756  C CD   . GLN B 1 49 ? 8.523   -7.204  -8.423  1.00 0.00 ? 49 GLN B CD   1  
ATOM 1757  O OE1  . GLN B 1 49 ? 7.947   -6.169  -8.759  1.00 0.00 ? 49 GLN B OE1  1  
ATOM 1758  N NE2  . GLN B 1 49 ? 9.245   -7.930  -9.269  1.00 0.00 ? 49 GLN B NE2  1  
ATOM 1759  H H    . GLN B 1 49 ? 8.434   -8.175  -4.554  1.00 0.00 ? 49 GLN B H    1  
ATOM 1760  H HA   . GLN B 1 49 ? 6.298   -9.870  -5.351  1.00 0.00 ? 49 GLN B HA   1  
ATOM 1761  H HB2  . GLN B 1 49 ? 6.811   -8.913  -7.647  1.00 0.00 ? 49 GLN B HB2  1  
ATOM 1762  H HB3  . GLN B 1 49 ? 6.404   -7.752  -6.391  1.00 0.00 ? 49 GLN B HB3  1  
ATOM 1763  H HG2  . GLN B 1 49 ? 8.500   -6.872  -6.326  1.00 0.00 ? 49 GLN B HG2  1  
ATOM 1764  H HG3  . GLN B 1 49 ? 9.270   -8.380  -6.819  1.00 0.00 ? 49 GLN B HG3  1  
ATOM 1765  H HE21 . GLN B 1 49 ? 9.675   -8.743  -8.932  1.00 0.00 ? 49 GLN B HE21 1  
ATOM 1766  H HE22 . GLN B 1 49 ? 9.317   -7.622  -10.197 1.00 0.00 ? 49 GLN B HE22 1  
ATOM 1767  N N    . ARG B 1 50 ? 9.300   -10.896 -5.955  1.00 0.00 ? 50 ARG B N    1  
ATOM 1768  C CA   . ARG B 1 50 ? 10.097  -12.004 -6.470  1.00 0.00 ? 50 ARG B CA   1  
ATOM 1769  C C    . ARG B 1 50 ? 9.619   -13.341 -5.908  1.00 0.00 ? 50 ARG B C    1  
ATOM 1770  O O    . ARG B 1 50 ? 9.860   -14.393 -6.500  1.00 0.00 ? 50 ARG B O    1  
ATOM 1771  C CB   . ARG B 1 50 ? 11.576  -11.798 -6.133  1.00 0.00 ? 50 ARG B CB   1  
ATOM 1772  C CG   . ARG B 1 50 ? 12.390  -11.226 -7.282  1.00 0.00 ? 50 ARG B CG   1  
ATOM 1773  C CD   . ARG B 1 50 ? 13.721  -10.670 -6.801  1.00 0.00 ? 50 ARG B CD   1  
ATOM 1774  N NE   . ARG B 1 50 ? 14.466  -11.643 -6.001  1.00 0.00 ? 50 ARG B NE   1  
ATOM 1775  C CZ   . ARG B 1 50 ? 15.528  -12.319 -6.440  1.00 0.00 ? 50 ARG B CZ   1  
ATOM 1776  N NH1  . ARG B 1 50 ? 15.980  -12.143 -7.677  1.00 0.00 ? 50 ARG B NH1  1  
ATOM 1777  N NH2  . ARG B 1 50 ? 16.141  -13.177 -5.637  1.00 0.00 ? 50 ARG B NH2  1  
ATOM 1778  H H    . ARG B 1 50 ? 9.725   -10.233 -5.375  1.00 0.00 ? 50 ARG B H    1  
ATOM 1779  H HA   . ARG B 1 50 ? 9.983   -12.019 -7.543  1.00 0.00 ? 50 ARG B HA   1  
ATOM 1780  H HB2  . ARG B 1 50 ? 11.650  -11.122 -5.296  1.00 0.00 ? 50 ARG B HB2  1  
ATOM 1781  H HB3  . ARG B 1 50 ? 12.007  -12.749 -5.854  1.00 0.00 ? 50 ARG B HB3  1  
ATOM 1782  H HG2  . ARG B 1 50 ? 12.578  -12.009 -8.002  1.00 0.00 ? 50 ARG B HG2  1  
ATOM 1783  H HG3  . ARG B 1 50 ? 11.826  -10.432 -7.750  1.00 0.00 ? 50 ARG B HG3  1  
ATOM 1784  H HD2  . ARG B 1 50 ? 14.312  -10.391 -7.658  1.00 0.00 ? 50 ARG B HD2  1  
ATOM 1785  H HD3  . ARG B 1 50 ? 13.532  -9.795  -6.198  1.00 0.00 ? 50 ARG B HD3  1  
ATOM 1786  H HE   . ARG B 1 50 ? 14.158  -11.801 -5.085  1.00 0.00 ? 50 ARG B HE   1  
ATOM 1787  H HH11 . ARG B 1 50 ? 15.525  -11.501 -8.292  1.00 0.00 ? 50 ARG B HH11 1  
ATOM 1788  H HH12 . ARG B 1 50 ? 16.779  -12.655 -7.993  1.00 0.00 ? 50 ARG B HH12 1  
ATOM 1789  H HH21 . ARG B 1 50 ? 15.806  -13.317 -4.705  1.00 0.00 ? 50 ARG B HH21 1  
ATOM 1790  H HH22 . ARG B 1 50 ? 16.938  -13.685 -5.963  1.00 0.00 ? 50 ARG B HH22 1  
ATOM 1791  N N    . ILE B 1 51 ? 8.949   -13.299 -4.761  1.00 0.00 ? 51 ILE B N    1  
ATOM 1792  C CA   . ILE B 1 51 ? 8.452   -14.515 -4.127  1.00 0.00 ? 51 ILE B CA   1  
ATOM 1793  C C    . ILE B 1 51 ? 6.929   -14.606 -4.192  1.00 0.00 ? 51 ILE B C    1  
ATOM 1794  O O    . ILE B 1 51 ? 6.362   -15.692 -4.077  1.00 0.00 ? 51 ILE B O    1  
ATOM 1795  C CB   . ILE B 1 51 ? 8.898   -14.605 -2.654  1.00 0.00 ? 51 ILE B CB   1  
ATOM 1796  C CG1  . ILE B 1 51 ? 8.359   -13.415 -1.857  1.00 0.00 ? 51 ILE B CG1  1  
ATOM 1797  C CG2  . ILE B 1 51 ? 10.415  -14.666 -2.564  1.00 0.00 ? 51 ILE B CG2  1  
ATOM 1798  C CD1  . ILE B 1 51 ? 8.309   -13.663 -0.364  1.00 0.00 ? 51 ILE B CD1  1  
ATOM 1799  H H    . ILE B 1 51 ? 8.792   -12.434 -4.328  1.00 0.00 ? 51 ILE B H    1  
ATOM 1800  H HA   . ILE B 1 51 ? 8.872   -15.358 -4.656  1.00 0.00 ? 51 ILE B HA   1  
ATOM 1801  H HB   . ILE B 1 51 ? 8.501   -15.518 -2.237  1.00 0.00 ? 51 ILE B HB   1  
ATOM 1802  H HG12 . ILE B 1 51 ? 8.993   -12.558 -2.030  1.00 0.00 ? 51 ILE B HG12 1  
ATOM 1803  H HG13 . ILE B 1 51 ? 7.357   -13.189 -2.191  1.00 0.00 ? 51 ILE B HG13 1  
ATOM 1804  H HG21 . ILE B 1 51 ? 10.701  -15.206 -1.673  1.00 0.00 ? 51 ILE B HG21 1  
ATOM 1805  H HG22 . ILE B 1 51 ? 10.814  -13.663 -2.521  1.00 0.00 ? 51 ILE B HG22 1  
ATOM 1806  H HG23 . ILE B 1 51 ? 10.807  -15.172 -3.434  1.00 0.00 ? 51 ILE B HG23 1  
ATOM 1807  H HD11 . ILE B 1 51 ? 7.429   -14.241 -0.124  1.00 0.00 ? 51 ILE B HD11 1  
ATOM 1808  H HD12 . ILE B 1 51 ? 8.272   -12.717 0.157   1.00 0.00 ? 51 ILE B HD12 1  
ATOM 1809  H HD13 . ILE B 1 51 ? 9.191   -14.207 -0.059  1.00 0.00 ? 51 ILE B HD13 1  
ATOM 1810  N N    . GLN B 1 52 ? 6.269   -13.465 -4.368  1.00 0.00 ? 52 GLN B N    1  
ATOM 1811  C CA   . GLN B 1 52 ? 4.812   -13.434 -4.437  1.00 0.00 ? 52 GLN B CA   1  
ATOM 1812  C C    . GLN B 1 52 ? 4.325   -13.182 -5.863  1.00 0.00 ? 52 GLN B C    1  
ATOM 1813  O O    . GLN B 1 52 ? 3.576   -13.983 -6.423  1.00 0.00 ? 52 GLN B O    1  
ATOM 1814  C CB   . GLN B 1 52 ? 4.263   -12.356 -3.500  1.00 0.00 ? 52 GLN B CB   1  
ATOM 1815  C CG   . GLN B 1 52 ? 3.090   -12.825 -2.655  1.00 0.00 ? 52 GLN B CG   1  
ATOM 1816  C CD   . GLN B 1 52 ? 3.413   -14.069 -1.850  1.00 0.00 ? 52 GLN B CD   1  
ATOM 1817  O OE1  . GLN B 1 52 ? 3.974   -13.987 -0.758  1.00 0.00 ? 52 GLN B OE1  1  
ATOM 1818  N NE2  . GLN B 1 52 ? 3.059   -15.230 -2.388  1.00 0.00 ? 52 GLN B NE2  1  
ATOM 1819  H H    . GLN B 1 52 ? 6.771   -12.626 -4.448  1.00 0.00 ? 52 GLN B H    1  
ATOM 1820  H HA   . GLN B 1 52 ? 4.446   -14.396 -4.112  1.00 0.00 ? 52 GLN B HA   1  
ATOM 1821  H HB2  . GLN B 1 52 ? 5.052   -12.037 -2.835  1.00 0.00 ? 52 GLN B HB2  1  
ATOM 1822  H HB3  . GLN B 1 52 ? 3.939   -11.511 -4.090  1.00 0.00 ? 52 GLN B HB3  1  
ATOM 1823  H HG2  . GLN B 1 52 ? 2.816   -12.035 -1.972  1.00 0.00 ? 52 GLN B HG2  1  
ATOM 1824  H HG3  . GLN B 1 52 ? 2.257   -13.042 -3.307  1.00 0.00 ? 52 GLN B HG3  1  
ATOM 1825  H HE21 . GLN B 1 52 ? 2.616   -15.220 -3.262  1.00 0.00 ? 52 GLN B HE21 1  
ATOM 1826  H HE22 . GLN B 1 52 ? 3.256   -16.050 -1.889  1.00 0.00 ? 52 GLN B HE22 1  
ATOM 1827  N N    . ALA B 1 53 ? 4.748   -12.063 -6.439  1.00 0.00 ? 53 ALA B N    1  
ATOM 1828  C CA   . ALA B 1 53 ? 4.349   -11.701 -7.793  1.00 0.00 ? 53 ALA B CA   1  
ATOM 1829  C C    . ALA B 1 53 ? 4.921   -12.671 -8.822  1.00 0.00 ? 53 ALA B C    1  
ATOM 1830  O O    . ALA B 1 53 ? 4.197   -13.495 -9.381  1.00 0.00 ? 53 ALA B O    1  
ATOM 1831  C CB   . ALA B 1 53 ? 4.782   -10.276 -8.107  1.00 0.00 ? 53 ALA B CB   1  
ATOM 1832  H H    . ALA B 1 53 ? 5.339   -11.464 -5.939  1.00 0.00 ? 53 ALA B H    1  
ATOM 1833  H HA   . ALA B 1 53 ? 3.272   -11.739 -7.840  1.00 0.00 ? 53 ALA B HA   1  
ATOM 1834  H HB1  . ALA B 1 53 ? 5.080   -9.781  -7.194  1.00 0.00 ? 53 ALA B HB1  1  
ATOM 1835  H HB2  . ALA B 1 53 ? 3.959   -9.740  -8.554  1.00 0.00 ? 53 ALA B HB2  1  
ATOM 1836  H HB3  . ALA B 1 53 ? 5.615   -10.294 -8.794  1.00 0.00 ? 53 ALA B HB3  1  
ATOM 1837  N N    . GLU B 1 54 ? 6.223   -12.567 -9.071  1.00 0.00 ? 54 GLU B N    1  
ATOM 1838  C CA   . GLU B 1 54 ? 6.888   -13.434 -10.036 1.00 0.00 ? 54 GLU B CA   1  
ATOM 1839  C C    . GLU B 1 54 ? 7.947   -14.296 -9.355  1.00 0.00 ? 54 GLU B C    1  
ATOM 1840  O O    . GLU B 1 54 ? 8.802   -13.788 -8.631  1.00 0.00 ? 54 GLU B O    1  
ATOM 1841  C CB   . GLU B 1 54 ? 7.532   -12.600 -11.145 1.00 0.00 ? 54 GLU B CB   1  
ATOM 1842  C CG   . GLU B 1 54 ? 6.607   -12.333 -12.321 1.00 0.00 ? 54 GLU B CG   1  
ATOM 1843  C CD   . GLU B 1 54 ? 6.305   -10.858 -12.505 1.00 0.00 ? 54 GLU B CD   1  
ATOM 1844  O OE1  . GLU B 1 54 ? 7.264   -10.063 -12.601 1.00 0.00 ? 54 GLU B OE1  1  
ATOM 1845  O OE2  . GLU B 1 54 ? 5.110   -10.497 -12.552 1.00 0.00 ? 54 GLU B OE2  1  
ATOM 1846  H H    . GLU B 1 54 ? 6.748   -11.890 -8.595  1.00 0.00 ? 54 GLU B H    1  
ATOM 1847  H HA   . GLU B 1 54 ? 6.141   -14.080 -10.472 1.00 0.00 ? 54 GLU B HA   1  
ATOM 1848  H HB2  . GLU B 1 54 ? 7.840   -11.650 -10.732 1.00 0.00 ? 54 GLU B HB2  1  
ATOM 1849  H HB3  . GLU B 1 54 ? 8.403   -13.122 -11.512 1.00 0.00 ? 54 GLU B HB3  1  
ATOM 1850  H HG2  . GLU B 1 54 ? 7.074   -12.703 -13.221 1.00 0.00 ? 54 GLU B HG2  1  
ATOM 1851  H HG3  . GLU B 1 54 ? 5.677   -12.858 -12.158 1.00 0.00 ? 54 GLU B HG3  1  
ATOM 1852  N N    . LYS B 1 55 ? 7.887   -15.600 -9.597  1.00 0.00 ? 55 LYS B N    1  
ATOM 1853  C CA   . LYS B 1 55 ? 8.843   -16.531 -9.010  1.00 0.00 ? 55 LYS B CA   1  
ATOM 1854  C C    . LYS B 1 55 ? 10.248  -16.274 -9.546  1.00 0.00 ? 55 LYS B C    1  
ATOM 1855  O O    . LYS B 1 55 ? 10.636  -16.812 -10.583 1.00 0.00 ? 55 LYS B O    1  
ATOM 1856  C CB   . LYS B 1 55 ? 8.428   -17.974 -9.303  1.00 0.00 ? 55 LYS B CB   1  
ATOM 1857  C CG   . LYS B 1 55 ? 8.057   -18.217 -10.757 1.00 0.00 ? 55 LYS B CG   1  
ATOM 1858  C CD   . LYS B 1 55 ? 8.480   -19.603 -11.216 1.00 0.00 ? 55 LYS B CD   1  
ATOM 1859  C CE   . LYS B 1 55 ? 8.974   -19.587 -12.653 1.00 0.00 ? 55 LYS B CE   1  
ATOM 1860  N NZ   . LYS B 1 55 ? 8.793   -20.907 -13.318 1.00 0.00 ? 55 LYS B NZ   1  
ATOM 1861  H H    . LYS B 1 55 ? 7.186   -15.944 -10.188 1.00 0.00 ? 55 LYS B H    1  
ATOM 1862  H HA   . LYS B 1 55 ? 8.844   -16.375 -7.942  1.00 0.00 ? 55 LYS B HA   1  
ATOM 1863  H HB2  . LYS B 1 55 ? 9.247   -18.630 -9.049  1.00 0.00 ? 55 LYS B HB2  1  
ATOM 1864  H HB3  . LYS B 1 55 ? 7.575   -18.222 -8.689  1.00 0.00 ? 55 LYS B HB3  1  
ATOM 1865  H HG2  . LYS B 1 55 ? 6.987   -18.124 -10.865 1.00 0.00 ? 55 LYS B HG2  1  
ATOM 1866  H HG3  . LYS B 1 55 ? 8.548   -17.477 -11.372 1.00 0.00 ? 55 LYS B HG3  1  
ATOM 1867  H HD2  . LYS B 1 55 ? 9.276   -19.956 -10.576 1.00 0.00 ? 55 LYS B HD2  1  
ATOM 1868  H HD3  . LYS B 1 55 ? 7.634   -20.270 -11.142 1.00 0.00 ? 55 LYS B HD3  1  
ATOM 1869  H HE2  . LYS B 1 55 ? 8.422   -18.839 -13.202 1.00 0.00 ? 55 LYS B HE2  1  
ATOM 1870  H HE3  . LYS B 1 55 ? 10.024  -19.333 -12.657 1.00 0.00 ? 55 LYS B HE3  1  
ATOM 1871  H HZ1  . LYS B 1 55 ? 9.636   -21.499 -13.173 1.00 0.00 ? 55 LYS B HZ1  1  
ATOM 1872  H HZ2  . LYS B 1 55 ? 8.647   -20.776 -14.339 1.00 0.00 ? 55 LYS B HZ2  1  
ATOM 1873  H HZ3  . LYS B 1 55 ? 7.966   -21.397 -12.920 1.00 0.00 ? 55 LYS B HZ3  1  
ATOM 1874  N N    . SER B 1 56 ? 11.008  -15.449 -8.831  1.00 0.00 ? 56 SER B N    1  
ATOM 1875  C CA   . SER B 1 56 ? 12.371  -15.121 -9.233  1.00 0.00 ? 56 SER B CA   1  
ATOM 1876  C C    . SER B 1 56 ? 12.399  -14.520 -10.635 1.00 0.00 ? 56 SER B C    1  
ATOM 1877  O O    . SER B 1 56 ? 12.573  -15.232 -11.624 1.00 0.00 ? 56 SER B O    1  
ATOM 1878  C CB   . SER B 1 56 ? 13.254  -16.370 -9.184  1.00 0.00 ? 56 SER B CB   1  
ATOM 1879  O OG   . SER B 1 56 ? 14.596  -16.035 -8.878  1.00 0.00 ? 56 SER B OG   1  
ATOM 1880  H H    . SER B 1 56 ? 10.643  -15.052 -8.013  1.00 0.00 ? 56 SER B H    1  
ATOM 1881  H HA   . SER B 1 56 ? 12.756  -14.393 -8.535  1.00 0.00 ? 56 SER B HA   1  
ATOM 1882  H HB2  . SER B 1 56 ? 12.882  -17.041 -8.425  1.00 0.00 ? 56 SER B HB2  1  
ATOM 1883  H HB3  . SER B 1 56 ? 13.229  -16.864 -10.145 1.00 0.00 ? 56 SER B HB3  1  
ATOM 1884  H HG   . SER B 1 56 ? 14.837  -16.419 -8.032  1.00 0.00 ? 56 SER B HG   1  
ATOM 1885  N N    . GLN B 1 57 ? 12.227  -13.204 -10.714 1.00 0.00 ? 57 GLN B N    1  
ATOM 1886  C CA   . GLN B 1 57 ? 12.233  -12.507 -11.995 1.00 0.00 ? 57 GLN B CA   1  
ATOM 1887  C C    . GLN B 1 57 ? 13.498  -11.670 -12.155 1.00 0.00 ? 57 GLN B C    1  
ATOM 1888  O O    . GLN B 1 57 ? 14.158  -11.716 -13.193 1.00 0.00 ? 57 GLN B O    1  
ATOM 1889  C CB   . GLN B 1 57 ? 10.998  -11.613 -12.119 1.00 0.00 ? 57 GLN B CB   1  
ATOM 1890  C CG   . GLN B 1 57 ? 10.786  -11.058 -13.518 1.00 0.00 ? 57 GLN B CG   1  
ATOM 1891  C CD   . GLN B 1 57 ? 10.582  -12.148 -14.552 1.00 0.00 ? 57 GLN B CD   1  
ATOM 1892  O OE1  . GLN B 1 57 ? 9.458   -12.590 -14.793 1.00 0.00 ? 57 GLN B OE1  1  
ATOM 1893  N NE2  . GLN B 1 57 ? 11.671  -12.589 -15.171 1.00 0.00 ? 57 GLN B NE2  1  
ATOM 1894  H H    . GLN B 1 57 ? 12.092  -12.689 -9.891  1.00 0.00 ? 57 GLN B H    1  
ATOM 1895  H HA   . GLN B 1 57 ? 12.207  -13.251 -12.777 1.00 0.00 ? 57 GLN B HA   1  
ATOM 1896  H HB2  . GLN B 1 57 ? 10.124  -12.185 -11.846 1.00 0.00 ? 57 GLN B HB2  1  
ATOM 1897  H HB3  . GLN B 1 57 ? 11.100  -10.781 -11.437 1.00 0.00 ? 57 GLN B HB3  1  
ATOM 1898  H HG2  . GLN B 1 57 ? 9.913   -10.422 -13.512 1.00 0.00 ? 57 GLN B HG2  1  
ATOM 1899  H HG3  . GLN B 1 57 ? 11.653  -10.476 -13.796 1.00 0.00 ? 57 GLN B HG3  1  
ATOM 1900  H HE21 . GLN B 1 57 ? 12.534  -12.191 -14.929 1.00 0.00 ? 57 GLN B HE21 1  
ATOM 1901  H HE22 . GLN B 1 57 ? 11.568  -13.293 -15.844 1.00 0.00 ? 57 GLN B HE22 1  
ATOM 1902  N N    . GLN B 1 58 ? 13.829  -10.905 -11.119 1.00 0.00 ? 58 GLN B N    1  
ATOM 1903  C CA   . GLN B 1 58 ? 15.015  -10.056 -11.143 1.00 0.00 ? 58 GLN B CA   1  
ATOM 1904  C C    . GLN B 1 58 ? 14.899  -8.990  -12.229 1.00 0.00 ? 58 GLN B C    1  
ATOM 1905  O O    . GLN B 1 58 ? 13.858  -8.857  -12.873 1.00 0.00 ? 58 GLN B O    1  
ATOM 1906  C CB   . GLN B 1 58 ? 16.271  -10.901 -11.370 1.00 0.00 ? 58 GLN B CB   1  
ATOM 1907  C CG   . GLN B 1 58 ? 17.427  -10.529 -10.456 1.00 0.00 ? 58 GLN B CG   1  
ATOM 1908  C CD   . GLN B 1 58 ? 18.770  -10.968 -11.005 1.00 0.00 ? 58 GLN B CD   1  
ATOM 1909  O OE1  . GLN B 1 58 ? 18.910  -11.231 -12.199 1.00 0.00 ? 58 GLN B OE1  1  
ATOM 1910  N NE2  . GLN B 1 58 ? 19.768  -11.051 -10.132 1.00 0.00 ? 58 GLN B NE2  1  
ATOM 1911  H H    . GLN B 1 58 ? 13.263  -10.911 -10.320 1.00 0.00 ? 58 GLN B H    1  
ATOM 1912  H HA   . GLN B 1 58 ? 15.090  -9.566  -10.184 1.00 0.00 ? 58 GLN B HA   1  
ATOM 1913  H HB2  . GLN B 1 58 ? 16.027  -11.939 -11.201 1.00 0.00 ? 58 GLN B HB2  1  
ATOM 1914  H HB3  . GLN B 1 58 ? 16.596  -10.779 -12.393 1.00 0.00 ? 58 GLN B HB3  1  
ATOM 1915  H HG2  . GLN B 1 58 ? 17.440  -9.456  -10.331 1.00 0.00 ? 58 GLN B HG2  1  
ATOM 1916  H HG3  . GLN B 1 58 ? 17.275  -11.000 -9.495  1.00 0.00 ? 58 GLN B HG3  1  
ATOM 1917  H HE21 . GLN B 1 58 ? 19.583  -10.827 -9.196  1.00 0.00 ? 58 GLN B HE21 1  
ATOM 1918  H HE22 . GLN B 1 58 ? 20.647  -11.332 -10.459 1.00 0.00 ? 58 GLN B HE22 1  
ATOM 1919  N N    . SER B 1 59 ? 15.974  -8.234  -12.427 1.00 0.00 ? 59 SER B N    1  
ATOM 1920  C CA   . SER B 1 59 ? 15.992  -7.179  -13.434 1.00 0.00 ? 59 SER B CA   1  
ATOM 1921  C C    . SER B 1 59 ? 15.747  -7.753  -14.827 1.00 0.00 ? 59 SER B C    1  
ATOM 1922  O O    . SER B 1 59 ? 14.667  -7.594  -15.394 1.00 0.00 ? 59 SER B O    1  
ATOM 1923  C CB   . SER B 1 59 ? 17.329  -6.435  -13.400 1.00 0.00 ? 59 SER B CB   1  
ATOM 1924  O OG   . SER B 1 59 ? 17.131  -5.038  -13.265 1.00 0.00 ? 59 SER B OG   1  
ATOM 1925  H H    . SER B 1 59 ? 16.774  -8.387  -11.882 1.00 0.00 ? 59 SER B H    1  
ATOM 1926  H HA   . SER B 1 59 ? 15.198  -6.486  -13.201 1.00 0.00 ? 59 SER B HA   1  
ATOM 1927  H HB2  . SER B 1 59 ? 17.912  -6.785  -12.561 1.00 0.00 ? 59 SER B HB2  1  
ATOM 1928  H HB3  . SER B 1 59 ? 17.869  -6.623  -14.316 1.00 0.00 ? 59 SER B HB3  1  
ATOM 1929  H HG   . SER B 1 59 ? 17.853  -4.660  -12.758 1.00 0.00 ? 59 SER B HG   1  
ATOM 1930  N N    . SER B 1 60 ? 16.759  -8.420  -15.373 1.00 0.00 ? 60 SER B N    1  
ATOM 1931  C CA   . SER B 1 60 ? 16.655  -9.018  -16.699 1.00 0.00 ? 60 SER B CA   1  
ATOM 1932  C C    . SER B 1 60 ? 16.711  -10.540 -16.616 1.00 0.00 ? 60 SER B C    1  
ATOM 1933  O O    . SER B 1 60 ? 17.635  -11.106 -16.032 1.00 0.00 ? 60 SER B O    1  
ATOM 1934  C CB   . SER B 1 60 ? 17.776  -8.503  -17.603 1.00 0.00 ? 60 SER B CB   1  
ATOM 1935  O OG   . SER B 1 60 ? 17.471  -8.721  -18.970 1.00 0.00 ? 60 SER B OG   1  
ATOM 1936  H H    . SER B 1 60 ? 17.596  -8.513  -14.872 1.00 0.00 ? 60 SER B H    1  
ATOM 1937  H HA   . SER B 1 60 ? 15.704  -8.728  -17.119 1.00 0.00 ? 60 SER B HA   1  
ATOM 1938  H HB2  . SER B 1 60 ? 17.908  -7.443  -17.442 1.00 0.00 ? 60 SER B HB2  1  
ATOM 1939  H HB3  . SER B 1 60 ? 18.694  -9.020  -17.364 1.00 0.00 ? 60 SER B HB3  1  
ATOM 1940  H HG   . SER B 1 60 ? 18.284  -8.739  -19.480 1.00 0.00 ? 60 SER B HG   1  
ATOM 1941  N N    . TYR B 1 61 ? 15.717  -11.196 -17.204 1.00 0.00 ? 61 TYR B N    1  
ATOM 1942  C CA   . TYR B 1 61 ? 15.653  -12.653 -17.196 1.00 0.00 ? 61 TYR B CA   1  
ATOM 1943  C C    . TYR B 1 61 ? 14.836  -13.168 -18.377 1.00 0.00 ? 61 TYR B C    1  
ATOM 1944  O O    . TYR B 1 61 ? 14.775  -14.402 -18.560 1.00 0.00 ? 61 TYR B O    1  
ATOM 1945  C CB   . TYR B 1 61 ? 15.048  -13.150 -15.881 1.00 0.00 ? 61 TYR B CB   1  
ATOM 1946  C CG   . TYR B 1 61 ? 15.999  -13.984 -15.053 1.00 0.00 ? 61 TYR B CG   1  
ATOM 1947  C CD1  . TYR B 1 61 ? 16.141  -15.347 -15.285 1.00 0.00 ? 61 TYR B CD1  1  
ATOM 1948  C CD2  . TYR B 1 61 ? 16.756  -13.409 -14.039 1.00 0.00 ? 61 TYR B CD2  1  
ATOM 1949  C CE1  . TYR B 1 61 ? 17.010  -16.112 -14.530 1.00 0.00 ? 61 TYR B CE1  1  
ATOM 1950  C CE2  . TYR B 1 61 ? 17.627  -14.168 -13.281 1.00 0.00 ? 61 TYR B CE2  1  
ATOM 1951  C CZ   . TYR B 1 61 ? 17.750  -15.518 -13.530 1.00 0.00 ? 61 TYR B CZ   1  
ATOM 1952  O OH   . TYR B 1 61 ? 18.616  -16.277 -12.777 1.00 0.00 ? 61 TYR B OH   1  
ATOM 1953  O OXT  . TYR B 1 61 ? 14.263  -12.333 -19.108 1.00 0.00 ? 61 TYR B OXT  1  
ATOM 1954  H H    . TYR B 1 61 ? 15.009  -10.690 -17.653 1.00 0.00 ? 61 TYR B H    1  
ATOM 1955  H HA   . TYR B 1 61 ? 16.662  -13.028 -17.281 1.00 0.00 ? 61 TYR B HA   1  
ATOM 1956  H HB2  . TYR B 1 61 ? 14.750  -12.300 -15.286 1.00 0.00 ? 61 TYR B HB2  1  
ATOM 1957  H HB3  . TYR B 1 61 ? 14.178  -13.754 -16.096 1.00 0.00 ? 61 TYR B HB3  1  
ATOM 1958  H HD1  . TYR B 1 61 ? 15.561  -15.809 -16.069 1.00 0.00 ? 61 TYR B HD1  1  
ATOM 1959  H HD2  . TYR B 1 61 ? 16.657  -12.351 -13.847 1.00 0.00 ? 61 TYR B HD2  1  
ATOM 1960  H HE1  . TYR B 1 61 ? 17.106  -17.170 -14.726 1.00 0.00 ? 61 TYR B HE1  1  
ATOM 1961  H HE2  . TYR B 1 61 ? 18.206  -13.702 -12.498 1.00 0.00 ? 61 TYR B HE2  1  
ATOM 1962  H HH   . TYR B 1 61 ? 19.520  -16.082 -13.034 1.00 0.00 ? 61 TYR B HH   1  
ATOM 1963  N N    . MET A 1 1  ? -2.316  -10.742 -5.724  1.00 0.00 ? 1  MET A N    2  
ATOM 1964  C CA   . MET A 1 1  ? -2.055  -10.458 -4.289  1.00 0.00 ? 1  MET A CA   2  
ATOM 1965  C C    . MET A 1 1  ? -0.582  -10.651 -3.947  1.00 0.00 ? 1  MET A C    2  
ATOM 1966  O O    . MET A 1 1  ? 0.010   -11.681 -4.267  1.00 0.00 ? 1  MET A O    2  
ATOM 1967  C CB   . MET A 1 1  ? -2.920  -11.393 -3.441  1.00 0.00 ? 1  MET A CB   2  
ATOM 1968  C CG   . MET A 1 1  ? -3.264  -10.829 -2.073  1.00 0.00 ? 1  MET A CG   2  
ATOM 1969  S SD   . MET A 1 1  ? -3.608  -12.116 -0.857  1.00 0.00 ? 1  MET A SD   2  
ATOM 1970  C CE   . MET A 1 1  ? -4.615  -11.213 0.317   1.00 0.00 ? 1  MET A CE   2  
ATOM 1971  H H1   . MET A 1 1  ? -2.155  -11.757 -5.881  1.00 0.00 ? 1  MET A H1   2  
ATOM 1972  H H2   . MET A 1 1  ? -1.657  -10.166 -6.286  1.00 0.00 ? 1  MET A H2   2  
ATOM 1973  H H3   . MET A 1 1  ? -3.304  -10.486 -5.924  1.00 0.00 ? 1  MET A H3   2  
ATOM 1974  H HA   . MET A 1 1  ? -2.334  -9.435  -4.085  1.00 0.00 ? 1  MET A HA   2  
ATOM 1975  H HB2  . MET A 1 1  ? -3.841  -11.590 -3.969  1.00 0.00 ? 1  MET A HB2  2  
ATOM 1976  H HB3  . MET A 1 1  ? -2.390  -12.324 -3.300  1.00 0.00 ? 1  MET A HB3  2  
ATOM 1977  H HG2  . MET A 1 1  ? -2.432  -10.237 -1.722  1.00 0.00 ? 1  MET A HG2  2  
ATOM 1978  H HG3  . MET A 1 1  ? -4.137  -10.200 -2.167  1.00 0.00 ? 1  MET A HG3  2  
ATOM 1979  H HE1  . MET A 1 1  ? -4.244  -10.203 0.408   1.00 0.00 ? 1  MET A HE1  2  
ATOM 1980  H HE2  . MET A 1 1  ? -4.570  -11.701 1.279   1.00 0.00 ? 1  MET A HE2  2  
ATOM 1981  H HE3  . MET A 1 1  ? -5.638  -11.191 -0.028  1.00 0.00 ? 1  MET A HE3  2  
ATOM 1982  N N    . LEU A 1 2  ? 0.003   -9.654  -3.291  1.00 0.00 ? 2  LEU A N    2  
ATOM 1983  C CA   . LEU A 1 2  ? 1.407   -9.717  -2.901  1.00 0.00 ? 2  LEU A CA   2  
ATOM 1984  C C    . LEU A 1 2  ? 1.551   -9.615  -1.386  1.00 0.00 ? 2  LEU A C    2  
ATOM 1985  O O    . LEU A 1 2  ? 1.217   -8.591  -0.791  1.00 0.00 ? 2  LEU A O    2  
ATOM 1986  C CB   . LEU A 1 2  ? 2.195   -8.593  -3.579  1.00 0.00 ? 2  LEU A CB   2  
ATOM 1987  C CG   . LEU A 1 2  ? 2.236   -8.660  -5.107  1.00 0.00 ? 2  LEU A CG   2  
ATOM 1988  C CD1  . LEU A 1 2  ? 0.856   -8.396  -5.691  1.00 0.00 ? 2  LEU A CD1  2  
ATOM 1989  C CD2  . LEU A 1 2  ? 3.250   -7.667  -5.656  1.00 0.00 ? 2  LEU A CD2  2  
ATOM 1990  H H    . LEU A 1 2  ? -0.523  -8.858  -3.060  1.00 0.00 ? 2  LEU A H    2  
ATOM 1991  H HA   . LEU A 1 2  ? 1.801   -10.668 -3.226  1.00 0.00 ? 2  LEU A HA   2  
ATOM 1992  H HB2  . LEU A 1 2  ? 1.755   -7.650  -3.292  1.00 0.00 ? 2  LEU A HB2  2  
ATOM 1993  H HB3  . LEU A 1 2  ? 3.211   -8.623  -3.213  1.00 0.00 ? 2  LEU A HB3  2  
ATOM 1994  H HG   . LEU A 1 2  ? 2.541   -9.651  -5.409  1.00 0.00 ? 2  LEU A HG   2  
ATOM 1995  H HD11 . LEU A 1 2  ? 0.257   -7.860  -4.971  1.00 0.00 ? 2  LEU A HD11 2  
ATOM 1996  H HD12 . LEU A 1 2  ? 0.380   -9.335  -5.928  1.00 0.00 ? 2  LEU A HD12 2  
ATOM 1997  H HD13 . LEU A 1 2  ? 0.953   -7.805  -6.591  1.00 0.00 ? 2  LEU A HD13 2  
ATOM 1998  H HD21 . LEU A 1 2  ? 3.338   -6.831  -4.977  1.00 0.00 ? 2  LEU A HD21 2  
ATOM 1999  H HD22 . LEU A 1 2  ? 2.920   -7.313  -6.621  1.00 0.00 ? 2  LEU A HD22 2  
ATOM 2000  H HD23 . LEU A 1 2  ? 4.209   -8.151  -5.758  1.00 0.00 ? 2  LEU A HD23 2  
ATOM 2001  N N    . ILE A 1 3  ? 2.057   -10.676 -0.764  1.00 0.00 ? 3  ILE A N    2  
ATOM 2002  C CA   . ILE A 1 3  ? 2.247   -10.690 0.682   1.00 0.00 ? 3  ILE A CA   2  
ATOM 2003  C C    . ILE A 1 3  ? 3.659   -10.236 1.042   1.00 0.00 ? 3  ILE A C    2  
ATOM 2004  O O    . ILE A 1 3  ? 4.628   -10.974 0.860   1.00 0.00 ? 3  ILE A O    2  
ATOM 2005  C CB   . ILE A 1 3  ? 1.978   -12.093 1.277   1.00 0.00 ? 3  ILE A CB   2  
ATOM 2006  C CG1  . ILE A 1 3  ? 0.476   -12.400 1.254   1.00 0.00 ? 3  ILE A CG1  2  
ATOM 2007  C CG2  . ILE A 1 3  ? 2.522   -12.200 2.698   1.00 0.00 ? 3  ILE A CG2  2  
ATOM 2008  C CD1  . ILE A 1 3  ? -0.327  -11.619 2.278   1.00 0.00 ? 3  ILE A CD1  2  
ATOM 2009  H H    . ILE A 1 3  ? 2.317   -11.463 -1.287  1.00 0.00 ? 3  ILE A H    2  
ATOM 2010  H HA   . ILE A 1 3  ? 1.540   -9.997  1.115   1.00 0.00 ? 3  ILE A HA   2  
ATOM 2011  H HB   . ILE A 1 3  ? 2.493   -12.820 0.667   1.00 0.00 ? 3  ILE A HB   2  
ATOM 2012  H HG12 . ILE A 1 3  ? 0.082   -12.163 0.276   1.00 0.00 ? 3  ILE A HG12 2  
ATOM 2013  H HG13 . ILE A 1 3  ? 0.328   -13.452 1.449   1.00 0.00 ? 3  ILE A HG13 2  
ATOM 2014  H HG21 . ILE A 1 3  ? 2.116   -11.401 3.300   1.00 0.00 ? 3  ILE A HG21 2  
ATOM 2015  H HG22 . ILE A 1 3  ? 3.599   -12.125 2.677   1.00 0.00 ? 3  ILE A HG22 2  
ATOM 2016  H HG23 . ILE A 1 3  ? 2.235   -13.151 3.121   1.00 0.00 ? 3  ILE A HG23 2  
ATOM 2017  H HD11 . ILE A 1 3  ? -0.012  -10.586 2.272   1.00 0.00 ? 3  ILE A HD11 2  
ATOM 2018  H HD12 . ILE A 1 3  ? -0.165  -12.038 3.261   1.00 0.00 ? 3  ILE A HD12 2  
ATOM 2019  H HD13 . ILE A 1 3  ? -1.378  -11.675 2.033   1.00 0.00 ? 3  ILE A HD13 2  
ATOM 2020  N N    . LEU A 1 4  ? 3.762   -9.014  1.550   1.00 0.00 ? 4  LEU A N    2  
ATOM 2021  C CA   . LEU A 1 4  ? 5.047   -8.444  1.936   1.00 0.00 ? 4  LEU A CA   2  
ATOM 2022  C C    . LEU A 1 4  ? 5.085   -8.169  3.434   1.00 0.00 ? 4  LEU A C    2  
ATOM 2023  O O    . LEU A 1 4  ? 4.048   -8.002  4.068   1.00 0.00 ? 4  LEU A O    2  
ATOM 2024  C CB   . LEU A 1 4  ? 5.309   -7.152  1.160   1.00 0.00 ? 4  LEU A CB   2  
ATOM 2025  C CG   . LEU A 1 4  ? 5.404   -7.317  -0.357  1.00 0.00 ? 4  LEU A CG   2  
ATOM 2026  C CD1  . LEU A 1 4  ? 6.438   -8.372  -0.716  1.00 0.00 ? 4  LEU A CD1  2  
ATOM 2027  C CD2  . LEU A 1 4  ? 4.046   -7.679  -0.939  1.00 0.00 ? 4  LEU A CD2  2  
ATOM 2028  H H    . LEU A 1 4  ? 2.951   -8.477  1.664   1.00 0.00 ? 4  LEU A H    2  
ATOM 2029  H HA   . LEU A 1 4  ? 5.816   -9.162  1.694   1.00 0.00 ? 4  LEU A HA   2  
ATOM 2030  H HB2  . LEU A 1 4  ? 4.510   -6.458  1.378   1.00 0.00 ? 4  LEU A HB2  2  
ATOM 2031  H HB3  . LEU A 1 4  ? 6.238   -6.728  1.512   1.00 0.00 ? 4  LEU A HB3  2  
ATOM 2032  H HG   . LEU A 1 4  ? 5.717   -6.380  -0.796  1.00 0.00 ? 4  LEU A HG   2  
ATOM 2033  H HD11 . LEU A 1 4  ? 7.267   -8.313  -0.027  1.00 0.00 ? 4  LEU A HD11 2  
ATOM 2034  H HD12 . LEU A 1 4  ? 6.793   -8.201  -1.722  1.00 0.00 ? 4  LEU A HD12 2  
ATOM 2035  H HD13 . LEU A 1 4  ? 5.988   -9.352  -0.655  1.00 0.00 ? 4  LEU A HD13 2  
ATOM 2036  H HD21 . LEU A 1 4  ? 3.267   -7.347  -0.268  1.00 0.00 ? 4  LEU A HD21 2  
ATOM 2037  H HD22 . LEU A 1 4  ? 3.981   -8.750  -1.063  1.00 0.00 ? 4  LEU A HD22 2  
ATOM 2038  H HD23 . LEU A 1 4  ? 3.924   -7.197  -1.897  1.00 0.00 ? 4  LEU A HD23 2  
ATOM 2039  N N    . THR A 1 5  ? 6.287   -8.111  3.993   1.00 0.00 ? 5  THR A N    2  
ATOM 2040  C CA   . THR A 1 5  ? 6.446   -7.841  5.417   1.00 0.00 ? 5  THR A CA   2  
ATOM 2041  C C    . THR A 1 5  ? 6.735   -6.369  5.654   1.00 0.00 ? 5  THR A C    2  
ATOM 2042  O O    . THR A 1 5  ? 7.575   -5.772  4.980   1.00 0.00 ? 5  THR A O    2  
ATOM 2043  C CB   . THR A 1 5  ? 7.567   -8.685  6.016   1.00 0.00 ? 5  THR A CB   2  
ATOM 2044  O OG1  . THR A 1 5  ? 8.077   -9.604  5.065   1.00 0.00 ? 5  THR A OG1  2  
ATOM 2045  C CG2  . THR A 1 5  ? 7.120   -9.470  7.227   1.00 0.00 ? 5  THR A CG2  2  
ATOM 2046  H H    . THR A 1 5  ? 7.077   -8.234  3.426   1.00 0.00 ? 5  THR A H    2  
ATOM 2047  H HA   . THR A 1 5  ? 5.515   -8.094  5.911   1.00 0.00 ? 5  THR A HA   2  
ATOM 2048  H HB   . THR A 1 5  ? 8.371   -8.029  6.327   1.00 0.00 ? 5  THR A HB   2  
ATOM 2049  H HG1  . THR A 1 5  ? 8.870   -10.018 5.414   1.00 0.00 ? 5  THR A HG1  2  
ATOM 2050  H HG21 . THR A 1 5  ? 6.168   -9.088  7.569   1.00 0.00 ? 5  THR A HG21 2  
ATOM 2051  H HG22 . THR A 1 5  ? 7.853   -9.366  8.012   1.00 0.00 ? 5  THR A HG22 2  
ATOM 2052  H HG23 . THR A 1 5  ? 7.017   -10.512 6.964   1.00 0.00 ? 5  THR A HG23 2  
ATOM 2053  N N    . ARG A 1 6  ? 6.037   -5.790  6.618   1.00 0.00 ? 6  ARG A N    2  
ATOM 2054  C CA   . ARG A 1 6  ? 6.220   -4.389  6.947   1.00 0.00 ? 6  ARG A CA   2  
ATOM 2055  C C    . ARG A 1 6  ? 5.902   -4.131  8.413   1.00 0.00 ? 6  ARG A C    2  
ATOM 2056  O O    . ARG A 1 6  ? 5.044   -4.794  9.002   1.00 0.00 ? 6  ARG A O    2  
ATOM 2057  C CB   . ARG A 1 6  ? 5.335   -3.514  6.057   1.00 0.00 ? 6  ARG A CB   2  
ATOM 2058  C CG   . ARG A 1 6  ? 5.786   -3.465  4.606   1.00 0.00 ? 6  ARG A CG   2  
ATOM 2059  C CD   . ARG A 1 6  ? 5.017   -4.458  3.748   1.00 0.00 ? 6  ARG A CD   2  
ATOM 2060  N NE   . ARG A 1 6  ? 4.837   -3.976  2.380   1.00 0.00 ? 6  ARG A NE   2  
ATOM 2061  C CZ   . ARG A 1 6  ? 3.886   -3.120  2.012   1.00 0.00 ? 6  ARG A CZ   2  
ATOM 2062  N NH1  . ARG A 1 6  ? 3.030   -2.643  2.908   1.00 0.00 ? 6  ARG A NH1  2  
ATOM 2063  N NH2  . ARG A 1 6  ? 3.791   -2.738  0.746   1.00 0.00 ? 6  ARG A NH2  2  
ATOM 2064  H H    . ARG A 1 6  ? 5.383   -6.319  7.121   1.00 0.00 ? 6  ARG A H    2  
ATOM 2065  H HA   . ARG A 1 6  ? 7.255   -4.138  6.766   1.00 0.00 ? 6  ARG A HA   2  
ATOM 2066  H HB2  . ARG A 1 6  ? 4.328   -3.898  6.085   1.00 0.00 ? 6  ARG A HB2  2  
ATOM 2067  H HB3  . ARG A 1 6  ? 5.338   -2.506  6.446   1.00 0.00 ? 6  ARG A HB3  2  
ATOM 2068  H HG2  . ARG A 1 6  ? 5.620   -2.470  4.222   1.00 0.00 ? 6  ARG A HG2  2  
ATOM 2069  H HG3  . ARG A 1 6  ? 6.839   -3.701  4.559   1.00 0.00 ? 6  ARG A HG3  2  
ATOM 2070  H HD2  . ARG A 1 6  ? 5.563   -5.389  3.721   1.00 0.00 ? 6  ARG A HD2  2  
ATOM 2071  H HD3  . ARG A 1 6  ? 4.047   -4.623  4.192   1.00 0.00 ? 6  ARG A HD3  2  
ATOM 2072  H HE   . ARG A 1 6  ? 5.456   -4.311  1.698   1.00 0.00 ? 6  ARG A HE   2  
ATOM 2073  H HH11 . ARG A 1 6  ? 3.096   -2.927  3.864   1.00 0.00 ? 6  ARG A HH11 2  
ATOM 2074  H HH12 . ARG A 1 6  ? 2.318   -2.000  2.625   1.00 0.00 ? 6  ARG A HH12 2  
ATOM 2075  H HH21 . ARG A 1 6  ? 4.434   -3.094  0.067   1.00 0.00 ? 6  ARG A HH21 2  
ATOM 2076  H HH22 . ARG A 1 6  ? 3.077   -2.096  0.470   1.00 0.00 ? 6  ARG A HH22 2  
ATOM 2077  N N    . ARG A 1 7  ? 6.603   -3.164  8.991   1.00 0.00 ? 7  ARG A N    2  
ATOM 2078  C CA   . ARG A 1 7  ? 6.405   -2.797  10.392  1.00 0.00 ? 7  ARG A CA   2  
ATOM 2079  C C    . ARG A 1 7  ? 7.374   -1.699  10.845  1.00 0.00 ? 7  ARG A C    2  
ATOM 2080  O O    . ARG A 1 7  ? 7.263   -1.195  11.963  1.00 0.00 ? 7  ARG A O    2  
ATOM 2081  C CB   . ARG A 1 7  ? 6.553   -4.022  11.296  1.00 0.00 ? 7  ARG A CB   2  
ATOM 2082  C CG   . ARG A 1 7  ? 6.123   -3.767  12.733  1.00 0.00 ? 7  ARG A CG   2  
ATOM 2083  C CD   . ARG A 1 7  ? 7.255   -4.030  13.713  1.00 0.00 ? 7  ARG A CD   2  
ATOM 2084  N NE   . ARG A 1 7  ? 6.869   -3.726  15.089  1.00 0.00 ? 7  ARG A NE   2  
ATOM 2085  C CZ   . ARG A 1 7  ? 7.696   -3.817  16.128  1.00 0.00 ? 7  ARG A CZ   2  
ATOM 2086  N NH1  . ARG A 1 7  ? 8.954   -4.203  15.952  1.00 0.00 ? 7  ARG A NH1  2  
ATOM 2087  N NH2  . ARG A 1 7  ? 7.265   -3.522  17.347  1.00 0.00 ? 7  ARG A NH2  2  
ATOM 2088  H H    . ARG A 1 7  ? 7.268   -2.686  8.458   1.00 0.00 ? 7  ARG A H    2  
ATOM 2089  H HA   . ARG A 1 7  ? 5.398   -2.420  10.486  1.00 0.00 ? 7  ARG A HA   2  
ATOM 2090  H HB2  . ARG A 1 7  ? 5.947   -4.823  10.898  1.00 0.00 ? 7  ARG A HB2  2  
ATOM 2091  H HB3  . ARG A 1 7  ? 7.588   -4.330  11.300  1.00 0.00 ? 7  ARG A HB3  2  
ATOM 2092  H HG2  . ARG A 1 7  ? 5.811   -2.737  12.827  1.00 0.00 ? 7  ARG A HG2  2  
ATOM 2093  H HG3  . ARG A 1 7  ? 5.294   -4.418  12.970  1.00 0.00 ? 7  ARG A HG3  2  
ATOM 2094  H HD2  . ARG A 1 7  ? 7.534   -5.072  13.649  1.00 0.00 ? 7  ARG A HD2  2  
ATOM 2095  H HD3  . ARG A 1 7  ? 8.099   -3.414  13.441  1.00 0.00 ? 7  ARG A HD3  2  
ATOM 2096  H HE   . ARG A 1 7  ? 5.946   -3.439  15.247  1.00 0.00 ? 7  ARG A HE   2  
ATOM 2097  H HH11 . ARG A 1 7  ? 9.285   -4.427  15.036  1.00 0.00 ? 7  ARG A HH11 2  
ATOM 2098  H HH12 . ARG A 1 7  ? 9.570   -4.269  16.736  1.00 0.00 ? 7  ARG A HH12 2  
ATOM 2099  H HH21 . ARG A 1 7  ? 6.318   -3.231  17.486  1.00 0.00 ? 7  ARG A HH21 2  
ATOM 2100  H HH22 . ARG A 1 7  ? 7.886   -3.591  18.128  1.00 0.00 ? 7  ARG A HH22 2  
ATOM 2101  N N    . VAL A 1 8  ? 8.319   -1.326  9.983   1.00 0.00 ? 8  VAL A N    2  
ATOM 2102  C CA   . VAL A 1 8  ? 9.286   -0.288  10.317  1.00 0.00 ? 8  VAL A CA   2  
ATOM 2103  C C    . VAL A 1 8  ? 9.123   0.925   9.408   1.00 0.00 ? 8  VAL A C    2  
ATOM 2104  O O    . VAL A 1 8  ? 8.905   2.041   9.880   1.00 0.00 ? 8  VAL A O    2  
ATOM 2105  C CB   . VAL A 1 8  ? 10.731  -0.810  10.210  1.00 0.00 ? 8  VAL A CB   2  
ATOM 2106  C CG1  . VAL A 1 8  ? 11.715  0.222   10.739  1.00 0.00 ? 8  VAL A CG1  2  
ATOM 2107  C CG2  . VAL A 1 8  ? 10.876  -2.128  10.956  1.00 0.00 ? 8  VAL A CG2  2  
ATOM 2108  H H    . VAL A 1 8  ? 8.367   -1.752  9.105   1.00 0.00 ? 8  VAL A H    2  
ATOM 2109  H HA   . VAL A 1 8  ? 9.110   0.015   11.340  1.00 0.00 ? 8  VAL A HA   2  
ATOM 2110  H HB   . VAL A 1 8  ? 10.953  -0.985  9.167   1.00 0.00 ? 8  VAL A HB   2  
ATOM 2111  H HG11 . VAL A 1 8  ? 12.592  0.239   10.109  1.00 0.00 ? 8  VAL A HG11 2  
ATOM 2112  H HG12 . VAL A 1 8  ? 12.000  -0.037  11.748  1.00 0.00 ? 8  VAL A HG12 2  
ATOM 2113  H HG13 . VAL A 1 8  ? 11.250  1.197   10.735  1.00 0.00 ? 8  VAL A HG13 2  
ATOM 2114  H HG21 . VAL A 1 8  ? 10.323  -2.079  11.883  1.00 0.00 ? 8  VAL A HG21 2  
ATOM 2115  H HG22 . VAL A 1 8  ? 11.919  -2.309  11.168  1.00 0.00 ? 8  VAL A HG22 2  
ATOM 2116  H HG23 . VAL A 1 8  ? 10.488  -2.931  10.347  1.00 0.00 ? 8  VAL A HG23 2  
ATOM 2117  N N    . GLY A 1 9  ? 9.228   0.700   8.102   1.00 0.00 ? 9  GLY A N    2  
ATOM 2118  C CA   . GLY A 1 9  ? 9.087   1.786   7.149   1.00 0.00 ? 9  GLY A CA   2  
ATOM 2119  C C    . GLY A 1 9  ? 9.276   1.332   5.714   1.00 0.00 ? 9  GLY A C    2  
ATOM 2120  O O    . GLY A 1 9  ? 10.386  1.374   5.184   1.00 0.00 ? 9  GLY A O    2  
ATOM 2121  H H    . GLY A 1 9  ? 9.403   -0.210  7.782   1.00 0.00 ? 9  GLY A H    2  
ATOM 2122  H HA2  . GLY A 1 9  ? 8.101   2.214   7.252   1.00 0.00 ? 9  GLY A HA2  2  
ATOM 2123  H HA3  . GLY A 1 9  ? 9.823   2.544   7.374   1.00 0.00 ? 9  GLY A HA3  2  
ATOM 2124  N N    . GLU A 1 10 ? 8.188   0.898   5.083   1.00 0.00 ? 10 GLU A N    2  
ATOM 2125  C CA   . GLU A 1 10 ? 8.240   0.438   3.700   1.00 0.00 ? 10 GLU A CA   2  
ATOM 2126  C C    . GLU A 1 10 ? 7.827   1.552   2.743   1.00 0.00 ? 10 GLU A C    2  
ATOM 2127  O O    . GLU A 1 10 ? 8.658   2.098   2.017   1.00 0.00 ? 10 GLU A O    2  
ATOM 2128  C CB   . GLU A 1 10 ? 7.333   -0.781  3.510   1.00 0.00 ? 10 GLU A CB   2  
ATOM 2129  C CG   . GLU A 1 10 ? 7.958   -1.877  2.662   1.00 0.00 ? 10 GLU A CG   2  
ATOM 2130  C CD   . GLU A 1 10 ? 7.791   -1.629  1.176   1.00 0.00 ? 10 GLU A CD   2  
ATOM 2131  O OE1  . GLU A 1 10 ? 6.642   -1.688  0.689   1.00 0.00 ? 10 GLU A OE1  2  
ATOM 2132  O OE2  . GLU A 1 10 ? 8.809   -1.377  0.498   1.00 0.00 ? 10 GLU A OE2  2  
ATOM 2133  H H    . GLU A 1 10 ? 7.331   0.891   5.558   1.00 0.00 ? 10 GLU A H    2  
ATOM 2134  H HA   . GLU A 1 10 ? 9.259   0.154   3.484   1.00 0.00 ? 10 GLU A HA   2  
ATOM 2135  H HB2  . GLU A 1 10 ? 7.100   -1.194  4.480   1.00 0.00 ? 10 GLU A HB2  2  
ATOM 2136  H HB3  . GLU A 1 10 ? 6.418   -0.464  3.033   1.00 0.00 ? 10 GLU A HB3  2  
ATOM 2137  H HG2  . GLU A 1 10 ? 9.013   -1.931  2.886   1.00 0.00 ? 10 GLU A HG2  2  
ATOM 2138  H HG3  . GLU A 1 10 ? 7.489   -2.817  2.911   1.00 0.00 ? 10 GLU A HG3  2  
ATOM 2139  N N    . THR A 1 11 ? 6.539   1.891   2.753   1.00 0.00 ? 11 THR A N    2  
ATOM 2140  C CA   . THR A 1 11 ? 6.010   2.947   1.892   1.00 0.00 ? 11 THR A CA   2  
ATOM 2141  C C    . THR A 1 11 ? 5.872   2.475   0.447   1.00 0.00 ? 11 THR A C    2  
ATOM 2142  O O    . THR A 1 11 ? 6.856   2.392   -0.289  1.00 0.00 ? 11 THR A O    2  
ATOM 2143  C CB   . THR A 1 11 ? 6.902   4.190   1.950   1.00 0.00 ? 11 THR A CB   2  
ATOM 2144  O OG1  . THR A 1 11 ? 7.368   4.413   3.269   1.00 0.00 ? 11 THR A OG1  2  
ATOM 2145  C CG2  . THR A 1 11 ? 6.202   5.451   1.491   1.00 0.00 ? 11 THR A CG2  2  
ATOM 2146  H H    . THR A 1 11 ? 5.925   1.423   3.356   1.00 0.00 ? 11 THR A H    2  
ATOM 2147  H HA   . THR A 1 11 ? 5.030   3.207   2.262   1.00 0.00 ? 11 THR A HA   2  
ATOM 2148  H HB   . THR A 1 11 ? 7.759   4.036   1.309   1.00 0.00 ? 11 THR A HB   2  
ATOM 2149  H HG1  . THR A 1 11 ? 8.322   4.518   3.259   1.00 0.00 ? 11 THR A HG1  2  
ATOM 2150  H HG21 . THR A 1 11 ? 5.154   5.395   1.748   1.00 0.00 ? 11 THR A HG21 2  
ATOM 2151  H HG22 . THR A 1 11 ? 6.305   5.551   0.420   1.00 0.00 ? 11 THR A HG22 2  
ATOM 2152  H HG23 . THR A 1 11 ? 6.646   6.307   1.977   1.00 0.00 ? 11 THR A HG23 2  
ATOM 2153  N N    . LEU A 1 12 ? 4.638   2.183   0.045   1.00 0.00 ? 12 LEU A N    2  
ATOM 2154  C CA   . LEU A 1 12 ? 4.355   1.738   -1.315  1.00 0.00 ? 12 LEU A CA   2  
ATOM 2155  C C    . LEU A 1 12 ? 3.622   2.835   -2.080  1.00 0.00 ? 12 LEU A C    2  
ATOM 2156  O O    . LEU A 1 12 ? 2.952   3.674   -1.477  1.00 0.00 ? 12 LEU A O    2  
ATOM 2157  C CB   . LEU A 1 12 ? 3.527   0.444   -1.302  1.00 0.00 ? 12 LEU A CB   2  
ATOM 2158  C CG   . LEU A 1 12 ? 2.009   0.624   -1.167  1.00 0.00 ? 12 LEU A CG   2  
ATOM 2159  C CD1  . LEU A 1 12 ? 1.273   -0.568  -1.760  1.00 0.00 ? 12 LEU A CD1  2  
ATOM 2160  C CD2  . LEU A 1 12 ? 1.625   0.820   0.290   1.00 0.00 ? 12 LEU A CD2  2  
ATOM 2161  H H    . LEU A 1 12 ? 3.896   2.282   0.677   1.00 0.00 ? 12 LEU A H    2  
ATOM 2162  H HA   . LEU A 1 12 ? 5.300   1.547   -1.804  1.00 0.00 ? 12 LEU A HA   2  
ATOM 2163  H HB2  . LEU A 1 12 ? 3.723   -0.089  -2.221  1.00 0.00 ? 12 LEU A HB2  2  
ATOM 2164  H HB3  . LEU A 1 12 ? 3.867   -0.164  -0.477  1.00 0.00 ? 12 LEU A HB3  2  
ATOM 2165  H HG   . LEU A 1 12 ? 1.705   1.503   -1.715  1.00 0.00 ? 12 LEU A HG   2  
ATOM 2166  H HD11 . LEU A 1 12 ? 0.956   -1.227  -0.965  1.00 0.00 ? 12 LEU A HD11 2  
ATOM 2167  H HD12 . LEU A 1 12 ? 1.930   -1.101  -2.430  1.00 0.00 ? 12 LEU A HD12 2  
ATOM 2168  H HD13 . LEU A 1 12 ? 0.407   -0.219  -2.306  1.00 0.00 ? 12 LEU A HD13 2  
ATOM 2169  H HD21 . LEU A 1 12 ? 1.977   1.783   0.626   1.00 0.00 ? 12 LEU A HD21 2  
ATOM 2170  H HD22 . LEU A 1 12 ? 2.073   0.042   0.889   1.00 0.00 ? 12 LEU A HD22 2  
ATOM 2171  H HD23 . LEU A 1 12 ? 0.550   0.776   0.387   1.00 0.00 ? 12 LEU A HD23 2  
ATOM 2172  N N    . MET A 1 13 ? 3.745   2.834   -3.402  1.00 0.00 ? 13 MET A N    2  
ATOM 2173  C CA   . MET A 1 13 ? 3.081   3.842   -4.214  1.00 0.00 ? 13 MET A CA   2  
ATOM 2174  C C    . MET A 1 13 ? 2.267   3.204   -5.326  1.00 0.00 ? 13 MET A C    2  
ATOM 2175  O O    . MET A 1 13 ? 2.804   2.806   -6.358  1.00 0.00 ? 13 MET A O    2  
ATOM 2176  C CB   . MET A 1 13 ? 4.106   4.812   -4.804  1.00 0.00 ? 13 MET A CB   2  
ATOM 2177  C CG   . MET A 1 13 ? 3.484   5.933   -5.620  1.00 0.00 ? 13 MET A CG   2  
ATOM 2178  S SD   . MET A 1 13 ? 4.657   6.700   -6.754  1.00 0.00 ? 13 MET A SD   2  
ATOM 2179  C CE   . MET A 1 13 ? 4.422   5.692   -8.215  1.00 0.00 ? 13 MET A CE   2  
ATOM 2180  H H    . MET A 1 13 ? 4.287   2.144   -3.838  1.00 0.00 ? 13 MET A H    2  
ATOM 2181  H HA   . MET A 1 13 ? 2.409   4.389   -3.573  1.00 0.00 ? 13 MET A HA   2  
ATOM 2182  H HB2  . MET A 1 13 ? 4.671   5.255   -3.997  1.00 0.00 ? 13 MET A HB2  2  
ATOM 2183  H HB3  . MET A 1 13 ? 4.780   4.262   -5.443  1.00 0.00 ? 13 MET A HB3  2  
ATOM 2184  H HG2  . MET A 1 13 ? 2.662   5.530   -6.193  1.00 0.00 ? 13 MET A HG2  2  
ATOM 2185  H HG3  . MET A 1 13 ? 3.112   6.689   -4.943  1.00 0.00 ? 13 MET A HG3  2  
ATOM 2186  H HE1  . MET A 1 13 ? 3.493   5.963   -8.694  1.00 0.00 ? 13 MET A HE1  2  
ATOM 2187  H HE2  . MET A 1 13 ? 4.391   4.650   -7.933  1.00 0.00 ? 13 MET A HE2  2  
ATOM 2188  H HE3  . MET A 1 13 ? 5.242   5.855   -8.900  1.00 0.00 ? 13 MET A HE3  2  
ATOM 2189  N N    . ILE A 1 14 ? 0.963   3.118   -5.103  1.00 0.00 ? 14 ILE A N    2  
ATOM 2190  C CA   . ILE A 1 14 ? 0.054   2.540   -6.073  1.00 0.00 ? 14 ILE A CA   2  
ATOM 2191  C C    . ILE A 1 14 ? -0.878  3.612   -6.635  1.00 0.00 ? 14 ILE A C    2  
ATOM 2192  O O    . ILE A 1 14 ? -1.588  4.284   -5.887  1.00 0.00 ? 14 ILE A O    2  
ATOM 2193  C CB   . ILE A 1 14 ? -0.772  1.400   -5.439  1.00 0.00 ? 14 ILE A CB   2  
ATOM 2194  C CG1  . ILE A 1 14 ? -1.878  0.923   -6.388  1.00 0.00 ? 14 ILE A CG1  2  
ATOM 2195  C CG2  . ILE A 1 14 ? -1.362  1.847   -4.110  1.00 0.00 ? 14 ILE A CG2  2  
ATOM 2196  C CD1  . ILE A 1 14 ? -1.387  0.595   -7.780  1.00 0.00 ? 14 ILE A CD1  2  
ATOM 2197  H H    . ILE A 1 14 ? 0.602   3.455   -4.261  1.00 0.00 ? 14 ILE A H    2  
ATOM 2198  H HA   . ILE A 1 14 ? 0.647   2.127   -6.876  1.00 0.00 ? 14 ILE A HA   2  
ATOM 2199  H HB   . ILE A 1 14 ? -0.100  0.580   -5.240  1.00 0.00 ? 14 ILE A HB   2  
ATOM 2200  H HG12 . ILE A 1 14 ? -2.334  0.034   -5.980  1.00 0.00 ? 14 ILE A HG12 2  
ATOM 2201  H HG13 . ILE A 1 14 ? -2.627  1.698   -6.473  1.00 0.00 ? 14 ILE A HG13 2  
ATOM 2202  H HG21 . ILE A 1 14 ? -0.737  1.493   -3.302  1.00 0.00 ? 14 ILE A HG21 2  
ATOM 2203  H HG22 . ILE A 1 14 ? -2.356  1.437   -4.001  1.00 0.00 ? 14 ILE A HG22 2  
ATOM 2204  H HG23 . ILE A 1 14 ? -1.412  2.925   -4.082  1.00 0.00 ? 14 ILE A HG23 2  
ATOM 2205  H HD11 . ILE A 1 14 ? -0.623  1.302   -8.066  1.00 0.00 ? 14 ILE A HD11 2  
ATOM 2206  H HD12 . ILE A 1 14 ? -2.211  0.654   -8.476  1.00 0.00 ? 14 ILE A HD12 2  
ATOM 2207  H HD13 . ILE A 1 14 ? -0.976  -0.403  -7.791  1.00 0.00 ? 14 ILE A HD13 2  
ATOM 2208  N N    . GLY A 1 15 ? -0.867  3.770   -7.955  1.00 0.00 ? 15 GLY A N    2  
ATOM 2209  C CA   . GLY A 1 15 ? -1.708  4.767   -8.594  1.00 0.00 ? 15 GLY A CA   2  
ATOM 2210  C C    . GLY A 1 15 ? -0.945  5.577   -9.627  1.00 0.00 ? 15 GLY A C    2  
ATOM 2211  O O    . GLY A 1 15 ? -0.657  5.087   -10.720 1.00 0.00 ? 15 GLY A O    2  
ATOM 2212  H H    . GLY A 1 15 ? -0.283  3.207   -8.505  1.00 0.00 ? 15 GLY A H    2  
ATOM 2213  H HA2  . GLY A 1 15 ? -2.534  4.269   -9.080  1.00 0.00 ? 15 GLY A HA2  2  
ATOM 2214  H HA3  . GLY A 1 15 ? -2.098  5.438   -7.840  1.00 0.00 ? 15 GLY A HA3  2  
ATOM 2215  N N    . ASP A 1 16 ? -0.612  6.817   -9.279  1.00 0.00 ? 16 ASP A N    2  
ATOM 2216  C CA   . ASP A 1 16 ? 0.128   7.692   -10.186 1.00 0.00 ? 16 ASP A CA   2  
ATOM 2217  C C    . ASP A 1 16 ? 0.826   8.832   -9.437  1.00 0.00 ? 16 ASP A C    2  
ATOM 2218  O O    . ASP A 1 16 ? 1.314   9.775   -10.060 1.00 0.00 ? 16 ASP A O    2  
ATOM 2219  C CB   . ASP A 1 16 ? -0.814  8.270   -11.244 1.00 0.00 ? 16 ASP A CB   2  
ATOM 2220  C CG   . ASP A 1 16 ? -0.161  8.370   -12.608 1.00 0.00 ? 16 ASP A CG   2  
ATOM 2221  O OD1  . ASP A 1 16 ? 0.441   7.370   -13.053 1.00 0.00 ? 16 ASP A OD1  2  
ATOM 2222  O OD2  . ASP A 1 16 ? -0.251  9.448   -13.232 1.00 0.00 ? 16 ASP A OD2  2  
ATOM 2223  H H    . ASP A 1 16 ? -0.869  7.149   -8.394  1.00 0.00 ? 16 ASP A H    2  
ATOM 2224  H HA   . ASP A 1 16 ? 0.878   7.093   -10.680 1.00 0.00 ? 16 ASP A HA   2  
ATOM 2225  H HB2  . ASP A 1 16 ? -1.684  7.634   -11.329 1.00 0.00 ? 16 ASP A HB2  2  
ATOM 2226  H HB3  . ASP A 1 16 ? -1.125  9.258   -10.940 1.00 0.00 ? 16 ASP A HB3  2  
ATOM 2227  N N    . GLU A 1 17 ? 0.872   8.737   -8.104  1.00 0.00 ? 17 GLU A N    2  
ATOM 2228  C CA   . GLU A 1 17 ? 1.509   9.753   -7.259  1.00 0.00 ? 17 GLU A CA   2  
ATOM 2229  C C    . GLU A 1 17 ? 0.941   9.684   -5.843  1.00 0.00 ? 17 GLU A C    2  
ATOM 2230  O O    . GLU A 1 17 ? 0.327   10.635  -5.360  1.00 0.00 ? 17 GLU A O    2  
ATOM 2231  C CB   . GLU A 1 17 ? 1.303   11.163  -7.832  1.00 0.00 ? 17 GLU A CB   2  
ATOM 2232  C CG   . GLU A 1 17 ? 2.521   11.708  -8.559  1.00 0.00 ? 17 GLU A CG   2  
ATOM 2233  C CD   . GLU A 1 17 ? 3.277   12.736  -7.739  1.00 0.00 ? 17 GLU A CD   2  
ATOM 2234  O OE1  . GLU A 1 17 ? 4.183   12.337  -6.977  1.00 0.00 ? 17 GLU A OE1  2  
ATOM 2235  O OE2  . GLU A 1 17 ? 2.963   13.938  -7.859  1.00 0.00 ? 17 GLU A OE2  2  
ATOM 2236  H H    . GLU A 1 17 ? 0.470   7.958   -7.671  1.00 0.00 ? 17 GLU A H    2  
ATOM 2237  H HA   . GLU A 1 17 ? 2.567   9.538   -7.221  1.00 0.00 ? 17 GLU A HA   2  
ATOM 2238  H HB2  . GLU A 1 17 ? 0.476   11.140  -8.527  1.00 0.00 ? 17 GLU A HB2  2  
ATOM 2239  H HB3  . GLU A 1 17 ? 1.062   11.839  -7.025  1.00 0.00 ? 17 GLU A HB3  2  
ATOM 2240  H HG2  . GLU A 1 17 ? 3.187   10.889  -8.783  1.00 0.00 ? 17 GLU A HG2  2  
ATOM 2241  H HG3  . GLU A 1 17 ? 2.198   12.171  -9.480  1.00 0.00 ? 17 GLU A HG3  2  
ATOM 2242  N N    . VAL A 1 18 ? 1.133   8.544   -5.188  1.00 0.00 ? 18 VAL A N    2  
ATOM 2243  C CA   . VAL A 1 18 ? 0.626   8.341   -3.847  1.00 0.00 ? 18 VAL A CA   2  
ATOM 2244  C C    . VAL A 1 18 ? 1.759   8.086   -2.844  1.00 0.00 ? 18 VAL A C    2  
ATOM 2245  O O    . VAL A 1 18 ? 2.900   8.487   -3.069  1.00 0.00 ? 18 VAL A O    2  
ATOM 2246  C CB   . VAL A 1 18 ? -0.361  7.160   -3.839  1.00 0.00 ? 18 VAL A CB   2  
ATOM 2247  C CG1  . VAL A 1 18 ? -1.471  7.384   -4.856  1.00 0.00 ? 18 VAL A CG1  2  
ATOM 2248  C CG2  . VAL A 1 18 ? 0.364   5.848   -4.105  1.00 0.00 ? 18 VAL A CG2  2  
ATOM 2249  H H    . VAL A 1 18 ? 1.615   7.816   -5.622  1.00 0.00 ? 18 VAL A H    2  
ATOM 2250  H HA   . VAL A 1 18 ? 0.090   9.231   -3.553  1.00 0.00 ? 18 VAL A HA   2  
ATOM 2251  H HB   . VAL A 1 18 ? -0.807  7.107   -2.867  1.00 0.00 ? 18 VAL A HB   2  
ATOM 2252  H HG11 . VAL A 1 18 ? -1.183  8.172   -5.536  1.00 0.00 ? 18 VAL A HG11 2  
ATOM 2253  H HG12 . VAL A 1 18 ? -2.378  7.665   -4.343  1.00 0.00 ? 18 VAL A HG12 2  
ATOM 2254  H HG13 . VAL A 1 18 ? -1.639  6.473   -5.412  1.00 0.00 ? 18 VAL A HG13 2  
ATOM 2255  H HG21 . VAL A 1 18 ? 1.430   6.014   -4.089  1.00 0.00 ? 18 VAL A HG21 2  
ATOM 2256  H HG22 . VAL A 1 18 ? 0.076   5.467   -5.073  1.00 0.00 ? 18 VAL A HG22 2  
ATOM 2257  H HG23 . VAL A 1 18 ? 0.100   5.130   -3.343  1.00 0.00 ? 18 VAL A HG23 2  
ATOM 2258  N N    . THR A 1 19 ? 1.428   7.412   -1.740  1.00 0.00 ? 19 THR A N    2  
ATOM 2259  C CA   . THR A 1 19 ? 2.394   7.088   -0.691  1.00 0.00 ? 19 THR A CA   2  
ATOM 2260  C C    . THR A 1 19 ? 1.656   6.575   0.541   1.00 0.00 ? 19 THR A C    2  
ATOM 2261  O O    . THR A 1 19 ? 1.064   7.354   1.283   1.00 0.00 ? 19 THR A O    2  
ATOM 2262  C CB   . THR A 1 19 ? 3.239   8.314   -0.322  1.00 0.00 ? 19 THR A CB   2  
ATOM 2263  O OG1  . THR A 1 19 ? 2.589   9.512   -0.707  1.00 0.00 ? 19 THR A OG1  2  
ATOM 2264  C CG2  . THR A 1 19 ? 4.611   8.309   -0.961  1.00 0.00 ? 19 THR A CG2  2  
ATOM 2265  H H    . THR A 1 19 ? 0.504   7.116   -1.625  1.00 0.00 ? 19 THR A H    2  
ATOM 2266  H HA   . THR A 1 19 ? 3.041   6.307   -1.063  1.00 0.00 ? 19 THR A HA   2  
ATOM 2267  H HB   . THR A 1 19 ? 3.376   8.333   0.750   1.00 0.00 ? 19 THR A HB   2  
ATOM 2268  H HG1  . THR A 1 19 ? 1.658   9.461   -0.475  1.00 0.00 ? 19 THR A HG1  2  
ATOM 2269  H HG21 . THR A 1 19 ? 5.360   8.505   -0.208  1.00 0.00 ? 19 THR A HG21 2  
ATOM 2270  H HG22 . THR A 1 19 ? 4.656   9.075   -1.722  1.00 0.00 ? 19 THR A HG22 2  
ATOM 2271  H HG23 . THR A 1 19 ? 4.796   7.345   -1.410  1.00 0.00 ? 19 THR A HG23 2  
ATOM 2272  N N    . VAL A 1 20 ? 1.677   5.264   0.750   1.00 0.00 ? 20 VAL A N    2  
ATOM 2273  C CA   . VAL A 1 20 ? 0.986   4.671   1.889   1.00 0.00 ? 20 VAL A CA   2  
ATOM 2274  C C    . VAL A 1 20 ? 1.950   3.927   2.812   1.00 0.00 ? 20 VAL A C    2  
ATOM 2275  O O    . VAL A 1 20 ? 2.488   2.881   2.451   1.00 0.00 ? 20 VAL A O    2  
ATOM 2276  C CB   . VAL A 1 20 ? -0.113  3.694   1.426   1.00 0.00 ? 20 VAL A CB   2  
ATOM 2277  C CG1  . VAL A 1 20 ? -0.937  3.208   2.609   1.00 0.00 ? 20 VAL A CG1  2  
ATOM 2278  C CG2  . VAL A 1 20 ? -1.004  4.346   0.381   1.00 0.00 ? 20 VAL A CG2  2  
ATOM 2279  H H    . VAL A 1 20 ? 2.158   4.684   0.123   1.00 0.00 ? 20 VAL A H    2  
ATOM 2280  H HA   . VAL A 1 20 ? 0.512   5.471   2.443   1.00 0.00 ? 20 VAL A HA   2  
ATOM 2281  H HB   . VAL A 1 20 ? 0.364   2.837   0.974   1.00 0.00 ? 20 VAL A HB   2  
ATOM 2282  H HG11 . VAL A 1 20 ? -1.178  2.164   2.475   1.00 0.00 ? 20 VAL A HG11 2  
ATOM 2283  H HG12 . VAL A 1 20 ? -1.849  3.782   2.671   1.00 0.00 ? 20 VAL A HG12 2  
ATOM 2284  H HG13 . VAL A 1 20 ? -0.369  3.333   3.519   1.00 0.00 ? 20 VAL A HG13 2  
ATOM 2285  H HG21 . VAL A 1 20 ? -0.397  4.711   -0.434  1.00 0.00 ? 20 VAL A HG21 2  
ATOM 2286  H HG22 . VAL A 1 20 ? -1.540  5.171   0.828   1.00 0.00 ? 20 VAL A HG22 2  
ATOM 2287  H HG23 . VAL A 1 20 ? -1.710  3.619   0.006   1.00 0.00 ? 20 VAL A HG23 2  
ATOM 2288  N N    . THR A 1 21 ? 2.153   4.468   4.009   1.00 0.00 ? 21 THR A N    2  
ATOM 2289  C CA   . THR A 1 21 ? 3.040   3.850   4.990   1.00 0.00 ? 21 THR A CA   2  
ATOM 2290  C C    . THR A 1 21 ? 2.249   2.938   5.926   1.00 0.00 ? 21 THR A C    2  
ATOM 2291  O O    . THR A 1 21 ? 1.419   3.404   6.706   1.00 0.00 ? 21 THR A O    2  
ATOM 2292  C CB   . THR A 1 21 ? 3.769   4.924   5.799   1.00 0.00 ? 21 THR A CB   2  
ATOM 2293  O OG1  . THR A 1 21 ? 3.975   6.087   5.017   1.00 0.00 ? 21 THR A OG1  2  
ATOM 2294  C CG2  . THR A 1 21 ? 5.119   4.472   6.314   1.00 0.00 ? 21 THR A CG2  2  
ATOM 2295  H H    . THR A 1 21 ? 1.691   5.300   4.241   1.00 0.00 ? 21 THR A H    2  
ATOM 2296  H HA   . THR A 1 21 ? 3.766   3.256   4.455   1.00 0.00 ? 21 THR A HA   2  
ATOM 2297  H HB   . THR A 1 21 ? 3.162   5.191   6.652   1.00 0.00 ? 21 THR A HB   2  
ATOM 2298  H HG1  . THR A 1 21 ? 4.433   6.748   5.541   1.00 0.00 ? 21 THR A HG1  2  
ATOM 2299  H HG21 . THR A 1 21 ? 5.562   3.786   5.608   1.00 0.00 ? 21 THR A HG21 2  
ATOM 2300  H HG22 . THR A 1 21 ? 4.994   3.979   7.267   1.00 0.00 ? 21 THR A HG22 2  
ATOM 2301  H HG23 . THR A 1 21 ? 5.763   5.330   6.435   1.00 0.00 ? 21 THR A HG23 2  
ATOM 2302  N N    . VAL A 1 22 ? 2.503   1.636   5.834   1.00 0.00 ? 22 VAL A N    2  
ATOM 2303  C CA   . VAL A 1 22 ? 1.803   0.659   6.665   1.00 0.00 ? 22 VAL A CA   2  
ATOM 2304  C C    . VAL A 1 22 ? 2.464   0.501   8.032   1.00 0.00 ? 22 VAL A C    2  
ATOM 2305  O O    . VAL A 1 22 ? 2.950   -0.577  8.379   1.00 0.00 ? 22 VAL A O    2  
ATOM 2306  C CB   . VAL A 1 22 ? 1.739   -0.716  5.975   1.00 0.00 ? 22 VAL A CB   2  
ATOM 2307  C CG1  . VAL A 1 22 ? 0.899   -0.641  4.709   1.00 0.00 ? 22 VAL A CG1  2  
ATOM 2308  C CG2  . VAL A 1 22 ? 3.139   -1.223  5.665   1.00 0.00 ? 22 VAL A CG2  2  
ATOM 2309  H H    . VAL A 1 22 ? 3.168   1.323   5.187   1.00 0.00 ? 22 VAL A H    2  
ATOM 2310  H HA   . VAL A 1 22 ? 0.792   1.012   6.808   1.00 0.00 ? 22 VAL A HA   2  
ATOM 2311  H HB   . VAL A 1 22 ? 1.267   -1.414  6.651   1.00 0.00 ? 22 VAL A HB   2  
ATOM 2312  H HG11 . VAL A 1 22 ? -0.146  -0.573  4.974   1.00 0.00 ? 22 VAL A HG11 2  
ATOM 2313  H HG12 . VAL A 1 22 ? 1.063   -1.528  4.115   1.00 0.00 ? 22 VAL A HG12 2  
ATOM 2314  H HG13 . VAL A 1 22 ? 1.183   0.232   4.140   1.00 0.00 ? 22 VAL A HG13 2  
ATOM 2315  H HG21 . VAL A 1 22 ? 3.847   -0.758  6.335   1.00 0.00 ? 22 VAL A HG21 2  
ATOM 2316  H HG22 . VAL A 1 22 ? 3.394   -0.977  4.645   1.00 0.00 ? 22 VAL A HG22 2  
ATOM 2317  H HG23 . VAL A 1 22 ? 3.170   -2.295  5.796   1.00 0.00 ? 22 VAL A HG23 2  
ATOM 2318  N N    . LEU A 1 23 ? 2.474   1.582   8.807   1.00 0.00 ? 23 LEU A N    2  
ATOM 2319  C CA   . LEU A 1 23 ? 3.069   1.570   10.144  1.00 0.00 ? 23 LEU A CA   2  
ATOM 2320  C C    . LEU A 1 23 ? 2.645   0.325   10.924  1.00 0.00 ? 23 LEU A C    2  
ATOM 2321  O O    . LEU A 1 23 ? 1.455   0.084   11.124  1.00 0.00 ? 23 LEU A O    2  
ATOM 2322  C CB   . LEU A 1 23 ? 2.660   2.830   10.911  1.00 0.00 ? 23 LEU A CB   2  
ATOM 2323  C CG   . LEU A 1 23 ? 3.795   3.540   11.649  1.00 0.00 ? 23 LEU A CG   2  
ATOM 2324  C CD1  . LEU A 1 23 ? 4.387   2.631   12.717  1.00 0.00 ? 23 LEU A CD1  2  
ATOM 2325  C CD2  . LEU A 1 23 ? 4.870   3.989   10.670  1.00 0.00 ? 23 LEU A CD2  2  
ATOM 2326  H H    . LEU A 1 23 ? 2.072   2.409   8.469   1.00 0.00 ? 23 LEU A H    2  
ATOM 2327  H HA   . LEU A 1 23 ? 4.143   1.561   10.029  1.00 0.00 ? 23 LEU A HA   2  
ATOM 2328  H HB2  . LEU A 1 23 ? 2.224   3.526   10.209  1.00 0.00 ? 23 LEU A HB2  2  
ATOM 2329  H HB3  . LEU A 1 23 ? 1.907   2.557   11.635  1.00 0.00 ? 23 LEU A HB3  2  
ATOM 2330  H HG   . LEU A 1 23 ? 3.399   4.420   12.139  1.00 0.00 ? 23 LEU A HG   2  
ATOM 2331  H HD11 . LEU A 1 23 ? 5.082   3.193   13.324  1.00 0.00 ? 23 LEU A HD11 2  
ATOM 2332  H HD12 . LEU A 1 23 ? 4.904   1.808   12.245  1.00 0.00 ? 23 LEU A HD12 2  
ATOM 2333  H HD13 . LEU A 1 23 ? 3.594   2.246   13.342  1.00 0.00 ? 23 LEU A HD13 2  
ATOM 2334  H HD21 . LEU A 1 23 ? 4.787   3.418   9.757   1.00 0.00 ? 23 LEU A HD21 2  
ATOM 2335  H HD22 . LEU A 1 23 ? 5.845   3.829   11.107  1.00 0.00 ? 23 LEU A HD22 2  
ATOM 2336  H HD23 . LEU A 1 23 ? 4.742   5.039   10.451  1.00 0.00 ? 23 LEU A HD23 2  
ATOM 2337  N N    . GLY A 1 24 ? 3.625   -0.465  11.356  1.00 0.00 ? 24 GLY A N    2  
ATOM 2338  C CA   . GLY A 1 24 ? 3.329   -1.676  12.102  1.00 0.00 ? 24 GLY A CA   2  
ATOM 2339  C C    . GLY A 1 24 ? 3.489   -1.503  13.601  1.00 0.00 ? 24 GLY A C    2  
ATOM 2340  O O    . GLY A 1 24 ? 3.009   -2.328  14.379  1.00 0.00 ? 24 GLY A O    2  
ATOM 2341  H H    . GLY A 1 24 ? 4.556   -0.225  11.163  1.00 0.00 ? 24 GLY A H    2  
ATOM 2342  H HA2  . GLY A 1 24 ? 2.311   -1.971  11.894  1.00 0.00 ? 24 GLY A HA2  2  
ATOM 2343  H HA3  . GLY A 1 24 ? 3.992   -2.461  11.770  1.00 0.00 ? 24 GLY A HA3  2  
ATOM 2344  N N    . VAL A 1 25 ? 4.164   -0.434  14.011  1.00 0.00 ? 25 VAL A N    2  
ATOM 2345  C CA   . VAL A 1 25 ? 4.379   -0.166  15.424  1.00 0.00 ? 25 VAL A CA   2  
ATOM 2346  C C    . VAL A 1 25 ? 3.192   0.586   16.010  1.00 0.00 ? 25 VAL A C    2  
ATOM 2347  O O    . VAL A 1 25 ? 2.800   1.634   15.496  1.00 0.00 ? 25 VAL A O    2  
ATOM 2348  C CB   . VAL A 1 25 ? 5.663   0.656   15.661  1.00 0.00 ? 25 VAL A CB   2  
ATOM 2349  C CG1  . VAL A 1 25 ? 6.165   0.464   17.084  1.00 0.00 ? 25 VAL A CG1  2  
ATOM 2350  C CG2  . VAL A 1 25 ? 6.742   0.280   14.653  1.00 0.00 ? 25 VAL A CG2  2  
ATOM 2351  H H    . VAL A 1 25 ? 4.525   0.186   13.352  1.00 0.00 ? 25 VAL A H    2  
ATOM 2352  H HA   . VAL A 1 25 ? 4.481   -1.112  15.925  1.00 0.00 ? 25 VAL A HA   2  
ATOM 2353  H HB   . VAL A 1 25 ? 5.425   1.701   15.526  1.00 0.00 ? 25 VAL A HB   2  
ATOM 2354  H HG11 . VAL A 1 25 ? 7.244   0.492   17.092  1.00 0.00 ? 25 VAL A HG11 2  
ATOM 2355  H HG12 . VAL A 1 25 ? 5.826   -0.490  17.459  1.00 0.00 ? 25 VAL A HG12 2  
ATOM 2356  H HG13 . VAL A 1 25 ? 5.779   1.255   17.710  1.00 0.00 ? 25 VAL A HG13 2  
ATOM 2357  H HG21 . VAL A 1 25 ? 6.499   0.707   13.690  1.00 0.00 ? 25 VAL A HG21 2  
ATOM 2358  H HG22 . VAL A 1 25 ? 6.796   -0.795  14.567  1.00 0.00 ? 25 VAL A HG22 2  
ATOM 2359  H HG23 . VAL A 1 25 ? 7.695   0.663   14.987  1.00 0.00 ? 25 VAL A HG23 2  
ATOM 2360  N N    . LYS A 1 26 ? 2.618   0.050   17.085  1.00 0.00 ? 26 LYS A N    2  
ATOM 2361  C CA   . LYS A 1 26 ? 1.469   0.673   17.735  1.00 0.00 ? 26 LYS A CA   2  
ATOM 2362  C C    . LYS A 1 26 ? 0.970   -0.191  18.891  1.00 0.00 ? 26 LYS A C    2  
ATOM 2363  O O    . LYS A 1 26 ? 1.332   -1.362  19.005  1.00 0.00 ? 26 LYS A O    2  
ATOM 2364  C CB   . LYS A 1 26 ? 0.336   0.892   16.728  1.00 0.00 ? 26 LYS A CB   2  
ATOM 2365  C CG   . LYS A 1 26 ? -0.547  2.088   17.051  1.00 0.00 ? 26 LYS A CG   2  
ATOM 2366  C CD   . LYS A 1 26 ? 0.268   3.366   17.186  1.00 0.00 ? 26 LYS A CD   2  
ATOM 2367  C CE   . LYS A 1 26 ? 0.236   3.904   18.608  1.00 0.00 ? 26 LYS A CE   2  
ATOM 2368  N NZ   . LYS A 1 26 ? 1.503   3.620   19.339  1.00 0.00 ? 26 LYS A NZ   2  
ATOM 2369  H H    . LYS A 1 26 ? 2.971   -0.784  17.461  1.00 0.00 ? 26 LYS A H    2  
ATOM 2370  H HA   . LYS A 1 26 ? 1.785   1.629   18.124  1.00 0.00 ? 26 LYS A HA   2  
ATOM 2371  H HB2  . LYS A 1 26 ? 0.762   1.042   15.748  1.00 0.00 ? 26 LYS A HB2  2  
ATOM 2372  H HB3  . LYS A 1 26 ? -0.284  0.009   16.707  1.00 0.00 ? 26 LYS A HB3  2  
ATOM 2373  H HG2  . LYS A 1 26 ? -1.267  2.216   16.257  1.00 0.00 ? 26 LYS A HG2  2  
ATOM 2374  H HG3  . LYS A 1 26 ? -1.064  1.900   17.980  1.00 0.00 ? 26 LYS A HG3  2  
ATOM 2375  H HD2  . LYS A 1 26 ? 1.293   3.160   16.914  1.00 0.00 ? 26 LYS A HD2  2  
ATOM 2376  H HD3  . LYS A 1 26 ? -0.139  4.113   16.519  1.00 0.00 ? 26 LYS A HD3  2  
ATOM 2377  H HE2  . LYS A 1 26 ? 0.085   4.972   18.572  1.00 0.00 ? 26 LYS A HE2  2  
ATOM 2378  H HE3  . LYS A 1 26 ? -0.585  3.443   19.137  1.00 0.00 ? 26 LYS A HE3  2  
ATOM 2379  H HZ1  . LYS A 1 26 ? 1.737   4.413   19.969  1.00 0.00 ? 26 LYS A HZ1  2  
ATOM 2380  H HZ2  . LYS A 1 26 ? 2.283   3.485   18.664  1.00 0.00 ? 26 LYS A HZ2  2  
ATOM 2381  H HZ3  . LYS A 1 26 ? 1.400   2.756   19.910  1.00 0.00 ? 26 LYS A HZ3  2  
ATOM 2382  N N    . GLY A 1 27 ? 0.136   0.394   19.745  1.00 0.00 ? 27 GLY A N    2  
ATOM 2383  C CA   . GLY A 1 27 ? -0.402  -0.338  20.879  1.00 0.00 ? 27 GLY A CA   2  
ATOM 2384  C C    . GLY A 1 27 ? -1.718  -1.023  20.558  1.00 0.00 ? 27 GLY A C    2  
ATOM 2385  O O    . GLY A 1 27 ? -2.744  -0.362  20.405  1.00 0.00 ? 27 GLY A O    2  
ATOM 2386  H H    . GLY A 1 27 ? -0.117  1.329   19.598  1.00 0.00 ? 27 GLY A H    2  
ATOM 2387  H HA2  . GLY A 1 27 ? 0.315   -1.085  21.185  1.00 0.00 ? 27 GLY A HA2  2  
ATOM 2388  H HA3  . GLY A 1 27 ? -0.558  0.351   21.696  1.00 0.00 ? 27 GLY A HA3  2  
ATOM 2389  N N    . ASN A 1 28 ? -1.684  -2.352  20.454  1.00 0.00 ? 28 ASN A N    2  
ATOM 2390  C CA   . ASN A 1 28 ? -2.880  -3.137  20.144  1.00 0.00 ? 28 ASN A CA   2  
ATOM 2391  C C    . ASN A 1 28 ? -3.381  -2.828  18.736  1.00 0.00 ? 28 ASN A C    2  
ATOM 2392  O O    . ASN A 1 28 ? -3.282  -3.659  17.834  1.00 0.00 ? 28 ASN A O    2  
ATOM 2393  C CB   . ASN A 1 28 ? -3.985  -2.864  21.168  1.00 0.00 ? 28 ASN A CB   2  
ATOM 2394  C CG   . ASN A 1 28 ? -3.666  -3.446  22.531  1.00 0.00 ? 28 ASN A CG   2  
ATOM 2395  O OD1  . ASN A 1 28 ? -2.596  -3.200  23.089  1.00 0.00 ? 28 ASN A OD1  2  
ATOM 2396  N ND2  . ASN A 1 28 ? -4.595  -4.223  23.076  1.00 0.00 ? 28 ASN A ND2  2  
ATOM 2397  H H    . ASN A 1 28 ? -0.832  -2.818  20.585  1.00 0.00 ? 28 ASN A H    2  
ATOM 2398  H HA   . ASN A 1 28 ? -2.609  -4.181  20.192  1.00 0.00 ? 28 ASN A HA   2  
ATOM 2399  H HB2  . ASN A 1 28 ? -4.117  -1.799  21.274  1.00 0.00 ? 28 ASN A HB2  2  
ATOM 2400  H HB3  . ASN A 1 28 ? -4.908  -3.303  20.817  1.00 0.00 ? 28 ASN A HB3  2  
ATOM 2401  H HD21 . ASN A 1 28 ? -5.423  -4.375  22.574  1.00 0.00 ? 28 ASN A HD21 2  
ATOM 2402  H HD22 . ASN A 1 28 ? -4.415  -4.612  23.957  1.00 0.00 ? 28 ASN A HD22 2  
ATOM 2403  N N    . GLN A 1 29 ? -3.902  -1.621  18.555  1.00 0.00 ? 29 GLN A N    2  
ATOM 2404  C CA   . GLN A 1 29 ? -4.403  -1.187  17.257  1.00 0.00 ? 29 GLN A CA   2  
ATOM 2405  C C    . GLN A 1 29 ? -3.252  -0.640  16.421  1.00 0.00 ? 29 GLN A C    2  
ATOM 2406  O O    . GLN A 1 29 ? -2.407  0.091   16.933  1.00 0.00 ? 29 GLN A O    2  
ATOM 2407  C CB   . GLN A 1 29 ? -5.482  -0.117  17.435  1.00 0.00 ? 29 GLN A CB   2  
ATOM 2408  C CG   . GLN A 1 29 ? -6.896  -0.641  17.240  1.00 0.00 ? 29 GLN A CG   2  
ATOM 2409  C CD   . GLN A 1 29 ? -7.953  0.376   17.625  1.00 0.00 ? 29 GLN A CD   2  
ATOM 2410  O OE1  . GLN A 1 29 ? -8.838  0.698   16.833  1.00 0.00 ? 29 GLN A OE1  2  
ATOM 2411  N NE2  . GLN A 1 29 ? -7.864  0.889   18.847  1.00 0.00 ? 29 GLN A NE2  2  
ATOM 2412  H H    . GLN A 1 29 ? -3.939  -1.002  19.314  1.00 0.00 ? 29 GLN A H    2  
ATOM 2413  H HA   . GLN A 1 29 ? -4.828  -2.044  16.756  1.00 0.00 ? 29 GLN A HA   2  
ATOM 2414  H HB2  . GLN A 1 29 ? -5.407  0.290   18.433  1.00 0.00 ? 29 GLN A HB2  2  
ATOM 2415  H HB3  . GLN A 1 29 ? -5.312  0.673   16.720  1.00 0.00 ? 29 GLN A HB3  2  
ATOM 2416  H HG2  . GLN A 1 29 ? -7.030  -0.901  16.201  1.00 0.00 ? 29 GLN A HG2  2  
ATOM 2417  H HG3  . GLN A 1 29 ? -7.026  -1.523  17.851  1.00 0.00 ? 29 GLN A HG3  2  
ATOM 2418  H HE21 . GLN A 1 29 ? -7.132  0.586   19.424  1.00 0.00 ? 29 GLN A HE21 2  
ATOM 2419  H HE22 . GLN A 1 29 ? -8.534  1.549   19.122  1.00 0.00 ? 29 GLN A HE22 2  
ATOM 2420  N N    . VAL A 1 30 ? -3.205  -1.005  15.143  1.00 0.00 ? 30 VAL A N    2  
ATOM 2421  C CA   . VAL A 1 30 ? -2.126  -0.547  14.277  1.00 0.00 ? 30 VAL A CA   2  
ATOM 2422  C C    . VAL A 1 30 ? -2.507  0.724   13.538  1.00 0.00 ? 30 VAL A C    2  
ATOM 2423  O O    . VAL A 1 30 ? -3.469  0.748   12.771  1.00 0.00 ? 30 VAL A O    2  
ATOM 2424  C CB   . VAL A 1 30 ? -1.722  -1.623  13.252  1.00 0.00 ? 30 VAL A CB   2  
ATOM 2425  C CG1  . VAL A 1 30 ? -0.389  -1.274  12.610  1.00 0.00 ? 30 VAL A CG1  2  
ATOM 2426  C CG2  . VAL A 1 30 ? -1.661  -2.995  13.908  1.00 0.00 ? 30 VAL A CG2  2  
ATOM 2427  H H    . VAL A 1 30 ? -3.898  -1.602  14.780  1.00 0.00 ? 30 VAL A H    2  
ATOM 2428  H HA   . VAL A 1 30 ? -1.273  -0.337  14.900  1.00 0.00 ? 30 VAL A HA   2  
ATOM 2429  H HB   . VAL A 1 30 ? -2.472  -1.652  12.476  1.00 0.00 ? 30 VAL A HB   2  
ATOM 2430  H HG11 . VAL A 1 30 ? -0.301  -1.783  11.662  1.00 0.00 ? 30 VAL A HG11 2  
ATOM 2431  H HG12 . VAL A 1 30 ? 0.416   -1.583  13.261  1.00 0.00 ? 30 VAL A HG12 2  
ATOM 2432  H HG13 . VAL A 1 30 ? -0.334  -0.207  12.453  1.00 0.00 ? 30 VAL A HG13 2  
ATOM 2433  H HG21 . VAL A 1 30 ? -1.322  -3.724  13.187  1.00 0.00 ? 30 VAL A HG21 2  
ATOM 2434  H HG22 . VAL A 1 30 ? -2.643  -3.269  14.263  1.00 0.00 ? 30 VAL A HG22 2  
ATOM 2435  H HG23 . VAL A 1 30 ? -0.973  -2.966  14.741  1.00 0.00 ? 30 VAL A HG23 2  
ATOM 2436  N N    . ARG A 1 31 ? -1.736  1.784   13.772  1.00 0.00 ? 31 ARG A N    2  
ATOM 2437  C CA   . ARG A 1 31 ? -1.984  3.053   13.129  1.00 0.00 ? 31 ARG A CA   2  
ATOM 2438  C C    . ARG A 1 31 ? -1.369  3.069   11.739  1.00 0.00 ? 31 ARG A C    2  
ATOM 2439  O O    . ARG A 1 31 ? -0.172  3.303   11.576  1.00 0.00 ? 31 ARG A O    2  
ATOM 2440  C CB   . ARG A 1 31 ? -1.412  4.197   13.970  1.00 0.00 ? 31 ARG A CB   2  
ATOM 2441  C CG   . ARG A 1 31 ? -2.442  4.882   14.852  1.00 0.00 ? 31 ARG A CG   2  
ATOM 2442  C CD   . ARG A 1 31 ? -1.928  6.215   15.374  1.00 0.00 ? 31 ARG A CD   2  
ATOM 2443  N NE   . ARG A 1 31 ? -2.643  6.648   16.571  1.00 0.00 ? 31 ARG A NE   2  
ATOM 2444  C CZ   . ARG A 1 31 ? -2.334  7.743   17.263  1.00 0.00 ? 31 ARG A CZ   2  
ATOM 2445  N NH1  . ARG A 1 31 ? -1.326  8.516   16.879  1.00 0.00 ? 31 ARG A NH1  2  
ATOM 2446  N NH2  . ARG A 1 31 ? -3.036  8.066   18.341  1.00 0.00 ? 31 ARG A NH2  2  
ATOM 2447  H H    . ARG A 1 31 ? -0.987  1.707   14.382  1.00 0.00 ? 31 ARG A H    2  
ATOM 2448  H HA   . ARG A 1 31 ? -3.045  3.170   13.050  1.00 0.00 ? 31 ARG A HA   2  
ATOM 2449  H HB2  . ARG A 1 31 ? -0.630  3.806   14.604  1.00 0.00 ? 31 ARG A HB2  2  
ATOM 2450  H HB3  . ARG A 1 31 ? -0.988  4.938   13.308  1.00 0.00 ? 31 ARG A HB3  2  
ATOM 2451  H HG2  . ARG A 1 31 ? -3.339  5.054   14.276  1.00 0.00 ? 31 ARG A HG2  2  
ATOM 2452  H HG3  . ARG A 1 31 ? -2.668  4.240   15.691  1.00 0.00 ? 31 ARG A HG3  2  
ATOM 2453  H HD2  . ARG A 1 31 ? -0.880  6.114   15.610  1.00 0.00 ? 31 ARG A HD2  2  
ATOM 2454  H HD3  . ARG A 1 31 ? -2.052  6.960   14.602  1.00 0.00 ? 31 ARG A HD3  2  
ATOM 2455  H HE   . ARG A 1 31 ? -3.392  6.095   16.877  1.00 0.00 ? 31 ARG A HE   2  
ATOM 2456  H HH11 . ARG A 1 31 ? -0.793  8.278   16.067  1.00 0.00 ? 31 ARG A HH11 2  
ATOM 2457  H HH12 . ARG A 1 31 ? -1.099  9.337   17.402  1.00 0.00 ? 31 ARG A HH12 2  
ATOM 2458  H HH21 . ARG A 1 31 ? -3.796  7.488   18.634  1.00 0.00 ? 31 ARG A HH21 2  
ATOM 2459  H HH22 . ARG A 1 31 ? -2.803  8.889   18.860  1.00 0.00 ? 31 ARG A HH22 2  
ATOM 2460  N N    . ILE A 1 32 ? -2.198  2.810   10.743  1.00 0.00 ? 32 ILE A N    2  
ATOM 2461  C CA   . ILE A 1 32 ? -1.756  2.780   9.359   1.00 0.00 ? 32 ILE A CA   2  
ATOM 2462  C C    . ILE A 1 32 ? -1.951  4.142   8.704   1.00 0.00 ? 32 ILE A C    2  
ATOM 2463  O O    . ILE A 1 32 ? -3.041  4.711   8.750   1.00 0.00 ? 32 ILE A O    2  
ATOM 2464  C CB   . ILE A 1 32 ? -2.523  1.705   8.561   1.00 0.00 ? 32 ILE A CB   2  
ATOM 2465  C CG1  . ILE A 1 32 ? -2.802  0.485   9.450   1.00 0.00 ? 32 ILE A CG1  2  
ATOM 2466  C CG2  . ILE A 1 32 ? -1.738  1.301   7.320   1.00 0.00 ? 32 ILE A CG2  2  
ATOM 2467  C CD1  . ILE A 1 32 ? -1.552  -0.122  10.049  1.00 0.00 ? 32 ILE A CD1  2  
ATOM 2468  H H    . ILE A 1 32 ? -3.137  2.615   10.944  1.00 0.00 ? 32 ILE A H    2  
ATOM 2469  H HA   . ILE A 1 32 ? -0.704  2.529   9.345   1.00 0.00 ? 32 ILE A HA   2  
ATOM 2470  H HB   . ILE A 1 32 ? -3.462  2.129   8.239   1.00 0.00 ? 32 ILE A HB   2  
ATOM 2471  H HG12 . ILE A 1 32 ? -3.449  0.780   10.266  1.00 0.00 ? 32 ILE A HG12 2  
ATOM 2472  H HG13 . ILE A 1 32 ? -3.293  -0.279  8.865   1.00 0.00 ? 32 ILE A HG13 2  
ATOM 2473  H HG21 . ILE A 1 32 ? -1.297  0.327   7.474   1.00 0.00 ? 32 ILE A HG21 2  
ATOM 2474  H HG22 . ILE A 1 32 ? -0.958  2.024   7.136   1.00 0.00 ? 32 ILE A HG22 2  
ATOM 2475  H HG23 . ILE A 1 32 ? -2.403  1.265   6.470   1.00 0.00 ? 32 ILE A HG23 2  
ATOM 2476  H HD11 . ILE A 1 32 ? -0.846  -0.343  9.262   1.00 0.00 ? 32 ILE A HD11 2  
ATOM 2477  H HD12 . ILE A 1 32 ? -1.808  -1.034  10.569  1.00 0.00 ? 32 ILE A HD12 2  
ATOM 2478  H HD13 . ILE A 1 32 ? -1.110  0.576   10.743  1.00 0.00 ? 32 ILE A HD13 2  
ATOM 2479  N N    . GLY A 1 33 ? -0.889  4.663   8.099   1.00 0.00 ? 33 GLY A N    2  
ATOM 2480  C CA   . GLY A 1 33 ? -0.971  5.957   7.451   1.00 0.00 ? 33 GLY A CA   2  
ATOM 2481  C C    . GLY A 1 33 ? -1.065  5.841   5.946   1.00 0.00 ? 33 GLY A C    2  
ATOM 2482  O O    . GLY A 1 33 ? -0.115  5.421   5.289   1.00 0.00 ? 33 GLY A O    2  
ATOM 2483  H H    . GLY A 1 33 ? -0.043  4.168   8.089   1.00 0.00 ? 33 GLY A H    2  
ATOM 2484  H HA2  . GLY A 1 33 ? -1.844  6.475   7.815   1.00 0.00 ? 33 GLY A HA2  2  
ATOM 2485  H HA3  . GLY A 1 33 ? -0.092  6.531   7.703   1.00 0.00 ? 33 GLY A HA3  2  
ATOM 2486  N N    . VAL A 1 34 ? -2.214  6.213   5.397   1.00 0.00 ? 34 VAL A N    2  
ATOM 2487  C CA   . VAL A 1 34 ? -2.424  6.144   3.959   1.00 0.00 ? 34 VAL A CA   2  
ATOM 2488  C C    . VAL A 1 34 ? -2.400  7.533   3.332   1.00 0.00 ? 34 VAL A C    2  
ATOM 2489  O O    . VAL A 1 34 ? -3.365  8.291   3.438   1.00 0.00 ? 34 VAL A O    2  
ATOM 2490  C CB   . VAL A 1 34 ? -3.763  5.462   3.620   1.00 0.00 ? 34 VAL A CB   2  
ATOM 2491  C CG1  . VAL A 1 34 ? -3.896  5.257   2.119   1.00 0.00 ? 34 VAL A CG1  2  
ATOM 2492  C CG2  . VAL A 1 34 ? -3.893  4.139   4.360   1.00 0.00 ? 34 VAL A CG2  2  
ATOM 2493  H H    . VAL A 1 34 ? -2.938  6.539   5.972   1.00 0.00 ? 34 VAL A H    2  
ATOM 2494  H HA   . VAL A 1 34 ? -1.625  5.554   3.533   1.00 0.00 ? 34 VAL A HA   2  
ATOM 2495  H HB   . VAL A 1 34 ? -4.565  6.110   3.943   1.00 0.00 ? 34 VAL A HB   2  
ATOM 2496  H HG11 . VAL A 1 34 ? -3.252  5.952   1.601   1.00 0.00 ? 34 VAL A HG11 2  
ATOM 2497  H HG12 . VAL A 1 34 ? -4.921  5.426   1.821   1.00 0.00 ? 34 VAL A HG12 2  
ATOM 2498  H HG13 . VAL A 1 34 ? -3.611  4.246   1.867   1.00 0.00 ? 34 VAL A HG13 2  
ATOM 2499  H HG21 . VAL A 1 34 ? -3.386  4.206   5.311   1.00 0.00 ? 34 VAL A HG21 2  
ATOM 2500  H HG22 . VAL A 1 34 ? -3.447  3.351   3.771   1.00 0.00 ? 34 VAL A HG22 2  
ATOM 2501  H HG23 . VAL A 1 34 ? -4.937  3.919   4.524   1.00 0.00 ? 34 VAL A HG23 2  
ATOM 2502  N N    . ASN A 1 35 ? -1.293  7.859   2.675   1.00 0.00 ? 35 ASN A N    2  
ATOM 2503  C CA   . ASN A 1 35 ? -1.149  9.154   2.024   1.00 0.00 ? 35 ASN A CA   2  
ATOM 2504  C C    . ASN A 1 35 ? -1.453  9.036   0.535   1.00 0.00 ? 35 ASN A C    2  
ATOM 2505  O O    . ASN A 1 35 ? -0.670  8.474   -0.231  1.00 0.00 ? 35 ASN A O    2  
ATOM 2506  C CB   . ASN A 1 35 ? 0.260   9.714   2.234   1.00 0.00 ? 35 ASN A CB   2  
ATOM 2507  C CG   . ASN A 1 35 ? 0.253   11.202  2.525   1.00 0.00 ? 35 ASN A CG   2  
ATOM 2508  O OD1  . ASN A 1 35 ? 0.770   11.648  3.549   1.00 0.00 ? 35 ASN A OD1  2  
ATOM 2509  N ND2  . ASN A 1 35 ? -0.335  11.978  1.622   1.00 0.00 ? 35 ASN A ND2  2  
ATOM 2510  H H    . ASN A 1 35 ? -0.560  7.209   2.631   1.00 0.00 ? 35 ASN A H    2  
ATOM 2511  H HA   . ASN A 1 35 ? -1.865  9.828   2.470   1.00 0.00 ? 35 ASN A HA   2  
ATOM 2512  H HB2  . ASN A 1 35 ? 0.722   9.206   3.066   1.00 0.00 ? 35 ASN A HB2  2  
ATOM 2513  H HB3  . ASN A 1 35 ? 0.845   9.544   1.342   1.00 0.00 ? 35 ASN A HB3  2  
ATOM 2514  H HD21 . ASN A 1 35 ? -0.726  11.554  0.830   1.00 0.00 ? 35 ASN A HD21 2  
ATOM 2515  H HD22 . ASN A 1 35 ? -0.354  12.945  1.785   1.00 0.00 ? 35 ASN A HD22 2  
ATOM 2516  N N    . ALA A 1 36 ? -2.602  9.565   0.140   1.00 0.00 ? 36 ALA A N    2  
ATOM 2517  C CA   . ALA A 1 36 ? -3.029  9.520   -1.253  1.00 0.00 ? 36 ALA A CA   2  
ATOM 2518  C C    . ALA A 1 36 ? -3.623  10.852  -1.704  1.00 0.00 ? 36 ALA A C    2  
ATOM 2519  O O    . ALA A 1 36 ? -4.264  11.554  -0.921  1.00 0.00 ? 36 ALA A O    2  
ATOM 2520  C CB   . ALA A 1 36 ? -4.036  8.398   -1.457  1.00 0.00 ? 36 ALA A CB   2  
ATOM 2521  H H    . ALA A 1 36 ? -3.175  9.987   0.812   1.00 0.00 ? 36 ALA A H    2  
ATOM 2522  H HA   . ALA A 1 36 ? -2.161  9.302   -1.857  1.00 0.00 ? 36 ALA A HA   2  
ATOM 2523  H HB1  . ALA A 1 36 ? -4.972  8.664   -0.988  1.00 0.00 ? 36 ALA A HB1  2  
ATOM 2524  H HB2  . ALA A 1 36 ? -3.657  7.489   -1.013  1.00 0.00 ? 36 ALA A HB2  2  
ATOM 2525  H HB3  . ALA A 1 36 ? -4.194  8.244   -2.514  1.00 0.00 ? 36 ALA A HB3  2  
ATOM 2526  N N    . PRO A 1 37 ? -3.416  11.216  -2.982  1.00 0.00 ? 37 PRO A N    2  
ATOM 2527  C CA   . PRO A 1 37 ? -3.928  12.464  -3.548  1.00 0.00 ? 37 PRO A CA   2  
ATOM 2528  C C    . PRO A 1 37 ? -5.377  12.341  -4.008  1.00 0.00 ? 37 PRO A C    2  
ATOM 2529  O O    . PRO A 1 37 ? -5.852  11.245  -4.304  1.00 0.00 ? 37 PRO A O    2  
ATOM 2530  C CB   . PRO A 1 37 ? -3.010  12.684  -4.745  1.00 0.00 ? 37 PRO A CB   2  
ATOM 2531  C CG   . PRO A 1 37 ? -2.697  11.306  -5.217  1.00 0.00 ? 37 PRO A CG   2  
ATOM 2532  C CD   . PRO A 1 37 ? -2.660  10.436  -3.985  1.00 0.00 ? 37 PRO A CD   2  
ATOM 2533  H HA   . PRO A 1 37 ? -3.833  13.288  -2.856  1.00 0.00 ? 37 PRO A HA   2  
ATOM 2534  H HB2  . PRO A 1 37 ? -3.528  13.258  -5.501  1.00 0.00 ? 37 PRO A HB2  2  
ATOM 2535  H HB3  . PRO A 1 37 ? -2.119  13.206  -4.431  1.00 0.00 ? 37 PRO A HB3  2  
ATOM 2536  H HG2  . PRO A 1 37 ? -3.469  10.966  -5.892  1.00 0.00 ? 37 PRO A HG2  2  
ATOM 2537  H HG3  . PRO A 1 37 ? -1.737  11.298  -5.711  1.00 0.00 ? 37 PRO A HG3  2  
ATOM 2538  H HD2  . PRO A 1 37 ? -3.143  9.490   -4.178  1.00 0.00 ? 37 PRO A HD2  2  
ATOM 2539  H HD3  . PRO A 1 37 ? -1.641  10.282  -3.663  1.00 0.00 ? 37 PRO A HD3  2  
ATOM 2540  N N    . LYS A 1 38 ? -6.073  13.471  -4.071  1.00 0.00 ? 38 LYS A N    2  
ATOM 2541  C CA   . LYS A 1 38 ? -7.467  13.485  -4.502  1.00 0.00 ? 38 LYS A CA   2  
ATOM 2542  C C    . LYS A 1 38 ? -7.580  13.380  -6.024  1.00 0.00 ? 38 LYS A C    2  
ATOM 2543  O O    . LYS A 1 38 ? -8.683  13.320  -6.566  1.00 0.00 ? 38 LYS A O    2  
ATOM 2544  C CB   . LYS A 1 38 ? -8.158  14.761  -4.017  1.00 0.00 ? 38 LYS A CB   2  
ATOM 2545  C CG   . LYS A 1 38 ? -7.491  16.038  -4.505  1.00 0.00 ? 38 LYS A CG   2  
ATOM 2546  C CD   . LYS A 1 38 ? -7.394  17.076  -3.399  1.00 0.00 ? 38 LYS A CD   2  
ATOM 2547  C CE   . LYS A 1 38 ? -7.603  18.485  -3.933  1.00 0.00 ? 38 LYS A CE   2  
ATOM 2548  N NZ   . LYS A 1 38 ? -6.331  19.259  -3.969  1.00 0.00 ? 38 LYS A NZ   2  
ATOM 2549  H H    . LYS A 1 38 ? -5.639  14.315  -3.826  1.00 0.00 ? 38 LYS A H    2  
ATOM 2550  H HA   . LYS A 1 38 ? -7.958  12.632  -4.058  1.00 0.00 ? 38 LYS A HA   2  
ATOM 2551  H HB2  . LYS A 1 38 ? -9.179  14.758  -4.367  1.00 0.00 ? 38 LYS A HB2  2  
ATOM 2552  H HB3  . LYS A 1 38 ? -8.156  14.769  -2.937  1.00 0.00 ? 38 LYS A HB3  2  
ATOM 2553  H HG2  . LYS A 1 38 ? -6.495  15.803  -4.852  1.00 0.00 ? 38 LYS A HG2  2  
ATOM 2554  H HG3  . LYS A 1 38 ? -8.071  16.446  -5.320  1.00 0.00 ? 38 LYS A HG3  2  
ATOM 2555  H HD2  . LYS A 1 38 ? -8.150  16.869  -2.656  1.00 0.00 ? 38 LYS A HD2  2  
ATOM 2556  H HD3  . LYS A 1 38 ? -6.415  17.014  -2.945  1.00 0.00 ? 38 LYS A HD3  2  
ATOM 2557  H HE2  . LYS A 1 38 ? -8.004  18.422  -4.934  1.00 0.00 ? 38 LYS A HE2  2  
ATOM 2558  H HE3  . LYS A 1 38 ? -8.308  18.997  -3.295  1.00 0.00 ? 38 LYS A HE3  2  
ATOM 2559  H HZ1  . LYS A 1 38 ? -6.517  20.238  -4.270  1.00 0.00 ? 38 LYS A HZ1  2  
ATOM 2560  H HZ2  . LYS A 1 38 ? -5.666  18.824  -4.639  1.00 0.00 ? 38 LYS A HZ2  2  
ATOM 2561  H HZ3  . LYS A 1 38 ? -5.895  19.275  -3.025  1.00 0.00 ? 38 LYS A HZ3  2  
ATOM 2562  N N    . GLU A 1 39 ? -6.438  13.362  -6.710  1.00 0.00 ? 39 GLU A N    2  
ATOM 2563  C CA   . GLU A 1 39 ? -6.422  13.269  -8.165  1.00 0.00 ? 39 GLU A CA   2  
ATOM 2564  C C    . GLU A 1 39 ? -6.860  11.883  -8.634  1.00 0.00 ? 39 GLU A C    2  
ATOM 2565  O O    . GLU A 1 39 ? -7.628  11.757  -9.588  1.00 0.00 ? 39 GLU A O    2  
ATOM 2566  C CB   . GLU A 1 39 ? -5.025  13.586  -8.702  1.00 0.00 ? 39 GLU A CB   2  
ATOM 2567  C CG   . GLU A 1 39 ? -5.027  14.577  -9.855  1.00 0.00 ? 39 GLU A CG   2  
ATOM 2568  C CD   . GLU A 1 39 ? -4.124  14.149  -10.994 1.00 0.00 ? 39 GLU A CD   2  
ATOM 2569  O OE1  . GLU A 1 39 ? -4.566  13.331  -11.828 1.00 0.00 ? 39 GLU A OE1  2  
ATOM 2570  O OE2  . GLU A 1 39 ? -2.974  14.633  -11.054 1.00 0.00 ? 39 GLU A OE2  2  
ATOM 2571  H H    . GLU A 1 39 ? -5.586  13.417  -6.230  1.00 0.00 ? 39 GLU A H    2  
ATOM 2572  H HA   . GLU A 1 39 ? -7.118  14.000  -8.550  1.00 0.00 ? 39 GLU A HA   2  
ATOM 2573  H HB2  . GLU A 1 39 ? -4.430  14.000  -7.902  1.00 0.00 ? 39 GLU A HB2  2  
ATOM 2574  H HB3  . GLU A 1 39 ? -4.565  12.670  -9.044  1.00 0.00 ? 39 GLU A HB3  2  
ATOM 2575  H HG2  . GLU A 1 39 ? -6.035  14.669  -10.231 1.00 0.00 ? 39 GLU A HG2  2  
ATOM 2576  H HG3  . GLU A 1 39 ? -4.692  15.536  -9.488  1.00 0.00 ? 39 GLU A HG3  2  
ATOM 2577  N N    . VAL A 1 40 ? -6.372  10.847  -7.959  1.00 0.00 ? 40 VAL A N    2  
ATOM 2578  C CA   . VAL A 1 40 ? -6.722  9.476   -8.313  1.00 0.00 ? 40 VAL A CA   2  
ATOM 2579  C C    . VAL A 1 40 ? -7.951  9.013   -7.537  1.00 0.00 ? 40 VAL A C    2  
ATOM 2580  O O    . VAL A 1 40 ? -8.220  9.497   -6.437  1.00 0.00 ? 40 VAL A O    2  
ATOM 2581  C CB   . VAL A 1 40 ? -5.555  8.502   -8.051  1.00 0.00 ? 40 VAL A CB   2  
ATOM 2582  C CG1  . VAL A 1 40 ? -5.835  7.152   -8.691  1.00 0.00 ? 40 VAL A CG1  2  
ATOM 2583  C CG2  . VAL A 1 40 ? -4.248  9.083   -8.570  1.00 0.00 ? 40 VAL A CG2  2  
ATOM 2584  H H    . VAL A 1 40 ? -5.767  11.007  -7.204  1.00 0.00 ? 40 VAL A H    2  
ATOM 2585  H HA   . VAL A 1 40 ? -6.950  9.456   -9.369  1.00 0.00 ? 40 VAL A HA   2  
ATOM 2586  H HB   . VAL A 1 40 ? -5.460  8.356   -6.985  1.00 0.00 ? 40 VAL A HB   2  
ATOM 2587  H HG11 . VAL A 1 40 ? -4.905  6.703   -9.008  1.00 0.00 ? 40 VAL A HG11 2  
ATOM 2588  H HG12 . VAL A 1 40 ? -6.480  7.286   -9.547  1.00 0.00 ? 40 VAL A HG12 2  
ATOM 2589  H HG13 . VAL A 1 40 ? -6.320  6.506   -7.973  1.00 0.00 ? 40 VAL A HG13 2  
ATOM 2590  H HG21 . VAL A 1 40 ? -3.771  9.654   -7.787  1.00 0.00 ? 40 VAL A HG21 2  
ATOM 2591  H HG22 . VAL A 1 40 ? -4.450  9.727   -9.414  1.00 0.00 ? 40 VAL A HG22 2  
ATOM 2592  H HG23 . VAL A 1 40 ? -3.594  8.280   -8.879  1.00 0.00 ? 40 VAL A HG23 2  
ATOM 2593  N N    . SER A 1 41 ? -8.698  8.080   -8.118  1.00 0.00 ? 41 SER A N    2  
ATOM 2594  C CA   . SER A 1 41 ? -9.903  7.561   -7.479  1.00 0.00 ? 41 SER A CA   2  
ATOM 2595  C C    . SER A 1 41 ? -9.551  6.591   -6.358  1.00 0.00 ? 41 SER A C    2  
ATOM 2596  O O    . SER A 1 41 ? -9.139  5.459   -6.611  1.00 0.00 ? 41 SER A O    2  
ATOM 2597  C CB   . SER A 1 41 ? -10.791 6.865   -8.511  1.00 0.00 ? 41 SER A CB   2  
ATOM 2598  O OG   . SER A 1 41 ? -11.985 6.386   -7.917  1.00 0.00 ? 41 SER A OG   2  
ATOM 2599  H H    . SER A 1 41 ? -8.436  7.735   -8.997  1.00 0.00 ? 41 SER A H    2  
ATOM 2600  H HA   . SER A 1 41 ? -10.442 8.397   -7.060  1.00 0.00 ? 41 SER A HA   2  
ATOM 2601  H HB2  . SER A 1 41 ? -11.049 7.564   -9.292  1.00 0.00 ? 41 SER A HB2  2  
ATOM 2602  H HB3  . SER A 1 41 ? -10.256 6.029   -8.939  1.00 0.00 ? 41 SER A HB3  2  
ATOM 2603  H HG   . SER A 1 41 ? -11.793 5.599   -7.401  1.00 0.00 ? 41 SER A HG   2  
ATOM 2604  N N    . VAL A 1 42 ? -9.715  7.040   -5.116  1.00 0.00 ? 42 VAL A N    2  
ATOM 2605  C CA   . VAL A 1 42 ? -9.410  6.204   -3.963  1.00 0.00 ? 42 VAL A CA   2  
ATOM 2606  C C    . VAL A 1 42 ? -10.638 6.011   -3.071  1.00 0.00 ? 42 VAL A C    2  
ATOM 2607  O O    . VAL A 1 42 ? -11.195 6.978   -2.552  1.00 0.00 ? 42 VAL A O    2  
ATOM 2608  C CB   . VAL A 1 42 ? -8.269  6.810   -3.122  1.00 0.00 ? 42 VAL A CB   2  
ATOM 2609  C CG1  . VAL A 1 42 ? -8.682  8.156   -2.544  1.00 0.00 ? 42 VAL A CG1  2  
ATOM 2610  C CG2  . VAL A 1 42 ? -7.850  5.852   -2.017  1.00 0.00 ? 42 VAL A CG2  2  
ATOM 2611  H H    . VAL A 1 42 ? -10.044 7.952   -4.976  1.00 0.00 ? 42 VAL A H    2  
ATOM 2612  H HA   . VAL A 1 42 ? -9.084  5.243   -4.329  1.00 0.00 ? 42 VAL A HA   2  
ATOM 2613  H HB   . VAL A 1 42 ? -7.420  6.970   -3.770  1.00 0.00 ? 42 VAL A HB   2  
ATOM 2614  H HG11 . VAL A 1 42 ? -7.804  8.689   -2.209  1.00 0.00 ? 42 VAL A HG11 2  
ATOM 2615  H HG12 . VAL A 1 42 ? -9.349  8.000   -1.709  1.00 0.00 ? 42 VAL A HG12 2  
ATOM 2616  H HG13 . VAL A 1 42 ? -9.186  8.735   -3.304  1.00 0.00 ? 42 VAL A HG13 2  
ATOM 2617  H HG21 . VAL A 1 42 ? -6.790  5.950   -1.838  1.00 0.00 ? 42 VAL A HG21 2  
ATOM 2618  H HG22 . VAL A 1 42 ? -8.072  4.838   -2.317  1.00 0.00 ? 42 VAL A HG22 2  
ATOM 2619  H HG23 . VAL A 1 42 ? -8.392  6.087   -1.112  1.00 0.00 ? 42 VAL A HG23 2  
ATOM 2620  N N    . HIS A 1 43 ? -11.050 4.757   -2.891  1.00 0.00 ? 43 HIS A N    2  
ATOM 2621  C CA   . HIS A 1 43 ? -12.203 4.441   -2.056  1.00 0.00 ? 43 HIS A CA   2  
ATOM 2622  C C    . HIS A 1 43 ? -11.849 3.364   -1.034  1.00 0.00 ? 43 HIS A C    2  
ATOM 2623  O O    . HIS A 1 43 ? -11.223 2.359   -1.373  1.00 0.00 ? 43 HIS A O    2  
ATOM 2624  C CB   . HIS A 1 43 ? -13.375 3.974   -2.922  1.00 0.00 ? 43 HIS A CB   2  
ATOM 2625  C CG   . HIS A 1 43 ? -13.934 5.050   -3.801  1.00 0.00 ? 43 HIS A CG   2  
ATOM 2626  N ND1  . HIS A 1 43 ? -13.147 5.973   -4.456  1.00 0.00 ? 43 HIS A ND1  2  
ATOM 2627  C CD2  . HIS A 1 43 ? -15.213 5.348   -4.133  1.00 0.00 ? 43 HIS A CD2  2  
ATOM 2628  C CE1  . HIS A 1 43 ? -13.915 6.792   -5.152  1.00 0.00 ? 43 HIS A CE1  2  
ATOM 2629  N NE2  . HIS A 1 43 ? -15.173 6.434   -4.973  1.00 0.00 ? 43 HIS A NE2  2  
ATOM 2630  H H    . HIS A 1 43 ? -10.566 4.025   -3.327  1.00 0.00 ? 43 HIS A H    2  
ATOM 2631  H HA   . HIS A 1 43 ? -12.489 5.339   -1.531  1.00 0.00 ? 43 HIS A HA   2  
ATOM 2632  H HB2  . HIS A 1 43 ? -13.045 3.166   -3.557  1.00 0.00 ? 43 HIS A HB2  2  
ATOM 2633  H HB3  . HIS A 1 43 ? -14.169 3.621   -2.281  1.00 0.00 ? 43 HIS A HB3  2  
ATOM 2634  H HD2  . HIS A 1 43 ? -16.100 4.827   -3.800  1.00 0.00 ? 43 HIS A HD2  2  
ATOM 2635  H HE1  . HIS A 1 43 ? -13.572 7.614   -5.763  1.00 0.00 ? 43 HIS A HE1  2  
ATOM 2636  H HE2  . HIS A 1 43 ? -15.944 6.828   -5.432  1.00 0.00 ? 43 HIS A HE2  2  
ATOM 2637  N N    . ARG A 1 44 ? -12.250 3.575   0.215   1.00 0.00 ? 44 ARG A N    2  
ATOM 2638  C CA   . ARG A 1 44 ? -11.968 2.612   1.275   1.00 0.00 ? 44 ARG A CA   2  
ATOM 2639  C C    . ARG A 1 44 ? -12.991 2.716   2.404   1.00 0.00 ? 44 ARG A C    2  
ATOM 2640  O O    . ARG A 1 44 ? -13.553 1.711   2.837   1.00 0.00 ? 44 ARG A O    2  
ATOM 2641  C CB   . ARG A 1 44 ? -10.557 2.826   1.827   1.00 0.00 ? 44 ARG A CB   2  
ATOM 2642  C CG   . ARG A 1 44 ? -10.315 4.231   2.355   1.00 0.00 ? 44 ARG A CG   2  
ATOM 2643  C CD   . ARG A 1 44 ? -8.856  4.442   2.731   1.00 0.00 ? 44 ARG A CD   2  
ATOM 2644  N NE   . ARG A 1 44 ? -8.154  5.272   1.755   1.00 0.00 ? 44 ARG A NE   2  
ATOM 2645  C CZ   . ARG A 1 44 ? -8.236  6.600   1.715   1.00 0.00 ? 44 ARG A CZ   2  
ATOM 2646  N NH1  . ARG A 1 44 ? -8.990  7.252   2.591   1.00 0.00 ? 44 ARG A NH1  2  
ATOM 2647  N NH2  . ARG A 1 44 ? -7.563  7.277   0.795   1.00 0.00 ? 44 ARG A NH2  2  
ATOM 2648  H H    . ARG A 1 44 ? -12.746 4.393   0.429   1.00 0.00 ? 44 ARG A H    2  
ATOM 2649  H HA   . ARG A 1 44 ? -12.028 1.624   0.846   1.00 0.00 ? 44 ARG A HA   2  
ATOM 2650  H HB2  . ARG A 1 44 ? -10.390 2.128   2.634   1.00 0.00 ? 44 ARG A HB2  2  
ATOM 2651  H HB3  . ARG A 1 44 ? -9.843  2.632   1.041   1.00 0.00 ? 44 ARG A HB3  2  
ATOM 2652  H HG2  . ARG A 1 44 ? -10.585 4.944   1.591   1.00 0.00 ? 44 ARG A HG2  2  
ATOM 2653  H HG3  . ARG A 1 44 ? -10.929 4.387   3.230   1.00 0.00 ? 44 ARG A HG3  2  
ATOM 2654  H HD2  . ARG A 1 44 ? -8.813  4.924   3.697   1.00 0.00 ? 44 ARG A HD2  2  
ATOM 2655  H HD3  . ARG A 1 44 ? -8.369  3.479   2.789   1.00 0.00 ? 44 ARG A HD3  2  
ATOM 2656  H HE   . ARG A 1 44 ? -7.590  4.815   1.096   1.00 0.00 ? 44 ARG A HE   2  
ATOM 2657  H HH11 . ARG A 1 44 ? -9.501  6.747   3.286   1.00 0.00 ? 44 ARG A HH11 2  
ATOM 2658  H HH12 . ARG A 1 44 ? -9.047  8.250   2.555   1.00 0.00 ? 44 ARG A HH12 2  
ATOM 2659  H HH21 . ARG A 1 44 ? -6.994  6.791   0.132   1.00 0.00 ? 44 ARG A HH21 2  
ATOM 2660  H HH22 . ARG A 1 44 ? -7.625  8.275   0.764   1.00 0.00 ? 44 ARG A HH22 2  
ATOM 2661  N N    . GLU A 1 45 ? -13.225 3.935   2.877   1.00 0.00 ? 45 GLU A N    2  
ATOM 2662  C CA   . GLU A 1 45 ? -14.179 4.163   3.957   1.00 0.00 ? 45 GLU A CA   2  
ATOM 2663  C C    . GLU A 1 45 ? -14.608 5.625   4.005   1.00 0.00 ? 45 GLU A C    2  
ATOM 2664  O O    . GLU A 1 45 ? -13.772 6.525   4.099   1.00 0.00 ? 45 GLU A O    2  
ATOM 2665  C CB   . GLU A 1 45 ? -13.567 3.753   5.300   1.00 0.00 ? 45 GLU A CB   2  
ATOM 2666  C CG   . GLU A 1 45 ? -13.983 2.366   5.761   1.00 0.00 ? 45 GLU A CG   2  
ATOM 2667  C CD   . GLU A 1 45 ? -15.489 2.197   5.814   1.00 0.00 ? 45 GLU A CD   2  
ATOM 2668  O OE1  . GLU A 1 45 ? -16.083 1.831   4.778   1.00 0.00 ? 45 GLU A OE1  2  
ATOM 2669  O OE2  . GLU A 1 45 ? -16.075 2.430   6.893   1.00 0.00 ? 45 GLU A OE2  2  
ATOM 2670  H H    . GLU A 1 45 ? -12.746 4.699   2.494   1.00 0.00 ? 45 GLU A H    2  
ATOM 2671  H HA   . GLU A 1 45 ? -15.048 3.551   3.766   1.00 0.00 ? 45 GLU A HA   2  
ATOM 2672  H HB2  . GLU A 1 45 ? -12.491 3.771   5.211   1.00 0.00 ? 45 GLU A HB2  2  
ATOM 2673  H HB3  . GLU A 1 45 ? -13.870 4.465   6.054   1.00 0.00 ? 45 GLU A HB3  2  
ATOM 2674  H HG2  . GLU A 1 45 ? -13.579 1.636   5.076   1.00 0.00 ? 45 GLU A HG2  2  
ATOM 2675  H HG3  . GLU A 1 45 ? -13.581 2.194   6.748   1.00 0.00 ? 45 GLU A HG3  2  
ATOM 2676  N N    . GLU A 1 46 ? -15.915 5.856   3.937   1.00 0.00 ? 46 GLU A N    2  
ATOM 2677  C CA   . GLU A 1 46 ? -16.457 7.209   3.970   1.00 0.00 ? 46 GLU A CA   2  
ATOM 2678  C C    . GLU A 1 46 ? -16.004 7.952   5.224   1.00 0.00 ? 46 GLU A C    2  
ATOM 2679  O O    . GLU A 1 46 ? -15.364 8.999   5.136   1.00 0.00 ? 46 GLU A O    2  
ATOM 2680  C CB   . GLU A 1 46 ? -17.986 7.170   3.911   1.00 0.00 ? 46 GLU A CB   2  
ATOM 2681  C CG   . GLU A 1 46 ? -18.548 7.441   2.526   1.00 0.00 ? 46 GLU A CG   2  
ATOM 2682  C CD   . GLU A 1 46 ? -19.120 8.839   2.392   1.00 0.00 ? 46 GLU A CD   2  
ATOM 2683  O OE1  . GLU A 1 46 ? -18.543 9.776   2.984   1.00 0.00 ? 46 GLU A OE1  2  
ATOM 2684  O OE2  . GLU A 1 46 ? -20.144 8.998   1.695   1.00 0.00 ? 46 GLU A OE2  2  
ATOM 2685  H H    . GLU A 1 46 ? -16.532 5.098   3.862   1.00 0.00 ? 46 GLU A H    2  
ATOM 2686  H HA   . GLU A 1 46 ? -16.087 7.735   3.103   1.00 0.00 ? 46 GLU A HA   2  
ATOM 2687  H HB2  . GLU A 1 46 ? -18.322 6.194   4.228   1.00 0.00 ? 46 GLU A HB2  2  
ATOM 2688  H HB3  . GLU A 1 46 ? -18.381 7.914   4.588   1.00 0.00 ? 46 GLU A HB3  2  
ATOM 2689  H HG2  . GLU A 1 46 ? -17.758 7.322   1.800   1.00 0.00 ? 46 GLU A HG2  2  
ATOM 2690  H HG3  . GLU A 1 46 ? -19.333 6.726   2.324   1.00 0.00 ? 46 GLU A HG3  2  
ATOM 2691  N N    . ILE A 1 47 ? -16.338 7.403   6.388   1.00 0.00 ? 47 ILE A N    2  
ATOM 2692  C CA   . ILE A 1 47 ? -15.965 8.016   7.658   1.00 0.00 ? 47 ILE A CA   2  
ATOM 2693  C C    . ILE A 1 47 ? -14.452 8.179   7.768   1.00 0.00 ? 47 ILE A C    2  
ATOM 2694  O O    . ILE A 1 47 ? -13.960 9.216   8.218   1.00 0.00 ? 47 ILE A O    2  
ATOM 2695  C CB   . ILE A 1 47 ? -16.477 7.187   8.854   1.00 0.00 ? 47 ILE A CB   2  
ATOM 2696  C CG1  . ILE A 1 47 ? -16.168 7.902   10.171  1.00 0.00 ? 47 ILE A CG1  2  
ATOM 2697  C CG2  . ILE A 1 47 ? -15.860 5.796   8.841   1.00 0.00 ? 47 ILE A CG2  2  
ATOM 2698  C CD1  . ILE A 1 47 ? -16.779 7.230   11.381  1.00 0.00 ? 47 ILE A CD1  2  
ATOM 2699  H H    . ILE A 1 47 ? -16.846 6.565   6.394   1.00 0.00 ? 47 ILE A H    2  
ATOM 2700  H HA   . ILE A 1 47 ? -16.425 8.993   7.702   1.00 0.00 ? 47 ILE A HA   2  
ATOM 2701  H HB   . ILE A 1 47 ? -17.546 7.078   8.755   1.00 0.00 ? 47 ILE A HB   2  
ATOM 2702  H HG12 . ILE A 1 47 ? -15.098 7.932   10.315  1.00 0.00 ? 47 ILE A HG12 2  
ATOM 2703  H HG13 . ILE A 1 47 ? -16.549 8.911   10.123  1.00 0.00 ? 47 ILE A HG13 2  
ATOM 2704  H HG21 . ILE A 1 47 ? -15.743 5.462   7.821   1.00 0.00 ? 47 ILE A HG21 2  
ATOM 2705  H HG22 . ILE A 1 47 ? -16.505 5.111   9.372   1.00 0.00 ? 47 ILE A HG22 2  
ATOM 2706  H HG23 . ILE A 1 47 ? -14.894 5.826   9.324   1.00 0.00 ? 47 ILE A HG23 2  
ATOM 2707  H HD11 . ILE A 1 47 ? -16.708 6.157   11.272  1.00 0.00 ? 47 ILE A HD11 2  
ATOM 2708  H HD12 . ILE A 1 47 ? -17.818 7.515   11.465  1.00 0.00 ? 47 ILE A HD12 2  
ATOM 2709  H HD13 . ILE A 1 47 ? -16.249 7.537   12.270  1.00 0.00 ? 47 ILE A HD13 2  
ATOM 2710  N N    . TYR A 1 48 ? -13.717 7.149   7.349   1.00 0.00 ? 48 TYR A N    2  
ATOM 2711  C CA   . TYR A 1 48 ? -12.257 7.175   7.395   1.00 0.00 ? 48 TYR A CA   2  
ATOM 2712  C C    . TYR A 1 48 ? -11.723 8.513   6.894   1.00 0.00 ? 48 TYR A C    2  
ATOM 2713  O O    . TYR A 1 48 ? -11.020 9.222   7.614   1.00 0.00 ? 48 TYR A O    2  
ATOM 2714  C CB   . TYR A 1 48 ? -11.678 6.034   6.555   1.00 0.00 ? 48 TYR A CB   2  
ATOM 2715  C CG   . TYR A 1 48 ? -11.553 4.727   7.306   1.00 0.00 ? 48 TYR A CG   2  
ATOM 2716  C CD1  . TYR A 1 48 ? -12.537 4.318   8.198   1.00 0.00 ? 48 TYR A CD1  2  
ATOM 2717  C CD2  . TYR A 1 48 ? -10.450 3.902   7.122   1.00 0.00 ? 48 TYR A CD2  2  
ATOM 2718  C CE1  . TYR A 1 48 ? -12.425 3.125   8.886   1.00 0.00 ? 48 TYR A CE1  2  
ATOM 2719  C CE2  . TYR A 1 48 ? -10.332 2.707   7.806   1.00 0.00 ? 48 TYR A CE2  2  
ATOM 2720  C CZ   . TYR A 1 48 ? -11.321 2.323   8.686   1.00 0.00 ? 48 TYR A CZ   2  
ATOM 2721  O OH   . TYR A 1 48 ? -11.206 1.134   9.369   1.00 0.00 ? 48 TYR A OH   2  
ATOM 2722  H H    . TYR A 1 48 ? -14.168 6.353   6.997   1.00 0.00 ? 48 TYR A H    2  
ATOM 2723  H HA   . TYR A 1 48 ? -11.955 7.042   8.423   1.00 0.00 ? 48 TYR A HA   2  
ATOM 2724  H HB2  . TYR A 1 48 ? -12.318 5.865   5.702   1.00 0.00 ? 48 TYR A HB2  2  
ATOM 2725  H HB3  . TYR A 1 48 ? -10.694 6.315   6.209   1.00 0.00 ? 48 TYR A HB3  2  
ATOM 2726  H HD1  . TYR A 1 48 ? -13.400 4.948   8.352   1.00 0.00 ? 48 TYR A HD1  2  
ATOM 2727  H HD2  . TYR A 1 48 ? -9.677  4.206   6.433   1.00 0.00 ? 48 TYR A HD2  2  
ATOM 2728  H HE1  . TYR A 1 48 ? -13.201 2.824   9.574   1.00 0.00 ? 48 TYR A HE1  2  
ATOM 2729  H HE2  . TYR A 1 48 ? -9.466  2.080   7.650   1.00 0.00 ? 48 TYR A HE2  2  
ATOM 2730  H HH   . TYR A 1 48 ? -10.313 1.045   9.709   1.00 0.00 ? 48 TYR A HH   2  
ATOM 2731  N N    . GLN A 1 49 ? -12.073 8.856   5.660   1.00 0.00 ? 49 GLN A N    2  
ATOM 2732  C CA   . GLN A 1 49 ? -11.640 10.114  5.068   1.00 0.00 ? 49 GLN A CA   2  
ATOM 2733  C C    . GLN A 1 49 ? -12.454 11.282  5.621   1.00 0.00 ? 49 GLN A C    2  
ATOM 2734  O O    . GLN A 1 49 ? -12.015 12.430  5.575   1.00 0.00 ? 49 GLN A O    2  
ATOM 2735  C CB   . GLN A 1 49 ? -11.775 10.058  3.545   1.00 0.00 ? 49 GLN A CB   2  
ATOM 2736  C CG   . GLN A 1 49 ? -13.124 9.545   3.071   1.00 0.00 ? 49 GLN A CG   2  
ATOM 2737  C CD   . GLN A 1 49 ? -13.387 9.862   1.612   1.00 0.00 ? 49 GLN A CD   2  
ATOM 2738  O OE1  . GLN A 1 49 ? -13.435 11.026  1.216   1.00 0.00 ? 49 GLN A OE1  2  
ATOM 2739  N NE2  . GLN A 1 49 ? -13.560 8.823   0.802   1.00 0.00 ? 49 GLN A NE2  2  
ATOM 2740  H H    . GLN A 1 49 ? -12.641 8.253   5.134   1.00 0.00 ? 49 GLN A H    2  
ATOM 2741  H HA   . GLN A 1 49 ? -10.601 10.260  5.324   1.00 0.00 ? 49 GLN A HA   2  
ATOM 2742  H HB2  . GLN A 1 49 ? -11.632 11.051  3.146   1.00 0.00 ? 49 GLN A HB2  2  
ATOM 2743  H HB3  . GLN A 1 49 ? -11.008 9.408   3.151   1.00 0.00 ? 49 GLN A HB3  2  
ATOM 2744  H HG2  . GLN A 1 49 ? -13.154 8.474   3.201   1.00 0.00 ? 49 GLN A HG2  2  
ATOM 2745  H HG3  . GLN A 1 49 ? -13.899 10.002  3.669   1.00 0.00 ? 49 GLN A HG3  2  
ATOM 2746  H HE21 . GLN A 1 49 ? -13.509 7.923   1.187   1.00 0.00 ? 49 GLN A HE21 2  
ATOM 2747  H HE22 . GLN A 1 49 ? -13.731 8.999   -0.146  1.00 0.00 ? 49 GLN A HE22 2  
ATOM 2748  N N    . ARG A 1 50 ? -13.641 10.980  6.147   1.00 0.00 ? 50 ARG A N    2  
ATOM 2749  C CA   . ARG A 1 50 ? -14.516 12.003  6.711   1.00 0.00 ? 50 ARG A CA   2  
ATOM 2750  C C    . ARG A 1 50 ? -13.915 12.609  7.977   1.00 0.00 ? 50 ARG A C    2  
ATOM 2751  O O    . ARG A 1 50 ? -14.360 13.657  8.443   1.00 0.00 ? 50 ARG A O    2  
ATOM 2752  C CB   . ARG A 1 50 ? -15.893 11.413  7.022   1.00 0.00 ? 50 ARG A CB   2  
ATOM 2753  C CG   . ARG A 1 50 ? -17.004 12.450  7.064   1.00 0.00 ? 50 ARG A CG   2  
ATOM 2754  C CD   . ARG A 1 50 ? -17.901 12.358  5.840   1.00 0.00 ? 50 ARG A CD   2  
ATOM 2755  N NE   . ARG A 1 50 ? -17.148 12.504  4.596   1.00 0.00 ? 50 ARG A NE   2  
ATOM 2756  C CZ   . ARG A 1 50 ? -17.712 12.619  3.396   1.00 0.00 ? 50 ARG A CZ   2  
ATOM 2757  N NH1  . ARG A 1 50 ? -19.034 12.605  3.272   1.00 0.00 ? 50 ARG A NH1  2  
ATOM 2758  N NH2  . ARG A 1 50 ? -16.953 12.749  2.317   1.00 0.00 ? 50 ARG A NH2  2  
ATOM 2759  H H    . ARG A 1 50 ? -13.935 10.047  6.160   1.00 0.00 ? 50 ARG A H    2  
ATOM 2760  H HA   . ARG A 1 50 ? -14.629 12.779  5.973   1.00 0.00 ? 50 ARG A HA   2  
ATOM 2761  H HB2  . ARG A 1 50 ? -16.139 10.684  6.266   1.00 0.00 ? 50 ARG A HB2  2  
ATOM 2762  H HB3  . ARG A 1 50 ? -15.852 10.921  7.983   1.00 0.00 ? 50 ARG A HB3  2  
ATOM 2763  H HG2  . ARG A 1 50 ? -17.603 12.286  7.948   1.00 0.00 ? 50 ARG A HG2  2  
ATOM 2764  H HG3  . ARG A 1 50 ? -16.563 13.435  7.103   1.00 0.00 ? 50 ARG A HG3  2  
ATOM 2765  H HD2  . ARG A 1 50 ? -18.393 11.396  5.840   1.00 0.00 ? 50 ARG A HD2  2  
ATOM 2766  H HD3  . ARG A 1 50 ? -18.644 13.140  5.894   1.00 0.00 ? 50 ARG A HD3  2  
ATOM 2767  H HE   . ARG A 1 50 ? -16.170 12.517  4.659   1.00 0.00 ? 50 ARG A HE   2  
ATOM 2768  H HH11 . ARG A 1 50 ? -19.612 12.508  4.082   1.00 0.00 ? 50 ARG A HH11 2  
ATOM 2769  H HH12 . ARG A 1 50 ? -19.451 12.693  2.368   1.00 0.00 ? 50 ARG A HH12 2  
ATOM 2770  H HH21 . ARG A 1 50 ? -15.956 12.760  2.405   1.00 0.00 ? 50 ARG A HH21 2  
ATOM 2771  H HH22 . ARG A 1 50 ? -17.376 12.835  1.415   1.00 0.00 ? 50 ARG A HH22 2  
ATOM 2772  N N    . ILE A 1 51 ? -12.907 11.943  8.534   1.00 0.00 ? 51 ILE A N    2  
ATOM 2773  C CA   . ILE A 1 51 ? -12.253 12.420  9.748   1.00 0.00 ? 51 ILE A CA   2  
ATOM 2774  C C    . ILE A 1 51 ? -10.790 12.773  9.489   1.00 0.00 ? 51 ILE A C    2  
ATOM 2775  O O    . ILE A 1 51 ? -10.211 13.605  10.188  1.00 0.00 ? 51 ILE A O    2  
ATOM 2776  C CB   . ILE A 1 51 ? -12.322 11.368  10.871  1.00 0.00 ? 51 ILE A CB   2  
ATOM 2777  C CG1  . ILE A 1 51 ? -13.751 10.844  11.023  1.00 0.00 ? 51 ILE A CG1  2  
ATOM 2778  C CG2  . ILE A 1 51 ? -11.825 11.958  12.183  1.00 0.00 ? 51 ILE A CG2  2  
ATOM 2779  C CD1  . ILE A 1 51 ? -14.736 11.898  11.482  1.00 0.00 ? 51 ILE A CD1  2  
ATOM 2780  H H    . ILE A 1 51 ? -12.599 11.111  8.122   1.00 0.00 ? 51 ILE A H    2  
ATOM 2781  H HA   . ILE A 1 51 ? -12.774 13.306  10.081  1.00 0.00 ? 51 ILE A HA   2  
ATOM 2782  H HB   . ILE A 1 51 ? -11.672 10.548  10.606  1.00 0.00 ? 51 ILE A HB   2  
ATOM 2783  H HG12 . ILE A 1 51 ? -14.091 10.464  10.071  1.00 0.00 ? 51 ILE A HG12 2  
ATOM 2784  H HG13 . ILE A 1 51 ? -13.758 10.043  11.749  1.00 0.00 ? 51 ILE A HG13 2  
ATOM 2785  H HG21 . ILE A 1 51 ? -11.740 11.174  12.921  1.00 0.00 ? 51 ILE A HG21 2  
ATOM 2786  H HG22 . ILE A 1 51 ? -12.525 12.704  12.530  1.00 0.00 ? 51 ILE A HG22 2  
ATOM 2787  H HG23 . ILE A 1 51 ? -10.859 12.415  12.029  1.00 0.00 ? 51 ILE A HG23 2  
ATOM 2788  H HD11 . ILE A 1 51 ? -15.021 12.513  10.641  1.00 0.00 ? 51 ILE A HD11 2  
ATOM 2789  H HD12 . ILE A 1 51 ? -14.276 12.515  12.240  1.00 0.00 ? 51 ILE A HD12 2  
ATOM 2790  H HD13 . ILE A 1 51 ? -15.613 11.419  11.891  1.00 0.00 ? 51 ILE A HD13 2  
ATOM 2791  N N    . GLN A 1 52 ? -10.197 12.135  8.485   1.00 0.00 ? 52 GLN A N    2  
ATOM 2792  C CA   . GLN A 1 52 ? -8.802  12.381  8.139   1.00 0.00 ? 52 GLN A CA   2  
ATOM 2793  C C    . GLN A 1 52 ? -8.696  13.274  6.906   1.00 0.00 ? 52 GLN A C    2  
ATOM 2794  O O    . GLN A 1 52 ? -8.105  14.352  6.957   1.00 0.00 ? 52 GLN A O    2  
ATOM 2795  C CB   . GLN A 1 52 ? -8.078  11.055  7.892   1.00 0.00 ? 52 GLN A CB   2  
ATOM 2796  C CG   . GLN A 1 52 ? -6.889  10.831  8.811   1.00 0.00 ? 52 GLN A CG   2  
ATOM 2797  C CD   . GLN A 1 52 ? -7.248  10.977  10.277  1.00 0.00 ? 52 GLN A CD   2  
ATOM 2798  O OE1  . GLN A 1 52 ? -8.398  10.780  10.669  1.00 0.00 ? 52 GLN A OE1  2  
ATOM 2799  N NE2  . GLN A 1 52 ? -6.262  11.326  11.096  1.00 0.00 ? 52 GLN A NE2  2  
ATOM 2800  H H    . GLN A 1 52 ? -10.708 11.483  7.964   1.00 0.00 ? 52 GLN A H    2  
ATOM 2801  H HA   . GLN A 1 52 ? -8.338  12.884  8.974   1.00 0.00 ? 52 GLN A HA   2  
ATOM 2802  H HB2  . GLN A 1 52 ? -8.776  10.245  8.039   1.00 0.00 ? 52 GLN A HB2  2  
ATOM 2803  H HB3  . GLN A 1 52 ? -7.725  11.033  6.871   1.00 0.00 ? 52 GLN A HB3  2  
ATOM 2804  H HG2  . GLN A 1 52 ? -6.508  9.834   8.648   1.00 0.00 ? 52 GLN A HG2  2  
ATOM 2805  H HG3  . GLN A 1 52 ? -6.122  11.552  8.570   1.00 0.00 ? 52 GLN A HG3  2  
ATOM 2806  H HE21 . GLN A 1 52 ? -5.371  11.467  10.714  1.00 0.00 ? 52 GLN A HE21 2  
ATOM 2807  H HE22 . GLN A 1 52 ? -6.467  11.427  12.049  1.00 0.00 ? 52 GLN A HE22 2  
ATOM 2808  N N    . ALA A 1 53 ? -9.277  12.819  5.800   1.00 0.00 ? 53 ALA A N    2  
ATOM 2809  C CA   . ALA A 1 53 ? -9.251  13.578  4.557   1.00 0.00 ? 53 ALA A CA   2  
ATOM 2810  C C    . ALA A 1 53 ? -9.936  14.925  4.738   1.00 0.00 ? 53 ALA A C    2  
ATOM 2811  O O    . ALA A 1 53 ? -9.302  15.975  4.636   1.00 0.00 ? 53 ALA A O    2  
ATOM 2812  C CB   . ALA A 1 53 ? -9.913  12.789  3.439   1.00 0.00 ? 53 ALA A CB   2  
ATOM 2813  H H    . ALA A 1 53 ? -9.736  11.953  5.825   1.00 0.00 ? 53 ALA A H    2  
ATOM 2814  H HA   . ALA A 1 53 ? -8.217  13.743  4.289   1.00 0.00 ? 53 ALA A HA   2  
ATOM 2815  H HB1  . ALA A 1 53 ? -10.963 13.040  3.394   1.00 0.00 ? 53 ALA A HB1  2  
ATOM 2816  H HB2  . ALA A 1 53 ? -9.804  11.732  3.630   1.00 0.00 ? 53 ALA A HB2  2  
ATOM 2817  H HB3  . ALA A 1 53 ? -9.444  13.035  2.498   1.00 0.00 ? 53 ALA A HB3  2  
ATOM 2818  N N    . GLU A 1 54 ? -11.234 14.887  5.019   1.00 0.00 ? 54 GLU A N    2  
ATOM 2819  C CA   . GLU A 1 54 ? -12.002 16.106  5.229   1.00 0.00 ? 54 GLU A CA   2  
ATOM 2820  C C    . GLU A 1 54 ? -12.390 16.243  6.697   1.00 0.00 ? 54 GLU A C    2  
ATOM 2821  O O    . GLU A 1 54 ? -13.136 15.422  7.230   1.00 0.00 ? 54 GLU A O    2  
ATOM 2822  C CB   . GLU A 1 54 ? -13.250 16.114  4.343   1.00 0.00 ? 54 GLU A CB   2  
ATOM 2823  C CG   . GLU A 1 54 ? -14.020 14.805  4.362   1.00 0.00 ? 54 GLU A CG   2  
ATOM 2824  C CD   . GLU A 1 54 ? -13.908 14.042  3.055   1.00 0.00 ? 54 GLU A CD   2  
ATOM 2825  O OE1  . GLU A 1 54 ? -13.756 14.692  2.000   1.00 0.00 ? 54 GLU A OE1  2  
ATOM 2826  O OE2  . GLU A 1 54 ? -13.973 12.795  3.088   1.00 0.00 ? 54 GLU A OE2  2  
ATOM 2827  H H    . GLU A 1 54 ? -11.682 14.019  5.096   1.00 0.00 ? 54 GLU A H    2  
ATOM 2828  H HA   . GLU A 1 54 ? -11.374 16.942  4.958   1.00 0.00 ? 54 GLU A HA   2  
ATOM 2829  H HB2  . GLU A 1 54 ? -13.910 16.900  4.679   1.00 0.00 ? 54 GLU A HB2  2  
ATOM 2830  H HB3  . GLU A 1 54 ? -12.952 16.318  3.325   1.00 0.00 ? 54 GLU A HB3  2  
ATOM 2831  H HG2  . GLU A 1 54 ? -13.632 14.186  5.156   1.00 0.00 ? 54 GLU A HG2  2  
ATOM 2832  H HG3  . GLU A 1 54 ? -15.062 15.017  4.549   1.00 0.00 ? 54 GLU A HG3  2  
ATOM 2833  N N    . LYS A 1 55 ? -11.869 17.298  7.327   1.00 0.00 ? 55 LYS A N    2  
ATOM 2834  C CA   . LYS A 1 55 ? -12.118 17.610  8.740   1.00 0.00 ? 55 LYS A CA   2  
ATOM 2835  C C    . LYS A 1 55 ? -10.908 18.324  9.332   1.00 0.00 ? 55 LYS A C    2  
ATOM 2836  O O    . LYS A 1 55 ? -11.045 19.215  10.170  1.00 0.00 ? 55 LYS A O    2  
ATOM 2837  C CB   . LYS A 1 55 ? -12.423 16.354  9.567   1.00 0.00 ? 55 LYS A CB   2  
ATOM 2838  C CG   . LYS A 1 55 ? -13.900 16.184  9.884   1.00 0.00 ? 55 LYS A CG   2  
ATOM 2839  C CD   . LYS A 1 55 ? -14.116 15.256  11.071  1.00 0.00 ? 55 LYS A CD   2  
ATOM 2840  C CE   . LYS A 1 55 ? -14.756 15.985  12.242  1.00 0.00 ? 55 LYS A CE   2  
ATOM 2841  N NZ   . LYS A 1 55 ? -13.748 16.403  13.255  1.00 0.00 ? 55 LYS A NZ   2  
ATOM 2842  H H    . LYS A 1 55 ? -11.296 17.901  6.814   1.00 0.00 ? 55 LYS A H    2  
ATOM 2843  H HA   . LYS A 1 55 ? -12.968 18.276  8.783   1.00 0.00 ? 55 LYS A HA   2  
ATOM 2844  H HB2  . LYS A 1 55 ? -12.086 15.483  9.026   1.00 0.00 ? 55 LYS A HB2  2  
ATOM 2845  H HB3  . LYS A 1 55 ? -11.884 16.413  10.501  1.00 0.00 ? 55 LYS A HB3  2  
ATOM 2846  H HG2  . LYS A 1 55 ? -14.321 17.151  10.116  1.00 0.00 ? 55 LYS A HG2  2  
ATOM 2847  H HG3  . LYS A 1 55 ? -14.399 15.772  9.020   1.00 0.00 ? 55 LYS A HG3  2  
ATOM 2848  H HD2  . LYS A 1 55 ? -14.763 14.447  10.768  1.00 0.00 ? 55 LYS A HD2  2  
ATOM 2849  H HD3  . LYS A 1 55 ? -13.162 14.858  11.384  1.00 0.00 ? 55 LYS A HD3  2  
ATOM 2850  H HE2  . LYS A 1 55 ? -15.263 16.862  11.869  1.00 0.00 ? 55 LYS A HE2  2  
ATOM 2851  H HE3  . LYS A 1 55 ? -15.474 15.327  12.710  1.00 0.00 ? 55 LYS A HE3  2  
ATOM 2852  H HZ1  . LYS A 1 55 ? -14.214 16.589  14.166  1.00 0.00 ? 55 LYS A HZ1  2  
ATOM 2853  H HZ2  . LYS A 1 55 ? -13.264 17.268  12.943  1.00 0.00 ? 55 LYS A HZ2  2  
ATOM 2854  H HZ3  . LYS A 1 55 ? -13.041 15.651  13.386  1.00 0.00 ? 55 LYS A HZ3  2  
ATOM 2855  N N    . SER A 1 56 ? -9.723  17.924  8.880   1.00 0.00 ? 56 SER A N    2  
ATOM 2856  C CA   . SER A 1 56 ? -8.476  18.520  9.350   1.00 0.00 ? 56 SER A CA   2  
ATOM 2857  C C    . SER A 1 56 ? -8.257  18.244  10.834  1.00 0.00 ? 56 SER A C    2  
ATOM 2858  O O    . SER A 1 56 ? -9.102  17.641  11.497  1.00 0.00 ? 56 SER A O    2  
ATOM 2859  C CB   . SER A 1 56 ? -8.476  20.029  9.095   1.00 0.00 ? 56 SER A CB   2  
ATOM 2860  O OG   . SER A 1 56 ? -7.870  20.337  7.852   1.00 0.00 ? 56 SER A OG   2  
ATOM 2861  H H    . SER A 1 56 ? -9.688  17.211  8.207   1.00 0.00 ? 56 SER A H    2  
ATOM 2862  H HA   . SER A 1 56 ? -7.667  18.072  8.793   1.00 0.00 ? 56 SER A HA   2  
ATOM 2863  H HB2  . SER A 1 56 ? -9.494  20.390  9.084   1.00 0.00 ? 56 SER A HB2  2  
ATOM 2864  H HB3  . SER A 1 56 ? -7.927  20.525  9.882   1.00 0.00 ? 56 SER A HB3  2  
ATOM 2865  H HG   . SER A 1 56 ? -7.026  19.884  7.785   1.00 0.00 ? 56 SER A HG   2  
ATOM 2866  N N    . GLN A 1 57 ? -7.115  18.690  11.348  1.00 0.00 ? 57 GLN A N    2  
ATOM 2867  C CA   . GLN A 1 57 ? -6.776  18.497  12.753  1.00 0.00 ? 57 GLN A CA   2  
ATOM 2868  C C    . GLN A 1 57 ? -5.443  19.160  13.085  1.00 0.00 ? 57 GLN A C    2  
ATOM 2869  O O    . GLN A 1 57 ? -5.351  19.961  14.015  1.00 0.00 ? 57 GLN A O    2  
ATOM 2870  C CB   . GLN A 1 57 ? -6.713  17.004  13.084  1.00 0.00 ? 57 GLN A CB   2  
ATOM 2871  C CG   . GLN A 1 57 ? -6.431  16.719  14.551  1.00 0.00 ? 57 GLN A CG   2  
ATOM 2872  C CD   . GLN A 1 57 ? -7.453  17.352  15.475  1.00 0.00 ? 57 GLN A CD   2  
ATOM 2873  O OE1  . GLN A 1 57 ? -7.100  18.006  16.456  1.00 0.00 ? 57 GLN A OE1  2  
ATOM 2874  N NE2  . GLN A 1 57 ? -8.730  17.160  15.165  1.00 0.00 ? 57 GLN A NE2  2  
ATOM 2875  H H    . GLN A 1 57 ? -6.484  19.164  10.766  1.00 0.00 ? 57 GLN A H    2  
ATOM 2876  H HA   . GLN A 1 57 ? -7.551  18.956  13.347  1.00 0.00 ? 57 GLN A HA   2  
ATOM 2877  H HB2  . GLN A 1 57 ? -7.658  16.550  12.826  1.00 0.00 ? 57 GLN A HB2  2  
ATOM 2878  H HB3  . GLN A 1 57 ? -5.932  16.549  12.494  1.00 0.00 ? 57 GLN A HB3  2  
ATOM 2879  H HG2  . GLN A 1 57 ? -6.443  15.650  14.705  1.00 0.00 ? 57 GLN A HG2  2  
ATOM 2880  H HG3  . GLN A 1 57 ? -5.454  17.107  14.798  1.00 0.00 ? 57 GLN A HG3  2  
ATOM 2881  H HE21 . GLN A 1 57 ? -8.938  16.627  14.369  1.00 0.00 ? 57 GLN A HE21 2  
ATOM 2882  H HE22 . GLN A 1 57 ? -9.412  17.558  15.745  1.00 0.00 ? 57 GLN A HE22 2  
ATOM 2883  N N    . GLN A 1 58 ? -4.412  18.821  12.316  1.00 0.00 ? 58 GLN A N    2  
ATOM 2884  C CA   . GLN A 1 58 ? -3.083  19.384  12.526  1.00 0.00 ? 58 GLN A CA   2  
ATOM 2885  C C    . GLN A 1 58 ? -2.768  20.439  11.469  1.00 0.00 ? 58 GLN A C    2  
ATOM 2886  O O    . GLN A 1 58 ? -3.621  20.788  10.653  1.00 0.00 ? 58 GLN A O    2  
ATOM 2887  C CB   . GLN A 1 58 ? -2.027  18.277  12.493  1.00 0.00 ? 58 GLN A CB   2  
ATOM 2888  C CG   . GLN A 1 58 ? -1.551  17.850  13.872  1.00 0.00 ? 58 GLN A CG   2  
ATOM 2889  C CD   . GLN A 1 58 ? -0.785  18.945  14.589  1.00 0.00 ? 58 GLN A CD   2  
ATOM 2890  O OE1  . GLN A 1 58 ? -1.110  19.308  15.720  1.00 0.00 ? 58 GLN A OE1  2  
ATOM 2891  N NE2  . GLN A 1 58 ? 0.239   19.478  13.933  1.00 0.00 ? 58 GLN A NE2  2  
ATOM 2892  H H    . GLN A 1 58 ? -4.549  18.178  11.590  1.00 0.00 ? 58 GLN A H    2  
ATOM 2893  H HA   . GLN A 1 58 ? -3.072  19.852  13.499  1.00 0.00 ? 58 GLN A HA   2  
ATOM 2894  H HB2  . GLN A 1 58 ? -2.443  17.412  11.997  1.00 0.00 ? 58 GLN A HB2  2  
ATOM 2895  H HB3  . GLN A 1 58 ? -1.172  18.625  11.933  1.00 0.00 ? 58 GLN A HB3  2  
ATOM 2896  H HG2  . GLN A 1 58 ? -2.410  17.584  14.469  1.00 0.00 ? 58 GLN A HG2  2  
ATOM 2897  H HG3  . GLN A 1 58 ? -0.906  16.990  13.767  1.00 0.00 ? 58 GLN A HG3  2  
ATOM 2898  H HE21 . GLN A 1 58 ? 0.440   19.140  13.035  1.00 0.00 ? 58 GLN A HE21 2  
ATOM 2899  H HE22 . GLN A 1 58 ? 0.752   20.188  14.373  1.00 0.00 ? 58 GLN A HE22 2  
ATOM 2900  N N    . SER A 1 59 ? -1.538  20.942  11.491  1.00 0.00 ? 59 SER A N    2  
ATOM 2901  C CA   . SER A 1 59 ? -1.110  21.957  10.534  1.00 0.00 ? 59 SER A CA   2  
ATOM 2902  C C    . SER A 1 59 ? 0.087   21.471  9.723   1.00 0.00 ? 59 SER A C    2  
ATOM 2903  O O    . SER A 1 59 ? 0.803   20.560  10.140  1.00 0.00 ? 59 SER A O    2  
ATOM 2904  C CB   . SER A 1 59 ? -0.754  23.255  11.261  1.00 0.00 ? 59 SER A CB   2  
ATOM 2905  O OG   . SER A 1 59 ? 0.462   23.124  11.976  1.00 0.00 ? 59 SER A OG   2  
ATOM 2906  H H    . SER A 1 59 ? -0.903  20.624  12.166  1.00 0.00 ? 59 SER A H    2  
ATOM 2907  H HA   . SER A 1 59 ? -1.933  22.146  9.861   1.00 0.00 ? 59 SER A HA   2  
ATOM 2908  H HB2  . SER A 1 59 ? -0.648  24.052  10.539  1.00 0.00 ? 59 SER A HB2  2  
ATOM 2909  H HB3  . SER A 1 59 ? -1.542  23.503  11.957  1.00 0.00 ? 59 SER A HB3  2  
ATOM 2910  H HG   . SER A 1 59 ? 0.760   23.989  12.264  1.00 0.00 ? 59 SER A HG   2  
ATOM 2911  N N    . SER A 1 60 ? 0.297   22.084  8.563   1.00 0.00 ? 60 SER A N    2  
ATOM 2912  C CA   . SER A 1 60 ? 1.407   21.713  7.693   1.00 0.00 ? 60 SER A CA   2  
ATOM 2913  C C    . SER A 1 60 ? 2.463   22.813  7.659   1.00 0.00 ? 60 SER A C    2  
ATOM 2914  O O    . SER A 1 60 ? 2.142   23.992  7.510   1.00 0.00 ? 60 SER A O    2  
ATOM 2915  C CB   . SER A 1 60 ? 0.901   21.433  6.276   1.00 0.00 ? 60 SER A CB   2  
ATOM 2916  O OG   . SER A 1 60 ? -0.043  20.377  6.272   1.00 0.00 ? 60 SER A OG   2  
ATOM 2917  H H    . SER A 1 60 ? -0.308  22.802  8.285   1.00 0.00 ? 60 SER A H    2  
ATOM 2918  H HA   . SER A 1 60 ? 1.854   20.814  8.090   1.00 0.00 ? 60 SER A HA   2  
ATOM 2919  H HB2  . SER A 1 60 ? 0.430   22.321  5.882   1.00 0.00 ? 60 SER A HB2  2  
ATOM 2920  H HB3  . SER A 1 60 ? 1.735   21.158  5.647   1.00 0.00 ? 60 SER A HB3  2  
ATOM 2921  H HG   . SER A 1 60 ? -0.715  20.551  5.609   1.00 0.00 ? 60 SER A HG   2  
ATOM 2922  N N    . TYR A 1 61 ? 3.725   22.419  7.798   1.00 0.00 ? 61 TYR A N    2  
ATOM 2923  C CA   . TYR A 1 61 ? 4.829   23.372  7.783   1.00 0.00 ? 61 TYR A CA   2  
ATOM 2924  C C    . TYR A 1 61 ? 6.061   22.767  7.116   1.00 0.00 ? 61 TYR A C    2  
ATOM 2925  O O    . TYR A 1 61 ? 5.954   21.640  6.588   1.00 0.00 ? 61 TYR A O    2  
ATOM 2926  C CB   . TYR A 1 61 ? 5.167   23.815  9.209   1.00 0.00 ? 61 TYR A CB   2  
ATOM 2927  C CG   . TYR A 1 61 ? 5.197   25.316  9.386   1.00 0.00 ? 61 TYR A CG   2  
ATOM 2928  C CD1  . TYR A 1 61 ? 4.021   26.039  9.544   1.00 0.00 ? 61 TYR A CD1  2  
ATOM 2929  C CD2  . TYR A 1 61 ? 6.400   26.011  9.394   1.00 0.00 ? 61 TYR A CD2  2  
ATOM 2930  C CE1  . TYR A 1 61 ? 4.043   27.411  9.706   1.00 0.00 ? 61 TYR A CE1  2  
ATOM 2931  C CE2  . TYR A 1 61 ? 6.430   27.383  9.556   1.00 0.00 ? 61 TYR A CE2  2  
ATOM 2932  C CZ   . TYR A 1 61 ? 5.250   28.078  9.711   1.00 0.00 ? 61 TYR A CZ   2  
ATOM 2933  O OH   . TYR A 1 61 ? 5.276   29.445  9.872   1.00 0.00 ? 61 TYR A OH   2  
ATOM 2934  O OXT  . TYR A 1 61 ? 7.123   23.425  7.128   1.00 0.00 ? 61 TYR A OXT  2  
ATOM 2935  H H    . TYR A 1 61 ? 3.919   21.465  7.914   1.00 0.00 ? 61 TYR A H    2  
ATOM 2936  H HA   . TYR A 1 61 ? 4.514   24.234  7.214   1.00 0.00 ? 61 TYR A HA   2  
ATOM 2937  H HB2  . TYR A 1 61 ? 4.428   23.416  9.887   1.00 0.00 ? 61 TYR A HB2  2  
ATOM 2938  H HB3  . TYR A 1 61 ? 6.140   23.429  9.479   1.00 0.00 ? 61 TYR A HB3  2  
ATOM 2939  H HD1  . TYR A 1 61 ? 3.077   25.514  9.540   1.00 0.00 ? 61 TYR A HD1  2  
ATOM 2940  H HD2  . TYR A 1 61 ? 7.323   25.463  9.272   1.00 0.00 ? 61 TYR A HD2  2  
ATOM 2941  H HE1  . TYR A 1 61 ? 3.118   27.955  9.828   1.00 0.00 ? 61 TYR A HE1  2  
ATOM 2942  H HE2  . TYR A 1 61 ? 7.376   27.905  9.559   1.00 0.00 ? 61 TYR A HE2  2  
ATOM 2943  H HH   . TYR A 1 61 ? 5.353   29.656  10.805  1.00 0.00 ? 61 TYR A HH   2  
ATOM 2944  N N    . MET B 1 1  ? -1.955  13.118  4.242   1.00 0.00 ? 1  MET B N    2  
ATOM 2945  C CA   . MET B 1 1  ? -1.740  11.890  5.051   1.00 0.00 ? 1  MET B CA   2  
ATOM 2946  C C    . MET B 1 1  ? -2.959  11.576  5.912   1.00 0.00 ? 1  MET B C    2  
ATOM 2947  O O    . MET B 1 1  ? -3.469  12.442  6.623   1.00 0.00 ? 1  MET B O    2  
ATOM 2948  C CB   . MET B 1 1  ? -0.509  12.097  5.935   1.00 0.00 ? 1  MET B CB   2  
ATOM 2949  C CG   . MET B 1 1  ? 0.202   10.803  6.299   1.00 0.00 ? 1  MET B CG   2  
ATOM 2950  S SD   . MET B 1 1  ? 1.130   10.931  7.840   1.00 0.00 ? 1  MET B SD   2  
ATOM 2951  C CE   . MET B 1 1  ? 2.338   9.627   7.617   1.00 0.00 ? 1  MET B CE   2  
ATOM 2952  H H1   . MET B 1 1  ? -2.011  13.923  4.897   1.00 0.00 ? 1  MET B H1   2  
ATOM 2953  H H2   . MET B 1 1  ? -2.845  12.999  3.716   1.00 0.00 ? 1  MET B H2   2  
ATOM 2954  H H3   . MET B 1 1  ? -1.146  13.218  3.596   1.00 0.00 ? 1  MET B H3   2  
ATOM 2955  H HA   . MET B 1 1  ? -1.561  11.063  4.380   1.00 0.00 ? 1  MET B HA   2  
ATOM 2956  H HB2  . MET B 1 1  ? 0.190   12.734  5.416   1.00 0.00 ? 1  MET B HB2  2  
ATOM 2957  H HB3  . MET B 1 1  ? -0.815  12.583  6.850   1.00 0.00 ? 1  MET B HB3  2  
ATOM 2958  H HG2  . MET B 1 1  ? -0.534  10.020  6.403   1.00 0.00 ? 1  MET B HG2  2  
ATOM 2959  H HG3  . MET B 1 1  ? 0.887   10.549  5.503   1.00 0.00 ? 1  MET B HG3  2  
ATOM 2960  H HE1  . MET B 1 1  ? 1.878   8.794   7.107   1.00 0.00 ? 1  MET B HE1  2  
ATOM 2961  H HE2  . MET B 1 1  ? 2.701   9.304   8.581   1.00 0.00 ? 1  MET B HE2  2  
ATOM 2962  H HE3  . MET B 1 1  ? 3.163   9.998   7.027   1.00 0.00 ? 1  MET B HE3  2  
ATOM 2963  N N    . LEU B 1 2  ? -3.419  10.331  5.846   1.00 0.00 ? 2  LEU B N    2  
ATOM 2964  C CA   . LEU B 1 2  ? -4.576  9.902   6.624   1.00 0.00 ? 2  LEU B CA   2  
ATOM 2965  C C    . LEU B 1 2  ? -4.198  8.765   7.568   1.00 0.00 ? 2  LEU B C    2  
ATOM 2966  O O    . LEU B 1 2  ? -3.832  7.677   7.126   1.00 0.00 ? 2  LEU B O    2  
ATOM 2967  C CB   . LEU B 1 2  ? -5.705  9.456   5.692   1.00 0.00 ? 2  LEU B CB   2  
ATOM 2968  C CG   . LEU B 1 2  ? -6.262  10.551  4.779   1.00 0.00 ? 2  LEU B CG   2  
ATOM 2969  C CD1  . LEU B 1 2  ? -5.225  10.967  3.747   1.00 0.00 ? 2  LEU B CD1  2  
ATOM 2970  C CD2  . LEU B 1 2  ? -7.537  10.075  4.097   1.00 0.00 ? 2  LEU B CD2  2  
ATOM 2971  H H    . LEU B 1 2  ? -2.967  9.683   5.263   1.00 0.00 ? 2  LEU B H    2  
ATOM 2972  H HA   . LEU B 1 2  ? -4.915  10.744  7.209   1.00 0.00 ? 2  LEU B HA   2  
ATOM 2973  H HB2  . LEU B 1 2  ? -5.335  8.652   5.072   1.00 0.00 ? 2  LEU B HB2  2  
ATOM 2974  H HB3  . LEU B 1 2  ? -6.514  9.077   6.297   1.00 0.00 ? 2  LEU B HB3  2  
ATOM 2975  H HG   . LEU B 1 2  ? -6.505  11.418  5.375   1.00 0.00 ? 2  LEU B HG   2  
ATOM 2976  H HD11 . LEU B 1 2  ? -4.499  10.177  3.628   1.00 0.00 ? 2  LEU B HD11 2  
ATOM 2977  H HD12 . LEU B 1 2  ? -4.728  11.866  4.078   1.00 0.00 ? 2  LEU B HD12 2  
ATOM 2978  H HD13 . LEU B 1 2  ? -5.713  11.152  2.801   1.00 0.00 ? 2  LEU B HD13 2  
ATOM 2979  H HD21 . LEU B 1 2  ? -7.505  9.002   3.984   1.00 0.00 ? 2  LEU B HD21 2  
ATOM 2980  H HD22 . LEU B 1 2  ? -7.618  10.537  3.124   1.00 0.00 ? 2  LEU B HD22 2  
ATOM 2981  H HD23 . LEU B 1 2  ? -8.391  10.349  4.698   1.00 0.00 ? 2  LEU B HD23 2  
ATOM 2982  N N    . ILE B 1 3  ? -4.297  9.016   8.871   1.00 0.00 ? 3  ILE B N    2  
ATOM 2983  C CA   . ILE B 1 3  ? -3.970  8.002   9.866   1.00 0.00 ? 3  ILE B CA   2  
ATOM 2984  C C    . ILE B 1 3  ? -5.220  7.226   10.272  1.00 0.00 ? 3  ILE B C    2  
ATOM 2985  O O    . ILE B 1 3  ? -6.073  7.734   11.000  1.00 0.00 ? 3  ILE B O    2  
ATOM 2986  C CB   . ILE B 1 3  ? -3.310  8.628   11.118  1.00 0.00 ? 3  ILE B CB   2  
ATOM 2987  C CG1  . ILE B 1 3  ? -1.881  9.081   10.795  1.00 0.00 ? 3  ILE B CG1  2  
ATOM 2988  C CG2  . ILE B 1 3  ? -3.306  7.646   12.285  1.00 0.00 ? 3  ILE B CG2  2  
ATOM 2989  C CD1  . ILE B 1 3  ? -0.896  7.938   10.631  1.00 0.00 ? 3  ILE B CD1  2  
ATOM 2990  H H    . ILE B 1 3  ? -4.604  9.897   9.170   1.00 0.00 ? 3  ILE B H    2  
ATOM 2991  H HA   . ILE B 1 3  ? -3.266  7.316   9.420   1.00 0.00 ? 3  ILE B HA   2  
ATOM 2992  H HB   . ILE B 1 3  ? -3.892  9.489   11.409  1.00 0.00 ? 3  ILE B HB   2  
ATOM 2993  H HG12 . ILE B 1 3  ? -1.890  9.644   9.873   1.00 0.00 ? 3  ILE B HG12 2  
ATOM 2994  H HG13 . ILE B 1 3  ? -1.524  9.716   11.593  1.00 0.00 ? 3  ILE B HG13 2  
ATOM 2995  H HG21 . ILE B 1 3  ? -2.838  6.723   11.977  1.00 0.00 ? 3  ILE B HG21 2  
ATOM 2996  H HG22 . ILE B 1 3  ? -4.322  7.449   12.594  1.00 0.00 ? 3  ILE B HG22 2  
ATOM 2997  H HG23 . ILE B 1 3  ? -2.755  8.071   13.111  1.00 0.00 ? 3  ILE B HG23 2  
ATOM 2998  H HD11 . ILE B 1 3  ? -1.341  7.163   10.025  1.00 0.00 ? 3  ILE B HD11 2  
ATOM 2999  H HD12 . ILE B 1 3  ? -0.644  7.535   11.601  1.00 0.00 ? 3  ILE B HD12 2  
ATOM 3000  H HD13 . ILE B 1 3  ? 0.000   8.301   10.149  1.00 0.00 ? 3  ILE B HD13 2  
ATOM 3001  N N    . LEU B 1 4  ? -5.318  5.993   9.790   1.00 0.00 ? 4  LEU B N    2  
ATOM 3002  C CA   . LEU B 1 4  ? -6.457  5.135   10.088  1.00 0.00 ? 4  LEU B CA   2  
ATOM 3003  C C    . LEU B 1 4  ? -6.013  3.902   10.866  1.00 0.00 ? 4  LEU B C    2  
ATOM 3004  O O    . LEU B 1 4  ? -4.857  3.498   10.795  1.00 0.00 ? 4  LEU B O    2  
ATOM 3005  C CB   . LEU B 1 4  ? -7.158  4.714   8.795   1.00 0.00 ? 4  LEU B CB   2  
ATOM 3006  C CG   . LEU B 1 4  ? -7.747  5.862   7.975   1.00 0.00 ? 4  LEU B CG   2  
ATOM 3007  C CD1  . LEU B 1 4  ? -8.676  6.708   8.832   1.00 0.00 ? 4  LEU B CD1  2  
ATOM 3008  C CD2  . LEU B 1 4  ? -6.637  6.718   7.384   1.00 0.00 ? 4  LEU B CD2  2  
ATOM 3009  H H    . LEU B 1 4  ? -4.604  5.651   9.212   1.00 0.00 ? 4  LEU B H    2  
ATOM 3010  H HA   . LEU B 1 4  ? -7.148  5.700   10.695  1.00 0.00 ? 4  LEU B HA   2  
ATOM 3011  H HB2  . LEU B 1 4  ? -6.443  4.188   8.179   1.00 0.00 ? 4  LEU B HB2  2  
ATOM 3012  H HB3  . LEU B 1 4  ? -7.958  4.035   9.048   1.00 0.00 ? 4  LEU B HB3  2  
ATOM 3013  H HG   . LEU B 1 4  ? -8.326  5.454   7.160   1.00 0.00 ? 4  LEU B HG   2  
ATOM 3014  H HD11 . LEU B 1 4  ? -9.214  6.070   9.517   1.00 0.00 ? 4  LEU B HD11 2  
ATOM 3015  H HD12 . LEU B 1 4  ? -9.379  7.227   8.196   1.00 0.00 ? 4  LEU B HD12 2  
ATOM 3016  H HD13 . LEU B 1 4  ? -8.095  7.428   9.390   1.00 0.00 ? 4  LEU B HD13 2  
ATOM 3017  H HD21 . LEU B 1 4  ? -5.732  6.134   7.313   1.00 0.00 ? 4  LEU B HD21 2  
ATOM 3018  H HD22 . LEU B 1 4  ? -6.465  7.574   8.020   1.00 0.00 ? 4  LEU B HD22 2  
ATOM 3019  H HD23 . LEU B 1 4  ? -6.927  7.054   6.399   1.00 0.00 ? 4  LEU B HD23 2  
ATOM 3020  N N    . THR B 1 5  ? -6.942  3.301   11.598  1.00 0.00 ? 5  THR B N    2  
ATOM 3021  C CA   . THR B 1 5  ? -6.635  2.105   12.374  1.00 0.00 ? 5  THR B CA   2  
ATOM 3022  C C    . THR B 1 5  ? -7.035  0.854   11.611  1.00 0.00 ? 5  THR B C    2  
ATOM 3023  O O    . THR B 1 5  ? -8.133  0.772   11.061  1.00 0.00 ? 5  THR B O    2  
ATOM 3024  C CB   . THR B 1 5  ? -7.343  2.128   13.725  1.00 0.00 ? 5  THR B CB   2  
ATOM 3025  O OG1  . THR B 1 5  ? -8.011  3.360   13.930  1.00 0.00 ? 5  THR B OG1  2  
ATOM 3026  C CG2  . THR B 1 5  ? -6.395  1.916   14.882  1.00 0.00 ? 5  THR B CG2  2  
ATOM 3027  H H    . THR B 1 5  ? -7.853  3.663   11.595  1.00 0.00 ? 5  THR B H    2  
ATOM 3028  H HA   . THR B 1 5  ? -5.564  2.080   12.540  1.00 0.00 ? 5  THR B HA   2  
ATOM 3029  H HB   . THR B 1 5  ? -8.076  1.331   13.749  1.00 0.00 ? 5  THR B HB   2  
ATOM 3030  H HG1  . THR B 1 5  ? -8.566  3.299   14.711  1.00 0.00 ? 5  THR B HG1  2  
ATOM 3031  H HG21 . THR B 1 5  ? -5.450  1.549   14.507  1.00 0.00 ? 5  THR B HG21 2  
ATOM 3032  H HG22 . THR B 1 5  ? -6.817  1.195   15.565  1.00 0.00 ? 5  THR B HG22 2  
ATOM 3033  H HG23 . THR B 1 5  ? -6.239  2.852   15.397  1.00 0.00 ? 5  THR B HG23 2  
ATOM 3034  N N    . ARG B 1 6  ? -6.139  -0.119  11.584  1.00 0.00 ? 6  ARG B N    2  
ATOM 3035  C CA   . ARG B 1 6  ? -6.399  -1.367  10.891  1.00 0.00 ? 6  ARG B CA   2  
ATOM 3036  C C    . ARG B 1 6  ? -5.633  -2.514  11.537  1.00 0.00 ? 6  ARG B C    2  
ATOM 3037  O O    . ARG B 1 6  ? -4.538  -2.324  12.072  1.00 0.00 ? 6  ARG B O    2  
ATOM 3038  C CB   . ARG B 1 6  ? -6.014  -1.247  9.415   1.00 0.00 ? 6  ARG B CB   2  
ATOM 3039  C CG   . ARG B 1 6  ? -6.942  -0.348  8.614   1.00 0.00 ? 6  ARG B CG   2  
ATOM 3040  C CD   . ARG B 1 6  ? -6.383  1.061   8.485   1.00 0.00 ? 6  ARG B CD   2  
ATOM 3041  N NE   . ARG B 1 6  ? -6.760  1.688   7.220   1.00 0.00 ? 6  ARG B NE   2  
ATOM 3042  C CZ   . ARG B 1 6  ? -6.131  1.471   6.067   1.00 0.00 ? 6  ARG B CZ   2  
ATOM 3043  N NH1  . ARG B 1 6  ? -5.097  0.641   6.012   1.00 0.00 ? 6  ARG B NH1  2  
ATOM 3044  N NH2  . ARG B 1 6  ? -6.538  2.086   4.965   1.00 0.00 ? 6  ARG B NH2  2  
ATOM 3045  H H    . ARG B 1 6  ? -5.282  0.005   12.043  1.00 0.00 ? 6  ARG B H    2  
ATOM 3046  H HA   . ARG B 1 6  ? -7.456  -1.572  10.962  1.00 0.00 ? 6  ARG B HA   2  
ATOM 3047  H HB2  . ARG B 1 6  ? -5.015  -0.846  9.349   1.00 0.00 ? 6  ARG B HB2  2  
ATOM 3048  H HB3  . ARG B 1 6  ? -6.029  -2.230  8.970   1.00 0.00 ? 6  ARG B HB3  2  
ATOM 3049  H HG2  . ARG B 1 6  ? -7.067  -0.765  7.626   1.00 0.00 ? 6  ARG B HG2  2  
ATOM 3050  H HG3  . ARG B 1 6  ? -7.900  -0.301  9.111   1.00 0.00 ? 6  ARG B HG3  2  
ATOM 3051  H HD2  . ARG B 1 6  ? -6.762  1.661   9.298   1.00 0.00 ? 6  ARG B HD2  2  
ATOM 3052  H HD3  . ARG B 1 6  ? -5.306  1.014   8.546   1.00 0.00 ? 6  ARG B HD3  2  
ATOM 3053  H HE   . ARG B 1 6  ? -7.522  2.305   7.231   1.00 0.00 ? 6  ARG B HE   2  
ATOM 3054  H HH11 . ARG B 1 6  ? -4.785  0.174   6.839   1.00 0.00 ? 6  ARG B HH11 2  
ATOM 3055  H HH12 . ARG B 1 6  ? -4.630  0.484   5.142   1.00 0.00 ? 6  ARG B HH12 2  
ATOM 3056  H HH21 . ARG B 1 6  ? -7.316  2.713   5.001   1.00 0.00 ? 6  ARG B HH21 2  
ATOM 3057  H HH22 . ARG B 1 6  ? -6.065  1.925   4.099   1.00 0.00 ? 6  ARG B HH22 2  
ATOM 3058  N N    . ARG B 1 7  ? -6.224  -3.701  11.481  1.00 0.00 ? 7  ARG B N    2  
ATOM 3059  C CA   . ARG B 1 7  ? -5.607  -4.898  12.052  1.00 0.00 ? 7  ARG B CA   2  
ATOM 3060  C C    . ARG B 1 7  ? -6.508  -6.131  11.920  1.00 0.00 ? 7  ARG B C    2  
ATOM 3061  O O    . ARG B 1 7  ? -6.092  -7.242  12.246  1.00 0.00 ? 7  ARG B O    2  
ATOM 3062  C CB   . ARG B 1 7  ? -5.253  -4.672  13.522  1.00 0.00 ? 7  ARG B CB   2  
ATOM 3063  C CG   . ARG B 1 7  ? -4.393  -5.780  14.113  1.00 0.00 ? 7  ARG B CG   2  
ATOM 3064  C CD   . ARG B 1 7  ? -5.064  -6.433  15.310  1.00 0.00 ? 7  ARG B CD   2  
ATOM 3065  N NE   . ARG B 1 7  ? -4.274  -7.541  15.844  1.00 0.00 ? 7  ARG B NE   2  
ATOM 3066  C CZ   . ARG B 1 7  ? -4.667  -8.313  16.855  1.00 0.00 ? 7  ARG B CZ   2  
ATOM 3067  N NH1  . ARG B 1 7  ? -5.837  -8.101  17.444  1.00 0.00 ? 7  ARG B NH1  2  
ATOM 3068  N NH2  . ARG B 1 7  ? -3.888  -9.299  17.277  1.00 0.00 ? 7  ARG B NH2  2  
ATOM 3069  H H    . ARG B 1 7  ? -7.094  -3.771  11.043  1.00 0.00 ? 7  ARG B H    2  
ATOM 3070  H HA   . ARG B 1 7  ? -4.697  -5.083  11.504  1.00 0.00 ? 7  ARG B HA   2  
ATOM 3071  H HB2  . ARG B 1 7  ? -4.712  -3.741  13.611  1.00 0.00 ? 7  ARG B HB2  2  
ATOM 3072  H HB3  . ARG B 1 7  ? -6.165  -4.606  14.096  1.00 0.00 ? 7  ARG B HB3  2  
ATOM 3073  H HG2  . ARG B 1 7  ? -4.223  -6.532  13.355  1.00 0.00 ? 7  ARG B HG2  2  
ATOM 3074  H HG3  . ARG B 1 7  ? -3.448  -5.361  14.425  1.00 0.00 ? 7  ARG B HG3  2  
ATOM 3075  H HD2  . ARG B 1 7  ? -5.194  -5.691  16.084  1.00 0.00 ? 7  ARG B HD2  2  
ATOM 3076  H HD3  . ARG B 1 7  ? -6.031  -6.807  15.005  1.00 0.00 ? 7  ARG B HD3  2  
ATOM 3077  H HE   . ARG B 1 7  ? -3.405  -7.719  15.427  1.00 0.00 ? 7  ARG B HE   2  
ATOM 3078  H HH11 . ARG B 1 7  ? -6.430  -7.359  17.130  1.00 0.00 ? 7  ARG B HH11 2  
ATOM 3079  H HH12 . ARG B 1 7  ? -6.127  -8.685  18.202  1.00 0.00 ? 7  ARG B HH12 2  
ATOM 3080  H HH21 . ARG B 1 7  ? -3.005  -9.463  16.837  1.00 0.00 ? 7  ARG B HH21 2  
ATOM 3081  H HH22 . ARG B 1 7  ? -4.183  -9.879  18.037  1.00 0.00 ? 7  ARG B HH22 2  
ATOM 3082  N N    . VAL B 1 8  ? -7.737  -5.940  11.442  1.00 0.00 ? 8  VAL B N    2  
ATOM 3083  C CA   . VAL B 1 8  ? -8.669  -7.048  11.275  1.00 0.00 ? 8  VAL B CA   2  
ATOM 3084  C C    . VAL B 1 8  ? -9.010  -7.260  9.803   1.00 0.00 ? 8  VAL B C    2  
ATOM 3085  O O    . VAL B 1 8  ? -8.807  -8.345  9.259   1.00 0.00 ? 8  VAL B O    2  
ATOM 3086  C CB   . VAL B 1 8  ? -9.969  -6.814  12.067  1.00 0.00 ? 8  VAL B CB   2  
ATOM 3087  C CG1  . VAL B 1 8  ? -10.847 -8.055  12.033  1.00 0.00 ? 8  VAL B CG1  2  
ATOM 3088  C CG2  . VAL B 1 8  ? -9.652  -6.414  13.500  1.00 0.00 ? 8  VAL B CG2  2  
ATOM 3089  H H    . VAL B 1 8  ? -8.023  -5.040  11.193  1.00 0.00 ? 8  VAL B H    2  
ATOM 3090  H HA   . VAL B 1 8  ? -8.196  -7.942  11.656  1.00 0.00 ? 8  VAL B HA   2  
ATOM 3091  H HB   . VAL B 1 8  ? -10.511 -6.004  11.601  1.00 0.00 ? 8  VAL B HB   2  
ATOM 3092  H HG11 . VAL B 1 8  ? -11.881 -7.762  11.925  1.00 0.00 ? 8  VAL B HG11 2  
ATOM 3093  H HG12 . VAL B 1 8  ? -10.724 -8.608  12.953  1.00 0.00 ? 8  VAL B HG12 2  
ATOM 3094  H HG13 . VAL B 1 8  ? -10.560 -8.677  11.198  1.00 0.00 ? 8  VAL B HG13 2  
ATOM 3095  H HG21 . VAL B 1 8  ? -8.826  -7.007  13.865  1.00 0.00 ? 8  VAL B HG21 2  
ATOM 3096  H HG22 . VAL B 1 8  ? -10.519 -6.584  14.121  1.00 0.00 ? 8  VAL B HG22 2  
ATOM 3097  H HG23 . VAL B 1 8  ? -9.386  -5.368  13.531  1.00 0.00 ? 8  VAL B HG23 2  
ATOM 3098  N N    . GLY B 1 9  ? -9.527  -6.215  9.163   1.00 0.00 ? 9  GLY B N    2  
ATOM 3099  C CA   . GLY B 1 9  ? -9.885  -6.310  7.760   1.00 0.00 ? 9  GLY B CA   2  
ATOM 3100  C C    . GLY B 1 9  ? -10.491 -5.027  7.225   1.00 0.00 ? 9  GLY B C    2  
ATOM 3101  O O    . GLY B 1 9  ? -11.710 -4.854  7.243   1.00 0.00 ? 9  GLY B O    2  
ATOM 3102  H H    . GLY B 1 9  ? -9.667  -5.375  9.647   1.00 0.00 ? 9  GLY B H    2  
ATOM 3103  H HA2  . GLY B 1 9  ? -8.998  -6.541  7.189   1.00 0.00 ? 9  GLY B HA2  2  
ATOM 3104  H HA3  . GLY B 1 9  ? -10.598 -7.111  7.635   1.00 0.00 ? 9  GLY B HA3  2  
ATOM 3105  N N    . GLU B 1 10 ? -9.640  -4.125  6.744   1.00 0.00 ? 10 GLU B N    2  
ATOM 3106  C CA   . GLU B 1 10 ? -10.100 -2.852  6.199   1.00 0.00 ? 10 GLU B CA   2  
ATOM 3107  C C    . GLU B 1 10 ? -10.212 -2.924  4.679   1.00 0.00 ? 10 GLU B C    2  
ATOM 3108  O O    . GLU B 1 10 ? -11.312 -2.931  4.129   1.00 0.00 ? 10 GLU B O    2  
ATOM 3109  C CB   . GLU B 1 10 ? -9.148  -1.725  6.604   1.00 0.00 ? 10 GLU B CB   2  
ATOM 3110  C CG   . GLU B 1 10 ? -9.860  -0.453  7.035   1.00 0.00 ? 10 GLU B CG   2  
ATOM 3111  C CD   . GLU B 1 10 ? -10.257 0.420   5.861   1.00 0.00 ? 10 GLU B CD   2  
ATOM 3112  O OE1  . GLU B 1 10 ? -9.353  0.964   5.193   1.00 0.00 ? 10 GLU B OE1  2  
ATOM 3113  O OE2  . GLU B 1 10 ? -11.472 0.559   5.608   1.00 0.00 ? 10 GLU B OE2  2  
ATOM 3114  H H    . GLU B 1 10 ? -8.680  -4.322  6.755   1.00 0.00 ? 10 GLU B H    2  
ATOM 3115  H HA   . GLU B 1 10 ? -11.078 -2.651  6.610   1.00 0.00 ? 10 GLU B HA   2  
ATOM 3116  H HB2  . GLU B 1 10 ? -8.535  -2.064  7.425   1.00 0.00 ? 10 GLU B HB2  2  
ATOM 3117  H HB3  . GLU B 1 10 ? -8.510  -1.487  5.765   1.00 0.00 ? 10 GLU B HB3  2  
ATOM 3118  H HG2  . GLU B 1 10 ? -10.752 -0.722  7.581   1.00 0.00 ? 10 GLU B HG2  2  
ATOM 3119  H HG3  . GLU B 1 10 ? -9.202  0.112   7.679   1.00 0.00 ? 10 GLU B HG3  2  
ATOM 3120  N N    . THR B 1 11 ? -9.064  -2.984  4.006   1.00 0.00 ? 11 THR B N    2  
ATOM 3121  C CA   . THR B 1 11 ? -9.026  -3.063  2.547   1.00 0.00 ? 11 THR B CA   2  
ATOM 3122  C C    . THR B 1 11 ? -9.330  -1.713  1.903   1.00 0.00 ? 11 THR B C    2  
ATOM 3123  O O    . THR B 1 11 ? -10.484 -1.292  1.831   1.00 0.00 ? 11 THR B O    2  
ATOM 3124  C CB   . THR B 1 11 ? -10.013 -4.117  2.036   1.00 0.00 ? 11 THR B CB   2  
ATOM 3125  O OG1  . THR B 1 11 ? -10.019 -5.252  2.884   1.00 0.00 ? 11 THR B OG1  2  
ATOM 3126  C CG2  . THR B 1 11 ? -9.707  -4.593  0.633   1.00 0.00 ? 11 THR B CG2  2  
ATOM 3127  H H    . THR B 1 11 ? -8.218  -2.978  4.500   1.00 0.00 ? 11 THR B H    2  
ATOM 3128  H HA   . THR B 1 11 ? -8.027  -3.360  2.264   1.00 0.00 ? 11 THR B HA   2  
ATOM 3129  H HB   . THR B 1 11 ? -11.007 -3.691  2.031   1.00 0.00 ? 11 THR B HB   2  
ATOM 3130  H HG1  . THR B 1 11 ? -10.923 -5.458  3.136   1.00 0.00 ? 11 THR B HG1  2  
ATOM 3131  H HG21 . THR B 1 11 ? -8.639  -4.578  0.472   1.00 0.00 ? 11 THR B HG21 2  
ATOM 3132  H HG22 . THR B 1 11 ? -10.188 -3.941  -0.082  1.00 0.00 ? 11 THR B HG22 2  
ATOM 3133  H HG23 . THR B 1 11 ? -10.075 -5.600  0.506   1.00 0.00 ? 11 THR B HG23 2  
ATOM 3134  N N    . LEU B 1 12 ? -8.283  -1.048  1.422   1.00 0.00 ? 12 LEU B N    2  
ATOM 3135  C CA   . LEU B 1 12 ? -8.427  0.246   0.764   1.00 0.00 ? 12 LEU B CA   2  
ATOM 3136  C C    . LEU B 1 12 ? -8.172  0.100   -0.733  1.00 0.00 ? 12 LEU B C    2  
ATOM 3137  O O    . LEU B 1 12 ? -7.465  -0.812  -1.159  1.00 0.00 ? 12 LEU B O    2  
ATOM 3138  C CB   . LEU B 1 12 ? -7.467  1.277   1.377   1.00 0.00 ? 12 LEU B CB   2  
ATOM 3139  C CG   . LEU B 1 12 ? -6.040  1.278   0.813   1.00 0.00 ? 12 LEU B CG   2  
ATOM 3140  C CD1  . LEU B 1 12 ? -5.389  2.639   1.001   1.00 0.00 ? 12 LEU B CD1  2  
ATOM 3141  C CD2  . LEU B 1 12 ? -5.207  0.191   1.472   1.00 0.00 ? 12 LEU B CD2  2  
ATOM 3142  H H    . LEU B 1 12 ? -7.391  -1.445  1.500   1.00 0.00 ? 12 LEU B H    2  
ATOM 3143  H HA   . LEU B 1 12 ? -9.444  0.580   0.911   1.00 0.00 ? 12 LEU B HA   2  
ATOM 3144  H HB2  . LEU B 1 12 ? -7.889  2.260   1.227   1.00 0.00 ? 12 LEU B HB2  2  
ATOM 3145  H HB3  . LEU B 1 12 ? -7.407  1.091   2.439   1.00 0.00 ? 12 LEU B HB3  2  
ATOM 3146  H HG   . LEU B 1 12 ? -6.076  1.075   -0.247  1.00 0.00 ? 12 LEU B HG   2  
ATOM 3147  H HD11 . LEU B 1 12 ? -4.724  2.606   1.851   1.00 0.00 ? 12 LEU B HD11 2  
ATOM 3148  H HD12 . LEU B 1 12 ? -6.153  3.384   1.170   1.00 0.00 ? 12 LEU B HD12 2  
ATOM 3149  H HD13 . LEU B 1 12 ? -4.827  2.895   0.114   1.00 0.00 ? 12 LEU B HD13 2  
ATOM 3150  H HD21 . LEU B 1 12 ? -5.557  -0.775  1.145   1.00 0.00 ? 12 LEU B HD21 2  
ATOM 3151  H HD22 . LEU B 1 12 ? -5.302  0.265   2.545   1.00 0.00 ? 12 LEU B HD22 2  
ATOM 3152  H HD23 . LEU B 1 12 ? -4.171  0.312   1.192   1.00 0.00 ? 12 LEU B HD23 2  
ATOM 3153  N N    . MET B 1 13 ? -8.745  0.994   -1.531  1.00 0.00 ? 13 MET B N    2  
ATOM 3154  C CA   . MET B 1 13 ? -8.559  0.935   -2.973  1.00 0.00 ? 13 MET B CA   2  
ATOM 3155  C C    . MET B 1 13 ? -8.097  2.273   -3.523  1.00 0.00 ? 13 MET B C    2  
ATOM 3156  O O    . MET B 1 13 ? -8.894  3.187   -3.721  1.00 0.00 ? 13 MET B O    2  
ATOM 3157  C CB   . MET B 1 13 ? -9.854  0.502   -3.661  1.00 0.00 ? 13 MET B CB   2  
ATOM 3158  C CG   . MET B 1 13 ? -9.724  0.359   -5.168  1.00 0.00 ? 13 MET B CG   2  
ATOM 3159  S SD   . MET B 1 13 ? -11.315 0.425   -6.013  1.00 0.00 ? 13 MET B SD   2  
ATOM 3160  C CE   . MET B 1 13 ? -11.458 2.182   -6.330  1.00 0.00 ? 13 MET B CE   2  
ATOM 3161  H H    . MET B 1 13 ? -9.298  1.705   -1.146  1.00 0.00 ? 13 MET B H    2  
ATOM 3162  H HA   . MET B 1 13 ? -7.793  0.203   -3.174  1.00 0.00 ? 13 MET B HA   2  
ATOM 3163  H HB2  . MET B 1 13 ? -10.163 -0.450  -3.256  1.00 0.00 ? 13 MET B HB2  2  
ATOM 3164  H HB3  . MET B 1 13 ? -10.620 1.236   -3.455  1.00 0.00 ? 13 MET B HB3  2  
ATOM 3165  H HG2  . MET B 1 13 ? -9.102  1.161   -5.540  1.00 0.00 ? 13 MET B HG2  2  
ATOM 3166  H HG3  . MET B 1 13 ? -9.254  -0.589  -5.387  1.00 0.00 ? 13 MET B HG3  2  
ATOM 3167  H HE1  . MET B 1 13 ? -10.803 2.455   -7.144  1.00 0.00 ? 13 MET B HE1  2  
ATOM 3168  H HE2  . MET B 1 13 ? -11.179 2.731   -5.443  1.00 0.00 ? 13 MET B HE2  2  
ATOM 3169  H HE3  . MET B 1 13 ? -12.478 2.418   -6.593  1.00 0.00 ? 13 MET B HE3  2  
ATOM 3170  N N    . ILE B 1 14 ? -6.798  2.371   -3.773  1.00 0.00 ? 14 ILE B N    2  
ATOM 3171  C CA   . ILE B 1 14 ? -6.208  3.582   -4.308  1.00 0.00 ? 14 ILE B CA   2  
ATOM 3172  C C    . ILE B 1 14 ? -5.695  3.344   -5.728  1.00 0.00 ? 14 ILE B C    2  
ATOM 3173  O O    . ILE B 1 14 ? -4.876  2.455   -5.960  1.00 0.00 ? 14 ILE B O    2  
ATOM 3174  C CB   . ILE B 1 14 ? -5.057  4.075   -3.405  1.00 0.00 ? 14 ILE B CB   2  
ATOM 3175  C CG1  . ILE B 1 14 ? -4.291  5.228   -4.064  1.00 0.00 ? 14 ILE B CG1  2  
ATOM 3176  C CG2  . ILE B 1 14 ? -4.114  2.929   -3.071  1.00 0.00 ? 14 ILE B CG2  2  
ATOM 3177  C CD1  . ILE B 1 14 ? -5.181  6.349   -4.554  1.00 0.00 ? 14 ILE B CD1  2  
ATOM 3178  H H    . ILE B 1 14 ? -6.221  1.604   -3.594  1.00 0.00 ? 14 ILE B H    2  
ATOM 3179  H HA   . ILE B 1 14 ? -6.976  4.341   -4.329  1.00 0.00 ? 14 ILE B HA   2  
ATOM 3180  H HB   . ILE B 1 14 ? -5.491  4.423   -2.480  1.00 0.00 ? 14 ILE B HB   2  
ATOM 3181  H HG12 . ILE B 1 14 ? -3.598  5.646   -3.350  1.00 0.00 ? 14 ILE B HG12 2  
ATOM 3182  H HG13 . ILE B 1 14 ? -3.740  4.846   -4.912  1.00 0.00 ? 14 ILE B HG13 2  
ATOM 3183  H HG21 . ILE B 1 14 ? -4.363  2.532   -2.096  1.00 0.00 ? 14 ILE B HG21 2  
ATOM 3184  H HG22 . ILE B 1 14 ? -3.096  3.290   -3.064  1.00 0.00 ? 14 ILE B HG22 2  
ATOM 3185  H HG23 . ILE B 1 14 ? -4.216  2.151   -3.813  1.00 0.00 ? 14 ILE B HG23 2  
ATOM 3186  H HD11 . ILE B 1 14 ? -6.091  5.932   -4.959  1.00 0.00 ? 14 ILE B HD11 2  
ATOM 3187  H HD12 . ILE B 1 14 ? -4.667  6.907   -5.323  1.00 0.00 ? 14 ILE B HD12 2  
ATOM 3188  H HD13 . ILE B 1 14 ? -5.420  7.005   -3.731  1.00 0.00 ? 14 ILE B HD13 2  
ATOM 3189  N N    . GLY B 1 15 ? -6.187  4.139   -6.673  1.00 0.00 ? 15 GLY B N    2  
ATOM 3190  C CA   . GLY B 1 15 ? -5.774  3.994   -8.058  1.00 0.00 ? 15 GLY B CA   2  
ATOM 3191  C C    . GLY B 1 15 ? -6.956  4.019   -9.009  1.00 0.00 ? 15 GLY B C    2  
ATOM 3192  O O    . GLY B 1 15 ? -7.530  5.079   -9.268  1.00 0.00 ? 15 GLY B O    2  
ATOM 3193  H H    . GLY B 1 15 ? -6.836  4.832   -6.432  1.00 0.00 ? 15 GLY B H    2  
ATOM 3194  H HA2  . GLY B 1 15 ? -5.104  4.803   -8.310  1.00 0.00 ? 15 GLY B HA2  2  
ATOM 3195  H HA3  . GLY B 1 15 ? -5.250  3.055   -8.175  1.00 0.00 ? 15 GLY B HA3  2  
ATOM 3196  N N    . ASP B 1 16 ? -7.326  2.850   -9.526  1.00 0.00 ? 16 ASP B N    2  
ATOM 3197  C CA   . ASP B 1 16 ? -8.453  2.746   -10.450 1.00 0.00 ? 16 ASP B CA   2  
ATOM 3198  C C    . ASP B 1 16 ? -9.006  1.319   -10.517 1.00 0.00 ? 16 ASP B C    2  
ATOM 3199  O O    . ASP B 1 16 ? -9.812  1.006   -11.393 1.00 0.00 ? 16 ASP B O    2  
ATOM 3200  C CB   . ASP B 1 16 ? -8.031  3.202   -11.848 1.00 0.00 ? 16 ASP B CB   2  
ATOM 3201  C CG   . ASP B 1 16 ? -9.125  3.975   -12.559 1.00 0.00 ? 16 ASP B CG   2  
ATOM 3202  O OD1  . ASP B 1 16 ? -9.691  4.904   -11.945 1.00 0.00 ? 16 ASP B OD1  2  
ATOM 3203  O OD2  . ASP B 1 16 ? -9.414  3.653   -13.731 1.00 0.00 ? 16 ASP B OD2  2  
ATOM 3204  H H    . ASP B 1 16 ? -6.831  2.043   -9.280  1.00 0.00 ? 16 ASP B H    2  
ATOM 3205  H HA   . ASP B 1 16 ? -9.232  3.402   -10.092 1.00 0.00 ? 16 ASP B HA   2  
ATOM 3206  H HB2  . ASP B 1 16 ? -7.162  3.838   -11.766 1.00 0.00 ? 16 ASP B HB2  2  
ATOM 3207  H HB3  . ASP B 1 16 ? -7.783  2.336   -12.443 1.00 0.00 ? 16 ASP B HB3  2  
ATOM 3208  N N    . GLU B 1 17 ? -8.574  0.461   -9.586  1.00 0.00 ? 17 GLU B N    2  
ATOM 3209  C CA   . GLU B 1 17 ? -9.019  -0.936  -9.528  1.00 0.00 ? 17 GLU B CA   2  
ATOM 3210  C C    . GLU B 1 17 ? -7.992  -1.779  -8.775  1.00 0.00 ? 17 GLU B C    2  
ATOM 3211  O O    . GLU B 1 17 ? -7.394  -2.697  -9.336  1.00 0.00 ? 17 GLU B O    2  
ATOM 3212  C CB   . GLU B 1 17 ? -9.232  -1.512  -10.935 1.00 0.00 ? 17 GLU B CB   2  
ATOM 3213  C CG   . GLU B 1 17 ? -10.692 -1.576  -11.352 1.00 0.00 ? 17 GLU B CG   2  
ATOM 3214  C CD   . GLU B 1 17 ? -11.258 -2.981  -11.276 1.00 0.00 ? 17 GLU B CD   2  
ATOM 3215  O OE1  . GLU B 1 17 ? -11.774 -3.355  -10.202 1.00 0.00 ? 17 GLU B OE1  2  
ATOM 3216  O OE2  . GLU B 1 17 ? -11.185 -3.706  -12.290 1.00 0.00 ? 17 GLU B OE2  2  
ATOM 3217  H H    . GLU B 1 17 ? -7.938  0.775   -8.912  1.00 0.00 ? 17 GLU B H    2  
ATOM 3218  H HA   . GLU B 1 17 ? -9.955  -0.963  -8.988  1.00 0.00 ? 17 GLU B HA   2  
ATOM 3219  H HB2  . GLU B 1 17 ? -8.703  -0.896  -11.648 1.00 0.00 ? 17 GLU B HB2  2  
ATOM 3220  H HB3  . GLU B 1 17 ? -8.827  -2.512  -10.970 1.00 0.00 ? 17 GLU B HB3  2  
ATOM 3221  H HG2  . GLU B 1 17 ? -11.268 -0.937  -10.699 1.00 0.00 ? 17 GLU B HG2  2  
ATOM 3222  H HG3  . GLU B 1 17 ? -10.779 -1.223  -12.369 1.00 0.00 ? 17 GLU B HG3  2  
ATOM 3223  N N    . VAL B 1 18 ? -7.777  -1.448  -7.507  1.00 0.00 ? 18 VAL B N    2  
ATOM 3224  C CA   . VAL B 1 18 ? -6.812  -2.154  -6.689  1.00 0.00 ? 18 VAL B CA   2  
ATOM 3225  C C    . VAL B 1 18 ? -7.477  -2.829  -5.482  1.00 0.00 ? 18 VAL B C    2  
ATOM 3226  O O    . VAL B 1 18 ? -8.671  -3.126  -5.506  1.00 0.00 ? 18 VAL B O    2  
ATOM 3227  C CB   . VAL B 1 18 ? -5.723  -1.178  -6.212  1.00 0.00 ? 18 VAL B CB   2  
ATOM 3228  C CG1  . VAL B 1 18 ? -5.080  -0.473  -7.399  1.00 0.00 ? 18 VAL B CG1  2  
ATOM 3229  C CG2  . VAL B 1 18 ? -6.296  -0.168  -5.227  1.00 0.00 ? 18 VAL B CG2  2  
ATOM 3230  H H    . VAL B 1 18 ? -8.267  -0.703  -7.115  1.00 0.00 ? 18 VAL B H    2  
ATOM 3231  H HA   . VAL B 1 18 ? -6.343  -2.911  -7.301  1.00 0.00 ? 18 VAL B HA   2  
ATOM 3232  H HB   . VAL B 1 18 ? -4.965  -1.744  -5.711  1.00 0.00 ? 18 VAL B HB   2  
ATOM 3233  H HG11 . VAL B 1 18 ? -5.697  -0.607  -8.275  1.00 0.00 ? 18 VAL B HG11 2  
ATOM 3234  H HG12 . VAL B 1 18 ? -4.102  -0.893  -7.580  1.00 0.00 ? 18 VAL B HG12 2  
ATOM 3235  H HG13 . VAL B 1 18 ? -4.984  0.581   -7.184  1.00 0.00 ? 18 VAL B HG13 2  
ATOM 3236  H HG21 . VAL B 1 18 ? -7.302  -0.452  -4.961  1.00 0.00 ? 18 VAL B HG21 2  
ATOM 3237  H HG22 . VAL B 1 18 ? -6.309  0.812   -5.681  1.00 0.00 ? 18 VAL B HG22 2  
ATOM 3238  H HG23 . VAL B 1 18 ? -5.682  -0.145  -4.338  1.00 0.00 ? 18 VAL B HG23 2  
ATOM 3239  N N    . THR B 1 19 ? -6.690  -3.064  -4.429  1.00 0.00 ? 19 THR B N    2  
ATOM 3240  C CA   . THR B 1 19 ? -7.174  -3.697  -3.204  1.00 0.00 ? 19 THR B CA   2  
ATOM 3241  C C    . THR B 1 19 ? -5.988  -4.073  -2.322  1.00 0.00 ? 19 THR B C    2  
ATOM 3242  O O    . THR B 1 19 ? -5.295  -5.050  -2.591  1.00 0.00 ? 19 THR B O    2  
ATOM 3243  C CB   . THR B 1 19 ? -8.007  -4.944  -3.520  1.00 0.00 ? 19 THR B CB   2  
ATOM 3244  O OG1  . THR B 1 19 ? -7.713  -5.436  -4.816  1.00 0.00 ? 19 THR B OG1  2  
ATOM 3245  C CG2  . THR B 1 19 ? -9.499  -4.701  -3.449  1.00 0.00 ? 19 THR B CG2  2  
ATOM 3246  H H    . THR B 1 19 ? -5.750  -2.797  -4.473  1.00 0.00 ? 19 THR B H    2  
ATOM 3247  H HA   . THR B 1 19 ? -7.788  -2.980  -2.679  1.00 0.00 ? 19 THR B HA   2  
ATOM 3248  H HB   . THR B 1 19 ? -7.765  -5.717  -2.803  1.00 0.00 ? 19 THR B HB   2  
ATOM 3249  H HG1  . THR B 1 19 ? -6.763  -5.423  -4.956  1.00 0.00 ? 19 THR B HG1  2  
ATOM 3250  H HG21 . THR B 1 19 ? -9.961  -5.468  -2.844  1.00 0.00 ? 19 THR B HG21 2  
ATOM 3251  H HG22 . THR B 1 19 ? -9.916  -4.727  -4.445  1.00 0.00 ? 19 THR B HG22 2  
ATOM 3252  H HG23 . THR B 1 19 ? -9.686  -3.734  -3.006  1.00 0.00 ? 19 THR B HG23 2  
ATOM 3253  N N    . VAL B 1 20 ? -5.744  -3.289  -1.279  1.00 0.00 ? 20 VAL B N    2  
ATOM 3254  C CA   . VAL B 1 20 ? -4.622  -3.552  -0.384  1.00 0.00 ? 20 VAL B CA   2  
ATOM 3255  C C    . VAL B 1 20 ? -5.087  -3.800  1.051   1.00 0.00 ? 20 VAL B C    2  
ATOM 3256  O O    . VAL B 1 20 ? -5.558  -2.888  1.728   1.00 0.00 ? 20 VAL B O    2  
ATOM 3257  C CB   . VAL B 1 20 ? -3.622  -2.379  -0.387  1.00 0.00 ? 20 VAL B CB   2  
ATOM 3258  C CG1  . VAL B 1 20 ? -2.378  -2.728  0.416   1.00 0.00 ? 20 VAL B CG1  2  
ATOM 3259  C CG2  . VAL B 1 20 ? -3.254  -1.992  -1.811  1.00 0.00 ? 20 VAL B CG2  2  
ATOM 3260  H H    . VAL B 1 20 ? -6.322  -2.516  -1.111  1.00 0.00 ? 20 VAL B H    2  
ATOM 3261  H HA   . VAL B 1 20 ? -4.107  -4.433  -0.747  1.00 0.00 ? 20 VAL B HA   2  
ATOM 3262  H HB   . VAL B 1 20 ? -4.096  -1.529  0.081   1.00 0.00 ? 20 VAL B HB   2  
ATOM 3263  H HG11 . VAL B 1 20 ? -2.049  -1.859  0.967   1.00 0.00 ? 20 VAL B HG11 2  
ATOM 3264  H HG12 . VAL B 1 20 ? -1.595  -3.045  -0.256  1.00 0.00 ? 20 VAL B HG12 2  
ATOM 3265  H HG13 . VAL B 1 20 ? -2.606  -3.527  1.106   1.00 0.00 ? 20 VAL B HG13 2  
ATOM 3266  H HG21 . VAL B 1 20 ? -4.152  -1.778  -2.370  1.00 0.00 ? 20 VAL B HG21 2  
ATOM 3267  H HG22 . VAL B 1 20 ? -2.723  -2.807  -2.280  1.00 0.00 ? 20 VAL B HG22 2  
ATOM 3268  H HG23 . VAL B 1 20 ? -2.623  -1.115  -1.793  1.00 0.00 ? 20 VAL B HG23 2  
ATOM 3269  N N    . THR B 1 21 ? -4.939  -5.039  1.510   1.00 0.00 ? 21 THR B N    2  
ATOM 3270  C CA   . THR B 1 21 ? -5.331  -5.405  2.868   1.00 0.00 ? 21 THR B CA   2  
ATOM 3271  C C    . THR B 1 21 ? -4.141  -5.287  3.818   1.00 0.00 ? 21 THR B C    2  
ATOM 3272  O O    . THR B 1 21 ? -3.169  -6.035  3.706   1.00 0.00 ? 21 THR B O    2  
ATOM 3273  C CB   . THR B 1 21 ? -5.883  -6.832  2.896   1.00 0.00 ? 21 THR B CB   2  
ATOM 3274  O OG1  . THR B 1 21 ? -6.515  -7.149  1.668   1.00 0.00 ? 21 THR B OG1  2  
ATOM 3275  C CG2  . THR B 1 21 ? -6.889  -7.063  4.003   1.00 0.00 ? 21 THR B CG2  2  
ATOM 3276  H H    . THR B 1 21 ? -4.552  -5.722  0.924   1.00 0.00 ? 21 THR B H    2  
ATOM 3277  H HA   . THR B 1 21 ? -6.103  -4.721  3.188   1.00 0.00 ? 21 THR B HA   2  
ATOM 3278  H HB   . THR B 1 21 ? -5.064  -7.521  3.044   1.00 0.00 ? 21 THR B HB   2  
ATOM 3279  H HG1  . THR B 1 21 ? -6.854  -8.046  1.705   1.00 0.00 ? 21 THR B HG1  2  
ATOM 3280  H HG21 . THR B 1 21 ? -7.444  -6.154  4.180   1.00 0.00 ? 21 THR B HG21 2  
ATOM 3281  H HG22 . THR B 1 21 ? -6.371  -7.351  4.906   1.00 0.00 ? 21 THR B HG22 2  
ATOM 3282  H HG23 . THR B 1 21 ? -7.569  -7.849  3.712   1.00 0.00 ? 21 THR B HG23 2  
ATOM 3283  N N    . VAL B 1 22 ? -4.217  -4.336  4.744   1.00 0.00 ? 22 VAL B N    2  
ATOM 3284  C CA   . VAL B 1 22 ? -3.140  -4.113  5.703   1.00 0.00 ? 22 VAL B CA   2  
ATOM 3285  C C    . VAL B 1 22 ? -3.255  -5.039  6.912   1.00 0.00 ? 22 VAL B C    2  
ATOM 3286  O O    . VAL B 1 22 ? -3.429  -4.583  8.043   1.00 0.00 ? 22 VAL B O    2  
ATOM 3287  C CB   . VAL B 1 22 ? -3.118  -2.651  6.189   1.00 0.00 ? 22 VAL B CB   2  
ATOM 3288  C CG1  . VAL B 1 22 ? -2.790  -1.710  5.041   1.00 0.00 ? 22 VAL B CG1  2  
ATOM 3289  C CG2  . VAL B 1 22 ? -4.449  -2.282  6.827   1.00 0.00 ? 22 VAL B CG2  2  
ATOM 3290  H H    . VAL B 1 22 ? -5.013  -3.765  4.777   1.00 0.00 ? 22 VAL B H    2  
ATOM 3291  H HA   . VAL B 1 22 ? -2.204  -4.314  5.202   1.00 0.00 ? 22 VAL B HA   2  
ATOM 3292  H HB   . VAL B 1 22 ? -2.345  -2.553  6.938   1.00 0.00 ? 22 VAL B HB   2  
ATOM 3293  H HG11 . VAL B 1 22 ? -1.740  -1.788  4.800   1.00 0.00 ? 22 VAL B HG11 2  
ATOM 3294  H HG12 . VAL B 1 22 ? -3.018  -0.695  5.330   1.00 0.00 ? 22 VAL B HG12 2  
ATOM 3295  H HG13 . VAL B 1 22 ? -3.378  -1.979  4.176   1.00 0.00 ? 22 VAL B HG13 2  
ATOM 3296  H HG21 . VAL B 1 22 ? -4.940  -3.177  7.179   1.00 0.00 ? 22 VAL B HG21 2  
ATOM 3297  H HG22 . VAL B 1 22 ? -5.075  -1.791  6.096   1.00 0.00 ? 22 VAL B HG22 2  
ATOM 3298  H HG23 . VAL B 1 22 ? -4.277  -1.615  7.659   1.00 0.00 ? 22 VAL B HG23 2  
ATOM 3299  N N    . LEU B 1 23 ? -3.153  -6.342  6.665   1.00 0.00 ? 23 LEU B N    2  
ATOM 3300  C CA   . LEU B 1 23 ? -3.239  -7.341  7.730   1.00 0.00 ? 23 LEU B CA   2  
ATOM 3301  C C    . LEU B 1 23 ? -2.394  -6.932  8.937   1.00 0.00 ? 23 LEU B C    2  
ATOM 3302  O O    . LEU B 1 23 ? -1.187  -6.725  8.819   1.00 0.00 ? 23 LEU B O    2  
ATOM 3303  C CB   . LEU B 1 23 ? -2.778  -8.704  7.209   1.00 0.00 ? 23 LEU B CB   2  
ATOM 3304  C CG   . LEU B 1 23 ? -3.677  -9.883  7.583   1.00 0.00 ? 23 LEU B CG   2  
ATOM 3305  C CD1  . LEU B 1 23 ? -3.723  -10.059 9.094   1.00 0.00 ? 23 LEU B CD1  2  
ATOM 3306  C CD2  . LEU B 1 23 ? -5.078  -9.684  7.023   1.00 0.00 ? 23 LEU B CD2  2  
ATOM 3307  H H    . LEU B 1 23 ? -3.017  -6.638  5.740   1.00 0.00 ? 23 LEU B H    2  
ATOM 3308  H HA   . LEU B 1 23 ? -4.272  -7.412  8.035   1.00 0.00 ? 23 LEU B HA   2  
ATOM 3309  H HB2  . LEU B 1 23 ? -2.719  -8.652  6.131   1.00 0.00 ? 23 LEU B HB2  2  
ATOM 3310  H HB3  . LEU B 1 23 ? -1.790  -8.899  7.596   1.00 0.00 ? 23 LEU B HB3  2  
ATOM 3311  H HG   . LEU B 1 23 ? -3.269  -10.787 7.151   1.00 0.00 ? 23 LEU B HG   2  
ATOM 3312  H HD11 . LEU B 1 23 ? -4.239  -10.977 9.334   1.00 0.00 ? 23 LEU B HD11 2  
ATOM 3313  H HD12 . LEU B 1 23 ? -4.246  -9.225  9.539   1.00 0.00 ? 23 LEU B HD12 2  
ATOM 3314  H HD13 . LEU B 1 23 ? -2.716  -10.100 9.482   1.00 0.00 ? 23 LEU B HD13 2  
ATOM 3315  H HD21 . LEU B 1 23 ? -5.235  -8.637  6.806   1.00 0.00 ? 23 LEU B HD21 2  
ATOM 3316  H HD22 . LEU B 1 23 ? -5.807  -10.013 7.749   1.00 0.00 ? 23 LEU B HD22 2  
ATOM 3317  H HD23 . LEU B 1 23 ? -5.188  -10.260 6.116   1.00 0.00 ? 23 LEU B HD23 2  
ATOM 3318  N N    . GLY B 1 24 ? -3.038  -6.812  10.096  1.00 0.00 ? 24 GLY B N    2  
ATOM 3319  C CA   . GLY B 1 24 ? -2.328  -6.423  11.302  1.00 0.00 ? 24 GLY B CA   2  
ATOM 3320  C C    . GLY B 1 24 ? -1.982  -7.601  12.194  1.00 0.00 ? 24 GLY B C    2  
ATOM 3321  O O    . GLY B 1 24 ? -1.147  -7.482  13.090  1.00 0.00 ? 24 GLY B O    2  
ATOM 3322  H H    . GLY B 1 24 ? -4.002  -6.985  10.131  1.00 0.00 ? 24 GLY B H    2  
ATOM 3323  H HA2  . GLY B 1 24 ? -1.414  -5.922  11.021  1.00 0.00 ? 24 GLY B HA2  2  
ATOM 3324  H HA3  . GLY B 1 24 ? -2.943  -5.734  11.861  1.00 0.00 ? 24 GLY B HA3  2  
ATOM 3325  N N    . VAL B 1 25 ? -2.621  -8.741  11.952  1.00 0.00 ? 25 VAL B N    2  
ATOM 3326  C CA   . VAL B 1 25 ? -2.370  -9.936  12.741  1.00 0.00 ? 25 VAL B CA   2  
ATOM 3327  C C    . VAL B 1 25 ? -1.176  -10.701 12.184  1.00 0.00 ? 25 VAL B C    2  
ATOM 3328  O O    . VAL B 1 25 ? -1.144  -11.034 11.000  1.00 0.00 ? 25 VAL B O    2  
ATOM 3329  C CB   . VAL B 1 25 ? -3.597  -10.870 12.770  1.00 0.00 ? 25 VAL B CB   2  
ATOM 3330  C CG1  . VAL B 1 25 ? -3.541  -11.788 13.982  1.00 0.00 ? 25 VAL B CG1  2  
ATOM 3331  C CG2  . VAL B 1 25 ? -4.892  -10.067 12.762  1.00 0.00 ? 25 VAL B CG2  2  
ATOM 3332  H H    . VAL B 1 25 ? -3.275  -8.780  11.230  1.00 0.00 ? 25 VAL B H    2  
ATOM 3333  H HA   . VAL B 1 25 ? -2.153  -9.624  13.748  1.00 0.00 ? 25 VAL B HA   2  
ATOM 3334  H HB   . VAL B 1 25 ? -3.575  -11.486 11.883  1.00 0.00 ? 25 VAL B HB   2  
ATOM 3335  H HG11 . VAL B 1 25 ? -4.542  -11.971 14.342  1.00 0.00 ? 25 VAL B HG11 2  
ATOM 3336  H HG12 . VAL B 1 25 ? -2.958  -11.320 14.762  1.00 0.00 ? 25 VAL B HG12 2  
ATOM 3337  H HG13 . VAL B 1 25 ? -3.082  -12.725 13.703  1.00 0.00 ? 25 VAL B HG13 2  
ATOM 3338  H HG21 . VAL B 1 25 ? -5.063  -9.671  11.771  1.00 0.00 ? 25 VAL B HG21 2  
ATOM 3339  H HG22 . VAL B 1 25 ? -4.815  -9.253  13.467  1.00 0.00 ? 25 VAL B HG22 2  
ATOM 3340  H HG23 . VAL B 1 25 ? -5.715  -10.708 13.040  1.00 0.00 ? 25 VAL B HG23 2  
ATOM 3341  N N    . LYS B 1 26 ? -0.193  -10.977 13.040  1.00 0.00 ? 26 LYS B N    2  
ATOM 3342  C CA   . LYS B 1 26 ? 1.006   -11.699 12.626  1.00 0.00 ? 26 LYS B CA   2  
ATOM 3343  C C    . LYS B 1 26 ? 1.995   -11.809 13.785  1.00 0.00 ? 26 LYS B C    2  
ATOM 3344  O O    . LYS B 1 26 ? 1.870   -11.109 14.789  1.00 0.00 ? 26 LYS B O    2  
ATOM 3345  C CB   . LYS B 1 26 ? 1.674   -10.996 11.441  1.00 0.00 ? 26 LYS B CB   2  
ATOM 3346  C CG   . LYS B 1 26 ? 2.430   -11.939 10.517  1.00 0.00 ? 26 LYS B CG   2  
ATOM 3347  C CD   . LYS B 1 26 ? 1.535   -13.058 10.005  1.00 0.00 ? 26 LYS B CD   2  
ATOM 3348  C CE   . LYS B 1 26 ? 1.979   -14.415 10.529  1.00 0.00 ? 26 LYS B CE   2  
ATOM 3349  N NZ   . LYS B 1 26 ? 1.101   -14.901 11.629  1.00 0.00 ? 26 LYS B NZ   2  
ATOM 3350  H H    . LYS B 1 26 ? -0.269  -10.695 13.975  1.00 0.00 ? 26 LYS B H    2  
ATOM 3351  H HA   . LYS B 1 26 ? 0.708   -12.693 12.325  1.00 0.00 ? 26 LYS B HA   2  
ATOM 3352  H HB2  . LYS B 1 26 ? 0.918   -10.489 10.862  1.00 0.00 ? 26 LYS B HB2  2  
ATOM 3353  H HB3  . LYS B 1 26 ? 2.370   -10.265 11.822  1.00 0.00 ? 26 LYS B HB3  2  
ATOM 3354  H HG2  . LYS B 1 26 ? 2.803   -11.377 9.674   1.00 0.00 ? 26 LYS B HG2  2  
ATOM 3355  H HG3  . LYS B 1 26 ? 3.259   -12.370 11.059  1.00 0.00 ? 26 LYS B HG3  2  
ATOM 3356  H HD2  . LYS B 1 26 ? 0.522   -12.874 10.329  1.00 0.00 ? 26 LYS B HD2  2  
ATOM 3357  H HD3  . LYS B 1 26 ? 1.573   -13.069 8.925   1.00 0.00 ? 26 LYS B HD3  2  
ATOM 3358  H HE2  . LYS B 1 26 ? 1.951   -15.126 9.717   1.00 0.00 ? 26 LYS B HE2  2  
ATOM 3359  H HE3  . LYS B 1 26 ? 2.991   -14.331 10.898  1.00 0.00 ? 26 LYS B HE3  2  
ATOM 3360  H HZ1  . LYS B 1 26 ? 0.986   -15.933 11.565  1.00 0.00 ? 26 LYS B HZ1  2  
ATOM 3361  H HZ2  . LYS B 1 26 ? 0.164   -14.455 11.563  1.00 0.00 ? 26 LYS B HZ2  2  
ATOM 3362  H HZ3  . LYS B 1 26 ? 1.520   -14.666 12.552  1.00 0.00 ? 26 LYS B HZ3  2  
ATOM 3363  N N    . GLY B 1 27 ? 2.979   -12.691 13.636  1.00 0.00 ? 27 GLY B N    2  
ATOM 3364  C CA   . GLY B 1 27 ? 3.977   -12.874 14.676  1.00 0.00 ? 27 GLY B CA   2  
ATOM 3365  C C    . GLY B 1 27 ? 5.185   -11.975 14.488  1.00 0.00 ? 27 GLY B C    2  
ATOM 3366  O O    . GLY B 1 27 ? 5.986   -12.190 13.579  1.00 0.00 ? 27 GLY B O    2  
ATOM 3367  H H    . GLY B 1 27 ? 3.026   -13.217 12.811  1.00 0.00 ? 27 GLY B H    2  
ATOM 3368  H HA2  . GLY B 1 27 ? 3.527   -12.659 15.634  1.00 0.00 ? 27 GLY B HA2  2  
ATOM 3369  H HA3  . GLY B 1 27 ? 4.304   -13.904 14.668  1.00 0.00 ? 27 GLY B HA3  2  
ATOM 3370  N N    . ASN B 1 28 ? 5.311   -10.963 15.348  1.00 0.00 ? 28 ASN B N    2  
ATOM 3371  C CA   . ASN B 1 28 ? 6.426   -10.018 15.278  1.00 0.00 ? 28 ASN B CA   2  
ATOM 3372  C C    . ASN B 1 28 ? 6.357   -9.195  13.995  1.00 0.00 ? 28 ASN B C    2  
ATOM 3373  O O    . ASN B 1 28 ? 6.073   -7.997  14.027  1.00 0.00 ? 28 ASN B O    2  
ATOM 3374  C CB   . ASN B 1 28 ? 7.765   -10.756 15.358  1.00 0.00 ? 28 ASN B CB   2  
ATOM 3375  C CG   . ASN B 1 28 ? 8.027   -11.329 16.738  1.00 0.00 ? 28 ASN B CG   2  
ATOM 3376  O OD1  . ASN B 1 28 ? 7.193   -12.045 17.294  1.00 0.00 ? 28 ASN B OD1  2  
ATOM 3377  N ND2  . ASN B 1 28 ? 9.190   -11.017 17.298  1.00 0.00 ? 28 ASN B ND2  2  
ATOM 3378  H H    . ASN B 1 28 ? 4.633   -10.847 16.047  1.00 0.00 ? 28 ASN B H    2  
ATOM 3379  H HA   . ASN B 1 28 ? 6.343   -9.349  16.122  1.00 0.00 ? 28 ASN B HA   2  
ATOM 3380  H HB2  . ASN B 1 28 ? 7.768   -11.567 14.646  1.00 0.00 ? 28 ASN B HB2  2  
ATOM 3381  H HB3  . ASN B 1 28 ? 8.562   -10.068 15.118  1.00 0.00 ? 28 ASN B HB3  2  
ATOM 3382  H HD21 . ASN B 1 28 ? 9.805   -10.442 16.796  1.00 0.00 ? 28 ASN B HD21 2  
ATOM 3383  H HD22 . ASN B 1 28 ? 9.385   -11.374 18.189  1.00 0.00 ? 28 ASN B HD22 2  
ATOM 3384  N N    . GLN B 1 29 ? 6.601   -9.851  12.867  1.00 0.00 ? 29 GLN B N    2  
ATOM 3385  C CA   . GLN B 1 29 ? 6.552   -9.192  11.568  1.00 0.00 ? 29 GLN B CA   2  
ATOM 3386  C C    . GLN B 1 29 ? 5.116   -9.172  11.058  1.00 0.00 ? 29 GLN B C    2  
ATOM 3387  O O    . GLN B 1 29 ? 4.404   -10.168 11.174  1.00 0.00 ? 29 GLN B O    2  
ATOM 3388  C CB   . GLN B 1 29 ? 7.458   -9.917  10.570  1.00 0.00 ? 29 GLN B CB   2  
ATOM 3389  C CG   . GLN B 1 29 ? 8.776   -9.204  10.318  1.00 0.00 ? 29 GLN B CG   2  
ATOM 3390  C CD   . GLN B 1 29 ? 9.741   -10.037 9.496   1.00 0.00 ? 29 GLN B CD   2  
ATOM 3391  O OE1  . GLN B 1 29 ? 10.240  -9.591  8.463   1.00 0.00 ? 29 GLN B OE1  2  
ATOM 3392  N NE2  . GLN B 1 29 ? 10.007  -11.256 9.951   1.00 0.00 ? 29 GLN B NE2  2  
ATOM 3393  H H    . GLN B 1 29 ? 6.808   -10.808 12.911  1.00 0.00 ? 29 GLN B H    2  
ATOM 3394  H HA   . GLN B 1 29 ? 6.897   -8.177  11.692  1.00 0.00 ? 29 GLN B HA   2  
ATOM 3395  H HB2  . GLN B 1 29 ? 7.674   -10.904 10.950  1.00 0.00 ? 29 GLN B HB2  2  
ATOM 3396  H HB3  . GLN B 1 29 ? 6.937   -10.010 9.629   1.00 0.00 ? 29 GLN B HB3  2  
ATOM 3397  H HG2  . GLN B 1 29 ? 8.578   -8.284  9.788   1.00 0.00 ? 29 GLN B HG2  2  
ATOM 3398  H HG3  . GLN B 1 29 ? 9.237   -8.980  11.269  1.00 0.00 ? 29 GLN B HG3  2  
ATOM 3399  H HE21 . GLN B 1 29 ? 9.573   -11.545 10.781  1.00 0.00 ? 29 GLN B HE21 2  
ATOM 3400  H HE22 . GLN B 1 29 ? 10.628  -11.816 9.439   1.00 0.00 ? 29 GLN B HE22 2  
ATOM 3401  N N    . VAL B 1 30 ? 4.682   -8.040  10.512  1.00 0.00 ? 30 VAL B N    2  
ATOM 3402  C CA   . VAL B 1 30 ? 3.316   -7.927  10.019  1.00 0.00 ? 30 VAL B CA   2  
ATOM 3403  C C    . VAL B 1 30 ? 3.228   -8.265  8.541   1.00 0.00 ? 30 VAL B C    2  
ATOM 3404  O O    . VAL B 1 30 ? 3.851   -7.612  7.703   1.00 0.00 ? 30 VAL B O    2  
ATOM 3405  C CB   . VAL B 1 30 ? 2.743   -6.515  10.248  1.00 0.00 ? 30 VAL B CB   2  
ATOM 3406  C CG1  . VAL B 1 30 ? 1.234   -6.516  10.061  1.00 0.00 ? 30 VAL B CG1  2  
ATOM 3407  C CG2  . VAL B 1 30 ? 3.114   -6.002  11.632  1.00 0.00 ? 30 VAL B CG2  2  
ATOM 3408  H H    . VAL B 1 30 ? 5.286   -7.265  10.452  1.00 0.00 ? 30 VAL B H    2  
ATOM 3409  H HA   . VAL B 1 30 ? 2.711   -8.629  10.566  1.00 0.00 ? 30 VAL B HA   2  
ATOM 3410  H HB   . VAL B 1 30 ? 3.173   -5.850  9.514   1.00 0.00 ? 30 VAL B HB   2  
ATOM 3411  H HG11 . VAL B 1 30 ? 0.898   -5.514  9.838   1.00 0.00 ? 30 VAL B HG11 2  
ATOM 3412  H HG12 . VAL B 1 30 ? 0.759   -6.862  10.967  1.00 0.00 ? 30 VAL B HG12 2  
ATOM 3413  H HG13 . VAL B 1 30 ? 0.973   -7.173  9.244   1.00 0.00 ? 30 VAL B HG13 2  
ATOM 3414  H HG21 . VAL B 1 30 ? 2.656   -5.037  11.793  1.00 0.00 ? 30 VAL B HG21 2  
ATOM 3415  H HG22 . VAL B 1 30 ? 4.187   -5.908  11.706  1.00 0.00 ? 30 VAL B HG22 2  
ATOM 3416  H HG23 . VAL B 1 30 ? 2.761   -6.697  12.380  1.00 0.00 ? 30 VAL B HG23 2  
ATOM 3417  N N    . ARG B 1 31 ? 2.440   -9.290  8.227   1.00 0.00 ? 31 ARG B N    2  
ATOM 3418  C CA   . ARG B 1 31 ? 2.262   -9.712  6.858   1.00 0.00 ? 31 ARG B CA   2  
ATOM 3419  C C    . ARG B 1 31 ? 1.207   -8.855  6.175   1.00 0.00 ? 31 ARG B C    2  
ATOM 3420  O O    . ARG B 1 31 ? 0.008   -9.084  6.326   1.00 0.00 ? 31 ARG B O    2  
ATOM 3421  C CB   . ARG B 1 31 ? 1.856   -11.187 6.803   1.00 0.00 ? 31 ARG B CB   2  
ATOM 3422  C CG   . ARG B 1 31 ? 3.017   -12.131 6.536   1.00 0.00 ? 31 ARG B CG   2  
ATOM 3423  C CD   . ARG B 1 31 ? 2.527   -13.511 6.128   1.00 0.00 ? 31 ARG B CD   2  
ATOM 3424  N NE   . ARG B 1 31 ? 3.542   -14.540 6.344   1.00 0.00 ? 31 ARG B NE   2  
ATOM 3425  C CZ   . ARG B 1 31 ? 3.336   -15.839 6.137   1.00 0.00 ? 31 ARG B CZ   2  
ATOM 3426  N NH1  . ARG B 1 31 ? 2.155   -16.271 5.710   1.00 0.00 ? 31 ARG B NH1  2  
ATOM 3427  N NH2  . ARG B 1 31 ? 4.312   -16.708 6.358   1.00 0.00 ? 31 ARG B NH2  2  
ATOM 3428  H H    . ARG B 1 31 ? 1.967   -9.764  8.928   1.00 0.00 ? 31 ARG B H    2  
ATOM 3429  H HA   . ARG B 1 31 ? 3.200   -9.586  6.358   1.00 0.00 ? 31 ARG B HA   2  
ATOM 3430  H HB2  . ARG B 1 31 ? 1.409   -11.461 7.747   1.00 0.00 ? 31 ARG B HB2  2  
ATOM 3431  H HB3  . ARG B 1 31 ? 1.126   -11.319 6.017   1.00 0.00 ? 31 ARG B HB3  2  
ATOM 3432  H HG2  . ARG B 1 31 ? 3.623   -11.725 5.740   1.00 0.00 ? 31 ARG B HG2  2  
ATOM 3433  H HG3  . ARG B 1 31 ? 3.610   -12.220 7.434   1.00 0.00 ? 31 ARG B HG3  2  
ATOM 3434  H HD2  . ARG B 1 31 ? 1.652   -13.755 6.712   1.00 0.00 ? 31 ARG B HD2  2  
ATOM 3435  H HD3  . ARG B 1 31 ? 2.265   -13.491 5.080   1.00 0.00 ? 31 ARG B HD3  2  
ATOM 3436  H HE   . ARG B 1 31 ? 4.423   -14.248 6.659   1.00 0.00 ? 31 ARG B HE   2  
ATOM 3437  H HH11 . ARG B 1 31 ? 1.415   -15.620 5.540   1.00 0.00 ? 31 ARG B HH11 2  
ATOM 3438  H HH12 . ARG B 1 31 ? 2.007   -17.247 5.556   1.00 0.00 ? 31 ARG B HH12 2  
ATOM 3439  H HH21 . ARG B 1 31 ? 5.203   -16.388 6.679   1.00 0.00 ? 31 ARG B HH21 2  
ATOM 3440  H HH22 . ARG B 1 31 ? 4.157   -17.684 6.203   1.00 0.00 ? 31 ARG B HH22 2  
ATOM 3441  N N    . ILE B 1 32 ? 1.668   -7.864  5.431   1.00 0.00 ? 32 ILE B N    2  
ATOM 3442  C CA   . ILE B 1 32 ? 0.783   -6.955  4.724   1.00 0.00 ? 32 ILE B CA   2  
ATOM 3443  C C    . ILE B 1 32 ? 0.538   -7.442  3.302   1.00 0.00 ? 32 ILE B C    2  
ATOM 3444  O O    . ILE B 1 32 ? 1.481   -7.720  2.561   1.00 0.00 ? 32 ILE B O    2  
ATOM 3445  C CB   . ILE B 1 32 ? 1.374   -5.530  4.691   1.00 0.00 ? 32 ILE B CB   2  
ATOM 3446  C CG1  . ILE B 1 32 ? 2.118   -5.235  6.001   1.00 0.00 ? 32 ILE B CG1  2  
ATOM 3447  C CG2  . ILE B 1 32 ? 0.276   -4.503  4.451   1.00 0.00 ? 32 ILE B CG2  2  
ATOM 3448  C CD1  . ILE B 1 32 ? 1.256   -5.399  7.234   1.00 0.00 ? 32 ILE B CD1  2  
ATOM 3449  H H    . ILE B 1 32 ? 2.637   -7.728  5.368   1.00 0.00 ? 32 ILE B H    2  
ATOM 3450  H HA   . ILE B 1 32 ? -0.159  -6.921  5.253   1.00 0.00 ? 32 ILE B HA   2  
ATOM 3451  H HB   . ILE B 1 32 ? 2.071   -5.472  3.868   1.00 0.00 ? 32 ILE B HB   2  
ATOM 3452  H HG12 . ILE B 1 32 ? 2.957   -5.912  6.093   1.00 0.00 ? 32 ILE B HG12 2  
ATOM 3453  H HG13 . ILE B 1 32 ? 2.483   -4.219  5.984   1.00 0.00 ? 32 ILE B HG13 2  
ATOM 3454  H HG21 . ILE B 1 32 ? 0.063   -3.981  5.373   1.00 0.00 ? 32 ILE B HG21 2  
ATOM 3455  H HG22 . ILE B 1 32 ? -0.617  -5.003  4.106   1.00 0.00 ? 32 ILE B HG22 2  
ATOM 3456  H HG23 . ILE B 1 32 ? 0.603   -3.794  3.704   1.00 0.00 ? 32 ILE B HG23 2  
ATOM 3457  H HD11 . ILE B 1 32 ? 0.361   -4.803  7.129   1.00 0.00 ? 32 ILE B HD11 2  
ATOM 3458  H HD12 . ILE B 1 32 ? 1.806   -5.072  8.104   1.00 0.00 ? 32 ILE B HD12 2  
ATOM 3459  H HD13 . ILE B 1 32 ? 0.985   -6.438  7.348   1.00 0.00 ? 32 ILE B HD13 2  
ATOM 3460  N N    . GLY B 1 33 ? -0.731  -7.550  2.926   1.00 0.00 ? 33 GLY B N    2  
ATOM 3461  C CA   . GLY B 1 33 ? -1.069  -8.010  1.593   1.00 0.00 ? 33 GLY B CA   2  
ATOM 3462  C C    . GLY B 1 33 ? -1.487  -6.878  0.682   1.00 0.00 ? 33 GLY B C    2  
ATOM 3463  O O    . GLY B 1 33 ? -2.533  -6.266  0.883   1.00 0.00 ? 33 GLY B O    2  
ATOM 3464  H H    . GLY B 1 33 ? -1.446  -7.314  3.553   1.00 0.00 ? 33 GLY B H    2  
ATOM 3465  H HA2  . GLY B 1 33 ? -0.209  -8.502  1.166   1.00 0.00 ? 33 GLY B HA2  2  
ATOM 3466  H HA3  . GLY B 1 33 ? -1.880  -8.720  1.663   1.00 0.00 ? 33 GLY B HA3  2  
ATOM 3467  N N    . VAL B 1 34 ? -0.666  -6.596  -0.322  1.00 0.00 ? 34 VAL B N    2  
ATOM 3468  C CA   . VAL B 1 34 ? -0.960  -5.527  -1.263  1.00 0.00 ? 34 VAL B CA   2  
ATOM 3469  C C    . VAL B 1 34 ? -1.402  -6.084  -2.611  1.00 0.00 ? 34 VAL B C    2  
ATOM 3470  O O    . VAL B 1 34 ? -0.582  -6.554  -3.399  1.00 0.00 ? 34 VAL B O    2  
ATOM 3471  C CB   . VAL B 1 34 ? 0.263   -4.613  -1.473  1.00 0.00 ? 34 VAL B CB   2  
ATOM 3472  C CG1  . VAL B 1 34 ? -0.105  -3.413  -2.333  1.00 0.00 ? 34 VAL B CG1  2  
ATOM 3473  C CG2  . VAL B 1 34 ? 0.832   -4.164  -0.135  1.00 0.00 ? 34 VAL B CG2  2  
ATOM 3474  H H    . VAL B 1 34 ? 0.156   -7.118  -0.431  1.00 0.00 ? 34 VAL B H    2  
ATOM 3475  H HA   . VAL B 1 34 ? -1.761  -4.931  -0.851  1.00 0.00 ? 34 VAL B HA   2  
ATOM 3476  H HB   . VAL B 1 34 ? 1.024   -5.179  -1.991  1.00 0.00 ? 34 VAL B HB   2  
ATOM 3477  H HG11 . VAL B 1 34 ? -0.982  -3.645  -2.919  1.00 0.00 ? 34 VAL B HG11 2  
ATOM 3478  H HG12 . VAL B 1 34 ? 0.717   -3.179  -2.994  1.00 0.00 ? 34 VAL B HG12 2  
ATOM 3479  H HG13 . VAL B 1 34 ? -0.310  -2.564  -1.698  1.00 0.00 ? 34 VAL B HG13 2  
ATOM 3480  H HG21 . VAL B 1 34 ? 0.683   -4.941  0.600   1.00 0.00 ? 34 VAL B HG21 2  
ATOM 3481  H HG22 . VAL B 1 34 ? 0.330   -3.264  0.186   1.00 0.00 ? 34 VAL B HG22 2  
ATOM 3482  H HG23 . VAL B 1 34 ? 1.889   -3.968  -0.241  1.00 0.00 ? 34 VAL B HG23 2  
ATOM 3483  N N    . ASN B 1 35 ? -2.703  -6.024  -2.869  1.00 0.00 ? 35 ASN B N    2  
ATOM 3484  C CA   . ASN B 1 35 ? -3.251  -6.516  -4.126  1.00 0.00 ? 35 ASN B CA   2  
ATOM 3485  C C    . ASN B 1 35 ? -3.468  -5.362  -5.098  1.00 0.00 ? 35 ASN B C    2  
ATOM 3486  O O    . ASN B 1 35 ? -4.376  -4.549  -4.927  1.00 0.00 ? 35 ASN B O    2  
ATOM 3487  C CB   . ASN B 1 35 ? -4.565  -7.264  -3.890  1.00 0.00 ? 35 ASN B CB   2  
ATOM 3488  C CG   . ASN B 1 35 ? -4.675  -8.520  -4.732  1.00 0.00 ? 35 ASN B CG   2  
ATOM 3489  O OD1  . ASN B 1 35 ? -4.865  -9.617  -4.209  1.00 0.00 ? 35 ASN B OD1  2  
ATOM 3490  N ND2  . ASN B 1 35 ? -4.556  -8.363  -6.046  1.00 0.00 ? 35 ASN B ND2  2  
ATOM 3491  H H    . ASN B 1 35 ? -3.303  -5.640  -2.196  1.00 0.00 ? 35 ASN B H    2  
ATOM 3492  H HA   . ASN B 1 35 ? -2.531  -7.198  -4.555  1.00 0.00 ? 35 ASN B HA   2  
ATOM 3493  H HB2  . ASN B 1 35 ? -4.632  -7.544  -2.850  1.00 0.00 ? 35 ASN B HB2  2  
ATOM 3494  H HB3  . ASN B 1 35 ? -5.392  -6.614  -4.138  1.00 0.00 ? 35 ASN B HB3  2  
ATOM 3495  H HD21 . ASN B 1 35 ? -4.406  -7.459  -6.393  1.00 0.00 ? 35 ASN B HD21 2  
ATOM 3496  H HD22 . ASN B 1 35 ? -4.623  -9.159  -6.615  1.00 0.00 ? 35 ASN B HD22 2  
ATOM 3497  N N    . ALA B 1 36 ? -2.617  -5.299  -6.112  1.00 0.00 ? 36 ALA B N    2  
ATOM 3498  C CA   . ALA B 1 36 ? -2.698  -4.244  -7.116  1.00 0.00 ? 36 ALA B CA   2  
ATOM 3499  C C    . ALA B 1 36 ? -2.498  -4.793  -8.527  1.00 0.00 ? 36 ALA B C    2  
ATOM 3500  O O    . ALA B 1 36 ? -1.735  -5.737  -8.734  1.00 0.00 ? 36 ALA B O    2  
ATOM 3501  C CB   . ALA B 1 36 ? -1.672  -3.160  -6.822  1.00 0.00 ? 36 ALA B CB   2  
ATOM 3502  H H    . ALA B 1 36 ? -1.916  -5.978  -6.174  1.00 0.00 ? 36 ALA B H    2  
ATOM 3503  H HA   . ALA B 1 36 ? -3.680  -3.801  -7.050  1.00 0.00 ? 36 ALA B HA   2  
ATOM 3504  H HB1  . ALA B 1 36 ? -0.681  -3.536  -7.031  1.00 0.00 ? 36 ALA B HB1  2  
ATOM 3505  H HB2  . ALA B 1 36 ? -1.737  -2.876  -5.782  1.00 0.00 ? 36 ALA B HB2  2  
ATOM 3506  H HB3  . ALA B 1 36 ? -1.870  -2.300  -7.444  1.00 0.00 ? 36 ALA B HB3  2  
ATOM 3507  N N    . PRO B 1 37 ? -3.186  -4.201  -9.520  1.00 0.00 ? 37 PRO B N    2  
ATOM 3508  C CA   . PRO B 1 37 ? -3.089  -4.623  -10.917 1.00 0.00 ? 37 PRO B CA   2  
ATOM 3509  C C    . PRO B 1 37 ? -1.888  -4.007  -11.627 1.00 0.00 ? 37 PRO B C    2  
ATOM 3510  O O    . PRO B 1 37 ? -1.391  -2.955  -11.225 1.00 0.00 ? 37 PRO B O    2  
ATOM 3511  C CB   . PRO B 1 37 ? -4.387  -4.089  -11.512 1.00 0.00 ? 37 PRO B CB   2  
ATOM 3512  C CG   . PRO B 1 37 ? -4.640  -2.831  -10.756 1.00 0.00 ? 37 PRO B CG   2  
ATOM 3513  C CD   . PRO B 1 37 ? -4.120  -3.067  -9.359  1.00 0.00 ? 37 PRO B CD   2  
ATOM 3514  H HA   . PRO B 1 37 ? -3.058  -5.698  -11.011 1.00 0.00 ? 37 PRO B HA   2  
ATOM 3515  H HB2  . PRO B 1 37 ? -4.254  -3.900  -12.568 1.00 0.00 ? 37 PRO B HB2  2  
ATOM 3516  H HB3  . PRO B 1 37 ? -5.180  -4.806  -11.363 1.00 0.00 ? 37 PRO B HB3  2  
ATOM 3517  H HG2  . PRO B 1 37 ? -4.109  -2.012  -11.218 1.00 0.00 ? 37 PRO B HG2  2  
ATOM 3518  H HG3  . PRO B 1 37 ? -5.699  -2.625  -10.731 1.00 0.00 ? 37 PRO B HG3  2  
ATOM 3519  H HD2  . PRO B 1 37 ? -3.602  -2.192  -8.997  1.00 0.00 ? 37 PRO B HD2  2  
ATOM 3520  H HD3  . PRO B 1 37 ? -4.931  -3.328  -8.695  1.00 0.00 ? 37 PRO B HD3  2  
ATOM 3521  N N    . LYS B 1 38 ? -1.430  -4.664  -12.686 1.00 0.00 ? 38 LYS B N    2  
ATOM 3522  C CA   . LYS B 1 38 ? -0.291  -4.175  -13.454 1.00 0.00 ? 38 LYS B CA   2  
ATOM 3523  C C    . LYS B 1 38 ? -0.698  -3.035  -14.389 1.00 0.00 ? 38 LYS B C    2  
ATOM 3524  O O    . LYS B 1 38 ? 0.145   -2.457  -15.075 1.00 0.00 ? 38 LYS B O    2  
ATOM 3525  C CB   . LYS B 1 38 ? 0.332   -5.314  -14.264 1.00 0.00 ? 38 LYS B CB   2  
ATOM 3526  C CG   . LYS B 1 38 ? -0.641  -5.981  -15.223 1.00 0.00 ? 38 LYS B CG   2  
ATOM 3527  C CD   . LYS B 1 38 ? -0.499  -7.495  -15.200 1.00 0.00 ? 38 LYS B CD   2  
ATOM 3528  C CE   . LYS B 1 38 ? -0.696  -8.096  -16.583 1.00 0.00 ? 38 LYS B CE   2  
ATOM 3529  N NZ   . LYS B 1 38 ? -1.999  -8.807  -16.699 1.00 0.00 ? 38 LYS B NZ   2  
ATOM 3530  H H    . LYS B 1 38 ? -1.870  -5.495  -12.961 1.00 0.00 ? 38 LYS B H    2  
ATOM 3531  H HA   . LYS B 1 38 ? 0.443   -3.803  -12.754 1.00 0.00 ? 38 LYS B HA   2  
ATOM 3532  H HB2  . LYS B 1 38 ? 1.158   -4.921  -14.839 1.00 0.00 ? 38 LYS B HB2  2  
ATOM 3533  H HB3  . LYS B 1 38 ? 0.704   -6.063  -13.582 1.00 0.00 ? 38 LYS B HB3  2  
ATOM 3534  H HG2  . LYS B 1 38 ? -1.649  -5.720  -14.937 1.00 0.00 ? 38 LYS B HG2  2  
ATOM 3535  H HG3  . LYS B 1 38 ? -0.446  -5.624  -16.224 1.00 0.00 ? 38 LYS B HG3  2  
ATOM 3536  H HD2  . LYS B 1 38 ? 0.489   -7.748  -14.847 1.00 0.00 ? 38 LYS B HD2  2  
ATOM 3537  H HD3  . LYS B 1 38 ? -1.239  -7.906  -14.530 1.00 0.00 ? 38 LYS B HD3  2  
ATOM 3538  H HE2  . LYS B 1 38 ? -0.662  -7.304  -17.316 1.00 0.00 ? 38 LYS B HE2  2  
ATOM 3539  H HE3  . LYS B 1 38 ? 0.104   -8.796  -16.774 1.00 0.00 ? 38 LYS B HE3  2  
ATOM 3540  H HZ1  . LYS B 1 38 ? -2.074  -9.266  -17.630 1.00 0.00 ? 38 LYS B HZ1  2  
ATOM 3541  H HZ2  . LYS B 1 38 ? -2.785  -8.133  -16.594 1.00 0.00 ? 38 LYS B HZ2  2  
ATOM 3542  H HZ3  . LYS B 1 38 ? -2.078  -9.532  -15.958 1.00 0.00 ? 38 LYS B HZ3  2  
ATOM 3543  N N    . GLU B 1 39 ? -1.991  -2.716  -14.418 1.00 0.00 ? 39 GLU B N    2  
ATOM 3544  C CA   . GLU B 1 39 ? -2.496  -1.649  -15.275 1.00 0.00 ? 39 GLU B CA   2  
ATOM 3545  C C    . GLU B 1 39 ? -2.050  -0.279  -14.771 1.00 0.00 ? 39 GLU B C    2  
ATOM 3546  O O    . GLU B 1 39 ? -1.650  0.580   -15.557 1.00 0.00 ? 39 GLU B O    2  
ATOM 3547  C CB   . GLU B 1 39 ? -4.023  -1.708  -15.351 1.00 0.00 ? 39 GLU B CB   2  
ATOM 3548  C CG   . GLU B 1 39 ? -4.565  -1.618  -16.769 1.00 0.00 ? 39 GLU B CG   2  
ATOM 3549  C CD   . GLU B 1 39 ? -5.735  -0.661  -16.887 1.00 0.00 ? 39 GLU B CD   2  
ATOM 3550  O OE1  . GLU B 1 39 ? -5.495  0.558   -17.006 1.00 0.00 ? 39 GLU B OE1  2  
ATOM 3551  O OE2  . GLU B 1 39 ? -6.892  -1.132  -16.859 1.00 0.00 ? 39 GLU B OE2  2  
ATOM 3552  H H    . GLU B 1 39 ? -2.623  -3.209  -13.856 1.00 0.00 ? 39 GLU B H    2  
ATOM 3553  H HA   . GLU B 1 39 ? -2.091  -1.802  -16.265 1.00 0.00 ? 39 GLU B HA   2  
ATOM 3554  H HB2  . GLU B 1 39 ? -4.357  -2.641  -14.920 1.00 0.00 ? 39 GLU B HB2  2  
ATOM 3555  H HB3  . GLU B 1 39 ? -4.435  -0.890  -14.778 1.00 0.00 ? 39 GLU B HB3  2  
ATOM 3556  H HG2  . GLU B 1 39 ? -3.775  -1.278  -17.421 1.00 0.00 ? 39 GLU B HG2  2  
ATOM 3557  H HG3  . GLU B 1 39 ? -4.889  -2.601  -17.079 1.00 0.00 ? 39 GLU B HG3  2  
ATOM 3558  N N    . VAL B 1 40 ? -2.119  -0.080  -13.458 1.00 0.00 ? 40 VAL B N    2  
ATOM 3559  C CA   . VAL B 1 40 ? -1.717  1.189   -12.861 1.00 0.00 ? 40 VAL B CA   2  
ATOM 3560  C C    . VAL B 1 40 ? -0.242  1.162   -12.473 1.00 0.00 ? 40 VAL B C    2  
ATOM 3561  O O    . VAL B 1 40 ? 0.318   0.101   -12.199 1.00 0.00 ? 40 VAL B O    2  
ATOM 3562  C CB   . VAL B 1 40 ? -2.566  1.530   -11.618 1.00 0.00 ? 40 VAL B CB   2  
ATOM 3563  C CG1  . VAL B 1 40 ? -2.331  2.971   -11.193 1.00 0.00 ? 40 VAL B CG1  2  
ATOM 3564  C CG2  . VAL B 1 40 ? -4.042  1.284   -11.896 1.00 0.00 ? 40 VAL B CG2  2  
ATOM 3565  H H    . VAL B 1 40 ? -2.441  -0.801  -12.878 1.00 0.00 ? 40 VAL B H    2  
ATOM 3566  H HA   . VAL B 1 40 ? -1.869  1.964   -13.598 1.00 0.00 ? 40 VAL B HA   2  
ATOM 3567  H HB   . VAL B 1 40 ? -2.263  0.885   -10.806 1.00 0.00 ? 40 VAL B HB   2  
ATOM 3568  H HG11 . VAL B 1 40 ? -3.238  3.371   -10.764 1.00 0.00 ? 40 VAL B HG11 2  
ATOM 3569  H HG12 . VAL B 1 40 ? -2.049  3.559   -12.053 1.00 0.00 ? 40 VAL B HG12 2  
ATOM 3570  H HG13 . VAL B 1 40 ? -1.540  3.005   -10.458 1.00 0.00 ? 40 VAL B HG13 2  
ATOM 3571  H HG21 . VAL B 1 40 ? -4.295  0.270   -11.626 1.00 0.00 ? 40 VAL B HG21 2  
ATOM 3572  H HG22 . VAL B 1 40 ? -4.241  1.437   -12.946 1.00 0.00 ? 40 VAL B HG22 2  
ATOM 3573  H HG23 . VAL B 1 40 ? -4.637  1.971   -11.313 1.00 0.00 ? 40 VAL B HG23 2  
ATOM 3574  N N    . SER B 1 41 ? 0.385   2.334   -12.459 1.00 0.00 ? 41 SER B N    2  
ATOM 3575  C CA   . SER B 1 41 ? 1.798   2.439   -12.113 1.00 0.00 ? 41 SER B CA   2  
ATOM 3576  C C    . SER B 1 41 ? 2.003   2.304   -10.609 1.00 0.00 ? 41 SER B C    2  
ATOM 3577  O O    . SER B 1 41 ? 1.699   3.222   -9.847  1.00 0.00 ? 41 SER B O    2  
ATOM 3578  C CB   . SER B 1 41 ? 2.365   3.774   -12.598 1.00 0.00 ? 41 SER B CB   2  
ATOM 3579  O OG   . SER B 1 41 ? 3.748   3.879   -12.303 1.00 0.00 ? 41 SER B OG   2  
ATOM 3580  H H    . SER B 1 41 ? -0.112  3.147   -12.691 1.00 0.00 ? 41 SER B H    2  
ATOM 3581  H HA   . SER B 1 41 ? 2.321   1.635   -12.609 1.00 0.00 ? 41 SER B HA   2  
ATOM 3582  H HB2  . SER B 1 41 ? 2.232   3.853   -13.667 1.00 0.00 ? 41 SER B HB2  2  
ATOM 3583  H HB3  . SER B 1 41 ? 1.843   4.583   -12.110 1.00 0.00 ? 41 SER B HB3  2  
ATOM 3584  H HG   . SER B 1 41 ? 3.863   4.055   -11.367 1.00 0.00 ? 41 SER B HG   2  
ATOM 3585  N N    . VAL B 1 42 ? 2.519   1.154   -10.184 1.00 0.00 ? 42 VAL B N    2  
ATOM 3586  C CA   . VAL B 1 42 ? 2.759   0.908   -8.768  1.00 0.00 ? 42 VAL B CA   2  
ATOM 3587  C C    . VAL B 1 42 ? 4.234   0.610   -8.493  1.00 0.00 ? 42 VAL B C    2  
ATOM 3588  O O    . VAL B 1 42 ? 4.789   -0.353  -9.022  1.00 0.00 ? 42 VAL B O    2  
ATOM 3589  C CB   . VAL B 1 42 ? 1.905   -0.268  -8.255  1.00 0.00 ? 42 VAL B CB   2  
ATOM 3590  C CG1  . VAL B 1 42 ? 2.291   -1.562  -8.958  1.00 0.00 ? 42 VAL B CG1  2  
ATOM 3591  C CG2  . VAL B 1 42 ? 2.039   -0.410  -6.747  1.00 0.00 ? 42 VAL B CG2  2  
ATOM 3592  H H    . VAL B 1 42 ? 2.740   0.457   -10.838 1.00 0.00 ? 42 VAL B H    2  
ATOM 3593  H HA   . VAL B 1 42 ? 2.470   1.795   -8.226  1.00 0.00 ? 42 VAL B HA   2  
ATOM 3594  H HB   . VAL B 1 42 ? 0.870   -0.059  -8.484  1.00 0.00 ? 42 VAL B HB   2  
ATOM 3595  H HG11 . VAL B 1 42 ? 1.516   -2.299  -8.807  1.00 0.00 ? 42 VAL B HG11 2  
ATOM 3596  H HG12 . VAL B 1 42 ? 3.221   -1.929  -8.550  1.00 0.00 ? 42 VAL B HG12 2  
ATOM 3597  H HG13 . VAL B 1 42 ? 2.410   -1.376  -10.015 1.00 0.00 ? 42 VAL B HG13 2  
ATOM 3598  H HG21 . VAL B 1 42 ? 1.104   -0.758  -6.333  1.00 0.00 ? 42 VAL B HG21 2  
ATOM 3599  H HG22 . VAL B 1 42 ? 2.289   0.549   -6.316  1.00 0.00 ? 42 VAL B HG22 2  
ATOM 3600  H HG23 . VAL B 1 42 ? 2.820   -1.121  -6.520  1.00 0.00 ? 42 VAL B HG23 2  
ATOM 3601  N N    . HIS B 1 43 ? 4.861   1.437   -7.658  1.00 0.00 ? 43 HIS B N    2  
ATOM 3602  C CA   . HIS B 1 43 ? 6.265   1.255   -7.308  1.00 0.00 ? 43 HIS B CA   2  
ATOM 3603  C C    . HIS B 1 43 ? 6.448   1.264   -5.792  1.00 0.00 ? 43 HIS B C    2  
ATOM 3604  O O    . HIS B 1 43 ? 5.897   2.119   -5.099  1.00 0.00 ? 43 HIS B O    2  
ATOM 3605  C CB   . HIS B 1 43 ? 7.118   2.354   -7.944  1.00 0.00 ? 43 HIS B CB   2  
ATOM 3606  C CG   . HIS B 1 43 ? 7.175   2.277   -9.438  1.00 0.00 ? 43 HIS B CG   2  
ATOM 3607  N ND1  . HIS B 1 43 ? 6.085   1.958   -10.218 1.00 0.00 ? 43 HIS B ND1  2  
ATOM 3608  C CD2  . HIS B 1 43 ? 8.202   2.481   -10.298 1.00 0.00 ? 43 HIS B CD2  2  
ATOM 3609  C CE1  . HIS B 1 43 ? 6.435   1.967   -11.492 1.00 0.00 ? 43 HIS B CE1  2  
ATOM 3610  N NE2  . HIS B 1 43 ? 7.715   2.282   -11.567 1.00 0.00 ? 43 HIS B NE2  2  
ATOM 3611  H H    . HIS B 1 43 ? 4.368   2.186   -7.263  1.00 0.00 ? 43 HIS B H    2  
ATOM 3612  H HA   . HIS B 1 43 ? 6.581   0.296   -7.692  1.00 0.00 ? 43 HIS B HA   2  
ATOM 3613  H HB2  . HIS B 1 43 ? 6.710   3.317   -7.676  1.00 0.00 ? 43 HIS B HB2  2  
ATOM 3614  H HB3  . HIS B 1 43 ? 8.128   2.279   -7.567  1.00 0.00 ? 43 HIS B HB3  2  
ATOM 3615  H HD2  . HIS B 1 43 ? 9.215   2.750   -10.034 1.00 0.00 ? 43 HIS B HD2  2  
ATOM 3616  H HE1  . HIS B 1 43 ? 5.786   1.755   -12.328 1.00 0.00 ? 43 HIS B HE1  2  
ATOM 3617  H HE2  . HIS B 1 43 ? 8.213   2.430   -12.398 1.00 0.00 ? 43 HIS B HE2  2  
ATOM 3618  N N    . ARG B 1 44 ? 7.222   0.312   -5.281  1.00 0.00 ? 44 ARG B N    2  
ATOM 3619  C CA   . ARG B 1 44 ? 7.469   0.224   -3.846  1.00 0.00 ? 44 ARG B CA   2  
ATOM 3620  C C    . ARG B 1 44 ? 8.792   -0.478  -3.553  1.00 0.00 ? 44 ARG B C    2  
ATOM 3621  O O    . ARG B 1 44 ? 9.610   0.020   -2.780  1.00 0.00 ? 44 ARG B O    2  
ATOM 3622  C CB   . ARG B 1 44 ? 6.321   -0.514  -3.153  1.00 0.00 ? 44 ARG B CB   2  
ATOM 3623  C CG   . ARG B 1 44 ? 6.074   -1.911  -3.700  1.00 0.00 ? 44 ARG B CG   2  
ATOM 3624  C CD   . ARG B 1 44 ? 4.823   -2.532  -3.101  1.00 0.00 ? 44 ARG B CD   2  
ATOM 3625  N NE   . ARG B 1 44 ? 3.712   -2.552  -4.050  1.00 0.00 ? 44 ARG B NE   2  
ATOM 3626  C CZ   . ARG B 1 44 ? 3.581   -3.455  -5.020  1.00 0.00 ? 44 ARG B CZ   2  
ATOM 3627  N NH1  . ARG B 1 44 ? 4.489   -4.411  -5.173  1.00 0.00 ? 44 ARG B NH1  2  
ATOM 3628  N NH2  . ARG B 1 44 ? 2.540   -3.401  -5.839  1.00 0.00 ? 44 ARG B NH2  2  
ATOM 3629  H H    . ARG B 1 44 ? 7.636   -0.344  -5.881  1.00 0.00 ? 44 ARG B H    2  
ATOM 3630  H HA   . ARG B 1 44 ? 7.519   1.230   -3.459  1.00 0.00 ? 44 ARG B HA   2  
ATOM 3631  H HB2  . ARG B 1 44 ? 6.547   -0.599  -2.101  1.00 0.00 ? 44 ARG B HB2  2  
ATOM 3632  H HB3  . ARG B 1 44 ? 5.415   0.061   -3.273  1.00 0.00 ? 44 ARG B HB3  2  
ATOM 3633  H HG2  . ARG B 1 44 ? 5.956   -1.852  -4.772  1.00 0.00 ? 44 ARG B HG2  2  
ATOM 3634  H HG3  . ARG B 1 44 ? 6.924   -2.535  -3.464  1.00 0.00 ? 44 ARG B HG3  2  
ATOM 3635  H HD2  . ARG B 1 44 ? 5.047   -3.546  -2.803  1.00 0.00 ? 44 ARG B HD2  2  
ATOM 3636  H HD3  . ARG B 1 44 ? 4.532   -1.960  -2.232  1.00 0.00 ? 44 ARG B HD3  2  
ATOM 3637  H HE   . ARG B 1 44 ? 3.028   -1.856  -3.960  1.00 0.00 ? 44 ARG B HE   2  
ATOM 3638  H HH11 . ARG B 1 44 ? 5.276   -4.458  -4.559  1.00 0.00 ? 44 ARG B HH11 2  
ATOM 3639  H HH12 . ARG B 1 44 ? 4.384   -5.087  -5.902  1.00 0.00 ? 44 ARG B HH12 2  
ATOM 3640  H HH21 . ARG B 1 44 ? 1.854   -2.682  -5.729  1.00 0.00 ? 44 ARG B HH21 2  
ATOM 3641  H HH22 . ARG B 1 44 ? 2.442   -4.079  -6.567  1.00 0.00 ? 44 ARG B HH22 2  
ATOM 3642  N N    . GLU B 1 45 ? 8.996   -1.636  -4.172  1.00 0.00 ? 45 GLU B N    2  
ATOM 3643  C CA   . GLU B 1 45 ? 10.220  -2.402  -3.972  1.00 0.00 ? 45 GLU B CA   2  
ATOM 3644  C C    . GLU B 1 45 ? 10.421  -3.411  -5.099  1.00 0.00 ? 45 GLU B C    2  
ATOM 3645  O O    . GLU B 1 45 ? 9.548   -4.237  -5.369  1.00 0.00 ? 45 GLU B O    2  
ATOM 3646  C CB   . GLU B 1 45 ? 10.179  -3.125  -2.624  1.00 0.00 ? 45 GLU B CB   2  
ATOM 3647  C CG   . GLU B 1 45 ? 10.926  -2.397  -1.519  1.00 0.00 ? 45 GLU B CG   2  
ATOM 3648  C CD   . GLU B 1 45 ? 12.365  -2.094  -1.889  1.00 0.00 ? 45 GLU B CD   2  
ATOM 3649  O OE1  . GLU B 1 45 ? 12.609  -1.034  -2.503  1.00 0.00 ? 45 GLU B OE1  2  
ATOM 3650  O OE2  . GLU B 1 45 ? 13.247  -2.917  -1.566  1.00 0.00 ? 45 GLU B OE2  2  
ATOM 3651  H H    . GLU B 1 45 ? 8.307   -1.983  -4.777  1.00 0.00 ? 45 GLU B H    2  
ATOM 3652  H HA   . GLU B 1 45 ? 11.048  -1.710  -3.974  1.00 0.00 ? 45 GLU B HA   2  
ATOM 3653  H HB2  . GLU B 1 45 ? 9.148   -3.235  -2.319  1.00 0.00 ? 45 GLU B HB2  2  
ATOM 3654  H HB3  . GLU B 1 45 ? 10.617  -4.106  -2.739  1.00 0.00 ? 45 GLU B HB3  2  
ATOM 3655  H HG2  . GLU B 1 45 ? 10.420  -1.466  -1.312  1.00 0.00 ? 45 GLU B HG2  2  
ATOM 3656  H HG3  . GLU B 1 45 ? 10.921  -3.014  -0.631  1.00 0.00 ? 45 GLU B HG3  2  
ATOM 3657  N N    . GLU B 1 46 ? 11.575  -3.337  -5.753  1.00 0.00 ? 46 GLU B N    2  
ATOM 3658  C CA   . GLU B 1 46 ? 11.891  -4.242  -6.852  1.00 0.00 ? 46 GLU B CA   2  
ATOM 3659  C C    . GLU B 1 46 ? 11.798  -5.698  -6.409  1.00 0.00 ? 46 GLU B C    2  
ATOM 3660  O O    . GLU B 1 46 ? 11.022  -6.475  -6.964  1.00 0.00 ? 46 GLU B O    2  
ATOM 3661  C CB   . GLU B 1 46 ? 13.293  -3.950  -7.392  1.00 0.00 ? 46 GLU B CB   2  
ATOM 3662  C CG   . GLU B 1 46 ? 13.295  -3.106  -8.656  1.00 0.00 ? 46 GLU B CG   2  
ATOM 3663  C CD   . GLU B 1 46 ? 13.575  -3.923  -9.903  1.00 0.00 ? 46 GLU B CD   2  
ATOM 3664  O OE1  . GLU B 1 46 ? 13.109  -5.079  -9.971  1.00 0.00 ? 46 GLU B OE1  2  
ATOM 3665  O OE2  . GLU B 1 46 ? 14.260  -3.406  -10.810 1.00 0.00 ? 46 GLU B OE2  2  
ATOM 3666  H H    . GLU B 1 46 ? 12.232  -2.657  -5.493  1.00 0.00 ? 46 GLU B H    2  
ATOM 3667  H HA   . GLU B 1 46 ? 11.171  -4.071  -7.638  1.00 0.00 ? 46 GLU B HA   2  
ATOM 3668  H HB2  . GLU B 1 46 ? 13.857  -3.425  -6.635  1.00 0.00 ? 46 GLU B HB2  2  
ATOM 3669  H HB3  . GLU B 1 46 ? 13.786  -4.886  -7.611  1.00 0.00 ? 46 GLU B HB3  2  
ATOM 3670  H HG2  . GLU B 1 46 ? 12.328  -2.636  -8.762  1.00 0.00 ? 46 GLU B HG2  2  
ATOM 3671  H HG3  . GLU B 1 46 ? 14.056  -2.344  -8.564  1.00 0.00 ? 46 GLU B HG3  2  
ATOM 3672  N N    . ILE B 1 47 ? 12.591  -6.062  -5.405  1.00 0.00 ? 47 ILE B N    2  
ATOM 3673  C CA   . ILE B 1 47 ? 12.596  -7.426  -4.890  1.00 0.00 ? 47 ILE B CA   2  
ATOM 3674  C C    . ILE B 1 47 ? 11.208  -7.839  -4.408  1.00 0.00 ? 47 ILE B C    2  
ATOM 3675  O O    . ILE B 1 47 ? 10.757  -8.957  -4.666  1.00 0.00 ? 47 ILE B O    2  
ATOM 3676  C CB   . ILE B 1 47 ? 13.606  -7.587  -3.734  1.00 0.00 ? 47 ILE B CB   2  
ATOM 3677  C CG1  . ILE B 1 47 ? 13.672  -9.047  -3.281  1.00 0.00 ? 47 ILE B CG1  2  
ATOM 3678  C CG2  . ILE B 1 47 ? 13.233  -6.680  -2.570  1.00 0.00 ? 47 ILE B CG2  2  
ATOM 3679  C CD1  . ILE B 1 47 ? 14.756  -9.314  -2.260  1.00 0.00 ? 47 ILE B CD1  2  
ATOM 3680  H H    . ILE B 1 47 ? 13.186  -5.397  -5.000  1.00 0.00 ? 47 ILE B H    2  
ATOM 3681  H HA   . ILE B 1 47 ? 12.895  -8.083  -5.694  1.00 0.00 ? 47 ILE B HA   2  
ATOM 3682  H HB   . ILE B 1 47 ? 14.578  -7.285  -4.093  1.00 0.00 ? 47 ILE B HB   2  
ATOM 3683  H HG12 . ILE B 1 47 ? 12.726  -9.324  -2.840  1.00 0.00 ? 47 ILE B HG12 2  
ATOM 3684  H HG13 . ILE B 1 47 ? 13.861  -9.675  -4.139  1.00 0.00 ? 47 ILE B HG13 2  
ATOM 3685  H HG21 . ILE B 1 47 ? 12.819  -5.758  -2.950  1.00 0.00 ? 47 ILE B HG21 2  
ATOM 3686  H HG22 . ILE B 1 47 ? 14.115  -6.465  -1.985  1.00 0.00 ? 47 ILE B HG22 2  
ATOM 3687  H HG23 . ILE B 1 47 ? 12.501  -7.175  -1.950  1.00 0.00 ? 47 ILE B HG23 2  
ATOM 3688  H HD11 . ILE B 1 47 ? 14.809  -8.488  -1.566  1.00 0.00 ? 47 ILE B HD11 2  
ATOM 3689  H HD12 . ILE B 1 47 ? 15.706  -9.422  -2.763  1.00 0.00 ? 47 ILE B HD12 2  
ATOM 3690  H HD13 . ILE B 1 47 ? 14.528  -10.222 -1.722  1.00 0.00 ? 47 ILE B HD13 2  
ATOM 3691  N N    . TYR B 1 48 ? 10.533  -6.926  -3.710  1.00 0.00 ? 48 TYR B N    2  
ATOM 3692  C CA   . TYR B 1 48 ? 9.192   -7.189  -3.192  1.00 0.00 ? 48 TYR B CA   2  
ATOM 3693  C C    . TYR B 1 48 ? 8.329   -7.872  -4.248  1.00 0.00 ? 48 TYR B C    2  
ATOM 3694  O O    . TYR B 1 48 ? 7.822   -8.974  -4.034  1.00 0.00 ? 48 TYR B O    2  
ATOM 3695  C CB   . TYR B 1 48 ? 8.531   -5.885  -2.742  1.00 0.00 ? 48 TYR B CB   2  
ATOM 3696  C CG   . TYR B 1 48 ? 8.866   -5.493  -1.319  1.00 0.00 ? 48 TYR B CG   2  
ATOM 3697  C CD1  . TYR B 1 48 ? 10.146  -5.673  -0.811  1.00 0.00 ? 48 TYR B CD1  2  
ATOM 3698  C CD2  . TYR B 1 48 ? 7.900   -4.942  -0.486  1.00 0.00 ? 48 TYR B CD2  2  
ATOM 3699  C CE1  . TYR B 1 48 ? 10.455  -5.316  0.488   1.00 0.00 ? 48 TYR B CE1  2  
ATOM 3700  C CE2  . TYR B 1 48 ? 8.202   -4.582  0.814   1.00 0.00 ? 48 TYR B CE2  2  
ATOM 3701  C CZ   . TYR B 1 48 ? 9.480   -4.771  1.296   1.00 0.00 ? 48 TYR B CZ   2  
ATOM 3702  O OH   . TYR B 1 48 ? 9.783   -4.414  2.589   1.00 0.00 ? 48 TYR B OH   2  
ATOM 3703  H H    . TYR B 1 48 ? 10.945  -6.053  -3.541  1.00 0.00 ? 48 TYR B H    2  
ATOM 3704  H HA   . TYR B 1 48 ? 9.288   -7.847  -2.342  1.00 0.00 ? 48 TYR B HA   2  
ATOM 3705  H HB2  . TYR B 1 48 ? 8.853   -5.084  -3.390  1.00 0.00 ? 48 TYR B HB2  2  
ATOM 3706  H HB3  . TYR B 1 48 ? 7.458   -5.990  -2.814  1.00 0.00 ? 48 TYR B HB3  2  
ATOM 3707  H HD1  . TYR B 1 48 ? 10.908  -6.100  -1.446  1.00 0.00 ? 48 TYR B HD1  2  
ATOM 3708  H HD2  . TYR B 1 48 ? 6.900   -4.795  -0.866  1.00 0.00 ? 48 TYR B HD2  2  
ATOM 3709  H HE1  . TYR B 1 48 ? 11.456  -5.464  0.865   1.00 0.00 ? 48 TYR B HE1  2  
ATOM 3710  H HE2  . TYR B 1 48 ? 7.437   -4.155  1.446   1.00 0.00 ? 48 TYR B HE2  2  
ATOM 3711  H HH   . TYR B 1 48 ? 9.086   -4.714  3.177   1.00 0.00 ? 48 TYR B HH   2  
ATOM 3712  N N    . GLN B 1 49 ? 8.176   -7.215  -5.391  1.00 0.00 ? 49 GLN B N    2  
ATOM 3713  C CA   . GLN B 1 49 ? 7.385   -7.764  -6.484  1.00 0.00 ? 49 GLN B CA   2  
ATOM 3714  C C    . GLN B 1 49 ? 8.161   -8.855  -7.220  1.00 0.00 ? 49 GLN B C    2  
ATOM 3715  O O    . GLN B 1 49 ? 7.571   -9.703  -7.888  1.00 0.00 ? 49 GLN B O    2  
ATOM 3716  C CB   . GLN B 1 49 ? 6.990   -6.655  -7.463  1.00 0.00 ? 49 GLN B CB   2  
ATOM 3717  C CG   . GLN B 1 49 ? 8.151   -5.767  -7.879  1.00 0.00 ? 49 GLN B CG   2  
ATOM 3718  C CD   . GLN B 1 49 ? 7.843   -4.948  -9.117  1.00 0.00 ? 49 GLN B CD   2  
ATOM 3719  O OE1  . GLN B 1 49 ? 7.581   -5.496  -10.188 1.00 0.00 ? 49 GLN B OE1  2  
ATOM 3720  N NE2  . GLN B 1 49 ? 7.874   -3.628  -8.977  1.00 0.00 ? 49 GLN B NE2  2  
ATOM 3721  H H    . GLN B 1 49 ? 8.608   -6.342  -5.508  1.00 0.00 ? 49 GLN B H    2  
ATOM 3722  H HA   . GLN B 1 49 ? 6.490   -8.195  -6.062  1.00 0.00 ? 49 GLN B HA   2  
ATOM 3723  H HB2  . GLN B 1 49 ? 6.575   -7.106  -8.351  1.00 0.00 ? 49 GLN B HB2  2  
ATOM 3724  H HB3  . GLN B 1 49 ? 6.238   -6.034  -7.000  1.00 0.00 ? 49 GLN B HB3  2  
ATOM 3725  H HG2  . GLN B 1 49 ? 8.380   -5.092  -7.068  1.00 0.00 ? 49 GLN B HG2  2  
ATOM 3726  H HG3  . GLN B 1 49 ? 9.010   -6.390  -8.081  1.00 0.00 ? 49 GLN B HG3  2  
ATOM 3727  H HE21 . GLN B 1 49 ? 8.091   -3.261  -8.094  1.00 0.00 ? 49 GLN B HE21 2  
ATOM 3728  H HE22 . GLN B 1 49 ? 7.678   -3.074  -9.761  1.00 0.00 ? 49 GLN B HE22 2  
ATOM 3729  N N    . ARG B 1 50 ? 9.488   -8.830  -7.088  1.00 0.00 ? 50 ARG B N    2  
ATOM 3730  C CA   . ARG B 1 50 ? 10.345  -9.817  -7.737  1.00 0.00 ? 50 ARG B CA   2  
ATOM 3731  C C    . ARG B 1 50 ? 10.141  -11.209 -7.140  1.00 0.00 ? 50 ARG B C    2  
ATOM 3732  O O    . ARG B 1 50 ? 10.566  -12.209 -7.718  1.00 0.00 ? 50 ARG B O    2  
ATOM 3733  C CB   . ARG B 1 50 ? 11.815  -9.411  -7.610  1.00 0.00 ? 50 ARG B CB   2  
ATOM 3734  C CG   . ARG B 1 50 ? 12.708  -10.014 -8.683  1.00 0.00 ? 50 ARG B CG   2  
ATOM 3735  C CD   . ARG B 1 50 ? 13.128  -8.974  -9.710  1.00 0.00 ? 50 ARG B CD   2  
ATOM 3736  N NE   . ARG B 1 50 ? 11.977  -8.332  -10.340 1.00 0.00 ? 50 ARG B NE   2  
ATOM 3737  C CZ   . ARG B 1 50 ? 12.067  -7.504  -11.379 1.00 0.00 ? 50 ARG B CZ   2  
ATOM 3738  N NH1  . ARG B 1 50 ? 13.251  -7.216  -11.907 1.00 0.00 ? 50 ARG B NH1  2  
ATOM 3739  N NH2  . ARG B 1 50 ? 10.970  -6.964  -11.893 1.00 0.00 ? 50 ARG B NH2  2  
ATOM 3740  H H    . ARG B 1 50 ? 9.901   -8.134  -6.539  1.00 0.00 ? 50 ARG B H    2  
ATOM 3741  H HA   . ARG B 1 50 ? 10.081  -9.845  -8.781  1.00 0.00 ? 50 ARG B HA   2  
ATOM 3742  H HB2  . ARG B 1 50 ? 11.887  -8.337  -7.674  1.00 0.00 ? 50 ARG B HB2  2  
ATOM 3743  H HB3  . ARG B 1 50 ? 12.182  -9.731  -6.645  1.00 0.00 ? 50 ARG B HB3  2  
ATOM 3744  H HG2  . ARG B 1 50 ? 13.593  -10.419 -8.215  1.00 0.00 ? 50 ARG B HG2  2  
ATOM 3745  H HG3  . ARG B 1 50 ? 12.169  -10.804 -9.183  1.00 0.00 ? 50 ARG B HG3  2  
ATOM 3746  H HD2  . ARG B 1 50 ? 13.723  -8.220  -9.217  1.00 0.00 ? 50 ARG B HD2  2  
ATOM 3747  H HD3  . ARG B 1 50 ? 13.721  -9.458  -10.471 1.00 0.00 ? 50 ARG B HD3  2  
ATOM 3748  H HE   . ARG B 1 50 ? 11.091  -8.527  -9.971  1.00 0.00 ? 50 ARG B HE   2  
ATOM 3749  H HH11 . ARG B 1 50 ? 14.081  -7.620  -11.525 1.00 0.00 ? 50 ARG B HH11 2  
ATOM 3750  H HH12 . ARG B 1 50 ? 13.311  -6.594  -12.688 1.00 0.00 ? 50 ARG B HH12 2  
ATOM 3751  H HH21 . ARG B 1 50 ? 10.076  -7.177  -11.499 1.00 0.00 ? 50 ARG B HH21 2  
ATOM 3752  H HH22 . ARG B 1 50 ? 11.038  -6.342  -12.673 1.00 0.00 ? 50 ARG B HH22 2  
ATOM 3753  N N    . ILE B 1 51 ? 9.494   -11.267 -5.980  1.00 0.00 ? 51 ILE B N    2  
ATOM 3754  C CA   . ILE B 1 51 ? 9.239   -12.536 -5.307  1.00 0.00 ? 51 ILE B CA   2  
ATOM 3755  C C    . ILE B 1 51 ? 7.743   -12.821 -5.209  1.00 0.00 ? 51 ILE B C    2  
ATOM 3756  O O    . ILE B 1 51 ? 7.326   -13.978 -5.141  1.00 0.00 ? 51 ILE B O    2  
ATOM 3757  C CB   . ILE B 1 51 ? 9.846   -12.552 -3.891  1.00 0.00 ? 51 ILE B CB   2  
ATOM 3758  C CG1  . ILE B 1 51 ? 11.299  -12.076 -3.929  1.00 0.00 ? 51 ILE B CG1  2  
ATOM 3759  C CG2  . ILE B 1 51 ? 9.754   -13.946 -3.290  1.00 0.00 ? 51 ILE B CG2  2  
ATOM 3760  C CD1  . ILE B 1 51 ? 12.217  -12.998 -4.705  1.00 0.00 ? 51 ILE B CD1  2  
ATOM 3761  H H    . ILE B 1 51 ? 9.184   -10.437 -5.565  1.00 0.00 ? 51 ILE B H    2  
ATOM 3762  H HA   . ILE B 1 51 ? 9.708   -13.319 -5.885  1.00 0.00 ? 51 ILE B HA   2  
ATOM 3763  H HB   . ILE B 1 51 ? 9.271   -11.881 -3.270  1.00 0.00 ? 51 ILE B HB   2  
ATOM 3764  H HG12 . ILE B 1 51 ? 11.340  -11.102 -4.392  1.00 0.00 ? 51 ILE B HG12 2  
ATOM 3765  H HG13 . ILE B 1 51 ? 11.674  -12.006 -2.918  1.00 0.00 ? 51 ILE B HG13 2  
ATOM 3766  H HG21 . ILE B 1 51 ? 10.044  -13.910 -2.250  1.00 0.00 ? 51 ILE B HG21 2  
ATOM 3767  H HG22 . ILE B 1 51 ? 10.415  -14.613 -3.825  1.00 0.00 ? 51 ILE B HG22 2  
ATOM 3768  H HG23 . ILE B 1 51 ? 8.739   -14.307 -3.369  1.00 0.00 ? 51 ILE B HG23 2  
ATOM 3769  H HD11 . ILE B 1 51 ? 12.098  -12.818 -5.763  1.00 0.00 ? 51 ILE B HD11 2  
ATOM 3770  H HD12 . ILE B 1 51 ? 11.966  -14.025 -4.484  1.00 0.00 ? 51 ILE B HD12 2  
ATOM 3771  H HD13 . ILE B 1 51 ? 13.242  -12.809 -4.421  1.00 0.00 ? 51 ILE B HD13 2  
ATOM 3772  N N    . GLN B 1 52 ? 6.939   -11.762 -5.199  1.00 0.00 ? 52 GLN B N    2  
ATOM 3773  C CA   . GLN B 1 52 ? 5.490   -11.902 -5.107  1.00 0.00 ? 52 GLN B CA   2  
ATOM 3774  C C    . GLN B 1 52 ? 4.835   -11.704 -6.471  1.00 0.00 ? 52 GLN B C    2  
ATOM 3775  O O    . GLN B 1 52 ? 4.147   -12.591 -6.976  1.00 0.00 ? 52 GLN B O    2  
ATOM 3776  C CB   . GLN B 1 52 ? 4.926   -10.896 -4.100  1.00 0.00 ? 52 GLN B CB   2  
ATOM 3777  C CG   . GLN B 1 52 ? 4.175   -11.544 -2.949  1.00 0.00 ? 52 GLN B CG   2  
ATOM 3778  C CD   . GLN B 1 52 ? 4.995   -12.606 -2.241  1.00 0.00 ? 52 GLN B CD   2  
ATOM 3779  O OE1  . GLN B 1 52 ? 6.226   -12.568 -2.255  1.00 0.00 ? 52 GLN B OE1  2  
ATOM 3780  N NE2  . GLN B 1 52 ? 4.315   -13.561 -1.619  1.00 0.00 ? 52 GLN B NE2  2  
ATOM 3781  H H    . GLN B 1 52 ? 7.327   -10.865 -5.254  1.00 0.00 ? 52 GLN B H    2  
ATOM 3782  H HA   . GLN B 1 52 ? 5.276   -12.902 -4.761  1.00 0.00 ? 52 GLN B HA   2  
ATOM 3783  H HB2  . GLN B 1 52 ? 5.742   -10.320 -3.690  1.00 0.00 ? 52 GLN B HB2  2  
ATOM 3784  H HB3  . GLN B 1 52 ? 4.249   -10.229 -4.613  1.00 0.00 ? 52 GLN B HB3  2  
ATOM 3785  H HG2  . GLN B 1 52 ? 3.911   -10.780 -2.233  1.00 0.00 ? 52 GLN B HG2  2  
ATOM 3786  H HG3  . GLN B 1 52 ? 3.276   -12.002 -3.334  1.00 0.00 ? 52 GLN B HG3  2  
ATOM 3787  H HE21 . GLN B 1 52 ? 3.336   -13.528 -1.650  1.00 0.00 ? 52 GLN B HE21 2  
ATOM 3788  H HE22 . GLN B 1 52 ? 4.820   -14.260 -1.153  1.00 0.00 ? 52 GLN B HE22 2  
ATOM 3789  N N    . ALA B 1 53 ? 5.056   -10.535 -7.063  1.00 0.00 ? 53 ALA B N    2  
ATOM 3790  C CA   . ALA B 1 53 ? 4.489   -10.223 -8.369  1.00 0.00 ? 53 ALA B CA   2  
ATOM 3791  C C    . ALA B 1 53 ? 4.990   -11.205 -9.420  1.00 0.00 ? 53 ALA B C    2  
ATOM 3792  O O    . ALA B 1 53 ? 4.213   -11.969 -9.993  1.00 0.00 ? 53 ALA B O    2  
ATOM 3793  C CB   . ALA B 1 53 ? 4.830   -8.796  -8.768  1.00 0.00 ? 53 ALA B CB   2  
ATOM 3794  H H    . ALA B 1 53 ? 5.615   -9.870  -6.611  1.00 0.00 ? 53 ALA B H    2  
ATOM 3795  H HA   . ALA B 1 53 ? 3.415   -10.306 -8.295  1.00 0.00 ? 53 ALA B HA   2  
ATOM 3796  H HB1  . ALA B 1 53 ? 5.751   -8.790  -9.334  1.00 0.00 ? 53 ALA B HB1  2  
ATOM 3797  H HB2  . ALA B 1 53 ? 4.949   -8.193  -7.881  1.00 0.00 ? 53 ALA B HB2  2  
ATOM 3798  H HB3  . ALA B 1 53 ? 4.033   -8.392  -9.374  1.00 0.00 ? 53 ALA B HB3  2  
ATOM 3799  N N    . GLU B 1 54 ? 6.296   -11.185 -9.660  1.00 0.00 ? 54 GLU B N    2  
ATOM 3800  C CA   . GLU B 1 54 ? 6.909   -12.079 -10.634 1.00 0.00 ? 54 GLU B CA   2  
ATOM 3801  C C    . GLU B 1 54 ? 7.787   -13.113 -9.937  1.00 0.00 ? 54 GLU B C    2  
ATOM 3802  O O    . GLU B 1 54 ? 8.749   -12.764 -9.256  1.00 0.00 ? 54 GLU B O    2  
ATOM 3803  C CB   . GLU B 1 54 ? 7.743   -11.285 -11.640 1.00 0.00 ? 54 GLU B CB   2  
ATOM 3804  C CG   . GLU B 1 54 ? 8.658   -10.258 -10.995 1.00 0.00 ? 54 GLU B CG   2  
ATOM 3805  C CD   . GLU B 1 54 ? 8.215   -8.832  -11.260 1.00 0.00 ? 54 GLU B CD   2  
ATOM 3806  O OE1  . GLU B 1 54 ? 7.614   -8.586  -12.327 1.00 0.00 ? 54 GLU B OE1  2  
ATOM 3807  O OE2  . GLU B 1 54 ? 8.470   -7.962  -10.402 1.00 0.00 ? 54 GLU B OE2  2  
ATOM 3808  H H    . GLU B 1 54 ? 6.863   -10.558 -9.165  1.00 0.00 ? 54 GLU B H    2  
ATOM 3809  H HA   . GLU B 1 54 ? 6.116   -12.591 -11.160 1.00 0.00 ? 54 GLU B HA   2  
ATOM 3810  H HB2  . GLU B 1 54 ? 8.354   -11.974 -12.206 1.00 0.00 ? 54 GLU B HB2  2  
ATOM 3811  H HB3  . GLU B 1 54 ? 7.078   -10.769 -12.317 1.00 0.00 ? 54 GLU B HB3  2  
ATOM 3812  H HG2  . GLU B 1 54 ? 8.665   -10.423 -9.928  1.00 0.00 ? 54 GLU B HG2  2  
ATOM 3813  H HG3  . GLU B 1 54 ? 9.657   -10.388 -11.385 1.00 0.00 ? 54 GLU B HG3  2  
ATOM 3814  N N    . LYS B 1 55 ? 7.458   -14.384 -10.121 1.00 0.00 ? 55 LYS B N    2  
ATOM 3815  C CA   . LYS B 1 55 ? 8.226   -15.466 -9.517  1.00 0.00 ? 55 LYS B CA   2  
ATOM 3816  C C    . LYS B 1 55 ? 9.666   -15.442 -10.019 1.00 0.00 ? 55 LYS B C    2  
ATOM 3817  O O    . LYS B 1 55 ? 9.970   -15.972 -11.088 1.00 0.00 ? 55 LYS B O    2  
ATOM 3818  C CB   . LYS B 1 55 ? 7.583   -16.818 -9.836  1.00 0.00 ? 55 LYS B CB   2  
ATOM 3819  C CG   . LYS B 1 55 ? 6.676   -17.336 -8.731  1.00 0.00 ? 55 LYS B CG   2  
ATOM 3820  C CD   . LYS B 1 55 ? 6.685   -18.855 -8.669  1.00 0.00 ? 55 LYS B CD   2  
ATOM 3821  C CE   . LYS B 1 55 ? 5.286   -19.416 -8.465  1.00 0.00 ? 55 LYS B CE   2  
ATOM 3822  N NZ   . LYS B 1 55 ? 5.220   -20.336 -7.296  1.00 0.00 ? 55 LYS B NZ   2  
ATOM 3823  H H    . LYS B 1 55 ? 6.689   -14.598 -10.684 1.00 0.00 ? 55 LYS B H    2  
ATOM 3824  H HA   . LYS B 1 55 ? 8.226   -15.318 -8.448  1.00 0.00 ? 55 LYS B HA   2  
ATOM 3825  H HB2  . LYS B 1 55 ? 6.995   -16.721 -10.737 1.00 0.00 ? 55 LYS B HB2  2  
ATOM 3826  H HB3  . LYS B 1 55 ? 8.363   -17.546 -10.002 1.00 0.00 ? 55 LYS B HB3  2  
ATOM 3827  H HG2  . LYS B 1 55 ? 7.020   -16.946 -7.784  1.00 0.00 ? 55 LYS B HG2  2  
ATOM 3828  H HG3  . LYS B 1 55 ? 5.668   -16.997 -8.918  1.00 0.00 ? 55 LYS B HG3  2  
ATOM 3829  H HD2  . LYS B 1 55 ? 7.084   -19.242 -9.595  1.00 0.00 ? 55 LYS B HD2  2  
ATOM 3830  H HD3  . LYS B 1 55 ? 7.311   -19.169 -7.847  1.00 0.00 ? 55 LYS B HD3  2  
ATOM 3831  H HE2  . LYS B 1 55 ? 4.601   -18.596 -8.305  1.00 0.00 ? 55 LYS B HE2  2  
ATOM 3832  H HE3  . LYS B 1 55 ? 4.996   -19.956 -9.355  1.00 0.00 ? 55 LYS B HE3  2  
ATOM 3833  H HZ1  . LYS B 1 55 ? 4.874   -19.825 -6.459  1.00 0.00 ? 55 LYS B HZ1  2  
ATOM 3834  H HZ2  . LYS B 1 55 ? 6.164   -20.719 -7.089  1.00 0.00 ? 55 LYS B HZ2  2  
ATOM 3835  H HZ3  . LYS B 1 55 ? 4.575   -21.126 -7.499  1.00 0.00 ? 55 LYS B HZ3  2  
ATOM 3836  N N    . SER B 1 56 ? 10.548  -14.815 -9.246  1.00 0.00 ? 56 SER B N    2  
ATOM 3837  C CA   . SER B 1 56 ? 11.956  -14.711 -9.617  1.00 0.00 ? 56 SER B CA   2  
ATOM 3838  C C    . SER B 1 56 ? 12.124  -13.795 -10.826 1.00 0.00 ? 56 SER B C    2  
ATOM 3839  O O    . SER B 1 56 ? 11.202  -13.067 -11.195 1.00 0.00 ? 56 SER B O    2  
ATOM 3840  C CB   . SER B 1 56 ? 12.536  -16.097 -9.917  1.00 0.00 ? 56 SER B CB   2  
ATOM 3841  O OG   . SER B 1 56 ? 13.692  -16.346 -9.136  1.00 0.00 ? 56 SER B OG   2  
ATOM 3842  H H    . SER B 1 56 ? 10.243  -14.406 -8.409  1.00 0.00 ? 56 SER B H    2  
ATOM 3843  H HA   . SER B 1 56 ? 12.487  -14.282 -8.780  1.00 0.00 ? 56 SER B HA   2  
ATOM 3844  H HB2  . SER B 1 56 ? 11.796  -16.851 -9.692  1.00 0.00 ? 56 SER B HB2  2  
ATOM 3845  H HB3  . SER B 1 56 ? 12.803  -16.157 -10.962 1.00 0.00 ? 56 SER B HB3  2  
ATOM 3846  H HG   . SER B 1 56 ? 13.512  -16.127 -8.219  1.00 0.00 ? 56 SER B HG   2  
ATOM 3847  N N    . GLN B 1 57 ? 13.301  -13.834 -11.442 1.00 0.00 ? 57 GLN B N    2  
ATOM 3848  C CA   . GLN B 1 57 ? 13.577  -13.004 -12.610 1.00 0.00 ? 57 GLN B CA   2  
ATOM 3849  C C    . GLN B 1 57 ? 14.659  -13.630 -13.484 1.00 0.00 ? 57 GLN B C    2  
ATOM 3850  O O    . GLN B 1 57 ? 15.400  -12.926 -14.169 1.00 0.00 ? 57 GLN B O    2  
ATOM 3851  C CB   . GLN B 1 57 ? 14.004  -11.600 -12.174 1.00 0.00 ? 57 GLN B CB   2  
ATOM 3852  C CG   . GLN B 1 57 ? 13.399  -10.492 -13.021 1.00 0.00 ? 57 GLN B CG   2  
ATOM 3853  C CD   . GLN B 1 57 ? 14.225  -10.185 -14.255 1.00 0.00 ? 57 GLN B CD   2  
ATOM 3854  O OE1  . GLN B 1 57 ? 14.149  -10.895 -15.258 1.00 0.00 ? 57 GLN B OE1  2  
ATOM 3855  N NE2  . GLN B 1 57 ? 15.019  -9.123  -14.188 1.00 0.00 ? 57 GLN B NE2  2  
ATOM 3856  H H    . GLN B 1 57 ? 13.999  -14.434 -11.106 1.00 0.00 ? 57 GLN B H    2  
ATOM 3857  H HA   . GLN B 1 57 ? 12.666  -12.930 -13.184 1.00 0.00 ? 57 GLN B HA   2  
ATOM 3858  H HB2  . GLN B 1 57 ? 13.701  -11.446 -11.149 1.00 0.00 ? 57 GLN B HB2  2  
ATOM 3859  H HB3  . GLN B 1 57 ? 15.079  -11.527 -12.238 1.00 0.00 ? 57 GLN B HB3  2  
ATOM 3860  H HG2  . GLN B 1 57 ? 12.411  -10.793 -13.334 1.00 0.00 ? 57 GLN B HG2  2  
ATOM 3861  H HG3  . GLN B 1 57 ? 13.329  -9.596  -12.421 1.00 0.00 ? 57 GLN B HG3  2  
ATOM 3862  H HE21 . GLN B 1 57 ? 15.028  -8.604  -13.356 1.00 0.00 ? 57 GLN B HE21 2  
ATOM 3863  H HE22 . GLN B 1 57 ? 15.564  -8.902  -14.972 1.00 0.00 ? 57 GLN B HE22 2  
ATOM 3864  N N    . GLN B 1 58 ? 14.744  -14.957 -13.456 1.00 0.00 ? 58 GLN B N    2  
ATOM 3865  C CA   . GLN B 1 58 ? 15.736  -15.676 -14.248 1.00 0.00 ? 58 GLN B CA   2  
ATOM 3866  C C    . GLN B 1 58 ? 17.151  -15.305 -13.814 1.00 0.00 ? 58 GLN B C    2  
ATOM 3867  O O    . GLN B 1 58 ? 17.406  -14.178 -13.389 1.00 0.00 ? 58 GLN B O    2  
ATOM 3868  C CB   . GLN B 1 58 ? 15.549  -15.375 -15.737 1.00 0.00 ? 58 GLN B CB   2  
ATOM 3869  C CG   . GLN B 1 58 ? 14.734  -16.427 -16.472 1.00 0.00 ? 58 GLN B CG   2  
ATOM 3870  C CD   . GLN B 1 58 ? 15.549  -17.177 -17.508 1.00 0.00 ? 58 GLN B CD   2  
ATOM 3871  O OE1  . GLN B 1 58 ? 15.127  -17.332 -18.654 1.00 0.00 ? 58 GLN B OE1  2  
ATOM 3872  N NE2  . GLN B 1 58 ? 16.726  -17.647 -17.108 1.00 0.00 ? 58 GLN B NE2  2  
ATOM 3873  H H    . GLN B 1 58 ? 14.126  -15.464 -12.890 1.00 0.00 ? 58 GLN B H    2  
ATOM 3874  H HA   . GLN B 1 58 ? 15.588  -16.732 -14.082 1.00 0.00 ? 58 GLN B HA   2  
ATOM 3875  H HB2  . GLN B 1 58 ? 15.047  -14.424 -15.840 1.00 0.00 ? 58 GLN B HB2  2  
ATOM 3876  H HB3  . GLN B 1 58 ? 16.521  -15.310 -16.205 1.00 0.00 ? 58 GLN B HB3  2  
ATOM 3877  H HG2  . GLN B 1 58 ? 14.354  -17.137 -15.753 1.00 0.00 ? 58 GLN B HG2  2  
ATOM 3878  H HG3  . GLN B 1 58 ? 13.907  -15.941 -16.969 1.00 0.00 ? 58 GLN B HG3  2  
ATOM 3879  H HE21 . GLN B 1 58 ? 16.997  -17.485 -16.181 1.00 0.00 ? 58 GLN B HE21 2  
ATOM 3880  H HE22 . GLN B 1 58 ? 17.274  -18.136 -17.757 1.00 0.00 ? 58 GLN B HE22 2  
ATOM 3881  N N    . SER B 1 59 ? 18.067  -16.261 -13.924 1.00 0.00 ? 59 SER B N    2  
ATOM 3882  C CA   . SER B 1 59 ? 19.456  -16.036 -13.544 1.00 0.00 ? 59 SER B CA   2  
ATOM 3883  C C    . SER B 1 59 ? 20.373  -17.061 -14.204 1.00 0.00 ? 59 SER B C    2  
ATOM 3884  O O    . SER B 1 59 ? 20.117  -18.264 -14.148 1.00 0.00 ? 59 SER B O    2  
ATOM 3885  C CB   . SER B 1 59 ? 19.607  -16.103 -12.023 1.00 0.00 ? 59 SER B CB   2  
ATOM 3886  O OG   . SER B 1 59 ? 19.488  -14.816 -11.442 1.00 0.00 ? 59 SER B OG   2  
ATOM 3887  H H    . SER B 1 59 ? 17.802  -17.139 -14.270 1.00 0.00 ? 59 SER B H    2  
ATOM 3888  H HA   . SER B 1 59 ? 19.737  -15.050 -13.882 1.00 0.00 ? 59 SER B HA   2  
ATOM 3889  H HB2  . SER B 1 59 ? 18.838  -16.741 -11.615 1.00 0.00 ? 59 SER B HB2  2  
ATOM 3890  H HB3  . SER B 1 59 ? 20.578  -16.507 -11.777 1.00 0.00 ? 59 SER B HB3  2  
ATOM 3891  H HG   . SER B 1 59 ? 18.746  -14.353 -11.838 1.00 0.00 ? 59 SER B HG   2  
ATOM 3892  N N    . SER B 1 60 ? 21.441  -16.577 -14.828 1.00 0.00 ? 60 SER B N    2  
ATOM 3893  C CA   . SER B 1 60 ? 22.395  -17.452 -15.499 1.00 0.00 ? 60 SER B CA   2  
ATOM 3894  C C    . SER B 1 60 ? 23.529  -17.844 -14.558 1.00 0.00 ? 60 SER B C    2  
ATOM 3895  O O    . SER B 1 60 ? 24.107  -16.995 -13.878 1.00 0.00 ? 60 SER B O    2  
ATOM 3896  C CB   . SER B 1 60 ? 22.963  -16.764 -16.741 1.00 0.00 ? 60 SER B CB   2  
ATOM 3897  O OG   . SER B 1 60 ? 24.011  -17.526 -17.313 1.00 0.00 ? 60 SER B OG   2  
ATOM 3898  H H    . SER B 1 60 ? 21.591  -15.609 -14.838 1.00 0.00 ? 60 SER B H    2  
ATOM 3899  H HA   . SER B 1 60 ? 21.870  -18.345 -15.802 1.00 0.00 ? 60 SER B HA   2  
ATOM 3900  H HB2  . SER B 1 60 ? 22.179  -16.646 -17.475 1.00 0.00 ? 60 SER B HB2  2  
ATOM 3901  H HB3  . SER B 1 60 ? 23.348  -15.792 -16.468 1.00 0.00 ? 60 SER B HB3  2  
ATOM 3902  H HG   . SER B 1 60 ? 23.933  -17.512 -18.270 1.00 0.00 ? 60 SER B HG   2  
ATOM 3903  N N    . TYR B 1 61 ? 23.843  -19.135 -14.523 1.00 0.00 ? 61 TYR B N    2  
ATOM 3904  C CA   . TYR B 1 61 ? 24.908  -19.640 -13.665 1.00 0.00 ? 61 TYR B CA   2  
ATOM 3905  C C    . TYR B 1 61 ? 24.615  -19.341 -12.199 1.00 0.00 ? 61 TYR B C    2  
ATOM 3906  O O    . TYR B 1 61 ? 25.506  -19.581 -11.357 1.00 0.00 ? 61 TYR B O    2  
ATOM 3907  C CB   . TYR B 1 61 ? 26.249  -19.023 -14.066 1.00 0.00 ? 61 TYR B CB   2  
ATOM 3908  C CG   . TYR B 1 61 ? 26.772  -19.519 -15.396 1.00 0.00 ? 61 TYR B CG   2  
ATOM 3909  C CD1  . TYR B 1 61 ? 27.439  -20.733 -15.492 1.00 0.00 ? 61 TYR B CD1  2  
ATOM 3910  C CD2  . TYR B 1 61 ? 26.598  -18.772 -16.554 1.00 0.00 ? 61 TYR B CD2  2  
ATOM 3911  C CE1  . TYR B 1 61 ? 27.918  -21.190 -16.705 1.00 0.00 ? 61 TYR B CE1  2  
ATOM 3912  C CE2  . TYR B 1 61 ? 27.073  -19.222 -17.771 1.00 0.00 ? 61 TYR B CE2  2  
ATOM 3913  C CZ   . TYR B 1 61 ? 27.733  -20.431 -17.841 1.00 0.00 ? 61 TYR B CZ   2  
ATOM 3914  O OH   . TYR B 1 61 ? 28.208  -20.882 -19.051 1.00 0.00 ? 61 TYR B OH   2  
ATOM 3915  O OXT  . TYR B 1 61 ? 23.497  -18.868 -11.904 1.00 0.00 ? 61 TYR B OXT  2  
ATOM 3916  H H    . TYR B 1 61 ? 23.346  -19.762 -15.089 1.00 0.00 ? 61 TYR B H    2  
ATOM 3917  H HA   . TYR B 1 61 ? 24.961  -20.710 -13.798 1.00 0.00 ? 61 TYR B HA   2  
ATOM 3918  H HB2  . TYR B 1 61 ? 26.139  -17.951 -14.132 1.00 0.00 ? 61 TYR B HB2  2  
ATOM 3919  H HB3  . TYR B 1 61 ? 26.985  -19.258 -13.311 1.00 0.00 ? 61 TYR B HB3  2  
ATOM 3920  H HD1  . TYR B 1 61 ? 27.582  -21.326 -14.601 1.00 0.00 ? 61 TYR B HD1  2  
ATOM 3921  H HD2  . TYR B 1 61 ? 26.081  -17.825 -16.496 1.00 0.00 ? 61 TYR B HD2  2  
ATOM 3922  H HE1  . TYR B 1 61 ? 28.434  -22.137 -16.760 1.00 0.00 ? 61 TYR B HE1  2  
ATOM 3923  H HE2  . TYR B 1 61 ? 26.928  -18.627 -18.660 1.00 0.00 ? 61 TYR B HE2  2  
ATOM 3924  H HH   . TYR B 1 61 ? 27.514  -20.820 -19.712 1.00 0.00 ? 61 TYR B HH   2  
ATOM 3925  N N    . MET A 1 1  ? -2.853  -10.585 -6.881  1.00 0.00 ? 1  MET A N    3  
ATOM 3926  C CA   . MET A 1 1  ? -2.689  -10.445 -5.410  1.00 0.00 ? 1  MET A CA   3  
ATOM 3927  C C    . MET A 1 1  ? -1.233  -10.634 -4.998  1.00 0.00 ? 1  MET A C    3  
ATOM 3928  O O    . MET A 1 1  ? -0.633  -11.677 -5.261  1.00 0.00 ? 1  MET A O    3  
ATOM 3929  C CB   . MET A 1 1  ? -3.572  -11.486 -4.720  1.00 0.00 ? 1  MET A CB   3  
ATOM 3930  C CG   . MET A 1 1  ? -3.366  -12.899 -5.241  1.00 0.00 ? 1  MET A CG   3  
ATOM 3931  S SD   . MET A 1 1  ? -4.632  -14.044 -4.660  1.00 0.00 ? 1  MET A SD   3  
ATOM 3932  C CE   . MET A 1 1  ? -4.706  -15.191 -6.034  1.00 0.00 ? 1  MET A CE   3  
ATOM 3933  H H1   . MET A 1 1  ? -3.867  -10.706 -7.076  1.00 0.00 ? 1  MET A H1   3  
ATOM 3934  H H2   . MET A 1 1  ? -2.310  -11.421 -7.181  1.00 0.00 ? 1  MET A H2   3  
ATOM 3935  H H3   . MET A 1 1  ? -2.487  -9.719  -7.325  1.00 0.00 ? 1  MET A H3   3  
ATOM 3936  H HA   . MET A 1 1  ? -3.011  -9.456  -5.121  1.00 0.00 ? 1  MET A HA   3  
ATOM 3937  H HB2  . MET A 1 1  ? -3.356  -11.480 -3.662  1.00 0.00 ? 1  MET A HB2  3  
ATOM 3938  H HB3  . MET A 1 1  ? -4.608  -11.218 -4.868  1.00 0.00 ? 1  MET A HB3  3  
ATOM 3939  H HG2  . MET A 1 1  ? -3.390  -12.877 -6.320  1.00 0.00 ? 1  MET A HG2  3  
ATOM 3940  H HG3  . MET A 1 1  ? -2.401  -13.253 -4.910  1.00 0.00 ? 1  MET A HG3  3  
ATOM 3941  H HE1  . MET A 1 1  ? -4.264  -14.735 -6.907  1.00 0.00 ? 1  MET A HE1  3  
ATOM 3942  H HE2  . MET A 1 1  ? -5.736  -15.440 -6.240  1.00 0.00 ? 1  MET A HE2  3  
ATOM 3943  H HE3  . MET A 1 1  ? -4.162  -16.090 -5.782  1.00 0.00 ? 1  MET A HE3  3  
ATOM 3944  N N    . LEU A 1 2  ? -0.669  -9.619  -4.352  1.00 0.00 ? 2  LEU A N    3  
ATOM 3945  C CA   . LEU A 1 2  ? 0.718   -9.674  -3.904  1.00 0.00 ? 2  LEU A CA   3  
ATOM 3946  C C    . LEU A 1 2  ? 0.812   -9.470  -2.395  1.00 0.00 ? 2  LEU A C    3  
ATOM 3947  O O    . LEU A 1 2  ? 0.630   -8.359  -1.899  1.00 0.00 ? 2  LEU A O    3  
ATOM 3948  C CB   . LEU A 1 2  ? 1.549   -8.612  -4.625  1.00 0.00 ? 2  LEU A CB   3  
ATOM 3949  C CG   . LEU A 1 2  ? 1.809   -8.889  -6.107  1.00 0.00 ? 2  LEU A CG   3  
ATOM 3950  C CD1  . LEU A 1 2  ? 0.743   -8.228  -6.968  1.00 0.00 ? 2  LEU A CD1  3  
ATOM 3951  C CD2  . LEU A 1 2  ? 3.195   -8.403  -6.505  1.00 0.00 ? 2  LEU A CD2  3  
ATOM 3952  H H    . LEU A 1 2  ? -1.198  -8.813  -4.171  1.00 0.00 ? 2  LEU A H    3  
ATOM 3953  H HA   . LEU A 1 2  ? 1.109   -10.650 -4.149  1.00 0.00 ? 2  LEU A HA   3  
ATOM 3954  H HB2  . LEU A 1 2  ? 1.035   -7.665  -4.541  1.00 0.00 ? 2  LEU A HB2  3  
ATOM 3955  H HB3  . LEU A 1 2  ? 2.502   -8.530  -4.125  1.00 0.00 ? 2  LEU A HB3  3  
ATOM 3956  H HG   . LEU A 1 2  ? 1.764   -9.954  -6.281  1.00 0.00 ? 2  LEU A HG   3  
ATOM 3957  H HD11 . LEU A 1 2  ? -0.234  -8.559  -6.648  1.00 0.00 ? 2  LEU A HD11 3  
ATOM 3958  H HD12 . LEU A 1 2  ? 0.896   -8.502  -8.002  1.00 0.00 ? 2  LEU A HD12 3  
ATOM 3959  H HD13 . LEU A 1 2  ? 0.812   -7.155  -6.866  1.00 0.00 ? 2  LEU A HD13 3  
ATOM 3960  H HD21 . LEU A 1 2  ? 3.840   -8.408  -5.639  1.00 0.00 ? 2  LEU A HD21 3  
ATOM 3961  H HD22 . LEU A 1 2  ? 3.126   -7.399  -6.897  1.00 0.00 ? 2  LEU A HD22 3  
ATOM 3962  H HD23 . LEU A 1 2  ? 3.602   -9.058  -7.262  1.00 0.00 ? 2  LEU A HD23 3  
ATOM 3963  N N    . ILE A 1 3  ? 1.107   -10.545 -1.670  1.00 0.00 ? 3  ILE A N    3  
ATOM 3964  C CA   . ILE A 1 3  ? 1.234   -10.471 -0.219  1.00 0.00 ? 3  ILE A CA   3  
ATOM 3965  C C    . ILE A 1 3  ? 2.661   -10.771 0.219   1.00 0.00 ? 3  ILE A C    3  
ATOM 3966  O O    . ILE A 1 3  ? 3.154   -11.888 0.063   1.00 0.00 ? 3  ILE A O    3  
ATOM 3967  C CB   . ILE A 1 3  ? 0.257   -11.429 0.496   1.00 0.00 ? 3  ILE A CB   3  
ATOM 3968  C CG1  . ILE A 1 3  ? 0.372   -11.276 2.014   1.00 0.00 ? 3  ILE A CG1  3  
ATOM 3969  C CG2  . ILE A 1 3  ? 0.518   -12.870 0.086   1.00 0.00 ? 3  ILE A CG2  3  
ATOM 3970  C CD1  . ILE A 1 3  ? -0.950  -11.413 2.738   1.00 0.00 ? 3  ILE A CD1  3  
ATOM 3971  H H    . ILE A 1 3  ? 1.251   -11.403 -2.120  1.00 0.00 ? 3  ILE A H    3  
ATOM 3972  H HA   . ILE A 1 3  ? 0.995   -9.462  0.077   1.00 0.00 ? 3  ILE A HA   3  
ATOM 3973  H HB   . ILE A 1 3  ? -0.746  -11.173 0.193   1.00 0.00 ? 3  ILE A HB   3  
ATOM 3974  H HG12 . ILE A 1 3  ? 1.039   -12.035 2.395   1.00 0.00 ? 3  ILE A HG12 3  
ATOM 3975  H HG13 . ILE A 1 3  ? 0.777   -10.302 2.242   1.00 0.00 ? 3  ILE A HG13 3  
ATOM 3976  H HG21 . ILE A 1 3  ? 0.580   -12.933 -0.990  1.00 0.00 ? 3  ILE A HG21 3  
ATOM 3977  H HG22 . ILE A 1 3  ? -0.291  -13.493 0.438   1.00 0.00 ? 3  ILE A HG22 3  
ATOM 3978  H HG23 . ILE A 1 3  ? 1.446   -13.206 0.522   1.00 0.00 ? 3  ILE A HG23 3  
ATOM 3979  H HD11 . ILE A 1 3  ? -0.805  -11.237 3.796   1.00 0.00 ? 3  ILE A HD11 3  
ATOM 3980  H HD12 . ILE A 1 3  ? -1.340  -12.409 2.588   1.00 0.00 ? 3  ILE A HD12 3  
ATOM 3981  H HD13 . ILE A 1 3  ? -1.651  -10.690 2.348   1.00 0.00 ? 3  ILE A HD13 3  
ATOM 3982  N N    . LEU A 1 4  ? 3.310   -9.762  0.787   1.00 0.00 ? 4  LEU A N    3  
ATOM 3983  C CA   . LEU A 1 4  ? 4.673   -9.902  1.278   1.00 0.00 ? 4  LEU A CA   3  
ATOM 3984  C C    . LEU A 1 4  ? 4.767   -9.487  2.742   1.00 0.00 ? 4  LEU A C    3  
ATOM 3985  O O    . LEU A 1 4  ? 4.217   -8.456  3.137   1.00 0.00 ? 4  LEU A O    3  
ATOM 3986  C CB   . LEU A 1 4  ? 5.636   -9.063  0.435   1.00 0.00 ? 4  LEU A CB   3  
ATOM 3987  C CG   . LEU A 1 4  ? 6.999   -9.706  0.167   1.00 0.00 ? 4  LEU A CG   3  
ATOM 3988  C CD1  . LEU A 1 4  ? 7.571   -10.311 1.441   1.00 0.00 ? 4  LEU A CD1  3  
ATOM 3989  C CD2  . LEU A 1 4  ? 6.883   -10.762 -0.921  1.00 0.00 ? 4  LEU A CD2  3  
ATOM 3990  H H    . LEU A 1 4  ? 2.843   -8.911  0.915   1.00 0.00 ? 4  LEU A H    3  
ATOM 3991  H HA   . LEU A 1 4  ? 4.950   -10.942 1.193   1.00 0.00 ? 4  LEU A HA   3  
ATOM 3992  H HB2  . LEU A 1 4  ? 5.164   -8.860  -0.516  1.00 0.00 ? 4  LEU A HB2  3  
ATOM 3993  H HB3  . LEU A 1 4  ? 5.800   -8.125  0.943   1.00 0.00 ? 4  LEU A HB3  3  
ATOM 3994  H HG   . LEU A 1 4  ? 7.685   -8.946  -0.175  1.00 0.00 ? 4  LEU A HG   3  
ATOM 3995  H HD11 . LEU A 1 4  ? 8.640   -10.427 1.336   1.00 0.00 ? 4  LEU A HD11 3  
ATOM 3996  H HD12 . LEU A 1 4  ? 7.120   -11.276 1.616   1.00 0.00 ? 4  LEU A HD12 3  
ATOM 3997  H HD13 . LEU A 1 4  ? 7.361   -9.658  2.275   1.00 0.00 ? 4  LEU A HD13 3  
ATOM 3998  H HD21 . LEU A 1 4  ? 6.343   -11.616 -0.539  1.00 0.00 ? 4  LEU A HD21 3  
ATOM 3999  H HD22 . LEU A 1 4  ? 7.871   -11.071 -1.230  1.00 0.00 ? 4  LEU A HD22 3  
ATOM 4000  H HD23 . LEU A 1 4  ? 6.354   -10.351 -1.768  1.00 0.00 ? 4  LEU A HD23 3  
ATOM 4001  N N    . THR A 1 5  ? 5.469   -10.274 3.548   1.00 0.00 ? 5  THR A N    3  
ATOM 4002  C CA   . THR A 1 5  ? 5.627   -9.941  4.957   1.00 0.00 ? 5  THR A CA   3  
ATOM 4003  C C    . THR A 1 5  ? 6.368   -8.618  5.092   1.00 0.00 ? 5  THR A C    3  
ATOM 4004  O O    . THR A 1 5  ? 7.175   -8.262  4.233   1.00 0.00 ? 5  THR A O    3  
ATOM 4005  C CB   . THR A 1 5  ? 6.389   -11.038 5.699   1.00 0.00 ? 5  THR A CB   3  
ATOM 4006  O OG1  . THR A 1 5  ? 6.504   -12.203 4.903   1.00 0.00 ? 5  THR A OG1  3  
ATOM 4007  C CG2  . THR A 1 5  ? 5.735   -11.432 7.004   1.00 0.00 ? 5  THR A CG2  3  
ATOM 4008  H H    . THR A 1 5  ? 5.889   -11.084 3.193   1.00 0.00 ? 5  THR A H    3  
ATOM 4009  H HA   . THR A 1 5  ? 4.642   -9.837  5.388   1.00 0.00 ? 5  THR A HA   3  
ATOM 4010  H HB   . THR A 1 5  ? 7.385   -10.678 5.926   1.00 0.00 ? 5  THR A HB   3  
ATOM 4011  H HG1  . THR A 1 5  ? 7.229   -12.097 4.282   1.00 0.00 ? 5  THR A HG1  3  
ATOM 4012  H HG21 . THR A 1 5  ? 4.769   -11.870 6.805   1.00 0.00 ? 5  THR A HG21 3  
ATOM 4013  H HG22 . THR A 1 5  ? 5.612   -10.555 7.623   1.00 0.00 ? 5  THR A HG22 3  
ATOM 4014  H HG23 . THR A 1 5  ? 6.358   -12.150 7.517   1.00 0.00 ? 5  THR A HG23 3  
ATOM 4015  N N    . ARG A 1 6  ? 6.093   -7.891  6.164   1.00 0.00 ? 6  ARG A N    3  
ATOM 4016  C CA   . ARG A 1 6  ? 6.744   -6.611  6.385   1.00 0.00 ? 6  ARG A CA   3  
ATOM 4017  C C    . ARG A 1 6  ? 6.449   -6.069  7.775   1.00 0.00 ? 6  ARG A C    3  
ATOM 4018  O O    . ARG A 1 6  ? 5.376   -6.298  8.336   1.00 0.00 ? 6  ARG A O    3  
ATOM 4019  C CB   . ARG A 1 6  ? 6.294   -5.600  5.329   1.00 0.00 ? 6  ARG A CB   3  
ATOM 4020  C CG   . ARG A 1 6  ? 7.312   -4.503  5.064   1.00 0.00 ? 6  ARG A CG   3  
ATOM 4021  C CD   . ARG A 1 6  ? 8.523   -5.034  4.312   1.00 0.00 ? 6  ARG A CD   3  
ATOM 4022  N NE   . ARG A 1 6  ? 9.716   -5.074  5.155   1.00 0.00 ? 6  ARG A NE   3  
ATOM 4023  C CZ   . ARG A 1 6  ? 10.957  -5.148  4.679   1.00 0.00 ? 6  ARG A CZ   3  
ATOM 4024  N NH1  . ARG A 1 6  ? 11.171  -5.191  3.370   1.00 0.00 ? 6  ARG A NH1  3  
ATOM 4025  N NH2  . ARG A 1 6  ? 11.986  -5.179  5.514   1.00 0.00 ? 6  ARG A NH2  3  
ATOM 4026  H H    . ARG A 1 6  ? 5.440   -8.220  6.816   1.00 0.00 ? 6  ARG A H    3  
ATOM 4027  H HA   . ARG A 1 6  ? 7.808   -6.762  6.290   1.00 0.00 ? 6  ARG A HA   3  
ATOM 4028  H HB2  . ARG A 1 6  ? 6.110   -6.123  4.403   1.00 0.00 ? 6  ARG A HB2  3  
ATOM 4029  H HB3  . ARG A 1 6  ? 5.376   -5.137  5.659   1.00 0.00 ? 6  ARG A HB3  3  
ATOM 4030  H HG2  . ARG A 1 6  ? 6.846   -3.729  4.473   1.00 0.00 ? 6  ARG A HG2  3  
ATOM 4031  H HG3  . ARG A 1 6  ? 7.637   -4.092  6.008   1.00 0.00 ? 6  ARG A HG3  3  
ATOM 4032  H HD2  . ARG A 1 6  ? 8.307   -6.033  3.964   1.00 0.00 ? 6  ARG A HD2  3  
ATOM 4033  H HD3  . ARG A 1 6  ? 8.714   -4.392  3.465   1.00 0.00 ? 6  ARG A HD3  3  
ATOM 4034  H HE   . ARG A 1 6  ? 9.586   -5.044  6.125   1.00 0.00 ? 6  ARG A HE   3  
ATOM 4035  H HH11 . ARG A 1 6  ? 10.400  -5.168  2.734   1.00 0.00 ? 6  ARG A HH11 3  
ATOM 4036  H HH12 . ARG A 1 6  ? 12.106  -5.247  3.018   1.00 0.00 ? 6  ARG A HH12 3  
ATOM 4037  H HH21 . ARG A 1 6  ? 11.830  -5.146  6.501   1.00 0.00 ? 6  ARG A HH21 3  
ATOM 4038  H HH22 . ARG A 1 6  ? 12.918  -5.235  5.157   1.00 0.00 ? 6  ARG A HH22 3  
ATOM 4039  N N    . ARG A 1 7  ? 7.417   -5.347  8.319   1.00 0.00 ? 7  ARG A N    3  
ATOM 4040  C CA   . ARG A 1 7  ? 7.284   -4.751  9.644   1.00 0.00 ? 7  ARG A CA   3  
ATOM 4041  C C    . ARG A 1 7  ? 8.505   -3.900  10.010  1.00 0.00 ? 7  ARG A C    3  
ATOM 4042  O O    . ARG A 1 7  ? 8.621   -3.431  11.140  1.00 0.00 ? 7  ARG A O    3  
ATOM 4043  C CB   . ARG A 1 7  ? 7.076   -5.843  10.694  1.00 0.00 ? 7  ARG A CB   3  
ATOM 4044  C CG   . ARG A 1 7  ? 6.748   -5.303  12.077  1.00 0.00 ? 7  ARG A CG   3  
ATOM 4045  C CD   . ARG A 1 7  ? 7.702   -5.847  13.130  1.00 0.00 ? 7  ARG A CD   3  
ATOM 4046  N NE   . ARG A 1 7  ? 9.087   -5.468  12.862  1.00 0.00 ? 7  ARG A NE   3  
ATOM 4047  C CZ   . ARG A 1 7  ? 10.143  -6.132  13.329  1.00 0.00 ? 7  ARG A CZ   3  
ATOM 4048  N NH1  . ARG A 1 7  ? 9.977   -7.207  14.090  1.00 0.00 ? 7  ARG A NH1  3  
ATOM 4049  N NH2  . ARG A 1 7  ? 11.368  -5.719  13.035  1.00 0.00 ? 7  ARG A NH2  3  
ATOM 4050  H H    . ARG A 1 7  ? 8.241   -5.213  7.812   1.00 0.00 ? 7  ARG A H    3  
ATOM 4051  H HA   . ARG A 1 7  ? 6.413   -4.114  9.630   1.00 0.00 ? 7  ARG A HA   3  
ATOM 4052  H HB2  . ARG A 1 7  ? 6.261   -6.477  10.376  1.00 0.00 ? 7  ARG A HB2  3  
ATOM 4053  H HB3  . ARG A 1 7  ? 7.976   -6.436  10.764  1.00 0.00 ? 7  ARG A HB3  3  
ATOM 4054  H HG2  . ARG A 1 7  ? 6.823   -4.224  12.060  1.00 0.00 ? 7  ARG A HG2  3  
ATOM 4055  H HG3  . ARG A 1 7  ? 5.740   -5.591  12.335  1.00 0.00 ? 7  ARG A HG3  3  
ATOM 4056  H HD2  . ARG A 1 7  ? 7.413   -5.458  14.095  1.00 0.00 ? 7  ARG A HD2  3  
ATOM 4057  H HD3  . ARG A 1 7  ? 7.628   -6.924  13.139  1.00 0.00 ? 7  ARG A HD3  3  
ATOM 4058  H HE   . ARG A 1 7  ? 9.240   -4.677  12.304  1.00 0.00 ? 7  ARG A HE   3  
ATOM 4059  H HH11 . ARG A 1 7  ? 9.057   -7.524  14.317  1.00 0.00 ? 7  ARG A HH11 3  
ATOM 4060  H HH12 . ARG A 1 7  ? 10.774  -7.702  14.436  1.00 0.00 ? 7  ARG A HH12 3  
ATOM 4061  H HH21 . ARG A 1 7  ? 11.499  -4.909  12.464  1.00 0.00 ? 7  ARG A HH21 3  
ATOM 4062  H HH22 . ARG A 1 7  ? 12.161  -6.218  13.386  1.00 0.00 ? 7  ARG A HH22 3  
ATOM 4063  N N    . VAL A 1 8  ? 9.415   -3.703  9.058   1.00 0.00 ? 8  VAL A N    3  
ATOM 4064  C CA   . VAL A 1 8  ? 10.614  -2.911  9.303   1.00 0.00 ? 8  VAL A CA   3  
ATOM 4065  C C    . VAL A 1 8  ? 10.613  -1.642  8.458   1.00 0.00 ? 8  VAL A C    3  
ATOM 4066  O O    . VAL A 1 8  ? 10.617  -0.531  8.989   1.00 0.00 ? 8  VAL A O    3  
ATOM 4067  C CB   . VAL A 1 8  ? 11.892  -3.718  9.000   1.00 0.00 ? 8  VAL A CB   3  
ATOM 4068  C CG1  . VAL A 1 8  ? 13.108  -3.039  9.610   1.00 0.00 ? 8  VAL A CG1  3  
ATOM 4069  C CG2  . VAL A 1 8  ? 11.758  -5.146  9.510   1.00 0.00 ? 8  VAL A CG2  3  
ATOM 4070  H H    . VAL A 1 8  ? 9.284   -4.101  8.175   1.00 0.00 ? 8  VAL A H    3  
ATOM 4071  H HA   . VAL A 1 8  ? 10.625  -2.637  10.348  1.00 0.00 ? 8  VAL A HA   3  
ATOM 4072  H HB   . VAL A 1 8  ? 12.026  -3.752  7.929   1.00 0.00 ? 8  VAL A HB   3  
ATOM 4073  H HG11 . VAL A 1 8  ? 13.827  -3.788  9.907   1.00 0.00 ? 8  VAL A HG11 3  
ATOM 4074  H HG12 . VAL A 1 8  ? 12.806  -2.467  10.474  1.00 0.00 ? 8  VAL A HG12 3  
ATOM 4075  H HG13 . VAL A 1 8  ? 13.556  -2.380  8.881   1.00 0.00 ? 8  VAL A HG13 3  
ATOM 4076  H HG21 . VAL A 1 8  ? 11.139  -5.714  8.831   1.00 0.00 ? 8  VAL A HG21 3  
ATOM 4077  H HG22 . VAL A 1 8  ? 11.304  -5.138  10.489  1.00 0.00 ? 8  VAL A HG22 3  
ATOM 4078  H HG23 . VAL A 1 8  ? 12.736  -5.600  9.570   1.00 0.00 ? 8  VAL A HG23 3  
ATOM 4079  N N    . GLY A 1 9  ? 10.608  -1.814  7.140   1.00 0.00 ? 9  GLY A N    3  
ATOM 4080  C CA   . GLY A 1 9  ? 10.607  -0.672  6.243   1.00 0.00 ? 9  GLY A CA   3  
ATOM 4081  C C    . GLY A 1 9  ? 9.872   -0.953  4.947   1.00 0.00 ? 9  GLY A C    3  
ATOM 4082  O O    . GLY A 1 9  ? 10.481  -1.345  3.952   1.00 0.00 ? 9  GLY A O    3  
ATOM 4083  H H    . GLY A 1 9  ? 10.606  -2.722  6.773   1.00 0.00 ? 9  GLY A H    3  
ATOM 4084  H HA2  . GLY A 1 9  ? 10.133  0.161   6.740   1.00 0.00 ? 9  GLY A HA2  3  
ATOM 4085  H HA3  . GLY A 1 9  ? 11.629  -0.407  6.014   1.00 0.00 ? 9  GLY A HA3  3  
ATOM 4086  N N    . GLU A 1 10 ? 8.557   -0.754  4.959   1.00 0.00 ? 10 GLU A N    3  
ATOM 4087  C CA   . GLU A 1 10 ? 7.737   -0.989  3.776   1.00 0.00 ? 10 GLU A CA   3  
ATOM 4088  C C    . GLU A 1 10 ? 7.791   0.207   2.830   1.00 0.00 ? 10 GLU A C    3  
ATOM 4089  O O    . GLU A 1 10 ? 8.335   1.257   3.172   1.00 0.00 ? 10 GLU A O    3  
ATOM 4090  C CB   . GLU A 1 10 ? 6.289   -1.270  4.183   1.00 0.00 ? 10 GLU A CB   3  
ATOM 4091  C CG   . GLU A 1 10 ? 5.513   -2.076  3.153   1.00 0.00 ? 10 GLU A CG   3  
ATOM 4092  C CD   . GLU A 1 10 ? 4.528   -1.231  2.370   1.00 0.00 ? 10 GLU A CD   3  
ATOM 4093  O OE1  . GLU A 1 10 ? 4.069   -0.201  2.907   1.00 0.00 ? 10 GLU A OE1  3  
ATOM 4094  O OE2  . GLU A 1 10 ? 4.215   -1.599  1.218   1.00 0.00 ? 10 GLU A OE2  3  
ATOM 4095  H H    . GLU A 1 10 ? 8.129   -0.441  5.784   1.00 0.00 ? 10 GLU A H    3  
ATOM 4096  H HA   . GLU A 1 10 ? 8.132   -1.854  3.266   1.00 0.00 ? 10 GLU A HA   3  
ATOM 4097  H HB2  . GLU A 1 10 ? 6.289   -1.819  5.113   1.00 0.00 ? 10 GLU A HB2  3  
ATOM 4098  H HB3  . GLU A 1 10 ? 5.780   -0.329  4.331   1.00 0.00 ? 10 GLU A HB3  3  
ATOM 4099  H HG2  . GLU A 1 10 ? 6.213   -2.519  2.461   1.00 0.00 ? 10 GLU A HG2  3  
ATOM 4100  H HG3  . GLU A 1 10 ? 4.969   -2.857  3.663   1.00 0.00 ? 10 GLU A HG3  3  
ATOM 4101  N N    . THR A 1 11 ? 7.221   0.041   1.639   1.00 0.00 ? 11 THR A N    3  
ATOM 4102  C CA   . THR A 1 11 ? 7.204   1.110   0.645   1.00 0.00 ? 11 THR A CA   3  
ATOM 4103  C C    . THR A 1 11 ? 6.519   0.655   -0.639  1.00 0.00 ? 11 THR A C    3  
ATOM 4104  O O    . THR A 1 11 ? 6.926   -0.327  -1.260  1.00 0.00 ? 11 THR A O    3  
ATOM 4105  C CB   . THR A 1 11 ? 8.628   1.574   0.336   1.00 0.00 ? 11 THR A CB   3  
ATOM 4106  O OG1  . THR A 1 11 ? 8.636   2.481   -0.751  1.00 0.00 ? 11 THR A OG1  3  
ATOM 4107  C CG2  . THR A 1 11 ? 9.566   0.437   -0.008  1.00 0.00 ? 11 THR A CG2  3  
ATOM 4108  H H    . THR A 1 11 ? 6.801   -0.818  1.427   1.00 0.00 ? 11 THR A H    3  
ATOM 4109  H HA   . THR A 1 11 ? 6.648   1.938   1.059   1.00 0.00 ? 11 THR A HA   3  
ATOM 4110  H HB   . THR A 1 11 ? 9.027   2.080   1.203   1.00 0.00 ? 11 THR A HB   3  
ATOM 4111  H HG1  . THR A 1 11 ? 8.911   3.348   -0.444  1.00 0.00 ? 11 THR A HG1  3  
ATOM 4112  H HG21 . THR A 1 11 ? 9.458   -0.352  0.721   1.00 0.00 ? 11 THR A HG21 3  
ATOM 4113  H HG22 . THR A 1 11 ? 10.585  0.796   -0.002  1.00 0.00 ? 11 THR A HG22 3  
ATOM 4114  H HG23 . THR A 1 11 ? 9.325   0.056   -0.990  1.00 0.00 ? 11 THR A HG23 3  
ATOM 4115  N N    . LEU A 1 12 ? 5.478   1.381   -1.033  1.00 0.00 ? 12 LEU A N    3  
ATOM 4116  C CA   . LEU A 1 12 ? 4.734   1.061   -2.246  1.00 0.00 ? 12 LEU A CA   3  
ATOM 4117  C C    . LEU A 1 12 ? 4.267   2.340   -2.937  1.00 0.00 ? 12 LEU A C    3  
ATOM 4118  O O    . LEU A 1 12 ? 3.864   3.298   -2.276  1.00 0.00 ? 12 LEU A O    3  
ATOM 4119  C CB   . LEU A 1 12 ? 3.535   0.157   -1.907  1.00 0.00 ? 12 LEU A CB   3  
ATOM 4120  C CG   . LEU A 1 12 ? 2.158   0.662   -2.363  1.00 0.00 ? 12 LEU A CG   3  
ATOM 4121  C CD1  . LEU A 1 12 ? 1.931   0.345   -3.833  1.00 0.00 ? 12 LEU A CD1  3  
ATOM 4122  C CD2  . LEU A 1 12 ? 1.056   0.053   -1.512  1.00 0.00 ? 12 LEU A CD2  3  
ATOM 4123  H H    . LEU A 1 12 ? 5.205   2.153   -0.497  1.00 0.00 ? 12 LEU A H    3  
ATOM 4124  H HA   . LEU A 1 12 ? 5.398   0.530   -2.911  1.00 0.00 ? 12 LEU A HA   3  
ATOM 4125  H HB2  . LEU A 1 12 ? 3.706   -0.808  -2.361  1.00 0.00 ? 12 LEU A HB2  3  
ATOM 4126  H HB3  . LEU A 1 12 ? 3.506   0.027   -0.835  1.00 0.00 ? 12 LEU A HB3  3  
ATOM 4127  H HG   . LEU A 1 12 ? 2.116   1.734   -2.243  1.00 0.00 ? 12 LEU A HG   3  
ATOM 4128  H HD11 . LEU A 1 12 ? 1.124   0.955   -4.212  1.00 0.00 ? 12 LEU A HD11 3  
ATOM 4129  H HD12 . LEU A 1 12 ? 1.675   -0.698  -3.941  1.00 0.00 ? 12 LEU A HD12 3  
ATOM 4130  H HD13 . LEU A 1 12 ? 2.832   0.554   -4.390  1.00 0.00 ? 12 LEU A HD13 3  
ATOM 4131  H HD21 . LEU A 1 12 ? 0.198   0.710   -1.515  1.00 0.00 ? 12 LEU A HD21 3  
ATOM 4132  H HD22 . LEU A 1 12 ? 1.411   -0.072  -0.500  1.00 0.00 ? 12 LEU A HD22 3  
ATOM 4133  H HD23 . LEU A 1 12 ? 0.777   -0.907  -1.918  1.00 0.00 ? 12 LEU A HD23 3  
ATOM 4134  N N    . MET A 1 13 ? 4.315   2.352   -4.265  1.00 0.00 ? 13 MET A N    3  
ATOM 4135  C CA   . MET A 1 13 ? 3.884   3.519   -5.021  1.00 0.00 ? 13 MET A CA   3  
ATOM 4136  C C    . MET A 1 13 ? 2.968   3.119   -6.173  1.00 0.00 ? 13 MET A C    3  
ATOM 4137  O O    . MET A 1 13 ? 3.430   2.689   -7.230  1.00 0.00 ? 13 MET A O    3  
ATOM 4138  C CB   . MET A 1 13 ? 5.098   4.277   -5.560  1.00 0.00 ? 13 MET A CB   3  
ATOM 4139  C CG   . MET A 1 13 ? 4.739   5.550   -6.309  1.00 0.00 ? 13 MET A CG   3  
ATOM 4140  S SD   . MET A 1 13 ? 5.941   5.968   -7.586  1.00 0.00 ? 13 MET A SD   3  
ATOM 4141  C CE   . MET A 1 13 ? 4.963   7.043   -8.632  1.00 0.00 ? 13 MET A CE   3  
ATOM 4142  H H    . MET A 1 13 ? 4.640   1.561   -4.744  1.00 0.00 ? 13 MET A H    3  
ATOM 4143  H HA   . MET A 1 13 ? 3.338   4.164   -4.350  1.00 0.00 ? 13 MET A HA   3  
ATOM 4144  H HB2  . MET A 1 13 ? 5.739   4.542   -4.732  1.00 0.00 ? 13 MET A HB2  3  
ATOM 4145  H HB3  . MET A 1 13 ? 5.642   3.631   -6.233  1.00 0.00 ? 13 MET A HB3  3  
ATOM 4146  H HG2  . MET A 1 13 ? 3.773   5.418   -6.774  1.00 0.00 ? 13 MET A HG2  3  
ATOM 4147  H HG3  . MET A 1 13 ? 4.687   6.365   -5.602  1.00 0.00 ? 13 MET A HG3  3  
ATOM 4148  H HE1  . MET A 1 13 ? 4.969   6.664   -9.643  1.00 0.00 ? 13 MET A HE1  3  
ATOM 4149  H HE2  . MET A 1 13 ? 5.382   8.038   -8.617  1.00 0.00 ? 13 MET A HE2  3  
ATOM 4150  H HE3  . MET A 1 13 ? 3.948   7.075   -8.266  1.00 0.00 ? 13 MET A HE3  3  
ATOM 4151  N N    . ILE A 1 14 ? 1.666   3.273   -5.957  1.00 0.00 ? 14 ILE A N    3  
ATOM 4152  C CA   . ILE A 1 14 ? 0.675   2.940   -6.971  1.00 0.00 ? 14 ILE A CA   3  
ATOM 4153  C C    . ILE A 1 14 ? -0.086  4.190   -7.405  1.00 0.00 ? 14 ILE A C    3  
ATOM 4154  O O    . ILE A 1 14 ? -0.588  4.944   -6.573  1.00 0.00 ? 14 ILE A O    3  
ATOM 4155  C CB   . ILE A 1 14 ? -0.317  1.872   -6.459  1.00 0.00 ? 14 ILE A CB   3  
ATOM 4156  C CG1  . ILE A 1 14 ? -1.224  1.384   -7.597  1.00 0.00 ? 14 ILE A CG1  3  
ATOM 4157  C CG2  . ILE A 1 14 ? -1.136  2.407   -5.291  1.00 0.00 ? 14 ILE A CG2  3  
ATOM 4158  C CD1  . ILE A 1 14 ? -2.280  2.383   -8.027  1.00 0.00 ? 14 ILE A CD1  3  
ATOM 4159  H H    . ILE A 1 14 ? 1.369   3.617   -5.091  1.00 0.00 ? 14 ILE A H    3  
ATOM 4160  H HA   . ILE A 1 14 ? 1.199   2.536   -7.825  1.00 0.00 ? 14 ILE A HA   3  
ATOM 4161  H HB   . ILE A 1 14 ? 0.261   1.035   -6.095  1.00 0.00 ? 14 ILE A HB   3  
ATOM 4162  H HG12 . ILE A 1 14 ? -0.616  1.160   -8.460  1.00 0.00 ? 14 ILE A HG12 3  
ATOM 4163  H HG13 . ILE A 1 14 ? -1.730  0.483   -7.280  1.00 0.00 ? 14 ILE A HG13 3  
ATOM 4164  H HG21 . ILE A 1 14 ? -2.175  2.477   -5.579  1.00 0.00 ? 14 ILE A HG21 3  
ATOM 4165  H HG22 . ILE A 1 14 ? -0.773  3.386   -5.013  1.00 0.00 ? 14 ILE A HG22 3  
ATOM 4166  H HG23 . ILE A 1 14 ? -1.041  1.737   -4.449  1.00 0.00 ? 14 ILE A HG23 3  
ATOM 4167  H HD11 . ILE A 1 14 ? -2.424  3.116   -7.248  1.00 0.00 ? 14 ILE A HD11 3  
ATOM 4168  H HD12 . ILE A 1 14 ? -3.211  1.866   -8.211  1.00 0.00 ? 14 ILE A HD12 3  
ATOM 4169  H HD13 . ILE A 1 14 ? -1.960  2.878   -8.932  1.00 0.00 ? 14 ILE A HD13 3  
ATOM 4170  N N    . GLY A 1 15 ? -0.161  4.408   -8.713  1.00 0.00 ? 15 GLY A N    3  
ATOM 4171  C CA   . GLY A 1 15 ? -0.852  5.572   -9.236  1.00 0.00 ? 15 GLY A CA   3  
ATOM 4172  C C    . GLY A 1 15 ? 0.005   6.344   -10.219 1.00 0.00 ? 15 GLY A C    3  
ATOM 4173  O O    . GLY A 1 15 ? 0.196   5.912   -11.357 1.00 0.00 ? 15 GLY A O    3  
ATOM 4174  H H    . GLY A 1 15 ? 0.257   3.774   -9.333  1.00 0.00 ? 15 GLY A H    3  
ATOM 4175  H HA2  . GLY A 1 15 ? -1.755  5.249   -9.735  1.00 0.00 ? 15 GLY A HA2  3  
ATOM 4176  H HA3  . GLY A 1 15 ? -1.119  6.223   -8.415  1.00 0.00 ? 15 GLY A HA3  3  
ATOM 4177  N N    . ASP A 1 16 ? 0.529   7.486   -9.783  1.00 0.00 ? 16 ASP A N    3  
ATOM 4178  C CA   . ASP A 1 16 ? 1.375   8.310   -10.642 1.00 0.00 ? 16 ASP A CA   3  
ATOM 4179  C C    . ASP A 1 16 ? 2.194   9.323   -9.837  1.00 0.00 ? 16 ASP A C    3  
ATOM 4180  O O    . ASP A 1 16 ? 2.732   10.273  -10.405 1.00 0.00 ? 16 ASP A O    3  
ATOM 4181  C CB   . ASP A 1 16 ? 0.519   9.043   -11.676 1.00 0.00 ? 16 ASP A CB   3  
ATOM 4182  C CG   . ASP A 1 16 ? -0.681  9.728   -11.052 1.00 0.00 ? 16 ASP A CG   3  
ATOM 4183  O OD1  . ASP A 1 16 ? -0.501  10.803  -10.442 1.00 0.00 ? 16 ASP A OD1  3  
ATOM 4184  O OD2  . ASP A 1 16 ? -1.801  9.189   -11.173 1.00 0.00 ? 16 ASP A OD2  3  
ATOM 4185  H H    . ASP A 1 16 ? 0.343   7.778   -8.867  1.00 0.00 ? 16 ASP A H    3  
ATOM 4186  H HA   . ASP A 1 16 ? 2.056   7.651   -11.160 1.00 0.00 ? 16 ASP A HA   3  
ATOM 4187  H HB2  . ASP A 1 16 ? 1.122   9.792   -12.167 1.00 0.00 ? 16 ASP A HB2  3  
ATOM 4188  H HB3  . ASP A 1 16 ? 0.166   8.333   -12.409 1.00 0.00 ? 16 ASP A HB3  3  
ATOM 4189  N N    . GLU A 1 17 ? 2.294   9.112   -8.519  1.00 0.00 ? 17 GLU A N    3  
ATOM 4190  C CA   . GLU A 1 17 ? 3.054   10.005  -7.636  1.00 0.00 ? 17 GLU A CA   3  
ATOM 4191  C C    . GLU A 1 17 ? 2.576   9.863   -6.191  1.00 0.00 ? 17 GLU A C    3  
ATOM 4192  O O    . GLU A 1 17 ? 2.091   10.822  -5.589  1.00 0.00 ? 17 GLU A O    3  
ATOM 4193  C CB   . GLU A 1 17 ? 2.925   11.469  -8.082  1.00 0.00 ? 17 GLU A CB   3  
ATOM 4194  C CG   . GLU A 1 17 ? 4.146   11.989  -8.824  1.00 0.00 ? 17 GLU A CG   3  
ATOM 4195  C CD   . GLU A 1 17 ? 3.833   13.195  -9.687  1.00 0.00 ? 17 GLU A CD   3  
ATOM 4196  O OE1  . GLU A 1 17 ? 2.809   13.862  -9.428  1.00 0.00 ? 17 GLU A OE1  3  
ATOM 4197  O OE2  . GLU A 1 17 ? 4.612   13.474  -10.623 1.00 0.00 ? 17 GLU A OE2  3  
ATOM 4198  H H    . GLU A 1 17 ? 1.853   8.332   -8.127  1.00 0.00 ? 17 GLU A H    3  
ATOM 4199  H HA   . GLU A 1 17 ? 4.093   9.712   -7.687  1.00 0.00 ? 17 GLU A HA   3  
ATOM 4200  H HB2  . GLU A 1 17 ? 2.068   11.561  -8.732  1.00 0.00 ? 17 GLU A HB2  3  
ATOM 4201  H HB3  . GLU A 1 17 ? 2.772   12.090  -7.211  1.00 0.00 ? 17 GLU A HB3  3  
ATOM 4202  H HG2  . GLU A 1 17 ? 4.899   12.268  -8.102  1.00 0.00 ? 17 GLU A HG2  3  
ATOM 4203  H HG3  . GLU A 1 17 ? 4.529   11.201  -9.456  1.00 0.00 ? 17 GLU A HG3  3  
ATOM 4204  N N    . VAL A 1 18 ? 2.703   8.660   -5.639  1.00 0.00 ? 18 VAL A N    3  
ATOM 4205  C CA   . VAL A 1 18 ? 2.273   8.398   -4.281  1.00 0.00 ? 18 VAL A CA   3  
ATOM 4206  C C    . VAL A 1 18 ? 3.434   7.918   -3.403  1.00 0.00 ? 18 VAL A C    3  
ATOM 4207  O O    . VAL A 1 18 ? 4.601   8.134   -3.729  1.00 0.00 ? 18 VAL A O    3  
ATOM 4208  C CB   . VAL A 1 18 ? 1.145   7.353   -4.278  1.00 0.00 ? 18 VAL A CB   3  
ATOM 4209  C CG1  . VAL A 1 18 ? 0.000   7.802   -5.175  1.00 0.00 ? 18 VAL A CG1  3  
ATOM 4210  C CG2  . VAL A 1 18 ? 1.667   5.985   -4.704  1.00 0.00 ? 18 VAL A CG2  3  
ATOM 4211  H H    . VAL A 1 18 ? 3.082   7.929   -6.159  1.00 0.00 ? 18 VAL A H    3  
ATOM 4212  H HA   . VAL A 1 18 ? 1.881   9.318   -3.872  1.00 0.00 ? 18 VAL A HA   3  
ATOM 4213  H HB   . VAL A 1 18 ? 0.771   7.273   -3.279  1.00 0.00 ? 18 VAL A HB   3  
ATOM 4214  H HG11 . VAL A 1 18 ? -0.807  8.181   -4.566  1.00 0.00 ? 18 VAL A HG11 3  
ATOM 4215  H HG12 . VAL A 1 18 ? -0.352  6.965   -5.758  1.00 0.00 ? 18 VAL A HG12 3  
ATOM 4216  H HG13 . VAL A 1 18 ? 0.346   8.581   -5.838  1.00 0.00 ? 18 VAL A HG13 3  
ATOM 4217  H HG21 . VAL A 1 18 ? 2.744   6.014   -4.772  1.00 0.00 ? 18 VAL A HG21 3  
ATOM 4218  H HG22 . VAL A 1 18 ? 1.254   5.725   -5.666  1.00 0.00 ? 18 VAL A HG22 3  
ATOM 4219  H HG23 . VAL A 1 18 ? 1.372   5.244   -3.973  1.00 0.00 ? 18 VAL A HG23 3  
ATOM 4220  N N    . THR A 1 19 ? 3.099   7.263   -2.291  1.00 0.00 ? 19 THR A N    3  
ATOM 4221  C CA   . THR A 1 19 ? 4.089   6.740   -1.352  1.00 0.00 ? 19 THR A CA   3  
ATOM 4222  C C    . THR A 1 19 ? 3.392   6.306   -0.068  1.00 0.00 ? 19 THR A C    3  
ATOM 4223  O O    . THR A 1 19 ? 3.004   7.141   0.744   1.00 0.00 ? 19 THR A O    3  
ATOM 4224  C CB   . THR A 1 19 ? 5.159   7.791   -1.035  1.00 0.00 ? 19 THR A CB   3  
ATOM 4225  O OG1  . THR A 1 19 ? 4.686   9.096   -1.319  1.00 0.00 ? 19 THR A OG1  3  
ATOM 4226  C CG2  . THR A 1 19 ? 6.444   7.589   -1.809  1.00 0.00 ? 19 THR A CG2  3  
ATOM 4227  H H    . THR A 1 19 ? 2.151   7.120   -2.095  1.00 0.00 ? 19 THR A H    3  
ATOM 4228  H HA   . THR A 1 19 ? 4.558   5.878   -1.806  1.00 0.00 ? 19 THR A HA   3  
ATOM 4229  H HB   . THR A 1 19 ? 5.398   7.740   0.018   1.00 0.00 ? 19 THR A HB   3  
ATOM 4230  H HG1  . THR A 1 19 ? 5.239   9.741   -0.872  1.00 0.00 ? 19 THR A HG1  3  
ATOM 4231  H HG21 . THR A 1 19 ? 6.526   8.346   -2.575  1.00 0.00 ? 19 THR A HG21 3  
ATOM 4232  H HG22 . THR A 1 19 ? 6.438   6.612   -2.268  1.00 0.00 ? 19 THR A HG22 3  
ATOM 4233  H HG23 . THR A 1 19 ? 7.286   7.666   -1.136  1.00 0.00 ? 19 THR A HG23 3  
ATOM 4234  N N    . VAL A 1 20 ? 3.218   5.002   0.109   1.00 0.00 ? 20 VAL A N    3  
ATOM 4235  C CA   . VAL A 1 20 ? 2.544   4.488   1.296   1.00 0.00 ? 20 VAL A CA   3  
ATOM 4236  C C    . VAL A 1 20 ? 3.421   3.512   2.075   1.00 0.00 ? 20 VAL A C    3  
ATOM 4237  O O    . VAL A 1 20 ? 3.742   2.426   1.591   1.00 0.00 ? 20 VAL A O    3  
ATOM 4238  C CB   . VAL A 1 20 ? 1.224   3.784   0.926   1.00 0.00 ? 20 VAL A CB   3  
ATOM 4239  C CG1  . VAL A 1 20 ? 0.263   4.763   0.269   1.00 0.00 ? 20 VAL A CG1  3  
ATOM 4240  C CG2  . VAL A 1 20 ? 1.488   2.594   0.016   1.00 0.00 ? 20 VAL A CG2  3  
ATOM 4241  H H    . VAL A 1 20 ? 3.541   4.375   -0.571  1.00 0.00 ? 20 VAL A H    3  
ATOM 4242  H HA   . VAL A 1 20 ? 2.306   5.331   1.931   1.00 0.00 ? 20 VAL A HA   3  
ATOM 4243  H HB   . VAL A 1 20 ? 0.767   3.421   1.834   1.00 0.00 ? 20 VAL A HB   3  
ATOM 4244  H HG11 . VAL A 1 20 ? -0.744  4.377   0.334   1.00 0.00 ? 20 VAL A HG11 3  
ATOM 4245  H HG12 . VAL A 1 20 ? 0.533   4.891   -0.769  1.00 0.00 ? 20 VAL A HG12 3  
ATOM 4246  H HG13 . VAL A 1 20 ? 0.317   5.715   0.775   1.00 0.00 ? 20 VAL A HG13 3  
ATOM 4247  H HG21 . VAL A 1 20 ? 2.372   2.781   -0.575  1.00 0.00 ? 20 VAL A HG21 3  
ATOM 4248  H HG22 . VAL A 1 20 ? 0.642   2.447   -0.639  1.00 0.00 ? 20 VAL A HG22 3  
ATOM 4249  H HG23 . VAL A 1 20 ? 1.637   1.708   0.615   1.00 0.00 ? 20 VAL A HG23 3  
ATOM 4250  N N    . THR A 1 21 ? 3.795   3.906   3.288   1.00 0.00 ? 21 THR A N    3  
ATOM 4251  C CA   . THR A 1 21 ? 4.621   3.068   4.149   1.00 0.00 ? 21 THR A CA   3  
ATOM 4252  C C    . THR A 1 21 ? 3.792   2.518   5.305   1.00 0.00 ? 21 THR A C    3  
ATOM 4253  O O    . THR A 1 21 ? 3.277   3.278   6.126   1.00 0.00 ? 21 THR A O    3  
ATOM 4254  C CB   . THR A 1 21 ? 5.808   3.867   4.689   1.00 0.00 ? 21 THR A CB   3  
ATOM 4255  O OG1  . THR A 1 21 ? 5.413   5.185   5.027   1.00 0.00 ? 21 THR A OG1  3  
ATOM 4256  C CG2  . THR A 1 21 ? 6.957   3.969   3.710   1.00 0.00 ? 21 THR A CG2  3  
ATOM 4257  H H    . THR A 1 21 ? 3.501   4.782   3.616   1.00 0.00 ? 21 THR A H    3  
ATOM 4258  H HA   . THR A 1 21 ? 4.989   2.243   3.558   1.00 0.00 ? 21 THR A HA   3  
ATOM 4259  H HB   . THR A 1 21 ? 6.177   3.384   5.583   1.00 0.00 ? 21 THR A HB   3  
ATOM 4260  H HG1  . THR A 1 21 ? 6.169   5.668   5.368   1.00 0.00 ? 21 THR A HG1  3  
ATOM 4261  H HG21 . THR A 1 21 ? 7.886   4.067   4.253   1.00 0.00 ? 21 THR A HG21 3  
ATOM 4262  H HG22 . THR A 1 21 ? 6.816   4.835   3.079   1.00 0.00 ? 21 THR A HG22 3  
ATOM 4263  H HG23 . THR A 1 21 ? 6.990   3.080   3.099   1.00 0.00 ? 21 THR A HG23 3  
ATOM 4264  N N    . VAL A 1 22 ? 3.653   1.197   5.360   1.00 0.00 ? 22 VAL A N    3  
ATOM 4265  C CA   . VAL A 1 22 ? 2.871   0.557   6.412   1.00 0.00 ? 22 VAL A CA   3  
ATOM 4266  C C    . VAL A 1 22 ? 3.762   -0.186  7.405   1.00 0.00 ? 22 VAL A C    3  
ATOM 4267  O O    . VAL A 1 22 ? 3.568   -1.375  7.660   1.00 0.00 ? 22 VAL A O    3  
ATOM 4268  C CB   . VAL A 1 22 ? 1.842   -0.427  5.821   1.00 0.00 ? 22 VAL A CB   3  
ATOM 4269  C CG1  . VAL A 1 22 ? 0.833   0.312   4.955   1.00 0.00 ? 22 VAL A CG1  3  
ATOM 4270  C CG2  . VAL A 1 22 ? 2.541   -1.519  5.024   1.00 0.00 ? 22 VAL A CG2  3  
ATOM 4271  H H    . VAL A 1 22 ? 4.079   0.642   4.674   1.00 0.00 ? 22 VAL A H    3  
ATOM 4272  H HA   . VAL A 1 22 ? 2.332   1.330   6.940   1.00 0.00 ? 22 VAL A HA   3  
ATOM 4273  H HB   . VAL A 1 22 ? 1.309   -0.892  6.637   1.00 0.00 ? 22 VAL A HB   3  
ATOM 4274  H HG11 . VAL A 1 22 ? 1.088   0.181   3.914   1.00 0.00 ? 22 VAL A HG11 3  
ATOM 4275  H HG12 . VAL A 1 22 ? 0.849   1.364   5.201   1.00 0.00 ? 22 VAL A HG12 3  
ATOM 4276  H HG13 . VAL A 1 22 ? -0.155  -0.085  5.136   1.00 0.00 ? 22 VAL A HG13 3  
ATOM 4277  H HG21 . VAL A 1 22 ? 2.093   -2.475  5.254   1.00 0.00 ? 22 VAL A HG21 3  
ATOM 4278  H HG22 . VAL A 1 22 ? 3.589   -1.541  5.283   1.00 0.00 ? 22 VAL A HG22 3  
ATOM 4279  H HG23 . VAL A 1 22 ? 2.435   -1.318  3.968   1.00 0.00 ? 22 VAL A HG23 3  
ATOM 4280  N N    . LEU A 1 23 ? 4.738   0.522   7.967   1.00 0.00 ? 23 LEU A N    3  
ATOM 4281  C CA   . LEU A 1 23 ? 5.656   -0.073  8.937   1.00 0.00 ? 23 LEU A CA   3  
ATOM 4282  C C    . LEU A 1 23 ? 4.889   -0.857  10.003  1.00 0.00 ? 23 LEU A C    3  
ATOM 4283  O O    . LEU A 1 23 ? 3.738   -0.543  10.307  1.00 0.00 ? 23 LEU A O    3  
ATOM 4284  C CB   . LEU A 1 23 ? 6.521   1.014   9.586   1.00 0.00 ? 23 LEU A CB   3  
ATOM 4285  C CG   . LEU A 1 23 ? 5.821   1.870   10.645  1.00 0.00 ? 23 LEU A CG   3  
ATOM 4286  C CD1  . LEU A 1 23 ? 5.947   1.222   12.015  1.00 0.00 ? 23 LEU A CD1  3  
ATOM 4287  C CD2  . LEU A 1 23 ? 6.406   3.274   10.664  1.00 0.00 ? 23 LEU A CD2  3  
ATOM 4288  H H    . LEU A 1 23 ? 4.844   1.465   7.722   1.00 0.00 ? 23 LEU A H    3  
ATOM 4289  H HA   . LEU A 1 23 ? 6.299   -0.757  8.402   1.00 0.00 ? 23 LEU A HA   3  
ATOM 4290  H HB2  . LEU A 1 23 ? 7.372   0.535   10.048  1.00 0.00 ? 23 LEU A HB2  3  
ATOM 4291  H HB3  . LEU A 1 23 ? 6.880   1.670   8.807   1.00 0.00 ? 23 LEU A HB3  3  
ATOM 4292  H HG   . LEU A 1 23 ? 4.769   1.948   10.405  1.00 0.00 ? 23 LEU A HG   3  
ATOM 4293  H HD11 . LEU A 1 23 ? 5.734   1.953   12.780  1.00 0.00 ? 23 LEU A HD11 3  
ATOM 4294  H HD12 . LEU A 1 23 ? 6.953   0.846   12.144  1.00 0.00 ? 23 LEU A HD12 3  
ATOM 4295  H HD13 . LEU A 1 23 ? 5.246   0.403   12.093  1.00 0.00 ? 23 LEU A HD13 3  
ATOM 4296  H HD21 . LEU A 1 23 ? 6.003   3.821   11.503  1.00 0.00 ? 23 LEU A HD21 3  
ATOM 4297  H HD22 . LEU A 1 23 ? 6.151   3.783   9.746   1.00 0.00 ? 23 LEU A HD22 3  
ATOM 4298  H HD23 . LEU A 1 23 ? 7.481   3.215   10.755  1.00 0.00 ? 23 LEU A HD23 3  
ATOM 4299  N N    . GLY A 1 24 ? 5.526   -1.886  10.558  1.00 0.00 ? 24 GLY A N    3  
ATOM 4300  C CA   . GLY A 1 24 ? 4.874   -2.702  11.569  1.00 0.00 ? 24 GLY A CA   3  
ATOM 4301  C C    . GLY A 1 24 ? 5.417   -2.482  12.972  1.00 0.00 ? 24 GLY A C    3  
ATOM 4302  O O    . GLY A 1 24 ? 4.987   -3.144  13.916  1.00 0.00 ? 24 GLY A O    3  
ATOM 4303  H H    . GLY A 1 24 ? 6.439   -2.099  10.271  1.00 0.00 ? 24 GLY A H    3  
ATOM 4304  H HA2  . GLY A 1 24 ? 3.819   -2.474  11.569  1.00 0.00 ? 24 GLY A HA2  3  
ATOM 4305  H HA3  . GLY A 1 24 ? 5.001   -3.742  11.308  1.00 0.00 ? 24 GLY A HA3  3  
ATOM 4306  N N    . VAL A 1 25 ? 6.360   -1.557  13.114  1.00 0.00 ? 25 VAL A N    3  
ATOM 4307  C CA   . VAL A 1 25 ? 6.950   -1.266  14.413  1.00 0.00 ? 25 VAL A CA   3  
ATOM 4308  C C    . VAL A 1 25 ? 6.099   -0.259  15.175  1.00 0.00 ? 25 VAL A C    3  
ATOM 4309  O O    . VAL A 1 25 ? 5.875   0.856   14.706  1.00 0.00 ? 25 VAL A O    3  
ATOM 4310  C CB   . VAL A 1 25 ? 8.383   -0.705  14.285  1.00 0.00 ? 25 VAL A CB   3  
ATOM 4311  C CG1  . VAL A 1 25 ? 9.204   -1.051  15.517  1.00 0.00 ? 25 VAL A CG1  3  
ATOM 4312  C CG2  . VAL A 1 25 ? 9.061   -1.221  13.024  1.00 0.00 ? 25 VAL A CG2  3  
ATOM 4313  H H    . VAL A 1 25 ? 6.668   -1.065  12.334  1.00 0.00 ? 25 VAL A H    3  
ATOM 4314  H HA   . VAL A 1 25 ? 6.992   -2.186  14.969  1.00 0.00 ? 25 VAL A HA   3  
ATOM 4315  H HB   . VAL A 1 25 ? 8.319   0.372   14.217  1.00 0.00 ? 25 VAL A HB   3  
ATOM 4316  H HG11 . VAL A 1 25 ? 9.801   -1.928  15.316  1.00 0.00 ? 25 VAL A HG11 3  
ATOM 4317  H HG12 . VAL A 1 25 ? 8.542   -1.249  16.347  1.00 0.00 ? 25 VAL A HG12 3  
ATOM 4318  H HG13 . VAL A 1 25 ? 9.852   -0.223  15.762  1.00 0.00 ? 25 VAL A HG13 3  
ATOM 4319  H HG21 . VAL A 1 25 ? 8.967   -2.296  12.980  1.00 0.00 ? 25 VAL A HG21 3  
ATOM 4320  H HG22 . VAL A 1 25 ? 10.107  -0.951  13.041  1.00 0.00 ? 25 VAL A HG22 3  
ATOM 4321  H HG23 . VAL A 1 25 ? 8.590   -0.782  12.157  1.00 0.00 ? 25 VAL A HG23 3  
ATOM 4322  N N    . LYS A 1 26 ? 5.620   -0.653  16.353  1.00 0.00 ? 26 LYS A N    3  
ATOM 4323  C CA   . LYS A 1 26 ? 4.788   0.221   17.172  1.00 0.00 ? 26 LYS A CA   3  
ATOM 4324  C C    . LYS A 1 26 ? 4.272   -0.523  18.402  1.00 0.00 ? 26 LYS A C    3  
ATOM 4325  O O    . LYS A 1 26 ? 4.340   -1.751  18.470  1.00 0.00 ? 26 LYS A O    3  
ATOM 4326  C CB   . LYS A 1 26 ? 3.610   0.760   16.355  1.00 0.00 ? 26 LYS A CB   3  
ATOM 4327  C CG   . LYS A 1 26 ? 3.423   2.264   16.475  1.00 0.00 ? 26 LYS A CG   3  
ATOM 4328  C CD   . LYS A 1 26 ? 2.265   2.613   17.396  1.00 0.00 ? 26 LYS A CD   3  
ATOM 4329  C CE   . LYS A 1 26 ? 2.448   3.984   18.026  1.00 0.00 ? 26 LYS A CE   3  
ATOM 4330  N NZ   . LYS A 1 26 ? 1.903   4.036   19.411  1.00 0.00 ? 26 LYS A NZ   3  
ATOM 4331  H H    . LYS A 1 26 ? 5.828   -1.551  16.687  1.00 0.00 ? 26 LYS A H    3  
ATOM 4332  H HA   . LYS A 1 26 ? 5.399   1.050   17.497  1.00 0.00 ? 26 LYS A HA   3  
ATOM 4333  H HB2  . LYS A 1 26 ? 3.768   0.521   15.314  1.00 0.00 ? 26 LYS A HB2  3  
ATOM 4334  H HB3  . LYS A 1 26 ? 2.706   0.278   16.691  1.00 0.00 ? 26 LYS A HB3  3  
ATOM 4335  H HG2  . LYS A 1 26 ? 4.328   2.699   16.872  1.00 0.00 ? 26 LYS A HG2  3  
ATOM 4336  H HG3  . LYS A 1 26 ? 3.226   2.671   15.494  1.00 0.00 ? 26 LYS A HG3  3  
ATOM 4337  H HD2  . LYS A 1 26 ? 1.349   2.610   16.824  1.00 0.00 ? 26 LYS A HD2  3  
ATOM 4338  H HD3  . LYS A 1 26 ? 2.204   1.871   18.179  1.00 0.00 ? 26 LYS A HD3  3  
ATOM 4339  H HE2  . LYS A 1 26 ? 3.502   4.215   18.055  1.00 0.00 ? 26 LYS A HE2  3  
ATOM 4340  H HE3  . LYS A 1 26 ? 1.935   4.716   17.419  1.00 0.00 ? 26 LYS A HE3  3  
ATOM 4341  H HZ1  . LYS A 1 26 ? 2.505   4.638   20.009  1.00 0.00 ? 26 LYS A HZ1  3  
ATOM 4342  H HZ2  . LYS A 1 26 ? 1.873   3.081   19.820  1.00 0.00 ? 26 LYS A HZ2  3  
ATOM 4343  H HZ3  . LYS A 1 26 ? 0.939   4.427   19.402  1.00 0.00 ? 26 LYS A HZ3  3  
ATOM 4344  N N    . GLY A 1 27 ? 3.761   0.228   19.372  1.00 0.00 ? 27 GLY A N    3  
ATOM 4345  C CA   . GLY A 1 27 ? 3.245   -0.378  20.587  1.00 0.00 ? 27 GLY A CA   3  
ATOM 4346  C C    . GLY A 1 27 ? 1.804   -0.840  20.450  1.00 0.00 ? 27 GLY A C    3  
ATOM 4347  O O    . GLY A 1 27 ? 0.887   -0.021  20.397  1.00 0.00 ? 27 GLY A O    3  
ATOM 4348  H H    . GLY A 1 27 ? 3.736   1.201   19.259  1.00 0.00 ? 27 GLY A H    3  
ATOM 4349  H HA2  . GLY A 1 27 ? 3.860   -1.229  20.840  1.00 0.00 ? 27 GLY A HA2  3  
ATOM 4350  H HA3  . GLY A 1 27 ? 3.304   0.344   21.388  1.00 0.00 ? 27 GLY A HA3  3  
ATOM 4351  N N    . ASN A 1 28 ? 1.608   -2.156  20.397  1.00 0.00 ? 28 ASN A N    3  
ATOM 4352  C CA   . ASN A 1 28 ? 0.271   -2.734  20.269  1.00 0.00 ? 28 ASN A CA   3  
ATOM 4353  C C    . ASN A 1 28 ? -0.351  -2.383  18.920  1.00 0.00 ? 28 ASN A C    3  
ATOM 4354  O O    . ASN A 1 28 ? -0.431  -3.223  18.024  1.00 0.00 ? 28 ASN A O    3  
ATOM 4355  C CB   . ASN A 1 28 ? -0.633  -2.247  21.406  1.00 0.00 ? 28 ASN A CB   3  
ATOM 4356  C CG   . ASN A 1 28 ? -0.944  -3.343  22.406  1.00 0.00 ? 28 ASN A CG   3  
ATOM 4357  O OD1  . ASN A 1 28 ? -0.056  -4.080  22.833  1.00 0.00 ? 28 ASN A OD1  3  
ATOM 4358  N ND2  . ASN A 1 28 ? -2.212  -3.455  22.785  1.00 0.00 ? 28 ASN A ND2  3  
ATOM 4359  H H    . ASN A 1 28 ? 2.382   -2.755  20.446  1.00 0.00 ? 28 ASN A H    3  
ATOM 4360  H HA   . ASN A 1 28 ? 0.368   -3.807  20.335  1.00 0.00 ? 28 ASN A HA   3  
ATOM 4361  H HB2  . ASN A 1 28 ? -0.141  -1.439  21.927  1.00 0.00 ? 28 ASN A HB2  3  
ATOM 4362  H HB3  . ASN A 1 28 ? -1.564  -1.888  20.991  1.00 0.00 ? 28 ASN A HB3  3  
ATOM 4363  H HD21 . ASN A 1 28 ? -2.866  -2.834  22.403  1.00 0.00 ? 28 ASN A HD21 3  
ATOM 4364  H HD22 . ASN A 1 28 ? -2.442  -4.156  23.431  1.00 0.00 ? 28 ASN A HD22 3  
ATOM 4365  N N    . GLN A 1 29 ? -0.780  -1.134  18.782  1.00 0.00 ? 29 GLN A N    3  
ATOM 4366  C CA   . GLN A 1 29 ? -1.384  -0.667  17.541  1.00 0.00 ? 29 GLN A CA   3  
ATOM 4367  C C    . GLN A 1 29 ? -0.299  -0.231  16.565  1.00 0.00 ? 29 GLN A C    3  
ATOM 4368  O O    . GLN A 1 29 ? 0.657   0.436   16.954  1.00 0.00 ? 29 GLN A O    3  
ATOM 4369  C CB   . GLN A 1 29 ? -2.342  0.492   17.819  1.00 0.00 ? 29 GLN A CB   3  
ATOM 4370  C CG   . GLN A 1 29 ? -3.317  0.217   18.952  1.00 0.00 ? 29 GLN A CG   3  
ATOM 4371  C CD   . GLN A 1 29 ? -3.737  1.480   19.678  1.00 0.00 ? 29 GLN A CD   3  
ATOM 4372  O OE1  . GLN A 1 29 ? -2.903  2.318   20.022  1.00 0.00 ? 29 GLN A OE1  3  
ATOM 4373  N NE2  . GLN A 1 29 ? -5.036  1.623   19.915  1.00 0.00 ? 29 GLN A NE2  3  
ATOM 4374  H H    . GLN A 1 29 ? -0.679  -0.512  19.532  1.00 0.00 ? 29 GLN A H    3  
ATOM 4375  H HA   . GLN A 1 29 ? -1.936  -1.488  17.108  1.00 0.00 ? 29 GLN A HA   3  
ATOM 4376  H HB2  . GLN A 1 29 ? -1.764  1.367   18.075  1.00 0.00 ? 29 GLN A HB2  3  
ATOM 4377  H HB3  . GLN A 1 29 ? -2.912  0.695   16.924  1.00 0.00 ? 29 GLN A HB3  3  
ATOM 4378  H HG2  . GLN A 1 29 ? -4.199  -0.255  18.544  1.00 0.00 ? 29 GLN A HG2  3  
ATOM 4379  H HG3  . GLN A 1 29 ? -2.848  -0.450  19.660  1.00 0.00 ? 29 GLN A HG3  3  
ATOM 4380  H HE21 . GLN A 1 29 ? -5.642  0.915   19.612  1.00 0.00 ? 29 GLN A HE21 3  
ATOM 4381  H HE22 . GLN A 1 29 ? -5.335  2.430   20.383  1.00 0.00 ? 29 GLN A HE22 3  
ATOM 4382  N N    . VAL A 1 30 ? -0.441  -0.619  15.302  1.00 0.00 ? 30 VAL A N    3  
ATOM 4383  C CA   . VAL A 1 30 ? 0.550   -0.274  14.290  1.00 0.00 ? 30 VAL A CA   3  
ATOM 4384  C C    . VAL A 1 30 ? 0.179   1.009   13.559  1.00 0.00 ? 30 VAL A C    3  
ATOM 4385  O O    . VAL A 1 30 ? -0.846  1.079   12.884  1.00 0.00 ? 30 VAL A O    3  
ATOM 4386  C CB   . VAL A 1 30 ? 0.713   -1.406  13.258  1.00 0.00 ? 30 VAL A CB   3  
ATOM 4387  C CG1  . VAL A 1 30 ? 1.875   -1.114  12.322  1.00 0.00 ? 30 VAL A CG1  3  
ATOM 4388  C CG2  . VAL A 1 30 ? 0.905   -2.742  13.959  1.00 0.00 ? 30 VAL A CG2  3  
ATOM 4389  H H    . VAL A 1 30 ? -1.221  -1.159  15.049  1.00 0.00 ? 30 VAL A H    3  
ATOM 4390  H HA   . VAL A 1 30 ? 1.498   -0.132  14.787  1.00 0.00 ? 30 VAL A HA   3  
ATOM 4391  H HB   . VAL A 1 30 ? -0.190  -1.461  12.668  1.00 0.00 ? 30 VAL A HB   3  
ATOM 4392  H HG11 . VAL A 1 30 ? 2.802   -1.152  12.875  1.00 0.00 ? 30 VAL A HG11 3  
ATOM 4393  H HG12 . VAL A 1 30 ? 1.753   -0.131  11.892  1.00 0.00 ? 30 VAL A HG12 3  
ATOM 4394  H HG13 . VAL A 1 30 ? 1.896   -1.852  11.533  1.00 0.00 ? 30 VAL A HG13 3  
ATOM 4395  H HG21 . VAL A 1 30 ? 1.328   -2.578  14.939  1.00 0.00 ? 30 VAL A HG21 3  
ATOM 4396  H HG22 . VAL A 1 30 ? 1.573   -3.361  13.378  1.00 0.00 ? 30 VAL A HG22 3  
ATOM 4397  H HG23 . VAL A 1 30 ? -0.049  -3.238  14.058  1.00 0.00 ? 30 VAL A HG23 3  
ATOM 4398  N N    . ARG A 1 31 ? 1.027   2.022   13.696  1.00 0.00 ? 31 ARG A N    3  
ATOM 4399  C CA   . ARG A 1 31 ? 0.801   3.300   13.054  1.00 0.00 ? 31 ARG A CA   3  
ATOM 4400  C C    . ARG A 1 31 ? 1.116   3.213   11.565  1.00 0.00 ? 31 ARG A C    3  
ATOM 4401  O O    . ARG A 1 31 ? 2.278   3.253   11.163  1.00 0.00 ? 31 ARG A O    3  
ATOM 4402  C CB   . ARG A 1 31 ? 1.662   4.382   13.709  1.00 0.00 ? 31 ARG A CB   3  
ATOM 4403  C CG   . ARG A 1 31 ? 0.969   5.730   13.819  1.00 0.00 ? 31 ARG A CG   3  
ATOM 4404  C CD   . ARG A 1 31 ? 1.177   6.356   15.189  1.00 0.00 ? 31 ARG A CD   3  
ATOM 4405  N NE   . ARG A 1 31 ? 0.910   7.792   15.181  1.00 0.00 ? 31 ARG A NE   3  
ATOM 4406  C CZ   . ARG A 1 31 ? -0.311  8.319   15.235  1.00 0.00 ? 31 ARG A CZ   3  
ATOM 4407  N NH1  . ARG A 1 31 ? -1.379  7.534   15.301  1.00 0.00 ? 31 ARG A NH1  3  
ATOM 4408  N NH2  . ARG A 1 31 ? -0.465  9.636   15.224  1.00 0.00 ? 31 ARG A NH2  3  
ATOM 4409  H H    . ARG A 1 31 ? 1.823   1.907   14.242  1.00 0.00 ? 31 ARG A H    3  
ATOM 4410  H HA   . ARG A 1 31 ? -0.233  3.548   13.183  1.00 0.00 ? 31 ARG A HA   3  
ATOM 4411  H HB2  . ARG A 1 31 ? 1.931   4.056   14.704  1.00 0.00 ? 31 ARG A HB2  3  
ATOM 4412  H HB3  . ARG A 1 31 ? 2.563   4.511   13.127  1.00 0.00 ? 31 ARG A HB3  3  
ATOM 4413  H HG2  . ARG A 1 31 ? 1.373   6.392   13.069  1.00 0.00 ? 31 ARG A HG2  3  
ATOM 4414  H HG3  . ARG A 1 31 ? -0.089  5.595   13.651  1.00 0.00 ? 31 ARG A HG3  3  
ATOM 4415  H HD2  . ARG A 1 31 ? 0.511   5.879   15.893  1.00 0.00 ? 31 ARG A HD2  3  
ATOM 4416  H HD3  . ARG A 1 31 ? 2.200   6.191   15.494  1.00 0.00 ? 31 ARG A HD3  3  
ATOM 4417  H HE   . ARG A 1 31 ? 1.680   8.395   15.133  1.00 0.00 ? 31 ARG A HE   3  
ATOM 4418  H HH11 . ARG A 1 31 ? -1.271  6.540   15.310  1.00 0.00 ? 31 ARG A HH11 3  
ATOM 4419  H HH12 . ARG A 1 31 ? -2.294  7.937   15.342  1.00 0.00 ? 31 ARG A HH12 3  
ATOM 4420  H HH21 . ARG A 1 31 ? 0.337   10.233  15.174  1.00 0.00 ? 31 ARG A HH21 3  
ATOM 4421  H HH22 . ARG A 1 31 ? -1.382  10.033  15.264  1.00 0.00 ? 31 ARG A HH22 3  
ATOM 4422  N N    . ILE A 1 32 ? 0.075   3.070   10.752  1.00 0.00 ? 32 ILE A N    3  
ATOM 4423  C CA   . ILE A 1 32 ? 0.248   2.951   9.310   1.00 0.00 ? 32 ILE A CA   3  
ATOM 4424  C C    . ILE A 1 32 ? 0.291   4.322   8.646   1.00 0.00 ? 32 ILE A C    3  
ATOM 4425  O O    . ILE A 1 32 ? -0.626  5.128   8.802   1.00 0.00 ? 32 ILE A O    3  
ATOM 4426  C CB   . ILE A 1 32 ? -0.887  2.114   8.685   1.00 0.00 ? 32 ILE A CB   3  
ATOM 4427  C CG1  . ILE A 1 32 ? -1.173  0.880   9.548   1.00 0.00 ? 32 ILE A CG1  3  
ATOM 4428  C CG2  . ILE A 1 32 ? -0.525  1.706   7.264   1.00 0.00 ? 32 ILE A CG2  3  
ATOM 4429  C CD1  . ILE A 1 32 ? -0.037  -0.119  9.571   1.00 0.00 ? 32 ILE A CD1  3  
ATOM 4430  H H    . ILE A 1 32 ? -0.829  3.018   11.134  1.00 0.00 ? 32 ILE A H    3  
ATOM 4431  H HA   . ILE A 1 32 ? 1.184   2.443   9.127   1.00 0.00 ? 32 ILE A HA   3  
ATOM 4432  H HB   . ILE A 1 32 ? -1.774  2.728   8.641   1.00 0.00 ? 32 ILE A HB   3  
ATOM 4433  H HG12 . ILE A 1 32 ? -1.355  1.195   10.566  1.00 0.00 ? 32 ILE A HG12 3  
ATOM 4434  H HG13 . ILE A 1 32 ? -2.051  0.377   9.171   1.00 0.00 ? 32 ILE A HG13 3  
ATOM 4435  H HG21 . ILE A 1 32 ? -1.413  1.373   6.748   1.00 0.00 ? 32 ILE A HG21 3  
ATOM 4436  H HG22 . ILE A 1 32 ? 0.197   0.902   7.294   1.00 0.00 ? 32 ILE A HG22 3  
ATOM 4437  H HG23 . ILE A 1 32 ? -0.101  2.551   6.743   1.00 0.00 ? 32 ILE A HG23 3  
ATOM 4438  H HD11 . ILE A 1 32 ? -0.146  -0.770  10.425  1.00 0.00 ? 32 ILE A HD11 3  
ATOM 4439  H HD12 . ILE A 1 32 ? 0.904   0.407   9.637   1.00 0.00 ? 32 ILE A HD12 3  
ATOM 4440  H HD13 . ILE A 1 32 ? -0.057  -0.708  8.665   1.00 0.00 ? 32 ILE A HD13 3  
ATOM 4441  N N    . GLY A 1 33 ? 1.365   4.578   7.902   1.00 0.00 ? 33 GLY A N    3  
ATOM 4442  C CA   . GLY A 1 33 ? 1.517   5.852   7.224   1.00 0.00 ? 33 GLY A CA   3  
ATOM 4443  C C    . GLY A 1 33 ? 1.214   5.762   5.743   1.00 0.00 ? 33 GLY A C    3  
ATOM 4444  O O    . GLY A 1 33 ? 1.882   5.034   5.010   1.00 0.00 ? 33 GLY A O    3  
ATOM 4445  H H    . GLY A 1 33 ? 2.063   3.896   7.805   1.00 0.00 ? 33 GLY A H    3  
ATOM 4446  H HA2  . GLY A 1 33 ? 0.853   6.569   7.674   1.00 0.00 ? 33 GLY A HA2  3  
ATOM 4447  H HA3  . GLY A 1 33 ? 2.535   6.193   7.350   1.00 0.00 ? 33 GLY A HA3  3  
ATOM 4448  N N    . VAL A 1 34 ? 0.202   6.502   5.300   1.00 0.00 ? 34 VAL A N    3  
ATOM 4449  C CA   . VAL A 1 34 ? -0.183  6.496   3.896   1.00 0.00 ? 34 VAL A CA   3  
ATOM 4450  C C    . VAL A 1 34 ? -0.022  7.877   3.269   1.00 0.00 ? 34 VAL A C    3  
ATOM 4451  O O    . VAL A 1 34 ? -0.841  8.770   3.487   1.00 0.00 ? 34 VAL A O    3  
ATOM 4452  C CB   . VAL A 1 34 ? -1.642  6.034   3.718   1.00 0.00 ? 34 VAL A CB   3  
ATOM 4453  C CG1  . VAL A 1 34 ? -1.954  5.800   2.248   1.00 0.00 ? 34 VAL A CG1  3  
ATOM 4454  C CG2  . VAL A 1 34 ? -1.907  4.777   4.533   1.00 0.00 ? 34 VAL A CG2  3  
ATOM 4455  H H    . VAL A 1 34 ? -0.297  7.062   5.930   1.00 0.00 ? 34 VAL A H    3  
ATOM 4456  H HA   . VAL A 1 34 ? 0.458   5.799   3.376   1.00 0.00 ? 34 VAL A HA   3  
ATOM 4457  H HB   . VAL A 1 34 ? -2.292  6.816   4.080   1.00 0.00 ? 34 VAL A HB   3  
ATOM 4458  H HG11 . VAL A 1 34 ? -1.773  4.764   2.001   1.00 0.00 ? 34 VAL A HG11 3  
ATOM 4459  H HG12 . VAL A 1 34 ? -1.321  6.430   1.641   1.00 0.00 ? 34 VAL A HG12 3  
ATOM 4460  H HG13 . VAL A 1 34 ? -2.989  6.040   2.057   1.00 0.00 ? 34 VAL A HG13 3  
ATOM 4461  H HG21 . VAL A 1 34 ? -1.501  4.901   5.527   1.00 0.00 ? 34 VAL A HG21 3  
ATOM 4462  H HG22 . VAL A 1 34 ? -1.436  3.931   4.055   1.00 0.00 ? 34 VAL A HG22 3  
ATOM 4463  H HG23 . VAL A 1 34 ? -2.971  4.608   4.598   1.00 0.00 ? 34 VAL A HG23 3  
ATOM 4464  N N    . ASN A 1 35 ? 1.040   8.041   2.487   1.00 0.00 ? 35 ASN A N    3  
ATOM 4465  C CA   . ASN A 1 35 ? 1.308   9.311   1.822   1.00 0.00 ? 35 ASN A CA   3  
ATOM 4466  C C    . ASN A 1 35 ? 0.844   9.262   0.370   1.00 0.00 ? 35 ASN A C    3  
ATOM 4467  O O    . ASN A 1 35 ? 1.455   8.603   -0.471  1.00 0.00 ? 35 ASN A O    3  
ATOM 4468  C CB   . ASN A 1 35 ? 2.799   9.663   1.885   1.00 0.00 ? 35 ASN A CB   3  
ATOM 4469  C CG   . ASN A 1 35 ? 3.476   9.134   3.136   1.00 0.00 ? 35 ASN A CG   3  
ATOM 4470  O OD1  . ASN A 1 35 ? 3.490   7.928   3.385   1.00 0.00 ? 35 ASN A OD1  3  
ATOM 4471  N ND2  . ASN A 1 35 ? 4.041   10.036  3.929   1.00 0.00 ? 35 ASN A ND2  3  
ATOM 4472  H H    . ASN A 1 35 ? 1.653   7.287   2.360   1.00 0.00 ? 35 ASN A H    3  
ATOM 4473  H HA   . ASN A 1 35 ? 0.745   10.076  2.337   1.00 0.00 ? 35 ASN A HA   3  
ATOM 4474  H HB2  . ASN A 1 35 ? 3.299   9.247   1.024   1.00 0.00 ? 35 ASN A HB2  3  
ATOM 4475  H HB3  . ASN A 1 35 ? 2.906   10.738  1.870   1.00 0.00 ? 35 ASN A HB3  3  
ATOM 4476  H HD21 . ASN A 1 35 ? 3.991   10.979  3.668   1.00 0.00 ? 35 ASN A HD21 3  
ATOM 4477  H HD22 . ASN A 1 35 ? 4.486   9.722   4.744   1.00 0.00 ? 35 ASN A HD22 3  
ATOM 4478  N N    . ALA A 1 36 ? -0.245  9.963   0.089   1.00 0.00 ? 36 ALA A N    3  
ATOM 4479  C CA   . ALA A 1 36 ? -0.803  10.002  -1.257  1.00 0.00 ? 36 ALA A CA   3  
ATOM 4480  C C    . ALA A 1 36 ? -1.360  11.382  -1.596  1.00 0.00 ? 36 ALA A C    3  
ATOM 4481  O O    . ALA A 1 36 ? -1.932  12.058  -0.740  1.00 0.00 ? 36 ALA A O    3  
ATOM 4482  C CB   . ALA A 1 36 ? -1.887  8.945   -1.407  1.00 0.00 ? 36 ALA A CB   3  
ATOM 4483  H H    . ALA A 1 36 ? -0.681  10.459  0.812   1.00 0.00 ? 36 ALA A H    3  
ATOM 4484  H HA   . ALA A 1 36 ? -0.009  9.766   -1.950  1.00 0.00 ? 36 ALA A HA   3  
ATOM 4485  H HB1  . ALA A 1 36 ? -2.345  8.761   -0.447  1.00 0.00 ? 36 ALA A HB1  3  
ATOM 4486  H HB2  . ALA A 1 36 ? -1.448  8.030   -1.778  1.00 0.00 ? 36 ALA A HB2  3  
ATOM 4487  H HB3  . ALA A 1 36 ? -2.635  9.293   -2.103  1.00 0.00 ? 36 ALA A HB3  3  
ATOM 4488  N N    . PRO A 1 37 ? -1.205  11.817  -2.860  1.00 0.00 ? 37 PRO A N    3  
ATOM 4489  C CA   . PRO A 1 37 ? -1.698  13.117  -3.316  1.00 0.00 ? 37 PRO A CA   3  
ATOM 4490  C C    . PRO A 1 37 ? -3.204  13.108  -3.552  1.00 0.00 ? 37 PRO A C    3  
ATOM 4491  O O    . PRO A 1 37 ? -3.798  12.056  -3.784  1.00 0.00 ? 37 PRO A O    3  
ATOM 4492  C CB   . PRO A 1 37 ? -0.952  13.327  -4.632  1.00 0.00 ? 37 PRO A CB   3  
ATOM 4493  C CG   . PRO A 1 37 ? -0.727  11.951  -5.154  1.00 0.00 ? 37 PRO A CG   3  
ATOM 4494  C CD   . PRO A 1 37 ? -0.539  11.070  -3.947  1.00 0.00 ? 37 PRO A CD   3  
ATOM 4495  H HA   . PRO A 1 37 ? -1.445  13.905  -2.622  1.00 0.00 ? 37 PRO A HA   3  
ATOM 4496  H HB2  . PRO A 1 37 ? -1.561  13.913  -5.305  1.00 0.00 ? 37 PRO A HB2  3  
ATOM 4497  H HB3  . PRO A 1 37 ? -0.019  13.836  -4.444  1.00 0.00 ? 37 PRO A HB3  3  
ATOM 4498  H HG2  . PRO A 1 37 ? -1.587  11.630  -5.722  1.00 0.00 ? 37 PRO A HG2  3  
ATOM 4499  H HG3  . PRO A 1 37 ? 0.159   11.934  -5.771  1.00 0.00 ? 37 PRO A HG3  3  
ATOM 4500  H HD2  . PRO A 1 37 ? -1.014  10.113  -4.102  1.00 0.00 ? 37 PRO A HD2  3  
ATOM 4501  H HD3  . PRO A 1 37 ? 0.512   10.940  -3.735  1.00 0.00 ? 37 PRO A HD3  3  
ATOM 4502  N N    . LYS A 1 38 ? -3.817  14.285  -3.491  1.00 0.00 ? 38 LYS A N    3  
ATOM 4503  C CA   . LYS A 1 38 ? -5.256  14.407  -3.698  1.00 0.00 ? 38 LYS A CA   3  
ATOM 4504  C C    . LYS A 1 38 ? -5.588  14.618  -5.175  1.00 0.00 ? 38 LYS A C    3  
ATOM 4505  O O    . LYS A 1 38 ? -6.585  15.259  -5.509  1.00 0.00 ? 38 LYS A O    3  
ATOM 4506  C CB   . LYS A 1 38 ? -5.812  15.566  -2.868  1.00 0.00 ? 38 LYS A CB   3  
ATOM 4507  C CG   . LYS A 1 38 ? -6.337  15.142  -1.506  1.00 0.00 ? 38 LYS A CG   3  
ATOM 4508  C CD   . LYS A 1 38 ? -6.422  16.320  -0.548  1.00 0.00 ? 38 LYS A CD   3  
ATOM 4509  C CE   . LYS A 1 38 ? -5.241  16.348  0.408   1.00 0.00 ? 38 LYS A CE   3  
ATOM 4510  N NZ   . LYS A 1 38 ? -5.171  17.626  1.169   1.00 0.00 ? 38 LYS A NZ   3  
ATOM 4511  H H    . LYS A 1 38 ? -3.291  15.090  -3.302  1.00 0.00 ? 38 LYS A H    3  
ATOM 4512  H HA   . LYS A 1 38 ? -5.716  13.489  -3.367  1.00 0.00 ? 38 LYS A HA   3  
ATOM 4513  H HB2  . LYS A 1 38 ? -5.028  16.294  -2.716  1.00 0.00 ? 38 LYS A HB2  3  
ATOM 4514  H HB3  . LYS A 1 38 ? -6.621  16.030  -3.412  1.00 0.00 ? 38 LYS A HB3  3  
ATOM 4515  H HG2  . LYS A 1 38 ? -7.323  14.718  -1.627  1.00 0.00 ? 38 LYS A HG2  3  
ATOM 4516  H HG3  . LYS A 1 38 ? -5.672  14.399  -1.090  1.00 0.00 ? 38 LYS A HG3  3  
ATOM 4517  H HD2  . LYS A 1 38 ? -6.431  17.236  -1.120  1.00 0.00 ? 38 LYS A HD2  3  
ATOM 4518  H HD3  . LYS A 1 38 ? -7.335  16.241  0.023   1.00 0.00 ? 38 LYS A HD3  3  
ATOM 4519  H HE2  . LYS A 1 38 ? -5.340  15.530  1.106   1.00 0.00 ? 38 LYS A HE2  3  
ATOM 4520  H HE3  . LYS A 1 38 ? -4.331  16.227  -0.161  1.00 0.00 ? 38 LYS A HE3  3  
ATOM 4521  H HZ1  . LYS A 1 38 ? -5.080  18.428  0.513   1.00 0.00 ? 38 LYS A HZ1  3  
ATOM 4522  H HZ2  . LYS A 1 38 ? -4.350  17.619  1.807   1.00 0.00 ? 38 LYS A HZ2  3  
ATOM 4523  H HZ3  . LYS A 1 38 ? -6.035  17.752  1.736   1.00 0.00 ? 38 LYS A HZ3  3  
ATOM 4524  N N    . GLU A 1 39 ? -4.754  14.073  -6.057  1.00 0.00 ? 39 GLU A N    3  
ATOM 4525  C CA   . GLU A 1 39 ? -4.969  14.203  -7.493  1.00 0.00 ? 39 GLU A CA   3  
ATOM 4526  C C    . GLU A 1 39 ? -5.571  12.925  -8.069  1.00 0.00 ? 39 GLU A C    3  
ATOM 4527  O O    . GLU A 1 39 ? -6.436  12.974  -8.944  1.00 0.00 ? 39 GLU A O    3  
ATOM 4528  C CB   . GLU A 1 39 ? -3.651  14.523  -8.201  1.00 0.00 ? 39 GLU A CB   3  
ATOM 4529  C CG   . GLU A 1 39 ? -3.180  15.954  -7.995  1.00 0.00 ? 39 GLU A CG   3  
ATOM 4530  C CD   . GLU A 1 39 ? -1.742  16.034  -7.522  1.00 0.00 ? 39 GLU A CD   3  
ATOM 4531  O OE1  . GLU A 1 39 ? -0.834  16.033  -8.379  1.00 0.00 ? 39 GLU A OE1  3  
ATOM 4532  O OE2  . GLU A 1 39 ? -1.523  16.097  -6.294  1.00 0.00 ? 39 GLU A OE2  3  
ATOM 4533  H H    . GLU A 1 39 ? -3.977  13.571  -5.738  1.00 0.00 ? 39 GLU A H    3  
ATOM 4534  H HA   . GLU A 1 39 ? -5.660  15.017  -7.653  1.00 0.00 ? 39 GLU A HA   3  
ATOM 4535  H HB2  . GLU A 1 39 ? -2.886  13.857  -7.830  1.00 0.00 ? 39 GLU A HB2  3  
ATOM 4536  H HB3  . GLU A 1 39 ? -3.776  14.357  -9.261  1.00 0.00 ? 39 GLU A HB3  3  
ATOM 4537  H HG2  . GLU A 1 39 ? -3.264  16.485  -8.931  1.00 0.00 ? 39 GLU A HG2  3  
ATOM 4538  H HG3  . GLU A 1 39 ? -3.814  16.424  -7.257  1.00 0.00 ? 39 GLU A HG3  3  
ATOM 4539  N N    . VAL A 1 40 ? -5.111  11.782  -7.569  1.00 0.00 ? 40 VAL A N    3  
ATOM 4540  C CA   . VAL A 1 40 ? -5.608  10.491  -8.032  1.00 0.00 ? 40 VAL A CA   3  
ATOM 4541  C C    . VAL A 1 40 ? -6.754  10.004  -7.153  1.00 0.00 ? 40 VAL A C    3  
ATOM 4542  O O    . VAL A 1 40 ? -6.908  10.448  -6.015  1.00 0.00 ? 40 VAL A O    3  
ATOM 4543  C CB   . VAL A 1 40 ? -4.492  9.427   -8.048  1.00 0.00 ? 40 VAL A CB   3  
ATOM 4544  C CG1  . VAL A 1 40 ? -4.967  8.166   -8.752  1.00 0.00 ? 40 VAL A CG1  3  
ATOM 4545  C CG2  . VAL A 1 40 ? -3.239  9.977   -8.713  1.00 0.00 ? 40 VAL A CG2  3  
ATOM 4546  H H    . VAL A 1 40 ? -4.423  11.807  -6.871  1.00 0.00 ? 40 VAL A H    3  
ATOM 4547  H HA   . VAL A 1 40 ? -5.971  10.617  -9.042  1.00 0.00 ? 40 VAL A HA   3  
ATOM 4548  H HB   . VAL A 1 40 ? -4.248  9.171   -7.027  1.00 0.00 ? 40 VAL A HB   3  
ATOM 4549  H HG11 . VAL A 1 40 ? -4.118  7.534   -8.969  1.00 0.00 ? 40 VAL A HG11 3  
ATOM 4550  H HG12 . VAL A 1 40 ? -5.462  8.433   -9.674  1.00 0.00 ? 40 VAL A HG12 3  
ATOM 4551  H HG13 . VAL A 1 40 ? -5.657  7.635   -8.113  1.00 0.00 ? 40 VAL A HG13 3  
ATOM 4552  H HG21 . VAL A 1 40 ? -2.662  10.533  -7.989  1.00 0.00 ? 40 VAL A HG21 3  
ATOM 4553  H HG22 . VAL A 1 40 ? -3.521  10.630  -9.526  1.00 0.00 ? 40 VAL A HG22 3  
ATOM 4554  H HG23 . VAL A 1 40 ? -2.647  9.160   -9.096  1.00 0.00 ? 40 VAL A HG23 3  
ATOM 4555  N N    . SER A 1 41 ? -7.560  9.091   -7.686  1.00 0.00 ? 41 SER A N    3  
ATOM 4556  C CA   . SER A 1 41 ? -8.695  8.551   -6.947  1.00 0.00 ? 41 SER A CA   3  
ATOM 4557  C C    . SER A 1 41 ? -8.228  7.753   -5.734  1.00 0.00 ? 41 SER A C    3  
ATOM 4558  O O    . SER A 1 41 ? -7.871  6.581   -5.851  1.00 0.00 ? 41 SER A O    3  
ATOM 4559  C CB   . SER A 1 41 ? -9.547  7.664   -7.857  1.00 0.00 ? 41 SER A CB   3  
ATOM 4560  O OG   . SER A 1 41 ? -10.843 7.474   -7.317  1.00 0.00 ? 41 SER A OG   3  
ATOM 4561  H H    . SER A 1 41 ? -7.390  8.776   -8.599  1.00 0.00 ? 41 SER A H    3  
ATOM 4562  H HA   . SER A 1 41 ? -9.294  9.382   -6.607  1.00 0.00 ? 41 SER A HA   3  
ATOM 4563  H HB2  . SER A 1 41 ? -9.640  8.131   -8.826  1.00 0.00 ? 41 SER A HB2  3  
ATOM 4564  H HB3  . SER A 1 41 ? -9.070  6.701   -7.966  1.00 0.00 ? 41 SER A HB3  3  
ATOM 4565  H HG   . SER A 1 41 ? -11.253 8.328   -7.160  1.00 0.00 ? 41 SER A HG   3  
ATOM 4566  N N    . VAL A 1 42 ? -8.241  8.391   -4.567  1.00 0.00 ? 42 VAL A N    3  
ATOM 4567  C CA   . VAL A 1 42 ? -7.826  7.736   -3.333  1.00 0.00 ? 42 VAL A CA   3  
ATOM 4568  C C    . VAL A 1 42 ? -8.949  7.767   -2.296  1.00 0.00 ? 42 VAL A C    3  
ATOM 4569  O O    . VAL A 1 42 ? -9.412  8.839   -1.907  1.00 0.00 ? 42 VAL A O    3  
ATOM 4570  C CB   . VAL A 1 42 ? -6.568  8.402   -2.740  1.00 0.00 ? 42 VAL A CB   3  
ATOM 4571  C CG1  . VAL A 1 42 ? -6.841  9.858   -2.394  1.00 0.00 ? 42 VAL A CG1  3  
ATOM 4572  C CG2  . VAL A 1 42 ? -6.082  7.637   -1.517  1.00 0.00 ? 42 VAL A CG2  3  
ATOM 4573  H H    . VAL A 1 42 ? -8.545  9.322   -4.532  1.00 0.00 ? 42 VAL A H    3  
ATOM 4574  H HA   . VAL A 1 42 ? -7.588  6.708   -3.566  1.00 0.00 ? 42 VAL A HA   3  
ATOM 4575  H HB   . VAL A 1 42 ? -5.788  8.375   -3.487  1.00 0.00 ? 42 VAL A HB   3  
ATOM 4576  H HG11 . VAL A 1 42 ? -5.905  10.367  -2.217  1.00 0.00 ? 42 VAL A HG11 3  
ATOM 4577  H HG12 . VAL A 1 42 ? -7.452  9.908   -1.505  1.00 0.00 ? 42 VAL A HG12 3  
ATOM 4578  H HG13 . VAL A 1 42 ? -7.359  10.332  -3.215  1.00 0.00 ? 42 VAL A HG13 3  
ATOM 4579  H HG21 . VAL A 1 42 ? -6.419  8.138   -0.622  1.00 0.00 ? 42 VAL A HG21 3  
ATOM 4580  H HG22 . VAL A 1 42 ? -5.003  7.597   -1.523  1.00 0.00 ? 42 VAL A HG22 3  
ATOM 4581  H HG23 . VAL A 1 42 ? -6.480  6.633   -1.539  1.00 0.00 ? 42 VAL A HG23 3  
ATOM 4582  N N    . HIS A 1 43 ? -9.384  6.590   -1.852  1.00 0.00 ? 43 HIS A N    3  
ATOM 4583  C CA   . HIS A 1 43 ? -10.451 6.494   -0.862  1.00 0.00 ? 43 HIS A CA   3  
ATOM 4584  C C    . HIS A 1 43 ? -10.028 5.610   0.306   1.00 0.00 ? 43 HIS A C    3  
ATOM 4585  O O    . HIS A 1 43 ? -9.443  4.545   0.109   1.00 0.00 ? 43 HIS A O    3  
ATOM 4586  C CB   . HIS A 1 43 ? -11.725 5.942   -1.507  1.00 0.00 ? 43 HIS A CB   3  
ATOM 4587  C CG   . HIS A 1 43 ? -12.906 6.851   -1.370  1.00 0.00 ? 43 HIS A CG   3  
ATOM 4588  N ND1  . HIS A 1 43 ? -13.801 7.084   -2.393  1.00 0.00 ? 43 HIS A ND1  3  
ATOM 4589  C CD2  . HIS A 1 43 ? -13.341 7.589   -0.321  1.00 0.00 ? 43 HIS A CD2  3  
ATOM 4590  C CE1  . HIS A 1 43 ? -14.732 7.925   -1.982  1.00 0.00 ? 43 HIS A CE1  3  
ATOM 4591  N NE2  . HIS A 1 43 ? -14.476 8.246   -0.728  1.00 0.00 ? 43 HIS A NE2  3  
ATOM 4592  H H    . HIS A 1 43 ? -8.981  5.766   -2.195  1.00 0.00 ? 43 HIS A H    3  
ATOM 4593  H HA   . HIS A 1 43 ? -10.649 7.489   -0.491  1.00 0.00 ? 43 HIS A HA   3  
ATOM 4594  H HB2  . HIS A 1 43 ? -11.548 5.785   -2.561  1.00 0.00 ? 43 HIS A HB2  3  
ATOM 4595  H HB3  . HIS A 1 43 ? -11.976 4.997   -1.045  1.00 0.00 ? 43 HIS A HB3  3  
ATOM 4596  H HD2  . HIS A 1 43 ? -12.879 7.650   0.655   1.00 0.00 ? 43 HIS A HD2  3  
ATOM 4597  H HE1  . HIS A 1 43 ? -15.562 8.287   -2.571  1.00 0.00 ? 43 HIS A HE1  3  
ATOM 4598  H HE2  . HIS A 1 43 ? -15.058 8.787   -0.153  1.00 0.00 ? 43 HIS A HE2  3  
ATOM 4599  N N    . ARG A 1 44 ? -10.328 6.054   1.522   1.00 0.00 ? 44 ARG A N    3  
ATOM 4600  C CA   . ARG A 1 44 ? -9.979  5.298   2.719   1.00 0.00 ? 44 ARG A CA   3  
ATOM 4601  C C    . ARG A 1 44 ? -11.166 5.223   3.675   1.00 0.00 ? 44 ARG A C    3  
ATOM 4602  O O    . ARG A 1 44 ? -12.258 5.696   3.361   1.00 0.00 ? 44 ARG A O    3  
ATOM 4603  C CB   . ARG A 1 44 ? -8.781  5.941   3.421   1.00 0.00 ? 44 ARG A CB   3  
ATOM 4604  C CG   . ARG A 1 44 ? -7.507  5.919   2.592   1.00 0.00 ? 44 ARG A CG   3  
ATOM 4605  C CD   . ARG A 1 44 ? -6.749  7.233   2.697   1.00 0.00 ? 44 ARG A CD   3  
ATOM 4606  N NE   . ARG A 1 44 ? -7.550  8.366   2.240   1.00 0.00 ? 44 ARG A NE   3  
ATOM 4607  C CZ   . ARG A 1 44 ? -7.038  9.545   1.895   1.00 0.00 ? 44 ARG A CZ   3  
ATOM 4608  N NH1  . ARG A 1 44 ? -5.728  9.750   1.952   1.00 0.00 ? 44 ARG A NH1  3  
ATOM 4609  N NH2  . ARG A 1 44 ? -7.838  10.522  1.491   1.00 0.00 ? 44 ARG A NH2  3  
ATOM 4610  H H    . ARG A 1 44 ? -10.800 6.907   1.622   1.00 0.00 ? 44 ARG A H    3  
ATOM 4611  H HA   . ARG A 1 44 ? -9.713  4.297   2.414   1.00 0.00 ? 44 ARG A HA   3  
ATOM 4612  H HB2  . ARG A 1 44 ? -9.021  6.970   3.648   1.00 0.00 ? 44 ARG A HB2  3  
ATOM 4613  H HB3  . ARG A 1 44 ? -8.594  5.413   4.345   1.00 0.00 ? 44 ARG A HB3  3  
ATOM 4614  H HG2  . ARG A 1 44 ? -6.873  5.120   2.947   1.00 0.00 ? 44 ARG A HG2  3  
ATOM 4615  H HG3  . ARG A 1 44 ? -7.766  5.744   1.558   1.00 0.00 ? 44 ARG A HG3  3  
ATOM 4616  H HD2  . ARG A 1 44 ? -6.472  7.393   3.728   1.00 0.00 ? 44 ARG A HD2  3  
ATOM 4617  H HD3  . ARG A 1 44 ? -5.857  7.168   2.092   1.00 0.00 ? 44 ARG A HD3  3  
ATOM 4618  H HE   . ARG A 1 44 ? -8.521  8.242   2.188   1.00 0.00 ? 44 ARG A HE   3  
ATOM 4619  H HH11 . ARG A 1 44 ? -5.119  9.017   2.255   1.00 0.00 ? 44 ARG A HH11 3  
ATOM 4620  H HH12 . ARG A 1 44 ? -5.349  10.638  1.691   1.00 0.00 ? 44 ARG A HH12 3  
ATOM 4621  H HH21 . ARG A 1 44 ? -8.826  10.373  1.445   1.00 0.00 ? 44 ARG A HH21 3  
ATOM 4622  H HH22 . ARG A 1 44 ? -7.454  11.408  1.232   1.00 0.00 ? 44 ARG A HH22 3  
ATOM 4623  N N    . GLU A 1 45 ? -10.946 4.625   4.842   1.00 0.00 ? 45 GLU A N    3  
ATOM 4624  C CA   . GLU A 1 45 ? -12.000 4.490   5.840   1.00 0.00 ? 45 GLU A CA   3  
ATOM 4625  C C    . GLU A 1 45 ? -12.449 5.858   6.347   1.00 0.00 ? 45 GLU A C    3  
ATOM 4626  O O    . GLU A 1 45 ? -11.655 6.797   6.418   1.00 0.00 ? 45 GLU A O    3  
ATOM 4627  C CB   . GLU A 1 45 ? -11.517 3.634   7.012   1.00 0.00 ? 45 GLU A CB   3  
ATOM 4628  C CG   . GLU A 1 45 ? -11.608 2.139   6.754   1.00 0.00 ? 45 GLU A CG   3  
ATOM 4629  C CD   . GLU A 1 45 ? -12.021 1.359   7.986   1.00 0.00 ? 45 GLU A CD   3  
ATOM 4630  O OE1  . GLU A 1 45 ? -11.268 1.381   8.983   1.00 0.00 ? 45 GLU A OE1  3  
ATOM 4631  O OE2  . GLU A 1 45 ? -13.097 0.726   7.956   1.00 0.00 ? 45 GLU A OE2  3  
ATOM 4632  H H    . GLU A 1 45 ? -10.055 4.267   5.036   1.00 0.00 ? 45 GLU A H    3  
ATOM 4633  H HA   . GLU A 1 45 ? -12.840 4.000   5.371   1.00 0.00 ? 45 GLU A HA   3  
ATOM 4634  H HB2  . GLU A 1 45 ? -10.486 3.879   7.221   1.00 0.00 ? 45 GLU A HB2  3  
ATOM 4635  H HB3  . GLU A 1 45 ? -12.115 3.864   7.882   1.00 0.00 ? 45 GLU A HB3  3  
ATOM 4636  H HG2  . GLU A 1 45 ? -12.336 1.965   5.976   1.00 0.00 ? 45 GLU A HG2  3  
ATOM 4637  H HG3  . GLU A 1 45 ? -10.642 1.784   6.427   1.00 0.00 ? 45 GLU A HG3  3  
ATOM 4638  N N    . GLU A 1 46 ? -13.728 5.965   6.694   1.00 0.00 ? 46 GLU A N    3  
ATOM 4639  C CA   . GLU A 1 46 ? -14.286 7.218   7.193   1.00 0.00 ? 46 GLU A CA   3  
ATOM 4640  C C    . GLU A 1 46 ? -13.440 7.785   8.329   1.00 0.00 ? 46 GLU A C    3  
ATOM 4641  O O    . GLU A 1 46 ? -12.908 8.890   8.227   1.00 0.00 ? 46 GLU A O    3  
ATOM 4642  C CB   . GLU A 1 46 ? -15.723 7.004   7.673   1.00 0.00 ? 46 GLU A CB   3  
ATOM 4643  C CG   . GLU A 1 46 ? -16.764 7.184   6.579   1.00 0.00 ? 46 GLU A CG   3  
ATOM 4644  C CD   . GLU A 1 46 ? -16.707 6.086   5.535   1.00 0.00 ? 46 GLU A CD   3  
ATOM 4645  O OE1  . GLU A 1 46 ? -17.366 5.044   5.733   1.00 0.00 ? 46 GLU A OE1  3  
ATOM 4646  O OE2  . GLU A 1 46 ? -16.003 6.269   4.520   1.00 0.00 ? 46 GLU A OE2  3  
ATOM 4647  H H    . GLU A 1 46 ? -14.314 5.184   6.610   1.00 0.00 ? 46 GLU A H    3  
ATOM 4648  H HA   . GLU A 1 46 ? -14.292 7.925   6.377   1.00 0.00 ? 46 GLU A HA   3  
ATOM 4649  H HB2  . GLU A 1 46 ? -15.814 6.002   8.065   1.00 0.00 ? 46 GLU A HB2  3  
ATOM 4650  H HB3  . GLU A 1 46 ? -15.936 7.710   8.462   1.00 0.00 ? 46 GLU A HB3  3  
ATOM 4651  H HG2  . GLU A 1 46 ? -17.745 7.180   7.030   1.00 0.00 ? 46 GLU A HG2  3  
ATOM 4652  H HG3  . GLU A 1 46 ? -16.595 8.133   6.093   1.00 0.00 ? 46 GLU A HG3  3  
ATOM 4653  N N    . ILE A 1 47 ? -13.320 7.021   9.411   1.00 0.00 ? 47 ILE A N    3  
ATOM 4654  C CA   . ILE A 1 47 ? -12.540 7.446   10.569  1.00 0.00 ? 47 ILE A CA   3  
ATOM 4655  C C    . ILE A 1 47 ? -11.110 7.806   10.170  1.00 0.00 ? 47 ILE A C    3  
ATOM 4656  O O    . ILE A 1 47 ? -10.513 8.727   10.727  1.00 0.00 ? 47 ILE A O    3  
ATOM 4657  C CB   . ILE A 1 47 ? -12.505 6.350   11.654  1.00 0.00 ? 47 ILE A CB   3  
ATOM 4658  C CG1  . ILE A 1 47 ? -11.804 6.865   12.913  1.00 0.00 ? 47 ILE A CG1  3  
ATOM 4659  C CG2  . ILE A 1 47 ? -11.814 5.100   11.129  1.00 0.00 ? 47 ILE A CG2  3  
ATOM 4660  C CD1  . ILE A 1 47 ? -12.748 7.491   13.917  1.00 0.00 ? 47 ILE A CD1  3  
ATOM 4661  H H    . ILE A 1 47 ? -13.769 6.150   9.432   1.00 0.00 ? 47 ILE A H    3  
ATOM 4662  H HA   . ILE A 1 47 ? -13.016 8.321   10.987  1.00 0.00 ? 47 ILE A HA   3  
ATOM 4663  H HB   . ILE A 1 47 ? -13.523 6.089   11.901  1.00 0.00 ? 47 ILE A HB   3  
ATOM 4664  H HG12 . ILE A 1 47 ? -11.302 6.043   13.400  1.00 0.00 ? 47 ILE A HG12 3  
ATOM 4665  H HG13 . ILE A 1 47 ? -11.075 7.611   12.633  1.00 0.00 ? 47 ILE A HG13 3  
ATOM 4666  H HG21 . ILE A 1 47 ? -10.759 5.150   11.355  1.00 0.00 ? 47 ILE A HG21 3  
ATOM 4667  H HG22 . ILE A 1 47 ? -11.950 5.036   10.059  1.00 0.00 ? 47 ILE A HG22 3  
ATOM 4668  H HG23 . ILE A 1 47 ? -12.243 4.227   11.599  1.00 0.00 ? 47 ILE A HG23 3  
ATOM 4669  H HD11 . ILE A 1 47 ? -12.374 7.323   14.916  1.00 0.00 ? 47 ILE A HD11 3  
ATOM 4670  H HD12 . ILE A 1 47 ? -13.726 7.043   13.819  1.00 0.00 ? 47 ILE A HD12 3  
ATOM 4671  H HD13 . ILE A 1 47 ? -12.818 8.553   13.733  1.00 0.00 ? 47 ILE A HD13 3  
ATOM 4672  N N    . TYR A 1 48 ? -10.568 7.073   9.202   1.00 0.00 ? 48 TYR A N    3  
ATOM 4673  C CA   . TYR A 1 48 ? -9.209  7.313   8.726   1.00 0.00 ? 48 TYR A CA   3  
ATOM 4674  C C    . TYR A 1 48 ? -9.017  8.775   8.331   1.00 0.00 ? 48 TYR A C    3  
ATOM 4675  O O    . TYR A 1 48 ? -8.351  9.539   9.032   1.00 0.00 ? 48 TYR A O    3  
ATOM 4676  C CB   . TYR A 1 48 ? -8.900  6.406   7.532   1.00 0.00 ? 48 TYR A CB   3  
ATOM 4677  C CG   . TYR A 1 48 ? -7.888  5.322   7.831   1.00 0.00 ? 48 TYR A CG   3  
ATOM 4678  C CD1  . TYR A 1 48 ? -8.113  4.392   8.838   1.00 0.00 ? 48 TYR A CD1  3  
ATOM 4679  C CD2  . TYR A 1 48 ? -6.709  5.228   7.102   1.00 0.00 ? 48 TYR A CD2  3  
ATOM 4680  C CE1  . TYR A 1 48 ? -7.191  3.398   9.109   1.00 0.00 ? 48 TYR A CE1  3  
ATOM 4681  C CE2  . TYR A 1 48 ? -5.783  4.237   7.367   1.00 0.00 ? 48 TYR A CE2  3  
ATOM 4682  C CZ   . TYR A 1 48 ? -6.029  3.325   8.371   1.00 0.00 ? 48 TYR A CZ   3  
ATOM 4683  O OH   . TYR A 1 48 ? -5.109  2.337   8.637   1.00 0.00 ? 48 TYR A OH   3  
ATOM 4684  H H    . TYR A 1 48 ? -11.095 6.352   8.797   1.00 0.00 ? 48 TYR A H    3  
ATOM 4685  H HA   . TYR A 1 48 ? -8.531  7.078   9.531   1.00 0.00 ? 48 TYR A HA   3  
ATOM 4686  H HB2  . TYR A 1 48 ? -9.810  5.924   7.211   1.00 0.00 ? 48 TYR A HB2  3  
ATOM 4687  H HB3  . TYR A 1 48 ? -8.513  7.007   6.722   1.00 0.00 ? 48 TYR A HB3  3  
ATOM 4688  H HD1  . TYR A 1 48 ? -9.024  4.452   9.414   1.00 0.00 ? 48 TYR A HD1  3  
ATOM 4689  H HD2  . TYR A 1 48 ? -6.519  5.944   6.316   1.00 0.00 ? 48 TYR A HD2  3  
ATOM 4690  H HE1  . TYR A 1 48 ? -7.384  2.683   9.896   1.00 0.00 ? 48 TYR A HE1  3  
ATOM 4691  H HE2  . TYR A 1 48 ? -4.873  4.180   6.789   1.00 0.00 ? 48 TYR A HE2  3  
ATOM 4692  H HH   . TYR A 1 48 ? -5.481  1.482   8.406   1.00 0.00 ? 48 TYR A HH   3  
ATOM 4693  N N    . GLN A 1 49 ? -9.602  9.156   7.201   1.00 0.00 ? 49 GLN A N    3  
ATOM 4694  C CA   . GLN A 1 49 ? -9.494  10.523  6.706   1.00 0.00 ? 49 GLN A CA   3  
ATOM 4695  C C    . GLN A 1 49 ? -10.157 11.518  7.657   1.00 0.00 ? 49 GLN A C    3  
ATOM 4696  O O    . GLN A 1 49 ? -9.906  12.720  7.578   1.00 0.00 ? 49 GLN A O    3  
ATOM 4697  C CB   . GLN A 1 49 ? -10.131 10.630  5.318   1.00 0.00 ? 49 GLN A CB   3  
ATOM 4698  C CG   . GLN A 1 49 ? -11.577 10.164  5.275   1.00 0.00 ? 49 GLN A CG   3  
ATOM 4699  C CD   . GLN A 1 49 ? -11.936 9.498   3.961   1.00 0.00 ? 49 GLN A CD   3  
ATOM 4700  O OE1  . GLN A 1 49 ? -11.569 9.977   2.888   1.00 0.00 ? 49 GLN A OE1  3  
ATOM 4701  N NE2  . GLN A 1 49 ? -12.658 8.386   4.038   1.00 0.00 ? 49 GLN A NE2  3  
ATOM 4702  H H    . GLN A 1 49 ? -10.118 8.503   6.682   1.00 0.00 ? 49 GLN A H    3  
ATOM 4703  H HA   . GLN A 1 49 ? -8.444  10.763  6.627   1.00 0.00 ? 49 GLN A HA   3  
ATOM 4704  H HB2  . GLN A 1 49 ? -10.099 11.660  4.999   1.00 0.00 ? 49 GLN A HB2  3  
ATOM 4705  H HB3  . GLN A 1 49 ? -9.561  10.029  4.626   1.00 0.00 ? 49 GLN A HB3  3  
ATOM 4706  H HG2  . GLN A 1 49 ? -11.739 9.457   6.075   1.00 0.00 ? 49 GLN A HG2  3  
ATOM 4707  H HG3  . GLN A 1 49 ? -12.222 11.019  5.416   1.00 0.00 ? 49 GLN A HG3  3  
ATOM 4708  H HE21 . GLN A 1 49 ? -12.915 8.062   4.927   1.00 0.00 ? 49 GLN A HE21 3  
ATOM 4709  H HE22 . GLN A 1 49 ? -12.903 7.934   3.204   1.00 0.00 ? 49 GLN A HE22 3  
ATOM 4710  N N    . ARG A 1 50 ? -11.007 11.018  8.550   1.00 0.00 ? 50 ARG A N    3  
ATOM 4711  C CA   . ARG A 1 50 ? -11.705 11.872  9.504   1.00 0.00 ? 50 ARG A CA   3  
ATOM 4712  C C    . ARG A 1 50 ? -10.744 12.446  10.542  1.00 0.00 ? 50 ARG A C    3  
ATOM 4713  O O    . ARG A 1 50 ? -10.951 13.548  11.049  1.00 0.00 ? 50 ARG A O    3  
ATOM 4714  C CB   . ARG A 1 50 ? -12.817 11.088  10.204  1.00 0.00 ? 50 ARG A CB   3  
ATOM 4715  C CG   . ARG A 1 50 ? -14.206 11.382  9.658   1.00 0.00 ? 50 ARG A CG   3  
ATOM 4716  C CD   . ARG A 1 50 ? -15.141 11.881  10.748  1.00 0.00 ? 50 ARG A CD   3  
ATOM 4717  N NE   . ARG A 1 50 ? -15.516 10.817  11.677  1.00 0.00 ? 50 ARG A NE   3  
ATOM 4718  C CZ   . ARG A 1 50 ? -15.993 11.034  12.901  1.00 0.00 ? 50 ARG A CZ   3  
ATOM 4719  N NH1  . ARG A 1 50 ? -16.157 12.273  13.348  1.00 0.00 ? 50 ARG A NH1  3  
ATOM 4720  N NH2  . ARG A 1 50 ? -16.309 10.008  13.680  1.00 0.00 ? 50 ARG A NH2  3  
ATOM 4721  H H    . ARG A 1 50 ? -11.174 10.055  8.569   1.00 0.00 ? 50 ARG A H    3  
ATOM 4722  H HA   . ARG A 1 50 ? -12.146 12.686  8.952   1.00 0.00 ? 50 ARG A HA   3  
ATOM 4723  H HB2  . ARG A 1 50 ? -12.624 10.033  10.088  1.00 0.00 ? 50 ARG A HB2  3  
ATOM 4724  H HB3  . ARG A 1 50 ? -12.807 11.332  11.256  1.00 0.00 ? 50 ARG A HB3  3  
ATOM 4725  H HG2  . ARG A 1 50 ? -14.128 12.138  8.892   1.00 0.00 ? 50 ARG A HG2  3  
ATOM 4726  H HG3  . ARG A 1 50 ? -14.613 10.476  9.233   1.00 0.00 ? 50 ARG A HG3  3  
ATOM 4727  H HD2  . ARG A 1 50 ? -14.645 12.666  11.298  1.00 0.00 ? 50 ARG A HD2  3  
ATOM 4728  H HD3  . ARG A 1 50 ? -16.034 12.274  10.286  1.00 0.00 ? 50 ARG A HD3  3  
ATOM 4729  H HE   . ARG A 1 50 ? -15.406 9.892   11.373  1.00 0.00 ? 50 ARG A HE   3  
ATOM 4730  H HH11 . ARG A 1 50 ? -15.921 13.051  12.766  1.00 0.00 ? 50 ARG A HH11 3  
ATOM 4731  H HH12 . ARG A 1 50 ? -16.515 12.428  14.268  1.00 0.00 ? 50 ARG A HH12 3  
ATOM 4732  H HH21 . ARG A 1 50 ? -16.188 9.072   13.348  1.00 0.00 ? 50 ARG A HH21 3  
ATOM 4733  H HH22 . ARG A 1 50 ? -16.667 10.170  14.599  1.00 0.00 ? 50 ARG A HH22 3  
ATOM 4734  N N    . ILE A 1 51 ? -9.701  11.690  10.863  1.00 0.00 ? 51 ILE A N    3  
ATOM 4735  C CA   . ILE A 1 51 ? -8.720  12.127  11.849  1.00 0.00 ? 51 ILE A CA   3  
ATOM 4736  C C    . ILE A 1 51 ? -7.420  12.588  11.194  1.00 0.00 ? 51 ILE A C    3  
ATOM 4737  O O    . ILE A 1 51 ? -6.573  13.198  11.846  1.00 0.00 ? 51 ILE A O    3  
ATOM 4738  C CB   . ILE A 1 51 ? -8.401  11.004  12.855  1.00 0.00 ? 51 ILE A CB   3  
ATOM 4739  C CG1  . ILE A 1 51 ? -9.693  10.391  13.396  1.00 0.00 ? 51 ILE A CG1  3  
ATOM 4740  C CG2  . ILE A 1 51 ? -7.545  11.539  13.994  1.00 0.00 ? 51 ILE A CG2  3  
ATOM 4741  C CD1  . ILE A 1 51 ? -10.580 11.387  14.114  1.00 0.00 ? 51 ILE A CD1  3  
ATOM 4742  H H    . ILE A 1 51 ? -9.591  10.817  10.432  1.00 0.00 ? 51 ILE A H    3  
ATOM 4743  H HA   . ILE A 1 51 ? -9.147  12.955  12.396  1.00 0.00 ? 51 ILE A HA   3  
ATOM 4744  H HB   . ILE A 1 51 ? -7.836  10.241  12.341  1.00 0.00 ? 51 ILE A HB   3  
ATOM 4745  H HG12 . ILE A 1 51 ? -10.259 9.976   12.575  1.00 0.00 ? 51 ILE A HG12 3  
ATOM 4746  H HG13 . ILE A 1 51 ? -9.446  9.603   14.092  1.00 0.00 ? 51 ILE A HG13 3  
ATOM 4747  H HG21 . ILE A 1 51 ? -7.828  11.053  14.916  1.00 0.00 ? 51 ILE A HG21 3  
ATOM 4748  H HG22 . ILE A 1 51 ? -7.696  12.604  14.088  1.00 0.00 ? 51 ILE A HG22 3  
ATOM 4749  H HG23 . ILE A 1 51 ? -6.504  11.340  13.786  1.00 0.00 ? 51 ILE A HG23 3  
ATOM 4750  H HD11 . ILE A 1 51 ? -10.826 12.198  13.444  1.00 0.00 ? 51 ILE A HD11 3  
ATOM 4751  H HD12 . ILE A 1 51 ? -10.059 11.777  14.975  1.00 0.00 ? 51 ILE A HD12 3  
ATOM 4752  H HD13 . ILE A 1 51 ? -11.488 10.896  14.433  1.00 0.00 ? 51 ILE A HD13 3  
ATOM 4753  N N    . GLN A 1 52 ? -7.257  12.290  9.907   1.00 0.00 ? 52 GLN A N    3  
ATOM 4754  C CA   . GLN A 1 52 ? -6.046  12.676  9.189   1.00 0.00 ? 52 GLN A CA   3  
ATOM 4755  C C    . GLN A 1 52 ? -6.342  13.690  8.086   1.00 0.00 ? 52 GLN A C    3  
ATOM 4756  O O    . GLN A 1 52 ? -5.779  14.785  8.072   1.00 0.00 ? 52 GLN A O    3  
ATOM 4757  C CB   . GLN A 1 52 ? -5.371  11.440  8.592   1.00 0.00 ? 52 GLN A CB   3  
ATOM 4758  C CG   . GLN A 1 52 ? -4.397  10.763  9.541   1.00 0.00 ? 52 GLN A CG   3  
ATOM 4759  C CD   . GLN A 1 52 ? -3.349  11.717  10.080  1.00 0.00 ? 52 GLN A CD   3  
ATOM 4760  O OE1  . GLN A 1 52 ? -3.158  12.812  9.550   1.00 0.00 ? 52 GLN A OE1  3  
ATOM 4761  N NE2  . GLN A 1 52 ? -2.663  11.306  11.140  1.00 0.00 ? 52 GLN A NE2  3  
ATOM 4762  H H    . GLN A 1 52 ? -7.958  11.793  9.434   1.00 0.00 ? 52 GLN A H    3  
ATOM 4763  H HA   . GLN A 1 52 ? -5.373  13.129  9.901   1.00 0.00 ? 52 GLN A HA   3  
ATOM 4764  H HB2  . GLN A 1 52 ? -6.133  10.724  8.319   1.00 0.00 ? 52 GLN A HB2  3  
ATOM 4765  H HB3  . GLN A 1 52 ? -4.831  11.733  7.704   1.00 0.00 ? 52 GLN A HB3  3  
ATOM 4766  H HG2  . GLN A 1 52 ? -4.950  10.353  10.373  1.00 0.00 ? 52 GLN A HG2  3  
ATOM 4767  H HG3  . GLN A 1 52 ? -3.897  9.963   9.014   1.00 0.00 ? 52 GLN A HG3  3  
ATOM 4768  H HE21 . GLN A 1 52 ? -2.868  10.422  11.510  1.00 0.00 ? 52 GLN A HE21 3  
ATOM 4769  H HE22 . GLN A 1 52 ? -1.979  11.903  11.509  1.00 0.00 ? 52 GLN A HE22 3  
ATOM 4770  N N    . ALA A 1 53 ? -7.219  13.318  7.161   1.00 0.00 ? 53 ALA A N    3  
ATOM 4771  C CA   . ALA A 1 53 ? -7.576  14.195  6.053   1.00 0.00 ? 53 ALA A CA   3  
ATOM 4772  C C    . ALA A 1 53 ? -8.346  15.418  6.538   1.00 0.00 ? 53 ALA A C    3  
ATOM 4773  O O    . ALA A 1 53 ? -7.823  16.532  6.539   1.00 0.00 ? 53 ALA A O    3  
ATOM 4774  C CB   . ALA A 1 53 ? -8.386  13.432  5.015   1.00 0.00 ? 53 ALA A CB   3  
ATOM 4775  H H    . ALA A 1 53 ? -7.631  12.433  7.222   1.00 0.00 ? 53 ALA A H    3  
ATOM 4776  H HA   . ALA A 1 53 ? -6.660  14.523  5.586   1.00 0.00 ? 53 ALA A HA   3  
ATOM 4777  H HB1  . ALA A 1 53 ? -8.049  13.703  4.026   1.00 0.00 ? 53 ALA A HB1  3  
ATOM 4778  H HB2  . ALA A 1 53 ? -9.432  13.680  5.120   1.00 0.00 ? 53 ALA A HB2  3  
ATOM 4779  H HB3  . ALA A 1 53 ? -8.251  12.371  5.163   1.00 0.00 ? 53 ALA A HB3  3  
ATOM 4780  N N    . GLU A 1 54 ? -9.592  15.205  6.947   1.00 0.00 ? 54 GLU A N    3  
ATOM 4781  C CA   . GLU A 1 54 ? -10.434 16.293  7.432   1.00 0.00 ? 54 GLU A CA   3  
ATOM 4782  C C    . GLU A 1 54 ? -10.834 16.068  8.886   1.00 0.00 ? 54 GLU A C    3  
ATOM 4783  O O    . GLU A 1 54 ? -11.508 15.090  9.209   1.00 0.00 ? 54 GLU A O    3  
ATOM 4784  C CB   . GLU A 1 54 ? -11.687 16.421  6.563   1.00 0.00 ? 54 GLU A CB   3  
ATOM 4785  C CG   . GLU A 1 54 ? -11.392 16.806  5.123   1.00 0.00 ? 54 GLU A CG   3  
ATOM 4786  C CD   . GLU A 1 54 ? -11.246 18.303  4.938   1.00 0.00 ? 54 GLU A CD   3  
ATOM 4787  O OE1  . GLU A 1 54 ? -12.000 19.058  5.587   1.00 0.00 ? 54 GLU A OE1  3  
ATOM 4788  O OE2  . GLU A 1 54 ? -10.377 18.721  4.143   1.00 0.00 ? 54 GLU A OE2  3  
ATOM 4789  H H    . GLU A 1 54 ? -9.955  14.295  6.922   1.00 0.00 ? 54 GLU A H    3  
ATOM 4790  H HA   . GLU A 1 54 ? -9.865  17.208  7.365   1.00 0.00 ? 54 GLU A HA   3  
ATOM 4791  H HB2  . GLU A 1 54 ? -12.208 15.476  6.562   1.00 0.00 ? 54 GLU A HB2  3  
ATOM 4792  H HB3  . GLU A 1 54 ? -12.330 17.176  6.990   1.00 0.00 ? 54 GLU A HB3  3  
ATOM 4793  H HG2  . GLU A 1 54 ? -10.473 16.329  4.817   1.00 0.00 ? 54 GLU A HG2  3  
ATOM 4794  H HG3  . GLU A 1 54 ? -12.202 16.458  4.498   1.00 0.00 ? 54 GLU A HG3  3  
ATOM 4795  N N    . LYS A 1 55 ? -10.417 16.981  9.757   1.00 0.00 ? 55 LYS A N    3  
ATOM 4796  C CA   . LYS A 1 55 ? -10.729 16.890  11.171  1.00 0.00 ? 55 LYS A CA   3  
ATOM 4797  C C    . LYS A 1 55 ? -12.236 16.785  11.393  1.00 0.00 ? 55 LYS A C    3  
ATOM 4798  O O    . LYS A 1 55 ? -12.971 17.742  11.157  1.00 0.00 ? 55 LYS A O    3  
ATOM 4799  C CB   . LYS A 1 55 ? -10.175 18.105  11.917  1.00 0.00 ? 55 LYS A CB   3  
ATOM 4800  C CG   . LYS A 1 55 ? -10.480 19.429  11.236  1.00 0.00 ? 55 LYS A CG   3  
ATOM 4801  C CD   . LYS A 1 55 ? -10.263 20.602  12.178  1.00 0.00 ? 55 LYS A CD   3  
ATOM 4802  C CE   . LYS A 1 55 ? -8.849  21.149  12.070  1.00 0.00 ? 55 LYS A CE   3  
ATOM 4803  N NZ   . LYS A 1 55 ? -7.911  20.451  12.993  1.00 0.00 ? 55 LYS A NZ   3  
ATOM 4804  H H    . LYS A 1 55 ? -9.889  17.732  9.441   1.00 0.00 ? 55 LYS A H    3  
ATOM 4805  H HA   . LYS A 1 55 ? -10.255 16.004  11.545  1.00 0.00 ? 55 LYS A HA   3  
ATOM 4806  H HB2  . LYS A 1 55 ? -10.600 18.128  12.909  1.00 0.00 ? 55 LYS A HB2  3  
ATOM 4807  H HB3  . LYS A 1 55 ? -9.102  18.005  11.997  1.00 0.00 ? 55 LYS A HB3  3  
ATOM 4808  H HG2  . LYS A 1 55 ? -9.830  19.541  10.381  1.00 0.00 ? 55 LYS A HG2  3  
ATOM 4809  H HG3  . LYS A 1 55 ? -11.510 19.426  10.910  1.00 0.00 ? 55 LYS A HG3  3  
ATOM 4810  H HD2  . LYS A 1 55 ? -10.961 21.387  11.927  1.00 0.00 ? 55 LYS A HD2  3  
ATOM 4811  H HD3  . LYS A 1 55 ? -10.437 20.274  13.192  1.00 0.00 ? 55 LYS A HD3  3  
ATOM 4812  H HE2  . LYS A 1 55 ? -8.503  21.020  11.056  1.00 0.00 ? 55 LYS A HE2  3  
ATOM 4813  H HE3  . LYS A 1 55 ? -8.863  22.201  12.313  1.00 0.00 ? 55 LYS A HE3  3  
ATOM 4814  H HZ1  . LYS A 1 55 ? -8.129  20.700  13.979  1.00 0.00 ? 55 LYS A HZ1  3  
ATOM 4815  H HZ2  . LYS A 1 55 ? -6.931  20.729  12.785  1.00 0.00 ? 55 LYS A HZ2  3  
ATOM 4816  H HZ3  . LYS A 1 55 ? -7.999  19.421  12.879  1.00 0.00 ? 55 LYS A HZ3  3  
ATOM 4817  N N    . SER A 1 56 ? -12.686 15.620  11.851  1.00 0.00 ? 56 SER A N    3  
ATOM 4818  C CA   . SER A 1 56 ? -14.106 15.390  12.110  1.00 0.00 ? 56 SER A CA   3  
ATOM 4819  C C    . SER A 1 56 ? -14.951 15.678  10.868  1.00 0.00 ? 56 SER A C    3  
ATOM 4820  O O    . SER A 1 56 ? -15.278 14.768  10.105  1.00 0.00 ? 56 SER A O    3  
ATOM 4821  C CB   . SER A 1 56 ? -14.578 16.253  13.283  1.00 0.00 ? 56 SER A CB   3  
ATOM 4822  O OG   . SER A 1 56 ? -14.164 15.702  14.521  1.00 0.00 ? 56 SER A OG   3  
ATOM 4823  H H    . SER A 1 56 ? -12.049 14.897  12.028  1.00 0.00 ? 56 SER A H    3  
ATOM 4824  H HA   . SER A 1 56 ? -14.225 14.349  12.373  1.00 0.00 ? 56 SER A HA   3  
ATOM 4825  H HB2  . SER A 1 56 ? -14.162 17.245  13.188  1.00 0.00 ? 56 SER A HB2  3  
ATOM 4826  H HB3  . SER A 1 56 ? -15.657 16.312  13.272  1.00 0.00 ? 56 SER A HB3  3  
ATOM 4827  H HG   . SER A 1 56 ? -14.929 15.577  15.088  1.00 0.00 ? 56 SER A HG   3  
ATOM 4828  N N    . GLN A 1 57 ? -15.300 16.946  10.669  1.00 0.00 ? 57 GLN A N    3  
ATOM 4829  C CA   . GLN A 1 57 ? -16.104 17.348  9.521   1.00 0.00 ? 57 GLN A CA   3  
ATOM 4830  C C    . GLN A 1 57 ? -15.840 18.806  9.158   1.00 0.00 ? 57 GLN A C    3  
ATOM 4831  O O    . GLN A 1 57 ? -15.189 19.534  9.907   1.00 0.00 ? 57 GLN A O    3  
ATOM 4832  C CB   . GLN A 1 57 ? -17.592 17.143  9.817   1.00 0.00 ? 57 GLN A CB   3  
ATOM 4833  C CG   . GLN A 1 57 ? -18.137 15.820  9.306   1.00 0.00 ? 57 GLN A CG   3  
ATOM 4834  C CD   . GLN A 1 57 ? -18.763 15.941  7.930   1.00 0.00 ? 57 GLN A CD   3  
ATOM 4835  O OE1  . GLN A 1 57 ? -19.986 15.949  7.790   1.00 0.00 ? 57 GLN A OE1  3  
ATOM 4836  N NE2  . GLN A 1 57 ? -17.924 16.036  6.905   1.00 0.00 ? 57 GLN A NE2  3  
ATOM 4837  H H    . GLN A 1 57 ? -15.008 17.626  11.311  1.00 0.00 ? 57 GLN A H    3  
ATOM 4838  H HA   . GLN A 1 57 ? -15.824 16.725  8.686   1.00 0.00 ? 57 GLN A HA   3  
ATOM 4839  H HB2  . GLN A 1 57 ? -17.743 17.181  10.886  1.00 0.00 ? 57 GLN A HB2  3  
ATOM 4840  H HB3  . GLN A 1 57 ? -18.153 17.942  9.355   1.00 0.00 ? 57 GLN A HB3  3  
ATOM 4841  H HG2  . GLN A 1 57 ? -17.328 15.107  9.255   1.00 0.00 ? 57 GLN A HG2  3  
ATOM 4842  H HG3  . GLN A 1 57 ? -18.887 15.463  9.996   1.00 0.00 ? 57 GLN A HG3  3  
ATOM 4843  H HE21 . GLN A 1 57 ? -16.962 16.024  7.091   1.00 0.00 ? 57 GLN A HE21 3  
ATOM 4844  H HE22 . GLN A 1 57 ? -18.301 16.116  6.004   1.00 0.00 ? 57 GLN A HE22 3  
ATOM 4845  N N    . GLN A 1 58 ? -16.349 19.225  8.004   1.00 0.00 ? 58 GLN A N    3  
ATOM 4846  C CA   . GLN A 1 58 ? -16.167 20.596  7.542   1.00 0.00 ? 58 GLN A CA   3  
ATOM 4847  C C    . GLN A 1 58 ? -17.160 20.932  6.433   1.00 0.00 ? 58 GLN A C    3  
ATOM 4848  O O    . GLN A 1 58 ? -16.856 20.788  5.249   1.00 0.00 ? 58 GLN A O    3  
ATOM 4849  C CB   . GLN A 1 58 ? -14.733 20.802  7.045   1.00 0.00 ? 58 GLN A CB   3  
ATOM 4850  C CG   . GLN A 1 58 ? -14.003 21.933  7.750   1.00 0.00 ? 58 GLN A CG   3  
ATOM 4851  C CD   . GLN A 1 58 ? -12.503 21.714  7.802   1.00 0.00 ? 58 GLN A CD   3  
ATOM 4852  O OE1  . GLN A 1 58 ? -11.915 21.619  8.879   1.00 0.00 ? 58 GLN A OE1  3  
ATOM 4853  N NE2  . GLN A 1 58 ? -11.876 21.634  6.634   1.00 0.00 ? 58 GLN A NE2  3  
ATOM 4854  H H    . GLN A 1 58 ? -16.859 18.598  7.449   1.00 0.00 ? 58 GLN A H    3  
ATOM 4855  H HA   . GLN A 1 58 ? -16.346 21.253  8.380   1.00 0.00 ? 58 GLN A HA   3  
ATOM 4856  H HB2  . GLN A 1 58 ? -14.176 19.890  7.202   1.00 0.00 ? 58 GLN A HB2  3  
ATOM 4857  H HB3  . GLN A 1 58 ? -14.756 21.021  5.988   1.00 0.00 ? 58 GLN A HB3  3  
ATOM 4858  H HG2  . GLN A 1 58 ? -14.199 22.855  7.223   1.00 0.00 ? 58 GLN A HG2  3  
ATOM 4859  H HG3  . GLN A 1 58 ? -14.376 22.011  8.760   1.00 0.00 ? 58 GLN A HG3  3  
ATOM 4860  H HE21 . GLN A 1 58 ? -12.409 21.719  5.816   1.00 0.00 ? 58 GLN A HE21 3  
ATOM 4861  H HE22 . GLN A 1 58 ? -10.907 21.493  6.638   1.00 0.00 ? 58 GLN A HE22 3  
ATOM 4862  N N    . SER A 1 59 ? -18.349 21.379  6.826   1.00 0.00 ? 59 SER A N    3  
ATOM 4863  C CA   . SER A 1 59 ? -19.387 21.735  5.865   1.00 0.00 ? 59 SER A CA   3  
ATOM 4864  C C    . SER A 1 59 ? -19.584 23.246  5.812   1.00 0.00 ? 59 SER A C    3  
ATOM 4865  O O    . SER A 1 59 ? -19.216 23.963  6.742   1.00 0.00 ? 59 SER A O    3  
ATOM 4866  C CB   . SER A 1 59 ? -20.705 21.050  6.231   1.00 0.00 ? 59 SER A CB   3  
ATOM 4867  O OG   . SER A 1 59 ? -20.475 19.800  6.857   1.00 0.00 ? 59 SER A OG   3  
ATOM 4868  H H    . SER A 1 59 ? -18.532 21.471  7.784   1.00 0.00 ? 59 SER A H    3  
ATOM 4869  H HA   . SER A 1 59 ? -19.070 21.390  4.892   1.00 0.00 ? 59 SER A HA   3  
ATOM 4870  H HB2  . SER A 1 59 ? -21.260 21.681  6.909   1.00 0.00 ? 59 SER A HB2  3  
ATOM 4871  H HB3  . SER A 1 59 ? -21.285 20.888  5.334   1.00 0.00 ? 59 SER A HB3  3  
ATOM 4872  H HG   . SER A 1 59 ? -20.001 19.222  6.254   1.00 0.00 ? 59 SER A HG   3  
ATOM 4873  N N    . SER A 1 60 ? -20.166 23.724  4.717   1.00 0.00 ? 60 SER A N    3  
ATOM 4874  C CA   . SER A 1 60 ? -20.412 25.151  4.542   1.00 0.00 ? 60 SER A CA   3  
ATOM 4875  C C    . SER A 1 60 ? -21.908 25.438  4.455   1.00 0.00 ? 60 SER A C    3  
ATOM 4876  O O    . SER A 1 60 ? -22.649 24.725  3.778   1.00 0.00 ? 60 SER A O    3  
ATOM 4877  C CB   . SER A 1 60 ? -19.709 25.660  3.282   1.00 0.00 ? 60 SER A CB   3  
ATOM 4878  O OG   . SER A 1 60 ? -19.171 26.955  3.486   1.00 0.00 ? 60 SER A OG   3  
ATOM 4879  H H    . SER A 1 60 ? -20.437 23.102  4.010   1.00 0.00 ? 60 SER A H    3  
ATOM 4880  H HA   . SER A 1 60 ? -20.008 25.665  5.401   1.00 0.00 ? 60 SER A HA   3  
ATOM 4881  H HB2  . SER A 1 60 ? -18.905 24.987  3.024   1.00 0.00 ? 60 SER A HB2  3  
ATOM 4882  H HB3  . SER A 1 60 ? -20.419 25.702  2.468   1.00 0.00 ? 60 SER A HB3  3  
ATOM 4883  H HG   . SER A 1 60 ? -18.395 27.070  2.932   1.00 0.00 ? 60 SER A HG   3  
ATOM 4884  N N    . TYR A 1 61 ? -22.345 26.487  5.144   1.00 0.00 ? 61 TYR A N    3  
ATOM 4885  C CA   . TYR A 1 61 ? -23.752 26.868  5.144   1.00 0.00 ? 61 TYR A CA   3  
ATOM 4886  C C    . TYR A 1 61 ? -24.142 27.513  3.818   1.00 0.00 ? 61 TYR A C    3  
ATOM 4887  O O    . TYR A 1 61 ? -23.823 28.705  3.624   1.00 0.00 ? 61 TYR A O    3  
ATOM 4888  C CB   . TYR A 1 61 ? -24.041 27.832  6.297   1.00 0.00 ? 61 TYR A CB   3  
ATOM 4889  C CG   . TYR A 1 61 ? -24.402 27.138  7.591   1.00 0.00 ? 61 TYR A CG   3  
ATOM 4890  C CD1  . TYR A 1 61 ? -23.546 26.205  8.164   1.00 0.00 ? 61 TYR A CD1  3  
ATOM 4891  C CD2  . TYR A 1 61 ? -25.598 27.417  8.241   1.00 0.00 ? 61 TYR A CD2  3  
ATOM 4892  C CE1  . TYR A 1 61 ? -23.872 25.569  9.346   1.00 0.00 ? 61 TYR A CE1  3  
ATOM 4893  C CE2  . TYR A 1 61 ? -25.931 26.786  9.425   1.00 0.00 ? 61 TYR A CE2  3  
ATOM 4894  C CZ   . TYR A 1 61 ? -25.065 25.863  9.973   1.00 0.00 ? 61 TYR A CZ   3  
ATOM 4895  O OH   . TYR A 1 61 ? -25.393 25.232  11.151  1.00 0.00 ? 61 TYR A OH   3  
ATOM 4896  O OXT  . TYR A 1 61 ? -24.761 26.819  2.983   1.00 0.00 ? 61 TYR A OXT  3  
ATOM 4897  H H    . TYR A 1 61 ? -21.706 27.017  5.665   1.00 0.00 ? 61 TYR A H    3  
ATOM 4898  H HA   . TYR A 1 61 ? -24.338 25.972  5.281   1.00 0.00 ? 61 TYR A HA   3  
ATOM 4899  H HB2  . TYR A 1 61 ? -23.166 28.437  6.479   1.00 0.00 ? 61 TYR A HB2  3  
ATOM 4900  H HB3  . TYR A 1 61 ? -24.866 28.473  6.022   1.00 0.00 ? 61 TYR A HB3  3  
ATOM 4901  H HD1  . TYR A 1 61 ? -22.612 25.978  7.671   1.00 0.00 ? 61 TYR A HD1  3  
ATOM 4902  H HD2  . TYR A 1 61 ? -26.274 28.140  7.809   1.00 0.00 ? 61 TYR A HD2  3  
ATOM 4903  H HE1  . TYR A 1 61 ? -23.194 24.847  9.776   1.00 0.00 ? 61 TYR A HE1  3  
ATOM 4904  H HE2  . TYR A 1 61 ? -26.865 27.016  9.915   1.00 0.00 ? 61 TYR A HE2  3  
ATOM 4905  H HH   . TYR A 1 61 ? -25.689 25.883  11.791  1.00 0.00 ? 61 TYR A HH   3  
ATOM 4906  N N    . MET B 1 1  ? 0.079   14.027  4.106   1.00 0.00 ? 1  MET B N    3  
ATOM 4907  C CA   . MET B 1 1  ? 0.459   12.818  4.883   1.00 0.00 ? 1  MET B CA   3  
ATOM 4908  C C    . MET B 1 1  ? -0.675  12.375  5.801   1.00 0.00 ? 1  MET B C    3  
ATOM 4909  O O    . MET B 1 1  ? -1.132  13.139  6.652   1.00 0.00 ? 1  MET B O    3  
ATOM 4910  C CB   . MET B 1 1  ? 1.708   13.140  5.705   1.00 0.00 ? 1  MET B CB   3  
ATOM 4911  C CG   . MET B 1 1  ? 1.579   14.405  6.538   1.00 0.00 ? 1  MET B CG   3  
ATOM 4912  S SD   . MET B 1 1  ? 3.153   14.945  7.231   1.00 0.00 ? 1  MET B SD   3  
ATOM 4913  C CE   . MET B 1 1  ? 2.907   16.718  7.288   1.00 0.00 ? 1  MET B CE   3  
ATOM 4914  H H1   . MET B 1 1  ? 0.949   14.432  3.704   1.00 0.00 ? 1  MET B H1   3  
ATOM 4915  H H2   . MET B 1 1  ? -0.378  14.694  4.761   1.00 0.00 ? 1  MET B H2   3  
ATOM 4916  H H3   . MET B 1 1  ? -0.575  13.729  3.356   1.00 0.00 ? 1  MET B H3   3  
ATOM 4917  H HA   . MET B 1 1  ? 0.684   12.021  4.191   1.00 0.00 ? 1  MET B HA   3  
ATOM 4918  H HB2  . MET B 1 1  ? 1.910   12.315  6.372   1.00 0.00 ? 1  MET B HB2  3  
ATOM 4919  H HB3  . MET B 1 1  ? 2.546   13.262  5.033   1.00 0.00 ? 1  MET B HB3  3  
ATOM 4920  H HG2  . MET B 1 1  ? 1.189   15.194  5.912   1.00 0.00 ? 1  MET B HG2  3  
ATOM 4921  H HG3  . MET B 1 1  ? 0.890   14.217  7.348   1.00 0.00 ? 1  MET B HG3  3  
ATOM 4922  H HE1  . MET B 1 1  ? 2.094   16.990  6.631   1.00 0.00 ? 1  MET B HE1  3  
ATOM 4923  H HE2  . MET B 1 1  ? 3.810   17.217  6.968   1.00 0.00 ? 1  MET B HE2  3  
ATOM 4924  H HE3  . MET B 1 1  ? 2.669   17.017  8.298   1.00 0.00 ? 1  MET B HE3  3  
ATOM 4925  N N    . LEU B 1 2  ? -1.126  11.138  5.623   1.00 0.00 ? 2  LEU B N    3  
ATOM 4926  C CA   . LEU B 1 2  ? -2.207  10.594  6.436   1.00 0.00 ? 2  LEU B CA   3  
ATOM 4927  C C    . LEU B 1 2  ? -1.761  9.328   7.161   1.00 0.00 ? 2  LEU B C    3  
ATOM 4928  O O    . LEU B 1 2  ? -1.607  8.273   6.546   1.00 0.00 ? 2  LEU B O    3  
ATOM 4929  C CB   . LEU B 1 2  ? -3.425  10.290  5.561   1.00 0.00 ? 2  LEU B CB   3  
ATOM 4930  C CG   . LEU B 1 2  ? -4.170  11.519  5.038   1.00 0.00 ? 2  LEU B CG   3  
ATOM 4931  C CD1  . LEU B 1 2  ? -3.645  11.920  3.669   1.00 0.00 ? 2  LEU B CD1  3  
ATOM 4932  C CD2  . LEU B 1 2  ? -5.667  11.251  4.980   1.00 0.00 ? 2  LEU B CD2  3  
ATOM 4933  H H    . LEU B 1 2  ? -0.721  10.576  4.928   1.00 0.00 ? 2  LEU B H    3  
ATOM 4934  H HA   . LEU B 1 2  ? -2.480  11.338  7.169   1.00 0.00 ? 2  LEU B HA   3  
ATOM 4935  H HB2  . LEU B 1 2  ? -3.096  9.706   4.713   1.00 0.00 ? 2  LEU B HB2  3  
ATOM 4936  H HB3  . LEU B 1 2  ? -4.117  9.695   6.138   1.00 0.00 ? 2  LEU B HB3  3  
ATOM 4937  H HG   . LEU B 1 2  ? -4.004  12.346  5.714   1.00 0.00 ? 2  LEU B HG   3  
ATOM 4938  H HD11 . LEU B 1 2  ? -2.577  12.073  3.723   1.00 0.00 ? 2  LEU B HD11 3  
ATOM 4939  H HD12 . LEU B 1 2  ? -4.123  12.835  3.353   1.00 0.00 ? 2  LEU B HD12 3  
ATOM 4940  H HD13 . LEU B 1 2  ? -3.860  11.136  2.957   1.00 0.00 ? 2  LEU B HD13 3  
ATOM 4941  H HD21 . LEU B 1 2  ? -5.926  10.498  5.709   1.00 0.00 ? 2  LEU B HD21 3  
ATOM 4942  H HD22 . LEU B 1 2  ? -5.931  10.902  3.992   1.00 0.00 ? 2  LEU B HD22 3  
ATOM 4943  H HD23 . LEU B 1 2  ? -6.205  12.162  5.196   1.00 0.00 ? 2  LEU B HD23 3  
ATOM 4944  N N    . ILE B 1 3  ? -1.563  9.435   8.472   1.00 0.00 ? 3  ILE B N    3  
ATOM 4945  C CA   . ILE B 1 3  ? -1.145  8.291   9.272   1.00 0.00 ? 3  ILE B CA   3  
ATOM 4946  C C    . ILE B 1 3  ? -2.223  7.906   10.276  1.00 0.00 ? 3  ILE B C    3  
ATOM 4947  O O    . ILE B 1 3  ? -2.530  8.657   11.202  1.00 0.00 ? 3  ILE B O    3  
ATOM 4948  C CB   . ILE B 1 3  ? 0.184   8.558   10.012  1.00 0.00 ? 3  ILE B CB   3  
ATOM 4949  C CG1  . ILE B 1 3  ? 0.624   7.314   10.788  1.00 0.00 ? 3  ILE B CG1  3  
ATOM 4950  C CG2  . ILE B 1 3  ? 0.051   9.749   10.947  1.00 0.00 ? 3  ILE B CG2  3  
ATOM 4951  C CD1  . ILE B 1 3  ? 2.123   7.104   10.794  1.00 0.00 ? 3  ILE B CD1  3  
ATOM 4952  H H    . ILE B 1 3  ? -1.710  10.299  8.910   1.00 0.00 ? 3  ILE B H    3  
ATOM 4953  H HA   . ILE B 1 3  ? -0.996  7.461   8.601   1.00 0.00 ? 3  ILE B HA   3  
ATOM 4954  H HB   . ILE B 1 3  ? 0.936   8.796   9.275   1.00 0.00 ? 3  ILE B HB   3  
ATOM 4955  H HG12 . ILE B 1 3  ? 0.298   7.405   11.813  1.00 0.00 ? 3  ILE B HG12 3  
ATOM 4956  H HG13 . ILE B 1 3  ? 0.167   6.442   10.346  1.00 0.00 ? 3  ILE B HG13 3  
ATOM 4957  H HG21 . ILE B 1 3  ? -0.400  10.575  10.418  1.00 0.00 ? 3  ILE B HG21 3  
ATOM 4958  H HG22 . ILE B 1 3  ? 1.030   10.037  11.300  1.00 0.00 ? 3  ILE B HG22 3  
ATOM 4959  H HG23 . ILE B 1 3  ? -0.568  9.478   11.789  1.00 0.00 ? 3  ILE B HG23 3  
ATOM 4960  H HD11 . ILE B 1 3  ? 2.358   6.182   11.308  1.00 0.00 ? 3  ILE B HD11 3  
ATOM 4961  H HD12 . ILE B 1 3  ? 2.599   7.931   11.301  1.00 0.00 ? 3  ILE B HD12 3  
ATOM 4962  H HD13 . ILE B 1 3  ? 2.484   7.050   9.777   1.00 0.00 ? 3  ILE B HD13 3  
ATOM 4963  N N    . LEU B 1 4  ? -2.779  6.715   10.091  1.00 0.00 ? 4  LEU B N    3  
ATOM 4964  C CA   . LEU B 1 4  ? -3.808  6.199   10.982  1.00 0.00 ? 4  LEU B CA   3  
ATOM 4965  C C    . LEU B 1 4  ? -3.415  4.829   11.526  1.00 0.00 ? 4  LEU B C    3  
ATOM 4966  O O    . LEU B 1 4  ? -2.951  3.967   10.776  1.00 0.00 ? 4  LEU B O    3  
ATOM 4967  C CB   . LEU B 1 4  ? -5.150  6.106   10.254  1.00 0.00 ? 4  LEU B CB   3  
ATOM 4968  C CG   . LEU B 1 4  ? -6.375  6.477   11.095  1.00 0.00 ? 4  LEU B CG   3  
ATOM 4969  C CD1  . LEU B 1 4  ? -6.307  5.824   12.468  1.00 0.00 ? 4  LEU B CD1  3  
ATOM 4970  C CD2  . LEU B 1 4  ? -6.491  7.988   11.227  1.00 0.00 ? 4  LEU B CD2  3  
ATOM 4971  H H    . LEU B 1 4  ? -2.458  6.151   9.357   1.00 0.00 ? 4  LEU B H    3  
ATOM 4972  H HA   . LEU B 1 4  ? -3.904  6.886   11.809  1.00 0.00 ? 4  LEU B HA   3  
ATOM 4973  H HB2  . LEU B 1 4  ? -5.116  6.763   9.397   1.00 0.00 ? 4  LEU B HB2  3  
ATOM 4974  H HB3  . LEU B 1 4  ? -5.276  5.093   9.904   1.00 0.00 ? 4  LEU B HB3  3  
ATOM 4975  H HG   . LEU B 1 4  ? -7.264  6.115   10.600  1.00 0.00 ? 4  LEU B HG   3  
ATOM 4976  H HD11 . LEU B 1 4  ? -7.297  5.786   12.898  1.00 0.00 ? 4  LEU B HD11 3  
ATOM 4977  H HD12 . LEU B 1 4  ? -5.658  6.401   13.109  1.00 0.00 ? 4  LEU B HD12 3  
ATOM 4978  H HD13 . LEU B 1 4  ? -5.918  4.821   12.370  1.00 0.00 ? 4  LEU B HD13 3  
ATOM 4979  H HD21 . LEU B 1 4  ? -5.703  8.355   11.868  1.00 0.00 ? 4  LEU B HD21 3  
ATOM 4980  H HD22 . LEU B 1 4  ? -7.450  8.240   11.655  1.00 0.00 ? 4  LEU B HD22 3  
ATOM 4981  H HD23 . LEU B 1 4  ? -6.402  8.443   10.251  1.00 0.00 ? 4  LEU B HD23 3  
ATOM 4982  N N    . THR B 1 5  ? -3.609  4.617   12.822  1.00 0.00 ? 5  THR B N    3  
ATOM 4983  C CA   . THR B 1 5  ? -3.281  3.331   13.420  1.00 0.00 ? 5  THR B CA   3  
ATOM 4984  C C    . THR B 1 5  ? -4.140  2.241   12.795  1.00 0.00 ? 5  THR B C    3  
ATOM 4985  O O    . THR B 1 5  ? -5.261  2.500   12.357  1.00 0.00 ? 5  THR B O    3  
ATOM 4986  C CB   . THR B 1 5  ? -3.498  3.355   14.932  1.00 0.00 ? 5  THR B CB   3  
ATOM 4987  O OG1  . THR B 1 5  ? -3.693  4.680   15.394  1.00 0.00 ? 5  THR B OG1  3  
ATOM 4988  C CG2  . THR B 1 5  ? -2.340  2.762   15.704  1.00 0.00 ? 5  THR B CG2  3  
ATOM 4989  H H    . THR B 1 5  ? -3.979  5.330   13.382  1.00 0.00 ? 5  THR B H    3  
ATOM 4990  H HA   . THR B 1 5  ? -2.242  3.121   13.212  1.00 0.00 ? 5  THR B HA   3  
ATOM 4991  H HB   . THR B 1 5  ? -4.381  2.776   15.168  1.00 0.00 ? 5  THR B HB   3  
ATOM 4992  H HG1  . THR B 1 5  ? -4.605  4.941   15.243  1.00 0.00 ? 5  THR B HG1  3  
ATOM 4993  H HG21 . THR B 1 5  ? -1.459  3.367   15.553  1.00 0.00 ? 5  THR B HG21 3  
ATOM 4994  H HG22 . THR B 1 5  ? -2.152  1.758   15.353  1.00 0.00 ? 5  THR B HG22 3  
ATOM 4995  H HG23 . THR B 1 5  ? -2.584  2.737   16.756  1.00 0.00 ? 5  THR B HG23 3  
ATOM 4996  N N    . ARG B 1 6  ? -3.617  1.025   12.751  1.00 0.00 ? 6  ARG B N    3  
ATOM 4997  C CA   . ARG B 1 6  ? -4.354  -0.085  12.172  1.00 0.00 ? 6  ARG B CA   3  
ATOM 4998  C C    . ARG B 1 6  ? -3.659  -1.412  12.435  1.00 0.00 ? 6  ARG B C    3  
ATOM 4999  O O    . ARG B 1 6  ? -2.432  -1.487  12.511  1.00 0.00 ? 6  ARG B O    3  
ATOM 5000  C CB   . ARG B 1 6  ? -4.525  0.121   10.666  1.00 0.00 ? 6  ARG B CB   3  
ATOM 5001  C CG   . ARG B 1 6  ? -5.747  -0.576  10.090  1.00 0.00 ? 6  ARG B CG   3  
ATOM 5002  C CD   . ARG B 1 6  ? -7.035  0.108   10.521  1.00 0.00 ? 6  ARG B CD   3  
ATOM 5003  N NE   . ARG B 1 6  ? -7.794  -0.703  11.469  1.00 0.00 ? 6  ARG B NE   3  
ATOM 5004  C CZ   . ARG B 1 6  ? -9.088  -0.525  11.727  1.00 0.00 ? 6  ARG B CZ   3  
ATOM 5005  N NH1  . ARG B 1 6  ? -9.769  0.434   11.111  1.00 0.00 ? 6  ARG B NH1  3  
ATOM 5006  N NH2  . ARG B 1 6  ? -9.703  -1.308  12.603  1.00 0.00 ? 6  ARG B NH2  3  
ATOM 5007  H H    . ARG B 1 6  ? -2.719  0.872   13.113  1.00 0.00 ? 6  ARG B H    3  
ATOM 5008  H HA   . ARG B 1 6  ? -5.330  -0.108  12.632  1.00 0.00 ? 6  ARG B HA   3  
ATOM 5009  H HB2  . ARG B 1 6  ? -4.613  1.179   10.468  1.00 0.00 ? 6  ARG B HB2  3  
ATOM 5010  H HB3  . ARG B 1 6  ? -3.649  -0.259  10.162  1.00 0.00 ? 6  ARG B HB3  3  
ATOM 5011  H HG2  . ARG B 1 6  ? -5.685  -0.557  9.013   1.00 0.00 ? 6  ARG B HG2  3  
ATOM 5012  H HG3  . ARG B 1 6  ? -5.761  -1.600  10.435  1.00 0.00 ? 6  ARG B HG3  3  
ATOM 5013  H HD2  . ARG B 1 6  ? -6.791  1.052   10.985  1.00 0.00 ? 6  ARG B HD2  3  
ATOM 5014  H HD3  . ARG B 1 6  ? -7.643  0.285   9.646   1.00 0.00 ? 6  ARG B HD3  3  
ATOM 5015  H HE   . ARG B 1 6  ? -7.316  -1.418  11.939  1.00 0.00 ? 6  ARG B HE   3  
ATOM 5016  H HH11 . ARG B 1 6  ? -9.311  1.027   10.449  1.00 0.00 ? 6  ARG B HH11 3  
ATOM 5017  H HH12 . ARG B 1 6  ? -10.740 0.562   11.309  1.00 0.00 ? 6  ARG B HH12 3  
ATOM 5018  H HH21 . ARG B 1 6  ? -9.195  -2.032  13.070  1.00 0.00 ? 6  ARG B HH21 3  
ATOM 5019  H HH22 . ARG B 1 6  ? -10.675 -1.174  12.797  1.00 0.00 ? 6  ARG B HH22 3  
ATOM 5020  N N    . ARG B 1 7  ? -4.464  -2.456  12.568  1.00 0.00 ? 7  ARG B N    3  
ATOM 5021  C CA   . ARG B 1 7  ? -3.950  -3.799  12.815  1.00 0.00 ? 7  ARG B CA   3  
ATOM 5022  C C    . ARG B 1 7  ? -5.074  -4.841  12.850  1.00 0.00 ? 7  ARG B C    3  
ATOM 5023  O O    . ARG B 1 7  ? -4.838  -6.002  13.176  1.00 0.00 ? 7  ARG B O    3  
ATOM 5024  C CB   . ARG B 1 7  ? -3.170  -3.831  14.129  1.00 0.00 ? 7  ARG B CB   3  
ATOM 5025  C CG   . ARG B 1 7  ? -2.448  -5.147  14.377  1.00 0.00 ? 7  ARG B CG   3  
ATOM 5026  C CD   . ARG B 1 7  ? -2.820  -5.743  15.725  1.00 0.00 ? 7  ARG B CD   3  
ATOM 5027  N NE   . ARG B 1 7  ? -4.248  -6.039  15.818  1.00 0.00 ? 7  ARG B NE   3  
ATOM 5028  C CZ   . ARG B 1 7  ? -4.912  -6.143  16.967  1.00 0.00 ? 7  ARG B CZ   3  
ATOM 5029  N NH1  . ARG B 1 7  ? -4.282  -5.979  18.125  1.00 0.00 ? 7  ARG B NH1  3  
ATOM 5030  N NH2  . ARG B 1 7  ? -6.210  -6.413  16.960  1.00 0.00 ? 7  ARG B NH2  3  
ATOM 5031  H H    . ARG B 1 7  ? -5.428  -2.316  12.497  1.00 0.00 ? 7  ARG B H    3  
ATOM 5032  H HA   . ARG B 1 7  ? -3.278  -4.046  12.007  1.00 0.00 ? 7  ARG B HA   3  
ATOM 5033  H HB2  . ARG B 1 7  ? -2.435  -3.039  14.114  1.00 0.00 ? 7  ARG B HB2  3  
ATOM 5034  H HB3  . ARG B 1 7  ? -3.855  -3.660  14.946  1.00 0.00 ? 7  ARG B HB3  3  
ATOM 5035  H HG2  . ARG B 1 7  ? -2.715  -5.846  13.597  1.00 0.00 ? 7  ARG B HG2  3  
ATOM 5036  H HG3  . ARG B 1 7  ? -1.382  -4.970  14.353  1.00 0.00 ? 7  ARG B HG3  3  
ATOM 5037  H HD2  . ARG B 1 7  ? -2.263  -6.658  15.866  1.00 0.00 ? 7  ARG B HD2  3  
ATOM 5038  H HD3  . ARG B 1 7  ? -2.556  -5.039  16.500  1.00 0.00 ? 7  ARG B HD3  3  
ATOM 5039  H HE   . ARG B 1 7  ? -4.739  -6.166  14.979  1.00 0.00 ? 7  ARG B HE   3  
ATOM 5040  H HH11 . ARG B 1 7  ? -3.303  -5.778  18.139  1.00 0.00 ? 7  ARG B HH11 3  
ATOM 5041  H HH12 . ARG B 1 7  ? -4.788  -6.057  18.984  1.00 0.00 ? 7  ARG B HH12 3  
ATOM 5042  H HH21 . ARG B 1 7  ? -6.690  -6.538  16.092  1.00 0.00 ? 7  ARG B HH21 3  
ATOM 5043  H HH22 . ARG B 1 7  ? -6.709  -6.491  17.823  1.00 0.00 ? 7  ARG B HH22 3  
ATOM 5044  N N    . VAL B 1 8  ? -6.296  -4.427  12.516  1.00 0.00 ? 8  VAL B N    3  
ATOM 5045  C CA   . VAL B 1 8  ? -7.434  -5.336  12.519  1.00 0.00 ? 8  VAL B CA   3  
ATOM 5046  C C    . VAL B 1 8  ? -7.980  -5.534  11.109  1.00 0.00 ? 8  VAL B C    3  
ATOM 5047  O O    . VAL B 1 8  ? -7.983  -6.647  10.584  1.00 0.00 ? 8  VAL B O    3  
ATOM 5048  C CB   . VAL B 1 8  ? -8.566  -4.818  13.428  1.00 0.00 ? 8  VAL B CB   3  
ATOM 5049  C CG1  . VAL B 1 8  ? -9.563  -5.927  13.724  1.00 0.00 ? 8  VAL B CG1  3  
ATOM 5050  C CG2  . VAL B 1 8  ? -7.997  -4.245  14.719  1.00 0.00 ? 8  VAL B CG2  3  
ATOM 5051  H H    . VAL B 1 8  ? -6.437  -3.493  12.268  1.00 0.00 ? 8  VAL B H    3  
ATOM 5052  H HA   . VAL B 1 8  ? -7.100  -6.289  12.902  1.00 0.00 ? 8  VAL B HA   3  
ATOM 5053  H HB   . VAL B 1 8  ? -9.086  -4.027  12.907  1.00 0.00 ? 8  VAL B HB   3  
ATOM 5054  H HG11 . VAL B 1 8  ? -9.970  -5.790  14.715  1.00 0.00 ? 8  VAL B HG11 3  
ATOM 5055  H HG12 . VAL B 1 8  ? -9.065  -6.883  13.668  1.00 0.00 ? 8  VAL B HG12 3  
ATOM 5056  H HG13 . VAL B 1 8  ? -10.363 -5.895  12.999  1.00 0.00 ? 8  VAL B HG13 3  
ATOM 5057  H HG21 . VAL B 1 8  ? -7.587  -3.264  14.528  1.00 0.00 ? 8  VAL B HG21 3  
ATOM 5058  H HG22 . VAL B 1 8  ? -7.216  -4.895  15.088  1.00 0.00 ? 8  VAL B HG22 3  
ATOM 5059  H HG23 . VAL B 1 8  ? -8.781  -4.170  15.457  1.00 0.00 ? 8  VAL B HG23 3  
ATOM 5060  N N    . GLY B 1 9  ? -8.442  -4.446  10.499  1.00 0.00 ? 9  GLY B N    3  
ATOM 5061  C CA   . GLY B 1 9  ? -8.983  -4.522  9.155   1.00 0.00 ? 9  GLY B CA   3  
ATOM 5062  C C    . GLY B 1 9  ? -8.752  -3.250  8.364   1.00 0.00 ? 9  GLY B C    3  
ATOM 5063  O O    . GLY B 1 9  ? -9.611  -2.368  8.329   1.00 0.00 ? 9  GLY B O    3  
ATOM 5064  H H    . GLY B 1 9  ? -8.415  -3.585  10.966  1.00 0.00 ? 9  GLY B H    3  
ATOM 5065  H HA2  . GLY B 1 9  ? -8.514  -5.346  8.636   1.00 0.00 ? 9  GLY B HA2  3  
ATOM 5066  H HA3  . GLY B 1 9  ? -10.045 -4.707  9.217   1.00 0.00 ? 9  GLY B HA3  3  
ATOM 5067  N N    . GLU B 1 10 ? -7.589  -3.153  7.727   1.00 0.00 ? 10 GLU B N    3  
ATOM 5068  C CA   . GLU B 1 10 ? -7.248  -1.978  6.933   1.00 0.00 ? 10 GLU B CA   3  
ATOM 5069  C C    . GLU B 1 10 ? -7.867  -2.062  5.541   1.00 0.00 ? 10 GLU B C    3  
ATOM 5070  O O    . GLU B 1 10 ? -8.421  -3.093  5.160   1.00 0.00 ? 10 GLU B O    3  
ATOM 5071  C CB   . GLU B 1 10 ? -5.728  -1.837  6.821   1.00 0.00 ? 10 GLU B CB   3  
ATOM 5072  C CG   . GLU B 1 10 ? -5.267  -0.413  6.552   1.00 0.00 ? 10 GLU B CG   3  
ATOM 5073  C CD   . GLU B 1 10 ? -4.818  -0.205  5.118   1.00 0.00 ? 10 GLU B CD   3  
ATOM 5074  O OE1  . GLU B 1 10 ? -4.383  -1.188  4.483   1.00 0.00 ? 10 GLU B OE1  3  
ATOM 5075  O OE2  . GLU B 1 10 ? -4.902  0.942   4.631   1.00 0.00 ? 10 GLU B OE2  3  
ATOM 5076  H H    . GLU B 1 10 ? -6.945  -3.888  7.793   1.00 0.00 ? 10 GLU B H    3  
ATOM 5077  H HA   . GLU B 1 10 ? -7.644  -1.110  7.438   1.00 0.00 ? 10 GLU B HA   3  
ATOM 5078  H HB2  . GLU B 1 10 ? -5.279  -2.169  7.746   1.00 0.00 ? 10 GLU B HB2  3  
ATOM 5079  H HB3  . GLU B 1 10 ? -5.378  -2.465  6.016   1.00 0.00 ? 10 GLU B HB3  3  
ATOM 5080  H HG2  . GLU B 1 10 ? -6.084  0.261   6.758   1.00 0.00 ? 10 GLU B HG2  3  
ATOM 5081  H HG3  . GLU B 1 10 ? -4.440  -0.187  7.209   1.00 0.00 ? 10 GLU B HG3  3  
ATOM 5082  N N    . THR B 1 11 ? -7.768  -0.971  4.785   1.00 0.00 ? 11 THR B N    3  
ATOM 5083  C CA   . THR B 1 11 ? -8.319  -0.925  3.434   1.00 0.00 ? 11 THR B CA   3  
ATOM 5084  C C    . THR B 1 11 ? -8.099  0.443   2.797   1.00 0.00 ? 11 THR B C    3  
ATOM 5085  O O    . THR B 1 11 ? -8.527  1.466   3.332   1.00 0.00 ? 11 THR B O    3  
ATOM 5086  C CB   . THR B 1 11 ? -9.814  -1.253  3.456   1.00 0.00 ? 11 THR B CB   3  
ATOM 5087  O OG1  . THR B 1 11 ? -10.393 -1.038  2.182   1.00 0.00 ? 11 THR B OG1  3  
ATOM 5088  C CG2  . THR B 1 11 ? -10.592 -0.429  4.459   1.00 0.00 ? 11 THR B CG2  3  
ATOM 5089  H H    . THR B 1 11 ? -7.313  -0.182  5.145   1.00 0.00 ? 11 THR B H    3  
ATOM 5090  H HA   . THR B 1 11 ? -7.806  -1.669  2.843   1.00 0.00 ? 11 THR B HA   3  
ATOM 5091  H HB   . THR B 1 11 ? -9.939  -2.294  3.715   1.00 0.00 ? 11 THR B HB   3  
ATOM 5092  H HG1  . THR B 1 11 ? -10.683 -1.877  1.816   1.00 0.00 ? 11 THR B HG1  3  
ATOM 5093  H HG21 . THR B 1 11 ? -10.078 -0.438  5.409   1.00 0.00 ? 11 THR B HG21 3  
ATOM 5094  H HG22 . THR B 1 11 ? -11.579 -0.849  4.581   1.00 0.00 ? 11 THR B HG22 3  
ATOM 5095  H HG23 . THR B 1 11 ? -10.674 0.587   4.104   1.00 0.00 ? 11 THR B HG23 3  
ATOM 5096  N N    . LEU B 1 12 ? -7.432  0.450   1.648   1.00 0.00 ? 12 LEU B N    3  
ATOM 5097  C CA   . LEU B 1 12 ? -7.155  1.687   0.929   1.00 0.00 ? 12 LEU B CA   3  
ATOM 5098  C C    . LEU B 1 12 ? -7.221  1.453   -0.578  1.00 0.00 ? 12 LEU B C    3  
ATOM 5099  O O    . LEU B 1 12 ? -6.778  0.416   -1.071  1.00 0.00 ? 12 LEU B O    3  
ATOM 5100  C CB   . LEU B 1 12 ? -5.776  2.237   1.335   1.00 0.00 ? 12 LEU B CB   3  
ATOM 5101  C CG   . LEU B 1 12 ? -4.787  2.494   0.188   1.00 0.00 ? 12 LEU B CG   3  
ATOM 5102  C CD1  . LEU B 1 12 ? -5.078  3.828   -0.482  1.00 0.00 ? 12 LEU B CD1  3  
ATOM 5103  C CD2  . LEU B 1 12 ? -3.356  2.457   0.697   1.00 0.00 ? 12 LEU B CD2  3  
ATOM 5104  H H    . LEU B 1 12 ? -7.120  -0.399  1.273   1.00 0.00 ? 12 LEU B H    3  
ATOM 5105  H HA   . LEU B 1 12 ? -7.914  2.406   1.202   1.00 0.00 ? 12 LEU B HA   3  
ATOM 5106  H HB2  . LEU B 1 12 ? -5.928  3.168   1.861   1.00 0.00 ? 12 LEU B HB2  3  
ATOM 5107  H HB3  . LEU B 1 12 ? -5.322  1.533   2.016   1.00 0.00 ? 12 LEU B HB3  3  
ATOM 5108  H HG   . LEU B 1 12 ? -4.895  1.718   -0.555  1.00 0.00 ? 12 LEU B HG   3  
ATOM 5109  H HD11 . LEU B 1 12 ? -4.597  3.858   -1.448  1.00 0.00 ? 12 LEU B HD11 3  
ATOM 5110  H HD12 . LEU B 1 12 ? -4.699  4.630   0.134   1.00 0.00 ? 12 LEU B HD12 3  
ATOM 5111  H HD13 . LEU B 1 12 ? -6.145  3.943   -0.607  1.00 0.00 ? 12 LEU B HD13 3  
ATOM 5112  H HD21 . LEU B 1 12 ? -2.695  2.187   -0.114  1.00 0.00 ? 12 LEU B HD21 3  
ATOM 5113  H HD22 . LEU B 1 12 ? -3.274  1.725   1.487   1.00 0.00 ? 12 LEU B HD22 3  
ATOM 5114  H HD23 . LEU B 1 12 ? -3.083  3.430   1.077   1.00 0.00 ? 12 LEU B HD23 3  
ATOM 5115  N N    . MET B 1 13 ? -7.767  2.420   -1.309  1.00 0.00 ? 13 MET B N    3  
ATOM 5116  C CA   . MET B 1 13 ? -7.870  2.300   -2.756  1.00 0.00 ? 13 MET B CA   3  
ATOM 5117  C C    . MET B 1 13 ? -7.400  3.576   -3.447  1.00 0.00 ? 13 MET B C    3  
ATOM 5118  O O    . MET B 1 13 ? -8.141  4.553   -3.544  1.00 0.00 ? 13 MET B O    3  
ATOM 5119  C CB   . MET B 1 13 ? -9.312  1.990   -3.159  1.00 0.00 ? 13 MET B CB   3  
ATOM 5120  C CG   . MET B 1 13 ? -9.496  1.783   -4.654  1.00 0.00 ? 13 MET B CG   3  
ATOM 5121  S SD   . MET B 1 13 ? -11.144 2.242   -5.221  1.00 0.00 ? 13 MET B SD   3  
ATOM 5122  C CE   . MET B 1 13 ? -10.843 2.495   -6.968  1.00 0.00 ? 13 MET B CE   3  
ATOM 5123  H H    . MET B 1 13 ? -8.102  3.229   -0.868  1.00 0.00 ? 13 MET B H    3  
ATOM 5124  H HA   . MET B 1 13 ? -7.236  1.483   -3.066  1.00 0.00 ? 13 MET B HA   3  
ATOM 5125  H HB2  . MET B 1 13 ? -9.630  1.091   -2.652  1.00 0.00 ? 13 MET B HB2  3  
ATOM 5126  H HB3  . MET B 1 13 ? -9.945  2.809   -2.851  1.00 0.00 ? 13 MET B HB3  3  
ATOM 5127  H HG2  . MET B 1 13 ? -8.770  2.386   -5.179  1.00 0.00 ? 13 MET B HG2  3  
ATOM 5128  H HG3  . MET B 1 13 ? -9.328  0.741   -4.883  1.00 0.00 ? 13 MET B HG3  3  
ATOM 5129  H HE1  . MET B 1 13 ? -11.162 3.487   -7.249  1.00 0.00 ? 13 MET B HE1  3  
ATOM 5130  H HE2  . MET B 1 13 ? -11.397 1.764   -7.539  1.00 0.00 ? 13 MET B HE2  3  
ATOM 5131  H HE3  . MET B 1 13 ? -9.788  2.385   -7.171  1.00 0.00 ? 13 MET B HE3  3  
ATOM 5132  N N    . ILE B 1 14 ? -6.163  3.549   -3.931  1.00 0.00 ? 14 ILE B N    3  
ATOM 5133  C CA   . ILE B 1 14 ? -5.585  4.693   -4.623  1.00 0.00 ? 14 ILE B CA   3  
ATOM 5134  C C    . ILE B 1 14 ? -5.281  4.340   -6.077  1.00 0.00 ? 14 ILE B C    3  
ATOM 5135  O O    . ILE B 1 14 ? -4.646  3.325   -6.360  1.00 0.00 ? 14 ILE B O    3  
ATOM 5136  C CB   . ILE B 1 14 ? -4.299  5.184   -3.922  1.00 0.00 ? 14 ILE B CB   3  
ATOM 5137  C CG1  . ILE B 1 14 ? -3.815  6.506   -4.537  1.00 0.00 ? 14 ILE B CG1  3  
ATOM 5138  C CG2  . ILE B 1 14 ? -3.210  4.120   -3.976  1.00 0.00 ? 14 ILE B CG2  3  
ATOM 5139  C CD1  . ILE B 1 14 ? -3.197  6.365   -5.914  1.00 0.00 ? 14 ILE B CD1  3  
ATOM 5140  H H    . ILE B 1 14 ? -5.628  2.738   -3.814  1.00 0.00 ? 14 ILE B H    3  
ATOM 5141  H HA   . ILE B 1 14 ? -6.311  5.493   -4.602  1.00 0.00 ? 14 ILE B HA   3  
ATOM 5142  H HB   . ILE B 1 14 ? -4.537  5.354   -2.882  1.00 0.00 ? 14 ILE B HB   3  
ATOM 5143  H HG12 . ILE B 1 14 ? -4.654  7.180   -4.622  1.00 0.00 ? 14 ILE B HG12 3  
ATOM 5144  H HG13 . ILE B 1 14 ? -3.075  6.945   -3.884  1.00 0.00 ? 14 ILE B HG13 3  
ATOM 5145  H HG21 . ILE B 1 14 ? -2.387  4.474   -4.580  1.00 0.00 ? 14 ILE B HG21 3  
ATOM 5146  H HG22 . ILE B 1 14 ? -3.610  3.215   -4.409  1.00 0.00 ? 14 ILE B HG22 3  
ATOM 5147  H HG23 . ILE B 1 14 ? -2.859  3.914   -2.976  1.00 0.00 ? 14 ILE B HG23 3  
ATOM 5148  H HD11 . ILE B 1 14 ? -2.904  5.339   -6.076  1.00 0.00 ? 14 ILE B HD11 3  
ATOM 5149  H HD12 . ILE B 1 14 ? -2.328  7.003   -5.984  1.00 0.00 ? 14 ILE B HD12 3  
ATOM 5150  H HD13 . ILE B 1 14 ? -3.918  6.657   -6.663  1.00 0.00 ? 14 ILE B HD13 3  
ATOM 5151  N N    . GLY B 1 15 ? -5.744  5.181   -6.995  1.00 0.00 ? 15 GLY B N    3  
ATOM 5152  C CA   . GLY B 1 15 ? -5.522  4.936   -8.408  1.00 0.00 ? 15 GLY B CA   3  
ATOM 5153  C C    . GLY B 1 15 ? -6.810  5.010   -9.205  1.00 0.00 ? 15 GLY B C    3  
ATOM 5154  O O    . GLY B 1 15 ? -7.334  6.098   -9.447  1.00 0.00 ? 15 GLY B O    3  
ATOM 5155  H H    . GLY B 1 15 ? -6.245  5.975   -6.714  1.00 0.00 ? 15 GLY B H    3  
ATOM 5156  H HA2  . GLY B 1 15 ? -4.832  5.676   -8.787  1.00 0.00 ? 15 GLY B HA2  3  
ATOM 5157  H HA3  . GLY B 1 15 ? -5.088  3.954   -8.533  1.00 0.00 ? 15 GLY B HA3  3  
ATOM 5158  N N    . ASP B 1 16 ? -7.327  3.852   -9.609  1.00 0.00 ? 16 ASP B N    3  
ATOM 5159  C CA   . ASP B 1 16 ? -8.567  3.802   -10.378 1.00 0.00 ? 16 ASP B CA   3  
ATOM 5160  C C    . ASP B 1 16 ? -9.189  2.404   -10.371 1.00 0.00 ? 16 ASP B C    3  
ATOM 5161  O O    . ASP B 1 16 ? -10.062 2.111   -11.188 1.00 0.00 ? 16 ASP B O    3  
ATOM 5162  C CB   . ASP B 1 16 ? -8.311  4.246   -11.819 1.00 0.00 ? 16 ASP B CB   3  
ATOM 5163  C CG   . ASP B 1 16 ? -7.107  3.556   -12.431 1.00 0.00 ? 16 ASP B CG   3  
ATOM 5164  O OD1  . ASP B 1 16 ? -7.234  2.376   -12.819 1.00 0.00 ? 16 ASP B OD1  3  
ATOM 5165  O OD2  . ASP B 1 16 ? -6.038  4.196   -12.520 1.00 0.00 ? 16 ASP B OD2  3  
ATOM 5166  H H    . ASP B 1 16 ? -6.866  3.018   -9.383  1.00 0.00 ? 16 ASP B H    3  
ATOM 5167  H HA   . ASP B 1 16 ? -9.263  4.491   -9.922  1.00 0.00 ? 16 ASP B HA   3  
ATOM 5168  H HB2  . ASP B 1 16 ? -9.178  4.016   -12.420 1.00 0.00 ? 16 ASP B HB2  3  
ATOM 5169  H HB3  . ASP B 1 16 ? -8.139  5.312   -11.835 1.00 0.00 ? 16 ASP B HB3  3  
ATOM 5170  N N    . GLU B 1 17 ? -8.746  1.547   -9.443  1.00 0.00 ? 17 GLU B N    3  
ATOM 5171  C CA   . GLU B 1 17 ? -9.263  0.179   -9.325  1.00 0.00 ? 17 GLU B CA   3  
ATOM 5172  C C    . GLU B 1 17 ? -8.259  -0.713  -8.595  1.00 0.00 ? 17 GLU B C    3  
ATOM 5173  O O    . GLU B 1 17 ? -7.763  -1.693  -9.152  1.00 0.00 ? 17 GLU B O    3  
ATOM 5174  C CB   . GLU B 1 17 ? -9.576  -0.418  -10.705 1.00 0.00 ? 17 GLU B CB   3  
ATOM 5175  C CG   . GLU B 1 17 ? -11.058 -0.423  -11.044 1.00 0.00 ? 17 GLU B CG   3  
ATOM 5176  C CD   . GLU B 1 17 ? -11.315 -0.510  -12.535 1.00 0.00 ? 17 GLU B CD   3  
ATOM 5177  O OE1  . GLU B 1 17 ? -10.406 -0.951  -13.270 1.00 0.00 ? 17 GLU B OE1  3  
ATOM 5178  O OE2  . GLU B 1 17 ? -12.426 -0.139  -12.969 1.00 0.00 ? 17 GLU B OE2  3  
ATOM 5179  H H    . GLU B 1 17 ? -8.057  1.842   -8.813  1.00 0.00 ? 17 GLU B H    3  
ATOM 5180  H HA   . GLU B 1 17 ? -10.174 0.220   -8.745  1.00 0.00 ? 17 GLU B HA   3  
ATOM 5181  H HB2  . GLU B 1 17 ? -9.059  0.158   -11.459 1.00 0.00 ? 17 GLU B HB2  3  
ATOM 5182  H HB3  . GLU B 1 17 ? -9.220  -1.436  -10.737 1.00 0.00 ? 17 GLU B HB3  3  
ATOM 5183  H HG2  . GLU B 1 17 ? -11.520 -1.274  -10.565 1.00 0.00 ? 17 GLU B HG2  3  
ATOM 5184  H HG3  . GLU B 1 17 ? -11.504 0.486   -10.668 1.00 0.00 ? 17 GLU B HG3  3  
ATOM 5185  N N    . VAL B 1 18 ? -7.950  -0.364  -7.350  1.00 0.00 ? 18 VAL B N    3  
ATOM 5186  C CA   . VAL B 1 18 ? -7.001  -1.122  -6.562  1.00 0.00 ? 18 VAL B CA   3  
ATOM 5187  C C    . VAL B 1 18 ? -7.639  -1.668  -5.280  1.00 0.00 ? 18 VAL B C    3  
ATOM 5188  O O    . VAL B 1 18 ? -8.861  -1.777  -5.181  1.00 0.00 ? 18 VAL B O    3  
ATOM 5189  C CB   . VAL B 1 18 ? -5.788  -0.245  -6.211  1.00 0.00 ? 18 VAL B CB   3  
ATOM 5190  C CG1  . VAL B 1 18 ? -5.166  0.333   -7.475  1.00 0.00 ? 18 VAL B CG1  3  
ATOM 5191  C CG2  . VAL B 1 18 ? -6.177  0.863   -5.240  1.00 0.00 ? 18 VAL B CG2  3  
ATOM 5192  H H    . VAL B 1 18 ? -8.360  0.427   -6.956  1.00 0.00 ? 18 VAL B H    3  
ATOM 5193  H HA   . VAL B 1 18 ? -6.655  -1.952  -7.162  1.00 0.00 ? 18 VAL B HA   3  
ATOM 5194  H HB   . VAL B 1 18 ? -5.057  -0.865  -5.737  1.00 0.00 ? 18 VAL B HB   3  
ATOM 5195  H HG11 . VAL B 1 18 ? -4.271  -0.219  -7.721  1.00 0.00 ? 18 VAL B HG11 3  
ATOM 5196  H HG12 . VAL B 1 18 ? -4.915  1.370   -7.312  1.00 0.00 ? 18 VAL B HG12 3  
ATOM 5197  H HG13 . VAL B 1 18 ? -5.871  0.257   -8.290  1.00 0.00 ? 18 VAL B HG13 3  
ATOM 5198  H HG21 . VAL B 1 18 ? -7.187  0.702   -4.893  1.00 0.00 ? 18 VAL B HG21 3  
ATOM 5199  H HG22 . VAL B 1 18 ? -6.118  1.818   -5.739  1.00 0.00 ? 18 VAL B HG22 3  
ATOM 5200  H HG23 . VAL B 1 18 ? -5.501  0.856   -4.395  1.00 0.00 ? 18 VAL B HG23 3  
ATOM 5201  N N    . THR B 1 19 ? -6.798  -2.007  -4.302  1.00 0.00 ? 19 THR B N    3  
ATOM 5202  C CA   . THR B 1 19 ? -7.250  -2.540  -3.018  1.00 0.00 ? 19 THR B CA   3  
ATOM 5203  C C    . THR B 1 19 ? -6.055  -3.084  -2.245  1.00 0.00 ? 19 THR B C    3  
ATOM 5204  O O    . THR B 1 19 ? -5.546  -4.157  -2.556  1.00 0.00 ? 19 THR B O    3  
ATOM 5205  C CB   . THR B 1 19 ? -8.292  -3.647  -3.216  1.00 0.00 ? 19 THR B CB   3  
ATOM 5206  O OG1  . THR B 1 19 ? -8.202  -4.198  -4.518  1.00 0.00 ? 19 THR B OG1  3  
ATOM 5207  C CG2  . THR B 1 19 ? -9.715  -3.174  -3.013  1.00 0.00 ? 19 THR B CG2  3  
ATOM 5208  H H    . THR B 1 19 ? -5.837  -1.890  -4.443  1.00 0.00 ? 19 THR B H    3  
ATOM 5209  H HA   . THR B 1 19 ? -7.693  -1.729  -2.457  1.00 0.00 ? 19 THR B HA   3  
ATOM 5210  H HB   . THR B 1 19 ? -8.102  -4.436  -2.502  1.00 0.00 ? 19 THR B HB   3  
ATOM 5211  H HG1  . THR B 1 19 ? -8.652  -5.046  -4.539  1.00 0.00 ? 19 THR B HG1  3  
ATOM 5212  H HG21 . THR B 1 19 ? -10.214 -3.113  -3.969  1.00 0.00 ? 19 THR B HG21 3  
ATOM 5213  H HG22 . THR B 1 19 ? -9.708  -2.200  -2.548  1.00 0.00 ? 19 THR B HG22 3  
ATOM 5214  H HG23 . THR B 1 19 ? -10.239 -3.873  -2.378  1.00 0.00 ? 19 THR B HG23 3  
ATOM 5215  N N    . VAL B 1 20 ? -5.596  -2.338  -1.247  1.00 0.00 ? 20 VAL B N    3  
ATOM 5216  C CA   . VAL B 1 20 ? -4.445  -2.763  -0.459  1.00 0.00 ? 20 VAL B CA   3  
ATOM 5217  C C    . VAL B 1 20 ? -4.773  -2.864  1.027   1.00 0.00 ? 20 VAL B C    3  
ATOM 5218  O O    . VAL B 1 20 ? -5.052  -1.859  1.683   1.00 0.00 ? 20 VAL B O    3  
ATOM 5219  C CB   . VAL B 1 20 ? -3.259  -1.796  -0.642  1.00 0.00 ? 20 VAL B CB   3  
ATOM 5220  C CG1  . VAL B 1 20 ? -2.808  -1.772  -2.094  1.00 0.00 ? 20 VAL B CG1  3  
ATOM 5221  C CG2  . VAL B 1 20 ? -3.628  -0.398  -0.169  1.00 0.00 ? 20 VAL B CG2  3  
ATOM 5222  H H    . VAL B 1 20 ? -6.033  -1.486  -1.040  1.00 0.00 ? 20 VAL B H    3  
ATOM 5223  H HA   . VAL B 1 20 ? -4.140  -3.737  -0.819  1.00 0.00 ? 20 VAL B HA   3  
ATOM 5224  H HB   . VAL B 1 20 ? -2.435  -2.151  -0.039  1.00 0.00 ? 20 VAL B HB   3  
ATOM 5225  H HG11 . VAL B 1 20 ? -1.800  -1.390  -2.152  1.00 0.00 ? 20 VAL B HG11 3  
ATOM 5226  H HG12 . VAL B 1 20 ? -3.468  -1.136  -2.665  1.00 0.00 ? 20 VAL B HG12 3  
ATOM 5227  H HG13 . VAL B 1 20 ? -2.837  -2.774  -2.496  1.00 0.00 ? 20 VAL B HG13 3  
ATOM 5228  H HG21 . VAL B 1 20 ? -4.688  -0.241  -0.303  1.00 0.00 ? 20 VAL B HG21 3  
ATOM 5229  H HG22 . VAL B 1 20 ? -3.080  0.333   -0.744  1.00 0.00 ? 20 VAL B HG22 3  
ATOM 5230  H HG23 . VAL B 1 20 ? -3.378  -0.295  0.877   1.00 0.00 ? 20 VAL B HG23 3  
ATOM 5231  N N    . THR B 1 21 ? -4.726  -4.084  1.553   1.00 0.00 ? 21 THR B N    3  
ATOM 5232  C CA   . THR B 1 21 ? -5.003  -4.326  2.964   1.00 0.00 ? 21 THR B CA   3  
ATOM 5233  C C    . THR B 1 21 ? -3.714  -4.677  3.702   1.00 0.00 ? 21 THR B C    3  
ATOM 5234  O O    . THR B 1 21 ? -3.074  -5.684  3.404   1.00 0.00 ? 21 THR B O    3  
ATOM 5235  C CB   . THR B 1 21 ? -6.021  -5.456  3.122   1.00 0.00 ? 21 THR B CB   3  
ATOM 5236  O OG1  . THR B 1 21 ? -5.770  -6.489  2.186   1.00 0.00 ? 21 THR B OG1  3  
ATOM 5237  C CG2  . THR B 1 21 ? -7.453  -5.003  2.934   1.00 0.00 ? 21 THR B CG2  3  
ATOM 5238  H H    . THR B 1 21 ? -4.493  -4.841  0.977   1.00 0.00 ? 21 THR B H    3  
ATOM 5239  H HA   . THR B 1 21 ? -5.412  -3.419  3.384   1.00 0.00 ? 21 THR B HA   3  
ATOM 5240  H HB   . THR B 1 21 ? -5.932  -5.870  4.116   1.00 0.00 ? 21 THR B HB   3  
ATOM 5241  H HG1  . THR B 1 21 ? -6.415  -7.191  2.302   1.00 0.00 ? 21 THR B HG1  3  
ATOM 5242  H HG21 . THR B 1 21 ? -8.109  -5.636  3.513   1.00 0.00 ? 21 THR B HG21 3  
ATOM 5243  H HG22 . THR B 1 21 ? -7.717  -5.071  1.889   1.00 0.00 ? 21 THR B HG22 3  
ATOM 5244  H HG23 . THR B 1 21 ? -7.553  -3.980  3.265   1.00 0.00 ? 21 THR B HG23 3  
ATOM 5245  N N    . VAL B 1 22 ? -3.331  -3.835  4.658   1.00 0.00 ? 22 VAL B N    3  
ATOM 5246  C CA   . VAL B 1 22 ? -2.110  -4.058  5.423   1.00 0.00 ? 22 VAL B CA   3  
ATOM 5247  C C    . VAL B 1 22 ? -2.412  -4.471  6.862   1.00 0.00 ? 22 VAL B C    3  
ATOM 5248  O O    . VAL B 1 22 ? -1.926  -3.854  7.811   1.00 0.00 ? 22 VAL B O    3  
ATOM 5249  C CB   . VAL B 1 22 ? -1.221  -2.799  5.434   1.00 0.00 ? 22 VAL B CB   3  
ATOM 5250  C CG1  . VAL B 1 22 ? -0.762  -2.457  4.025   1.00 0.00 ? 22 VAL B CG1  3  
ATOM 5251  C CG2  . VAL B 1 22 ? -1.960  -1.626  6.062   1.00 0.00 ? 22 VAL B CG2  3  
ATOM 5252  H H    . VAL B 1 22 ? -3.877  -3.044  4.846   1.00 0.00 ? 22 VAL B H    3  
ATOM 5253  H HA   . VAL B 1 22 ? -1.559  -4.854  4.942   1.00 0.00 ? 22 VAL B HA   3  
ATOM 5254  H HB   . VAL B 1 22 ? -0.345  -3.007  6.032   1.00 0.00 ? 22 VAL B HB   3  
ATOM 5255  H HG11 . VAL B 1 22 ? -1.363  -1.647  3.637   1.00 0.00 ? 22 VAL B HG11 3  
ATOM 5256  H HG12 . VAL B 1 22 ? -0.873  -3.323  3.389   1.00 0.00 ? 22 VAL B HG12 3  
ATOM 5257  H HG13 . VAL B 1 22 ? 0.275   -2.157  4.047   1.00 0.00 ? 22 VAL B HG13 3  
ATOM 5258  H HG21 . VAL B 1 22 ? -1.296  -1.097  6.729   1.00 0.00 ? 22 VAL B HG21 3  
ATOM 5259  H HG22 . VAL B 1 22 ? -2.811  -1.992  6.617   1.00 0.00 ? 22 VAL B HG22 3  
ATOM 5260  H HG23 . VAL B 1 22 ? -2.299  -0.957  5.285   1.00 0.00 ? 22 VAL B HG23 3  
ATOM 5261  N N    . LEU B 1 23 ? -3.214  -5.521  7.019   1.00 0.00 ? 23 LEU B N    3  
ATOM 5262  C CA   . LEU B 1 23 ? -3.576  -6.018  8.345   1.00 0.00 ? 23 LEU B CA   3  
ATOM 5263  C C    . LEU B 1 23 ? -2.337  -6.161  9.231   1.00 0.00 ? 23 LEU B C    3  
ATOM 5264  O O    . LEU B 1 23 ? -1.233  -6.383  8.734   1.00 0.00 ? 23 LEU B O    3  
ATOM 5265  C CB   . LEU B 1 23 ? -4.312  -7.357  8.229   1.00 0.00 ? 23 LEU B CB   3  
ATOM 5266  C CG   . LEU B 1 23 ? -3.430  -8.570  7.922   1.00 0.00 ? 23 LEU B CG   3  
ATOM 5267  C CD1  . LEU B 1 23 ? -2.912  -9.186  9.211   1.00 0.00 ? 23 LEU B CD1  3  
ATOM 5268  C CD2  . LEU B 1 23 ? -4.207  -9.599  7.114   1.00 0.00 ? 23 LEU B CD2  3  
ATOM 5269  H H    . LEU B 1 23 ? -3.571  -5.970  6.224   1.00 0.00 ? 23 LEU B H    3  
ATOM 5270  H HA   . LEU B 1 23 ? -4.239  -5.293  8.796   1.00 0.00 ? 23 LEU B HA   3  
ATOM 5271  H HB2  . LEU B 1 23 ? -4.825  -7.541  9.162   1.00 0.00 ? 23 LEU B HB2  3  
ATOM 5272  H HB3  . LEU B 1 23 ? -5.049  -7.270  7.445   1.00 0.00 ? 23 LEU B HB3  3  
ATOM 5273  H HG   . LEU B 1 23 ? -2.578  -8.255  7.333   1.00 0.00 ? 23 LEU B HG   3  
ATOM 5274  H HD11 . LEU B 1 23 ? -2.561  -10.188 9.016   1.00 0.00 ? 23 LEU B HD11 3  
ATOM 5275  H HD12 . LEU B 1 23 ? -3.710  -9.219  9.941   1.00 0.00 ? 23 LEU B HD12 3  
ATOM 5276  H HD13 . LEU B 1 23 ? -2.099  -8.588  9.597   1.00 0.00 ? 23 LEU B HD13 3  
ATOM 5277  H HD21 . LEU B 1 23 ? -3.622  -10.503 7.024   1.00 0.00 ? 23 LEU B HD21 3  
ATOM 5278  H HD22 . LEU B 1 23 ? -4.412  -9.204  6.129   1.00 0.00 ? 23 LEU B HD22 3  
ATOM 5279  H HD23 . LEU B 1 23 ? -5.138  -9.822  7.614   1.00 0.00 ? 23 LEU B HD23 3  
ATOM 5280  N N    . GLY B 1 24 ? -2.522  -6.018  10.542  1.00 0.00 ? 24 GLY B N    3  
ATOM 5281  C CA   . GLY B 1 24 ? -1.401  -6.121  11.463  1.00 0.00 ? 24 GLY B CA   3  
ATOM 5282  C C    . GLY B 1 24 ? -1.406  -7.399  12.286  1.00 0.00 ? 24 GLY B C    3  
ATOM 5283  O O    . GLY B 1 24 ? -0.541  -7.592  13.140  1.00 0.00 ? 24 GLY B O    3  
ATOM 5284  H H    . GLY B 1 24 ? -3.421  -5.831  10.884  1.00 0.00 ? 24 GLY B H    3  
ATOM 5285  H HA2  . GLY B 1 24 ? -0.484  -6.080  10.896  1.00 0.00 ? 24 GLY B HA2  3  
ATOM 5286  H HA3  . GLY B 1 24 ? -1.429  -5.276  12.135  1.00 0.00 ? 24 GLY B HA3  3  
ATOM 5287  N N    . VAL B 1 25 ? -2.375  -8.273  12.036  1.00 0.00 ? 25 VAL B N    3  
ATOM 5288  C CA   . VAL B 1 25 ? -2.474  -9.529  12.767  1.00 0.00 ? 25 VAL B CA   3  
ATOM 5289  C C    . VAL B 1 25 ? -1.594  -10.593 12.125  1.00 0.00 ? 25 VAL B C    3  
ATOM 5290  O O    . VAL B 1 25 ? -1.767  -10.928 10.954  1.00 0.00 ? 25 VAL B O    3  
ATOM 5291  C CB   . VAL B 1 25 ? -3.925  -10.054 12.820  1.00 0.00 ? 25 VAL B CB   3  
ATOM 5292  C CG1  . VAL B 1 25 ? -4.145  -10.888 14.072  1.00 0.00 ? 25 VAL B CG1  3  
ATOM 5293  C CG2  . VAL B 1 25 ? -4.924  -8.907  12.756  1.00 0.00 ? 25 VAL B CG2  3  
ATOM 5294  H H    . VAL B 1 25 ? -3.037  -8.070  11.353  1.00 0.00 ? 25 VAL B H    3  
ATOM 5295  H HA   . VAL B 1 25 ? -2.138  -9.351  13.773  1.00 0.00 ? 25 VAL B HA   3  
ATOM 5296  H HB   . VAL B 1 25 ? -4.086  -10.690 11.961  1.00 0.00 ? 25 VAL B HB   3  
ATOM 5297  H HG11 . VAL B 1 25 ? -4.607  -10.278 14.835  1.00 0.00 ? 25 VAL B HG11 3  
ATOM 5298  H HG12 . VAL B 1 25 ? -3.195  -11.255 14.432  1.00 0.00 ? 25 VAL B HG12 3  
ATOM 5299  H HG13 . VAL B 1 25 ? -4.789  -11.723 13.840  1.00 0.00 ? 25 VAL B HG13 3  
ATOM 5300  H HG21 . VAL B 1 25 ? -4.663  -8.162  13.491  1.00 0.00 ? 25 VAL B HG21 3  
ATOM 5301  H HG22 . VAL B 1 25 ? -5.916  -9.282  12.960  1.00 0.00 ? 25 VAL B HG22 3  
ATOM 5302  H HG23 . VAL B 1 25 ? -4.902  -8.466  11.770  1.00 0.00 ? 25 VAL B HG23 3  
ATOM 5303  N N    . LYS B 1 26 ? -0.645  -11.122 12.893  1.00 0.00 ? 26 LYS B N    3  
ATOM 5304  C CA   . LYS B 1 26 ? 0.264   -12.147 12.388  1.00 0.00 ? 26 LYS B CA   3  
ATOM 5305  C C    . LYS B 1 26 ? 1.330   -12.482 13.430  1.00 0.00 ? 26 LYS B C    3  
ATOM 5306  O O    . LYS B 1 26 ? 1.514   -11.749 14.402  1.00 0.00 ? 26 LYS B O    3  
ATOM 5307  C CB   . LYS B 1 26 ? 0.930   -11.681 11.091  1.00 0.00 ? 26 LYS B CB   3  
ATOM 5308  C CG   . LYS B 1 26 ? 0.876   -12.711 9.974   1.00 0.00 ? 26 LYS B CG   3  
ATOM 5309  C CD   . LYS B 1 26 ? 2.213   -13.411 9.792   1.00 0.00 ? 26 LYS B CD   3  
ATOM 5310  C CE   . LYS B 1 26 ? 2.039   -14.799 9.198   1.00 0.00 ? 26 LYS B CE   3  
ATOM 5311  N NZ   . LYS B 1 26 ? 3.046   -15.761 9.725   1.00 0.00 ? 26 LYS B NZ   3  
ATOM 5312  H H    . LYS B 1 26 ? -0.547  -10.825 13.821  1.00 0.00 ? 26 LYS B H    3  
ATOM 5313  H HA   . LYS B 1 26 ? -0.317  -13.034 12.186  1.00 0.00 ? 26 LYS B HA   3  
ATOM 5314  H HB2  . LYS B 1 26 ? 0.438   -10.784 10.747  1.00 0.00 ? 26 LYS B HB2  3  
ATOM 5315  H HB3  . LYS B 1 26 ? 1.964   -11.454 11.294  1.00 0.00 ? 26 LYS B HB3  3  
ATOM 5316  H HG2  . LYS B 1 26 ? 0.125   -13.449 10.214  1.00 0.00 ? 26 LYS B HG2  3  
ATOM 5317  H HG3  . LYS B 1 26 ? 0.612   -12.214 9.052   1.00 0.00 ? 26 LYS B HG3  3  
ATOM 5318  H HD2  . LYS B 1 26 ? 2.830   -12.822 9.130   1.00 0.00 ? 26 LYS B HD2  3  
ATOM 5319  H HD3  . LYS B 1 26 ? 2.696   -13.499 10.755  1.00 0.00 ? 26 LYS B HD3  3  
ATOM 5320  H HE2  . LYS B 1 26 ? 1.050   -15.159 9.440   1.00 0.00 ? 26 LYS B HE2  3  
ATOM 5321  H HE3  . LYS B 1 26 ? 2.144   -14.733 8.125   1.00 0.00 ? 26 LYS B HE3  3  
ATOM 5322  H HZ1  . LYS B 1 26 ? 2.617   -16.701 9.839   1.00 0.00 ? 26 LYS B HZ1  3  
ATOM 5323  H HZ2  . LYS B 1 26 ? 3.399   -15.439 10.649  1.00 0.00 ? 26 LYS B HZ2  3  
ATOM 5324  H HZ3  . LYS B 1 26 ? 3.849   -15.834 9.067   1.00 0.00 ? 26 LYS B HZ3  3  
ATOM 5325  N N    . GLY B 1 27 ? 2.025   -13.595 13.222  1.00 0.00 ? 27 GLY B N    3  
ATOM 5326  C CA   . GLY B 1 27 ? 3.061   -14.010 14.153  1.00 0.00 ? 27 GLY B CA   3  
ATOM 5327  C C    . GLY B 1 27 ? 4.401   -13.351 13.875  1.00 0.00 ? 27 GLY B C    3  
ATOM 5328  O O    . GLY B 1 27 ? 5.069   -13.678 12.895  1.00 0.00 ? 27 GLY B O    3  
ATOM 5329  H H    . GLY B 1 27 ? 1.832   -14.139 12.430  1.00 0.00 ? 27 GLY B H    3  
ATOM 5330  H HA2  . GLY B 1 27 ? 2.750   -13.756 15.155  1.00 0.00 ? 27 GLY B HA2  3  
ATOM 5331  H HA3  . GLY B 1 27 ? 3.180   -15.081 14.086  1.00 0.00 ? 27 GLY B HA3  3  
ATOM 5332  N N    . ASN B 1 28 ? 4.795   -12.422 14.746  1.00 0.00 ? 28 ASN B N    3  
ATOM 5333  C CA   . ASN B 1 28 ? 6.066   -11.713 14.598  1.00 0.00 ? 28 ASN B CA   3  
ATOM 5334  C C    . ASN B 1 28 ? 6.059   -10.832 13.352  1.00 0.00 ? 28 ASN B C    3  
ATOM 5335  O O    . ASN B 1 28 ? 5.945   -9.609  13.444  1.00 0.00 ? 28 ASN B O    3  
ATOM 5336  C CB   . ASN B 1 28 ? 7.228   -12.709 14.530  1.00 0.00 ? 28 ASN B CB   3  
ATOM 5337  C CG   . ASN B 1 28 ? 8.084   -12.683 15.781  1.00 0.00 ? 28 ASN B CG   3  
ATOM 5338  O OD1  . ASN B 1 28 ? 7.570   -12.680 16.899  1.00 0.00 ? 28 ASN B OD1  3  
ATOM 5339  N ND2  . ASN B 1 28 ? 9.399   -12.663 15.597  1.00 0.00 ? 28 ASN B ND2  3  
ATOM 5340  H H    . ASN B 1 28 ? 4.217   -12.208 15.508  1.00 0.00 ? 28 ASN B H    3  
ATOM 5341  H HA   . ASN B 1 28 ? 6.195   -11.084 15.466  1.00 0.00 ? 28 ASN B HA   3  
ATOM 5342  H HB2  . ASN B 1 28 ? 6.832   -13.706 14.409  1.00 0.00 ? 28 ASN B HB2  3  
ATOM 5343  H HB3  . ASN B 1 28 ? 7.853   -12.469 13.682  1.00 0.00 ? 28 ASN B HB3  3  
ATOM 5344  H HD21 . ASN B 1 28 ? 9.739   -12.666 14.678  1.00 0.00 ? 28 ASN B HD21 3  
ATOM 5345  H HD22 . ASN B 1 28 ? 9.977   -12.645 16.388  1.00 0.00 ? 28 ASN B HD22 3  
ATOM 5346  N N    . GLN B 1 29 ? 6.174   -11.462 12.189  1.00 0.00 ? 29 GLN B N    3  
ATOM 5347  C CA   . GLN B 1 29 ? 6.172   -10.739 10.925  1.00 0.00 ? 29 GLN B CA   3  
ATOM 5348  C C    . GLN B 1 29 ? 4.739   -10.494 10.467  1.00 0.00 ? 29 GLN B C    3  
ATOM 5349  O O    . GLN B 1 29 ? 3.898   -11.385 10.551  1.00 0.00 ? 29 GLN B O    3  
ATOM 5350  C CB   . GLN B 1 29 ? 6.939   -11.524 9.861   1.00 0.00 ? 29 GLN B CB   3  
ATOM 5351  C CG   . GLN B 1 29 ? 8.302   -12.010 10.328  1.00 0.00 ? 29 GLN B CG   3  
ATOM 5352  C CD   . GLN B 1 29 ? 8.730   -13.291 9.639   1.00 0.00 ? 29 GLN B CD   3  
ATOM 5353  O OE1  . GLN B 1 29 ? 7.952   -14.238 9.525   1.00 0.00 ? 29 GLN B OE1  3  
ATOM 5354  N NE2  . GLN B 1 29 ? 9.974   -13.326 9.177   1.00 0.00 ? 29 GLN B NE2  3  
ATOM 5355  H H    . GLN B 1 29 ? 6.252   -12.439 12.185  1.00 0.00 ? 29 GLN B H    3  
ATOM 5356  H HA   . GLN B 1 29 ? 6.657   -9.787  11.083  1.00 0.00 ? 29 GLN B HA   3  
ATOM 5357  H HB2  . GLN B 1 29 ? 6.354   -12.384 9.574   1.00 0.00 ? 29 GLN B HB2  3  
ATOM 5358  H HB3  . GLN B 1 29 ? 7.083   -10.892 8.997   1.00 0.00 ? 29 GLN B HB3  3  
ATOM 5359  H HG2  . GLN B 1 29 ? 9.034   -11.244 10.118  1.00 0.00 ? 29 GLN B HG2  3  
ATOM 5360  H HG3  . GLN B 1 29 ? 8.261   -12.186 11.392  1.00 0.00 ? 29 GLN B HG3  3  
ATOM 5361  H HE21 . GLN B 1 29 ? 10.538  -12.534 9.304   1.00 0.00 ? 29 GLN B HE21 3  
ATOM 5362  H HE22 . GLN B 1 29 ? 10.278  -14.142 8.727   1.00 0.00 ? 29 GLN B HE22 3  
ATOM 5363  N N    . VAL B 1 30 ? 4.462   -9.282  9.998   1.00 0.00 ? 30 VAL B N    3  
ATOM 5364  C CA   . VAL B 1 30 ? 3.118   -8.934  9.552   1.00 0.00 ? 30 VAL B CA   3  
ATOM 5365  C C    . VAL B 1 30 ? 2.950   -9.159  8.055   1.00 0.00 ? 30 VAL B C    3  
ATOM 5366  O O    . VAL B 1 30 ? 3.614   -8.521  7.241   1.00 0.00 ? 30 VAL B O    3  
ATOM 5367  C CB   . VAL B 1 30 ? 2.784   -7.466  9.876   1.00 0.00 ? 30 VAL B CB   3  
ATOM 5368  C CG1  . VAL B 1 30 ? 1.322   -7.170  9.577   1.00 0.00 ? 30 VAL B CG1  3  
ATOM 5369  C CG2  . VAL B 1 30 ? 3.113   -7.152  11.328  1.00 0.00 ? 30 VAL B CG2  3  
ATOM 5370  H H    . VAL B 1 30 ? 5.172   -8.605  9.962   1.00 0.00 ? 30 VAL B H    3  
ATOM 5371  H HA   . VAL B 1 30 ? 2.419   -9.564  10.080  1.00 0.00 ? 30 VAL B HA   3  
ATOM 5372  H HB   . VAL B 1 30 ? 3.392   -6.832  9.247   1.00 0.00 ? 30 VAL B HB   3  
ATOM 5373  H HG11 . VAL B 1 30 ? 0.696   -7.721  10.263  1.00 0.00 ? 30 VAL B HG11 3  
ATOM 5374  H HG12 . VAL B 1 30 ? 1.095   -7.468  8.564   1.00 0.00 ? 30 VAL B HG12 3  
ATOM 5375  H HG13 . VAL B 1 30 ? 1.138   -6.112  9.691   1.00 0.00 ? 30 VAL B HG13 3  
ATOM 5376  H HG21 . VAL B 1 30 ? 3.069   -8.060  11.911  1.00 0.00 ? 30 VAL B HG21 3  
ATOM 5377  H HG22 . VAL B 1 30 ? 2.397   -6.442  11.714  1.00 0.00 ? 30 VAL B HG22 3  
ATOM 5378  H HG23 . VAL B 1 30 ? 4.106   -6.733  11.390  1.00 0.00 ? 30 VAL B HG23 3  
ATOM 5379  N N    . ARG B 1 31 ? 2.049   -10.069 7.702   1.00 0.00 ? 31 ARG B N    3  
ATOM 5380  C CA   . ARG B 1 31 ? 1.783   -10.382 6.313   1.00 0.00 ? 31 ARG B CA   3  
ATOM 5381  C C    . ARG B 1 31 ? 0.952   -9.280  5.666   1.00 0.00 ? 31 ARG B C    3  
ATOM 5382  O O    . ARG B 1 31 ? -0.263  -9.217  5.851   1.00 0.00 ? 31 ARG B O    3  
ATOM 5383  C CB   . ARG B 1 31 ? 1.054   -11.722 6.202   1.00 0.00 ? 31 ARG B CB   3  
ATOM 5384  C CG   . ARG B 1 31 ? 1.484   -12.553 5.005   1.00 0.00 ? 31 ARG B CG   3  
ATOM 5385  C CD   . ARG B 1 31 ? 1.699   -14.010 5.383   1.00 0.00 ? 31 ARG B CD   3  
ATOM 5386  N NE   . ARG B 1 31 ? 1.682   -14.888 4.215   1.00 0.00 ? 31 ARG B NE   3  
ATOM 5387  C CZ   . ARG B 1 31 ? 2.717   -15.051 3.395   1.00 0.00 ? 31 ARG B CZ   3  
ATOM 5388  N NH1  . ARG B 1 31 ? 3.853   -14.399 3.610   1.00 0.00 ? 31 ARG B NH1  3  
ATOM 5389  N NH2  . ARG B 1 31 ? 2.616   -15.869 2.356   1.00 0.00 ? 31 ARG B NH2  3  
ATOM 5390  H H    . ARG B 1 31 ? 1.552   -10.540 8.391   1.00 0.00 ? 31 ARG B H    3  
ATOM 5391  H HA   . ARG B 1 31 ? 2.728   -10.453 5.812   1.00 0.00 ? 31 ARG B HA   3  
ATOM 5392  H HB2  . ARG B 1 31 ? 1.242   -12.295 7.098   1.00 0.00 ? 31 ARG B HB2  3  
ATOM 5393  H HB3  . ARG B 1 31 ? -0.007  -11.536 6.122   1.00 0.00 ? 31 ARG B HB3  3  
ATOM 5394  H HG2  . ARG B 1 31 ? 0.715   -12.500 4.249   1.00 0.00 ? 31 ARG B HG2  3  
ATOM 5395  H HG3  . ARG B 1 31 ? 2.406   -12.152 4.612   1.00 0.00 ? 31 ARG B HG3  3  
ATOM 5396  H HD2  . ARG B 1 31 ? 2.655   -14.103 5.877   1.00 0.00 ? 31 ARG B HD2  3  
ATOM 5397  H HD3  . ARG B 1 31 ? 0.914   -14.312 6.061   1.00 0.00 ? 31 ARG B HD3  3  
ATOM 5398  H HE   . ARG B 1 31 ? 0.855   -15.381 4.033   1.00 0.00 ? 31 ARG B HE   3  
ATOM 5399  H HH11 . ARG B 1 31 ? 3.936   -13.781 4.392   1.00 0.00 ? 31 ARG B HH11 3  
ATOM 5400  H HH12 . ARG B 1 31 ? 4.627   -14.527 2.990   1.00 0.00 ? 31 ARG B HH12 3  
ATOM 5401  H HH21 . ARG B 1 31 ? 1.763   -16.363 2.189   1.00 0.00 ? 31 ARG B HH21 3  
ATOM 5402  H HH22 . ARG B 1 31 ? 3.393   -15.992 1.739   1.00 0.00 ? 31 ARG B HH22 3  
ATOM 5403  N N    . ILE B 1 32 ? 1.617   -8.399  4.927   1.00 0.00 ? 32 ILE B N    3  
ATOM 5404  C CA   . ILE B 1 32 ? 0.938   -7.285  4.277   1.00 0.00 ? 32 ILE B CA   3  
ATOM 5405  C C    . ILE B 1 32 ? 0.403   -7.691  2.909   1.00 0.00 ? 32 ILE B C    3  
ATOM 5406  O O    . ILE B 1 32 ? 1.150   -8.166  2.054   1.00 0.00 ? 32 ILE B O    3  
ATOM 5407  C CB   . ILE B 1 32 ? 1.883   -6.077  4.120   1.00 0.00 ? 32 ILE B CB   3  
ATOM 5408  C CG1  . ILE B 1 32 ? 2.690   -5.865  5.407   1.00 0.00 ? 32 ILE B CG1  3  
ATOM 5409  C CG2  . ILE B 1 32 ? 1.092   -4.826  3.768   1.00 0.00 ? 32 ILE B CG2  3  
ATOM 5410  C CD1  . ILE B 1 32 ? 1.845   -5.437  6.587   1.00 0.00 ? 32 ILE B CD1  3  
ATOM 5411  H H    . ILE B 1 32 ? 2.592   -8.486  4.838   1.00 0.00 ? 32 ILE B H    3  
ATOM 5412  H HA   . ILE B 1 32 ? 0.110   -6.989  4.904   1.00 0.00 ? 32 ILE B HA   3  
ATOM 5413  H HB   . ILE B 1 32 ? 2.563   -6.283  3.308   1.00 0.00 ? 32 ILE B HB   3  
ATOM 5414  H HG12 . ILE B 1 32 ? 3.183   -6.790  5.672   1.00 0.00 ? 32 ILE B HG12 3  
ATOM 5415  H HG13 . ILE B 1 32 ? 3.436   -5.102  5.238   1.00 0.00 ? 32 ILE B HG13 3  
ATOM 5416  H HG21 . ILE B 1 32 ? 1.764   -4.069  3.392   1.00 0.00 ? 32 ILE B HG21 3  
ATOM 5417  H HG22 . ILE B 1 32 ? 0.592   -4.456  4.651   1.00 0.00 ? 32 ILE B HG22 3  
ATOM 5418  H HG23 . ILE B 1 32 ? 0.359   -5.064  3.012   1.00 0.00 ? 32 ILE B HG23 3  
ATOM 5419  H HD11 . ILE B 1 32 ? 2.383   -5.628  7.504   1.00 0.00 ? 32 ILE B HD11 3  
ATOM 5420  H HD12 . ILE B 1 32 ? 0.921   -5.996  6.589   1.00 0.00 ? 32 ILE B HD12 3  
ATOM 5421  H HD13 . ILE B 1 32 ? 1.628   -4.382  6.511   1.00 0.00 ? 32 ILE B HD13 3  
ATOM 5422  N N    . GLY B 1 33 ? -0.900  -7.498  2.710   1.00 0.00 ? 33 GLY B N    3  
ATOM 5423  C CA   . GLY B 1 33 ? -1.522  -7.850  1.447   1.00 0.00 ? 33 GLY B CA   3  
ATOM 5424  C C    . GLY B 1 33 ? -1.788  -6.642  0.574   1.00 0.00 ? 33 GLY B C    3  
ATOM 5425  O O    . GLY B 1 33 ? -2.541  -5.747  0.957   1.00 0.00 ? 33 GLY B O    3  
ATOM 5426  H H    . GLY B 1 33 ? -1.448  -7.110  3.424   1.00 0.00 ? 33 GLY B H    3  
ATOM 5427  H HA2  . GLY B 1 33 ? -0.877  -8.529  0.917   1.00 0.00 ? 33 GLY B HA2  3  
ATOM 5428  H HA3  . GLY B 1 33 ? -2.460  -8.346  1.648   1.00 0.00 ? 33 GLY B HA3  3  
ATOM 5429  N N    . VAL B 1 34 ? -1.168  -6.612  -0.601  1.00 0.00 ? 34 VAL B N    3  
ATOM 5430  C CA   . VAL B 1 34 ? -1.346  -5.500  -1.525  1.00 0.00 ? 34 VAL B CA   3  
ATOM 5431  C C    . VAL B 1 34 ? -1.976  -5.961  -2.835  1.00 0.00 ? 34 VAL B C    3  
ATOM 5432  O O    . VAL B 1 34 ? -1.310  -6.554  -3.684  1.00 0.00 ? 34 VAL B O    3  
ATOM 5433  C CB   . VAL B 1 34 ? -0.005  -4.807  -1.832  1.00 0.00 ? 34 VAL B CB   3  
ATOM 5434  C CG1  . VAL B 1 34 ? -0.234  -3.512  -2.595  1.00 0.00 ? 34 VAL B CG1  3  
ATOM 5435  C CG2  . VAL B 1 34 ? 0.768   -4.549  -0.548  1.00 0.00 ? 34 VAL B CG2  3  
ATOM 5436  H H    . VAL B 1 34 ? -0.578  -7.352  -0.853  1.00 0.00 ? 34 VAL B H    3  
ATOM 5437  H HA   . VAL B 1 34 ? -2.000  -4.779  -1.056  1.00 0.00 ? 34 VAL B HA   3  
ATOM 5438  H HB   . VAL B 1 34 ? 0.583   -5.466  -2.454  1.00 0.00 ? 34 VAL B HB   3  
ATOM 5439  H HG11 . VAL B 1 34 ? -0.305  -2.691  -1.898  1.00 0.00 ? 34 VAL B HG11 3  
ATOM 5440  H HG12 . VAL B 1 34 ? -1.151  -3.585  -3.161  1.00 0.00 ? 34 VAL B HG12 3  
ATOM 5441  H HG13 . VAL B 1 34 ? 0.593   -3.342  -3.269  1.00 0.00 ? 34 VAL B HG13 3  
ATOM 5442  H HG21 . VAL B 1 34 ? 0.752   -5.437  0.067   1.00 0.00 ? 34 VAL B HG21 3  
ATOM 5443  H HG22 . VAL B 1 34 ? 0.312   -3.730  -0.011  1.00 0.00 ? 34 VAL B HG22 3  
ATOM 5444  H HG23 . VAL B 1 34 ? 1.791   -4.296  -0.788  1.00 0.00 ? 34 VAL B HG23 3  
ATOM 5445  N N    . ASN B 1 35 ? -3.265  -5.678  -2.992  1.00 0.00 ? 35 ASN B N    3  
ATOM 5446  C CA   . ASN B 1 35 ? -3.987  -6.058  -4.202  1.00 0.00 ? 35 ASN B CA   3  
ATOM 5447  C C    . ASN B 1 35 ? -4.105  -4.868  -5.149  1.00 0.00 ? 35 ASN B C    3  
ATOM 5448  O O    . ASN B 1 35 ? -4.859  -3.928  -4.899  1.00 0.00 ? 35 ASN B O    3  
ATOM 5449  C CB   . ASN B 1 35 ? -5.382  -6.600  -3.864  1.00 0.00 ? 35 ASN B CB   3  
ATOM 5450  C CG   . ASN B 1 35 ? -5.431  -7.303  -2.520  1.00 0.00 ? 35 ASN B CG   3  
ATOM 5451  O OD1  . ASN B 1 35 ? -5.134  -6.709  -1.484  1.00 0.00 ? 35 ASN B OD1  3  
ATOM 5452  N ND2  . ASN B 1 35 ? -5.807  -8.577  -2.533  1.00 0.00 ? 35 ASN B ND2  3  
ATOM 5453  H H    . ASN B 1 35 ? -3.736  -5.205  -2.274  1.00 0.00 ? 35 ASN B H    3  
ATOM 5454  H HA   . ASN B 1 35 ? -3.419  -6.834  -4.692  1.00 0.00 ? 35 ASN B HA   3  
ATOM 5455  H HB2  . ASN B 1 35 ? -6.086  -5.782  -3.847  1.00 0.00 ? 35 ASN B HB2  3  
ATOM 5456  H HB3  . ASN B 1 35 ? -5.678  -7.304  -4.628  1.00 0.00 ? 35 ASN B HB3  3  
ATOM 5457  H HD21 . ASN B 1 35 ? -6.028  -8.986  -3.395  1.00 0.00 ? 35 ASN B HD21 3  
ATOM 5458  H HD22 . ASN B 1 35 ? -5.847  -9.056  -1.679  1.00 0.00 ? 35 ASN B HD22 3  
ATOM 5459  N N    . ALA B 1 36 ? -3.346  -4.920  -6.235  1.00 0.00 ? 36 ALA B N    3  
ATOM 5460  C CA   . ALA B 1 36 ? -3.353  -3.849  -7.223  1.00 0.00 ? 36 ALA B CA   3  
ATOM 5461  C C    . ALA B 1 36 ? -3.222  -4.394  -8.643  1.00 0.00 ? 36 ALA B C    3  
ATOM 5462  O O    . ALA B 1 36 ? -2.501  -5.362  -8.882  1.00 0.00 ? 36 ALA B O    3  
ATOM 5463  C CB   . ALA B 1 36 ? -2.236  -2.859  -6.933  1.00 0.00 ? 36 ALA B CB   3  
ATOM 5464  H H    . ALA B 1 36 ? -2.766  -5.698  -6.362  1.00 0.00 ? 36 ALA B H    3  
ATOM 5465  H HA   . ALA B 1 36 ? -4.294  -3.325  -7.135  1.00 0.00 ? 36 ALA B HA   3  
ATOM 5466  H HB1  . ALA B 1 36 ? -1.424  -3.368  -6.435  1.00 0.00 ? 36 ALA B HB1  3  
ATOM 5467  H HB2  . ALA B 1 36 ? -2.610  -2.070  -6.297  1.00 0.00 ? 36 ALA B HB2  3  
ATOM 5468  H HB3  . ALA B 1 36 ? -1.880  -2.435  -7.860  1.00 0.00 ? 36 ALA B HB3  3  
ATOM 5469  N N    . PRO B 1 37 ? -3.917  -3.768  -9.610  1.00 0.00 ? 37 PRO B N    3  
ATOM 5470  C CA   . PRO B 1 37 ? -3.874  -4.185  -11.013 1.00 0.00 ? 37 PRO B CA   3  
ATOM 5471  C C    . PRO B 1 37 ? -2.593  -3.735  -11.705 1.00 0.00 ? 37 PRO B C    3  
ATOM 5472  O O    . PRO B 1 37 ? -1.952  -2.774  -11.280 1.00 0.00 ? 37 PRO B O    3  
ATOM 5473  C CB   . PRO B 1 37 ? -5.086  -3.481  -11.620 1.00 0.00 ? 37 PRO B CB   3  
ATOM 5474  C CG   . PRO B 1 37 ? -5.241  -2.243  -10.808 1.00 0.00 ? 37 PRO B CG   3  
ATOM 5475  C CD   . PRO B 1 37 ? -4.798  -2.598  -9.412  1.00 0.00 ? 37 PRO B CD   3  
ATOM 5476  H HA   . PRO B 1 37 ? -3.984  -5.254  -11.114 1.00 0.00 ? 37 PRO B HA   3  
ATOM 5477  H HB2  . PRO B 1 37 ? -4.891  -3.254  -12.658 1.00 0.00 ? 37 PRO B HB2  3  
ATOM 5478  H HB3  . PRO B 1 37 ? -5.954  -4.117  -11.540 1.00 0.00 ? 37 PRO B HB3  3  
ATOM 5479  H HG2  . PRO B 1 37 ? -4.616  -1.459  -11.211 1.00 0.00 ? 37 PRO B HG2  3  
ATOM 5480  H HG3  . PRO B 1 37 ? -6.275  -1.933  -10.805 1.00 0.00 ? 37 PRO B HG3  3  
ATOM 5481  H HD2  . PRO B 1 37 ? -4.253  -1.778  -8.970  1.00 0.00 ? 37 PRO B HD2  3  
ATOM 5482  H HD3  . PRO B 1 37 ? -5.650  -2.858  -8.802  1.00 0.00 ? 37 PRO B HD3  3  
ATOM 5483  N N    . LYS B 1 38 ? -2.224  -4.433  -12.773 1.00 0.00 ? 38 LYS B N    3  
ATOM 5484  C CA   . LYS B 1 38 ? -1.016  -4.102  -13.521 1.00 0.00 ? 38 LYS B CA   3  
ATOM 5485  C C    . LYS B 1 38 ? -1.308  -3.085  -14.625 1.00 0.00 ? 38 LYS B C    3  
ATOM 5486  O O    . LYS B 1 38 ? -0.643  -3.076  -15.661 1.00 0.00 ? 38 LYS B O    3  
ATOM 5487  C CB   . LYS B 1 38 ? -0.405  -5.368  -14.126 1.00 0.00 ? 38 LYS B CB   3  
ATOM 5488  C CG   . LYS B 1 38 ? 0.661   -6.007  -13.251 1.00 0.00 ? 38 LYS B CG   3  
ATOM 5489  C CD   . LYS B 1 38 ? 0.888   -7.463  -13.622 1.00 0.00 ? 38 LYS B CD   3  
ATOM 5490  C CE   . LYS B 1 38 ? 0.170   -8.401  -12.664 1.00 0.00 ? 38 LYS B CE   3  
ATOM 5491  N NZ   . LYS B 1 38 ? 0.165   -9.805  -13.160 1.00 0.00 ? 38 LYS B NZ   3  
ATOM 5492  H H    . LYS B 1 38 ? -2.775  -5.189  -13.065 1.00 0.00 ? 38 LYS B H    3  
ATOM 5493  H HA   . LYS B 1 38 ? -0.309  -3.669  -12.830 1.00 0.00 ? 38 LYS B HA   3  
ATOM 5494  H HB2  . LYS B 1 38 ? -1.190  -6.092  -14.285 1.00 0.00 ? 38 LYS B HB2  3  
ATOM 5495  H HB3  . LYS B 1 38 ? 0.042   -5.120  -15.077 1.00 0.00 ? 38 LYS B HB3  3  
ATOM 5496  H HG2  . LYS B 1 38 ? 1.587   -5.466  -13.376 1.00 0.00 ? 38 LYS B HG2  3  
ATOM 5497  H HG3  . LYS B 1 38 ? 0.347   -5.951  -12.219 1.00 0.00 ? 38 LYS B HG3  3  
ATOM 5498  H HD2  . LYS B 1 38 ? 0.517   -7.633  -14.621 1.00 0.00 ? 38 LYS B HD2  3  
ATOM 5499  H HD3  . LYS B 1 38 ? 1.948   -7.672  -13.589 1.00 0.00 ? 38 LYS B HD3  3  
ATOM 5500  H HE2  . LYS B 1 38 ? 0.669   -8.369  -11.707 1.00 0.00 ? 38 LYS B HE2  3  
ATOM 5501  H HE3  . LYS B 1 38 ? -0.850  -8.064  -12.549 1.00 0.00 ? 38 LYS B HE3  3  
ATOM 5502  H HZ1  . LYS B 1 38 ? -0.309  -9.856  -14.085 1.00 0.00 ? 38 LYS B HZ1  3  
ATOM 5503  H HZ2  . LYS B 1 38 ? -0.340  -10.419 -12.490 1.00 0.00 ? 38 LYS B HZ2  3  
ATOM 5504  H HZ3  . LYS B 1 38 ? 1.140   -10.151 -13.264 1.00 0.00 ? 38 LYS B HZ3  3  
ATOM 5505  N N    . GLU B 1 39 ? -2.302  -2.229  -14.399 1.00 0.00 ? 39 GLU B N    3  
ATOM 5506  C CA   . GLU B 1 39 ? -2.671  -1.212  -15.376 1.00 0.00 ? 39 GLU B CA   3  
ATOM 5507  C C    . GLU B 1 39 ? -2.111  0.151   -14.978 1.00 0.00 ? 39 GLU B C    3  
ATOM 5508  O O    . GLU B 1 39 ? -1.663  0.921   -15.828 1.00 0.00 ? 39 GLU B O    3  
ATOM 5509  C CB   . GLU B 1 39 ? -4.193  -1.131  -15.510 1.00 0.00 ? 39 GLU B CB   3  
ATOM 5510  C CG   . GLU B 1 39 ? -4.799  -2.295  -16.277 1.00 0.00 ? 39 GLU B CG   3  
ATOM 5511  C CD   . GLU B 1 39 ? -5.942  -2.956  -15.531 1.00 0.00 ? 39 GLU B CD   3  
ATOM 5512  O OE1  . GLU B 1 39 ? -7.091  -2.484  -15.666 1.00 0.00 ? 39 GLU B OE1  3  
ATOM 5513  O OE2  . GLU B 1 39 ? -5.688  -3.944  -14.811 1.00 0.00 ? 39 GLU B OE2  3  
ATOM 5514  H H    . GLU B 1 39 ? -2.798  -2.278  -13.558 1.00 0.00 ? 39 GLU B H    3  
ATOM 5515  H HA   . GLU B 1 39 ? -2.249  -1.497  -16.328 1.00 0.00 ? 39 GLU B HA   3  
ATOM 5516  H HB2  . GLU B 1 39 ? -4.629  -1.111  -14.522 1.00 0.00 ? 39 GLU B HB2  3  
ATOM 5517  H HB3  . GLU B 1 39 ? -4.449  -0.217  -16.025 1.00 0.00 ? 39 GLU B HB3  3  
ATOM 5518  H HG2  . GLU B 1 39 ? -5.171  -1.932  -17.224 1.00 0.00 ? 39 GLU B HG2  3  
ATOM 5519  H HG3  . GLU B 1 39 ? -4.030  -3.033  -16.453 1.00 0.00 ? 39 GLU B HG3  3  
ATOM 5520  N N    . VAL B 1 40 ? -2.137  0.440   -13.681 1.00 0.00 ? 40 VAL B N    3  
ATOM 5521  C CA   . VAL B 1 40 ? -1.628  1.708   -13.171 1.00 0.00 ? 40 VAL B CA   3  
ATOM 5522  C C    . VAL B 1 40 ? -0.168  1.579   -12.752 1.00 0.00 ? 40 VAL B C    3  
ATOM 5523  O O    . VAL B 1 40 ? 0.321   0.476   -12.505 1.00 0.00 ? 40 VAL B O    3  
ATOM 5524  C CB   . VAL B 1 40 ? -2.457  2.209   -11.971 1.00 0.00 ? 40 VAL B CB   3  
ATOM 5525  C CG1  . VAL B 1 40 ? -2.065  3.633   -11.609 1.00 0.00 ? 40 VAL B CG1  3  
ATOM 5526  C CG2  . VAL B 1 40 ? -3.945  2.121   -12.277 1.00 0.00 ? 40 VAL B CG2  3  
ATOM 5527  H H    . VAL B 1 40 ? -2.504  -0.216  -13.051 1.00 0.00 ? 40 VAL B H    3  
ATOM 5528  H HA   . VAL B 1 40 ? -1.701  2.438   -13.963 1.00 0.00 ? 40 VAL B HA   3  
ATOM 5529  H HB   . VAL B 1 40 ? -2.248  1.576   -11.122 1.00 0.00 ? 40 VAL B HB   3  
ATOM 5530  H HG11 . VAL B 1 40 ? -2.805  4.052   -10.943 1.00 0.00 ? 40 VAL B HG11 3  
ATOM 5531  H HG12 . VAL B 1 40 ? -2.011  4.231   -12.507 1.00 0.00 ? 40 VAL B HG12 3  
ATOM 5532  H HG13 . VAL B 1 40 ? -1.102  3.629   -11.120 1.00 0.00 ? 40 VAL B HG13 3  
ATOM 5533  H HG21 . VAL B 1 40 ? -4.297  1.121   -12.067 1.00 0.00 ? 40 VAL B HG21 3  
ATOM 5534  H HG22 . VAL B 1 40 ? -4.113  2.350   -13.319 1.00 0.00 ? 40 VAL B HG22 3  
ATOM 5535  H HG23 . VAL B 1 40 ? -4.482  2.828   -11.662 1.00 0.00 ? 40 VAL B HG23 3  
ATOM 5536  N N    . SER B 1 41 ? 0.527   2.709   -12.678 1.00 0.00 ? 41 SER B N    3  
ATOM 5537  C CA   . SER B 1 41 ? 1.934   2.716   -12.294 1.00 0.00 ? 41 SER B CA   3  
ATOM 5538  C C    . SER B 1 41 ? 2.110   2.252   -10.852 1.00 0.00 ? 41 SER B C    3  
ATOM 5539  O O    . SER B 1 41 ? 1.950   3.034   -9.915  1.00 0.00 ? 41 SER B O    3  
ATOM 5540  C CB   . SER B 1 41 ? 2.524   4.116   -12.466 1.00 0.00 ? 41 SER B CB   3  
ATOM 5541  O OG   . SER B 1 41 ? 3.939   4.072   -12.513 1.00 0.00 ? 41 SER B OG   3  
ATOM 5542  H H    . SER B 1 41 ? 0.085   3.558   -12.889 1.00 0.00 ? 41 SER B H    3  
ATOM 5543  H HA   . SER B 1 41 ? 2.458   2.032   -12.945 1.00 0.00 ? 41 SER B HA   3  
ATOM 5544  H HB2  . SER B 1 41 ? 2.159   4.548   -13.386 1.00 0.00 ? 41 SER B HB2  3  
ATOM 5545  H HB3  . SER B 1 41 ? 2.222   4.736   -11.634 1.00 0.00 ? 41 SER B HB3  3  
ATOM 5546  H HG   . SER B 1 41 ? 4.218   3.476   -13.212 1.00 0.00 ? 41 SER B HG   3  
ATOM 5547  N N    . VAL B 1 42 ? 2.447   0.977   -10.679 1.00 0.00 ? 42 VAL B N    3  
ATOM 5548  C CA   . VAL B 1 42 ? 2.653   0.414   -9.350  1.00 0.00 ? 42 VAL B CA   3  
ATOM 5549  C C    . VAL B 1 42 ? 4.058   -0.172  -9.219  1.00 0.00 ? 42 VAL B C    3  
ATOM 5550  O O    . VAL B 1 42 ? 4.434   -1.072  -9.970  1.00 0.00 ? 42 VAL B O    3  
ATOM 5551  C CB   . VAL B 1 42 ? 1.614   -0.681  -9.038  1.00 0.00 ? 42 VAL B CB   3  
ATOM 5552  C CG1  . VAL B 1 42 ? 1.731   -1.833  -10.026 1.00 0.00 ? 42 VAL B CG1  3  
ATOM 5553  C CG2  . VAL B 1 42 ? 1.770   -1.177  -7.608  1.00 0.00 ? 42 VAL B CG2  3  
ATOM 5554  H H    . VAL B 1 42 ? 2.571   0.401   -11.463 1.00 0.00 ? 42 VAL B H    3  
ATOM 5555  H HA   . VAL B 1 42 ? 2.533   1.210   -8.630  1.00 0.00 ? 42 VAL B HA   3  
ATOM 5556  H HB   . VAL B 1 42 ? 0.628   -0.251  -9.140  1.00 0.00 ? 42 VAL B HB   3  
ATOM 5557  H HG11 . VAL B 1 42 ? 0.856   -2.461  -9.951  1.00 0.00 ? 42 VAL B HG11 3  
ATOM 5558  H HG12 . VAL B 1 42 ? 2.613   -2.414  -9.799  1.00 0.00 ? 42 VAL B HG12 3  
ATOM 5559  H HG13 . VAL B 1 42 ? 1.807   -1.440  -11.029 1.00 0.00 ? 42 VAL B HG13 3  
ATOM 5560  H HG21 . VAL B 1 42 ? 2.324   -2.105  -7.607  1.00 0.00 ? 42 VAL B HG21 3  
ATOM 5561  H HG22 . VAL B 1 42 ? 0.794   -1.340  -7.175  1.00 0.00 ? 42 VAL B HG22 3  
ATOM 5562  H HG23 . VAL B 1 42 ? 2.303   -0.439  -7.027  1.00 0.00 ? 42 VAL B HG23 3  
ATOM 5563  N N    . HIS B 1 43 ? 4.831   0.340   -8.265  1.00 0.00 ? 43 HIS B N    3  
ATOM 5564  C CA   . HIS B 1 43 ? 6.192   -0.139  -8.045  1.00 0.00 ? 43 HIS B CA   3  
ATOM 5565  C C    . HIS B 1 43 ? 6.406   -0.506  -6.580  1.00 0.00 ? 43 HIS B C    3  
ATOM 5566  O O    . HIS B 1 43 ? 5.991   0.225   -5.681  1.00 0.00 ? 43 HIS B O    3  
ATOM 5567  C CB   . HIS B 1 43 ? 7.206   0.925   -8.475  1.00 0.00 ? 43 HIS B CB   3  
ATOM 5568  C CG   . HIS B 1 43 ? 8.168   0.445   -9.517  1.00 0.00 ? 43 HIS B CG   3  
ATOM 5569  N ND1  . HIS B 1 43 ? 8.554   1.212   -10.596 1.00 0.00 ? 43 HIS B ND1  3  
ATOM 5570  C CD2  . HIS B 1 43 ? 8.826   -0.733  -9.642  1.00 0.00 ? 43 HIS B CD2  3  
ATOM 5571  C CE1  . HIS B 1 43 ? 9.404   0.529   -11.341 1.00 0.00 ? 43 HIS B CE1  3  
ATOM 5572  N NE2  . HIS B 1 43 ? 9.587   -0.654  -10.783 1.00 0.00 ? 43 HIS B NE2  3  
ATOM 5573  H H    . HIS B 1 43 ? 4.484   1.056   -7.694  1.00 0.00 ? 43 HIS B H    3  
ATOM 5574  H HA   . HIS B 1 43 ? 6.333   -1.023  -8.649  1.00 0.00 ? 43 HIS B HA   3  
ATOM 5575  H HB2  . HIS B 1 43 ? 6.676   1.774   -8.879  1.00 0.00 ? 43 HIS B HB2  3  
ATOM 5576  H HB3  . HIS B 1 43 ? 7.777   1.240   -7.613  1.00 0.00 ? 43 HIS B HB3  3  
ATOM 5577  H HD2  . HIS B 1 43 ? 8.763   -1.576  -8.969  1.00 0.00 ? 43 HIS B HD2  3  
ATOM 5578  H HE1  . HIS B 1 43 ? 9.872   0.878   -12.249 1.00 0.00 ? 43 HIS B HE1  3  
ATOM 5579  H HE2  . HIS B 1 43 ? 10.235  -1.326  -11.082 1.00 0.00 ? 43 HIS B HE2  3  
ATOM 5580  N N    . ARG B 1 44 ? 7.058   -1.641  -6.344  1.00 0.00 ? 44 ARG B N    3  
ATOM 5581  C CA   . ARG B 1 44 ? 7.327   -2.099  -4.986  1.00 0.00 ? 44 ARG B CA   3  
ATOM 5582  C C    . ARG B 1 44 ? 8.779   -2.544  -4.845  1.00 0.00 ? 44 ARG B C    3  
ATOM 5583  O O    . ARG B 1 44 ? 9.569   -2.423  -5.782  1.00 0.00 ? 44 ARG B O    3  
ATOM 5584  C CB   . ARG B 1 44 ? 6.388   -3.249  -4.619  1.00 0.00 ? 44 ARG B CB   3  
ATOM 5585  C CG   . ARG B 1 44 ? 4.921   -2.850  -4.584  1.00 0.00 ? 44 ARG B CG   3  
ATOM 5586  C CD   . ARG B 1 44 ? 4.036   -3.915  -5.213  1.00 0.00 ? 44 ARG B CD   3  
ATOM 5587  N NE   . ARG B 1 44 ? 4.390   -4.168  -6.608  1.00 0.00 ? 44 ARG B NE   3  
ATOM 5588  C CZ   . ARG B 1 44 ? 3.583   -4.769  -7.480  1.00 0.00 ? 44 ARG B CZ   3  
ATOM 5589  N NH1  . ARG B 1 44 ? 2.377   -5.178  -7.106  1.00 0.00 ? 44 ARG B NH1  3  
ATOM 5590  N NH2  . ARG B 1 44 ? 3.983   -4.960  -8.729  1.00 0.00 ? 44 ARG B NH2  3  
ATOM 5591  H H    . ARG B 1 44 ? 7.371   -2.183  -7.098  1.00 0.00 ? 44 ARG B H    3  
ATOM 5592  H HA   . ARG B 1 44 ? 7.149   -1.271  -4.316  1.00 0.00 ? 44 ARG B HA   3  
ATOM 5593  H HB2  . ARG B 1 44 ? 6.507   -4.041  -5.344  1.00 0.00 ? 44 ARG B HB2  3  
ATOM 5594  H HB3  . ARG B 1 44 ? 6.660   -3.623  -3.643  1.00 0.00 ? 44 ARG B HB3  3  
ATOM 5595  H HG2  . ARG B 1 44 ? 4.621   -2.708  -3.557  1.00 0.00 ? 44 ARG B HG2  3  
ATOM 5596  H HG3  . ARG B 1 44 ? 4.798   -1.924  -5.128  1.00 0.00 ? 44 ARG B HG3  3  
ATOM 5597  H HD2  . ARG B 1 44 ? 4.145   -4.831  -4.652  1.00 0.00 ? 44 ARG B HD2  3  
ATOM 5598  H HD3  . ARG B 1 44 ? 3.009   -3.584  -5.165  1.00 0.00 ? 44 ARG B HD3  3  
ATOM 5599  H HE   . ARG B 1 44 ? 5.275   -3.875  -6.911  1.00 0.00 ? 44 ARG B HE   3  
ATOM 5600  H HH11 . ARG B 1 44 ? 2.069   -5.036  -6.165  1.00 0.00 ? 44 ARG B HH11 3  
ATOM 5601  H HH12 . ARG B 1 44 ? 1.775   -5.629  -7.766  1.00 0.00 ? 44 ARG B HH12 3  
ATOM 5602  H HH21 . ARG B 1 44 ? 4.890   -4.653  -9.017  1.00 0.00 ? 44 ARG B HH21 3  
ATOM 5603  H HH22 . ARG B 1 44 ? 3.377   -5.412  -9.385  1.00 0.00 ? 44 ARG B HH22 3  
ATOM 5604  N N    . GLU B 1 45 ? 9.126   -3.060  -3.670  1.00 0.00 ? 45 GLU B N    3  
ATOM 5605  C CA   . GLU B 1 45 ? 10.485  -3.522  -3.412  1.00 0.00 ? 45 GLU B CA   3  
ATOM 5606  C C    . GLU B 1 45 ? 10.839  -4.704  -4.310  1.00 0.00 ? 45 GLU B C    3  
ATOM 5607  O O    . GLU B 1 45 ? 9.976   -5.508  -4.666  1.00 0.00 ? 45 GLU B O    3  
ATOM 5608  C CB   . GLU B 1 45 ? 10.641  -3.921  -1.943  1.00 0.00 ? 45 GLU B CB   3  
ATOM 5609  C CG   . GLU B 1 45 ? 10.894  -2.744  -1.015  1.00 0.00 ? 45 GLU B CG   3  
ATOM 5610  C CD   . GLU B 1 45 ? 11.873  -3.077  0.093   1.00 0.00 ? 45 GLU B CD   3  
ATOM 5611  O OE1  . GLU B 1 45 ? 11.561  -3.963  0.916   1.00 0.00 ? 45 GLU B OE1  3  
ATOM 5612  O OE2  . GLU B 1 45 ? 12.953  -2.451  0.139   1.00 0.00 ? 45 GLU B OE2  3  
ATOM 5613  H H    . GLU B 1 45 ? 8.454   -3.131  -2.961  1.00 0.00 ? 45 GLU B H    3  
ATOM 5614  H HA   . GLU B 1 45 ? 11.159  -2.707  -3.627  1.00 0.00 ? 45 GLU B HA   3  
ATOM 5615  H HB2  . GLU B 1 45 ? 9.739   -4.419  -1.619  1.00 0.00 ? 45 GLU B HB2  3  
ATOM 5616  H HB3  . GLU B 1 45 ? 11.471  -4.606  -1.854  1.00 0.00 ? 45 GLU B HB3  3  
ATOM 5617  H HG2  . GLU B 1 45 ? 11.293  -1.925  -1.594  1.00 0.00 ? 45 GLU B HG2  3  
ATOM 5618  H HG3  . GLU B 1 45 ? 9.956   -2.446  -0.570  1.00 0.00 ? 45 GLU B HG3  3  
ATOM 5619  N N    . GLU B 1 46 ? 12.113  -4.801  -4.678  1.00 0.00 ? 46 GLU B N    3  
ATOM 5620  C CA   . GLU B 1 46 ? 12.583  -5.883  -5.539  1.00 0.00 ? 46 GLU B CA   3  
ATOM 5621  C C    . GLU B 1 46 ? 12.141  -7.243  -5.006  1.00 0.00 ? 46 GLU B C    3  
ATOM 5622  O O    . GLU B 1 46 ? 11.420  -7.978  -5.680  1.00 0.00 ? 46 GLU B O    3  
ATOM 5623  C CB   . GLU B 1 46 ? 14.108  -5.842  -5.655  1.00 0.00 ? 46 GLU B CB   3  
ATOM 5624  C CG   . GLU B 1 46 ? 14.610  -4.963  -6.789  1.00 0.00 ? 46 GLU B CG   3  
ATOM 5625  C CD   . GLU B 1 46 ? 14.361  -3.488  -6.537  1.00 0.00 ? 46 GLU B CD   3  
ATOM 5626  O OE1  . GLU B 1 46 ? 15.222  -2.841  -5.904  1.00 0.00 ? 46 GLU B OE1  3  
ATOM 5627  O OE2  . GLU B 1 46 ? 13.306  -2.981  -6.972  1.00 0.00 ? 46 GLU B OE2  3  
ATOM 5628  H H    . GLU B 1 46 ? 12.754  -4.127  -4.369  1.00 0.00 ? 46 GLU B H    3  
ATOM 5629  H HA   . GLU B 1 46 ? 12.154  -5.736  -6.518  1.00 0.00 ? 46 GLU B HA   3  
ATOM 5630  H HB2  . GLU B 1 46 ? 14.518  -5.467  -4.729  1.00 0.00 ? 46 GLU B HB2  3  
ATOM 5631  H HB3  . GLU B 1 46 ? 14.472  -6.846  -5.819  1.00 0.00 ? 46 GLU B HB3  3  
ATOM 5632  H HG2  . GLU B 1 46 ? 15.672  -5.118  -6.905  1.00 0.00 ? 46 GLU B HG2  3  
ATOM 5633  H HG3  . GLU B 1 46 ? 14.103  -5.248  -7.699  1.00 0.00 ? 46 GLU B HG3  3  
ATOM 5634  N N    . ILE B 1 47 ? 12.577  -7.569  -3.793  1.00 0.00 ? 47 ILE B N    3  
ATOM 5635  C CA   . ILE B 1 47 ? 12.227  -8.841  -3.168  1.00 0.00 ? 47 ILE B CA   3  
ATOM 5636  C C    . ILE B 1 47 ? 10.714  -9.036  -3.118  1.00 0.00 ? 47 ILE B C    3  
ATOM 5637  O O    . ILE B 1 47 ? 10.216  -10.152 -3.264  1.00 0.00 ? 47 ILE B O    3  
ATOM 5638  C CB   . ILE B 1 47 ? 12.801  -8.940  -1.739  1.00 0.00 ? 47 ILE B CB   3  
ATOM 5639  C CG1  . ILE B 1 47 ? 12.547  -10.332 -1.154  1.00 0.00 ? 47 ILE B CG1  3  
ATOM 5640  C CG2  . ILE B 1 47 ? 12.200  -7.865  -0.846  1.00 0.00 ? 47 ILE B CG2  3  
ATOM 5641  C CD1  . ILE B 1 47 ? 13.671  -11.311 -1.414  1.00 0.00 ? 47 ILE B CD1  3  
ATOM 5642  H H    . ILE B 1 47 ? 13.149  -6.940  -3.306  1.00 0.00 ? 47 ILE B H    3  
ATOM 5643  H HA   . ILE B 1 47 ? 12.661  -9.633  -3.762  1.00 0.00 ? 47 ILE B HA   3  
ATOM 5644  H HB   . ILE B 1 47 ? 13.866  -8.771  -1.793  1.00 0.00 ? 47 ILE B HB   3  
ATOM 5645  H HG12 . ILE B 1 47 ? 12.421  -10.249 -0.085  1.00 0.00 ? 47 ILE B HG12 3  
ATOM 5646  H HG13 . ILE B 1 47 ? 11.645  -10.739 -1.587  1.00 0.00 ? 47 ILE B HG13 3  
ATOM 5647  H HG21 . ILE B 1 47 ? 11.317  -8.254  -0.359  1.00 0.00 ? 47 ILE B HG21 3  
ATOM 5648  H HG22 . ILE B 1 47 ? 11.932  -7.008  -1.446  1.00 0.00 ? 47 ILE B HG22 3  
ATOM 5649  H HG23 . ILE B 1 47 ? 12.923  -7.570  -0.100  1.00 0.00 ? 47 ILE B HG23 3  
ATOM 5650  H HD11 . ILE B 1 47 ? 13.738  -12.009 -0.592  1.00 0.00 ? 47 ILE B HD11 3  
ATOM 5651  H HD12 . ILE B 1 47 ? 14.603  -10.773 -1.506  1.00 0.00 ? 47 ILE B HD12 3  
ATOM 5652  H HD13 . ILE B 1 47 ? 13.474  -11.850 -2.329  1.00 0.00 ? 47 ILE B HD13 3  
ATOM 5653  N N    . TYR B 1 48 ? 9.988   -7.941  -2.911  1.00 0.00 ? 48 TYR B N    3  
ATOM 5654  C CA   . TYR B 1 48 ? 8.530   -7.988  -2.841  1.00 0.00 ? 48 TYR B CA   3  
ATOM 5655  C C    . TYR B 1 48 ? 7.944   -8.678  -4.071  1.00 0.00 ? 48 TYR B C    3  
ATOM 5656  O O    . TYR B 1 48 ? 7.465   -9.811  -3.994  1.00 0.00 ? 48 TYR B O    3  
ATOM 5657  C CB   . TYR B 1 48 ? 7.961   -6.571  -2.718  1.00 0.00 ? 48 TYR B CB   3  
ATOM 5658  C CG   . TYR B 1 48 ? 7.348   -6.272  -1.368  1.00 0.00 ? 48 TYR B CG   3  
ATOM 5659  C CD1  . TYR B 1 48 ? 8.099   -6.373  -0.204  1.00 0.00 ? 48 TYR B CD1  3  
ATOM 5660  C CD2  . TYR B 1 48 ? 6.019   -5.881  -1.260  1.00 0.00 ? 48 TYR B CD2  3  
ATOM 5661  C CE1  . TYR B 1 48 ? 7.542   -6.094  1.031   1.00 0.00 ? 48 TYR B CE1  3  
ATOM 5662  C CE2  . TYR B 1 48 ? 5.456   -5.601  -0.030  1.00 0.00 ? 48 TYR B CE2  3  
ATOM 5663  C CZ   . TYR B 1 48 ? 6.221   -5.709  1.112   1.00 0.00 ? 48 TYR B CZ   3  
ATOM 5664  O OH   . TYR B 1 48 ? 5.663   -5.430  2.338   1.00 0.00 ? 48 TYR B OH   3  
ATOM 5665  H H    . TYR B 1 48 ? 10.443  -7.080  -2.802  1.00 0.00 ? 48 TYR B H    3  
ATOM 5666  H HA   . TYR B 1 48 ? 8.259   -8.553  -1.963  1.00 0.00 ? 48 TYR B HA   3  
ATOM 5667  H HB2  . TYR B 1 48 ? 8.753   -5.858  -2.883  1.00 0.00 ? 48 TYR B HB2  3  
ATOM 5668  H HB3  . TYR B 1 48 ? 7.196   -6.430  -3.468  1.00 0.00 ? 48 TYR B HB3  3  
ATOM 5669  H HD1  . TYR B 1 48 ? 9.134   -6.675  -0.271  1.00 0.00 ? 48 TYR B HD1  3  
ATOM 5670  H HD2  . TYR B 1 48 ? 5.422   -5.799  -2.156  1.00 0.00 ? 48 TYR B HD2  3  
ATOM 5671  H HE1  . TYR B 1 48 ? 8.142   -6.179  1.925   1.00 0.00 ? 48 TYR B HE1  3  
ATOM 5672  H HE2  . TYR B 1 48 ? 4.421   -5.300  0.033   1.00 0.00 ? 48 TYR B HE2  3  
ATOM 5673  H HH   . TYR B 1 48 ? 6.066   -4.639  2.702   1.00 0.00 ? 48 TYR B HH   3  
ATOM 5674  N N    . GLN B 1 49 ? 7.983   -7.985  -5.202  1.00 0.00 ? 49 GLN B N    3  
ATOM 5675  C CA   . GLN B 1 49 ? 7.453   -8.523  -6.449  1.00 0.00 ? 49 GLN B CA   3  
ATOM 5676  C C    . GLN B 1 49 ? 8.235   -9.754  -6.906  1.00 0.00 ? 49 GLN B C    3  
ATOM 5677  O O    . GLN B 1 49 ? 7.762   -10.519 -7.745  1.00 0.00 ? 49 GLN B O    3  
ATOM 5678  C CB   . GLN B 1 49 ? 7.489   -7.452  -7.541  1.00 0.00 ? 49 GLN B CB   3  
ATOM 5679  C CG   . GLN B 1 49 ? 8.871   -6.858  -7.765  1.00 0.00 ? 49 GLN B CG   3  
ATOM 5680  C CD   . GLN B 1 49 ? 8.821   -5.389  -8.140  1.00 0.00 ? 49 GLN B CD   3  
ATOM 5681  O OE1  . GLN B 1 49 ? 7.997   -4.972  -8.954  1.00 0.00 ? 49 GLN B OE1  3  
ATOM 5682  N NE2  . GLN B 1 49 ? 9.705   -4.596  -7.546  1.00 0.00 ? 49 GLN B NE2  3  
ATOM 5683  H H    . GLN B 1 49 ? 8.374   -7.085  -5.203  1.00 0.00 ? 49 GLN B H    3  
ATOM 5684  H HA   . GLN B 1 49 ? 6.426   -8.809  -6.275  1.00 0.00 ? 49 GLN B HA   3  
ATOM 5685  H HB2  . GLN B 1 49 ? 7.155   -7.888  -8.469  1.00 0.00 ? 49 GLN B HB2  3  
ATOM 5686  H HB3  . GLN B 1 49 ? 6.818   -6.652  -7.267  1.00 0.00 ? 49 GLN B HB3  3  
ATOM 5687  H HG2  . GLN B 1 49 ? 9.446   -6.963  -6.858  1.00 0.00 ? 49 GLN B HG2  3  
ATOM 5688  H HG3  . GLN B 1 49 ? 9.356   -7.401  -8.563  1.00 0.00 ? 49 GLN B HG3  3  
ATOM 5689  H HE21 . GLN B 1 49 ? 10.332  -4.998  -6.908  1.00 0.00 ? 49 GLN B HE21 3  
ATOM 5690  H HE22 . GLN B 1 49 ? 9.695   -3.642  -7.769  1.00 0.00 ? 49 GLN B HE22 3  
ATOM 5691  N N    . ARG B 1 50 ? 9.434   -9.938  -6.358  1.00 0.00 ? 50 ARG B N    3  
ATOM 5692  C CA   . ARG B 1 50 ? 10.274  -11.073 -6.722  1.00 0.00 ? 50 ARG B CA   3  
ATOM 5693  C C    . ARG B 1 50 ? 9.690   -12.385 -6.206  1.00 0.00 ? 50 ARG B C    3  
ATOM 5694  O O    . ARG B 1 50 ? 9.872   -13.438 -6.817  1.00 0.00 ? 50 ARG B O    3  
ATOM 5695  C CB   . ARG B 1 50 ? 11.689  -10.883 -6.171  1.00 0.00 ? 50 ARG B CB   3  
ATOM 5696  C CG   . ARG B 1 50 ? 12.693  -10.421 -7.216  1.00 0.00 ? 50 ARG B CG   3  
ATOM 5697  C CD   . ARG B 1 50 ? 13.865  -11.383 -7.330  1.00 0.00 ? 50 ARG B CD   3  
ATOM 5698  N NE   . ARG B 1 50 ? 14.746  -11.313 -6.167  1.00 0.00 ? 50 ARG B NE   3  
ATOM 5699  C CZ   . ARG B 1 50 ? 15.602  -12.274 -5.825  1.00 0.00 ? 50 ARG B CZ   3  
ATOM 5700  N NH1  . ARG B 1 50 ? 15.697  -13.379 -6.555  1.00 0.00 ? 50 ARG B NH1  3  
ATOM 5701  N NH2  . ARG B 1 50 ? 16.366  -12.130 -4.751  1.00 0.00 ? 50 ARG B NH2  3  
ATOM 5702  H H    . ARG B 1 50 ? 9.765   -9.298  -5.698  1.00 0.00 ? 50 ARG B H    3  
ATOM 5703  H HA   . ARG B 1 50 ? 10.322  -11.113 -7.798  1.00 0.00 ? 50 ARG B HA   3  
ATOM 5704  H HB2  . ARG B 1 50 ? 11.659  -10.147 -5.382  1.00 0.00 ? 50 ARG B HB2  3  
ATOM 5705  H HB3  . ARG B 1 50 ? 12.034  -11.821 -5.761  1.00 0.00 ? 50 ARG B HB3  3  
ATOM 5706  H HG2  . ARG B 1 50 ? 12.198  -10.357 -8.173  1.00 0.00 ? 50 ARG B HG2  3  
ATOM 5707  H HG3  . ARG B 1 50 ? 13.066  -9.446  -6.936  1.00 0.00 ? 50 ARG B HG3  3  
ATOM 5708  H HD2  . ARG B 1 50 ? 13.481  -12.388 -7.419  1.00 0.00 ? 50 ARG B HD2  3  
ATOM 5709  H HD3  . ARG B 1 50 ? 14.432  -11.136 -8.216  1.00 0.00 ? 50 ARG B HD3  3  
ATOM 5710  H HE   . ARG B 1 50 ? 14.697  -10.508 -5.610  1.00 0.00 ? 50 ARG B HE   3  
ATOM 5711  H HH11 . ARG B 1 50 ? 15.125  -13.494 -7.366  1.00 0.00 ? 50 ARG B HH11 3  
ATOM 5712  H HH12 . ARG B 1 50 ? 16.342  -14.096 -6.292  1.00 0.00 ? 50 ARG B HH12 3  
ATOM 5713  H HH21 . ARG B 1 50 ? 16.299  -11.299 -4.198  1.00 0.00 ? 50 ARG B HH21 3  
ATOM 5714  H HH22 . ARG B 1 50 ? 17.009  -12.851 -4.494  1.00 0.00 ? 50 ARG B HH22 3  
ATOM 5715  N N    . ILE B 1 51 ? 8.998   -12.320 -5.075  1.00 0.00 ? 51 ILE B N    3  
ATOM 5716  C CA   . ILE B 1 51 ? 8.401   -13.509 -4.479  1.00 0.00 ? 51 ILE B CA   3  
ATOM 5717  C C    . ILE B 1 51 ? 6.890   -13.555 -4.694  1.00 0.00 ? 51 ILE B C    3  
ATOM 5718  O O    . ILE B 1 51 ? 6.256   -14.583 -4.457  1.00 0.00 ? 51 ILE B O    3  
ATOM 5719  C CB   . ILE B 1 51 ? 8.691   -13.582 -2.967  1.00 0.00 ? 51 ILE B CB   3  
ATOM 5720  C CG1  . ILE B 1 51 ? 10.179  -13.353 -2.700  1.00 0.00 ? 51 ILE B CG1  3  
ATOM 5721  C CG2  . ILE B 1 51 ? 8.247   -14.925 -2.406  1.00 0.00 ? 51 ILE B CG2  3  
ATOM 5722  C CD1  . ILE B 1 51 ? 11.077  -14.371 -3.371  1.00 0.00 ? 51 ILE B CD1  3  
ATOM 5723  H H    . ILE B 1 51 ? 8.892   -11.454 -4.627  1.00 0.00 ? 51 ILE B H    3  
ATOM 5724  H HA   . ILE B 1 51 ? 8.846   -14.374 -4.948  1.00 0.00 ? 51 ILE B HA   3  
ATOM 5725  H HB   . ILE B 1 51 ? 8.121   -12.808 -2.476  1.00 0.00 ? 51 ILE B HB   3  
ATOM 5726  H HG12 . ILE B 1 51 ? 10.458  -12.375 -3.063  1.00 0.00 ? 51 ILE B HG12 3  
ATOM 5727  H HG13 . ILE B 1 51 ? 10.359  -13.402 -1.635  1.00 0.00 ? 51 ILE B HG13 3  
ATOM 5728  H HG21 . ILE B 1 51 ? 8.938   -15.241 -1.639  1.00 0.00 ? 51 ILE B HG21 3  
ATOM 5729  H HG22 . ILE B 1 51 ? 8.228   -15.658 -3.199  1.00 0.00 ? 51 ILE B HG22 3  
ATOM 5730  H HG23 . ILE B 1 51 ? 7.258   -14.828 -1.982  1.00 0.00 ? 51 ILE B HG23 3  
ATOM 5731  H HD11 . ILE B 1 51 ? 10.903  -14.357 -4.437  1.00 0.00 ? 51 ILE B HD11 3  
ATOM 5732  H HD12 . ILE B 1 51 ? 10.858  -15.355 -2.984  1.00 0.00 ? 51 ILE B HD12 3  
ATOM 5733  H HD13 . ILE B 1 51 ? 12.110  -14.127 -3.172  1.00 0.00 ? 51 ILE B HD13 3  
ATOM 5734  N N    . GLN B 1 52 ? 6.312   -12.440 -5.133  1.00 0.00 ? 52 GLN B N    3  
ATOM 5735  C CA   . GLN B 1 52 ? 4.871   -12.374 -5.361  1.00 0.00 ? 52 GLN B CA   3  
ATOM 5736  C C    . GLN B 1 52 ? 4.541   -12.162 -6.836  1.00 0.00 ? 52 GLN B C    3  
ATOM 5737  O O    . GLN B 1 52 ? 3.828   -12.962 -7.442  1.00 0.00 ? 52 GLN B O    3  
ATOM 5738  C CB   . GLN B 1 52 ? 4.254   -11.252 -4.524  1.00 0.00 ? 52 GLN B CB   3  
ATOM 5739  C CG   . GLN B 1 52 ? 3.848   -11.690 -3.126  1.00 0.00 ? 52 GLN B CG   3  
ATOM 5740  C CD   . GLN B 1 52 ? 2.927   -12.895 -3.137  1.00 0.00 ? 52 GLN B CD   3  
ATOM 5741  O OE1  . GLN B 1 52 ? 2.357   -13.246 -4.171  1.00 0.00 ? 52 GLN B OE1  3  
ATOM 5742  N NE2  . GLN B 1 52 ? 2.776   -13.535 -1.984  1.00 0.00 ? 52 GLN B NE2  3  
ATOM 5743  H H    . GLN B 1 52 ? 6.863   -11.645 -5.298  1.00 0.00 ? 52 GLN B H    3  
ATOM 5744  H HA   . GLN B 1 52 ? 4.446   -13.315 -5.046  1.00 0.00 ? 52 GLN B HA   3  
ATOM 5745  H HB2  . GLN B 1 52 ? 4.973   -10.450 -4.433  1.00 0.00 ? 52 GLN B HB2  3  
ATOM 5746  H HB3  . GLN B 1 52 ? 3.376   -10.881 -5.032  1.00 0.00 ? 52 GLN B HB3  3  
ATOM 5747  H HG2  . GLN B 1 52 ? 4.737   -11.941 -2.568  1.00 0.00 ? 52 GLN B HG2  3  
ATOM 5748  H HG3  . GLN B 1 52 ? 3.338   -10.870 -2.640  1.00 0.00 ? 52 GLN B HG3  3  
ATOM 5749  H HE21 . GLN B 1 52 ? 3.260   -13.199 -1.201  1.00 0.00 ? 52 GLN B HE21 3  
ATOM 5750  H HE22 . GLN B 1 52 ? 2.187   -14.318 -1.962  1.00 0.00 ? 52 GLN B HE22 3  
ATOM 5751  N N    . ALA B 1 53 ? 5.055   -11.078 -7.407  1.00 0.00 ? 53 ALA B N    3  
ATOM 5752  C CA   . ALA B 1 53 ? 4.803   -10.762 -8.807  1.00 0.00 ? 53 ALA B CA   3  
ATOM 5753  C C    . ALA B 1 53 ? 5.466   -11.777 -9.733  1.00 0.00 ? 53 ALA B C    3  
ATOM 5754  O O    . ALA B 1 53 ? 4.792   -12.596 -10.356 1.00 0.00 ? 53 ALA B O    3  
ATOM 5755  C CB   . ALA B 1 53 ? 5.286   -9.355  -9.126  1.00 0.00 ? 53 ALA B CB   3  
ATOM 5756  H H    . ALA B 1 53 ? 5.611   -10.476 -6.874  1.00 0.00 ? 53 ALA B H    3  
ATOM 5757  H HA   . ALA B 1 53 ? 3.737   -10.793 -8.964  1.00 0.00 ? 53 ALA B HA   3  
ATOM 5758  H HB1  . ALA B 1 53 ? 4.559   -8.859  -9.751  1.00 0.00 ? 53 ALA B HB1  3  
ATOM 5759  H HB2  . ALA B 1 53 ? 6.231   -9.407  -9.645  1.00 0.00 ? 53 ALA B HB2  3  
ATOM 5760  H HB3  . ALA B 1 53 ? 5.409   -8.801  -8.207  1.00 0.00 ? 53 ALA B HB3  3  
ATOM 5761  N N    . GLU B 1 54 ? 6.790   -11.717 -9.818  1.00 0.00 ? 54 GLU B N    3  
ATOM 5762  C CA   . GLU B 1 54 ? 7.543   -12.631 -10.667 1.00 0.00 ? 54 GLU B CA   3  
ATOM 5763  C C    . GLU B 1 54 ? 8.487   -13.488 -9.832  1.00 0.00 ? 54 GLU B C    3  
ATOM 5764  O O    . GLU B 1 54 ? 9.402   -12.975 -9.190  1.00 0.00 ? 54 GLU B O    3  
ATOM 5765  C CB   . GLU B 1 54 ? 8.335   -11.850 -11.718 1.00 0.00 ? 54 GLU B CB   3  
ATOM 5766  C CG   . GLU B 1 54 ? 7.457   -11.085 -12.695 1.00 0.00 ? 54 GLU B CG   3  
ATOM 5767  C CD   . GLU B 1 54 ? 6.985   -11.945 -13.851 1.00 0.00 ? 54 GLU B CD   3  
ATOM 5768  O OE1  . GLU B 1 54 ? 7.780   -12.780 -14.333 1.00 0.00 ? 54 GLU B OE1  3  
ATOM 5769  O OE2  . GLU B 1 54 ? 5.821   -11.784 -14.274 1.00 0.00 ? 54 GLU B OE2  3  
ATOM 5770  H H    . GLU B 1 54 ? 7.273   -11.043 -9.296  1.00 0.00 ? 54 GLU B H    3  
ATOM 5771  H HA   . GLU B 1 54 ? 6.837   -13.277 -11.167 1.00 0.00 ? 54 GLU B HA   3  
ATOM 5772  H HB2  . GLU B 1 54 ? 8.978   -11.143 -11.215 1.00 0.00 ? 54 GLU B HB2  3  
ATOM 5773  H HB3  . GLU B 1 54 ? 8.945   -12.542 -12.280 1.00 0.00 ? 54 GLU B HB3  3  
ATOM 5774  H HG2  . GLU B 1 54 ? 6.592   -10.714 -12.167 1.00 0.00 ? 54 GLU B HG2  3  
ATOM 5775  H HG3  . GLU B 1 54 ? 8.022   -10.253 -13.091 1.00 0.00 ? 54 GLU B HG3  3  
ATOM 5776  N N    . LYS B 1 55 ? 8.259   -14.797 -9.848  1.00 0.00 ? 55 LYS B N    3  
ATOM 5777  C CA   . LYS B 1 55 ? 9.092   -15.725 -9.093  1.00 0.00 ? 55 LYS B CA   3  
ATOM 5778  C C    . LYS B 1 55 ? 10.541  -15.642 -9.557  1.00 0.00 ? 55 LYS B C    3  
ATOM 5779  O O    . LYS B 1 55 ? 10.871  -16.071 -10.662 1.00 0.00 ? 55 LYS B O    3  
ATOM 5780  C CB   . LYS B 1 55 ? 8.575   -17.156 -9.250  1.00 0.00 ? 55 LYS B CB   3  
ATOM 5781  C CG   . LYS B 1 55 ? 7.184   -17.367 -8.676  1.00 0.00 ? 55 LYS B CG   3  
ATOM 5782  C CD   . LYS B 1 55 ? 6.390   -18.374 -9.493  1.00 0.00 ? 55 LYS B CD   3  
ATOM 5783  C CE   . LYS B 1 55 ? 6.179   -17.892 -10.920 1.00 0.00 ? 55 LYS B CE   3  
ATOM 5784  N NZ   . LYS B 1 55 ? 7.090   -18.578 -11.878 1.00 0.00 ? 55 LYS B NZ   3  
ATOM 5785  H H    . LYS B 1 55 ? 7.517   -15.146 -10.385 1.00 0.00 ? 55 LYS B H    3  
ATOM 5786  H HA   . LYS B 1 55 ? 9.042   -15.445 -8.051  1.00 0.00 ? 55 LYS B HA   3  
ATOM 5787  H HB2  . LYS B 1 55 ? 8.548   -17.403 -10.301 1.00 0.00 ? 55 LYS B HB2  3  
ATOM 5788  H HB3  . LYS B 1 55 ? 9.254   -17.830 -8.749  1.00 0.00 ? 55 LYS B HB3  3  
ATOM 5789  H HG2  . LYS B 1 55 ? 7.275   -17.732 -7.663  1.00 0.00 ? 55 LYS B HG2  3  
ATOM 5790  H HG3  . LYS B 1 55 ? 6.659   -16.423 -8.674  1.00 0.00 ? 55 LYS B HG3  3  
ATOM 5791  H HD2  . LYS B 1 55 ? 6.929   -19.309 -9.515  1.00 0.00 ? 55 LYS B HD2  3  
ATOM 5792  H HD3  . LYS B 1 55 ? 5.427   -18.522 -9.026  1.00 0.00 ? 55 LYS B HD3  3  
ATOM 5793  H HE2  . LYS B 1 55 ? 5.157   -18.090 -11.205 1.00 0.00 ? 55 LYS B HE2  3  
ATOM 5794  H HE3  . LYS B 1 55 ? 6.364   -16.829 -10.959 1.00 0.00 ? 55 LYS B HE3  3  
ATOM 5795  H HZ1  . LYS B 1 55 ? 6.590   -19.360 -12.348 1.00 0.00 ? 55 LYS B HZ1  3  
ATOM 5796  H HZ2  . LYS B 1 55 ? 7.916   -18.962 -11.376 1.00 0.00 ? 55 LYS B HZ2  3  
ATOM 5797  H HZ3  . LYS B 1 55 ? 7.419   -17.907 -12.601 1.00 0.00 ? 55 LYS B HZ3  3  
ATOM 5798  N N    . SER B 1 56 ? 11.403  -15.094 -8.704  1.00 0.00 ? 56 SER B N    3  
ATOM 5799  C CA   . SER B 1 56 ? 12.821  -14.957 -9.026  1.00 0.00 ? 56 SER B CA   3  
ATOM 5800  C C    . SER B 1 56 ? 13.031  -13.978 -10.179 1.00 0.00 ? 56 SER B C    3  
ATOM 5801  O O    . SER B 1 56 ? 13.604  -12.903 -9.996  1.00 0.00 ? 56 SER B O    3  
ATOM 5802  C CB   . SER B 1 56 ? 13.423  -16.320 -9.380  1.00 0.00 ? 56 SER B CB   3  
ATOM 5803  O OG   . SER B 1 56 ? 14.149  -16.856 -8.287  1.00 0.00 ? 56 SER B OG   3  
ATOM 5804  H H    . SER B 1 56 ? 11.080  -14.778 -7.832  1.00 0.00 ? 56 SER B H    3  
ATOM 5805  H HA   . SER B 1 56 ? 13.321  -14.571 -8.150  1.00 0.00 ? 56 SER B HA   3  
ATOM 5806  H HB2  . SER B 1 56 ? 12.630  -17.006 -9.638  1.00 0.00 ? 56 SER B HB2  3  
ATOM 5807  H HB3  . SER B 1 56 ? 14.092  -16.210 -10.221 1.00 0.00 ? 56 SER B HB3  3  
ATOM 5808  H HG   . SER B 1 56 ? 13.557  -16.990 -7.544  1.00 0.00 ? 56 SER B HG   3  
ATOM 5809  N N    . GLN B 1 57 ? 12.565  -14.360 -11.366 1.00 0.00 ? 57 GLN B N    3  
ATOM 5810  C CA   . GLN B 1 57 ? 12.695  -13.525 -12.560 1.00 0.00 ? 57 GLN B CA   3  
ATOM 5811  C C    . GLN B 1 57 ? 14.106  -13.605 -13.136 1.00 0.00 ? 57 GLN B C    3  
ATOM 5812  O O    . GLN B 1 57 ? 14.292  -13.985 -14.292 1.00 0.00 ? 57 GLN B O    3  
ATOM 5813  C CB   . GLN B 1 57 ? 12.339  -12.069 -12.247 1.00 0.00 ? 57 GLN B CB   3  
ATOM 5814  C CG   . GLN B 1 57 ? 11.708  -11.332 -13.416 1.00 0.00 ? 57 GLN B CG   3  
ATOM 5815  C CD   . GLN B 1 57 ? 12.674  -11.131 -14.568 1.00 0.00 ? 57 GLN B CD   3  
ATOM 5816  O OE1  . GLN B 1 57 ? 13.873  -10.943 -14.361 1.00 0.00 ? 57 GLN B OE1  3  
ATOM 5817  N NE2  . GLN B 1 57 ? 12.155  -11.168 -15.789 1.00 0.00 ? 57 GLN B NE2  3  
ATOM 5818  H H    . GLN B 1 57 ? 12.120  -15.230 -11.441 1.00 0.00 ? 57 GLN B H    3  
ATOM 5819  H HA   . GLN B 1 57 ? 12.001  -13.901 -13.298 1.00 0.00 ? 57 GLN B HA   3  
ATOM 5820  H HB2  . GLN B 1 57 ? 11.645  -12.049 -11.420 1.00 0.00 ? 57 GLN B HB2  3  
ATOM 5821  H HB3  . GLN B 1 57 ? 13.239  -11.544 -11.962 1.00 0.00 ? 57 GLN B HB3  3  
ATOM 5822  H HG2  . GLN B 1 57 ? 10.863  -11.902 -13.771 1.00 0.00 ? 57 GLN B HG2  3  
ATOM 5823  H HG3  . GLN B 1 57 ? 11.370  -10.364 -13.076 1.00 0.00 ? 57 GLN B HG3  3  
ATOM 5824  H HE21 . GLN B 1 57 ? 11.191  -11.321 -15.878 1.00 0.00 ? 57 GLN B HE21 3  
ATOM 5825  H HE22 . GLN B 1 57 ? 12.757  -11.042 -16.552 1.00 0.00 ? 57 GLN B HE22 3  
ATOM 5826  N N    . GLN B 1 58 ? 15.097  -13.246 -12.325 1.00 0.00 ? 58 GLN B N    3  
ATOM 5827  C CA   . GLN B 1 58 ? 16.488  -13.280 -12.761 1.00 0.00 ? 58 GLN B CA   3  
ATOM 5828  C C    . GLN B 1 58 ? 17.112  -14.645 -12.483 1.00 0.00 ? 58 GLN B C    3  
ATOM 5829  O O    . GLN B 1 58 ? 18.114  -14.750 -11.774 1.00 0.00 ? 58 GLN B O    3  
ATOM 5830  C CB   . GLN B 1 58 ? 17.290  -12.182 -12.059 1.00 0.00 ? 58 GLN B CB   3  
ATOM 5831  C CG   . GLN B 1 58 ? 17.245  -10.843 -12.776 1.00 0.00 ? 58 GLN B CG   3  
ATOM 5832  C CD   . GLN B 1 58 ? 17.735  -9.700  -11.909 1.00 0.00 ? 58 GLN B CD   3  
ATOM 5833  O OE1  . GLN B 1 58 ? 17.442  -9.641  -10.715 1.00 0.00 ? 58 GLN B OE1  3  
ATOM 5834  N NE2  . GLN B 1 58 ? 18.486  -8.783  -12.508 1.00 0.00 ? 58 GLN B NE2  3  
ATOM 5835  H H    . GLN B 1 58 ? 14.889  -12.953 -11.414 1.00 0.00 ? 58 GLN B H    3  
ATOM 5836  H HA   . GLN B 1 58 ? 16.505  -13.101 -13.826 1.00 0.00 ? 58 GLN B HA   3  
ATOM 5837  H HB2  . GLN B 1 58 ? 16.896  -12.047 -11.063 1.00 0.00 ? 58 GLN B HB2  3  
ATOM 5838  H HB3  . GLN B 1 58 ? 18.322  -12.495 -11.990 1.00 0.00 ? 58 GLN B HB3  3  
ATOM 5839  H HG2  . GLN B 1 58 ? 17.867  -10.899 -13.657 1.00 0.00 ? 58 GLN B HG2  3  
ATOM 5840  H HG3  . GLN B 1 58 ? 16.225  -10.641 -13.070 1.00 0.00 ? 58 GLN B HG3  3  
ATOM 5841  H HE21 . GLN B 1 58 ? 18.680  -8.894  -13.462 1.00 0.00 ? 58 GLN B HE21 3  
ATOM 5842  H HE22 . GLN B 1 58 ? 18.817  -8.033  -11.971 1.00 0.00 ? 58 GLN B HE22 3  
ATOM 5843  N N    . SER B 1 59 ? 16.513  -15.689 -13.046 1.00 0.00 ? 59 SER B N    3  
ATOM 5844  C CA   . SER B 1 59 ? 17.010  -17.048 -12.859 1.00 0.00 ? 59 SER B CA   3  
ATOM 5845  C C    . SER B 1 59 ? 16.643  -17.930 -14.048 1.00 0.00 ? 59 SER B C    3  
ATOM 5846  O O    . SER B 1 59 ? 15.508  -17.909 -14.523 1.00 0.00 ? 59 SER B O    3  
ATOM 5847  C CB   . SER B 1 59 ? 16.444  -17.648 -11.571 1.00 0.00 ? 59 SER B CB   3  
ATOM 5848  O OG   . SER B 1 59 ? 15.040  -17.816 -11.660 1.00 0.00 ? 59 SER B OG   3  
ATOM 5849  H H    . SER B 1 59 ? 15.719  -15.543 -13.601 1.00 0.00 ? 59 SER B H    3  
ATOM 5850  H HA   . SER B 1 59 ? 18.086  -16.999 -12.781 1.00 0.00 ? 59 SER B HA   3  
ATOM 5851  H HB2  . SER B 1 59 ? 16.899  -18.611 -11.395 1.00 0.00 ? 59 SER B HB2  3  
ATOM 5852  H HB3  . SER B 1 59 ? 16.664  -16.990 -10.743 1.00 0.00 ? 59 SER B HB3  3  
ATOM 5853  H HG   . SER B 1 59 ? 14.811  -18.721 -11.436 1.00 0.00 ? 59 SER B HG   3  
ATOM 5854  N N    . SER B 1 60 ? 17.612  -18.705 -14.525 1.00 0.00 ? 60 SER B N    3  
ATOM 5855  C CA   . SER B 1 60 ? 17.392  -19.596 -15.658 1.00 0.00 ? 60 SER B CA   3  
ATOM 5856  C C    . SER B 1 60 ? 17.587  -21.053 -15.251 1.00 0.00 ? 60 SER B C    3  
ATOM 5857  O O    . SER B 1 60 ? 18.659  -21.439 -14.785 1.00 0.00 ? 60 SER B O    3  
ATOM 5858  C CB   . SER B 1 60 ? 18.342  -19.242 -16.804 1.00 0.00 ? 60 SER B CB   3  
ATOM 5859  O OG   . SER B 1 60 ? 17.742  -18.321 -17.699 1.00 0.00 ? 60 SER B OG   3  
ATOM 5860  H H    . SER B 1 60 ? 18.497  -18.678 -14.104 1.00 0.00 ? 60 SER B H    3  
ATOM 5861  H HA   . SER B 1 60 ? 16.374  -19.462 -15.992 1.00 0.00 ? 60 SER B HA   3  
ATOM 5862  H HB2  . SER B 1 60 ? 19.240  -18.800 -16.401 1.00 0.00 ? 60 SER B HB2  3  
ATOM 5863  H HB3  . SER B 1 60 ? 18.596  -20.141 -17.348 1.00 0.00 ? 60 SER B HB3  3  
ATOM 5864  H HG   . SER B 1 60 ? 17.056  -18.765 -18.203 1.00 0.00 ? 60 SER B HG   3  
ATOM 5865  N N    . TYR B 1 61 ? 16.545  -21.857 -15.432 1.00 0.00 ? 61 TYR B N    3  
ATOM 5866  C CA   . TYR B 1 61 ? 16.603  -23.272 -15.083 1.00 0.00 ? 61 TYR B CA   3  
ATOM 5867  C C    . TYR B 1 61 ? 17.662  -23.993 -15.911 1.00 0.00 ? 61 TYR B C    3  
ATOM 5868  O O    . TYR B 1 61 ? 18.357  -23.318 -16.699 1.00 0.00 ? 61 TYR B O    3  
ATOM 5869  C CB   . TYR B 1 61 ? 15.237  -23.927 -15.298 1.00 0.00 ? 61 TYR B CB   3  
ATOM 5870  C CG   . TYR B 1 61 ? 14.905  -24.986 -14.271 1.00 0.00 ? 61 TYR B CG   3  
ATOM 5871  C CD1  . TYR B 1 61 ? 14.754  -24.657 -12.930 1.00 0.00 ? 61 TYR B CD1  3  
ATOM 5872  C CD2  . TYR B 1 61 ? 14.742  -26.315 -14.643 1.00 0.00 ? 61 TYR B CD2  3  
ATOM 5873  C CE1  . TYR B 1 61 ? 14.450  -25.622 -11.988 1.00 0.00 ? 61 TYR B CE1  3  
ATOM 5874  C CE2  . TYR B 1 61 ? 14.438  -27.285 -13.708 1.00 0.00 ? 61 TYR B CE2  3  
ATOM 5875  C CZ   . TYR B 1 61 ? 14.293  -26.934 -12.382 1.00 0.00 ? 61 TYR B CZ   3  
ATOM 5876  O OH   . TYR B 1 61 ? 13.990  -27.898 -11.448 1.00 0.00 ? 61 TYR B OH   3  
ATOM 5877  O OXT  . TYR B 1 61 ? 17.787  -25.227 -15.764 1.00 0.00 ? 61 TYR B OXT  3  
ATOM 5878  H H    . TYR B 1 61 ? 15.718  -21.491 -15.808 1.00 0.00 ? 61 TYR B H    3  
ATOM 5879  H HA   . TYR B 1 61 ? 16.867  -23.345 -14.039 1.00 0.00 ? 61 TYR B HA   3  
ATOM 5880  H HB2  . TYR B 1 61 ? 14.470  -23.169 -15.252 1.00 0.00 ? 61 TYR B HB2  3  
ATOM 5881  H HB3  . TYR B 1 61 ? 15.219  -24.392 -16.273 1.00 0.00 ? 61 TYR B HB3  3  
ATOM 5882  H HD1  . TYR B 1 61 ? 14.877  -23.629 -12.625 1.00 0.00 ? 61 TYR B HD1  3  
ATOM 5883  H HD2  . TYR B 1 61 ? 14.857  -26.587 -15.682 1.00 0.00 ? 61 TYR B HD2  3  
ATOM 5884  H HE1  . TYR B 1 61 ? 14.336  -25.347 -10.951 1.00 0.00 ? 61 TYR B HE1  3  
ATOM 5885  H HE2  . TYR B 1 61 ? 14.315  -28.313 -14.017 1.00 0.00 ? 61 TYR B HE2  3  
ATOM 5886  H HH   . TYR B 1 61 ? 14.493  -27.736 -10.646 1.00 0.00 ? 61 TYR B HH   3  
ATOM 5887  N N    . MET A 1 1  ? -1.095  -9.354  -6.097  1.00 0.00 ? 1  MET A N    4  
ATOM 5888  C CA   . MET A 1 1  ? -1.062  -9.978  -4.748  1.00 0.00 ? 1  MET A CA   4  
ATOM 5889  C C    . MET A 1 1  ? 0.370   -10.260 -4.307  1.00 0.00 ? 1  MET A C    4  
ATOM 5890  O O    . MET A 1 1  ? 0.907   -11.339 -4.559  1.00 0.00 ? 1  MET A O    4  
ATOM 5891  C CB   . MET A 1 1  ? -1.866  -11.278 -4.793  1.00 0.00 ? 1  MET A CB   4  
ATOM 5892  C CG   . MET A 1 1  ? -2.319  -11.761 -3.424  1.00 0.00 ? 1  MET A CG   4  
ATOM 5893  S SD   . MET A 1 1  ? -3.960  -12.505 -3.458  1.00 0.00 ? 1  MET A SD   4  
ATOM 5894  C CE   . MET A 1 1  ? -3.800  -13.613 -4.856  1.00 0.00 ? 1  MET A CE   4  
ATOM 5895  H H1   . MET A 1 1  ? -2.078  -9.377  -6.433  1.00 0.00 ? 1  MET A H1   4  
ATOM 5896  H H2   . MET A 1 1  ? -0.471  -9.910  -6.718  1.00 0.00 ? 1  MET A H2   4  
ATOM 5897  H H3   . MET A 1 1  ? -0.756  -8.376  -6.002  1.00 0.00 ? 1  MET A H3   4  
ATOM 5898  H HA   . MET A 1 1  ? -1.520  -9.300  -4.044  1.00 0.00 ? 1  MET A HA   4  
ATOM 5899  H HB2  . MET A 1 1  ? -2.743  -11.125 -5.405  1.00 0.00 ? 1  MET A HB2  4  
ATOM 5900  H HB3  . MET A 1 1  ? -1.257  -12.050 -5.239  1.00 0.00 ? 1  MET A HB3  4  
ATOM 5901  H HG2  . MET A 1 1  ? -1.614  -12.495 -3.065  1.00 0.00 ? 1  MET A HG2  4  
ATOM 5902  H HG3  . MET A 1 1  ? -2.334  -10.918 -2.748  1.00 0.00 ? 1  MET A HG3  4  
ATOM 5903  H HE1  . MET A 1 1  ? -3.351  -13.086 -5.684  1.00 0.00 ? 1  MET A HE1  4  
ATOM 5904  H HE2  . MET A 1 1  ? -4.777  -13.972 -5.144  1.00 0.00 ? 1  MET A HE2  4  
ATOM 5905  H HE3  . MET A 1 1  ? -3.176  -14.451 -4.581  1.00 0.00 ? 1  MET A HE3  4  
ATOM 5906  N N    . LEU A 1 2  ? 0.982   -9.284  -3.645  1.00 0.00 ? 2  LEU A N    4  
ATOM 5907  C CA   . LEU A 1 2  ? 2.352   -9.429  -3.164  1.00 0.00 ? 2  LEU A CA   4  
ATOM 5908  C C    . LEU A 1 2  ? 2.423   -9.226  -1.653  1.00 0.00 ? 2  LEU A C    4  
ATOM 5909  O O    . LEU A 1 2  ? 2.131   -8.140  -1.153  1.00 0.00 ? 2  LEU A O    4  
ATOM 5910  C CB   . LEU A 1 2  ? 3.269   -8.426  -3.867  1.00 0.00 ? 2  LEU A CB   4  
ATOM 5911  C CG   . LEU A 1 2  ? 3.381   -8.602  -5.382  1.00 0.00 ? 2  LEU A CG   4  
ATOM 5912  C CD1  . LEU A 1 2  ? 2.092   -8.176  -6.066  1.00 0.00 ? 2  LEU A CD1  4  
ATOM 5913  C CD2  . LEU A 1 2  ? 4.561   -7.810  -5.924  1.00 0.00 ? 2  LEU A CD2  4  
ATOM 5914  H H    . LEU A 1 2  ? 0.498   -8.449  -3.468  1.00 0.00 ? 2  LEU A H    4  
ATOM 5915  H HA   . LEU A 1 2  ? 2.683   -10.430 -3.397  1.00 0.00 ? 2  LEU A HA   4  
ATOM 5916  H HB2  . LEU A 1 2  ? 2.898   -7.431  -3.667  1.00 0.00 ? 2  LEU A HB2  4  
ATOM 5917  H HB3  . LEU A 1 2  ? 4.257   -8.515  -3.442  1.00 0.00 ? 2  LEU A HB3  4  
ATOM 5918  H HG   . LEU A 1 2  ? 3.548   -9.646  -5.605  1.00 0.00 ? 2  LEU A HG   4  
ATOM 5919  H HD11 . LEU A 1 2  ? 1.583   -7.447  -5.453  1.00 0.00 ? 2  LEU A HD11 4  
ATOM 5920  H HD12 . LEU A 1 2  ? 1.455   -9.038  -6.203  1.00 0.00 ? 2  LEU A HD12 4  
ATOM 5921  H HD13 . LEU A 1 2  ? 2.321   -7.741  -7.027  1.00 0.00 ? 2  LEU A HD13 4  
ATOM 5922  H HD21 . LEU A 1 2  ? 5.471   -8.374  -5.780  1.00 0.00 ? 2  LEU A HD21 4  
ATOM 5923  H HD22 . LEU A 1 2  ? 4.635   -6.869  -5.398  1.00 0.00 ? 2  LEU A HD22 4  
ATOM 5924  H HD23 . LEU A 1 2  ? 4.417   -7.623  -6.977  1.00 0.00 ? 2  LEU A HD23 4  
ATOM 5925  N N    . ILE A 1 3  ? 2.823   -10.268 -0.927  1.00 0.00 ? 3  ILE A N    4  
ATOM 5926  C CA   . ILE A 1 3  ? 2.937   -10.174 0.523   1.00 0.00 ? 3  ILE A CA   4  
ATOM 5927  C C    . ILE A 1 3  ? 4.383   -9.905  0.929   1.00 0.00 ? 3  ILE A C    4  
ATOM 5928  O O    . ILE A 1 3  ? 5.232   -10.796 0.894   1.00 0.00 ? 3  ILE A O    4  
ATOM 5929  C CB   . ILE A 1 3  ? 2.418   -11.452 1.219   1.00 0.00 ? 3  ILE A CB   4  
ATOM 5930  C CG1  . ILE A 1 3  ? 2.341   -11.242 2.733   1.00 0.00 ? 3  ILE A CG1  4  
ATOM 5931  C CG2  . ILE A 1 3  ? 3.295   -12.649 0.887   1.00 0.00 ? 3  ILE A CG2  4  
ATOM 5932  C CD1  . ILE A 1 3  ? 1.174   -11.959 3.382   1.00 0.00 ? 3  ILE A CD1  4  
ATOM 5933  H H    . ILE A 1 3  ? 3.055   -11.108 -1.375  1.00 0.00 ? 3  ILE A H    4  
ATOM 5934  H HA   . ILE A 1 3  ? 2.331   -9.343  0.848   1.00 0.00 ? 3  ILE A HA   4  
ATOM 5935  H HB   . ILE A 1 3  ? 1.426   -11.655 0.845   1.00 0.00 ? 3  ILE A HB   4  
ATOM 5936  H HG12 . ILE A 1 3  ? 3.250   -11.609 3.187   1.00 0.00 ? 3  ILE A HG12 4  
ATOM 5937  H HG13 . ILE A 1 3  ? 2.241   -10.186 2.939   1.00 0.00 ? 3  ILE A HG13 4  
ATOM 5938  H HG21 . ILE A 1 3  ? 2.731   -13.559 1.032   1.00 0.00 ? 3  ILE A HG21 4  
ATOM 5939  H HG22 . ILE A 1 3  ? 4.159   -12.654 1.536   1.00 0.00 ? 3  ILE A HG22 4  
ATOM 5940  H HG23 . ILE A 1 3  ? 3.618   -12.585 -0.142  1.00 0.00 ? 3  ILE A HG23 4  
ATOM 5941  H HD11 . ILE A 1 3  ? 1.069   -12.941 2.946   1.00 0.00 ? 3  ILE A HD11 4  
ATOM 5942  H HD12 . ILE A 1 3  ? 0.267   -11.394 3.220   1.00 0.00 ? 3  ILE A HD12 4  
ATOM 5943  H HD13 . ILE A 1 3  ? 1.353   -12.053 4.443   1.00 0.00 ? 3  ILE A HD13 4  
ATOM 5944  N N    . LEU A 1 4  ? 4.649   -8.663  1.317   1.00 0.00 ? 4  LEU A N    4  
ATOM 5945  C CA   . LEU A 1 4  ? 5.983   -8.256  1.738   1.00 0.00 ? 4  LEU A CA   4  
ATOM 5946  C C    . LEU A 1 4  ? 5.955   -7.623  3.125   1.00 0.00 ? 4  LEU A C    4  
ATOM 5947  O O    . LEU A 1 4  ? 5.272   -6.621  3.338   1.00 0.00 ? 4  LEU A O    4  
ATOM 5948  C CB   . LEU A 1 4  ? 6.576   -7.274  0.728   1.00 0.00 ? 4  LEU A CB   4  
ATOM 5949  C CG   . LEU A 1 4  ? 6.456   -7.705  -0.737  1.00 0.00 ? 4  LEU A CG   4  
ATOM 5950  C CD1  . LEU A 1 4  ? 5.945   -6.556  -1.594  1.00 0.00 ? 4  LEU A CD1  4  
ATOM 5951  C CD2  . LEU A 1 4  ? 7.795   -8.212  -1.258  1.00 0.00 ? 4  LEU A CD2  4  
ATOM 5952  H H    . LEU A 1 4  ? 3.922   -8.006  1.337   1.00 0.00 ? 4  LEU A H    4  
ATOM 5953  H HA   . LEU A 1 4  ? 6.603   -9.139  1.772   1.00 0.00 ? 4  LEU A HA   4  
ATOM 5954  H HB2  . LEU A 1 4  ? 6.075   -6.323  0.847   1.00 0.00 ? 4  LEU A HB2  4  
ATOM 5955  H HB3  . LEU A 1 4  ? 7.622   -7.141  0.957   1.00 0.00 ? 4  LEU A HB3  4  
ATOM 5956  H HG   . LEU A 1 4  ? 5.742   -8.513  -0.807  1.00 0.00 ? 4  LEU A HG   4  
ATOM 5957  H HD11 . LEU A 1 4  ? 6.775   -5.932  -1.891  1.00 0.00 ? 4  LEU A HD11 4  
ATOM 5958  H HD12 . LEU A 1 4  ? 5.239   -5.969  -1.026  1.00 0.00 ? 4  LEU A HD12 4  
ATOM 5959  H HD13 . LEU A 1 4  ? 5.459   -6.952  -2.474  1.00 0.00 ? 4  LEU A HD13 4  
ATOM 5960  H HD21 . LEU A 1 4  ? 8.141   -7.567  -2.052  1.00 0.00 ? 4  LEU A HD21 4  
ATOM 5961  H HD22 . LEU A 1 4  ? 7.676   -9.216  -1.636  1.00 0.00 ? 4  LEU A HD22 4  
ATOM 5962  H HD23 . LEU A 1 4  ? 8.518   -8.214  -0.455  1.00 0.00 ? 4  LEU A HD23 4  
ATOM 5963  N N    . THR A 1 5  ? 6.701   -8.192  4.068   1.00 0.00 ? 5  THR A N    4  
ATOM 5964  C CA   . THR A 1 5  ? 6.745   -7.641  5.418   1.00 0.00 ? 5  THR A CA   4  
ATOM 5965  C C    . THR A 1 5  ? 7.129   -6.169  5.370   1.00 0.00 ? 5  THR A C    4  
ATOM 5966  O O    . THR A 1 5  ? 8.006   -5.774  4.602   1.00 0.00 ? 5  THR A O    4  
ATOM 5967  C CB   . THR A 1 5  ? 7.734   -8.411  6.291   1.00 0.00 ? 5  THR A CB   4  
ATOM 5968  O OG1  . THR A 1 5  ? 8.070   -9.653  5.699   1.00 0.00 ? 5  THR A OG1  4  
ATOM 5969  C CG2  . THR A 1 5  ? 7.202   -8.690  7.679   1.00 0.00 ? 5  THR A CG2  4  
ATOM 5970  H H    . THR A 1 5  ? 7.230   -8.988  3.855   1.00 0.00 ? 5  THR A H    4  
ATOM 5971  H HA   . THR A 1 5  ? 5.759   -7.725  5.844   1.00 0.00 ? 5  THR A HA   4  
ATOM 5972  H HB   . THR A 1 5  ? 8.638   -7.827  6.396   1.00 0.00 ? 5  THR A HB   4  
ATOM 5973  H HG1  . THR A 1 5  ? 7.294   -10.219 5.682   1.00 0.00 ? 5  THR A HG1  4  
ATOM 5974  H HG21 . THR A 1 5  ? 6.492   -7.922  7.953   1.00 0.00 ? 5  THR A HG21 4  
ATOM 5975  H HG22 . THR A 1 5  ? 8.019   -8.692  8.385   1.00 0.00 ? 5  THR A HG22 4  
ATOM 5976  H HG23 . THR A 1 5  ? 6.713   -9.652  7.691   1.00 0.00 ? 5  THR A HG23 4  
ATOM 5977  N N    . ARG A 1 6  ? 6.467   -5.358  6.183   1.00 0.00 ? 6  ARG A N    4  
ATOM 5978  C CA   . ARG A 1 6  ? 6.750   -3.932  6.208   1.00 0.00 ? 6  ARG A CA   4  
ATOM 5979  C C    . ARG A 1 6  ? 6.523   -3.335  7.590   1.00 0.00 ? 6  ARG A C    4  
ATOM 5980  O O    . ARG A 1 6  ? 5.612   -3.735  8.319   1.00 0.00 ? 6  ARG A O    4  
ATOM 5981  C CB   . ARG A 1 6  ? 5.885   -3.204  5.178   1.00 0.00 ? 6  ARG A CB   4  
ATOM 5982  C CG   . ARG A 1 6  ? 6.391   -3.341  3.751   1.00 0.00 ? 6  ARG A CG   4  
ATOM 5983  C CD   . ARG A 1 6  ? 5.374   -2.821  2.748   1.00 0.00 ? 6  ARG A CD   4  
ATOM 5984  N NE   . ARG A 1 6  ? 5.627   -3.324  1.400   1.00 0.00 ? 6  ARG A NE   4  
ATOM 5985  C CZ   . ARG A 1 6  ? 4.970   -2.912  0.319   1.00 0.00 ? 6  ARG A CZ   4  
ATOM 5986  N NH1  . ARG A 1 6  ? 4.022   -1.988  0.421   1.00 0.00 ? 6  ARG A NH1  4  
ATOM 5987  N NH2  . ARG A 1 6  ? 5.263   -3.422  -0.870  1.00 0.00 ? 6  ARG A NH2  4  
ATOM 5988  H H    . ARG A 1 6  ? 5.774   -5.724  6.772   1.00 0.00 ? 6  ARG A H    4  
ATOM 5989  H HA   . ARG A 1 6  ? 7.787   -3.801  5.944   1.00 0.00 ? 6  ARG A HA   4  
ATOM 5990  H HB2  . ARG A 1 6  ? 4.884   -3.603  5.221   1.00 0.00 ? 6  ARG A HB2  4  
ATOM 5991  H HB3  . ARG A 1 6  ? 5.856   -2.154  5.427   1.00 0.00 ? 6  ARG A HB3  4  
ATOM 5992  H HG2  . ARG A 1 6  ? 7.305   -2.776  3.647   1.00 0.00 ? 6  ARG A HG2  4  
ATOM 5993  H HG3  . ARG A 1 6  ? 6.585   -4.384  3.547   1.00 0.00 ? 6  ARG A HG3  4  
ATOM 5994  H HD2  . ARG A 1 6  ? 4.388   -3.134  3.059   1.00 0.00 ? 6  ARG A HD2  4  
ATOM 5995  H HD3  . ARG A 1 6  ? 5.420   -1.742  2.734   1.00 0.00 ? 6  ARG A HD3  4  
ATOM 5996  H HE   . ARG A 1 6  ? 6.323   -4.006  1.295   1.00 0.00 ? 6  ARG A HE   4  
ATOM 5997  H HH11 . ARG A 1 6  ? 3.797   -1.597  1.313   1.00 0.00 ? 6  ARG A HH11 4  
ATOM 5998  H HH12 . ARG A 1 6  ? 3.532   -1.683  -0.396  1.00 0.00 ? 6  ARG A HH12 4  
ATOM 5999  H HH21 . ARG A 1 6  ? 5.977   -4.117  -0.953  1.00 0.00 ? 6  ARG A HH21 4  
ATOM 6000  H HH22 . ARG A 1 6  ? 4.769   -3.113  -1.682  1.00 0.00 ? 6  ARG A HH22 4  
ATOM 6001  N N    . ARG A 1 7  ? 7.365   -2.365  7.926   1.00 0.00 ? 7  ARG A N    4  
ATOM 6002  C CA   . ARG A 1 7  ? 7.300   -1.665  9.203   1.00 0.00 ? 7  ARG A CA   4  
ATOM 6003  C C    . ARG A 1 7  ? 8.480   -0.703  9.319   1.00 0.00 ? 7  ARG A C    4  
ATOM 6004  O O    . ARG A 1 7  ? 8.329   0.502   9.122   1.00 0.00 ? 7  ARG A O    4  
ATOM 6005  C CB   . ARG A 1 7  ? 7.291   -2.654  10.374  1.00 0.00 ? 7  ARG A CB   4  
ATOM 6006  C CG   . ARG A 1 7  ? 6.853   -2.030  11.692  1.00 0.00 ? 7  ARG A CG   4  
ATOM 6007  C CD   . ARG A 1 7  ? 7.952   -2.094  12.743  1.00 0.00 ? 7  ARG A CD   4  
ATOM 6008  N NE   . ARG A 1 7  ? 8.337   -0.764  13.210  1.00 0.00 ? 7  ARG A NE   4  
ATOM 6009  C CZ   . ARG A 1 7  ? 9.040   -0.543  14.319  1.00 0.00 ? 7  ARG A CZ   4  
ATOM 6010  N NH1  . ARG A 1 7  ? 9.435   -1.559  15.076  1.00 0.00 ? 7  ARG A NH1  4  
ATOM 6011  N NH2  . ARG A 1 7  ? 9.348   0.698   14.671  1.00 0.00 ? 7  ARG A NH2  4  
ATOM 6012  H H    . ARG A 1 7  ? 8.059   -2.105  7.284   1.00 0.00 ? 7  ARG A H    4  
ATOM 6013  H HA   . ARG A 1 7  ? 6.383   -1.092  9.218   1.00 0.00 ? 7  ARG A HA   4  
ATOM 6014  H HB2  . ARG A 1 7  ? 6.612   -3.461  10.141  1.00 0.00 ? 7  ARG A HB2  4  
ATOM 6015  H HB3  . ARG A 1 7  ? 8.283   -3.058  10.501  1.00 0.00 ? 7  ARG A HB3  4  
ATOM 6016  H HG2  . ARG A 1 7  ? 6.595   -0.996  11.520  1.00 0.00 ? 7  ARG A HG2  4  
ATOM 6017  H HG3  . ARG A 1 7  ? 5.987   -2.562  12.058  1.00 0.00 ? 7  ARG A HG3  4  
ATOM 6018  H HD2  . ARG A 1 7  ? 7.595   -2.670  13.583  1.00 0.00 ? 7  ARG A HD2  4  
ATOM 6019  H HD3  . ARG A 1 7  ? 8.816   -2.580  12.316  1.00 0.00 ? 7  ARG A HD3  4  
ATOM 6020  H HE   . ARG A 1 7  ? 8.057   0.004   12.670  1.00 0.00 ? 7  ARG A HE   4  
ATOM 6021  H HH11 . ARG A 1 7  ? 9.206   -2.497  14.816  1.00 0.00 ? 7  ARG A HH11 4  
ATOM 6022  H HH12 . ARG A 1 7  ? 9.964   -1.386  15.907  1.00 0.00 ? 7  ARG A HH12 4  
ATOM 6023  H HH21 . ARG A 1 7  ? 9.051   1.467   14.105  1.00 0.00 ? 7  ARG A HH21 4  
ATOM 6024  H HH22 . ARG A 1 7  ? 9.876   0.864   15.504  1.00 0.00 ? 7  ARG A HH22 4  
ATOM 6025  N N    . VAL A 1 8  ? 9.656   -1.244  9.626   1.00 0.00 ? 8  VAL A N    4  
ATOM 6026  C CA   . VAL A 1 8  ? 10.861  -0.430  9.751   1.00 0.00 ? 8  VAL A CA   4  
ATOM 6027  C C    . VAL A 1 8  ? 11.533  -0.227  8.392   1.00 0.00 ? 8  VAL A C    4  
ATOM 6028  O O    . VAL A 1 8  ? 12.606  0.371   8.307   1.00 0.00 ? 8  VAL A O    4  
ATOM 6029  C CB   . VAL A 1 8  ? 11.881  -1.069  10.714  1.00 0.00 ? 8  VAL A CB   4  
ATOM 6030  C CG1  . VAL A 1 8  ? 12.914  -0.043  11.154  1.00 0.00 ? 8  VAL A CG1  4  
ATOM 6031  C CG2  . VAL A 1 8  ? 11.180  -1.679  11.919  1.00 0.00 ? 8  VAL A CG2  4  
ATOM 6032  H H    . VAL A 1 8  ? 9.716   -2.210  9.771   1.00 0.00 ? 8  VAL A H    4  
ATOM 6033  H HA   . VAL A 1 8  ? 10.574  0.533   10.148  1.00 0.00 ? 8  VAL A HA   4  
ATOM 6034  H HB   . VAL A 1 8  ? 12.396  -1.859  10.187  1.00 0.00 ? 8  VAL A HB   4  
ATOM 6035  H HG11 . VAL A 1 8  ? 13.239  -0.266  12.160  1.00 0.00 ? 8  VAL A HG11 4  
ATOM 6036  H HG12 . VAL A 1 8  ? 12.475  0.944   11.128  1.00 0.00 ? 8  VAL A HG12 4  
ATOM 6037  H HG13 . VAL A 1 8  ? 13.762  -0.077  10.486  1.00 0.00 ? 8  VAL A HG13 4  
ATOM 6038  H HG21 . VAL A 1 8  ? 10.467  -0.972  12.316  1.00 0.00 ? 8  VAL A HG21 4  
ATOM 6039  H HG22 . VAL A 1 8  ? 11.910  -1.919  12.677  1.00 0.00 ? 8  VAL A HG22 4  
ATOM 6040  H HG23 . VAL A 1 8  ? 10.665  -2.580  11.617  1.00 0.00 ? 8  VAL A HG23 4  
ATOM 6041  N N    . GLY A 1 9  ? 10.903  -0.733  7.333   1.00 0.00 ? 9  GLY A N    4  
ATOM 6042  C CA   . GLY A 1 9  ? 11.464  -0.600  6.001   1.00 0.00 ? 9  GLY A CA   4  
ATOM 6043  C C    . GLY A 1 9  ? 11.114  0.721   5.342   1.00 0.00 ? 9  GLY A C    4  
ATOM 6044  O O    . GLY A 1 9  ? 11.126  1.768   5.989   1.00 0.00 ? 9  GLY A O    4  
ATOM 6045  H H    . GLY A 1 9  ? 10.054  -1.206  7.457   1.00 0.00 ? 9  GLY A H    4  
ATOM 6046  H HA2  . GLY A 1 9  ? 12.539  -0.682  6.067   1.00 0.00 ? 9  GLY A HA2  4  
ATOM 6047  H HA3  . GLY A 1 9  ? 11.091  -1.405  5.385   1.00 0.00 ? 9  GLY A HA3  4  
ATOM 6048  N N    . GLU A 1 10 ? 10.809  0.669   4.049   1.00 0.00 ? 10 GLU A N    4  
ATOM 6049  C CA   . GLU A 1 10 ? 10.462  1.868   3.294   1.00 0.00 ? 10 GLU A CA   4  
ATOM 6050  C C    . GLU A 1 10 ? 8.976   1.892   2.948   1.00 0.00 ? 10 GLU A C    4  
ATOM 6051  O O    . GLU A 1 10 ? 8.215   1.021   3.370   1.00 0.00 ? 10 GLU A O    4  
ATOM 6052  C CB   . GLU A 1 10 ? 11.297  1.944   2.013   1.00 0.00 ? 10 GLU A CB   4  
ATOM 6053  C CG   . GLU A 1 10 ? 12.644  2.622   2.204   1.00 0.00 ? 10 GLU A CG   4  
ATOM 6054  C CD   . GLU A 1 10 ? 13.526  1.896   3.201   1.00 0.00 ? 10 GLU A CD   4  
ATOM 6055  O OE1  . GLU A 1 10 ? 13.614  0.652   3.119   1.00 0.00 ? 10 GLU A OE1  4  
ATOM 6056  O OE2  . GLU A 1 10 ? 14.128  2.570   4.062   1.00 0.00 ? 10 GLU A OE2  4  
ATOM 6057  H H    . GLU A 1 10 ? 10.823  -0.197  3.590   1.00 0.00 ? 10 GLU A H    4  
ATOM 6058  H HA   . GLU A 1 10 ? 10.689  2.725   3.910   1.00 0.00 ? 10 GLU A HA   4  
ATOM 6059  H HB2  . GLU A 1 10 ? 11.472  0.941   1.652   1.00 0.00 ? 10 GLU A HB2  4  
ATOM 6060  H HB3  . GLU A 1 10 ? 10.744  2.494   1.267   1.00 0.00 ? 10 GLU A HB3  4  
ATOM 6061  H HG2  . GLU A 1 10 ? 13.154  2.656   1.253   1.00 0.00 ? 10 GLU A HG2  4  
ATOM 6062  H HG3  . GLU A 1 10 ? 12.478  3.629   2.559   1.00 0.00 ? 10 GLU A HG3  4  
ATOM 6063  N N    . THR A 1 11 ? 8.570   2.898   2.179   1.00 0.00 ? 11 THR A N    4  
ATOM 6064  C CA   . THR A 1 11 ? 7.176   3.046   1.774   1.00 0.00 ? 11 THR A CA   4  
ATOM 6065  C C    . THR A 1 11 ? 6.972   2.583   0.335   1.00 0.00 ? 11 THR A C    4  
ATOM 6066  O O    . THR A 1 11 ? 7.933   2.412   -0.414  1.00 0.00 ? 11 THR A O    4  
ATOM 6067  C CB   . THR A 1 11 ? 6.742   4.505   1.916   1.00 0.00 ? 11 THR A CB   4  
ATOM 6068  O OG1  . THR A 1 11 ? 7.334   5.303   0.906   1.00 0.00 ? 11 THR A OG1  4  
ATOM 6069  C CG2  . THR A 1 11 ? 7.109   5.112   3.252   1.00 0.00 ? 11 THR A CG2  4  
ATOM 6070  H H    . THR A 1 11 ? 9.225   3.562   1.877   1.00 0.00 ? 11 THR A H    4  
ATOM 6071  H HA   . THR A 1 11 ? 6.572   2.434   2.427   1.00 0.00 ? 11 THR A HA   4  
ATOM 6072  H HB   . THR A 1 11 ? 5.670   4.564   1.808   1.00 0.00 ? 11 THR A HB   4  
ATOM 6073  H HG1  . THR A 1 11 ? 8.267   5.091   0.836   1.00 0.00 ? 11 THR A HG1  4  
ATOM 6074  H HG21 . THR A 1 11 ? 6.429   5.919   3.479   1.00 0.00 ? 11 THR A HG21 4  
ATOM 6075  H HG22 . THR A 1 11 ? 8.119   5.492   3.210   1.00 0.00 ? 11 THR A HG22 4  
ATOM 6076  H HG23 . THR A 1 11 ? 7.041   4.357   4.021   1.00 0.00 ? 11 THR A HG23 4  
ATOM 6077  N N    . LEU A 1 12 ? 5.712   2.389   -0.047  1.00 0.00 ? 12 LEU A N    4  
ATOM 6078  C CA   . LEU A 1 12 ? 5.383   1.954   -1.402  1.00 0.00 ? 12 LEU A CA   4  
ATOM 6079  C C    . LEU A 1 12 ? 4.697   3.078   -2.173  1.00 0.00 ? 12 LEU A C    4  
ATOM 6080  O O    . LEU A 1 12 ? 4.082   3.961   -1.574  1.00 0.00 ? 12 LEU A O    4  
ATOM 6081  C CB   . LEU A 1 12 ? 4.499   0.697   -1.366  1.00 0.00 ? 12 LEU A CB   4  
ATOM 6082  C CG   . LEU A 1 12 ? 2.986   0.939   -1.283  1.00 0.00 ? 12 LEU A CG   4  
ATOM 6083  C CD1  . LEU A 1 12 ? 2.236   -0.073  -2.134  1.00 0.00 ? 12 LEU A CD1  4  
ATOM 6084  C CD2  . LEU A 1 12 ? 2.514   0.874   0.160   1.00 0.00 ? 12 LEU A CD2  4  
ATOM 6085  H H    . LEU A 1 12 ? 4.988   2.547   0.594   1.00 0.00 ? 12 LEU A H    4  
ATOM 6086  H HA   . LEU A 1 12 ? 6.310   1.713   -1.901  1.00 0.00 ? 12 LEU A HA   4  
ATOM 6087  H HB2  . LEU A 1 12 ? 4.699   0.122   -2.259  1.00 0.00 ? 12 LEU A HB2  4  
ATOM 6088  H HB3  . LEU A 1 12 ? 4.791   0.106   -0.511  1.00 0.00 ? 12 LEU A HB3  4  
ATOM 6089  H HG   . LEU A 1 12 ? 2.760   1.923   -1.663  1.00 0.00 ? 12 LEU A HG   4  
ATOM 6090  H HD11 . LEU A 1 12 ? 1.911   -0.895  -1.513  1.00 0.00 ? 12 LEU A HD11 4  
ATOM 6091  H HD12 . LEU A 1 12 ? 2.889   -0.445  -2.910  1.00 0.00 ? 12 LEU A HD12 4  
ATOM 6092  H HD13 . LEU A 1 12 ? 1.376   0.401   -2.583  1.00 0.00 ? 12 LEU A HD13 4  
ATOM 6093  H HD21 . LEU A 1 12 ? 1.518   1.286   0.230   1.00 0.00 ? 12 LEU A HD21 4  
ATOM 6094  H HD22 . LEU A 1 12 ? 3.185   1.447   0.783   1.00 0.00 ? 12 LEU A HD22 4  
ATOM 6095  H HD23 . LEU A 1 12 ? 2.504   -0.154  0.490   1.00 0.00 ? 12 LEU A HD23 4  
ATOM 6096  N N    . MET A 1 13 ? 4.802   3.049   -3.499  1.00 0.00 ? 13 MET A N    4  
ATOM 6097  C CA   . MET A 1 13 ? 4.183   4.077   -4.322  1.00 0.00 ? 13 MET A CA   4  
ATOM 6098  C C    . MET A 1 13 ? 3.369   3.466   -5.455  1.00 0.00 ? 13 MET A C    4  
ATOM 6099  O O    . MET A 1 13 ? 3.913   3.066   -6.484  1.00 0.00 ? 13 MET A O    4  
ATOM 6100  C CB   . MET A 1 13 ? 5.252   5.009   -4.895  1.00 0.00 ? 13 MET A CB   4  
ATOM 6101  C CG   . MET A 1 13 ? 4.683   6.252   -5.560  1.00 0.00 ? 13 MET A CG   4  
ATOM 6102  S SD   . MET A 1 13 ? 5.865   7.054   -6.660  1.00 0.00 ? 13 MET A SD   4  
ATOM 6103  C CE   . MET A 1 13 ? 4.953   7.045   -8.202  1.00 0.00 ? 13 MET A CE   4  
ATOM 6104  H H    . MET A 1 13 ? 5.299   2.323   -3.930  1.00 0.00 ? 13 MET A H    4  
ATOM 6105  H HA   . MET A 1 13 ? 3.522   4.651   -3.691  1.00 0.00 ? 13 MET A HA   4  
ATOM 6106  H HB2  . MET A 1 13 ? 5.907   5.323   -4.096  1.00 0.00 ? 13 MET A HB2  4  
ATOM 6107  H HB3  . MET A 1 13 ? 5.828   4.467   -5.630  1.00 0.00 ? 13 MET A HB3  4  
ATOM 6108  H HG2  . MET A 1 13 ? 3.813   5.970   -6.135  1.00 0.00 ? 13 MET A HG2  4  
ATOM 6109  H HG3  . MET A 1 13 ? 4.393   6.954   -4.792  1.00 0.00 ? 13 MET A HG3  4  
ATOM 6110  H HE1  . MET A 1 13 ? 4.916   6.038   -8.591  1.00 0.00 ? 13 MET A HE1  4  
ATOM 6111  H HE2  . MET A 1 13 ? 5.446   7.689   -8.915  1.00 0.00 ? 13 MET A HE2  4  
ATOM 6112  H HE3  . MET A 1 13 ? 3.949   7.401   -8.028  1.00 0.00 ? 13 MET A HE3  4  
ATOM 6113  N N    . ILE A 1 14 ? 2.058   3.408   -5.257  1.00 0.00 ? 14 ILE A N    4  
ATOM 6114  C CA   . ILE A 1 14 ? 1.154   2.861   -6.254  1.00 0.00 ? 14 ILE A CA   4  
ATOM 6115  C C    . ILE A 1 14 ? 0.205   3.943   -6.767  1.00 0.00 ? 14 ILE A C    4  
ATOM 6116  O O    . ILE A 1 14 ? -0.482  4.599   -5.985  1.00 0.00 ? 14 ILE A O    4  
ATOM 6117  C CB   . ILE A 1 14 ? 0.337   1.685   -5.679  1.00 0.00 ? 14 ILE A CB   4  
ATOM 6118  C CG1  . ILE A 1 14 ? -0.634  1.137   -6.727  1.00 0.00 ? 14 ILE A CG1  4  
ATOM 6119  C CG2  . ILE A 1 14 ? -0.412  2.120   -4.427  1.00 0.00 ? 14 ILE A CG2  4  
ATOM 6120  C CD1  . ILE A 1 14 ? 0.047   0.695   -8.002  1.00 0.00 ? 14 ILE A CD1  4  
ATOM 6121  H H    . ILE A 1 14 ? 1.691   3.742   -4.415  1.00 0.00 ? 14 ILE A H    4  
ATOM 6122  H HA   . ILE A 1 14 ? 1.753   2.495   -7.074  1.00 0.00 ? 14 ILE A HA   4  
ATOM 6123  H HB   . ILE A 1 14 ? 1.028   0.905   -5.397  1.00 0.00 ? 14 ILE A HB   4  
ATOM 6124  H HG12 . ILE A 1 14 ? -1.155  0.285   -6.317  1.00 0.00 ? 14 ILE A HG12 4  
ATOM 6125  H HG13 . ILE A 1 14 ? -1.351  1.905   -6.982  1.00 0.00 ? 14 ILE A HG13 4  
ATOM 6126  H HG21 . ILE A 1 14 ? -0.037  1.571   -3.575  1.00 0.00 ? 14 ILE A HG21 4  
ATOM 6127  H HG22 . ILE A 1 14 ? -1.465  1.918   -4.549  1.00 0.00 ? 14 ILE A HG22 4  
ATOM 6128  H HG23 . ILE A 1 14 ? -0.263  3.177   -4.267  1.00 0.00 ? 14 ILE A HG23 4  
ATOM 6129  H HD11 . ILE A 1 14 ? 1.082   1.001   -7.978  1.00 0.00 ? 14 ILE A HD11 4  
ATOM 6130  H HD12 . ILE A 1 14 ? -0.444  1.151   -8.850  1.00 0.00 ? 14 ILE A HD12 4  
ATOM 6131  H HD13 . ILE A 1 14 ? -0.010  -0.380  -8.087  1.00 0.00 ? 14 ILE A HD13 4  
ATOM 6132  N N    . GLY A 1 15 ? 0.171   4.127   -8.083  1.00 0.00 ? 15 GLY A N    4  
ATOM 6133  C CA   . GLY A 1 15 ? -0.695  5.135   -8.671  1.00 0.00 ? 15 GLY A CA   4  
ATOM 6134  C C    . GLY A 1 15 ? 0.029   5.975   -9.707  1.00 0.00 ? 15 GLY A C    4  
ATOM 6135  O O    . GLY A 1 15 ? 0.305   5.507   -10.812 1.00 0.00 ? 15 GLY A O    4  
ATOM 6136  H H    . GLY A 1 15 ? 0.736   3.577   -8.666  1.00 0.00 ? 15 GLY A H    4  
ATOM 6137  H HA2  . GLY A 1 15 ? -1.533  4.644   -9.142  1.00 0.00 ? 15 GLY A HA2  4  
ATOM 6138  H HA3  . GLY A 1 15 ? -1.063  5.785   -7.889  1.00 0.00 ? 15 GLY A HA3  4  
ATOM 6139  N N    . ASP A 1 16 ? 0.339   7.217   -9.350  1.00 0.00 ? 16 ASP A N    4  
ATOM 6140  C CA   . ASP A 1 16 ? 1.040   8.121   -10.260 1.00 0.00 ? 16 ASP A CA   4  
ATOM 6141  C C    . ASP A 1 16 ? 1.804   9.214   -9.506  1.00 0.00 ? 16 ASP A C    4  
ATOM 6142  O O    . ASP A 1 16 ? 2.380   10.109  -10.125 1.00 0.00 ? 16 ASP A O    4  
ATOM 6143  C CB   . ASP A 1 16 ? 0.047   8.759   -11.233 1.00 0.00 ? 16 ASP A CB   4  
ATOM 6144  C CG   . ASP A 1 16 ? 0.572   8.791   -12.655 1.00 0.00 ? 16 ASP A CG   4  
ATOM 6145  O OD1  . ASP A 1 16 ? 1.808   8.752   -12.833 1.00 0.00 ? 16 ASP A OD1  4  
ATOM 6146  O OD2  . ASP A 1 16 ? -0.253  8.855   -13.591 1.00 0.00 ? 16 ASP A OD2  4  
ATOM 6147  H H    . ASP A 1 16 ? 0.093   7.531   -8.456  1.00 0.00 ? 16 ASP A H    4  
ATOM 6148  H HA   . ASP A 1 16 ? 1.748   7.533   -10.824 1.00 0.00 ? 16 ASP A HA   4  
ATOM 6149  H HB2  . ASP A 1 16 ? -0.873  8.194   -11.222 1.00 0.00 ? 16 ASP A HB2  4  
ATOM 6150  H HB3  . ASP A 1 16 ? -0.155  9.773   -10.920 1.00 0.00 ? 16 ASP A HB3  4  
ATOM 6151  N N    . GLU A 1 17 ? 1.809   9.138   -8.172  1.00 0.00 ? 17 GLU A N    4  
ATOM 6152  C CA   . GLU A 1 17 ? 2.502   10.119  -7.333  1.00 0.00 ? 17 GLU A CA   4  
ATOM 6153  C C    . GLU A 1 17 ? 2.002   10.021  -5.894  1.00 0.00 ? 17 GLU A C    4  
ATOM 6154  O O    . GLU A 1 17 ? 1.439   10.972  -5.352  1.00 0.00 ? 17 GLU A O    4  
ATOM 6155  C CB   . GLU A 1 17 ? 2.291   11.544  -7.866  1.00 0.00 ? 17 GLU A CB   4  
ATOM 6156  C CG   . GLU A 1 17 ? 3.545   12.161  -8.465  1.00 0.00 ? 17 GLU A CG   4  
ATOM 6157  C CD   . GLU A 1 17 ? 3.361   13.623  -8.826  1.00 0.00 ? 17 GLU A CD   4  
ATOM 6158  O OE1  . GLU A 1 17 ? 2.244   14.148  -8.634  1.00 0.00 ? 17 GLU A OE1  4  
ATOM 6159  O OE2  . GLU A 1 17 ? 4.336   14.244  -9.300  1.00 0.00 ? 17 GLU A OE2  4  
ATOM 6160  H H    . GLU A 1 17 ? 1.338   8.402   -7.736  1.00 0.00 ? 17 GLU A H    4  
ATOM 6161  H HA   . GLU A 1 17 ? 3.557   9.886   -7.353  1.00 0.00 ? 17 GLU A HA   4  
ATOM 6162  H HB2  . GLU A 1 17 ? 1.528   11.521  -8.630  1.00 0.00 ? 17 GLU A HB2  4  
ATOM 6163  H HB3  . GLU A 1 17 ? 1.957   12.177  -7.057  1.00 0.00 ? 17 GLU A HB3  4  
ATOM 6164  H HG2  . GLU A 1 17 ? 4.347   12.082  -7.747  1.00 0.00 ? 17 GLU A HG2  4  
ATOM 6165  H HG3  . GLU A 1 17 ? 3.808   11.615  -9.359  1.00 0.00 ? 17 GLU A HG3  4  
ATOM 6166  N N    . VAL A 1 18 ? 2.194   8.856   -5.284  1.00 0.00 ? 18 VAL A N    4  
ATOM 6167  C CA   . VAL A 1 18 ? 1.748   8.626   -3.925  1.00 0.00 ? 18 VAL A CA   4  
ATOM 6168  C C    . VAL A 1 18 ? 2.924   8.382   -2.973  1.00 0.00 ? 18 VAL A C    4  
ATOM 6169  O O    . VAL A 1 18 ? 4.063   8.744   -3.268  1.00 0.00 ? 18 VAL A O    4  
ATOM 6170  C CB   . VAL A 1 18 ? 0.783   7.426   -3.880  1.00 0.00 ? 18 VAL A CB   4  
ATOM 6171  C CG1  . VAL A 1 18 ? -0.298  7.568   -4.942  1.00 0.00 ? 18 VAL A CG1  4  
ATOM 6172  C CG2  . VAL A 1 18 ? 1.535   6.111   -4.047  1.00 0.00 ? 18 VAL A CG2  4  
ATOM 6173  H H    . VAL A 1 18 ? 2.631   8.128   -5.762  1.00 0.00 ? 18 VAL A H    4  
ATOM 6174  H HA   . VAL A 1 18 ? 1.209   9.503   -3.598  1.00 0.00 ? 18 VAL A HA   4  
ATOM 6175  H HB   . VAL A 1 18 ? 0.306   7.421   -2.922  1.00 0.00 ? 18 VAL A HB   4  
ATOM 6176  H HG11 . VAL A 1 18 ? -0.355  8.597   -5.264  1.00 0.00 ? 18 VAL A HG11 4  
ATOM 6177  H HG12 . VAL A 1 18 ? -1.250  7.267   -4.529  1.00 0.00 ? 18 VAL A HG12 4  
ATOM 6178  H HG13 . VAL A 1 18 ? -0.058  6.940   -5.787  1.00 0.00 ? 18 VAL A HG13 4  
ATOM 6179  H HG21 . VAL A 1 18 ? 2.580   6.312   -4.226  1.00 0.00 ? 18 VAL A HG21 4  
ATOM 6180  H HG22 . VAL A 1 18 ? 1.127   5.565   -4.883  1.00 0.00 ? 18 VAL A HG22 4  
ATOM 6181  H HG23 . VAL A 1 18 ? 1.432   5.519   -3.147  1.00 0.00 ? 18 VAL A HG23 4  
ATOM 6182  N N    . THR A 1 19 ? 2.628   7.765   -1.831  1.00 0.00 ? 19 THR A N    4  
ATOM 6183  C CA   . THR A 1 19 ? 3.628   7.457   -0.815  1.00 0.00 ? 19 THR A CA   4  
ATOM 6184  C C    . THR A 1 19 ? 2.929   6.948   0.441   1.00 0.00 ? 19 THR A C    4  
ATOM 6185  O O    . THR A 1 19 ? 2.403   7.733   1.227   1.00 0.00 ? 19 THR A O    4  
ATOM 6186  C CB   . THR A 1 19 ? 4.469   8.694   -0.484  1.00 0.00 ? 19 THR A CB   4  
ATOM 6187  O OG1  . THR A 1 19 ? 3.790   9.879   -0.860  1.00 0.00 ? 19 THR A OG1  4  
ATOM 6188  C CG2  . THR A 1 19 ? 5.819   8.700   -1.169  1.00 0.00 ? 19 THR A CG2  4  
ATOM 6189  H H    . THR A 1 19 ? 1.700   7.505   -1.663  1.00 0.00 ? 19 THR A H    4  
ATOM 6190  H HA   . THR A 1 19 ? 4.270   6.679   -1.201  1.00 0.00 ? 19 THR A HA   4  
ATOM 6191  H HB   . THR A 1 19 ? 4.640   8.726   0.583   1.00 0.00 ? 19 THR A HB   4  
ATOM 6192  H HG1  . THR A 1 19 ? 4.218   10.636  -0.454  1.00 0.00 ? 19 THR A HG1  4  
ATOM 6193  H HG21 . THR A 1 19 ? 6.581   8.985   -0.459  1.00 0.00 ? 19 THR A HG21 4  
ATOM 6194  H HG22 . THR A 1 19 ? 5.805   9.407   -1.985  1.00 0.00 ? 19 THR A HG22 4  
ATOM 6195  H HG23 . THR A 1 19 ? 6.033   7.713   -1.550  1.00 0.00 ? 19 THR A HG23 4  
ATOM 6196  N N    . VAL A 1 20 ? 2.909   5.633   0.619   1.00 0.00 ? 20 VAL A N    4  
ATOM 6197  C CA   . VAL A 1 20 ? 2.252   5.035   1.774   1.00 0.00 ? 20 VAL A CA   4  
ATOM 6198  C C    . VAL A 1 20 ? 3.264   4.516   2.792   1.00 0.00 ? 20 VAL A C    4  
ATOM 6199  O O    . VAL A 1 20 ? 3.926   3.500   2.564   1.00 0.00 ? 20 VAL A O    4  
ATOM 6200  C CB   . VAL A 1 20 ? 1.327   3.878   1.350   1.00 0.00 ? 20 VAL A CB   4  
ATOM 6201  C CG1  . VAL A 1 20 ? 0.566   3.325   2.546   1.00 0.00 ? 20 VAL A CG1  4  
ATOM 6202  C CG2  . VAL A 1 20 ? 0.366   4.333   0.262   1.00 0.00 ? 20 VAL A CG2  4  
ATOM 6203  H H    . VAL A 1 20 ? 3.338   5.051   -0.043  1.00 0.00 ? 20 VAL A H    4  
ATOM 6204  H HA   . VAL A 1 20 ? 1.643   5.799   2.241   1.00 0.00 ? 20 VAL A HA   4  
ATOM 6205  H HB   . VAL A 1 20 ? 1.941   3.087   0.947   1.00 0.00 ? 20 VAL A HB   4  
ATOM 6206  H HG11 . VAL A 1 20 ? -0.356  2.874   2.209   1.00 0.00 ? 20 VAL A HG11 4  
ATOM 6207  H HG12 . VAL A 1 20 ? 0.345   4.127   3.233   1.00 0.00 ? 20 VAL A HG12 4  
ATOM 6208  H HG13 . VAL A 1 20 ? 1.170   2.580   3.044   1.00 0.00 ? 20 VAL A HG13 4  
ATOM 6209  H HG21 . VAL A 1 20 ? 0.139   5.380   0.398   1.00 0.00 ? 20 VAL A HG21 4  
ATOM 6210  H HG22 . VAL A 1 20 ? -0.545  3.756   0.323   1.00 0.00 ? 20 VAL A HG22 4  
ATOM 6211  H HG23 . VAL A 1 20 ? 0.821   4.185   -0.706  1.00 0.00 ? 20 VAL A HG23 4  
ATOM 6212  N N    . THR A 1 21 ? 3.375   5.222   3.914   1.00 0.00 ? 21 THR A N    4  
ATOM 6213  C CA   . THR A 1 21 ? 4.299   4.844   4.978   1.00 0.00 ? 21 THR A CA   4  
ATOM 6214  C C    . THR A 1 21 ? 3.619   3.930   5.995   1.00 0.00 ? 21 THR A C    4  
ATOM 6215  O O    . THR A 1 21 ? 2.708   4.349   6.711   1.00 0.00 ? 21 THR A O    4  
ATOM 6216  C CB   . THR A 1 21 ? 4.837   6.092   5.681   1.00 0.00 ? 21 THR A CB   4  
ATOM 6217  O OG1  . THR A 1 21 ? 5.063   7.135   4.749   1.00 0.00 ? 21 THR A OG1  4  
ATOM 6218  C CG2  . THR A 1 21 ? 6.133   5.850   6.423   1.00 0.00 ? 21 THR A CG2  4  
ATOM 6219  H H    . THR A 1 21 ? 2.820   6.022   4.026   1.00 0.00 ? 21 THR A H    4  
ATOM 6220  H HA   . THR A 1 21 ? 5.123   4.312   4.528   1.00 0.00 ? 21 THR A HA   4  
ATOM 6221  H HB   . THR A 1 21 ? 4.103   6.432   6.398   1.00 0.00 ? 21 THR A HB   4  
ATOM 6222  H HG1  . THR A 1 21 ? 4.228   7.398   4.354   1.00 0.00 ? 21 THR A HG1  4  
ATOM 6223  H HG21 . THR A 1 21 ? 6.306   4.788   6.508   1.00 0.00 ? 21 THR A HG21 4  
ATOM 6224  H HG22 . THR A 1 21 ? 6.069   6.285   7.410   1.00 0.00 ? 21 THR A HG22 4  
ATOM 6225  H HG23 . THR A 1 21 ? 6.948   6.306   5.881   1.00 0.00 ? 21 THR A HG23 4  
ATOM 6226  N N    . VAL A 1 22 ? 4.061   2.679   6.045   1.00 0.00 ? 22 VAL A N    4  
ATOM 6227  C CA   . VAL A 1 22 ? 3.492   1.701   6.966   1.00 0.00 ? 22 VAL A CA   4  
ATOM 6228  C C    . VAL A 1 22 ? 3.994   1.917   8.392   1.00 0.00 ? 22 VAL A C    4  
ATOM 6229  O O    . VAL A 1 22 ? 4.773   1.119   8.915   1.00 0.00 ? 22 VAL A O    4  
ATOM 6230  C CB   . VAL A 1 22 ? 3.823   0.261   6.530   1.00 0.00 ? 22 VAL A CB   4  
ATOM 6231  C CG1  . VAL A 1 22 ? 3.138   -0.072  5.214   1.00 0.00 ? 22 VAL A CG1  4  
ATOM 6232  C CG2  . VAL A 1 22 ? 5.329   0.069   6.421   1.00 0.00 ? 22 VAL A CG2  4  
ATOM 6233  H H    . VAL A 1 22 ? 4.782   2.405   5.440   1.00 0.00 ? 22 VAL A H    4  
ATOM 6234  H HA   . VAL A 1 22 ? 2.418   1.819   6.953   1.00 0.00 ? 22 VAL A HA   4  
ATOM 6235  H HB   . VAL A 1 22 ? 3.450   -0.416  7.285   1.00 0.00 ? 22 VAL A HB   4  
ATOM 6236  H HG11 . VAL A 1 22 ? 2.078   0.120   5.301   1.00 0.00 ? 22 VAL A HG11 4  
ATOM 6237  H HG12 . VAL A 1 22 ? 3.297   -1.114  4.979   1.00 0.00 ? 22 VAL A HG12 4  
ATOM 6238  H HG13 . VAL A 1 22 ? 3.551   0.542   4.428   1.00 0.00 ? 22 VAL A HG13 4  
ATOM 6239  H HG21 . VAL A 1 22 ? 5.612   0.024   5.380   1.00 0.00 ? 22 VAL A HG21 4  
ATOM 6240  H HG22 . VAL A 1 22 ? 5.611   -0.851  6.911   1.00 0.00 ? 22 VAL A HG22 4  
ATOM 6241  H HG23 . VAL A 1 22 ? 5.834   0.898   6.895   1.00 0.00 ? 22 VAL A HG23 4  
ATOM 6242  N N    . LEU A 1 23 ? 3.542   3.000   9.017   1.00 0.00 ? 23 LEU A N    4  
ATOM 6243  C CA   . LEU A 1 23 ? 3.944   3.317   10.383  1.00 0.00 ? 23 LEU A CA   4  
ATOM 6244  C C    . LEU A 1 23 ? 2.904   2.810   11.386  1.00 0.00 ? 23 LEU A C    4  
ATOM 6245  O O    . LEU A 1 23 ? 2.199   1.838   11.115  1.00 0.00 ? 23 LEU A O    4  
ATOM 6246  C CB   . LEU A 1 23 ? 4.153   4.828   10.537  1.00 0.00 ? 23 LEU A CB   4  
ATOM 6247  C CG   . LEU A 1 23 ? 5.465   5.248   11.214  1.00 0.00 ? 23 LEU A CG   4  
ATOM 6248  C CD1  . LEU A 1 23 ? 5.746   4.412   12.461  1.00 0.00 ? 23 LEU A CD1  4  
ATOM 6249  C CD2  . LEU A 1 23 ? 6.622   5.146   10.232  1.00 0.00 ? 23 LEU A CD2  4  
ATOM 6250  H H    . LEU A 1 23 ? 2.925   3.599   8.547   1.00 0.00 ? 23 LEU A H    4  
ATOM 6251  H HA   . LEU A 1 23 ? 4.880   2.813   10.572  1.00 0.00 ? 23 LEU A HA   4  
ATOM 6252  H HB2  . LEU A 1 23 ? 4.126   5.272   9.553   1.00 0.00 ? 23 LEU A HB2  4  
ATOM 6253  H HB3  . LEU A 1 23 ? 3.333   5.229   11.113  1.00 0.00 ? 23 LEU A HB3  4  
ATOM 6254  H HG   . LEU A 1 23 ? 5.380   6.280   11.522  1.00 0.00 ? 23 LEU A HG   4  
ATOM 6255  H HD11 . LEU A 1 23 ? 5.196   4.818   13.297  1.00 0.00 ? 23 LEU A HD11 4  
ATOM 6256  H HD12 . LEU A 1 23 ? 6.803   4.440   12.680  1.00 0.00 ? 23 LEU A HD12 4  
ATOM 6257  H HD13 . LEU A 1 23 ? 5.443   3.387   12.295  1.00 0.00 ? 23 LEU A HD13 4  
ATOM 6258  H HD21 . LEU A 1 23 ? 7.502   5.600   10.665  1.00 0.00 ? 23 LEU A HD21 4  
ATOM 6259  H HD22 . LEU A 1 23 ? 6.365   5.660   9.318   1.00 0.00 ? 23 LEU A HD22 4  
ATOM 6260  H HD23 . LEU A 1 23 ? 6.822   4.107   10.018  1.00 0.00 ? 23 LEU A HD23 4  
ATOM 6261  N N    . GLY A 1 24 ? 2.813   3.463   12.546  1.00 0.00 ? 24 GLY A N    4  
ATOM 6262  C CA   . GLY A 1 24 ? 1.861   3.046   13.555  1.00 0.00 ? 24 GLY A CA   4  
ATOM 6263  C C    . GLY A 1 24 ? 2.111   1.629   14.018  1.00 0.00 ? 24 GLY A C    4  
ATOM 6264  O O    . GLY A 1 24 ? 1.299   0.736   13.774  1.00 0.00 ? 24 GLY A O    4  
ATOM 6265  H H    . GLY A 1 24 ? 3.398   4.226   12.719  1.00 0.00 ? 24 GLY A H    4  
ATOM 6266  H HA2  . GLY A 1 24 ? 1.935   3.710   14.403  1.00 0.00 ? 24 GLY A HA2  4  
ATOM 6267  H HA3  . GLY A 1 24 ? 0.867   3.108   13.147  1.00 0.00 ? 24 GLY A HA3  4  
ATOM 6268  N N    . VAL A 1 25 ? 3.241   1.418   14.680  1.00 0.00 ? 25 VAL A N    4  
ATOM 6269  C CA   . VAL A 1 25 ? 3.597   0.099   15.164  1.00 0.00 ? 25 VAL A CA   4  
ATOM 6270  C C    . VAL A 1 25 ? 2.978   -0.168  16.532  1.00 0.00 ? 25 VAL A C    4  
ATOM 6271  O O    . VAL A 1 25 ? 3.394   0.405   17.538  1.00 0.00 ? 25 VAL A O    4  
ATOM 6272  C CB   . VAL A 1 25 ? 5.128   -0.066  15.260  1.00 0.00 ? 25 VAL A CB   4  
ATOM 6273  C CG1  . VAL A 1 25 ? 5.497   -1.533  15.417  1.00 0.00 ? 25 VAL A CG1  4  
ATOM 6274  C CG2  . VAL A 1 25 ? 5.818   0.537   14.040  1.00 0.00 ? 25 VAL A CG2  4  
ATOM 6275  H H    . VAL A 1 25 ? 3.850   2.162   14.837  1.00 0.00 ? 25 VAL A H    4  
ATOM 6276  H HA   . VAL A 1 25 ? 3.222   -0.622  14.460  1.00 0.00 ? 25 VAL A HA   4  
ATOM 6277  H HB   . VAL A 1 25 ? 5.471   0.462   16.138  1.00 0.00 ? 25 VAL A HB   4  
ATOM 6278  H HG11 . VAL A 1 25 ? 4.822   -2.002  16.118  1.00 0.00 ? 25 VAL A HG11 4  
ATOM 6279  H HG12 . VAL A 1 25 ? 6.510   -1.613  15.784  1.00 0.00 ? 25 VAL A HG12 4  
ATOM 6280  H HG13 . VAL A 1 25 ? 5.421   -2.028  14.459  1.00 0.00 ? 25 VAL A HG13 4  
ATOM 6281  H HG21 . VAL A 1 25 ? 5.360   1.485   13.792  1.00 0.00 ? 25 VAL A HG21 4  
ATOM 6282  H HG22 . VAL A 1 25 ? 5.723   -0.138  13.203  1.00 0.00 ? 25 VAL A HG22 4  
ATOM 6283  H HG23 . VAL A 1 25 ? 6.864   0.691   14.261  1.00 0.00 ? 25 VAL A HG23 4  
ATOM 6284  N N    . LYS A 1 26 ? 1.971   -1.035  16.554  1.00 0.00 ? 26 LYS A N    4  
ATOM 6285  C CA   . LYS A 1 26 ? 1.279   -1.372  17.793  1.00 0.00 ? 26 LYS A CA   4  
ATOM 6286  C C    . LYS A 1 26 ? 0.634   -2.751  17.705  1.00 0.00 ? 26 LYS A C    4  
ATOM 6287  O O    . LYS A 1 26 ? 0.495   -3.317  16.621  1.00 0.00 ? 26 LYS A O    4  
ATOM 6288  C CB   . LYS A 1 26 ? 0.217   -0.318  18.111  1.00 0.00 ? 26 LYS A CB   4  
ATOM 6289  C CG   . LYS A 1 26 ? 0.165   0.069   19.580  1.00 0.00 ? 26 LYS A CG   4  
ATOM 6290  C CD   . LYS A 1 26 ? -1.228  0.521   19.990  1.00 0.00 ? 26 LYS A CD   4  
ATOM 6291  C CE   . LYS A 1 26 ? -1.333  2.037   20.030  1.00 0.00 ? 26 LYS A CE   4  
ATOM 6292  N NZ   . LYS A 1 26 ? -0.900  2.589   21.344  1.00 0.00 ? 26 LYS A NZ   4  
ATOM 6293  H H    . LYS A 1 26 ? 1.676   -1.439  15.712  1.00 0.00 ? 26 LYS A H    4  
ATOM 6294  H HA   . LYS A 1 26 ? 2.010   -1.382  18.587  1.00 0.00 ? 26 LYS A HA   4  
ATOM 6295  H HB2  . LYS A 1 26 ? 0.425   0.571   17.534  1.00 0.00 ? 26 LYS A HB2  4  
ATOM 6296  H HB3  . LYS A 1 26 ? -0.752  -0.701  17.828  1.00 0.00 ? 26 LYS A HB3  4  
ATOM 6297  H HG2  . LYS A 1 26 ? 0.445   -0.786  20.178  1.00 0.00 ? 26 LYS A HG2  4  
ATOM 6298  H HG3  . LYS A 1 26 ? 0.861   0.876   19.754  1.00 0.00 ? 26 LYS A HG3  4  
ATOM 6299  H HD2  . LYS A 1 26 ? -1.944  0.139   19.277  1.00 0.00 ? 26 LYS A HD2  4  
ATOM 6300  H HD3  . LYS A 1 26 ? -1.449  0.127   20.971  1.00 0.00 ? 26 LYS A HD3  4  
ATOM 6301  H HE2  . LYS A 1 26 ? -0.707  2.449   19.253  1.00 0.00 ? 26 LYS A HE2  4  
ATOM 6302  H HE3  . LYS A 1 26 ? -2.360  2.318   19.851  1.00 0.00 ? 26 LYS A HE3  4  
ATOM 6303  H HZ1  . LYS A 1 26 ? 0.091   2.899   21.292  1.00 0.00 ? 26 LYS A HZ1  4  
ATOM 6304  H HZ2  . LYS A 1 26 ? -0.987  1.864   22.083  1.00 0.00 ? 26 LYS A HZ2  4  
ATOM 6305  H HZ3  . LYS A 1 26 ? -1.494  3.404   21.602  1.00 0.00 ? 26 LYS A HZ3  4  
ATOM 6306  N N    . GLY A 1 27 ? 0.241   -3.284  18.857  1.00 0.00 ? 27 GLY A N    4  
ATOM 6307  C CA   . GLY A 1 27 ? -0.388  -4.591  18.894  1.00 0.00 ? 27 GLY A CA   4  
ATOM 6308  C C    . GLY A 1 27 ? -1.830  -4.555  18.425  1.00 0.00 ? 27 GLY A C    4  
ATOM 6309  O O    . GLY A 1 27 ? -2.480  -3.510  18.472  1.00 0.00 ? 27 GLY A O    4  
ATOM 6310  H H    . GLY A 1 27 ? 0.374   -2.781  19.687  1.00 0.00 ? 27 GLY A H    4  
ATOM 6311  H HA2  . GLY A 1 27 ? 0.169   -5.264  18.259  1.00 0.00 ? 27 GLY A HA2  4  
ATOM 6312  H HA3  . GLY A 1 27 ? -0.360  -4.963  19.908  1.00 0.00 ? 27 GLY A HA3  4  
ATOM 6313  N N    . ASN A 1 28 ? -2.326  -5.700  17.967  1.00 0.00 ? 28 ASN A N    4  
ATOM 6314  C CA   . ASN A 1 28 ? -3.698  -5.810  17.478  1.00 0.00 ? 28 ASN A CA   4  
ATOM 6315  C C    . ASN A 1 28 ? -3.869  -5.064  16.154  1.00 0.00 ? 28 ASN A C    4  
ATOM 6316  O O    . ASN A 1 28 ? -3.691  -5.646  15.083  1.00 0.00 ? 28 ASN A O    4  
ATOM 6317  C CB   . ASN A 1 28 ? -4.693  -5.290  18.524  1.00 0.00 ? 28 ASN A CB   4  
ATOM 6318  C CG   . ASN A 1 28 ? -5.394  -6.415  19.260  1.00 0.00 ? 28 ASN A CG   4  
ATOM 6319  O OD1  . ASN A 1 28 ? -6.360  -6.992  18.760  1.00 0.00 ? 28 ASN A OD1  4  
ATOM 6320  N ND2  . ASN A 1 28 ? -4.910  -6.732  20.455  1.00 0.00 ? 28 ASN A ND2  4  
ATOM 6321  H H    . ASN A 1 28 ? -1.751  -6.493  17.950  1.00 0.00 ? 28 ASN A H    4  
ATOM 6322  H HA   . ASN A 1 28 ? -3.896  -6.858  17.304  1.00 0.00 ? 28 ASN A HA   4  
ATOM 6323  H HB2  . ASN A 1 28 ? -4.166  -4.687  19.248  1.00 0.00 ? 28 ASN A HB2  4  
ATOM 6324  H HB3  . ASN A 1 28 ? -5.441  -4.685  18.033  1.00 0.00 ? 28 ASN A HB3  4  
ATOM 6325  H HD21 . ASN A 1 28 ? -4.139  -6.230  20.791  1.00 0.00 ? 28 ASN A HD21 4  
ATOM 6326  H HD22 . ASN A 1 28 ? -5.345  -7.456  20.953  1.00 0.00 ? 28 ASN A HD22 4  
ATOM 6327  N N    . GLN A 1 29 ? -4.216  -3.779  16.222  1.00 0.00 ? 29 GLN A N    4  
ATOM 6328  C CA   . GLN A 1 29 ? -4.409  -2.979  15.016  1.00 0.00 ? 29 GLN A CA   4  
ATOM 6329  C C    . GLN A 1 29 ? -3.305  -1.935  14.867  1.00 0.00 ? 29 GLN A C    4  
ATOM 6330  O O    . GLN A 1 29 ? -3.064  -1.136  15.772  1.00 0.00 ? 29 GLN A O    4  
ATOM 6331  C CB   . GLN A 1 29 ? -5.775  -2.293  15.048  1.00 0.00 ? 29 GLN A CB   4  
ATOM 6332  C CG   . GLN A 1 29 ? -6.939  -3.261  15.184  1.00 0.00 ? 29 GLN A CG   4  
ATOM 6333  C CD   . GLN A 1 29 ? -8.125  -2.649  15.903  1.00 0.00 ? 29 GLN A CD   4  
ATOM 6334  O OE1  . GLN A 1 29 ? -8.413  -2.989  17.051  1.00 0.00 ? 29 GLN A OE1  4  
ATOM 6335  N NE2  . GLN A 1 29 ? -8.821  -1.740  15.230  1.00 0.00 ? 29 GLN A NE2  4  
ATOM 6336  H H    . GLN A 1 29 ? -4.353  -3.358  17.095  1.00 0.00 ? 29 GLN A H    4  
ATOM 6337  H HA   . GLN A 1 29 ? -4.372  -3.646  14.168  1.00 0.00 ? 29 GLN A HA   4  
ATOM 6338  H HB2  . GLN A 1 29 ? -5.803  -1.609  15.884  1.00 0.00 ? 29 GLN A HB2  4  
ATOM 6339  H HB3  . GLN A 1 29 ? -5.906  -1.734  14.133  1.00 0.00 ? 29 GLN A HB3  4  
ATOM 6340  H HG2  . GLN A 1 29 ? -7.255  -3.566  14.198  1.00 0.00 ? 29 GLN A HG2  4  
ATOM 6341  H HG3  . GLN A 1 29 ? -6.607  -4.126  15.739  1.00 0.00 ? 29 GLN A HG3  4  
ATOM 6342  H HE21 . GLN A 1 29 ? -8.534  -1.519  14.319  1.00 0.00 ? 29 GLN A HE21 4  
ATOM 6343  H HE22 . GLN A 1 29 ? -9.593  -1.327  15.671  1.00 0.00 ? 29 GLN A HE22 4  
ATOM 6344  N N    . VAL A 1 30 ? -2.630  -1.961  13.723  1.00 0.00 ? 30 VAL A N    4  
ATOM 6345  C CA   . VAL A 1 30 ? -1.537  -1.032  13.451  1.00 0.00 ? 30 VAL A CA   4  
ATOM 6346  C C    . VAL A 1 30 ? -2.032  0.204   12.710  1.00 0.00 ? 30 VAL A C    4  
ATOM 6347  O O    . VAL A 1 30 ? -2.825  0.101   11.774  1.00 0.00 ? 30 VAL A O    4  
ATOM 6348  C CB   . VAL A 1 30 ? -0.426  -1.700  12.620  1.00 0.00 ? 30 VAL A CB   4  
ATOM 6349  C CG1  . VAL A 1 30 ? 0.358   -2.689  13.470  1.00 0.00 ? 30 VAL A CG1  4  
ATOM 6350  C CG2  . VAL A 1 30 ? -1.013  -2.383  11.395  1.00 0.00 ? 30 VAL A CG2  4  
ATOM 6351  H H    . VAL A 1 30 ? -2.860  -2.640  13.050  1.00 0.00 ? 30 VAL A H    4  
ATOM 6352  H HA   . VAL A 1 30 ? -1.116  -0.727  14.398  1.00 0.00 ? 30 VAL A HA   4  
ATOM 6353  H HB   . VAL A 1 30 ? 0.255   -0.931  12.285  1.00 0.00 ? 30 VAL A HB   4  
ATOM 6354  H HG11 . VAL A 1 30 ? 0.657   -3.529  12.860  1.00 0.00 ? 30 VAL A HG11 4  
ATOM 6355  H HG12 . VAL A 1 30 ? -0.263  -3.036  14.282  1.00 0.00 ? 30 VAL A HG12 4  
ATOM 6356  H HG13 . VAL A 1 30 ? 1.236   -2.203  13.869  1.00 0.00 ? 30 VAL A HG13 4  
ATOM 6357  H HG21 . VAL A 1 30 ? -0.246  -2.494  10.642  1.00 0.00 ? 30 VAL A HG21 4  
ATOM 6358  H HG22 . VAL A 1 30 ? -1.820  -1.784  11.000  1.00 0.00 ? 30 VAL A HG22 4  
ATOM 6359  H HG23 . VAL A 1 30 ? -1.389  -3.357  11.671  1.00 0.00 ? 30 VAL A HG23 4  
ATOM 6360  N N    . ARG A 1 31 ? -1.545  1.375   13.119  1.00 0.00 ? 31 ARG A N    4  
ATOM 6361  C CA   . ARG A 1 31 ? -1.924  2.618   12.478  1.00 0.00 ? 31 ARG A CA   4  
ATOM 6362  C C    . ARG A 1 31 ? -1.162  2.779   11.170  1.00 0.00 ? 31 ARG A C    4  
ATOM 6363  O O    . ARG A 1 31 ? 0.023   3.110   11.167  1.00 0.00 ? 31 ARG A O    4  
ATOM 6364  C CB   . ARG A 1 31 ? -1.659  3.816   13.397  1.00 0.00 ? 31 ARG A CB   4  
ATOM 6365  C CG   . ARG A 1 31 ? -1.834  3.510   14.876  1.00 0.00 ? 31 ARG A CG   4  
ATOM 6366  C CD   . ARG A 1 31 ? -2.343  4.723   15.639  1.00 0.00 ? 31 ARG A CD   4  
ATOM 6367  N NE   . ARG A 1 31 ? -3.791  4.680   15.831  1.00 0.00 ? 31 ARG A NE   4  
ATOM 6368  C CZ   . ARG A 1 31 ? -4.534  5.749   16.113  1.00 0.00 ? 31 ARG A CZ   4  
ATOM 6369  N NH1  . ARG A 1 31 ? -3.970  6.944   16.238  1.00 0.00 ? 31 ARG A NH1  4  
ATOM 6370  N NH2  . ARG A 1 31 ? -5.844  5.621   16.271  1.00 0.00 ? 31 ARG A NH2  4  
ATOM 6371  H H    . ARG A 1 31 ? -0.897  1.405   13.840  1.00 0.00 ? 31 ARG A H    4  
ATOM 6372  H HA   . ARG A 1 31 ? -2.970  2.563   12.268  1.00 0.00 ? 31 ARG A HA   4  
ATOM 6373  H HB2  . ARG A 1 31 ? -0.649  4.161   13.240  1.00 0.00 ? 31 ARG A HB2  4  
ATOM 6374  H HB3  . ARG A 1 31 ? -2.343  4.611   13.135  1.00 0.00 ? 31 ARG A HB3  4  
ATOM 6375  H HG2  . ARG A 1 31 ? -2.544  2.704   14.986  1.00 0.00 ? 31 ARG A HG2  4  
ATOM 6376  H HG3  . ARG A 1 31 ? -0.881  3.211   15.287  1.00 0.00 ? 31 ARG A HG3  4  
ATOM 6377  H HD2  . ARG A 1 31 ? -1.862  4.752   16.605  1.00 0.00 ? 31 ARG A HD2  4  
ATOM 6378  H HD3  . ARG A 1 31 ? -2.089  5.613   15.083  1.00 0.00 ? 31 ARG A HD3  4  
ATOM 6379  H HE   . ARG A 1 31 ? -4.233  3.810   15.746  1.00 0.00 ? 31 ARG A HE   4  
ATOM 6380  H HH11 . ARG A 1 31 ? -2.983  7.048   16.121  1.00 0.00 ? 31 ARG A HH11 4  
ATOM 6381  H HH12 . ARG A 1 31 ? -4.535  7.743   16.449  1.00 0.00 ? 31 ARG A HH12 4  
ATOM 6382  H HH21 . ARG A 1 31 ? -6.274  4.723   16.179  1.00 0.00 ? 31 ARG A HH21 4  
ATOM 6383  H HH22 . ARG A 1 31 ? -6.403  6.423   16.483  1.00 0.00 ? 31 ARG A HH22 4  
ATOM 6384  N N    . ILE A 1 32 ? -1.839  2.524   10.060  1.00 0.00 ? 32 ILE A N    4  
ATOM 6385  C CA   . ILE A 1 32 ? -1.209  2.622   8.752   1.00 0.00 ? 32 ILE A CA   4  
ATOM 6386  C C    . ILE A 1 32 ? -1.295  4.041   8.206   1.00 0.00 ? 32 ILE A C    4  
ATOM 6387  O O    . ILE A 1 32 ? -2.346  4.680   8.268   1.00 0.00 ? 32 ILE A O    4  
ATOM 6388  C CB   . ILE A 1 32 ? -1.855  1.641   7.754   1.00 0.00 ? 32 ILE A CB   4  
ATOM 6389  C CG1  . ILE A 1 32 ? -2.036  0.267   8.410   1.00 0.00 ? 32 ILE A CG1  4  
ATOM 6390  C CG2  . ILE A 1 32 ? -1.008  1.530   6.495   1.00 0.00 ? 32 ILE A CG2  4  
ATOM 6391  C CD1  . ILE A 1 32 ? -0.730  -0.423  8.738   1.00 0.00 ? 32 ILE A CD1  4  
ATOM 6392  H H    . ILE A 1 32 ? -2.778  2.248   10.121  1.00 0.00 ? 32 ILE A H    4  
ATOM 6393  H HA   . ILE A 1 32 ? -0.168  2.354   8.864   1.00 0.00 ? 32 ILE A HA   4  
ATOM 6394  H HB   . ILE A 1 32 ? -2.822  2.030   7.475   1.00 0.00 ? 32 ILE A HB   4  
ATOM 6395  H HG12 . ILE A 1 32 ? -2.587  0.385   9.333   1.00 0.00 ? 32 ILE A HG12 4  
ATOM 6396  H HG13 . ILE A 1 32 ? -2.593  -0.376  7.744   1.00 0.00 ? 32 ILE A HG13 4  
ATOM 6397  H HG21 . ILE A 1 32 ? -1.319  0.666   5.927   1.00 0.00 ? 32 ILE A HG21 4  
ATOM 6398  H HG22 . ILE A 1 32 ? 0.032   1.425   6.768   1.00 0.00 ? 32 ILE A HG22 4  
ATOM 6399  H HG23 . ILE A 1 32 ? -1.135  2.419   5.896   1.00 0.00 ? 32 ILE A HG23 4  
ATOM 6400  H HD11 . ILE A 1 32 ? -0.212  0.131   9.507   1.00 0.00 ? 32 ILE A HD11 4  
ATOM 6401  H HD12 . ILE A 1 32 ? -0.114  -0.470  7.851   1.00 0.00 ? 32 ILE A HD12 4  
ATOM 6402  H HD13 . ILE A 1 32 ? -0.930  -1.425  9.089   1.00 0.00 ? 32 ILE A HD13 4  
ATOM 6403  N N    . GLY A 1 33 ? -0.177  4.532   7.677   1.00 0.00 ? 33 GLY A N    4  
ATOM 6404  C CA   . GLY A 1 33 ? -0.141  5.875   7.132   1.00 0.00 ? 33 GLY A CA   4  
ATOM 6405  C C    . GLY A 1 33 ? -0.126  5.886   5.622   1.00 0.00 ? 33 GLY A C    4  
ATOM 6406  O O    . GLY A 1 33 ? 0.822   5.408   5.001   1.00 0.00 ? 33 GLY A O    4  
ATOM 6407  H H    . GLY A 1 33 ? 0.632   3.979   7.653   1.00 0.00 ? 33 GLY A H    4  
ATOM 6408  H HA2  . GLY A 1 33 ? -1.008  6.415   7.473   1.00 0.00 ? 33 GLY A HA2  4  
ATOM 6409  H HA3  . GLY A 1 33 ? 0.746   6.375   7.494   1.00 0.00 ? 33 GLY A HA3  4  
ATOM 6410  N N    . VAL A 1 34 ? -1.179  6.432   5.027   1.00 0.00 ? 34 VAL A N    4  
ATOM 6411  C CA   . VAL A 1 34 ? -1.276  6.499   3.578   1.00 0.00 ? 34 VAL A CA   4  
ATOM 6412  C C    . VAL A 1 34 ? -1.164  7.934   3.081   1.00 0.00 ? 34 VAL A C    4  
ATOM 6413  O O    . VAL A 1 34 ? -2.115  8.712   3.172   1.00 0.00 ? 34 VAL A O    4  
ATOM 6414  C CB   . VAL A 1 34 ? -2.602  5.896   3.076   1.00 0.00 ? 34 VAL A CB   4  
ATOM 6415  C CG1  . VAL A 1 34 ? -2.599  5.790   1.558   1.00 0.00 ? 34 VAL A CG1  4  
ATOM 6416  C CG2  . VAL A 1 34 ? -2.845  4.536   3.713   1.00 0.00 ? 34 VAL A CG2  4  
ATOM 6417  H H    . VAL A 1 34 ? -1.904  6.796   5.576   1.00 0.00 ? 34 VAL A H    4  
ATOM 6418  H HA   . VAL A 1 34 ? -0.464  5.921   3.162   1.00 0.00 ? 34 VAL A HA   4  
ATOM 6419  H HB   . VAL A 1 34 ? -3.406  6.555   3.366   1.00 0.00 ? 34 VAL A HB   4  
ATOM 6420  H HG11 . VAL A 1 34 ? -2.310  4.791   1.268   1.00 0.00 ? 34 VAL A HG11 4  
ATOM 6421  H HG12 . VAL A 1 34 ? -1.898  6.501   1.149   1.00 0.00 ? 34 VAL A HG12 4  
ATOM 6422  H HG13 . VAL A 1 34 ? -3.589  6.001   1.181   1.00 0.00 ? 34 VAL A HG13 4  
ATOM 6423  H HG21 . VAL A 1 34 ? -2.694  4.606   4.780   1.00 0.00 ? 34 VAL A HG21 4  
ATOM 6424  H HG22 . VAL A 1 34 ? -2.156  3.815   3.298   1.00 0.00 ? 34 VAL A HG22 4  
ATOM 6425  H HG23 . VAL A 1 34 ? -3.859  4.221   3.513   1.00 0.00 ? 34 VAL A HG23 4  
ATOM 6426  N N    . ASN A 1 35 ? 0.004   8.275   2.549   1.00 0.00 ? 35 ASN A N    4  
ATOM 6427  C CA   . ASN A 1 35 ? 0.240   9.613   2.026   1.00 0.00 ? 35 ASN A CA   4  
ATOM 6428  C C    . ASN A 1 35 ? 0.014   9.633   0.520   1.00 0.00 ? 35 ASN A C    4  
ATOM 6429  O O    . ASN A 1 35 ? 0.813   9.100   -0.246  1.00 0.00 ? 35 ASN A O    4  
ATOM 6430  C CB   . ASN A 1 35 ? 1.661   10.078  2.354   1.00 0.00 ? 35 ASN A CB   4  
ATOM 6431  C CG   . ASN A 1 35 ? 1.718   11.546  2.728   1.00 0.00 ? 35 ASN A CG   4  
ATOM 6432  O OD1  . ASN A 1 35 ? 0.832   12.324  2.375   1.00 0.00 ? 35 ASN A OD1  4  
ATOM 6433  N ND2  . ASN A 1 35 ? 2.767   11.933  3.446   1.00 0.00 ? 35 ASN A ND2  4  
ATOM 6434  H H    . ASN A 1 35 ? 0.720   7.606   2.512   1.00 0.00 ? 35 ASN A H    4  
ATOM 6435  H HA   . ASN A 1 35 ? -0.467  10.282  2.494   1.00 0.00 ? 35 ASN A HA   4  
ATOM 6436  H HB2  . ASN A 1 35 ? 2.041   9.500   3.183   1.00 0.00 ? 35 ASN A HB2  4  
ATOM 6437  H HB3  . ASN A 1 35 ? 2.292   9.921   1.491   1.00 0.00 ? 35 ASN A HB3  4  
ATOM 6438  H HD21 . ASN A 1 35 ? 3.435   11.259  3.690   1.00 0.00 ? 35 ASN A HD21 4  
ATOM 6439  H HD22 . ASN A 1 35 ? 2.829   12.877  3.702   1.00 0.00 ? 35 ASN A HD22 4  
ATOM 6440  N N    . ALA A 1 36 ? -1.087  10.243  0.108   1.00 0.00 ? 36 ALA A N    4  
ATOM 6441  C CA   . ALA A 1 36 ? -1.428  10.322  -1.307  1.00 0.00 ? 36 ALA A CA   4  
ATOM 6442  C C    . ALA A 1 36 ? -2.139  11.628  -1.649  1.00 0.00 ? 36 ALA A C    4  
ATOM 6443  O O    . ALA A 1 36 ? -2.876  12.179  -0.832  1.00 0.00 ? 36 ALA A O    4  
ATOM 6444  C CB   . ALA A 1 36 ? -2.290  9.134   -1.705  1.00 0.00 ? 36 ALA A CB   4  
ATOM 6445  H H    . ALA A 1 36 ? -1.682  10.633  0.780   1.00 0.00 ? 36 ALA A H    4  
ATOM 6446  H HA   . ALA A 1 36 ? -0.508  10.269  -1.870  1.00 0.00 ? 36 ALA A HA   4  
ATOM 6447  H HB1  . ALA A 1 36 ? -2.500  9.180   -2.764  1.00 0.00 ? 36 ALA A HB1  4  
ATOM 6448  H HB2  . ALA A 1 36 ? -3.217  9.160   -1.152  1.00 0.00 ? 36 ALA A HB2  4  
ATOM 6449  H HB3  . ALA A 1 36 ? -1.764  8.217   -1.483  1.00 0.00 ? 36 ALA A HB3  4  
ATOM 6450  N N    . PRO A 1 37 ? -1.928  12.134  -2.877  1.00 0.00 ? 37 PRO A N    4  
ATOM 6451  C CA   . PRO A 1 37 ? -2.550  13.373  -3.344  1.00 0.00 ? 37 PRO A CA   4  
ATOM 6452  C C    . PRO A 1 37 ? -3.994  13.157  -3.781  1.00 0.00 ? 37 PRO A C    4  
ATOM 6453  O O    . PRO A 1 37 ? -4.385  12.045  -4.136  1.00 0.00 ? 37 PRO A O    4  
ATOM 6454  C CB   . PRO A 1 37 ? -1.684  13.761  -4.538  1.00 0.00 ? 37 PRO A CB   4  
ATOM 6455  C CG   . PRO A 1 37 ? -1.218  12.459  -5.093  1.00 0.00 ? 37 PRO A CG   4  
ATOM 6456  C CD   . PRO A 1 37 ? -1.065  11.531  -3.915  1.00 0.00 ? 37 PRO A CD   4  
ATOM 6457  H HA   . PRO A 1 37 ? -2.509  14.149  -2.593  1.00 0.00 ? 37 PRO A HA   4  
ATOM 6458  H HB2  . PRO A 1 37 ? -2.277  14.310  -5.255  1.00 0.00 ? 37 PRO A HB2  4  
ATOM 6459  H HB3  . PRO A 1 37 ? -0.855  14.368  -4.206  1.00 0.00 ? 37 PRO A HB3  4  
ATOM 6460  H HG2  . PRO A 1 37 ? -1.953  12.070  -5.782  1.00 0.00 ? 37 PRO A HG2  4  
ATOM 6461  H HG3  . PRO A 1 37 ? -0.269  12.591  -5.590  1.00 0.00 ? 37 PRO A HG3  4  
ATOM 6462  H HD2  . PRO A 1 37 ? -1.408  10.540  -4.170  1.00 0.00 ? 37 PRO A HD2  4  
ATOM 6463  H HD3  . PRO A 1 37 ? -0.036  11.502  -3.589  1.00 0.00 ? 37 PRO A HD3  4  
ATOM 6464  N N    . LYS A 1 38 ? -4.785  14.224  -3.754  1.00 0.00 ? 38 LYS A N    4  
ATOM 6465  C CA   . LYS A 1 38 ? -6.186  14.143  -4.149  1.00 0.00 ? 38 LYS A CA   4  
ATOM 6466  C C    . LYS A 1 38 ? -6.357  14.448  -5.636  1.00 0.00 ? 38 LYS A C    4  
ATOM 6467  O O    . LYS A 1 38 ? -7.288  15.151  -6.030  1.00 0.00 ? 38 LYS A O    4  
ATOM 6468  C CB   . LYS A 1 38 ? -7.028  15.113  -3.318  1.00 0.00 ? 38 LYS A CB   4  
ATOM 6469  C CG   . LYS A 1 38 ? -6.703  15.083  -1.833  1.00 0.00 ? 38 LYS A CG   4  
ATOM 6470  C CD   . LYS A 1 38 ? -7.954  15.251  -0.985  1.00 0.00 ? 38 LYS A CD   4  
ATOM 6471  C CE   . LYS A 1 38 ? -7.701  16.162  0.206   1.00 0.00 ? 38 LYS A CE   4  
ATOM 6472  N NZ   . LYS A 1 38 ? -6.734  15.563  1.167   1.00 0.00 ? 38 LYS A NZ   4  
ATOM 6473  H H    . LYS A 1 38 ? -4.418  15.085  -3.462  1.00 0.00 ? 38 LYS A H    4  
ATOM 6474  H HA   . LYS A 1 38 ? -6.525  13.135  -3.960  1.00 0.00 ? 38 LYS A HA   4  
ATOM 6475  H HB2  . LYS A 1 38 ? -6.861  16.117  -3.680  1.00 0.00 ? 38 LYS A HB2  4  
ATOM 6476  H HB3  . LYS A 1 38 ? -8.071  14.864  -3.442  1.00 0.00 ? 38 LYS A HB3  4  
ATOM 6477  H HG2  . LYS A 1 38 ? -6.244  14.135  -1.594  1.00 0.00 ? 38 LYS A HG2  4  
ATOM 6478  H HG3  . LYS A 1 38 ? -6.015  15.885  -1.608  1.00 0.00 ? 38 LYS A HG3  4  
ATOM 6479  H HD2  . LYS A 1 38 ? -8.735  15.681  -1.594  1.00 0.00 ? 38 LYS A HD2  4  
ATOM 6480  H HD3  . LYS A 1 38 ? -8.267  14.282  -0.626  1.00 0.00 ? 38 LYS A HD3  4  
ATOM 6481  H HE2  . LYS A 1 38 ? -7.305  17.100  -0.152  1.00 0.00 ? 38 LYS A HE2  4  
ATOM 6482  H HE3  . LYS A 1 38 ? -8.639  16.338  0.713   1.00 0.00 ? 38 LYS A HE3  4  
ATOM 6483  H HZ1  . LYS A 1 38 ? -7.239  14.981  1.866   1.00 0.00 ? 38 LYS A HZ1  4  
ATOM 6484  H HZ2  . LYS A 1 38 ? -6.217  16.313  1.668   1.00 0.00 ? 38 LYS A HZ2  4  
ATOM 6485  H HZ3  . LYS A 1 38 ? -6.051  14.965  0.661   1.00 0.00 ? 38 LYS A HZ3  4  
ATOM 6486  N N    . GLU A 1 39 ? -5.457  13.916  -6.459  1.00 0.00 ? 39 GLU A N    4  
ATOM 6487  C CA   . GLU A 1 39 ? -5.516  14.136  -7.900  1.00 0.00 ? 39 GLU A CA   4  
ATOM 6488  C C    . GLU A 1 39 ? -5.757  12.825  -8.644  1.00 0.00 ? 39 GLU A C    4  
ATOM 6489  O O    . GLU A 1 39 ? -6.542  12.774  -9.590  1.00 0.00 ? 39 GLU A O    4  
ATOM 6490  C CB   . GLU A 1 39 ? -4.219  14.787  -8.390  1.00 0.00 ? 39 GLU A CB   4  
ATOM 6491  C CG   . GLU A 1 39 ? -4.377  16.253  -8.759  1.00 0.00 ? 39 GLU A CG   4  
ATOM 6492  C CD   . GLU A 1 39 ? -4.398  16.477  -10.258 1.00 0.00 ? 39 GLU A CD   4  
ATOM 6493  O OE1  . GLU A 1 39 ? -3.418  16.093  -10.930 1.00 0.00 ? 39 GLU A OE1  4  
ATOM 6494  O OE2  . GLU A 1 39 ? -5.395  17.038  -10.761 1.00 0.00 ? 39 GLU A OE2  4  
ATOM 6495  H H    . GLU A 1 39 ? -4.735  13.364  -6.095  1.00 0.00 ? 39 GLU A H    4  
ATOM 6496  H HA   . GLU A 1 39 ? -6.340  14.805  -8.099  1.00 0.00 ? 39 GLU A HA   4  
ATOM 6497  H HB2  . GLU A 1 39 ? -3.476  14.712  -7.610  1.00 0.00 ? 39 GLU A HB2  4  
ATOM 6498  H HB3  . GLU A 1 39 ? -3.867  14.254  -9.261  1.00 0.00 ? 39 GLU A HB3  4  
ATOM 6499  H HG2  . GLU A 1 39 ? -5.304  16.618  -8.343  1.00 0.00 ? 39 GLU A HG2  4  
ATOM 6500  H HG3  . GLU A 1 39 ? -3.551  16.807  -8.338  1.00 0.00 ? 39 GLU A HG3  4  
ATOM 6501  N N    . VAL A 1 40 ? -5.079  11.766  -8.209  1.00 0.00 ? 40 VAL A N    4  
ATOM 6502  C CA   . VAL A 1 40 ? -5.227  10.457  -8.836  1.00 0.00 ? 40 VAL A CA   4  
ATOM 6503  C C    . VAL A 1 40 ? -6.471  9.744   -8.317  1.00 0.00 ? 40 VAL A C    4  
ATOM 6504  O O    . VAL A 1 40 ? -6.980  10.069  -7.244  1.00 0.00 ? 40 VAL A O    4  
ATOM 6505  C CB   . VAL A 1 40 ? -3.991  9.565   -8.592  1.00 0.00 ? 40 VAL A CB   4  
ATOM 6506  C CG1  . VAL A 1 40 ? -4.006  8.367   -9.528  1.00 0.00 ? 40 VAL A CG1  4  
ATOM 6507  C CG2  . VAL A 1 40 ? -2.708  10.365  -8.763  1.00 0.00 ? 40 VAL A CG2  4  
ATOM 6508  H H    . VAL A 1 40 ? -4.469  11.865  -7.449  1.00 0.00 ? 40 VAL A H    4  
ATOM 6509  H HA   . VAL A 1 40 ? -5.330  10.609  -9.901  1.00 0.00 ? 40 VAL A HA   4  
ATOM 6510  H HB   . VAL A 1 40 ? -4.028  9.198   -7.576  1.00 0.00 ? 40 VAL A HB   4  
ATOM 6511  H HG11 . VAL A 1 40 ? -3.077  7.824   -9.432  1.00 0.00 ? 40 VAL A HG11 4  
ATOM 6512  H HG12 . VAL A 1 40 ? -4.121  8.707   -10.546 1.00 0.00 ? 40 VAL A HG12 4  
ATOM 6513  H HG13 . VAL A 1 40 ? -4.830  7.719   -9.269  1.00 0.00 ? 40 VAL A HG13 4  
ATOM 6514  H HG21 . VAL A 1 40 ? -2.403  10.764  -7.807  1.00 0.00 ? 40 VAL A HG21 4  
ATOM 6515  H HG22 . VAL A 1 40 ? -2.880  11.177  -9.453  1.00 0.00 ? 40 VAL A HG22 4  
ATOM 6516  H HG23 . VAL A 1 40 ? -1.932  9.722   -9.150  1.00 0.00 ? 40 VAL A HG23 4  
ATOM 6517  N N    . SER A 1 41 ? -6.961  8.776   -9.084  1.00 0.00 ? 41 SER A N    4  
ATOM 6518  C CA   . SER A 1 41 ? -8.151  8.025   -8.695  1.00 0.00 ? 41 SER A CA   4  
ATOM 6519  C C    . SER A 1 41 ? -7.909  7.262   -7.398  1.00 0.00 ? 41 SER A C    4  
ATOM 6520  O O    . SER A 1 41 ? -7.304  6.190   -7.400  1.00 0.00 ? 41 SER A O    4  
ATOM 6521  C CB   . SER A 1 41 ? -8.560  7.053   -9.804  1.00 0.00 ? 41 SER A CB   4  
ATOM 6522  O OG   . SER A 1 41 ? -9.970  6.945   -9.892  1.00 0.00 ? 41 SER A OG   4  
ATOM 6523  H H    . SER A 1 41 ? -6.515  8.562   -9.930  1.00 0.00 ? 41 SER A H    4  
ATOM 6524  H HA   . SER A 1 41 ? -8.951  8.733   -8.537  1.00 0.00 ? 41 SER A HA   4  
ATOM 6525  H HB2  . SER A 1 41 ? -8.180  7.408   -10.751 1.00 0.00 ? 41 SER A HB2  4  
ATOM 6526  H HB3  . SER A 1 41 ? -8.149  6.077   -9.594  1.00 0.00 ? 41 SER A HB3  4  
ATOM 6527  H HG   . SER A 1 41 ? -10.336 6.807   -9.016  1.00 0.00 ? 41 SER A HG   4  
ATOM 6528  N N    . VAL A 1 42 ? -8.386  7.822   -6.290  1.00 0.00 ? 42 VAL A N    4  
ATOM 6529  C CA   . VAL A 1 42 ? -8.223  7.194   -4.985  1.00 0.00 ? 42 VAL A CA   4  
ATOM 6530  C C    . VAL A 1 42 ? -9.578  6.948   -4.323  1.00 0.00 ? 42 VAL A C    4  
ATOM 6531  O O    . VAL A 1 42 ? -10.364 7.877   -4.140  1.00 0.00 ? 42 VAL A O    4  
ATOM 6532  C CB   . VAL A 1 42 ? -7.356  8.063   -4.052  1.00 0.00 ? 42 VAL A CB   4  
ATOM 6533  C CG1  . VAL A 1 42 ? -8.014  9.413   -3.809  1.00 0.00 ? 42 VAL A CG1  4  
ATOM 6534  C CG2  . VAL A 1 42 ? -7.095  7.344   -2.737  1.00 0.00 ? 42 VAL A CG2  4  
ATOM 6535  H H    . VAL A 1 42 ? -8.863  8.676   -6.348  1.00 0.00 ? 42 VAL A H    4  
ATOM 6536  H HA   . VAL A 1 42 ? -7.722  6.248   -5.130  1.00 0.00 ? 42 VAL A HA   4  
ATOM 6537  H HB   . VAL A 1 42 ? -6.406  8.236   -4.537  1.00 0.00 ? 42 VAL A HB   4  
ATOM 6538  H HG11 . VAL A 1 42 ? -8.306  9.847   -4.754  1.00 0.00 ? 42 VAL A HG11 4  
ATOM 6539  H HG12 . VAL A 1 42 ? -7.315  10.070  -3.312  1.00 0.00 ? 42 VAL A HG12 4  
ATOM 6540  H HG13 . VAL A 1 42 ? -8.888  9.281   -3.188  1.00 0.00 ? 42 VAL A HG13 4  
ATOM 6541  H HG21 . VAL A 1 42 ? -8.013  7.282   -2.172  1.00 0.00 ? 42 VAL A HG21 4  
ATOM 6542  H HG22 . VAL A 1 42 ? -6.358  7.890   -2.167  1.00 0.00 ? 42 VAL A HG22 4  
ATOM 6543  H HG23 . VAL A 1 42 ? -6.728  6.348   -2.938  1.00 0.00 ? 42 VAL A HG23 4  
ATOM 6544  N N    . HIS A 1 43 ? -9.843  5.697   -3.956  1.00 0.00 ? 43 HIS A N    4  
ATOM 6545  C CA   . HIS A 1 43 ? -11.098 5.340   -3.306  1.00 0.00 ? 43 HIS A CA   4  
ATOM 6546  C C    . HIS A 1 43 ? -10.827 4.556   -2.026  1.00 0.00 ? 43 HIS A C    4  
ATOM 6547  O O    . HIS A 1 43 ? -9.982  3.662   -2.008  1.00 0.00 ? 43 HIS A O    4  
ATOM 6548  C CB   . HIS A 1 43 ? -11.974 4.516   -4.250  1.00 0.00 ? 43 HIS A CB   4  
ATOM 6549  C CG   . HIS A 1 43 ? -13.431 4.568   -3.912  1.00 0.00 ? 43 HIS A CG   4  
ATOM 6550  N ND1  . HIS A 1 43 ? -14.411 4.852   -4.839  1.00 0.00 ? 43 HIS A ND1  4  
ATOM 6551  C CD2  . HIS A 1 43 ? -14.076 4.371   -2.737  1.00 0.00 ? 43 HIS A CD2  4  
ATOM 6552  C CE1  . HIS A 1 43 ? -15.594 4.829   -4.253  1.00 0.00 ? 43 HIS A CE1  4  
ATOM 6553  N NE2  . HIS A 1 43 ? -15.419 4.539   -2.977  1.00 0.00 ? 43 HIS A NE2  4  
ATOM 6554  H H    . HIS A 1 43 ? -9.178  4.995   -4.113  1.00 0.00 ? 43 HIS A H    4  
ATOM 6555  H HA   . HIS A 1 43 ? -11.614 6.255   -3.053  1.00 0.00 ? 43 HIS A HA   4  
ATOM 6556  H HB2  . HIS A 1 43 ? -11.854 4.886   -5.257  1.00 0.00 ? 43 HIS A HB2  4  
ATOM 6557  H HB3  . HIS A 1 43 ? -11.660 3.483   -4.212  1.00 0.00 ? 43 HIS A HB3  4  
ATOM 6558  H HD2  . HIS A 1 43 ? -13.620 4.128   -1.788  1.00 0.00 ? 43 HIS A HD2  4  
ATOM 6559  H HE1  . HIS A 1 43 ? -16.542 5.014   -4.735  1.00 0.00 ? 43 HIS A HE1  4  
ATOM 6560  H HE2  . HIS A 1 43 ? -16.122 4.546   -2.294  1.00 0.00 ? 43 HIS A HE2  4  
ATOM 6561  N N    . ARG A 1 44 ? -11.542 4.890   -0.957  1.00 0.00 ? 44 ARG A N    4  
ATOM 6562  C CA   . ARG A 1 44 ? -11.365 4.207   0.318   1.00 0.00 ? 44 ARG A CA   4  
ATOM 6563  C C    . ARG A 1 44 ? -12.504 4.547   1.275   1.00 0.00 ? 44 ARG A C    4  
ATOM 6564  O O    . ARG A 1 44 ? -13.493 5.164   0.881   1.00 0.00 ? 44 ARG A O    4  
ATOM 6565  C CB   . ARG A 1 44 ? -10.021 4.591   0.942   1.00 0.00 ? 44 ARG A CB   4  
ATOM 6566  C CG   . ARG A 1 44 ? -9.911  6.067   1.290   1.00 0.00 ? 44 ARG A CG   4  
ATOM 6567  C CD   . ARG A 1 44 ? -8.506  6.592   1.043   1.00 0.00 ? 44 ARG A CD   4  
ATOM 6568  N NE   . ARG A 1 44 ? -8.421  8.039   1.230   1.00 0.00 ? 44 ARG A NE   4  
ATOM 6569  C CZ   . ARG A 1 44 ? -8.886  8.928   0.356   1.00 0.00 ? 44 ARG A CZ   4  
ATOM 6570  N NH1  . ARG A 1 44 ? -9.473  8.524   -0.764  1.00 0.00 ? 44 ARG A NH1  4  
ATOM 6571  N NH2  . ARG A 1 44 ? -8.765  10.225  0.603   1.00 0.00 ? 44 ARG A NH2  4  
ATOM 6572  H H    . ARG A 1 44 ? -12.206 5.608   -1.019  1.00 0.00 ? 44 ARG A H    4  
ATOM 6573  H HA   . ARG A 1 44 ? -11.374 3.144   0.129   1.00 0.00 ? 44 ARG A HA   4  
ATOM 6574  H HB2  . ARG A 1 44 ? -9.880  4.018   1.847   1.00 0.00 ? 44 ARG A HB2  4  
ATOM 6575  H HB3  . ARG A 1 44 ? -9.233  4.348   0.246   1.00 0.00 ? 44 ARG A HB3  4  
ATOM 6576  H HG2  . ARG A 1 44 ? -10.605 6.624   0.679   1.00 0.00 ? 44 ARG A HG2  4  
ATOM 6577  H HG3  . ARG A 1 44 ? -10.158 6.200   2.333   1.00 0.00 ? 44 ARG A HG3  4  
ATOM 6578  H HD2  . ARG A 1 44 ? -7.829  6.110   1.733   1.00 0.00 ? 44 ARG A HD2  4  
ATOM 6579  H HD3  . ARG A 1 44 ? -8.218  6.352   0.030   1.00 0.00 ? 44 ARG A HD3  4  
ATOM 6580  H HE   . ARG A 1 44 ? -7.993  8.365   2.049   1.00 0.00 ? 44 ARG A HE   4  
ATOM 6581  H HH11 . ARG A 1 44 ? -9.568  7.548   -0.956  1.00 0.00 ? 44 ARG A HH11 4  
ATOM 6582  H HH12 . ARG A 1 44 ? -9.820  9.198   -1.417  1.00 0.00 ? 44 ARG A HH12 4  
ATOM 6583  H HH21 . ARG A 1 44 ? -8.324  10.535  1.445   1.00 0.00 ? 44 ARG A HH21 4  
ATOM 6584  H HH22 . ARG A 1 44 ? -9.114  10.894  -0.054  1.00 0.00 ? 44 ARG A HH22 4  
ATOM 6585  N N    . GLU A 1 45 ? -12.360 4.141   2.534   1.00 0.00 ? 45 GLU A N    4  
ATOM 6586  C CA   . GLU A 1 45 ? -13.380 4.404   3.544   1.00 0.00 ? 45 GLU A CA   4  
ATOM 6587  C C    . GLU A 1 45 ? -13.712 5.893   3.612   1.00 0.00 ? 45 GLU A C    4  
ATOM 6588  O O    . GLU A 1 45 ? -12.829 6.728   3.814   1.00 0.00 ? 45 GLU A O    4  
ATOM 6589  C CB   . GLU A 1 45 ? -12.910 3.911   4.913   1.00 0.00 ? 45 GLU A CB   4  
ATOM 6590  C CG   . GLU A 1 45 ? -13.289 2.468   5.203   1.00 0.00 ? 45 GLU A CG   4  
ATOM 6591  C CD   . GLU A 1 45 ? -14.780 2.220   5.075   1.00 0.00 ? 45 GLU A CD   4  
ATOM 6592  O OE1  . GLU A 1 45 ? -15.556 2.893   5.785   1.00 0.00 ? 45 GLU A OE1  4  
ATOM 6593  O OE2  . GLU A 1 45 ? -15.170 1.354   4.265   1.00 0.00 ? 45 GLU A OE2  4  
ATOM 6594  H H    . GLU A 1 45 ? -11.550 3.653   2.789   1.00 0.00 ? 45 GLU A H    4  
ATOM 6595  H HA   . GLU A 1 45 ? -14.271 3.863   3.264   1.00 0.00 ? 45 GLU A HA   4  
ATOM 6596  H HB2  . GLU A 1 45 ? -11.834 3.994   4.962   1.00 0.00 ? 45 GLU A HB2  4  
ATOM 6597  H HB3  . GLU A 1 45 ? -13.346 4.536   5.678   1.00 0.00 ? 45 GLU A HB3  4  
ATOM 6598  H HG2  . GLU A 1 45 ? -12.773 1.826   4.505   1.00 0.00 ? 45 GLU A HG2  4  
ATOM 6599  H HG3  . GLU A 1 45 ? -12.984 2.224   6.210   1.00 0.00 ? 45 GLU A HG3  4  
ATOM 6600  N N    . GLU A 1 46 ? -14.990 6.217   3.440   1.00 0.00 ? 46 GLU A N    4  
ATOM 6601  C CA   . GLU A 1 46 ? -15.441 7.604   3.478   1.00 0.00 ? 46 GLU A CA   4  
ATOM 6602  C C    . GLU A 1 46 ? -15.075 8.265   4.804   1.00 0.00 ? 46 GLU A C    4  
ATOM 6603  O O    . GLU A 1 46 ? -14.426 9.310   4.828   1.00 0.00 ? 46 GLU A O    4  
ATOM 6604  C CB   . GLU A 1 46 ? -16.954 7.673   3.257   1.00 0.00 ? 46 GLU A CB   4  
ATOM 6605  C CG   . GLU A 1 46 ? -17.355 8.516   2.058   1.00 0.00 ? 46 GLU A CG   4  
ATOM 6606  C CD   . GLU A 1 46 ? -18.783 8.259   1.616   1.00 0.00 ? 46 GLU A CD   4  
ATOM 6607  O OE1  . GLU A 1 46 ? -19.690 8.329   2.471   1.00 0.00 ? 46 GLU A OE1  4  
ATOM 6608  O OE2  . GLU A 1 46 ? -18.993 7.987   0.415   1.00 0.00 ? 46 GLU A OE2  4  
ATOM 6609  H H    . GLU A 1 46 ? -15.647 5.507   3.282   1.00 0.00 ? 46 GLU A H    4  
ATOM 6610  H HA   . GLU A 1 46 ? -14.946 8.134   2.678   1.00 0.00 ? 46 GLU A HA   4  
ATOM 6611  H HB2  . GLU A 1 46 ? -17.330 6.671   3.107   1.00 0.00 ? 46 GLU A HB2  4  
ATOM 6612  H HB3  . GLU A 1 46 ? -17.419 8.094   4.137   1.00 0.00 ? 46 GLU A HB3  4  
ATOM 6613  H HG2  . GLU A 1 46 ? -17.258 9.559   2.318   1.00 0.00 ? 46 GLU A HG2  4  
ATOM 6614  H HG3  . GLU A 1 46 ? -16.692 8.287   1.236   1.00 0.00 ? 46 GLU A HG3  4  
ATOM 6615  N N    . ILE A 1 47 ? -15.495 7.649   5.905   1.00 0.00 ? 47 ILE A N    4  
ATOM 6616  C CA   . ILE A 1 47 ? -15.210 8.181   7.232   1.00 0.00 ? 47 ILE A CA   4  
ATOM 6617  C C    . ILE A 1 47 ? -13.706 8.272   7.474   1.00 0.00 ? 47 ILE A C    4  
ATOM 6618  O O    . ILE A 1 47 ? -13.215 9.248   8.042   1.00 0.00 ? 47 ILE A O    4  
ATOM 6619  C CB   . ILE A 1 47 ? -15.851 7.313   8.334   1.00 0.00 ? 47 ILE A CB   4  
ATOM 6620  C CG1  . ILE A 1 47 ? -15.614 7.935   9.712   1.00 0.00 ? 47 ILE A CG1  4  
ATOM 6621  C CG2  . ILE A 1 47 ? -15.298 5.895   8.284   1.00 0.00 ? 47 ILE A CG2  4  
ATOM 6622  C CD1  . ILE A 1 47 ? -16.182 9.330   9.851   1.00 0.00 ? 47 ILE A CD1  4  
ATOM 6623  H H    . ILE A 1 47 ? -16.007 6.818   5.824   1.00 0.00 ? 47 ILE A H    4  
ATOM 6624  H HA   . ILE A 1 47 ? -15.634 9.172   7.291   1.00 0.00 ? 47 ILE A HA   4  
ATOM 6625  H HB   . ILE A 1 47 ? -16.913 7.263   8.148   1.00 0.00 ? 47 ILE A HB   4  
ATOM 6626  H HG12 . ILE A 1 47 ? -16.075 7.313   10.465  1.00 0.00 ? 47 ILE A HG12 4  
ATOM 6627  H HG13 . ILE A 1 47 ? -14.551 7.988   9.898   1.00 0.00 ? 47 ILE A HG13 4  
ATOM 6628  H HG21 . ILE A 1 47 ? -15.977 5.226   8.792   1.00 0.00 ? 47 ILE A HG21 4  
ATOM 6629  H HG22 . ILE A 1 47 ? -14.334 5.867   8.770   1.00 0.00 ? 47 ILE A HG22 4  
ATOM 6630  H HG23 . ILE A 1 47 ? -15.191 5.587   7.254   1.00 0.00 ? 47 ILE A HG23 4  
ATOM 6631  H HD11 . ILE A 1 47 ? -17.250 9.301   9.698   1.00 0.00 ? 47 ILE A HD11 4  
ATOM 6632  H HD12 . ILE A 1 47 ? -15.730 9.978   9.115   1.00 0.00 ? 47 ILE A HD12 4  
ATOM 6633  H HD13 . ILE A 1 47 ? -15.970 9.708   10.841  1.00 0.00 ? 47 ILE A HD13 4  
ATOM 6634  N N    . TYR A 1 48 ? -12.980 7.246   7.038   1.00 0.00 ? 48 TYR A N    4  
ATOM 6635  C CA   . TYR A 1 48 ? -11.530 7.202   7.205   1.00 0.00 ? 48 TYR A CA   4  
ATOM 6636  C C    . TYR A 1 48 ? -10.885 8.519   6.784   1.00 0.00 ? 48 TYR A C    4  
ATOM 6637  O O    . TYR A 1 48 ? -10.164 9.144   7.562   1.00 0.00 ? 48 TYR A O    4  
ATOM 6638  C CB   . TYR A 1 48 ? -10.940 6.049   6.392   1.00 0.00 ? 48 TYR A CB   4  
ATOM 6639  C CG   . TYR A 1 48 ? -10.900 4.737   7.143   1.00 0.00 ? 48 TYR A CG   4  
ATOM 6640  C CD1  . TYR A 1 48 ? -12.027 4.257   7.799   1.00 0.00 ? 48 TYR A CD1  4  
ATOM 6641  C CD2  . TYR A 1 48 ? -9.737  3.979   7.197   1.00 0.00 ? 48 TYR A CD2  4  
ATOM 6642  C CE1  . TYR A 1 48 ? -11.996 3.060   8.488   1.00 0.00 ? 48 TYR A CE1  4  
ATOM 6643  C CE2  . TYR A 1 48 ? -9.698  2.780   7.883   1.00 0.00 ? 48 TYR A CE2  4  
ATOM 6644  C CZ   . TYR A 1 48 ? -10.830 2.325   8.526   1.00 0.00 ? 48 TYR A CZ   4  
ATOM 6645  O OH   . TYR A 1 48 ? -10.795 1.131   9.211   1.00 0.00 ? 48 TYR A OH   4  
ATOM 6646  H H    . TYR A 1 48 ? -13.431 6.498   6.593   1.00 0.00 ? 48 TYR A H    4  
ATOM 6647  H HA   . TYR A 1 48 ? -11.324 7.033   8.251   1.00 0.00 ? 48 TYR A HA   4  
ATOM 6648  H HB2  . TYR A 1 48 ? -11.535 5.903   5.502   1.00 0.00 ? 48 TYR A HB2  4  
ATOM 6649  H HB3  . TYR A 1 48 ? -9.929  6.299   6.105   1.00 0.00 ? 48 TYR A HB3  4  
ATOM 6650  H HD1  . TYR A 1 48 ? -12.939 4.835   7.767   1.00 0.00 ? 48 TYR A HD1  4  
ATOM 6651  H HD2  . TYR A 1 48 ? -8.852  4.338   6.692   1.00 0.00 ? 48 TYR A HD2  4  
ATOM 6652  H HE1  . TYR A 1 48 ? -12.882 2.703   8.992   1.00 0.00 ? 48 TYR A HE1  4  
ATOM 6653  H HE2  . TYR A 1 48 ? -8.785  2.204   7.913   1.00 0.00 ? 48 TYR A HE2  4  
ATOM 6654  H HH   . TYR A 1 48 ? -11.602 0.640   9.039   1.00 0.00 ? 48 TYR A HH   4  
ATOM 6655  N N    . GLN A 1 49 ? -11.148 8.937   5.550   1.00 0.00 ? 49 GLN A N    4  
ATOM 6656  C CA   . GLN A 1 49 ? -10.591 10.180  5.031   1.00 0.00 ? 49 GLN A CA   4  
ATOM 6657  C C    . GLN A 1 49 ? -11.384 11.388  5.526   1.00 0.00 ? 49 GLN A C    4  
ATOM 6658  O O    . GLN A 1 49 ? -10.871 12.507  5.551   1.00 0.00 ? 49 GLN A O    4  
ATOM 6659  C CB   . GLN A 1 49 ? -10.578 10.157  3.502   1.00 0.00 ? 49 GLN A CB   4  
ATOM 6660  C CG   . GLN A 1 49 ? -11.940 9.882   2.886   1.00 0.00 ? 49 GLN A CG   4  
ATOM 6661  C CD   . GLN A 1 49 ? -12.166 10.658  1.603   1.00 0.00 ? 49 GLN A CD   4  
ATOM 6662  O OE1  . GLN A 1 49 ? -12.067 11.885  1.581   1.00 0.00 ? 49 GLN A OE1  4  
ATOM 6663  N NE2  . GLN A 1 49 ? -12.472 9.944   0.526   1.00 0.00 ? 49 GLN A NE2  4  
ATOM 6664  H H    . GLN A 1 49 ? -11.730 8.397   4.974   1.00 0.00 ? 49 GLN A H    4  
ATOM 6665  H HA   . GLN A 1 49 ? -9.575  10.261  5.389   1.00 0.00 ? 49 GLN A HA   4  
ATOM 6666  H HB2  . GLN A 1 49 ? -10.231 11.114  3.142   1.00 0.00 ? 49 GLN A HB2  4  
ATOM 6667  H HB3  . GLN A 1 49 ? -9.895  9.389   3.171   1.00 0.00 ? 49 GLN A HB3  4  
ATOM 6668  H HG2  . GLN A 1 49 ? -12.016 8.827   2.668   1.00 0.00 ? 49 GLN A HG2  4  
ATOM 6669  H HG3  . GLN A 1 49 ? -12.705 10.158  3.597   1.00 0.00 ? 49 GLN A HG3  4  
ATOM 6670  H HE21 . GLN A 1 49 ? -12.533 8.970   0.618   1.00 0.00 ? 49 GLN A HE21 4  
ATOM 6671  H HE22 . GLN A 1 49 ? -12.623 10.420  -0.317  1.00 0.00 ? 49 GLN A HE22 4  
ATOM 6672  N N    . ARG A 1 50 ? -12.633 11.156  5.924   1.00 0.00 ? 50 ARG A N    4  
ATOM 6673  C CA   . ARG A 1 50 ? -13.489 12.227  6.420   1.00 0.00 ? 50 ARG A CA   4  
ATOM 6674  C C    . ARG A 1 50 ? -13.034 12.708  7.797   1.00 0.00 ? 50 ARG A C    4  
ATOM 6675  O O    . ARG A 1 50 ? -13.468 13.757  8.270   1.00 0.00 ? 50 ARG A O    4  
ATOM 6676  C CB   . ARG A 1 50 ? -14.943 11.757  6.489   1.00 0.00 ? 50 ARG A CB   4  
ATOM 6677  C CG   . ARG A 1 50 ? -15.938 12.884  6.711   1.00 0.00 ? 50 ARG A CG   4  
ATOM 6678  C CD   . ARG A 1 50 ? -16.217 13.642  5.424   1.00 0.00 ? 50 ARG A CD   4  
ATOM 6679  N NE   . ARG A 1 50 ? -17.438 13.178  4.769   1.00 0.00 ? 50 ARG A NE   4  
ATOM 6680  C CZ   . ARG A 1 50 ? -18.103 13.882  3.855   1.00 0.00 ? 50 ARG A CZ   4  
ATOM 6681  N NH1  . ARG A 1 50 ? -17.669 15.080  3.484   1.00 0.00 ? 50 ARG A NH1  4  
ATOM 6682  N NH2  . ARG A 1 50 ? -19.205 13.386  3.310   1.00 0.00 ? 50 ARG A NH2  4  
ATOM 6683  H H    . ARG A 1 50 ? -12.986 10.246  5.888   1.00 0.00 ? 50 ARG A H    4  
ATOM 6684  H HA   . ARG A 1 50 ? -13.421 13.047  5.725   1.00 0.00 ? 50 ARG A HA   4  
ATOM 6685  H HB2  . ARG A 1 50 ? -15.194 11.262  5.563   1.00 0.00 ? 50 ARG A HB2  4  
ATOM 6686  H HB3  . ARG A 1 50 ? -15.043 11.053  7.302   1.00 0.00 ? 50 ARG A HB3  4  
ATOM 6687  H HG2  . ARG A 1 50 ? -16.864 12.468  7.079   1.00 0.00 ? 50 ARG A HG2  4  
ATOM 6688  H HG3  . ARG A 1 50 ? -15.534 13.569  7.442   1.00 0.00 ? 50 ARG A HG3  4  
ATOM 6689  H HD2  . ARG A 1 50 ? -16.321 14.692  5.655   1.00 0.00 ? 50 ARG A HD2  4  
ATOM 6690  H HD3  . ARG A 1 50 ? -15.384 13.503  4.751   1.00 0.00 ? 50 ARG A HD3  4  
ATOM 6691  H HE   . ARG A 1 50 ? -17.781 12.296  5.024   1.00 0.00 ? 50 ARG A HE   4  
ATOM 6692  H HH11 . ARG A 1 50 ? -16.838 15.459  3.891   1.00 0.00 ? 50 ARG A HH11 4  
ATOM 6693  H HH12 . ARG A 1 50 ? -18.173 15.603  2.797   1.00 0.00 ? 50 ARG A HH12 4  
ATOM 6694  H HH21 . ARG A 1 50 ? -19.537 12.483  3.586   1.00 0.00 ? 50 ARG A HH21 4  
ATOM 6695  H HH22 . ARG A 1 50 ? -19.705 13.914  2.624   1.00 0.00 ? 50 ARG A HH22 4  
ATOM 6696  N N    . ILE A 1 51 ? -12.156 11.936  8.433   1.00 0.00 ? 51 ILE A N    4  
ATOM 6697  C CA   . ILE A 1 51 ? -11.640 12.285  9.751   1.00 0.00 ? 51 ILE A CA   4  
ATOM 6698  C C    . ILE A 1 51 ? -10.139 12.546  9.689   1.00 0.00 ? 51 ILE A C    4  
ATOM 6699  O O    . ILE A 1 51 ? -9.623  13.430  10.372  1.00 0.00 ? 51 ILE A O    4  
ATOM 6700  C CB   . ILE A 1 51 ? -11.923 11.172  10.781  1.00 0.00 ? 51 ILE A CB   4  
ATOM 6701  C CG1  . ILE A 1 51 ? -11.473 11.607  12.178  1.00 0.00 ? 51 ILE A CG1  4  
ATOM 6702  C CG2  . ILE A 1 51 ? -11.231 9.879   10.372  1.00 0.00 ? 51 ILE A CG2  4  
ATOM 6703  C CD1  . ILE A 1 51 ? -12.493 11.319  13.258  1.00 0.00 ? 51 ILE A CD1  4  
ATOM 6704  H H    . ILE A 1 51 ? -11.846 11.114  8.005   1.00 0.00 ? 51 ILE A H    4  
ATOM 6705  H HA   . ILE A 1 51 ? -12.140 13.186  10.077  1.00 0.00 ? 51 ILE A HA   4  
ATOM 6706  H HB   . ILE A 1 51 ? -12.987 10.990  10.795  1.00 0.00 ? 51 ILE A HB   4  
ATOM 6707  H HG12 . ILE A 1 51 ? -10.562 11.087  12.435  1.00 0.00 ? 51 ILE A HG12 4  
ATOM 6708  H HG13 . ILE A 1 51 ? -11.285 12.671  12.173  1.00 0.00 ? 51 ILE A HG13 4  
ATOM 6709  H HG21 . ILE A 1 51 ? -10.166 9.979   10.518  1.00 0.00 ? 51 ILE A HG21 4  
ATOM 6710  H HG22 . ILE A 1 51 ? -11.434 9.676   9.331   1.00 0.00 ? 51 ILE A HG22 4  
ATOM 6711  H HG23 . ILE A 1 51 ? -11.603 9.065   10.977  1.00 0.00 ? 51 ILE A HG23 4  
ATOM 6712  H HD11 . ILE A 1 51 ? -12.097 11.620  14.217  1.00 0.00 ? 51 ILE A HD11 4  
ATOM 6713  H HD12 . ILE A 1 51 ? -12.711 10.261  13.275  1.00 0.00 ? 51 ILE A HD12 4  
ATOM 6714  H HD13 . ILE A 1 51 ? -13.399 11.870  13.054  1.00 0.00 ? 51 ILE A HD13 4  
ATOM 6715  N N    . GLN A 1 52 ? -9.447  11.777  8.854   1.00 0.00 ? 52 GLN A N    4  
ATOM 6716  C CA   . GLN A 1 52 ? -8.008  11.930  8.687   1.00 0.00 ? 52 GLN A CA   4  
ATOM 6717  C C    . GLN A 1 52 ? -7.713  12.975  7.617   1.00 0.00 ? 52 GLN A C    4  
ATOM 6718  O O    . GLN A 1 52 ? -7.052  13.979  7.880   1.00 0.00 ? 52 GLN A O    4  
ATOM 6719  C CB   . GLN A 1 52 ? -7.369  10.590  8.310   1.00 0.00 ? 52 GLN A CB   4  
ATOM 6720  C CG   . GLN A 1 52 ? -6.328  10.112  9.308   1.00 0.00 ? 52 GLN A CG   4  
ATOM 6721  C CD   . GLN A 1 52 ? -6.916  9.841   10.679  1.00 0.00 ? 52 GLN A CD   4  
ATOM 6722  O OE1  . GLN A 1 52 ? -8.027  9.326   10.800  1.00 0.00 ? 52 GLN A OE1  4  
ATOM 6723  N NE2  . GLN A 1 52 ? -6.170  10.189  11.722  1.00 0.00 ? 52 GLN A NE2  4  
ATOM 6724  H H    . GLN A 1 52 ? -9.919  11.097  8.329   1.00 0.00 ? 52 GLN A H    4  
ATOM 6725  H HA   . GLN A 1 52 ? -7.598  12.266  9.627   1.00 0.00 ? 52 GLN A HA   4  
ATOM 6726  H HB2  . GLN A 1 52 ? -8.145  9.841   8.246   1.00 0.00 ? 52 GLN A HB2  4  
ATOM 6727  H HB3  . GLN A 1 52 ? -6.894  10.687  7.345   1.00 0.00 ? 52 GLN A HB3  4  
ATOM 6728  H HG2  . GLN A 1 52 ? -5.884  9.200   8.938   1.00 0.00 ? 52 GLN A HG2  4  
ATOM 6729  H HG3  . GLN A 1 52 ? -5.564  10.871  9.403   1.00 0.00 ? 52 GLN A HG3  4  
ATOM 6730  H HE21 . GLN A 1 52 ? -5.295  10.595  11.551  1.00 0.00 ? 52 GLN A HE21 4  
ATOM 6731  H HE22 . GLN A 1 52 ? -6.526  10.025  12.620  1.00 0.00 ? 52 GLN A HE22 4  
ATOM 6732  N N    . ALA A 1 53 ? -8.221  12.736  6.412   1.00 0.00 ? 53 ALA A N    4  
ATOM 6733  C CA   . ALA A 1 53 ? -8.025  13.662  5.306   1.00 0.00 ? 53 ALA A CA   4  
ATOM 6734  C C    . ALA A 1 53 ? -8.643  15.015  5.635   1.00 0.00 ? 53 ALA A C    4  
ATOM 6735  O O    . ALA A 1 53 ? -7.989  16.052  5.530   1.00 0.00 ? 53 ALA A O    4  
ATOM 6736  C CB   . ALA A 1 53 ? -8.626  13.096  4.027   1.00 0.00 ? 53 ALA A CB   4  
ATOM 6737  H H    . ALA A 1 53 ? -8.747  11.921  6.268   1.00 0.00 ? 53 ALA A H    4  
ATOM 6738  H HA   . ALA A 1 53 ? -6.963  13.786  5.157   1.00 0.00 ? 53 ALA A HA   4  
ATOM 6739  H HB1  . ALA A 1 53 ? -7.956  13.284  3.201   1.00 0.00 ? 53 ALA A HB1  4  
ATOM 6740  H HB2  . ALA A 1 53 ? -9.576  13.571  3.835   1.00 0.00 ? 53 ALA A HB2  4  
ATOM 6741  H HB3  . ALA A 1 53 ? -8.771  12.032  4.138   1.00 0.00 ? 53 ALA A HB3  4  
ATOM 6742  N N    . GLU A 1 54 ? -9.908  14.992  6.043   1.00 0.00 ? 54 GLU A N    4  
ATOM 6743  C CA   . GLU A 1 54 ? -10.621 16.211  6.401   1.00 0.00 ? 54 GLU A CA   4  
ATOM 6744  C C    . GLU A 1 54 ? -10.926 16.235  7.895   1.00 0.00 ? 54 GLU A C    4  
ATOM 6745  O O    . GLU A 1 54 ? -11.656 15.385  8.404   1.00 0.00 ? 54 GLU A O    4  
ATOM 6746  C CB   . GLU A 1 54 ? -11.919 16.325  5.600   1.00 0.00 ? 54 GLU A CB   4  
ATOM 6747  C CG   . GLU A 1 54 ? -12.583 17.688  5.709   1.00 0.00 ? 54 GLU A CG   4  
ATOM 6748  C CD   . GLU A 1 54 ? -13.404 18.036  4.483   1.00 0.00 ? 54 GLU A CD   4  
ATOM 6749  O OE1  . GLU A 1 54 ? -12.901 17.842  3.356   1.00 0.00 ? 54 GLU A OE1  4  
ATOM 6750  O OE2  . GLU A 1 54 ? -14.551 18.503  4.649   1.00 0.00 ? 54 GLU A OE2  4  
ATOM 6751  H H    . GLU A 1 54 ? -10.373 14.131  6.110   1.00 0.00 ? 54 GLU A H    4  
ATOM 6752  H HA   . GLU A 1 54 ? -9.984  17.050  6.161   1.00 0.00 ? 54 GLU A HA   4  
ATOM 6753  H HB2  . GLU A 1 54 ? -11.704 16.135  4.558   1.00 0.00 ? 54 GLU A HB2  4  
ATOM 6754  H HB3  . GLU A 1 54 ? -12.615 15.580  5.956   1.00 0.00 ? 54 GLU A HB3  4  
ATOM 6755  H HG2  . GLU A 1 54 ? -13.234 17.689  6.571   1.00 0.00 ? 54 GLU A HG2  4  
ATOM 6756  H HG3  . GLU A 1 54 ? -11.817 18.438  5.836   1.00 0.00 ? 54 GLU A HG3  4  
ATOM 6757  N N    . LYS A 1 55 ? -10.355 17.210  8.594   1.00 0.00 ? 55 LYS A N    4  
ATOM 6758  C CA   . LYS A 1 55 ? -10.549 17.354  10.030  1.00 0.00 ? 55 LYS A CA   4  
ATOM 6759  C C    . LYS A 1 55 ? -12.019 17.203  10.418  1.00 0.00 ? 55 LYS A C    4  
ATOM 6760  O O    . LYS A 1 55 ? -12.864 17.998  10.010  1.00 0.00 ? 55 LYS A O    4  
ATOM 6761  C CB   . LYS A 1 55 ? -10.023 18.713  10.499  1.00 0.00 ? 55 LYS A CB   4  
ATOM 6762  C CG   . LYS A 1 55 ? -8.630  18.650  11.103  1.00 0.00 ? 55 LYS A CG   4  
ATOM 6763  C CD   . LYS A 1 55 ? -7.560  18.946  10.065  1.00 0.00 ? 55 LYS A CD   4  
ATOM 6764  C CE   . LYS A 1 55 ? -7.498  20.429  9.736   1.00 0.00 ? 55 LYS A CE   4  
ATOM 6765  N NZ   . LYS A 1 55 ? -7.049  21.238  10.902  1.00 0.00 ? 55 LYS A NZ   4  
ATOM 6766  H H    . LYS A 1 55 ? -9.780  17.845  8.133   1.00 0.00 ? 55 LYS A H    4  
ATOM 6767  H HA   . LYS A 1 55 ? -9.979  16.579  10.508  1.00 0.00 ? 55 LYS A HA   4  
ATOM 6768  H HB2  . LYS A 1 55 ? -9.997  19.387  9.656   1.00 0.00 ? 55 LYS A HB2  4  
ATOM 6769  H HB3  . LYS A 1 55 ? -10.697 19.110  11.245  1.00 0.00 ? 55 LYS A HB3  4  
ATOM 6770  H HG2  . LYS A 1 55 ? -8.558  19.378  11.896  1.00 0.00 ? 55 LYS A HG2  4  
ATOM 6771  H HG3  . LYS A 1 55 ? -8.466  17.660  11.503  1.00 0.00 ? 55 LYS A HG3  4  
ATOM 6772  H HD2  . LYS A 1 55 ? -6.601  18.633  10.450  1.00 0.00 ? 55 LYS A HD2  4  
ATOM 6773  H HD3  . LYS A 1 55 ? -7.785  18.395  9.163   1.00 0.00 ? 55 LYS A HD3  4  
ATOM 6774  H HE2  . LYS A 1 55 ? -6.806  20.575  8.920   1.00 0.00 ? 55 LYS A HE2  4  
ATOM 6775  H HE3  . LYS A 1 55 ? -8.482  20.759  9.436   1.00 0.00 ? 55 LYS A HE3  4  
ATOM 6776  H HZ1  . LYS A 1 55 ? -6.917  22.230  10.620  1.00 0.00 ? 55 LYS A HZ1  4  
ATOM 6777  H HZ2  . LYS A 1 55 ? -6.147  20.871  11.267  1.00 0.00 ? 55 LYS A HZ2  4  
ATOM 6778  H HZ3  . LYS A 1 55 ? -7.759  21.196  11.661  1.00 0.00 ? 55 LYS A HZ3  4  
ATOM 6779  N N    . SER A 1 56 ? -12.313 16.177  11.211  1.00 0.00 ? 56 SER A N    4  
ATOM 6780  C CA   . SER A 1 56 ? -13.678 15.922  11.657  1.00 0.00 ? 56 SER A CA   4  
ATOM 6781  C C    . SER A 1 56 ? -13.830 16.213  13.148  1.00 0.00 ? 56 SER A C    4  
ATOM 6782  O O    . SER A 1 56 ? -14.685 15.634  13.818  1.00 0.00 ? 56 SER A O    4  
ATOM 6783  C CB   . SER A 1 56 ? -14.069 14.472  11.368  1.00 0.00 ? 56 SER A CB   4  
ATOM 6784  O OG   . SER A 1 56 ? -15.332 14.161  11.929  1.00 0.00 ? 56 SER A OG   4  
ATOM 6785  H H    . SER A 1 56 ? -11.594 15.578  11.502  1.00 0.00 ? 56 SER A H    4  
ATOM 6786  H HA   . SER A 1 56 ? -14.335 16.578  11.106  1.00 0.00 ? 56 SER A HA   4  
ATOM 6787  H HB2  . SER A 1 56 ? -14.117 14.320  10.301  1.00 0.00 ? 56 SER A HB2  4  
ATOM 6788  H HB3  . SER A 1 56 ? -13.327 13.810  11.792  1.00 0.00 ? 56 SER A HB3  4  
ATOM 6789  H HG   . SER A 1 56 ? -15.236 14.014  12.873  1.00 0.00 ? 56 SER A HG   4  
ATOM 6790  N N    . GLN A 1 57 ? -12.995 17.111  13.662  1.00 0.00 ? 57 GLN A N    4  
ATOM 6791  C CA   . GLN A 1 57 ? -13.041 17.473  15.074  1.00 0.00 ? 57 GLN A CA   4  
ATOM 6792  C C    . GLN A 1 57 ? -12.687 18.945  15.272  1.00 0.00 ? 57 GLN A C    4  
ATOM 6793  O O    . GLN A 1 57 ? -11.708 19.274  15.943  1.00 0.00 ? 57 GLN A O    4  
ATOM 6794  C CB   . GLN A 1 57 ? -12.083 16.591  15.877  1.00 0.00 ? 57 GLN A CB   4  
ATOM 6795  C CG   . GLN A 1 57 ? -10.706 16.460  15.249  1.00 0.00 ? 57 GLN A CG   4  
ATOM 6796  C CD   . GLN A 1 57 ? -9.829  15.454  15.969  1.00 0.00 ? 57 GLN A CD   4  
ATOM 6797  O OE1  . GLN A 1 57 ? -9.337  15.715  17.066  1.00 0.00 ? 57 GLN A OE1  4  
ATOM 6798  N NE2  . GLN A 1 57 ? -9.629  14.295  15.352  1.00 0.00 ? 57 GLN A NE2  4  
ATOM 6799  H H    . GLN A 1 57 ? -12.333 17.539  13.080  1.00 0.00 ? 57 GLN A H    4  
ATOM 6800  H HA   . GLN A 1 57 ? -14.048 17.308  15.426  1.00 0.00 ? 57 GLN A HA   4  
ATOM 6801  H HB2  . GLN A 1 57 ? -11.966 17.012  16.865  1.00 0.00 ? 57 GLN A HB2  4  
ATOM 6802  H HB3  . GLN A 1 57 ? -12.511 15.603  15.965  1.00 0.00 ? 57 GLN A HB3  4  
ATOM 6803  H HG2  . GLN A 1 57 ? -10.821 16.144  14.223  1.00 0.00 ? 57 GLN A HG2  4  
ATOM 6804  H HG3  . GLN A 1 57 ? -10.219 17.424  15.275  1.00 0.00 ? 57 GLN A HG3  4  
ATOM 6805  H HE21 . GLN A 1 57 ? -10.052 14.156  14.479  1.00 0.00 ? 57 GLN A HE21 4  
ATOM 6806  H HE22 . GLN A 1 57 ? -9.066  13.626  15.795  1.00 0.00 ? 57 GLN A HE22 4  
ATOM 6807  N N    . GLN A 1 58 ? -13.490 19.826  14.685  1.00 0.00 ? 58 GLN A N    4  
ATOM 6808  C CA   . GLN A 1 58 ? -13.261 21.262  14.799  1.00 0.00 ? 58 GLN A CA   4  
ATOM 6809  C C    . GLN A 1 58 ? -13.940 21.824  16.043  1.00 0.00 ? 58 GLN A C    4  
ATOM 6810  O O    . GLN A 1 58 ? -15.162 21.761  16.176  1.00 0.00 ? 58 GLN A O    4  
ATOM 6811  C CB   . GLN A 1 58 ? -13.777 21.982  13.552  1.00 0.00 ? 58 GLN A CB   4  
ATOM 6812  C CG   . GLN A 1 58 ? -15.215 21.635  13.200  1.00 0.00 ? 58 GLN A CG   4  
ATOM 6813  C CD   . GLN A 1 58 ? -15.336 20.920  11.869  1.00 0.00 ? 58 GLN A CD   4  
ATOM 6814  O OE1  . GLN A 1 58 ? -14.847 21.400  10.846  1.00 0.00 ? 58 GLN A OE1  4  
ATOM 6815  N NE2  . GLN A 1 58 ? -15.989 19.764  11.876  1.00 0.00 ? 58 GLN A NE2  4  
ATOM 6816  H H    . GLN A 1 58 ? -14.254 19.504  14.163  1.00 0.00 ? 58 GLN A H    4  
ATOM 6817  H HA   . GLN A 1 58 ? -12.196 21.422  14.881  1.00 0.00 ? 58 GLN A HA   4  
ATOM 6818  H HB2  . GLN A 1 58 ? -13.716 23.048  13.715  1.00 0.00 ? 58 GLN A HB2  4  
ATOM 6819  H HB3  . GLN A 1 58 ? -13.150 21.719  12.713  1.00 0.00 ? 58 GLN A HB3  4  
ATOM 6820  H HG2  . GLN A 1 58 ? -15.617 20.996  13.972  1.00 0.00 ? 58 GLN A HG2  4  
ATOM 6821  H HG3  . GLN A 1 58 ? -15.791 22.549  13.155  1.00 0.00 ? 58 GLN A HG3  4  
ATOM 6822  H HE21 . GLN A 1 58 ? -16.352 19.442  12.727  1.00 0.00 ? 58 GLN A HE21 4  
ATOM 6823  H HE22 . GLN A 1 58 ? -16.082 19.280  11.029  1.00 0.00 ? 58 GLN A HE22 4  
ATOM 6824  N N    . SER A 1 59 ? -13.141 22.374  16.951  1.00 0.00 ? 59 SER A N    4  
ATOM 6825  C CA   . SER A 1 59 ? -13.666 22.947  18.184  1.00 0.00 ? 59 SER A CA   4  
ATOM 6826  C C    . SER A 1 59 ? -13.795 24.463  18.068  1.00 0.00 ? 59 SER A C    4  
ATOM 6827  O O    . SER A 1 59 ? -13.559 25.191  19.032  1.00 0.00 ? 59 SER A O    4  
ATOM 6828  C CB   . SER A 1 59 ? -12.761 22.589  19.365  1.00 0.00 ? 59 SER A CB   4  
ATOM 6829  O OG   . SER A 1 59 ? -13.453 22.713  20.595  1.00 0.00 ? 59 SER A OG   4  
ATOM 6830  H H    . SER A 1 59 ? -12.175 22.394  16.788  1.00 0.00 ? 59 SER A H    4  
ATOM 6831  H HA   . SER A 1 59 ? -14.646 22.527  18.354  1.00 0.00 ? 59 SER A HA   4  
ATOM 6832  H HB2  . SER A 1 59 ? -12.422 21.569  19.259  1.00 0.00 ? 59 SER A HB2  4  
ATOM 6833  H HB3  . SER A 1 59 ? -11.909 23.252  19.376  1.00 0.00 ? 59 SER A HB3  4  
ATOM 6834  H HG   . SER A 1 59 ? -13.951 23.534  20.601  1.00 0.00 ? 59 SER A HG   4  
ATOM 6835  N N    . SER A 1 60 ? -14.170 24.930  16.882  1.00 0.00 ? 60 SER A N    4  
ATOM 6836  C CA   . SER A 1 60 ? -14.330 26.360  16.640  1.00 0.00 ? 60 SER A CA   4  
ATOM 6837  C C    . SER A 1 60 ? -15.804 26.751  16.641  1.00 0.00 ? 60 SER A C    4  
ATOM 6838  O O    . SER A 1 60 ? -16.617 26.150  15.938  1.00 0.00 ? 60 SER A O    4  
ATOM 6839  C CB   . SER A 1 60 ? -13.689 26.747  15.306  1.00 0.00 ? 60 SER A CB   4  
ATOM 6840  O OG   . SER A 1 60 ? -13.367 28.127  15.276  1.00 0.00 ? 60 SER A OG   4  
ATOM 6841  H H    . SER A 1 60 ? -14.343 24.300  16.152  1.00 0.00 ? 60 SER A H    4  
ATOM 6842  H HA   . SER A 1 60 ? -13.828 26.888  17.436  1.00 0.00 ? 60 SER A HA   4  
ATOM 6843  H HB2  . SER A 1 60 ? -12.783 26.176  15.164  1.00 0.00 ? 60 SER A HB2  4  
ATOM 6844  H HB3  . SER A 1 60 ? -14.378 26.533  14.502  1.00 0.00 ? 60 SER A HB3  4  
ATOM 6845  H HG   . SER A 1 60 ? -12.514 28.248  14.851  1.00 0.00 ? 60 SER A HG   4  
ATOM 6846  N N    . TYR A 1 61 ? -16.142 27.762  17.435  1.00 0.00 ? 61 TYR A N    4  
ATOM 6847  C CA   . TYR A 1 61 ? -17.519 28.234  17.527  1.00 0.00 ? 61 TYR A CA   4  
ATOM 6848  C C    . TYR A 1 61 ? -17.598 29.736  17.268  1.00 0.00 ? 61 TYR A C    4  
ATOM 6849  O O    . TYR A 1 61 ? -16.999 30.503  18.051  1.00 0.00 ? 61 TYR A O    4  
ATOM 6850  C CB   . TYR A 1 61 ? -18.099 27.913  18.905  1.00 0.00 ? 61 TYR A CB   4  
ATOM 6851  C CG   . TYR A 1 61 ? -18.349 26.438  19.129  1.00 0.00 ? 61 TYR A CG   4  
ATOM 6852  C CD1  . TYR A 1 61 ? -19.452 25.808  18.564  1.00 0.00 ? 61 TYR A CD1  4  
ATOM 6853  C CD2  . TYR A 1 61 ? -17.484 25.677  19.904  1.00 0.00 ? 61 TYR A CD2  4  
ATOM 6854  C CE1  . TYR A 1 61 ? -19.684 24.461  18.766  1.00 0.00 ? 61 TYR A CE1  4  
ATOM 6855  C CE2  . TYR A 1 61 ? -17.709 24.329  20.110  1.00 0.00 ? 61 TYR A CE2  4  
ATOM 6856  C CZ   . TYR A 1 61 ? -18.810 23.726  19.539  1.00 0.00 ? 61 TYR A CZ   4  
ATOM 6857  O OH   . TYR A 1 61 ? -19.038 22.384  19.742  1.00 0.00 ? 61 TYR A OH   4  
ATOM 6858  O OXT  . TYR A 1 61 ? -18.257 30.131  16.283  1.00 0.00 ? 61 TYR A OXT  4  
ATOM 6859  H H    . TYR A 1 61 ? -15.449 28.201  17.971  1.00 0.00 ? 61 TYR A H    4  
ATOM 6860  H HA   . TYR A 1 61 ? -18.097 27.720  16.774  1.00 0.00 ? 61 TYR A HA   4  
ATOM 6861  H HB2  . TYR A 1 61 ? -17.411 28.251  19.666  1.00 0.00 ? 61 TYR A HB2  4  
ATOM 6862  H HB3  . TYR A 1 61 ? -19.039 28.432  19.022  1.00 0.00 ? 61 TYR A HB3  4  
ATOM 6863  H HD1  . TYR A 1 61 ? -20.134 26.386  17.959  1.00 0.00 ? 61 TYR A HD1  4  
ATOM 6864  H HD2  . TYR A 1 61 ? -16.622 26.152  20.350  1.00 0.00 ? 61 TYR A HD2  4  
ATOM 6865  H HE1  . TYR A 1 61 ? -20.546 23.989  18.319  1.00 0.00 ? 61 TYR A HE1  4  
ATOM 6866  H HE2  . TYR A 1 61 ? -17.024 23.754  20.715  1.00 0.00 ? 61 TYR A HE2  4  
ATOM 6867  H HH   . TYR A 1 61 ? -19.939 22.255  20.047  1.00 0.00 ? 61 TYR A HH   4  
ATOM 6868  N N    . MET B 1 1  ? -1.279  12.459  3.857   1.00 0.00 ? 1  MET B N    4  
ATOM 6869  C CA   . MET B 1 1  ? -0.835  11.881  5.153   1.00 0.00 ? 1  MET B CA   4  
ATOM 6870  C C    . MET B 1 1  ? -2.026  11.555  6.047   1.00 0.00 ? 1  MET B C    4  
ATOM 6871  O O    . MET B 1 1  ? -2.465  12.388  6.841   1.00 0.00 ? 1  MET B O    4  
ATOM 6872  C CB   . MET B 1 1  ? 0.087   12.886  5.845   1.00 0.00 ? 1  MET B CB   4  
ATOM 6873  C CG   . MET B 1 1  ? 0.977   12.263  6.908   1.00 0.00 ? 1  MET B CG   4  
ATOM 6874  S SD   . MET B 1 1  ? 2.622   13.001  6.956   1.00 0.00 ? 1  MET B SD   4  
ATOM 6875  C CE   . MET B 1 1  ? 2.210   14.744  6.958   1.00 0.00 ? 1  MET B CE   4  
ATOM 6876  H H1   . MET B 1 1  ? -0.442  12.852  3.382   1.00 0.00 ? 1  MET B H1   4  
ATOM 6877  H H2   . MET B 1 1  ? -1.976  13.203  4.065   1.00 0.00 ? 1  MET B H2   4  
ATOM 6878  H H3   . MET B 1 1  ? -1.702  11.693  3.297   1.00 0.00 ? 1  MET B H3   4  
ATOM 6879  H HA   . MET B 1 1  ? -0.285  10.973  4.954   1.00 0.00 ? 1  MET B HA   4  
ATOM 6880  H HB2  . MET B 1 1  ? 0.719   13.349  5.102   1.00 0.00 ? 1  MET B HB2  4  
ATOM 6881  H HB3  . MET B 1 1  ? -0.518  13.648  6.315   1.00 0.00 ? 1  MET B HB3  4  
ATOM 6882  H HG2  . MET B 1 1  ? 0.511   12.396  7.873   1.00 0.00 ? 1  MET B HG2  4  
ATOM 6883  H HG3  . MET B 1 1  ? 1.077   11.208  6.700   1.00 0.00 ? 1  MET B HG3  4  
ATOM 6884  H HE1  . MET B 1 1  ? 1.473   14.941  6.193   1.00 0.00 ? 1  MET B HE1  4  
ATOM 6885  H HE2  . MET B 1 1  ? 3.099   15.324  6.759   1.00 0.00 ? 1  MET B HE2  4  
ATOM 6886  H HE3  . MET B 1 1  ? 1.809   15.018  7.923   1.00 0.00 ? 1  MET B HE3  4  
ATOM 6887  N N    . LEU B 1 2  ? -2.542  10.338  5.916   1.00 0.00 ? 2  LEU B N    4  
ATOM 6888  C CA   . LEU B 1 2  ? -3.681  9.900   6.716   1.00 0.00 ? 2  LEU B CA   4  
ATOM 6889  C C    . LEU B 1 2  ? -3.335  8.647   7.515   1.00 0.00 ? 2  LEU B C    4  
ATOM 6890  O O    . LEU B 1 2  ? -3.056  7.595   6.939   1.00 0.00 ? 2  LEU B O    4  
ATOM 6891  C CB   . LEU B 1 2  ? -4.887  9.626   5.815   1.00 0.00 ? 2  LEU B CB   4  
ATOM 6892  C CG   . LEU B 1 2  ? -5.411  10.841  5.048   1.00 0.00 ? 2  LEU B CG   4  
ATOM 6893  C CD1  . LEU B 1 2  ? -4.445  11.230  3.940   1.00 0.00 ? 2  LEU B CD1  4  
ATOM 6894  C CD2  . LEU B 1 2  ? -6.792  10.554  4.477   1.00 0.00 ? 2  LEU B CD2  4  
ATOM 6895  H H    . LEU B 1 2  ? -2.143  9.716   5.270   1.00 0.00 ? 2  LEU B H    4  
ATOM 6896  H HA   . LEU B 1 2  ? -3.930  10.694  7.404   1.00 0.00 ? 2  LEU B HA   4  
ATOM 6897  H HB2  . LEU B 1 2  ? -4.609  8.866   5.099   1.00 0.00 ? 2  LEU B HB2  4  
ATOM 6898  H HB3  . LEU B 1 2  ? -5.688  9.243   6.429   1.00 0.00 ? 2  LEU B HB3  4  
ATOM 6899  H HG   . LEU B 1 2  ? -5.495  11.678  5.726   1.00 0.00 ? 2  LEU B HG   4  
ATOM 6900  H HD11 . LEU B 1 2  ? -3.881  10.361  3.633   1.00 0.00 ? 2  LEU B HD11 4  
ATOM 6901  H HD12 . LEU B 1 2  ? -3.768  11.989  4.303   1.00 0.00 ? 2  LEU B HD12 4  
ATOM 6902  H HD13 . LEU B 1 2  ? -5.000  11.615  3.097   1.00 0.00 ? 2  LEU B HD13 4  
ATOM 6903  H HD21 . LEU B 1 2  ? -7.537  10.704  5.245   1.00 0.00 ? 2  LEU B HD21 4  
ATOM 6904  H HD22 . LEU B 1 2  ? -6.833  9.533   4.131   1.00 0.00 ? 2  LEU B HD22 4  
ATOM 6905  H HD23 . LEU B 1 2  ? -6.986  11.223  3.652   1.00 0.00 ? 2  LEU B HD23 4  
ATOM 6906  N N    . ILE B 1 3  ? -3.365  8.755   8.841   1.00 0.00 ? 3  ILE B N    4  
ATOM 6907  C CA   . ILE B 1 3  ? -3.063  7.612   9.695   1.00 0.00 ? 3  ILE B CA   4  
ATOM 6908  C C    . ILE B 1 3  ? -4.350  6.944   10.168  1.00 0.00 ? 3  ILE B C    4  
ATOM 6909  O O    . ILE B 1 3  ? -5.046  7.451   11.048  1.00 0.00 ? 3  ILE B O    4  
ATOM 6910  C CB   . ILE B 1 3  ? -2.199  8.022   10.909  1.00 0.00 ? 3  ILE B CB   4  
ATOM 6911  C CG1  . ILE B 1 3  ? -1.714  6.781   11.662  1.00 0.00 ? 3  ILE B CG1  4  
ATOM 6912  C CG2  . ILE B 1 3  ? -2.969  8.947   11.840  1.00 0.00 ? 3  ILE B CG2  4  
ATOM 6913  C CD1  . ILE B 1 3  ? -0.324  6.937   12.247  1.00 0.00 ? 3  ILE B CD1  4  
ATOM 6914  H H    . ILE B 1 3  ? -3.604  9.613   9.250   1.00 0.00 ? 3  ILE B H    4  
ATOM 6915  H HA   . ILE B 1 3  ? -2.505  6.901   9.109   1.00 0.00 ? 3  ILE B HA   4  
ATOM 6916  H HB   . ILE B 1 3  ? -1.341  8.563   10.540  1.00 0.00 ? 3  ILE B HB   4  
ATOM 6917  H HG12 . ILE B 1 3  ? -2.394  6.572   12.475  1.00 0.00 ? 3  ILE B HG12 4  
ATOM 6918  H HG13 . ILE B 1 3  ? -1.699  5.940   10.985  1.00 0.00 ? 3  ILE B HG13 4  
ATOM 6919  H HG21 . ILE B 1 3  ? -2.271  9.522   12.432  1.00 0.00 ? 3  ILE B HG21 4  
ATOM 6920  H HG22 . ILE B 1 3  ? -3.597  8.360   12.493  1.00 0.00 ? 3  ILE B HG22 4  
ATOM 6921  H HG23 . ILE B 1 3  ? -3.582  9.617   11.256  1.00 0.00 ? 3  ILE B HG23 4  
ATOM 6922  H HD11 . ILE B 1 3  ? -0.221  7.925   12.670  1.00 0.00 ? 3  ILE B HD11 4  
ATOM 6923  H HD12 . ILE B 1 3  ? 0.414   6.800   11.468  1.00 0.00 ? 3  ILE B HD12 4  
ATOM 6924  H HD13 . ILE B 1 3  ? -0.172  6.197   13.019  1.00 0.00 ? 3  ILE B HD13 4  
ATOM 6925  N N    . LEU B 1 4  ? -4.654  5.797   9.573   1.00 0.00 ? 4  LEU B N    4  
ATOM 6926  C CA   . LEU B 1 4  ? -5.849  5.040   9.921   1.00 0.00 ? 4  LEU B CA   4  
ATOM 6927  C C    . LEU B 1 4  ? -5.503  3.604   10.299  1.00 0.00 ? 4  LEU B C    4  
ATOM 6928  O O    . LEU B 1 4  ? -4.926  2.871   9.495   1.00 0.00 ? 4  LEU B O    4  
ATOM 6929  C CB   . LEU B 1 4  ? -6.835  5.049   8.752   1.00 0.00 ? 4  LEU B CB   4  
ATOM 6930  C CG   . LEU B 1 4  ? -7.091  6.427   8.135   1.00 0.00 ? 4  LEU B CG   4  
ATOM 6931  C CD1  . LEU B 1 4  ? -7.008  6.358   6.617   1.00 0.00 ? 4  LEU B CD1  4  
ATOM 6932  C CD2  . LEU B 1 4  ? -8.444  6.970   8.577   1.00 0.00 ? 4  LEU B CD2  4  
ATOM 6933  H H    . LEU B 1 4  ? -4.046  5.441   8.891   1.00 0.00 ? 4  LEU B H    4  
ATOM 6934  H HA   . LEU B 1 4  ? -6.310  5.522   10.770  1.00 0.00 ? 4  LEU B HA   4  
ATOM 6935  H HB2  . LEU B 1 4  ? -6.451  4.395   7.982   1.00 0.00 ? 4  LEU B HB2  4  
ATOM 6936  H HB3  . LEU B 1 4  ? -7.777  4.653   9.100   1.00 0.00 ? 4  LEU B HB3  4  
ATOM 6937  H HG   . LEU B 1 4  ? -6.328  7.112   8.477   1.00 0.00 ? 4  LEU B HG   4  
ATOM 6938  H HD11 . LEU B 1 4  ? -7.964  6.051   6.218   1.00 0.00 ? 4  LEU B HD11 4  
ATOM 6939  H HD12 . LEU B 1 4  ? -6.251  5.644   6.329   1.00 0.00 ? 4  LEU B HD12 4  
ATOM 6940  H HD13 . LEU B 1 4  ? -6.752  7.332   6.226   1.00 0.00 ? 4  LEU B HD13 4  
ATOM 6941  H HD21 . LEU B 1 4  ? -9.088  7.077   7.717   1.00 0.00 ? 4  LEU B HD21 4  
ATOM 6942  H HD22 . LEU B 1 4  ? -8.309  7.933   9.047   1.00 0.00 ? 4  LEU B HD22 4  
ATOM 6943  H HD23 . LEU B 1 4  ? -8.895  6.286   9.281   1.00 0.00 ? 4  LEU B HD23 4  
ATOM 6944  N N    . THR B 1 5  ? -5.860  3.192   11.512  1.00 0.00 ? 5  THR B N    4  
ATOM 6945  C CA   . THR B 1 5  ? -5.581  1.828   11.949  1.00 0.00 ? 5  THR B CA   4  
ATOM 6946  C C    . THR B 1 5  ? -6.154  0.832   10.951  1.00 0.00 ? 5  THR B C    4  
ATOM 6947  O O    . THR B 1 5  ? -7.261  1.017   10.445  1.00 0.00 ? 5  THR B O    4  
ATOM 6948  C CB   . THR B 1 5  ? -6.162  1.570   13.338  1.00 0.00 ? 5  THR B CB   4  
ATOM 6949  O OG1  . THR B 1 5  ? -6.488  2.787   13.985  1.00 0.00 ? 5  THR B OG1  4  
ATOM 6950  C CG2  . THR B 1 5  ? -5.217  0.807   14.240  1.00 0.00 ? 5  THR B CG2  4  
ATOM 6951  H H    . THR B 1 5  ? -6.318  3.809   12.120  1.00 0.00 ? 5  THR B H    4  
ATOM 6952  H HA   . THR B 1 5  ? -4.512  1.702   11.985  1.00 0.00 ? 5  THR B HA   4  
ATOM 6953  H HB   . THR B 1 5  ? -7.066  0.984   13.237  1.00 0.00 ? 5  THR B HB   4  
ATOM 6954  H HG1  . THR B 1 5  ? -5.683  3.280   14.163  1.00 0.00 ? 5  THR B HG1  4  
ATOM 6955  H HG21 . THR B 1 5  ? -4.566  0.189   13.637  1.00 0.00 ? 5  THR B HG21 4  
ATOM 6956  H HG22 . THR B 1 5  ? -5.786  0.182   14.912  1.00 0.00 ? 5  THR B HG22 4  
ATOM 6957  H HG23 . THR B 1 5  ? -4.623  1.504   14.811  1.00 0.00 ? 5  THR B HG23 4  
ATOM 6958  N N    . ARG B 1 6  ? -5.397  -0.217  10.662  1.00 0.00 ? 6  ARG B N    4  
ATOM 6959  C CA   . ARG B 1 6  ? -5.847  -1.222  9.713   1.00 0.00 ? 6  ARG B CA   4  
ATOM 6960  C C    . ARG B 1 6  ? -5.309  -2.605  10.056  1.00 0.00 ? 6  ARG B C    4  
ATOM 6961  O O    . ARG B 1 6  ? -4.180  -2.753  10.532  1.00 0.00 ? 6  ARG B O    4  
ATOM 6962  C CB   . ARG B 1 6  ? -5.424  -0.837  8.295   1.00 0.00 ? 6  ARG B CB   4  
ATOM 6963  C CG   . ARG B 1 6  ? -6.300  0.234   7.667   1.00 0.00 ? 6  ARG B CG   4  
ATOM 6964  C CD   . ARG B 1 6  ? -5.698  0.759   6.373   1.00 0.00 ? 6  ARG B CD   4  
ATOM 6965  N NE   . ARG B 1 6  ? -6.263  2.050   5.989   1.00 0.00 ? 6  ARG B NE   4  
ATOM 6966  C CZ   . ARG B 1 6  ? -6.010  2.656   4.831   1.00 0.00 ? 6  ARG B CZ   4  
ATOM 6967  N NH1  . ARG B 1 6  ? -5.205  2.091   3.940   1.00 0.00 ? 6  ARG B NH1  4  
ATOM 6968  N NH2  . ARG B 1 6  ? -6.566  3.829   4.563   1.00 0.00 ? 6  ARG B NH2  4  
ATOM 6969  H H    . ARG B 1 6  ? -4.521  -0.314  11.090  1.00 0.00 ? 6  ARG B H    4  
ATOM 6970  H HA   . ARG B 1 6  ? -6.924  -1.254  9.757   1.00 0.00 ? 6  ARG B HA   4  
ATOM 6971  H HB2  . ARG B 1 6  ? -4.411  -0.470  8.322   1.00 0.00 ? 6  ARG B HB2  4  
ATOM 6972  H HB3  . ARG B 1 6  ? -5.463  -1.716  7.669   1.00 0.00 ? 6  ARG B HB3  4  
ATOM 6973  H HG2  . ARG B 1 6  ? -7.272  -0.187  7.454   1.00 0.00 ? 6  ARG B HG2  4  
ATOM 6974  H HG3  . ARG B 1 6  ? -6.405  1.054   8.363   1.00 0.00 ? 6  ARG B HG3  4  
ATOM 6975  H HD2  . ARG B 1 6  ? -4.632  0.869   6.507   1.00 0.00 ? 6  ARG B HD2  4  
ATOM 6976  H HD3  . ARG B 1 6  ? -5.889  0.044   5.586   1.00 0.00 ? 6  ARG B HD3  4  
ATOM 6977  H HE   . ARG B 1 6  ? -6.863  2.489   6.628   1.00 0.00 ? 6  ARG B HE   4  
ATOM 6978  H HH11 . ARG B 1 6  ? -4.784  1.206   4.135   1.00 0.00 ? 6  ARG B HH11 4  
ATOM 6979  H HH12 . ARG B 1 6  ? -5.018  2.553   3.073   1.00 0.00 ? 6  ARG B HH12 4  
ATOM 6980  H HH21 . ARG B 1 6  ? -7.175  4.258   5.229   1.00 0.00 ? 6  ARG B HH21 4  
ATOM 6981  H HH22 . ARG B 1 6  ? -6.375  4.286   3.693   1.00 0.00 ? 6  ARG B HH22 4  
ATOM 6982  N N    . ARG B 1 7  ? -6.138  -3.609  9.796   1.00 0.00 ? 7  ARG B N    4  
ATOM 6983  C CA   . ARG B 1 7  ? -5.796  -5.004  10.047  1.00 0.00 ? 7  ARG B CA   4  
ATOM 6984  C C    . ARG B 1 7  ? -7.008  -5.886  9.756   1.00 0.00 ? 7  ARG B C    4  
ATOM 6985  O O    . ARG B 1 7  ? -7.082  -6.526  8.707   1.00 0.00 ? 7  ARG B O    4  
ATOM 6986  C CB   . ARG B 1 7  ? -5.317  -5.203  11.489  1.00 0.00 ? 7  ARG B CB   4  
ATOM 6987  C CG   . ARG B 1 7  ? -4.601  -6.528  11.712  1.00 0.00 ? 7  ARG B CG   4  
ATOM 6988  C CD   . ARG B 1 7  ? -5.327  -7.403  12.724  1.00 0.00 ? 7  ARG B CD   4  
ATOM 6989  N NE   . ARG B 1 7  ? -5.732  -8.682  12.147  1.00 0.00 ? 7  ARG B NE   4  
ATOM 6990  C CZ   . ARG B 1 7  ? -6.104  -9.737  12.869  1.00 0.00 ? 7  ARG B CZ   4  
ATOM 6991  N NH1  . ARG B 1 7  ? -6.124  -9.668  14.195  1.00 0.00 ? 7  ARG B NH1  4  
ATOM 6992  N NH2  . ARG B 1 7  ? -6.457  -10.863 12.264  1.00 0.00 ? 7  ARG B NH2  4  
ATOM 6993  H H    . ARG B 1 7  ? -7.016  -3.403  9.413   1.00 0.00 ? 7  ARG B H    4  
ATOM 6994  H HA   . ARG B 1 7  ? -5.000  -5.275  9.369   1.00 0.00 ? 7  ARG B HA   4  
ATOM 6995  H HB2  . ARG B 1 7  ? -4.634  -4.405  11.741  1.00 0.00 ? 7  ARG B HB2  4  
ATOM 6996  H HB3  . ARG B 1 7  ? -6.166  -5.159  12.152  1.00 0.00 ? 7  ARG B HB3  4  
ATOM 6997  H HG2  . ARG B 1 7  ? -4.543  -7.057  10.772  1.00 0.00 ? 7  ARG B HG2  4  
ATOM 6998  H HG3  . ARG B 1 7  ? -3.603  -6.328  12.075  1.00 0.00 ? 7  ARG B HG3  4  
ATOM 6999  H HD2  . ARG B 1 7  ? -4.668  -7.588  13.558  1.00 0.00 ? 7  ARG B HD2  4  
ATOM 7000  H HD3  . ARG B 1 7  ? -6.206  -6.880  13.070  1.00 0.00 ? 7  ARG B HD3  4  
ATOM 7001  H HE   . ARG B 1 7  ? -5.725  -8.761  11.170  1.00 0.00 ? 7  ARG B HE   4  
ATOM 7002  H HH11 . ARG B 1 7  ? -5.859  -8.823  14.657  1.00 0.00 ? 7  ARG B HH11 4  
ATOM 7003  H HH12 . ARG B 1 7  ? -6.406  -10.464 14.731  1.00 0.00 ? 7  ARG B HH12 4  
ATOM 7004  H HH21 . ARG B 1 7  ? -6.443  -10.920 11.266  1.00 0.00 ? 7  ARG B HH21 4  
ATOM 7005  H HH22 . ARG B 1 7  ? -6.737  -11.655 12.807  1.00 0.00 ? 7  ARG B HH22 4  
ATOM 7006  N N    . VAL B 1 8  ? -7.961  -5.907  10.683  1.00 0.00 ? 8  VAL B N    4  
ATOM 7007  C CA   . VAL B 1 8  ? -9.174  -6.700  10.513  1.00 0.00 ? 8  VAL B CA   4  
ATOM 7008  C C    . VAL B 1 8  ? -10.234 -5.928  9.726   1.00 0.00 ? 8  VAL B C    4  
ATOM 7009  O O    . VAL B 1 8  ? -11.354 -6.406  9.547   1.00 0.00 ? 8  VAL B O    4  
ATOM 7010  C CB   . VAL B 1 8  ? -9.776  -7.117  11.871  1.00 0.00 ? 8  VAL B CB   4  
ATOM 7011  C CG1  . VAL B 1 8  ? -10.762 -8.260  11.688  1.00 0.00 ? 8  VAL B CG1  4  
ATOM 7012  C CG2  . VAL B 1 8  ? -8.680  -7.502  12.853  1.00 0.00 ? 8  VAL B CG2  4  
ATOM 7013  H H    . VAL B 1 8  ? -7.849  -5.377  11.498  1.00 0.00 ? 8  VAL B H    4  
ATOM 7014  H HA   . VAL B 1 8  ? -8.914  -7.596  9.968   1.00 0.00 ? 8  VAL B HA   4  
ATOM 7015  H HB   . VAL B 1 8  ? -10.312 -6.272  12.277  1.00 0.00 ? 8  VAL B HB   4  
ATOM 7016  H HG11 . VAL B 1 8  ? -10.748 -8.892  12.564  1.00 0.00 ? 8  VAL B HG11 4  
ATOM 7017  H HG12 . VAL B 1 8  ? -10.485 -8.840  10.821  1.00 0.00 ? 8  VAL B HG12 4  
ATOM 7018  H HG13 . VAL B 1 8  ? -11.756 -7.859  11.550  1.00 0.00 ? 8  VAL B HG13 4  
ATOM 7019  H HG21 . VAL B 1 8  ? -7.983  -8.169  12.371  1.00 0.00 ? 8  VAL B HG21 4  
ATOM 7020  H HG22 . VAL B 1 8  ? -9.119  -7.995  13.707  1.00 0.00 ? 8  VAL B HG22 4  
ATOM 7021  H HG23 . VAL B 1 8  ? -8.161  -6.612  13.179  1.00 0.00 ? 8  VAL B HG23 4  
ATOM 7022  N N    . GLY B 1 9  ? -9.878  -4.729  9.264   1.00 0.00 ? 9  GLY B N    4  
ATOM 7023  C CA   . GLY B 1 9  ? -10.815 -3.915  8.512   1.00 0.00 ? 9  GLY B CA   4  
ATOM 7024  C C    . GLY B 1 9  ? -10.850 -4.265  7.037   1.00 0.00 ? 9  GLY B C    4  
ATOM 7025  O O    . GLY B 1 9  ? -10.812 -5.439  6.668   1.00 0.00 ? 9  GLY B O    4  
ATOM 7026  H H    . GLY B 1 9  ? -8.975  -4.393  9.440   1.00 0.00 ? 9  GLY B H    4  
ATOM 7027  H HA2  . GLY B 1 9  ? -11.803 -4.051  8.925   1.00 0.00 ? 9  GLY B HA2  4  
ATOM 7028  H HA3  . GLY B 1 9  ? -10.534 -2.877  8.617   1.00 0.00 ? 9  GLY B HA3  4  
ATOM 7029  N N    . GLU B 1 10 ? -10.931 -3.240  6.193   1.00 0.00 ? 10 GLU B N    4  
ATOM 7030  C CA   . GLU B 1 10 ? -10.981 -3.439  4.748   1.00 0.00 ? 10 GLU B CA   4  
ATOM 7031  C C    . GLU B 1 10 ? -9.676  -3.004  4.086   1.00 0.00 ? 10 GLU B C    4  
ATOM 7032  O O    . GLU B 1 10 ? -8.717  -2.633  4.762   1.00 0.00 ? 10 GLU B O    4  
ATOM 7033  C CB   . GLU B 1 10 ? -12.154 -2.660  4.150   1.00 0.00 ? 10 GLU B CB   4  
ATOM 7034  C CG   . GLU B 1 10 ? -13.464 -3.431  4.161   1.00 0.00 ? 10 GLU B CG   4  
ATOM 7035  C CD   . GLU B 1 10 ? -13.914 -3.795  5.563   1.00 0.00 ? 10 GLU B CD   4  
ATOM 7036  O OE1  . GLU B 1 10 ? -13.856 -2.919  6.451   1.00 0.00 ? 10 GLU B OE1  4  
ATOM 7037  O OE2  . GLU B 1 10 ? -14.323 -4.956  5.772   1.00 0.00 ? 10 GLU B OE2  4  
ATOM 7038  H H    . GLU B 1 10 ? -10.963 -2.329  6.550   1.00 0.00 ? 10 GLU B H    4  
ATOM 7039  H HA   . GLU B 1 10 ? -11.130 -4.492  4.564   1.00 0.00 ? 10 GLU B HA   4  
ATOM 7040  H HB2  . GLU B 1 10 ? -12.292 -1.750  4.716   1.00 0.00 ? 10 GLU B HB2  4  
ATOM 7041  H HB3  . GLU B 1 10 ? -11.920 -2.405  3.128   1.00 0.00 ? 10 GLU B HB3  4  
ATOM 7042  H HG2  . GLU B 1 10 ? -14.229 -2.823  3.701   1.00 0.00 ? 10 GLU B HG2  4  
ATOM 7043  H HG3  . GLU B 1 10 ? -13.336 -4.340  3.592   1.00 0.00 ? 10 GLU B HG3  4  
ATOM 7044  N N    . THR B 1 11 ? -9.649  -3.057  2.757   1.00 0.00 ? 11 THR B N    4  
ATOM 7045  C CA   . THR B 1 11 ? -8.466  -2.673  1.995   1.00 0.00 ? 11 THR B CA   4  
ATOM 7046  C C    . THR B 1 11 ? -8.630  -1.282  1.391   1.00 0.00 ? 11 THR B C    4  
ATOM 7047  O O    . THR B 1 11 ? -9.736  -0.745  1.336   1.00 0.00 ? 11 THR B O    4  
ATOM 7048  C CB   . THR B 1 11 ? -8.206  -3.692  0.884   1.00 0.00 ? 11 THR B CB   4  
ATOM 7049  O OG1  . THR B 1 11 ? -9.166  -3.561  -0.150  1.00 0.00 ? 11 THR B OG1  4  
ATOM 7050  C CG2  . THR B 1 11 ? -8.245  -5.125  1.366   1.00 0.00 ? 11 THR B CG2  4  
ATOM 7051  H H    . THR B 1 11 ? -10.446 -3.364  2.275   1.00 0.00 ? 11 THR B H    4  
ATOM 7052  H HA   . THR B 1 11 ? -7.622  -2.664  2.668   1.00 0.00 ? 11 THR B HA   4  
ATOM 7053  H HB   . THR B 1 11 ? -7.229  -3.510  0.462   1.00 0.00 ? 11 THR B HB   4  
ATOM 7054  H HG1  . THR B 1 11 ? -10.043 -3.491  0.235   1.00 0.00 ? 11 THR B HG1  4  
ATOM 7055  H HG21 . THR B 1 11 ? -7.642  -5.740  0.715   1.00 0.00 ? 11 THR B HG21 4  
ATOM 7056  H HG22 . THR B 1 11 ? -9.265  -5.481  1.355   1.00 0.00 ? 11 THR B HG22 4  
ATOM 7057  H HG23 . THR B 1 11 ? -7.857  -5.177  2.372   1.00 0.00 ? 11 THR B HG23 4  
ATOM 7058  N N    . LEU B 1 12 ? -7.522  -0.706  0.933   1.00 0.00 ? 12 LEU B N    4  
ATOM 7059  C CA   . LEU B 1 12 ? -7.547  0.622   0.325   1.00 0.00 ? 12 LEU B CA   4  
ATOM 7060  C C    . LEU B 1 12 ? -7.270  0.530   -1.173  1.00 0.00 ? 12 LEU B C    4  
ATOM 7061  O O    . LEU B 1 12 ? -6.630  -0.416  -1.633  1.00 0.00 ? 12 LEU B O    4  
ATOM 7062  C CB   . LEU B 1 12 ? -6.532  1.550   1.012   1.00 0.00 ? 12 LEU B CB   4  
ATOM 7063  C CG   . LEU B 1 12 ? -5.107  1.528   0.445   1.00 0.00 ? 12 LEU B CG   4  
ATOM 7064  C CD1  . LEU B 1 12 ? -4.510  2.927   0.448   1.00 0.00 ? 12 LEU B CD1  4  
ATOM 7065  C CD2  . LEU B 1 12 ? -4.231  0.575   1.241   1.00 0.00 ? 12 LEU B CD2  4  
ATOM 7066  H H    . LEU B 1 12 ? -6.670  -1.185  0.999   1.00 0.00 ? 12 LEU B H    4  
ATOM 7067  H HA   . LEU B 1 12 ? -8.539  1.027   0.466   1.00 0.00 ? 12 LEU B HA   4  
ATOM 7068  H HB2  . LEU B 1 12 ? -6.905  2.562   0.945   1.00 0.00 ? 12 LEU B HB2  4  
ATOM 7069  H HB3  . LEU B 1 12 ? -6.482  1.276   2.056   1.00 0.00 ? 12 LEU B HB3  4  
ATOM 7070  H HG   . LEU B 1 12 ? -5.134  1.182   -0.576  1.00 0.00 ? 12 LEU B HG   4  
ATOM 7071  H HD11 . LEU B 1 12 ? -3.913  3.062   1.337   1.00 0.00 ? 12 LEU B HD11 4  
ATOM 7072  H HD12 . LEU B 1 12 ? -5.305  3.657   0.433   1.00 0.00 ? 12 LEU B HD12 4  
ATOM 7073  H HD13 . LEU B 1 12 ? -3.888  3.054   -0.426  1.00 0.00 ? 12 LEU B HD13 4  
ATOM 7074  H HD21 . LEU B 1 12 ? -3.322  0.381   0.691   1.00 0.00 ? 12 LEU B HD21 4  
ATOM 7075  H HD22 . LEU B 1 12 ? -4.761  -0.353  1.398   1.00 0.00 ? 12 LEU B HD22 4  
ATOM 7076  H HD23 . LEU B 1 12 ? -3.989  1.019   2.195   1.00 0.00 ? 12 LEU B HD23 4  
ATOM 7077  N N    . MET B 1 13 ? -7.752  1.509   -1.934  1.00 0.00 ? 13 MET B N    4  
ATOM 7078  C CA   . MET B 1 13 ? -7.541  1.510   -3.375  1.00 0.00 ? 13 MET B CA   4  
ATOM 7079  C C    . MET B 1 13 ? -7.018  2.856   -3.859  1.00 0.00 ? 13 MET B C    4  
ATOM 7080  O O    . MET B 1 13 ? -7.781  3.806   -4.038  1.00 0.00 ? 13 MET B O    4  
ATOM 7081  C CB   . MET B 1 13 ? -8.844  1.168   -4.099  1.00 0.00 ? 13 MET B CB   4  
ATOM 7082  C CG   . MET B 1 13 ? -8.663  0.904   -5.585  1.00 0.00 ? 13 MET B CG   4  
ATOM 7083  S SD   . MET B 1 13 ? -10.210 1.020   -6.504  1.00 0.00 ? 13 MET B SD   4  
ATOM 7084  C CE   . MET B 1 13 ? -9.794  2.279   -7.709  1.00 0.00 ? 13 MET B CE   4  
ATOM 7085  H H    . MET B 1 13 ? -8.252  2.243   -1.521  1.00 0.00 ? 13 MET B H    4  
ATOM 7086  H HA   . MET B 1 13 ? -6.807  0.753   -3.601  1.00 0.00 ? 13 MET B HA   4  
ATOM 7087  H HB2  . MET B 1 13 ? -9.273  0.286   -3.648  1.00 0.00 ? 13 MET B HB2  4  
ATOM 7088  H HB3  . MET B 1 13 ? -9.533  1.992   -3.984  1.00 0.00 ? 13 MET B HB3  4  
ATOM 7089  H HG2  . MET B 1 13 ? -7.969  1.629   -5.984  1.00 0.00 ? 13 MET B HG2  4  
ATOM 7090  H HG3  . MET B 1 13 ? -8.258  -0.089  -5.713  1.00 0.00 ? 13 MET B HG3  4  
ATOM 7091  H HE1  . MET B 1 13 ? -9.738  3.240   -7.220  1.00 0.00 ? 13 MET B HE1  4  
ATOM 7092  H HE2  . MET B 1 13 ? -10.553 2.308   -8.476  1.00 0.00 ? 13 MET B HE2  4  
ATOM 7093  H HE3  . MET B 1 13 ? -8.838  2.047   -8.156  1.00 0.00 ? 13 MET B HE3  4  
ATOM 7094  N N    . ILE B 1 14 ? -5.711  2.923   -4.076  1.00 0.00 ? 14 ILE B N    4  
ATOM 7095  C CA   . ILE B 1 14 ? -5.073  4.139   -4.549  1.00 0.00 ? 14 ILE B CA   4  
ATOM 7096  C C    . ILE B 1 14 ? -4.466  3.921   -5.935  1.00 0.00 ? 14 ILE B C    4  
ATOM 7097  O O    . ILE B 1 14 ? -3.674  3.001   -6.136  1.00 0.00 ? 14 ILE B O    4  
ATOM 7098  C CB   . ILE B 1 14 ? -3.976  4.609   -3.571  1.00 0.00 ? 14 ILE B CB   4  
ATOM 7099  C CG1  . ILE B 1 14 ? -3.288  5.872   -4.095  1.00 0.00 ? 14 ILE B CG1  4  
ATOM 7100  C CG2  . ILE B 1 14 ? -2.959  3.500   -3.340  1.00 0.00 ? 14 ILE B CG2  4  
ATOM 7101  C CD1  . ILE B 1 14 ? -4.245  7.012   -4.355  1.00 0.00 ? 14 ILE B CD1  4  
ATOM 7102  H H    . ILE B 1 14 ? -5.163  2.132   -3.911  1.00 0.00 ? 14 ILE B H    4  
ATOM 7103  H HA   . ILE B 1 14 ? -5.830  4.906   -4.610  1.00 0.00 ? 14 ILE B HA   4  
ATOM 7104  H HB   . ILE B 1 14 ? -4.445  4.831   -2.624  1.00 0.00 ? 14 ILE B HB   4  
ATOM 7105  H HG12 . ILE B 1 14 ? -2.562  6.207   -3.370  1.00 0.00 ? 14 ILE B HG12 4  
ATOM 7106  H HG13 . ILE B 1 14 ? -2.784  5.642   -5.023  1.00 0.00 ? 14 ILE B HG13 4  
ATOM 7107  H HG21 . ILE B 1 14 ? -2.994  3.190   -2.306  1.00 0.00 ? 14 ILE B HG21 4  
ATOM 7108  H HG22 . ILE B 1 14 ? -1.970  3.863   -3.573  1.00 0.00 ? 14 ILE B HG22 4  
ATOM 7109  H HG23 . ILE B 1 14 ? -3.193  2.658   -3.975  1.00 0.00 ? 14 ILE B HG23 4  
ATOM 7110  H HD11 . ILE B 1 14 ? -5.260  6.654   -4.263  1.00 0.00 ? 14 ILE B HD11 4  
ATOM 7111  H HD12 . ILE B 1 14 ? -4.087  7.396   -5.352  1.00 0.00 ? 14 ILE B HD12 4  
ATOM 7112  H HD13 . ILE B 1 14 ? -4.074  7.798   -3.635  1.00 0.00 ? 14 ILE B HD13 4  
ATOM 7113  N N    . GLY B 1 15 ? -4.842  4.769   -6.888  1.00 0.00 ? 15 GLY B N    4  
ATOM 7114  C CA   . GLY B 1 15 ? -4.326  4.643   -8.240  1.00 0.00 ? 15 GLY B CA   4  
ATOM 7115  C C    . GLY B 1 15 ? -5.424  4.748   -9.281  1.00 0.00 ? 15 GLY B C    4  
ATOM 7116  O O    . GLY B 1 15 ? -5.945  5.835   -9.536  1.00 0.00 ? 15 GLY B O    4  
ATOM 7117  H H    . GLY B 1 15 ? -5.474  5.487   -6.676  1.00 0.00 ? 15 GLY B H    4  
ATOM 7118  H HA2  . GLY B 1 15 ? -3.604  5.427   -8.413  1.00 0.00 ? 15 GLY B HA2  4  
ATOM 7119  H HA3  . GLY B 1 15 ? -3.836  3.685   -8.345  1.00 0.00 ? 15 GLY B HA3  4  
ATOM 7120  N N    . ASP B 1 16 ? -5.779  3.618   -9.883  1.00 0.00 ? 16 ASP B N    4  
ATOM 7121  C CA   . ASP B 1 16 ? -6.827  3.591   -10.901 1.00 0.00 ? 16 ASP B CA   4  
ATOM 7122  C C    . ASP B 1 16 ? -7.476  2.208   -11.018 1.00 0.00 ? 16 ASP B C    4  
ATOM 7123  O O    . ASP B 1 16 ? -8.320  1.991   -11.887 1.00 0.00 ? 16 ASP B O    4  
ATOM 7124  C CB   . ASP B 1 16 ? -6.254  4.012   -12.256 1.00 0.00 ? 16 ASP B CB   4  
ATOM 7125  C CG   . ASP B 1 16 ? -7.170  4.964   -13.000 1.00 0.00 ? 16 ASP B CG   4  
ATOM 7126  O OD1  . ASP B 1 16 ? -8.387  4.957   -12.721 1.00 0.00 ? 16 ASP B OD1  4  
ATOM 7127  O OD2  . ASP B 1 16 ? -6.670  5.718   -13.860 1.00 0.00 ? 16 ASP B OD2  4  
ATOM 7128  H H    . ASP B 1 16 ? -5.327  2.785   -9.637  1.00 0.00 ? 16 ASP B H    4  
ATOM 7129  H HA   . ASP B 1 16 ? -7.584  4.303   -10.609 1.00 0.00 ? 16 ASP B HA   4  
ATOM 7130  H HB2  . ASP B 1 16 ? -5.305  4.502   -12.102 1.00 0.00 ? 16 ASP B HB2  4  
ATOM 7131  H HB3  . ASP B 1 16 ? -6.106  3.133   -12.867 1.00 0.00 ? 16 ASP B HB3  4  
ATOM 7132  N N    . GLU B 1 17 ? -7.083  1.279   -10.142 1.00 0.00 ? 17 GLU B N    4  
ATOM 7133  C CA   . GLU B 1 17 ? -7.625  -0.081  -10.146 1.00 0.00 ? 17 GLU B CA   4  
ATOM 7134  C C    . GLU B 1 17 ? -6.719  -1.007  -9.336  1.00 0.00 ? 17 GLU B C    4  
ATOM 7135  O O    . GLU B 1 17 ? -6.154  -1.964  -9.866  1.00 0.00 ? 17 GLU B O    4  
ATOM 7136  C CB   . GLU B 1 17 ? -7.769  -0.612  -11.580 1.00 0.00 ? 17 GLU B CB   4  
ATOM 7137  C CG   . GLU B 1 17 ? -9.213  -0.750  -12.036 1.00 0.00 ? 17 GLU B CG   4  
ATOM 7138  C CD   . GLU B 1 17 ? -9.338  -1.435  -13.384 1.00 0.00 ? 17 GLU B CD   4  
ATOM 7139  O OE1  . GLU B 1 17 ? -8.293  -1.777  -13.977 1.00 0.00 ? 17 GLU B OE1  4  
ATOM 7140  O OE2  . GLU B 1 17 ? -10.482 -1.630  -13.846 1.00 0.00 ? 17 GLU B OE2  4  
ATOM 7141  H H    . GLU B 1 17 ? -6.411  1.512   -9.472  1.00 0.00 ? 17 GLU B H    4  
ATOM 7142  H HA   . GLU B 1 17 ? -8.599  -0.052  -9.680  1.00 0.00 ? 17 GLU B HA   4  
ATOM 7143  H HB2  . GLU B 1 17 ? -7.265  0.064   -12.255 1.00 0.00 ? 17 GLU B HB2  4  
ATOM 7144  H HB3  . GLU B 1 17 ? -7.301  -1.583  -11.645 1.00 0.00 ? 17 GLU B HB3  4  
ATOM 7145  H HG2  . GLU B 1 17 ? -9.754  -1.330  -11.304 1.00 0.00 ? 17 GLU B HG2  4  
ATOM 7146  H HG3  . GLU B 1 17 ? -9.650  0.235   -12.107 1.00 0.00 ? 17 GLU B HG3  4  
ATOM 7147  N N    . VAL B 1 18 ? -6.569  -0.704  -8.051  1.00 0.00 ? 18 VAL B N    4  
ATOM 7148  C CA   . VAL B 1 18 ? -5.721  -1.489  -7.178  1.00 0.00 ? 18 VAL B CA   4  
ATOM 7149  C C    . VAL B 1 18 ? -6.526  -2.181  -6.073  1.00 0.00 ? 18 VAL B C    4  
ATOM 7150  O O    . VAL B 1 18 ? -7.739  -2.356  -6.187  1.00 0.00 ? 18 VAL B O    4  
ATOM 7151  C CB   . VAL B 1 18 ? -4.634  -0.594  -6.551  1.00 0.00 ? 18 VAL B CB   4  
ATOM 7152  C CG1  . VAL B 1 18 ? -3.938  0.233   -7.622  1.00 0.00 ? 18 VAL B CG1  4  
ATOM 7153  C CG2  . VAL B 1 18 ? -5.221  0.304   -5.469  1.00 0.00 ? 18 VAL B CG2  4  
ATOM 7154  H H    . VAL B 1 18 ? -7.026  0.074   -7.683  1.00 0.00 ? 18 VAL B H    4  
ATOM 7155  H HA   . VAL B 1 18 ? -5.231  -2.242  -7.778  1.00 0.00 ? 18 VAL B HA   4  
ATOM 7156  H HB   . VAL B 1 18 ? -3.903  -1.231  -6.098  1.00 0.00 ? 18 VAL B HB   4  
ATOM 7157  H HG11 . VAL B 1 18 ? -4.114  -0.209  -8.591  1.00 0.00 ? 18 VAL B HG11 4  
ATOM 7158  H HG12 . VAL B 1 18 ? -2.876  0.257   -7.424  1.00 0.00 ? 18 VAL B HG12 4  
ATOM 7159  H HG13 . VAL B 1 18 ? -4.329  1.240   -7.609  1.00 0.00 ? 18 VAL B HG13 4  
ATOM 7160  H HG21 . VAL B 1 18 ? -6.290  0.164   -5.422  1.00 0.00 ? 18 VAL B HG21 4  
ATOM 7161  H HG22 . VAL B 1 18 ? -5.006  1.336   -5.701  1.00 0.00 ? 18 VAL B HG22 4  
ATOM 7162  H HG23 . VAL B 1 18 ? -4.783  0.051   -4.513  1.00 0.00 ? 18 VAL B HG23 4  
ATOM 7163  N N    . THR B 1 19 ? -5.831  -2.569  -5.006  1.00 0.00 ? 19 THR B N    4  
ATOM 7164  C CA   . THR B 1 19 ? -6.441  -3.242  -3.865  1.00 0.00 ? 19 THR B CA   4  
ATOM 7165  C C    . THR B 1 19 ? -5.347  -3.732  -2.924  1.00 0.00 ? 19 THR B C    4  
ATOM 7166  O O    . THR B 1 19 ? -4.723  -4.762  -3.171  1.00 0.00 ? 19 THR B O    4  
ATOM 7167  C CB   . THR B 1 19 ? -7.306  -4.420  -4.325  1.00 0.00 ? 19 THR B CB   4  
ATOM 7168  O OG1  . THR B 1 19 ? -6.930  -4.844  -5.623  1.00 0.00 ? 19 THR B OG1  4  
ATOM 7169  C CG2  . THR B 1 19 ? -8.785  -4.101  -4.356  1.00 0.00 ? 19 THR B CG2  4  
ATOM 7170  H H    . THR B 1 19 ? -4.868  -2.396  -4.981  1.00 0.00 ? 19 THR B H    4  
ATOM 7171  H HA   . THR B 1 19 ? -7.059  -2.526  -3.343  1.00 0.00 ? 19 THR B HA   4  
ATOM 7172  H HB   . THR B 1 19 ? -7.162  -5.247  -3.644  1.00 0.00 ? 19 THR B HB   4  
ATOM 7173  H HG1  . THR B 1 19 ? -7.317  -5.703  -5.804  1.00 0.00 ? 19 THR B HG1  4  
ATOM 7174  H HG21 . THR B 1 19 ? -9.339  -4.912  -3.908  1.00 0.00 ? 19 THR B HG21 4  
ATOM 7175  H HG22 . THR B 1 19 ? -9.103  -3.970  -5.380  1.00 0.00 ? 19 THR B HG22 4  
ATOM 7176  H HG23 . THR B 1 19 ? -8.969  -3.191  -3.803  1.00 0.00 ? 19 THR B HG23 4  
ATOM 7177  N N    . VAL B 1 20 ? -5.102  -2.984  -1.855  1.00 0.00 ? 20 VAL B N    4  
ATOM 7178  C CA   . VAL B 1 20 ? -4.063  -3.347  -0.899  1.00 0.00 ? 20 VAL B CA   4  
ATOM 7179  C C    . VAL B 1 20 ? -4.658  -3.882  0.402   1.00 0.00 ? 20 VAL B C    4  
ATOM 7180  O O    . VAL B 1 20 ? -5.216  -3.125  1.200   1.00 0.00 ? 20 VAL B O    4  
ATOM 7181  C CB   . VAL B 1 20 ? -3.158  -2.142  -0.579  1.00 0.00 ? 20 VAL B CB   4  
ATOM 7182  C CG1  . VAL B 1 20 ? -2.015  -2.550  0.339   1.00 0.00 ? 20 VAL B CG1  4  
ATOM 7183  C CG2  . VAL B 1 20 ? -2.624  -1.520  -1.860  1.00 0.00 ? 20 VAL B CG2  4  
ATOM 7184  H H    . VAL B 1 20 ? -5.624  -2.168  -1.709  1.00 0.00 ? 20 VAL B H    4  
ATOM 7185  H HA   . VAL B 1 20 ? -3.452  -4.118  -1.351  1.00 0.00 ? 20 VAL B HA   4  
ATOM 7186  H HB   . VAL B 1 20 ? -3.752  -1.401  -0.067  1.00 0.00 ? 20 VAL B HB   4  
ATOM 7187  H HG11 . VAL B 1 20 ? -1.180  -1.881  0.195   1.00 0.00 ? 20 VAL B HG11 4  
ATOM 7188  H HG12 . VAL B 1 20 ? -1.711  -3.560  0.108   1.00 0.00 ? 20 VAL B HG12 4  
ATOM 7189  H HG13 . VAL B 1 20 ? -2.343  -2.499  1.367   1.00 0.00 ? 20 VAL B HG13 4  
ATOM 7190  H HG21 . VAL B 1 20 ? -2.508  -2.286  -2.612  1.00 0.00 ? 20 VAL B HG21 4  
ATOM 7191  H HG22 . VAL B 1 20 ? -1.667  -1.059  -1.665  1.00 0.00 ? 20 VAL B HG22 4  
ATOM 7192  H HG23 . VAL B 1 20 ? -3.318  -0.771  -2.213  1.00 0.00 ? 20 VAL B HG23 4  
ATOM 7193  N N    . THR B 1 21 ? -4.529  -5.191  0.603   1.00 0.00 ? 21 THR B N    4  
ATOM 7194  C CA   . THR B 1 21 ? -5.045  -5.842  1.803   1.00 0.00 ? 21 THR B CA   4  
ATOM 7195  C C    . THR B 1 21 ? -3.983  -5.889  2.899   1.00 0.00 ? 21 THR B C    4  
ATOM 7196  O O    . THR B 1 21 ? -2.968  -6.573  2.767   1.00 0.00 ? 21 THR B O    4  
ATOM 7197  C CB   . THR B 1 21 ? -5.515  -7.260  1.475   1.00 0.00 ? 21 THR B CB   4  
ATOM 7198  O OG1  . THR B 1 21 ? -6.138  -7.301  0.203   1.00 0.00 ? 21 THR B OG1  4  
ATOM 7199  C CG2  . THR B 1 21 ? -6.495  -7.815  2.485   1.00 0.00 ? 21 THR B CG2  4  
ATOM 7200  H H    . THR B 1 21 ? -4.077  -5.733  -0.076  1.00 0.00 ? 21 THR B H    4  
ATOM 7201  H HA   . THR B 1 21 ? -5.887  -5.266  2.158   1.00 0.00 ? 21 THR B HA   4  
ATOM 7202  H HB   . THR B 1 21 ? -4.656  -7.916  1.452   1.00 0.00 ? 21 THR B HB   4  
ATOM 7203  H HG1  . THR B 1 21 ? -5.498  -7.076  -0.475  1.00 0.00 ? 21 THR B HG1  4  
ATOM 7204  H HG21 . THR B 1 21 ? -6.494  -7.193  3.368   1.00 0.00 ? 21 THR B HG21 4  
ATOM 7205  H HG22 . THR B 1 21 ? -6.205  -8.821  2.754   1.00 0.00 ? 21 THR B HG22 4  
ATOM 7206  H HG23 . THR B 1 21 ? -7.486  -7.829  2.056   1.00 0.00 ? 21 THR B HG23 4  
ATOM 7207  N N    . VAL B 1 22 ? -4.223  -5.151  3.978   1.00 0.00 ? 22 VAL B N    4  
ATOM 7208  C CA   . VAL B 1 22 ? -3.285  -5.100  5.095   1.00 0.00 ? 22 VAL B CA   4  
ATOM 7209  C C    . VAL B 1 22 ? -3.375  -6.357  5.958   1.00 0.00 ? 22 VAL B C    4  
ATOM 7210  O O    . VAL B 1 22 ? -3.854  -6.313  7.092   1.00 0.00 ? 22 VAL B O    4  
ATOM 7211  C CB   . VAL B 1 22 ? -3.536  -3.865  5.981   1.00 0.00 ? 22 VAL B CB   4  
ATOM 7212  C CG1  . VAL B 1 22 ? -3.225  -2.586  5.218   1.00 0.00 ? 22 VAL B CG1  4  
ATOM 7213  C CG2  . VAL B 1 22 ? -4.969  -3.856  6.493   1.00 0.00 ? 22 VAL B CG2  4  
ATOM 7214  H H    . VAL B 1 22 ? -5.046  -4.620  4.017   1.00 0.00 ? 22 VAL B H    4  
ATOM 7215  H HA   . VAL B 1 22 ? -2.287  -5.027  4.688   1.00 0.00 ? 22 VAL B HA   4  
ATOM 7216  H HB   . VAL B 1 22 ? -2.873  -3.918  6.833   1.00 0.00 ? 22 VAL B HB   4  
ATOM 7217  H HG11 . VAL B 1 22 ? -2.221  -2.638  4.823   1.00 0.00 ? 22 VAL B HG11 4  
ATOM 7218  H HG12 . VAL B 1 22 ? -3.307  -1.741  5.884   1.00 0.00 ? 22 VAL B HG12 4  
ATOM 7219  H HG13 . VAL B 1 22 ? -3.927  -2.473  4.405   1.00 0.00 ? 22 VAL B HG13 4  
ATOM 7220  H HG21 . VAL B 1 22 ? -5.534  -3.100  5.970   1.00 0.00 ? 22 VAL B HG21 4  
ATOM 7221  H HG22 . VAL B 1 22 ? -4.972  -3.640  7.551   1.00 0.00 ? 22 VAL B HG22 4  
ATOM 7222  H HG23 . VAL B 1 22 ? -5.418  -4.824  6.323   1.00 0.00 ? 22 VAL B HG23 4  
ATOM 7223  N N    . LEU B 1 23 ? -2.908  -7.478  5.415   1.00 0.00 ? 23 LEU B N    4  
ATOM 7224  C CA   . LEU B 1 23 ? -2.934  -8.745  6.138   1.00 0.00 ? 23 LEU B CA   4  
ATOM 7225  C C    . LEU B 1 23 ? -1.589  -9.005  6.822   1.00 0.00 ? 23 LEU B C    4  
ATOM 7226  O O    . LEU B 1 23 ? -0.871  -8.065  7.164   1.00 0.00 ? 23 LEU B O    4  
ATOM 7227  C CB   . LEU B 1 23 ? -3.286  -9.892  5.184   1.00 0.00 ? 23 LEU B CB   4  
ATOM 7228  C CG   . LEU B 1 23 ? -4.387  -10.842 5.673   1.00 0.00 ? 23 LEU B CG   4  
ATOM 7229  C CD1  . LEU B 1 23 ? -4.181  -11.237 7.134   1.00 0.00 ? 23 LEU B CD1  4  
ATOM 7230  C CD2  . LEU B 1 23 ? -5.757  -10.207 5.482   1.00 0.00 ? 23 LEU B CD2  4  
ATOM 7231  H H    . LEU B 1 23 ? -2.539  -7.450  4.507   1.00 0.00 ? 23 LEU B H    4  
ATOM 7232  H HA   . LEU B 1 23 ? -3.699  -8.672  6.896   1.00 0.00 ? 23 LEU B HA   4  
ATOM 7233  H HB2  . LEU B 1 23 ? -3.606  -9.461  4.246   1.00 0.00 ? 23 LEU B HB2  4  
ATOM 7234  H HB3  . LEU B 1 23 ? -2.395  -10.473 5.004   1.00 0.00 ? 23 LEU B HB3  4  
ATOM 7235  H HG   . LEU B 1 23 ? -4.354  -11.745 5.080   1.00 0.00 ? 23 LEU B HG   4  
ATOM 7236  H HD11 . LEU B 1 23 ? -3.470  -12.049 7.189   1.00 0.00 ? 23 LEU B HD11 4  
ATOM 7237  H HD12 . LEU B 1 23 ? -5.122  -11.557 7.556   1.00 0.00 ? 23 LEU B HD12 4  
ATOM 7238  H HD13 . LEU B 1 23 ? -3.806  -10.393 7.695   1.00 0.00 ? 23 LEU B HD13 4  
ATOM 7239  H HD21 . LEU B 1 23 ? -6.524  -10.943 5.671   1.00 0.00 ? 23 LEU B HD21 4  
ATOM 7240  H HD22 . LEU B 1 23 ? -5.847  -9.844  4.469   1.00 0.00 ? 23 LEU B HD22 4  
ATOM 7241  H HD23 . LEU B 1 23 ? -5.871  -9.383  6.171   1.00 0.00 ? 23 LEU B HD23 4  
ATOM 7242  N N    . GLY B 1 24 ? -1.252  -10.279 7.029   1.00 0.00 ? 24 GLY B N    4  
ATOM 7243  C CA   . GLY B 1 24 ? 0.000   -10.616 7.677   1.00 0.00 ? 24 GLY B CA   4  
ATOM 7244  C C    . GLY B 1 24 ? 0.086   -10.045 9.074   1.00 0.00 ? 24 GLY B C    4  
ATOM 7245  O O    . GLY B 1 24 ? 0.902   -9.163  9.343   1.00 0.00 ? 24 GLY B O    4  
ATOM 7246  H H    . GLY B 1 24 ? -1.856  -10.992 6.745   1.00 0.00 ? 24 GLY B H    4  
ATOM 7247  H HA2  . GLY B 1 24 ? 0.089   -11.691 7.731   1.00 0.00 ? 24 GLY B HA2  4  
ATOM 7248  H HA3  . GLY B 1 24 ? 0.815   -10.226 7.091   1.00 0.00 ? 24 GLY B HA3  4  
ATOM 7249  N N    . VAL B 1 25 ? -0.765  -10.540 9.963   1.00 0.00 ? 25 VAL B N    4  
ATOM 7250  C CA   . VAL B 1 25 ? -0.787  -10.064 11.332  1.00 0.00 ? 25 VAL B CA   4  
ATOM 7251  C C    . VAL B 1 25 ? 0.234   -10.808 12.187  1.00 0.00 ? 25 VAL B C    4  
ATOM 7252  O O    . VAL B 1 25 ? 0.056   -11.984 12.505  1.00 0.00 ? 25 VAL B O    4  
ATOM 7253  C CB   . VAL B 1 25 ? -2.187  -10.227 11.958  1.00 0.00 ? 25 VAL B CB   4  
ATOM 7254  C CG1  . VAL B 1 25 ? -2.297  -9.413  13.238  1.00 0.00 ? 25 VAL B CG1  4  
ATOM 7255  C CG2  . VAL B 1 25 ? -3.276  -9.825  10.968  1.00 0.00 ? 25 VAL B CG2  4  
ATOM 7256  H H    . VAL B 1 25 ? -1.395  -11.232 9.691   1.00 0.00 ? 25 VAL B H    4  
ATOM 7257  H HA   . VAL B 1 25 ? -0.541  -9.017  11.320  1.00 0.00 ? 25 VAL B HA   4  
ATOM 7258  H HB   . VAL B 1 25 ? -2.326  -11.269 12.209  1.00 0.00 ? 25 VAL B HB   4  
ATOM 7259  H HG11 . VAL B 1 25 ? -1.391  -9.526  13.816  1.00 0.00 ? 25 VAL B HG11 4  
ATOM 7260  H HG12 . VAL B 1 25 ? -3.139  -9.764  13.817  1.00 0.00 ? 25 VAL B HG12 4  
ATOM 7261  H HG13 . VAL B 1 25 ? -2.439  -8.372  12.991  1.00 0.00 ? 25 VAL B HG13 4  
ATOM 7262  H HG21 . VAL B 1 25 ? -3.039  -10.213 9.986   1.00 0.00 ? 25 VAL B HG21 4  
ATOM 7263  H HG22 . VAL B 1 25 ? -3.341  -8.748  10.922  1.00 0.00 ? 25 VAL B HG22 4  
ATOM 7264  H HG23 . VAL B 1 25 ? -4.223  -10.228 11.294  1.00 0.00 ? 25 VAL B HG23 4  
ATOM 7265  N N    . LYS B 1 26 ? 1.310   -10.114 12.544  1.00 0.00 ? 26 LYS B N    4  
ATOM 7266  C CA   . LYS B 1 26 ? 2.370   -10.706 13.350  1.00 0.00 ? 26 LYS B CA   4  
ATOM 7267  C C    . LYS B 1 26 ? 3.138   -9.638  14.121  1.00 0.00 ? 26 LYS B C    4  
ATOM 7268  O O    . LYS B 1 26 ? 3.029   -8.447  13.830  1.00 0.00 ? 26 LYS B O    4  
ATOM 7269  C CB   . LYS B 1 26 ? 3.330   -11.502 12.462  1.00 0.00 ? 26 LYS B CB   4  
ATOM 7270  C CG   . LYS B 1 26 ? 3.755   -12.831 13.065  1.00 0.00 ? 26 LYS B CG   4  
ATOM 7271  C CD   . LYS B 1 26 ? 5.134   -13.248 12.579  1.00 0.00 ? 26 LYS B CD   4  
ATOM 7272  C CE   . LYS B 1 26 ? 5.045   -14.273 11.461  1.00 0.00 ? 26 LYS B CE   4  
ATOM 7273  N NZ   . LYS B 1 26 ? 4.944   -15.663 11.987  1.00 0.00 ? 26 LYS B NZ   4  
ATOM 7274  H H    . LYS B 1 26 ? 1.398   -9.187  12.238  1.00 0.00 ? 26 LYS B H    4  
ATOM 7275  H HA   . LYS B 1 26 ? 1.910   -11.380 14.057  1.00 0.00 ? 26 LYS B HA   4  
ATOM 7276  H HB2  . LYS B 1 26 ? 2.847   -11.698 11.516  1.00 0.00 ? 26 LYS B HB2  4  
ATOM 7277  H HB3  . LYS B 1 26 ? 4.216   -10.910 12.288  1.00 0.00 ? 26 LYS B HB3  4  
ATOM 7278  H HG2  . LYS B 1 26 ? 3.777   -12.737 14.140  1.00 0.00 ? 26 LYS B HG2  4  
ATOM 7279  H HG3  . LYS B 1 26 ? 3.039   -13.588 12.782  1.00 0.00 ? 26 LYS B HG3  4  
ATOM 7280  H HD2  . LYS B 1 26 ? 5.655   -12.376 12.213  1.00 0.00 ? 26 LYS B HD2  4  
ATOM 7281  H HD3  . LYS B 1 26 ? 5.682   -13.676 13.406  1.00 0.00 ? 26 LYS B HD3  4  
ATOM 7282  H HE2  . LYS B 1 26 ? 4.171   -14.061 10.863  1.00 0.00 ? 26 LYS B HE2  4  
ATOM 7283  H HE3  . LYS B 1 26 ? 5.928   -14.194 10.845  1.00 0.00 ? 26 LYS B HE3  4  
ATOM 7284  H HZ1  . LYS B 1 26 ? 3.949   -15.962 12.017  1.00 0.00 ? 26 LYS B HZ1  4  
ATOM 7285  H HZ2  . LYS B 1 26 ? 5.338   -15.710 12.948  1.00 0.00 ? 26 LYS B HZ2  4  
ATOM 7286  H HZ3  . LYS B 1 26 ? 5.474   -16.316 11.375  1.00 0.00 ? 26 LYS B HZ3  4  
ATOM 7287  N N    . GLY B 1 27 ? 3.917   -10.076 15.104  1.00 0.00 ? 27 GLY B N    4  
ATOM 7288  C CA   . GLY B 1 27 ? 4.696   -9.150  15.903  1.00 0.00 ? 27 GLY B CA   4  
ATOM 7289  C C    . GLY B 1 27 ? 5.921   -8.639  15.169  1.00 0.00 ? 27 GLY B C    4  
ATOM 7290  O O    . GLY B 1 27 ? 6.412   -9.283  14.242  1.00 0.00 ? 27 GLY B O    4  
ATOM 7291  H H    . GLY B 1 27 ? 3.966   -11.038 15.284  1.00 0.00 ? 27 GLY B H    4  
ATOM 7292  H HA2  . GLY B 1 27 ? 4.073   -8.309  16.170  1.00 0.00 ? 27 GLY B HA2  4  
ATOM 7293  H HA3  . GLY B 1 27 ? 5.014   -9.650  16.806  1.00 0.00 ? 27 GLY B HA3  4  
ATOM 7294  N N    . ASN B 1 28 ? 6.410   -7.473  15.584  1.00 0.00 ? 28 ASN B N    4  
ATOM 7295  C CA   . ASN B 1 28 ? 7.582   -6.860  14.965  1.00 0.00 ? 28 ASN B CA   4  
ATOM 7296  C C    . ASN B 1 28 ? 7.259   -6.362  13.555  1.00 0.00 ? 28 ASN B C    4  
ATOM 7297  O O    . ASN B 1 28 ? 6.856   -5.213  13.378  1.00 0.00 ? 28 ASN B O    4  
ATOM 7298  C CB   . ASN B 1 28 ? 8.760   -7.842  14.936  1.00 0.00 ? 28 ASN B CB   4  
ATOM 7299  C CG   . ASN B 1 28 ? 9.788   -7.540  16.009  1.00 0.00 ? 28 ASN B CG   4  
ATOM 7300  O OD1  . ASN B 1 28 ? 10.634  -6.661  15.845  1.00 0.00 ? 28 ASN B OD1  4  
ATOM 7301  N ND2  . ASN B 1 28 ? 9.720   -8.270  17.116  1.00 0.00 ? 28 ASN B ND2  4  
ATOM 7302  H H    . ASN B 1 28 ? 5.965   -7.009  16.323  1.00 0.00 ? 28 ASN B H    4  
ATOM 7303  H HA   . ASN B 1 28 ? 7.857   -6.008  15.571  1.00 0.00 ? 28 ASN B HA   4  
ATOM 7304  H HB2  . ASN B 1 28 ? 8.391   -8.844  15.091  1.00 0.00 ? 28 ASN B HB2  4  
ATOM 7305  H HB3  . ASN B 1 28 ? 9.245   -7.785  13.973  1.00 0.00 ? 28 ASN B HB3  4  
ATOM 7306  H HD21 . ASN B 1 28 ? 9.020   -8.953  17.178  1.00 0.00 ? 28 ASN B HD21 4  
ATOM 7307  H HD22 . ASN B 1 28 ? 10.372  -8.096  17.826  1.00 0.00 ? 28 ASN B HD22 4  
ATOM 7308  N N    . GLN B 1 29 ? 7.438   -7.222  12.553  1.00 0.00 ? 29 GLN B N    4  
ATOM 7309  C CA   . GLN B 1 29 ? 7.163   -6.845  11.170  1.00 0.00 ? 29 GLN B CA   4  
ATOM 7310  C C    . GLN B 1 29 ? 5.936   -7.577  10.633  1.00 0.00 ? 29 GLN B C    4  
ATOM 7311  O O    . GLN B 1 29 ? 5.865   -8.805  10.673  1.00 0.00 ? 29 GLN B O    4  
ATOM 7312  C CB   . GLN B 1 29 ? 8.377   -7.144  10.288  1.00 0.00 ? 29 GLN B CB   4  
ATOM 7313  C CG   . GLN B 1 29 ? 9.647   -6.445  10.743  1.00 0.00 ? 29 GLN B CG   4  
ATOM 7314  C CD   . GLN B 1 29 ? 10.899  -7.224  10.390  1.00 0.00 ? 29 GLN B CD   4  
ATOM 7315  O OE1  . GLN B 1 29 ? 11.551  -7.802  11.260  1.00 0.00 ? 29 GLN B OE1  4  
ATOM 7316  N NE2  . GLN B 1 29 ? 11.242  -7.243  9.107   1.00 0.00 ? 29 GLN B NE2  4  
ATOM 7317  H H    . GLN B 1 29 ? 7.766   -8.126  12.740  1.00 0.00 ? 29 GLN B H    4  
ATOM 7318  H HA   . GLN B 1 29 ? 6.970   -5.783  11.150  1.00 0.00 ? 29 GLN B HA   4  
ATOM 7319  H HB2  . GLN B 1 29 ? 8.556   -8.209  10.291  1.00 0.00 ? 29 GLN B HB2  4  
ATOM 7320  H HB3  . GLN B 1 29 ? 8.160   -6.828  9.278   1.00 0.00 ? 29 GLN B HB3  4  
ATOM 7321  H HG2  . GLN B 1 29 ? 9.700   -5.476  10.270  1.00 0.00 ? 29 GLN B HG2  4  
ATOM 7322  H HG3  . GLN B 1 29 ? 9.609   -6.320  11.815  1.00 0.00 ? 29 GLN B HG3  4  
ATOM 7323  H HE21 . GLN B 1 29 ? 10.675  -6.760  8.470   1.00 0.00 ? 29 GLN B HE21 4  
ATOM 7324  H HE22 . GLN B 1 29 ? 12.047  -7.739  8.850   1.00 0.00 ? 29 GLN B HE22 4  
ATOM 7325  N N    . VAL B 1 30 ? 4.967   -6.809  10.147  1.00 0.00 ? 30 VAL B N    4  
ATOM 7326  C CA   . VAL B 1 30 ? 3.730   -7.373  9.616   1.00 0.00 ? 30 VAL B CA   4  
ATOM 7327  C C    . VAL B 1 30 ? 3.819   -7.588  8.110   1.00 0.00 ? 30 VAL B C    4  
ATOM 7328  O O    . VAL B 1 30 ? 4.311   -6.727  7.381   1.00 0.00 ? 30 VAL B O    4  
ATOM 7329  C CB   . VAL B 1 30 ? 2.523   -6.466  9.920   1.00 0.00 ? 30 VAL B CB   4  
ATOM 7330  C CG1  . VAL B 1 30 ? 2.159   -6.535  11.395  1.00 0.00 ? 30 VAL B CG1  4  
ATOM 7331  C CG2  . VAL B 1 30 ? 2.813   -5.033  9.499   1.00 0.00 ? 30 VAL B CG2  4  
ATOM 7332  H H    . VAL B 1 30 ? 5.079   -5.833  10.165  1.00 0.00 ? 30 VAL B H    4  
ATOM 7333  H HA   . VAL B 1 30 ? 3.566   -8.327  10.096  1.00 0.00 ? 30 VAL B HA   4  
ATOM 7334  H HB   . VAL B 1 30 ? 1.678   -6.822  9.348   1.00 0.00 ? 30 VAL B HB   4  
ATOM 7335  H HG11 . VAL B 1 30 ? 1.810   -5.567  11.725  1.00 0.00 ? 30 VAL B HG11 4  
ATOM 7336  H HG12 . VAL B 1 30 ? 3.030   -6.818  11.968  1.00 0.00 ? 30 VAL B HG12 4  
ATOM 7337  H HG13 . VAL B 1 30 ? 1.379   -7.267  11.540  1.00 0.00 ? 30 VAL B HG13 4  
ATOM 7338  H HG21 . VAL B 1 30 ? 1.882   -4.509  9.342   1.00 0.00 ? 30 VAL B HG21 4  
ATOM 7339  H HG22 . VAL B 1 30 ? 3.383   -5.036  8.582   1.00 0.00 ? 30 VAL B HG22 4  
ATOM 7340  H HG23 . VAL B 1 30 ? 3.379   -4.538  10.274  1.00 0.00 ? 30 VAL B HG23 4  
ATOM 7341  N N    . ARG B 1 31 ? 3.321   -8.732  7.643   1.00 0.00 ? 31 ARG B N    4  
ATOM 7342  C CA   . ARG B 1 31 ? 3.329   -9.039  6.228   1.00 0.00 ? 31 ARG B CA   4  
ATOM 7343  C C    . ARG B 1 31 ? 2.204   -8.288  5.529   1.00 0.00 ? 31 ARG B C    4  
ATOM 7344  O O    . ARG B 1 31 ? 1.037   -8.662  5.630   1.00 0.00 ? 31 ARG B O    4  
ATOM 7345  C CB   . ARG B 1 31 ? 3.187   -10.547 5.989   1.00 0.00 ? 31 ARG B CB   4  
ATOM 7346  C CG   . ARG B 1 31 ? 3.825   -11.406 7.071   1.00 0.00 ? 31 ARG B CG   4  
ATOM 7347  C CD   . ARG B 1 31 ? 4.368   -12.706 6.501   1.00 0.00 ? 31 ARG B CD   4  
ATOM 7348  N NE   . ARG B 1 31 ? 5.801   -12.627 6.228   1.00 0.00 ? 31 ARG B NE   4  
ATOM 7349  C CZ   . ARG B 1 31 ? 6.446   -13.448 5.401   1.00 0.00 ? 31 ARG B CZ   4  
ATOM 7350  N NH1  . ARG B 1 31 ? 5.790   -14.410 4.764   1.00 0.00 ? 31 ARG B NH1  4  
ATOM 7351  N NH2  . ARG B 1 31 ? 7.750   -13.305 5.210   1.00 0.00 ? 31 ARG B NH2  4  
ATOM 7352  H H    . ARG B 1 31 ? 2.914   -9.367  8.253   1.00 0.00 ? 31 ARG B H    4  
ATOM 7353  H HA   . ARG B 1 31 ? 4.266   -8.710  5.835   1.00 0.00 ? 31 ARG B HA   4  
ATOM 7354  H HB2  . ARG B 1 31 ? 2.139   -10.795 5.934   1.00 0.00 ? 31 ARG B HB2  4  
ATOM 7355  H HB3  . ARG B 1 31 ? 3.653   -10.793 5.046   1.00 0.00 ? 31 ARG B HB3  4  
ATOM 7356  H HG2  . ARG B 1 31 ? 4.636   -10.855 7.523   1.00 0.00 ? 31 ARG B HG2  4  
ATOM 7357  H HG3  . ARG B 1 31 ? 3.081   -11.634 7.820   1.00 0.00 ? 31 ARG B HG3  4  
ATOM 7358  H HD2  . ARG B 1 31 ? 4.190   -13.498 7.212   1.00 0.00 ? 31 ARG B HD2  4  
ATOM 7359  H HD3  . ARG B 1 31 ? 3.847   -12.925 5.580   1.00 0.00 ? 31 ARG B HD3  4  
ATOM 7360  H HE   . ARG B 1 31 ? 6.311   -11.926 6.686   1.00 0.00 ? 31 ARG B HE   4  
ATOM 7361  H HH11 . ARG B 1 31 ? 4.806   -14.524 4.903   1.00 0.00 ? 31 ARG B HH11 4  
ATOM 7362  H HH12 . ARG B 1 31 ? 6.280   -15.022 4.143   1.00 0.00 ? 31 ARG B HH12 4  
ATOM 7363  H HH21 . ARG B 1 31 ? 8.249   -12.582 5.688   1.00 0.00 ? 31 ARG B HH21 4  
ATOM 7364  H HH22 . ARG B 1 31 ? 8.235   -13.921 4.589   1.00 0.00 ? 31 ARG B HH22 4  
ATOM 7365  N N    . ILE B 1 32 ? 2.557   -7.214  4.838   1.00 0.00 ? 32 ILE B N    4  
ATOM 7366  C CA   . ILE B 1 32 ? 1.566   -6.402  4.147   1.00 0.00 ? 32 ILE B CA   4  
ATOM 7367  C C    . ILE B 1 32 ? 1.301   -6.936  2.745   1.00 0.00 ? 32 ILE B C    4  
ATOM 7368  O O    . ILE B 1 32 ? 2.230   -7.268  2.009   1.00 0.00 ? 32 ILE B O    4  
ATOM 7369  C CB   . ILE B 1 32 ? 2.018   -4.931  4.066   1.00 0.00 ? 32 ILE B CB   4  
ATOM 7370  C CG1  . ILE B 1 32 ? 2.562   -4.473  5.425   1.00 0.00 ? 32 ILE B CG1  4  
ATOM 7371  C CG2  . ILE B 1 32 ? 0.864   -4.044  3.622   1.00 0.00 ? 32 ILE B CG2  4  
ATOM 7372  C CD1  . ILE B 1 32 ? 1.512   -4.427  6.513   1.00 0.00 ? 32 ILE B CD1  4  
ATOM 7373  H H    . ILE B 1 32 ? 3.501   -6.950  4.804   1.00 0.00 ? 32 ILE B H    4  
ATOM 7374  H HA   . ILE B 1 32 ? 0.648   -6.443  4.716   1.00 0.00 ? 32 ILE B HA   4  
ATOM 7375  H HB   . ILE B 1 32 ? 2.802   -4.857  3.328   1.00 0.00 ? 32 ILE B HB   4  
ATOM 7376  H HG12 . ILE B 1 32 ? 3.337   -5.157  5.744   1.00 0.00 ? 32 ILE B HG12 4  
ATOM 7377  H HG13 . ILE B 1 32 ? 2.982   -3.483  5.326   1.00 0.00 ? 32 ILE B HG13 4  
ATOM 7378  H HG21 . ILE B 1 32 ? 1.108   -3.011  3.817   1.00 0.00 ? 32 ILE B HG21 4  
ATOM 7379  H HG22 . ILE B 1 32 ? -0.028  -4.313  4.169   1.00 0.00 ? 32 ILE B HG22 4  
ATOM 7380  H HG23 . ILE B 1 32 ? 0.692   -4.180  2.564   1.00 0.00 ? 32 ILE B HG23 4  
ATOM 7381  H HD11 . ILE B 1 32 ? 1.172   -5.429  6.729   1.00 0.00 ? 32 ILE B HD11 4  
ATOM 7382  H HD12 . ILE B 1 32 ? 0.677   -3.826  6.182   1.00 0.00 ? 32 ILE B HD12 4  
ATOM 7383  H HD13 . ILE B 1 32 ? 1.937   -3.991  7.405   1.00 0.00 ? 32 ILE B HD13 4  
ATOM 7384  N N    . GLY B 1 33 ? 0.023   -7.022  2.385   1.00 0.00 ? 33 GLY B N    4  
ATOM 7385  C CA   . GLY B 1 33 ? -0.348  -7.522  1.076   1.00 0.00 ? 33 GLY B CA   4  
ATOM 7386  C C    . GLY B 1 33 ? -0.803  -6.423  0.145   1.00 0.00 ? 33 GLY B C    4  
ATOM 7387  O O    . GLY B 1 33 ? -1.819  -5.774  0.391   1.00 0.00 ? 33 GLY B O    4  
ATOM 7388  H H    . GLY B 1 33 ? -0.677  -6.743  3.012   1.00 0.00 ? 33 GLY B H    4  
ATOM 7389  H HA2  . GLY B 1 33 ? 0.502   -8.017  0.637   1.00 0.00 ? 33 GLY B HA2  4  
ATOM 7390  H HA3  . GLY B 1 33 ? -1.149  -8.238  1.189   1.00 0.00 ? 33 GLY B HA3  4  
ATOM 7391  N N    . VAL B 1 34 ? -0.051  -6.211  -0.927  1.00 0.00 ? 34 VAL B N    4  
ATOM 7392  C CA   . VAL B 1 34 ? -0.389  -5.178  -1.893  1.00 0.00 ? 34 VAL B CA   4  
ATOM 7393  C C    . VAL B 1 34 ? -0.830  -5.785  -3.220  1.00 0.00 ? 34 VAL B C    4  
ATOM 7394  O O    . VAL B 1 34 ? -0.006  -6.244  -4.011  1.00 0.00 ? 34 VAL B O    4  
ATOM 7395  C CB   . VAL B 1 34 ? 0.800   -4.233  -2.145  1.00 0.00 ? 34 VAL B CB   4  
ATOM 7396  C CG1  . VAL B 1 34 ? 0.370   -3.049  -2.997  1.00 0.00 ? 34 VAL B CG1  4  
ATOM 7397  C CG2  . VAL B 1 34 ? 1.396   -3.762  -0.827  1.00 0.00 ? 34 VAL B CG2  4  
ATOM 7398  H H    . VAL B 1 34 ? 0.748   -6.760  -1.068  1.00 0.00 ? 34 VAL B H    4  
ATOM 7399  H HA   . VAL B 1 34 ? -1.204  -4.596  -1.488  1.00 0.00 ? 34 VAL B HA   4  
ATOM 7400  H HB   . VAL B 1 34 ? 1.560   -4.778  -2.685  1.00 0.00 ? 34 VAL B HB   4  
ATOM 7401  H HG11 . VAL B 1 34 ? 0.143   -2.208  -2.358  1.00 0.00 ? 34 VAL B HG11 4  
ATOM 7402  H HG12 . VAL B 1 34 ? -0.508  -3.315  -3.567  1.00 0.00 ? 34 VAL B HG12 4  
ATOM 7403  H HG13 . VAL B 1 34 ? 1.170   -2.782  -3.672  1.00 0.00 ? 34 VAL B HG13 4  
ATOM 7404  H HG21 . VAL B 1 34 ? 1.554   -4.612  -0.179  1.00 0.00 ? 34 VAL B HG21 4  
ATOM 7405  H HG22 . VAL B 1 34 ? 0.718   -3.069  -0.352  1.00 0.00 ? 34 VAL B HG22 4  
ATOM 7406  H HG23 . VAL B 1 34 ? 2.340   -3.272  -1.013  1.00 0.00 ? 34 VAL B HG23 4  
ATOM 7407  N N    . ASN B 1 35 ? -2.137  -5.776  -3.455  1.00 0.00 ? 35 ASN B N    4  
ATOM 7408  C CA   . ASN B 1 35 ? -2.690  -6.315  -4.690  1.00 0.00 ? 35 ASN B CA   4  
ATOM 7409  C C    . ASN B 1 35 ? -2.917  -5.193  -5.695  1.00 0.00 ? 35 ASN B C    4  
ATOM 7410  O O    . ASN B 1 35 ? -3.826  -4.381  -5.541  1.00 0.00 ? 35 ASN B O    4  
ATOM 7411  C CB   . ASN B 1 35 ? -4.003  -7.053  -4.417  1.00 0.00 ? 35 ASN B CB   4  
ATOM 7412  C CG   . ASN B 1 35 ? -4.142  -8.313  -5.248  1.00 0.00 ? 35 ASN B CG   4  
ATOM 7413  O OD1  . ASN B 1 35 ? -3.509  -8.455  -6.293  1.00 0.00 ? 35 ASN B OD1  4  
ATOM 7414  N ND2  . ASN B 1 35 ? -4.978  -9.237  -4.786  1.00 0.00 ? 35 ASN B ND2  4  
ATOM 7415  H H    . ASN B 1 35 ? -2.737  -5.398  -2.779  1.00 0.00 ? 35 ASN B H    4  
ATOM 7416  H HA   . ASN B 1 35 ? -1.972  -7.010  -5.099  1.00 0.00 ? 35 ASN B HA   4  
ATOM 7417  H HB2  . ASN B 1 35 ? -4.045  -7.326  -3.373  1.00 0.00 ? 35 ASN B HB2  4  
ATOM 7418  H HB3  . ASN B 1 35 ? -4.831  -6.399  -4.647  1.00 0.00 ? 35 ASN B HB3  4  
ATOM 7419  H HD21 . ASN B 1 35 ? -5.451  -9.055  -3.947  1.00 0.00 ? 35 ASN B HD21 4  
ATOM 7420  H HD22 . ASN B 1 35 ? -5.088  -10.062 -5.303  1.00 0.00 ? 35 ASN B HD22 4  
ATOM 7421  N N    . ALA B 1 36 ? -2.075  -5.151  -6.715  1.00 0.00 ? 36 ALA B N    4  
ATOM 7422  C CA   . ALA B 1 36 ? -2.175  -4.120  -7.741  1.00 0.00 ? 36 ALA B CA   4  
ATOM 7423  C C    . ALA B 1 36 ? -1.773  -4.644  -9.116  1.00 0.00 ? 36 ALA B C    4  
ATOM 7424  O O    . ALA B 1 36 ? -0.910  -5.514  -9.235  1.00 0.00 ? 36 ALA B O    4  
ATOM 7425  C CB   . ALA B 1 36 ? -1.316  -2.922  -7.364  1.00 0.00 ? 36 ALA B CB   4  
ATOM 7426  H H    . ALA B 1 36 ? -1.368  -5.826  -6.763  1.00 0.00 ? 36 ALA B H    4  
ATOM 7427  H HA   . ALA B 1 36 ? -3.203  -3.793  -7.780  1.00 0.00 ? 36 ALA B HA   4  
ATOM 7428  H HB1  . ALA B 1 36 ? -1.431  -2.148  -8.109  1.00 0.00 ? 36 ALA B HB1  4  
ATOM 7429  H HB2  . ALA B 1 36 ? -0.280  -3.223  -7.315  1.00 0.00 ? 36 ALA B HB2  4  
ATOM 7430  H HB3  . ALA B 1 36 ? -1.628  -2.544  -6.402  1.00 0.00 ? 36 ALA B HB3  4  
ATOM 7431  N N    . PRO B 1 37 ? -2.398  -4.109  -10.181 1.00 0.00 ? 37 PRO B N    4  
ATOM 7432  C CA   . PRO B 1 37 ? -2.108  -4.509  -11.557 1.00 0.00 ? 37 PRO B CA   4  
ATOM 7433  C C    . PRO B 1 37 ? -0.838  -3.853  -12.087 1.00 0.00 ? 37 PRO B C    4  
ATOM 7434  O O    . PRO B 1 37 ? -0.425  -2.800  -11.603 1.00 0.00 ? 37 PRO B O    4  
ATOM 7435  C CB   . PRO B 1 37 ? -3.328  -4.005  -12.322 1.00 0.00 ? 37 PRO B CB   4  
ATOM 7436  C CG   . PRO B 1 37 ? -3.758  -2.793  -11.572 1.00 0.00 ? 37 PRO B CG   4  
ATOM 7437  C CD   . PRO B 1 37 ? -3.437  -3.060  -10.123 1.00 0.00 ? 37 PRO B CD   4  
ATOM 7438  H HA   . PRO B 1 37 ? -2.031  -5.582  -11.654 1.00 0.00 ? 37 PRO B HA   4  
ATOM 7439  H HB2  . PRO B 1 37 ? -3.047  -3.766  -13.338 1.00 0.00 ? 37 PRO B HB2  4  
ATOM 7440  H HB3  . PRO B 1 37 ? -4.097  -4.763  -12.322 1.00 0.00 ? 37 PRO B HB3  4  
ATOM 7441  H HG2  . PRO B 1 37 ? -3.211  -1.931  -11.923 1.00 0.00 ? 37 PRO B HG2  4  
ATOM 7442  H HG3  . PRO B 1 37 ? -4.820  -2.641  -11.697 1.00 0.00 ? 37 PRO B HG3  4  
ATOM 7443  H HD2  . PRO B 1 37 ? -3.055  -2.166  -9.652  1.00 0.00 ? 37 PRO B HD2  4  
ATOM 7444  H HD3  . PRO B 1 37 ? -4.314  -3.416  -9.603  1.00 0.00 ? 37 PRO B HD3  4  
ATOM 7445  N N    . LYS B 1 38 ? -0.222  -4.479  -13.083 1.00 0.00 ? 38 LYS B N    4  
ATOM 7446  C CA   . LYS B 1 38 ? 1.001   -3.949  -13.675 1.00 0.00 ? 38 LYS B CA   4  
ATOM 7447  C C    . LYS B 1 38 ? 0.690   -3.039  -14.861 1.00 0.00 ? 38 LYS B C    4  
ATOM 7448  O O    . LYS B 1 38 ? 1.363   -3.095  -15.890 1.00 0.00 ? 38 LYS B O    4  
ATOM 7449  C CB   . LYS B 1 38 ? 1.912   -5.095  -14.122 1.00 0.00 ? 38 LYS B CB   4  
ATOM 7450  C CG   . LYS B 1 38 ? 2.041   -6.207  -13.094 1.00 0.00 ? 38 LYS B CG   4  
ATOM 7451  C CD   . LYS B 1 38 ? 3.450   -6.776  -13.062 1.00 0.00 ? 38 LYS B CD   4  
ATOM 7452  C CE   . LYS B 1 38 ? 3.437   -8.290  -12.925 1.00 0.00 ? 38 LYS B CE   4  
ATOM 7453  N NZ   . LYS B 1 38 ? 2.880   -8.725  -11.614 1.00 0.00 ? 38 LYS B NZ   4  
ATOM 7454  H H    . LYS B 1 38 ? -0.599  -5.315  -13.429 1.00 0.00 ? 38 LYS B H    4  
ATOM 7455  H HA   . LYS B 1 38 ? 1.511   -3.372  -12.918 1.00 0.00 ? 38 LYS B HA   4  
ATOM 7456  H HB2  . LYS B 1 38 ? 1.516   -5.520  -15.032 1.00 0.00 ? 38 LYS B HB2  4  
ATOM 7457  H HB3  . LYS B 1 38 ? 2.897   -4.699  -14.319 1.00 0.00 ? 38 LYS B HB3  4  
ATOM 7458  H HG2  . LYS B 1 38 ? 1.800   -5.812  -12.118 1.00 0.00 ? 38 LYS B HG2  4  
ATOM 7459  H HG3  . LYS B 1 38 ? 1.348   -6.997  -13.345 1.00 0.00 ? 38 LYS B HG3  4  
ATOM 7460  H HD2  . LYS B 1 38 ? 3.956   -6.512  -13.978 1.00 0.00 ? 38 LYS B HD2  4  
ATOM 7461  H HD3  . LYS B 1 38 ? 3.980   -6.352  -12.221 1.00 0.00 ? 38 LYS B HD3  4  
ATOM 7462  H HE2  . LYS B 1 38 ? 2.832   -8.705  -13.718 1.00 0.00 ? 38 LYS B HE2  4  
ATOM 7463  H HE3  . LYS B 1 38 ? 4.449   -8.656  -13.016 1.00 0.00 ? 38 LYS B HE3  4  
ATOM 7464  H HZ1  . LYS B 1 38 ? 3.638   -8.782  -10.905 1.00 0.00 ? 38 LYS B HZ1  4  
ATOM 7465  H HZ2  . LYS B 1 38 ? 2.436   -9.660  -11.707 1.00 0.00 ? 38 LYS B HZ2  4  
ATOM 7466  H HZ3  . LYS B 1 38 ? 2.164   -8.045  -11.287 1.00 0.00 ? 38 LYS B HZ3  4  
ATOM 7467  N N    . GLU B 1 39 ? -0.333  -2.199  -14.713 1.00 0.00 ? 39 GLU B N    4  
ATOM 7468  C CA   . GLU B 1 39 ? -0.726  -1.281  -15.776 1.00 0.00 ? 39 GLU B CA   4  
ATOM 7469  C C    . GLU B 1 39 ? -0.540  0.171   -15.340 1.00 0.00 ? 39 GLU B C    4  
ATOM 7470  O O    . GLU B 1 39 ? -0.065  1.003   -16.112 1.00 0.00 ? 39 GLU B O    4  
ATOM 7471  C CB   . GLU B 1 39 ? -2.183  -1.526  -16.177 1.00 0.00 ? 39 GLU B CB   4  
ATOM 7472  C CG   . GLU B 1 39 ? -2.335  -2.211  -17.526 1.00 0.00 ? 39 GLU B CG   4  
ATOM 7473  C CD   . GLU B 1 39 ? -2.781  -1.257  -18.617 1.00 0.00 ? 39 GLU B CD   4  
ATOM 7474  O OE1  . GLU B 1 39 ? -3.855  -0.638  -18.462 1.00 0.00 ? 39 GLU B OE1  4  
ATOM 7475  O OE2  . GLU B 1 39 ? -2.057  -1.129  -19.626 1.00 0.00 ? 39 GLU B OE2  4  
ATOM 7476  H H    . GLU B 1 39 ? -0.837  -2.195  -13.874 1.00 0.00 ? 39 GLU B H    4  
ATOM 7477  H HA   . GLU B 1 39 ? -0.091  -1.471  -16.629 1.00 0.00 ? 39 GLU B HA   4  
ATOM 7478  H HB2  . GLU B 1 39 ? -2.650  -2.147  -15.428 1.00 0.00 ? 39 GLU B HB2  4  
ATOM 7479  H HB3  . GLU B 1 39 ? -2.699  -0.578  -16.219 1.00 0.00 ? 39 GLU B HB3  4  
ATOM 7480  H HG2  . GLU B 1 39 ? -1.384  -2.637  -17.808 1.00 0.00 ? 39 GLU B HG2  4  
ATOM 7481  H HG3  . GLU B 1 39 ? -3.069  -2.998  -17.434 1.00 0.00 ? 39 GLU B HG3  4  
ATOM 7482  N N    . VAL B 1 40 ? -0.915  0.467   -14.099 1.00 0.00 ? 40 VAL B N    4  
ATOM 7483  C CA   . VAL B 1 40 ? -0.785  1.819   -13.566 1.00 0.00 ? 40 VAL B CA   4  
ATOM 7484  C C    . VAL B 1 40 ? 0.640   2.078   -13.087 1.00 0.00 ? 40 VAL B C    4  
ATOM 7485  O O    . VAL B 1 40 ? 1.391   1.142   -12.815 1.00 0.00 ? 40 VAL B O    4  
ATOM 7486  C CB   . VAL B 1 40 ? -1.766  2.071   -12.402 1.00 0.00 ? 40 VAL B CB   4  
ATOM 7487  C CG1  . VAL B 1 40 ? -1.866  3.557   -12.101 1.00 0.00 ? 40 VAL B CG1  4  
ATOM 7488  C CG2  . VAL B 1 40 ? -3.138  1.493   -12.721 1.00 0.00 ? 40 VAL B CG2  4  
ATOM 7489  H H    . VAL B 1 40 ? -1.285  -0.238  -13.528 1.00 0.00 ? 40 VAL B H    4  
ATOM 7490  H HA   . VAL B 1 40 ? -1.017  2.513   -14.361 1.00 0.00 ? 40 VAL B HA   4  
ATOM 7491  H HB   . VAL B 1 40 ? -1.387  1.574   -11.520 1.00 0.00 ? 40 VAL B HB   4  
ATOM 7492  H HG11 . VAL B 1 40 ? -2.646  3.726   -11.374 1.00 0.00 ? 40 VAL B HG11 4  
ATOM 7493  H HG12 . VAL B 1 40 ? -2.098  4.094   -13.010 1.00 0.00 ? 40 VAL B HG12 4  
ATOM 7494  H HG13 . VAL B 1 40 ? -0.924  3.908   -11.707 1.00 0.00 ? 40 VAL B HG13 4  
ATOM 7495  H HG21 . VAL B 1 40 ? -3.202  0.486   -12.337 1.00 0.00 ? 40 VAL B HG21 4  
ATOM 7496  H HG22 . VAL B 1 40 ? -3.283  1.481   -13.791 1.00 0.00 ? 40 VAL B HG22 4  
ATOM 7497  H HG23 . VAL B 1 40 ? -3.901  2.103   -12.260 1.00 0.00 ? 40 VAL B HG23 4  
ATOM 7498  N N    . SER B 1 41 ? 1.009   3.351   -12.990 1.00 0.00 ? 41 SER B N    4  
ATOM 7499  C CA   . SER B 1 41 ? 2.349   3.723   -12.546 1.00 0.00 ? 41 SER B CA   4  
ATOM 7500  C C    . SER B 1 41 ? 2.599   3.247   -11.120 1.00 0.00 ? 41 SER B C    4  
ATOM 7501  O O    . SER B 1 41 ? 2.167   3.883   -10.158 1.00 0.00 ? 41 SER B O    4  
ATOM 7502  C CB   . SER B 1 41 ? 2.542   5.239   -12.633 1.00 0.00 ? 41 SER B CB   4  
ATOM 7503  O OG   . SER B 1 41 ? 3.867   5.562   -13.018 1.00 0.00 ? 41 SER B OG   4  
ATOM 7504  H H    . SER B 1 41 ? 0.368   4.055   -13.222 1.00 0.00 ? 41 SER B H    4  
ATOM 7505  H HA   . SER B 1 41 ? 3.059   3.241   -13.202 1.00 0.00 ? 41 SER B HA   4  
ATOM 7506  H HB2  . SER B 1 41 ? 1.860   5.648   -13.363 1.00 0.00 ? 41 SER B HB2  4  
ATOM 7507  H HB3  . SER B 1 41 ? 2.343   5.681   -11.668 1.00 0.00 ? 41 SER B HB3  4  
ATOM 7508  H HG   . SER B 1 41 ? 4.487   5.059   -12.485 1.00 0.00 ? 41 SER B HG   4  
ATOM 7509  N N    . VAL B 1 42 ? 3.299   2.124   -10.990 1.00 0.00 ? 42 VAL B N    4  
ATOM 7510  C CA   . VAL B 1 42 ? 3.607   1.563   -9.681  1.00 0.00 ? 42 VAL B CA   4  
ATOM 7511  C C    . VAL B 1 42 ? 5.116   1.420   -9.489  1.00 0.00 ? 42 VAL B C    4  
ATOM 7512  O O    . VAL B 1 42 ? 5.791   0.771   -10.287 1.00 0.00 ? 42 VAL B O    4  
ATOM 7513  C CB   . VAL B 1 42 ? 2.942   0.184   -9.494  1.00 0.00 ? 42 VAL B CB   4  
ATOM 7514  C CG1  . VAL B 1 42 ? 3.458   -0.806  -10.527 1.00 0.00 ? 42 VAL B CG1  4  
ATOM 7515  C CG2  . VAL B 1 42 ? 3.174   -0.336  -8.082  1.00 0.00 ? 42 VAL B CG2  4  
ATOM 7516  H H    . VAL B 1 42 ? 3.620   1.661   -11.791 1.00 0.00 ? 42 VAL B H    4  
ATOM 7517  H HA   . VAL B 1 42 ? 3.216   2.234   -8.930  1.00 0.00 ? 42 VAL B HA   4  
ATOM 7518  H HB   . VAL B 1 42 ? 1.878   0.299   -9.641  1.00 0.00 ? 42 VAL B HB   4  
ATOM 7519  H HG11 . VAL B 1 42 ? 3.402   -0.363  -11.510 1.00 0.00 ? 42 VAL B HG11 4  
ATOM 7520  H HG12 . VAL B 1 42 ? 2.854   -1.701  -10.500 1.00 0.00 ? 42 VAL B HG12 4  
ATOM 7521  H HG13 . VAL B 1 42 ? 4.484   -1.058  -10.303 1.00 0.00 ? 42 VAL B HG13 4  
ATOM 7522  H HG21 . VAL B 1 42 ? 4.216   -0.589  -7.958  1.00 0.00 ? 42 VAL B HG21 4  
ATOM 7523  H HG22 . VAL B 1 42 ? 2.568   -1.216  -7.919  1.00 0.00 ? 42 VAL B HG22 4  
ATOM 7524  H HG23 . VAL B 1 42 ? 2.900   0.426   -7.368  1.00 0.00 ? 42 VAL B HG23 4  
ATOM 7525  N N    . HIS B 1 43 ? 5.640   2.020   -8.423  1.00 0.00 ? 43 HIS B N    4  
ATOM 7526  C CA   . HIS B 1 43 ? 7.066   1.946   -8.127  1.00 0.00 ? 43 HIS B CA   4  
ATOM 7527  C C    . HIS B 1 43 ? 7.285   1.494   -6.687  1.00 0.00 ? 43 HIS B C    4  
ATOM 7528  O O    . HIS B 1 43 ? 6.608   1.964   -5.774  1.00 0.00 ? 43 HIS B O    4  
ATOM 7529  C CB   . HIS B 1 43 ? 7.730   3.305   -8.356  1.00 0.00 ? 43 HIS B CB   4  
ATOM 7530  C CG   . HIS B 1 43 ? 9.203   3.215   -8.611  1.00 0.00 ? 43 HIS B CG   4  
ATOM 7531  N ND1  . HIS B 1 43 ? 9.823   3.836   -9.673  1.00 0.00 ? 43 HIS B ND1  4  
ATOM 7532  C CD2  . HIS B 1 43 ? 10.182  2.569   -7.934  1.00 0.00 ? 43 HIS B CD2  4  
ATOM 7533  C CE1  . HIS B 1 43 ? 11.118  3.578   -9.641  1.00 0.00 ? 43 HIS B CE1  4  
ATOM 7534  N NE2  . HIS B 1 43 ? 11.362  2.811   -8.594  1.00 0.00 ? 43 HIS B NE2  4  
ATOM 7535  H H    . HIS B 1 43 ? 5.058   2.515   -7.810  1.00 0.00 ? 43 HIS B H    4  
ATOM 7536  H HA   . HIS B 1 43 ? 7.507   1.220   -8.793  1.00 0.00 ? 43 HIS B HA   4  
ATOM 7537  H HB2  . HIS B 1 43 ? 7.274   3.782   -9.210  1.00 0.00 ? 43 HIS B HB2  4  
ATOM 7538  H HB3  . HIS B 1 43 ? 7.581   3.923   -7.482  1.00 0.00 ? 43 HIS B HB3  4  
ATOM 7539  H HD2  . HIS B 1 43 ? 10.058  1.974   -7.039  1.00 0.00 ? 43 HIS B HD2  4  
ATOM 7540  H HE1  . HIS B 1 43 ? 11.852  3.934   -10.349 1.00 0.00 ? 43 HIS B HE1  4  
ATOM 7541  H HE2  . HIS B 1 43 ? 12.226  2.399   -8.386  1.00 0.00 ? 43 HIS B HE2  4  
ATOM 7542  N N    . ARG B 1 44 ? 8.230   0.582   -6.484  1.00 0.00 ? 44 ARG B N    4  
ATOM 7543  C CA   . ARG B 1 44 ? 8.524   0.077   -5.148  1.00 0.00 ? 44 ARG B CA   4  
ATOM 7544  C C    . ARG B 1 44 ? 9.836   -0.701  -5.142  1.00 0.00 ? 44 ARG B C    4  
ATOM 7545  O O    . ARG B 1 44 ? 10.577  -0.692  -6.125  1.00 0.00 ? 44 ARG B O    4  
ATOM 7546  C CB   . ARG B 1 44 ? 7.382   -0.815  -4.656  1.00 0.00 ? 44 ARG B CB   4  
ATOM 7547  C CG   . ARG B 1 44 ? 7.183   -2.067  -5.494  1.00 0.00 ? 44 ARG B CG   4  
ATOM 7548  C CD   . ARG B 1 44 ? 5.710   -2.423  -5.622  1.00 0.00 ? 44 ARG B CD   4  
ATOM 7549  N NE   . ARG B 1 44 ? 5.493   -3.535  -6.545  1.00 0.00 ? 44 ARG B NE   4  
ATOM 7550  C CZ   . ARG B 1 44 ? 5.561   -3.424  -7.869  1.00 0.00 ? 44 ARG B CZ   4  
ATOM 7551  N NH1  . ARG B 1 44 ? 5.844   -2.255  -8.431  1.00 0.00 ? 44 ARG B NH1  4  
ATOM 7552  N NH2  . ARG B 1 44 ? 5.346   -4.485  -8.635  1.00 0.00 ? 44 ARG B NH2  4  
ATOM 7553  H H    . ARG B 1 44 ? 8.746   0.236   -7.242  1.00 0.00 ? 44 ARG B H    4  
ATOM 7554  H HA   . ARG B 1 44 ? 8.618   0.925   -4.487  1.00 0.00 ? 44 ARG B HA   4  
ATOM 7555  H HB2  . ARG B 1 44 ? 7.587   -1.116  -3.640  1.00 0.00 ? 44 ARG B HB2  4  
ATOM 7556  H HB3  . ARG B 1 44 ? 6.464   -0.246  -4.675  1.00 0.00 ? 44 ARG B HB3  4  
ATOM 7557  H HG2  . ARG B 1 44 ? 7.589   -1.898  -6.480  1.00 0.00 ? 44 ARG B HG2  4  
ATOM 7558  H HG3  . ARG B 1 44 ? 7.703   -2.889  -5.024  1.00 0.00 ? 44 ARG B HG3  4  
ATOM 7559  H HD2  . ARG B 1 44 ? 5.333   -2.697  -4.649  1.00 0.00 ? 44 ARG B HD2  4  
ATOM 7560  H HD3  . ARG B 1 44 ? 5.175   -1.558  -5.984  1.00 0.00 ? 44 ARG B HD3  4  
ATOM 7561  H HE   . ARG B 1 44 ? 5.283   -4.410  -6.156  1.00 0.00 ? 44 ARG B HE   4  
ATOM 7562  H HH11 . ARG B 1 44 ? 6.008   -1.452  -7.860  1.00 0.00 ? 44 ARG B HH11 4  
ATOM 7563  H HH12 . ARG B 1 44 ? 5.894   -2.179  -9.427  1.00 0.00 ? 44 ARG B HH12 4  
ATOM 7564  H HH21 . ARG B 1 44 ? 5.133   -5.368  -8.217  1.00 0.00 ? 44 ARG B HH21 4  
ATOM 7565  H HH22 . ARG B 1 44 ? 5.397   -4.403  -9.630  1.00 0.00 ? 44 ARG B HH22 4  
ATOM 7566  N N    . GLU B 1 45 ? 10.120  -1.373  -4.030  1.00 0.00 ? 45 GLU B N    4  
ATOM 7567  C CA   . GLU B 1 45 ? 11.346  -2.155  -3.901  1.00 0.00 ? 45 GLU B CA   4  
ATOM 7568  C C    . GLU B 1 45 ? 11.483  -3.153  -5.048  1.00 0.00 ? 45 GLU B C    4  
ATOM 7569  O O    . GLU B 1 45 ? 10.595  -3.975  -5.280  1.00 0.00 ? 45 GLU B O    4  
ATOM 7570  C CB   . GLU B 1 45 ? 11.364  -2.894  -2.561  1.00 0.00 ? 45 GLU B CB   4  
ATOM 7571  C CG   . GLU B 1 45 ? 12.000  -2.095  -1.435  1.00 0.00 ? 45 GLU B CG   4  
ATOM 7572  C CD   . GLU B 1 45 ? 13.407  -1.639  -1.766  1.00 0.00 ? 45 GLU B CD   4  
ATOM 7573  O OE1  . GLU B 1 45 ? 14.261  -2.506  -2.050  1.00 0.00 ? 45 GLU B OE1  4  
ATOM 7574  O OE2  . GLU B 1 45 ? 13.656  -0.415  -1.741  1.00 0.00 ? 45 GLU B OE2  4  
ATOM 7575  H H    . GLU B 1 45 ? 9.492   -1.343  -3.279  1.00 0.00 ? 45 GLU B H    4  
ATOM 7576  H HA   . GLU B 1 45 ? 12.180  -1.471  -3.935  1.00 0.00 ? 45 GLU B HA   4  
ATOM 7577  H HB2  . GLU B 1 45 ? 10.349  -3.128  -2.279  1.00 0.00 ? 45 GLU B HB2  4  
ATOM 7578  H HB3  . GLU B 1 45 ? 11.918  -3.814  -2.678  1.00 0.00 ? 45 GLU B HB3  4  
ATOM 7579  H HG2  . GLU B 1 45 ? 11.392  -1.224  -1.241  1.00 0.00 ? 45 GLU B HG2  4  
ATOM 7580  H HG3  . GLU B 1 45 ? 12.035  -2.712  -0.549  1.00 0.00 ? 45 GLU B HG3  4  
ATOM 7581  N N    . GLU B 1 46 ? 12.601  -3.074  -5.764  1.00 0.00 ? 46 GLU B N    4  
ATOM 7582  C CA   . GLU B 1 46 ? 12.856  -3.965  -6.889  1.00 0.00 ? 46 GLU B CA   4  
ATOM 7583  C C    . GLU B 1 46 ? 12.808  -5.427  -6.455  1.00 0.00 ? 46 GLU B C    4  
ATOM 7584  O O    . GLU B 1 46 ? 12.062  -6.227  -7.018  1.00 0.00 ? 46 GLU B O    4  
ATOM 7585  C CB   . GLU B 1 46 ? 14.217  -3.649  -7.517  1.00 0.00 ? 46 GLU B CB   4  
ATOM 7586  C CG   . GLU B 1 46 ? 14.136  -3.277  -8.988  1.00 0.00 ? 46 GLU B CG   4  
ATOM 7587  C CD   . GLU B 1 46 ? 15.394  -2.593  -9.486  1.00 0.00 ? 46 GLU B CD   4  
ATOM 7588  O OE1  . GLU B 1 46 ? 16.493  -3.147  -9.278  1.00 0.00 ? 46 GLU B OE1  4  
ATOM 7589  O OE2  . GLU B 1 46 ? 15.279  -1.502  -10.085 1.00 0.00 ? 46 GLU B OE2  4  
ATOM 7590  H H    . GLU B 1 46 ? 13.271  -2.398  -5.531  1.00 0.00 ? 46 GLU B H    4  
ATOM 7591  H HA   . GLU B 1 46 ? 12.084  -3.797  -7.625  1.00 0.00 ? 46 GLU B HA   4  
ATOM 7592  H HB2  . GLU B 1 46 ? 14.662  -2.822  -6.983  1.00 0.00 ? 46 GLU B HB2  4  
ATOM 7593  H HB3  . GLU B 1 46 ? 14.857  -4.514  -7.421  1.00 0.00 ? 46 GLU B HB3  4  
ATOM 7594  H HG2  . GLU B 1 46 ? 13.981  -4.176  -9.566  1.00 0.00 ? 46 GLU B HG2  4  
ATOM 7595  H HG3  . GLU B 1 46 ? 13.299  -2.609  -9.132  1.00 0.00 ? 46 GLU B HG3  4  
ATOM 7596  N N    . ILE B 1 47 ? 13.608  -5.770  -5.450  1.00 0.00 ? 47 ILE B N    4  
ATOM 7597  C CA   . ILE B 1 47 ? 13.653  -7.136  -4.943  1.00 0.00 ? 47 ILE B CA   4  
ATOM 7598  C C    . ILE B 1 47 ? 12.287  -7.573  -4.423  1.00 0.00 ? 47 ILE B C    4  
ATOM 7599  O O    . ILE B 1 47 ? 11.858  -8.706  -4.648  1.00 0.00 ? 47 ILE B O    4  
ATOM 7600  C CB   . ILE B 1 47 ? 14.696  -7.281  -3.815  1.00 0.00 ? 47 ILE B CB   4  
ATOM 7601  C CG1  . ILE B 1 47 ? 14.791  -8.739  -3.357  1.00 0.00 ? 47 ILE B CG1  4  
ATOM 7602  C CG2  . ILE B 1 47 ? 14.346  -6.374  -2.645  1.00 0.00 ? 47 ILE B CG2  4  
ATOM 7603  C CD1  . ILE B 1 47 ? 15.184  -9.696  -4.461  1.00 0.00 ? 47 ILE B CD1  4  
ATOM 7604  H H    . ILE B 1 47 ? 14.179  -5.089  -5.038  1.00 0.00 ? 47 ILE B H    4  
ATOM 7605  H HA   . ILE B 1 47 ? 13.942  -7.784  -5.757  1.00 0.00 ? 47 ILE B HA   4  
ATOM 7606  H HB   . ILE B 1 47 ? 15.655  -6.972  -4.202  1.00 0.00 ? 47 ILE B HB   4  
ATOM 7607  H HG12 . ILE B 1 47 ? 15.529  -8.816  -2.573  1.00 0.00 ? 47 ILE B HG12 4  
ATOM 7608  H HG13 . ILE B 1 47 ? 13.831  -9.051  -2.973  1.00 0.00 ? 47 ILE B HG13 4  
ATOM 7609  H HG21 . ILE B 1 47 ? 15.226  -6.211  -2.040  1.00 0.00 ? 47 ILE B HG21 4  
ATOM 7610  H HG22 . ILE B 1 47 ? 13.578  -6.840  -2.046  1.00 0.00 ? 47 ILE B HG22 4  
ATOM 7611  H HG23 . ILE B 1 47 ? 13.986  -5.427  -3.019  1.00 0.00 ? 47 ILE B HG23 4  
ATOM 7612  H HD11 . ILE B 1 47 ? 16.156  -9.423  -4.845  1.00 0.00 ? 47 ILE B HD11 4  
ATOM 7613  H HD12 . ILE B 1 47 ? 14.456  -9.646  -5.257  1.00 0.00 ? 47 ILE B HD12 4  
ATOM 7614  H HD13 . ILE B 1 47 ? 15.222  -10.701 -4.069  1.00 0.00 ? 47 ILE B HD13 4  
ATOM 7615  N N    . TYR B 1 48 ? 11.608  -6.666  -3.726  1.00 0.00 ? 48 TYR B N    4  
ATOM 7616  C CA   . TYR B 1 48 ? 10.289  -6.951  -3.169  1.00 0.00 ? 48 TYR B CA   4  
ATOM 7617  C C    . TYR B 1 48 ? 9.380   -7.605  -4.206  1.00 0.00 ? 48 TYR B C    4  
ATOM 7618  O O    . TYR B 1 48 ? 8.841   -8.687  -3.977  1.00 0.00 ? 48 TYR B O    4  
ATOM 7619  C CB   . TYR B 1 48 ? 9.645   -5.664  -2.650  1.00 0.00 ? 48 TYR B CB   4  
ATOM 7620  C CG   . TYR B 1 48 ? 10.000  -5.347  -1.214  1.00 0.00 ? 48 TYR B CG   4  
ATOM 7621  C CD1  . TYR B 1 48 ? 11.322  -5.360  -0.787  1.00 0.00 ? 48 TYR B CD1  4  
ATOM 7622  C CD2  . TYR B 1 48 ? 9.014   -5.035  -0.286  1.00 0.00 ? 48 TYR B CD2  4  
ATOM 7623  C CE1  . TYR B 1 48 ? 11.652  -5.071  0.523   1.00 0.00 ? 48 TYR B CE1  4  
ATOM 7624  C CE2  . TYR B 1 48 ? 9.336   -4.745  1.026   1.00 0.00 ? 48 TYR B CE2  4  
ATOM 7625  C CZ   . TYR B 1 48 ? 10.656  -4.765  1.426   1.00 0.00 ? 48 TYR B CZ   4  
ATOM 7626  O OH   . TYR B 1 48 ? 10.980  -4.476  2.732   1.00 0.00 ? 48 TYR B OH   4  
ATOM 7627  H H    . TYR B 1 48 ? 12.005  -5.781  -3.581  1.00 0.00 ? 48 TYR B H    4  
ATOM 7628  H HA   . TYR B 1 48 ? 10.420  -7.633  -2.343  1.00 0.00 ? 48 TYR B HA   4  
ATOM 7629  H HB2  . TYR B 1 48 ? 9.969   -4.835  -3.262  1.00 0.00 ? 48 TYR B HB2  4  
ATOM 7630  H HB3  . TYR B 1 48 ? 8.571   -5.754  -2.715  1.00 0.00 ? 48 TYR B HB3  4  
ATOM 7631  H HD1  . TYR B 1 48 ? 12.100  -5.600  -1.497  1.00 0.00 ? 48 TYR B HD1  4  
ATOM 7632  H HD2  . TYR B 1 48 ? 7.982   -5.021  -0.602  1.00 0.00 ? 48 TYR B HD2  4  
ATOM 7633  H HE1  . TYR B 1 48 ? 12.685  -5.086  0.836   1.00 0.00 ? 48 TYR B HE1  4  
ATOM 7634  H HE2  . TYR B 1 48 ? 8.555   -4.505  1.733   1.00 0.00 ? 48 TYR B HE2  4  
ATOM 7635  H HH   . TYR B 1 48 ? 11.760  -3.916  2.752   1.00 0.00 ? 48 TYR B HH   4  
ATOM 7636  N N    . GLN B 1 49 ? 9.215   -6.943  -5.346  1.00 0.00 ? 49 GLN B N    4  
ATOM 7637  C CA   . GLN B 1 49 ? 8.372   -7.464  -6.416  1.00 0.00 ? 49 GLN B CA   4  
ATOM 7638  C C    . GLN B 1 49 ? 9.107   -8.528  -7.229  1.00 0.00 ? 49 GLN B C    4  
ATOM 7639  O O    . GLN B 1 49 ? 8.480   -9.359  -7.886  1.00 0.00 ? 49 GLN B O    4  
ATOM 7640  C CB   . GLN B 1 49 ? 7.917   -6.328  -7.333  1.00 0.00 ? 49 GLN B CB   4  
ATOM 7641  C CG   . GLN B 1 49 ? 9.065   -5.512  -7.906  1.00 0.00 ? 49 GLN B CG   4  
ATOM 7642  C CD   . GLN B 1 49 ? 8.803   -5.058  -9.328  1.00 0.00 ? 49 GLN B CD   4  
ATOM 7643  O OE1  . GLN B 1 49 ? 8.540   -5.871  -10.214 1.00 0.00 ? 49 GLN B OE1  4  
ATOM 7644  N NE2  . GLN B 1 49 ? 8.873   -3.751  -9.554  1.00 0.00 ? 49 GLN B NE2  4  
ATOM 7645  H H    . GLN B 1 49 ? 9.670   -6.083  -5.474  1.00 0.00 ? 49 GLN B H    4  
ATOM 7646  H HA   . GLN B 1 49 ? 7.502   -7.915  -5.960  1.00 0.00 ? 49 GLN B HA   4  
ATOM 7647  H HB2  . GLN B 1 49 ? 7.357   -6.748  -8.156  1.00 0.00 ? 49 GLN B HB2  4  
ATOM 7648  H HB3  . GLN B 1 49 ? 7.275   -5.664  -6.774  1.00 0.00 ? 49 GLN B HB3  4  
ATOM 7649  H HG2  . GLN B 1 49 ? 9.213   -4.640  -7.287  1.00 0.00 ? 49 GLN B HG2  4  
ATOM 7650  H HG3  . GLN B 1 49 ? 9.960   -6.116  -7.895  1.00 0.00 ? 49 GLN B HG3  4  
ATOM 7651  H HE21 . GLN B 1 49 ? 9.088   -3.162  -8.801  1.00 0.00 ? 49 GLN B HE21 4  
ATOM 7652  H HE22 . GLN B 1 49 ? 8.708   -3.429  -10.465 1.00 0.00 ? 49 GLN B HE22 4  
ATOM 7653  N N    . ARG B 1 50 ? 10.437  -8.500  -7.178  1.00 0.00 ? 50 ARG B N    4  
ATOM 7654  C CA   . ARG B 1 50 ? 11.251  -9.464  -7.909  1.00 0.00 ? 50 ARG B CA   4  
ATOM 7655  C C    . ARG B 1 50 ? 11.157  -10.855 -7.284  1.00 0.00 ? 50 ARG B C    4  
ATOM 7656  O O    . ARG B 1 50 ? 11.569  -11.844 -7.888  1.00 0.00 ? 50 ARG B O    4  
ATOM 7657  C CB   . ARG B 1 50 ? 12.711  -9.008  -7.945  1.00 0.00 ? 50 ARG B CB   4  
ATOM 7658  C CG   . ARG B 1 50 ? 13.569  -9.791  -8.926  1.00 0.00 ? 50 ARG B CG   4  
ATOM 7659  C CD   . ARG B 1 50 ? 13.359  -9.313  -10.353 1.00 0.00 ? 50 ARG B CD   4  
ATOM 7660  N NE   . ARG B 1 50 ? 14.386  -8.362  -10.770 1.00 0.00 ? 50 ARG B NE   4  
ATOM 7661  C CZ   . ARG B 1 50 ? 14.657  -8.072  -12.041 1.00 0.00 ? 50 ARG B CZ   4  
ATOM 7662  N NH1  . ARG B 1 50 ? 13.979  -8.655  -13.021 1.00 0.00 ? 50 ARG B NH1  4  
ATOM 7663  N NH2  . ARG B 1 50 ? 15.608  -7.195  -12.332 1.00 0.00 ? 50 ARG B NH2  4  
ATOM 7664  H H    . ARG B 1 50 ? 10.882  -7.820  -6.635  1.00 0.00 ? 50 ARG B H    4  
ATOM 7665  H HA   . ARG B 1 50 ? 10.876  -9.510  -8.917  1.00 0.00 ? 50 ARG B HA   4  
ATOM 7666  H HB2  . ARG B 1 50 ? 12.744  -7.966  -8.223  1.00 0.00 ? 50 ARG B HB2  4  
ATOM 7667  H HB3  . ARG B 1 50 ? 13.136  -9.123  -6.958  1.00 0.00 ? 50 ARG B HB3  4  
ATOM 7668  H HG2  . ARG B 1 50 ? 14.609  -9.660  -8.663  1.00 0.00 ? 50 ARG B HG2  4  
ATOM 7669  H HG3  . ARG B 1 50 ? 13.308  -10.837 -8.863  1.00 0.00 ? 50 ARG B HG3  4  
ATOM 7670  H HD2  . ARG B 1 50 ? 13.385  -10.168 -11.013 1.00 0.00 ? 50 ARG B HD2  4  
ATOM 7671  H HD3  . ARG B 1 50 ? 12.391  -8.838  -10.421 1.00 0.00 ? 50 ARG B HD3  4  
ATOM 7672  H HE   . ARG B 1 50 ? 14.902  -7.916  -10.066 1.00 0.00 ? 50 ARG B HE   4  
ATOM 7673  H HH11 . ARG B 1 50 ? 13.260  -9.317  -12.809 1.00 0.00 ? 50 ARG B HH11 4  
ATOM 7674  H HH12 . ARG B 1 50 ? 14.187  -8.433  -13.974 1.00 0.00 ? 50 ARG B HH12 4  
ATOM 7675  H HH21 . ARG B 1 50 ? 16.122  -6.752  -11.597 1.00 0.00 ? 50 ARG B HH21 4  
ATOM 7676  H HH22 . ARG B 1 50 ? 15.812  -6.977  -13.286 1.00 0.00 ? 50 ARG B HH22 4  
ATOM 7677  N N    . ILE B 1 51 ? 10.612  -10.924 -6.072  1.00 0.00 ? 51 ILE B N    4  
ATOM 7678  C CA   . ILE B 1 51 ? 10.461  -12.191 -5.369  1.00 0.00 ? 51 ILE B CA   4  
ATOM 7679  C C    . ILE B 1 51 ? 8.986   -12.519 -5.162  1.00 0.00 ? 51 ILE B C    4  
ATOM 7680  O O    . ILE B 1 51 ? 8.579   -13.678 -5.242  1.00 0.00 ? 51 ILE B O    4  
ATOM 7681  C CB   . ILE B 1 51 ? 11.177  -12.168 -4.003  1.00 0.00 ? 51 ILE B CB   4  
ATOM 7682  C CG1  . ILE B 1 51 ? 11.099  -13.543 -3.334  1.00 0.00 ? 51 ILE B CG1  4  
ATOM 7683  C CG2  . ILE B 1 51 ? 10.574  -11.099 -3.103  1.00 0.00 ? 51 ILE B CG2  4  
ATOM 7684  C CD1  . ILE B 1 51 ? 12.418  -14.009 -2.756  1.00 0.00 ? 51 ILE B CD1  4  
ATOM 7685  H H    . ILE B 1 51 ? 10.301  -10.103 -5.642  1.00 0.00 ? 51 ILE B H    4  
ATOM 7686  H HA   . ILE B 1 51 ? 10.910  -12.965 -5.976  1.00 0.00 ? 51 ILE B HA   4  
ATOM 7687  H HB   . ILE B 1 51 ? 12.213  -11.917 -4.170  1.00 0.00 ? 51 ILE B HB   4  
ATOM 7688  H HG12 . ILE B 1 51 ? 10.380  -13.506 -2.529  1.00 0.00 ? 51 ILE B HG12 4  
ATOM 7689  H HG13 . ILE B 1 51 ? 10.779  -14.274 -4.063  1.00 0.00 ? 51 ILE B HG13 4  
ATOM 7690  H HG21 . ILE B 1 51 ? 9.593   -11.413 -2.777  1.00 0.00 ? 51 ILE B HG21 4  
ATOM 7691  H HG22 . ILE B 1 51 ? 10.490  -10.172 -3.651  1.00 0.00 ? 51 ILE B HG22 4  
ATOM 7692  H HG23 . ILE B 1 51 ? 11.210  -10.951 -2.242  1.00 0.00 ? 51 ILE B HG23 4  
ATOM 7693  H HD11 . ILE B 1 51 ? 12.283  -14.966 -2.274  1.00 0.00 ? 51 ILE B HD11 4  
ATOM 7694  H HD12 . ILE B 1 51 ? 12.770  -13.288 -2.033  1.00 0.00 ? 51 ILE B HD12 4  
ATOM 7695  H HD13 . ILE B 1 51 ? 13.145  -14.106 -3.550  1.00 0.00 ? 51 ILE B HD13 4  
ATOM 7696  N N    . GLN B 1 52 ? 8.190   -11.485 -4.908  1.00 0.00 ? 52 GLN B N    4  
ATOM 7697  C CA   . GLN B 1 52 ? 6.757   -11.655 -4.704  1.00 0.00 ? 52 GLN B CA   4  
ATOM 7698  C C    . GLN B 1 52 ? 6.028   -11.604 -6.042  1.00 0.00 ? 52 GLN B C    4  
ATOM 7699  O O    . GLN B 1 52 ? 5.345   -12.554 -6.425  1.00 0.00 ? 52 GLN B O    4  
ATOM 7700  C CB   . GLN B 1 52 ? 6.220   -10.570 -3.766  1.00 0.00 ? 52 GLN B CB   4  
ATOM 7701  C CG   . GLN B 1 52 ? 5.586   -11.122 -2.500  1.00 0.00 ? 52 GLN B CG   4  
ATOM 7702  C CD   . GLN B 1 52 ? 6.578   -11.870 -1.631  1.00 0.00 ? 52 GLN B CD   4  
ATOM 7703  O OE1  . GLN B 1 52 ? 7.735   -11.469 -1.502  1.00 0.00 ? 52 GLN B OE1  4  
ATOM 7704  N NE2  . GLN B 1 52 ? 6.130   -12.966 -1.029  1.00 0.00 ? 52 GLN B NE2  4  
ATOM 7705  H H    . GLN B 1 52 ? 8.574   -10.585 -4.868  1.00 0.00 ? 52 GLN B H    4  
ATOM 7706  H HA   . GLN B 1 52 ? 6.597   -12.623 -4.255  1.00 0.00 ? 52 GLN B HA   4  
ATOM 7707  H HB2  . GLN B 1 52 ? 7.034   -9.921  -3.481  1.00 0.00 ? 52 GLN B HB2  4  
ATOM 7708  H HB3  . GLN B 1 52 ? 5.475   -9.989  -4.291  1.00 0.00 ? 52 GLN B HB3  4  
ATOM 7709  H HG2  . GLN B 1 52 ? 5.179   -10.302 -1.929  1.00 0.00 ? 52 GLN B HG2  4  
ATOM 7710  H HG3  . GLN B 1 52 ? 4.790   -11.798 -2.776  1.00 0.00 ? 52 GLN B HG3  4  
ATOM 7711  H HE21 . GLN B 1 52 ? 5.197   -13.227 -1.178  1.00 0.00 ? 52 GLN B HE21 4  
ATOM 7712  H HE22 . GLN B 1 52 ? 6.750   -13.469 -0.461  1.00 0.00 ? 52 GLN B HE22 4  
ATOM 7713  N N    . ALA B 1 53 ? 6.190   -10.493 -6.754  1.00 0.00 ? 53 ALA B N    4  
ATOM 7714  C CA   . ALA B 1 53 ? 5.560   -10.324 -8.055  1.00 0.00 ? 53 ALA B CA   4  
ATOM 7715  C C    . ALA B 1 53 ? 6.061   -11.385 -9.027  1.00 0.00 ? 53 ALA B C    4  
ATOM 7716  O O    . ALA B 1 53 ? 5.273   -12.086 -9.661  1.00 0.00 ? 53 ALA B O    4  
ATOM 7717  C CB   . ALA B 1 53 ? 5.831   -8.930  -8.600  1.00 0.00 ? 53 ALA B CB   4  
ATOM 7718  H H    . ALA B 1 53 ? 6.754   -9.775  -6.397  1.00 0.00 ? 53 ALA B H    4  
ATOM 7719  H HA   . ALA B 1 53 ? 4.493   -10.438 -7.928  1.00 0.00 ? 53 ALA B HA   4  
ATOM 7720  H HB1  . ALA B 1 53 ? 4.931   -8.537  -9.049  1.00 0.00 ? 53 ALA B HB1  4  
ATOM 7721  H HB2  . ALA B 1 53 ? 6.613   -8.979  -9.344  1.00 0.00 ? 53 ALA B HB2  4  
ATOM 7722  H HB3  . ALA B 1 53 ? 6.143   -8.283  -7.793  1.00 0.00 ? 53 ALA B HB3  4  
ATOM 7723  N N    . GLU B 1 54 ? 7.381   -11.501 -9.128  1.00 0.00 ? 54 GLU B N    4  
ATOM 7724  C CA   . GLU B 1 54 ? 7.998   -12.482 -10.010 1.00 0.00 ? 54 GLU B CA   4  
ATOM 7725  C C    . GLU B 1 54 ? 8.719   -13.552 -9.198  1.00 0.00 ? 54 GLU B C    4  
ATOM 7726  O O    . GLU B 1 54 ? 9.673   -13.263 -8.478  1.00 0.00 ? 54 GLU B O    4  
ATOM 7727  C CB   . GLU B 1 54 ? 8.981   -11.798 -10.963 1.00 0.00 ? 54 GLU B CB   4  
ATOM 7728  C CG   . GLU B 1 54 ? 9.462   -12.699 -12.089 1.00 0.00 ? 54 GLU B CG   4  
ATOM 7729  C CD   . GLU B 1 54 ? 9.837   -11.923 -13.336 1.00 0.00 ? 54 GLU B CD   4  
ATOM 7730  O OE1  . GLU B 1 54 ? 9.058   -11.033 -13.739 1.00 0.00 ? 54 GLU B OE1  4  
ATOM 7731  O OE2  . GLU B 1 54 ? 10.910  -12.204 -13.911 1.00 0.00 ? 54 GLU B OE2  4  
ATOM 7732  H H    . GLU B 1 54 ? 7.955   -10.915 -8.591  1.00 0.00 ? 54 GLU B H    4  
ATOM 7733  H HA   . GLU B 1 54 ? 7.215   -12.950 -10.588 1.00 0.00 ? 54 GLU B HA   4  
ATOM 7734  H HB2  . GLU B 1 54 ? 8.500   -10.936 -11.400 1.00 0.00 ? 54 GLU B HB2  4  
ATOM 7735  H HB3  . GLU B 1 54 ? 9.843   -11.472 -10.399 1.00 0.00 ? 54 GLU B HB3  4  
ATOM 7736  H HG2  . GLU B 1 54 ? 10.329  -13.246 -11.750 1.00 0.00 ? 54 GLU B HG2  4  
ATOM 7737  H HG3  . GLU B 1 54 ? 8.673   -13.394 -12.339 1.00 0.00 ? 54 GLU B HG3  4  
ATOM 7738  N N    . LYS B 1 55 ? 8.253   -14.788 -9.316  1.00 0.00 ? 55 LYS B N    4  
ATOM 7739  C CA   . LYS B 1 55 ? 8.848   -15.905 -8.592  1.00 0.00 ? 55 LYS B CA   4  
ATOM 7740  C C    . LYS B 1 55 ? 10.306  -16.104 -8.998  1.00 0.00 ? 55 LYS B C    4  
ATOM 7741  O O    . LYS B 1 55 ? 10.595  -16.607 -10.083 1.00 0.00 ? 55 LYS B O    4  
ATOM 7742  C CB   . LYS B 1 55 ? 8.052   -17.187 -8.848  1.00 0.00 ? 55 LYS B CB   4  
ATOM 7743  C CG   . LYS B 1 55 ? 7.245   -17.650 -7.645  1.00 0.00 ? 55 LYS B CG   4  
ATOM 7744  C CD   . LYS B 1 55 ? 7.513   -19.110 -7.319  1.00 0.00 ? 55 LYS B CD   4  
ATOM 7745  C CE   . LYS B 1 55 ? 7.400   -19.377 -5.826  1.00 0.00 ? 55 LYS B CE   4  
ATOM 7746  N NZ   . LYS B 1 55 ? 6.021   -19.785 -5.435  1.00 0.00 ? 55 LYS B NZ   4  
ATOM 7747  H H    . LYS B 1 55 ? 7.488   -14.953 -9.903  1.00 0.00 ? 55 LYS B H    4  
ATOM 7748  H HA   . LYS B 1 55 ? 8.810   -15.673 -7.538  1.00 0.00 ? 55 LYS B HA   4  
ATOM 7749  H HB2  . LYS B 1 55 ? 7.370   -17.015 -9.667  1.00 0.00 ? 55 LYS B HB2  4  
ATOM 7750  H HB3  . LYS B 1 55 ? 8.737   -17.976 -9.121  1.00 0.00 ? 55 LYS B HB3  4  
ATOM 7751  H HG2  . LYS B 1 55 ? 7.512   -17.046 -6.791  1.00 0.00 ? 55 LYS B HG2  4  
ATOM 7752  H HG3  . LYS B 1 55 ? 6.193   -17.526 -7.861  1.00 0.00 ? 55 LYS B HG3  4  
ATOM 7753  H HD2  . LYS B 1 55 ? 6.794   -19.724 -7.839  1.00 0.00 ? 55 LYS B HD2  4  
ATOM 7754  H HD3  . LYS B 1 55 ? 8.511   -19.365 -7.646  1.00 0.00 ? 55 LYS B HD3  4  
ATOM 7755  H HE2  . LYS B 1 55 ? 8.087   -20.167 -5.561  1.00 0.00 ? 55 LYS B HE2  4  
ATOM 7756  H HE3  . LYS B 1 55 ? 7.665   -18.477 -5.292  1.00 0.00 ? 55 LYS B HE3  4  
ATOM 7757  H HZ1  . LYS B 1 55 ? 6.023   -20.767 -5.092  1.00 0.00 ? 55 LYS B HZ1  4  
ATOM 7758  H HZ2  . LYS B 1 55 ? 5.380   -19.716 -6.251  1.00 0.00 ? 55 LYS B HZ2  4  
ATOM 7759  H HZ3  . LYS B 1 55 ? 5.667   -19.166 -4.678  1.00 0.00 ? 55 LYS B HZ3  4  
ATOM 7760  N N    . SER B 1 56 ? 11.219  -15.708 -8.117  1.00 0.00 ? 56 SER B N    4  
ATOM 7761  C CA   . SER B 1 56 ? 12.646  -15.846 -8.383  1.00 0.00 ? 56 SER B CA   4  
ATOM 7762  C C    . SER B 1 56 ? 13.088  -17.298 -8.227  1.00 0.00 ? 56 SER B C    4  
ATOM 7763  O O    . SER B 1 56 ? 12.280  -18.172 -7.915  1.00 0.00 ? 56 SER B O    4  
ATOM 7764  C CB   . SER B 1 56 ? 13.451  -14.951 -7.439  1.00 0.00 ? 56 SER B CB   4  
ATOM 7765  O OG   . SER B 1 56 ? 14.761  -14.732 -7.936  1.00 0.00 ? 56 SER B OG   4  
ATOM 7766  H H    . SER B 1 56 ? 10.927  -15.316 -7.268  1.00 0.00 ? 56 SER B H    4  
ATOM 7767  H HA   . SER B 1 56 ? 12.826  -15.535 -9.401  1.00 0.00 ? 56 SER B HA   4  
ATOM 7768  H HB2  . SER B 1 56 ? 12.954  -13.998 -7.338  1.00 0.00 ? 56 SER B HB2  4  
ATOM 7769  H HB3  . SER B 1 56 ? 13.522  -15.424 -6.470  1.00 0.00 ? 56 SER B HB3  4  
ATOM 7770  H HG   . SER B 1 56 ? 14.710  -14.304 -8.794  1.00 0.00 ? 56 SER B HG   4  
ATOM 7771  N N    . GLN B 1 57 ? 14.375  -17.547 -8.445  1.00 0.00 ? 57 GLN B N    4  
ATOM 7772  C CA   . GLN B 1 57 ? 14.925  -18.894 -8.327  1.00 0.00 ? 57 GLN B CA   4  
ATOM 7773  C C    . GLN B 1 57 ? 14.161  -19.877 -9.210  1.00 0.00 ? 57 GLN B C    4  
ATOM 7774  O O    . GLN B 1 57 ? 13.395  -20.706 -8.716  1.00 0.00 ? 57 GLN B O    4  
ATOM 7775  C CB   . GLN B 1 57 ? 14.882  -19.358 -6.870  1.00 0.00 ? 57 GLN B CB   4  
ATOM 7776  C CG   . GLN B 1 57 ? 15.650  -20.645 -6.617  1.00 0.00 ? 57 GLN B CG   4  
ATOM 7777  C CD   . GLN B 1 57 ? 16.966  -20.409 -5.902  1.00 0.00 ? 57 GLN B CD   4  
ATOM 7778  O OE1  . GLN B 1 57 ? 16.990  -20.019 -4.734  1.00 0.00 ? 57 GLN B OE1  4  
ATOM 7779  N NE2  . GLN B 1 57 ? 18.070  -20.643 -6.601  1.00 0.00 ? 57 GLN B NE2  4  
ATOM 7780  H H    . GLN B 1 57 ? 14.971  -16.809 -8.689  1.00 0.00 ? 57 GLN B H    4  
ATOM 7781  H HA   . GLN B 1 57 ? 15.953  -18.861 -8.654  1.00 0.00 ? 57 GLN B HA   4  
ATOM 7782  H HB2  . GLN B 1 57 ? 15.303  -18.584 -6.245  1.00 0.00 ? 57 GLN B HB2  4  
ATOM 7783  H HB3  . GLN B 1 57 ? 13.852  -19.517 -6.585  1.00 0.00 ? 57 GLN B HB3  4  
ATOM 7784  H HG2  . GLN B 1 57 ? 15.042  -21.300 -6.012  1.00 0.00 ? 57 GLN B HG2  4  
ATOM 7785  H HG3  . GLN B 1 57 ? 15.853  -21.120 -7.566  1.00 0.00 ? 57 GLN B HG3  4  
ATOM 7786  H HE21 . GLN B 1 57 ? 17.975  -20.952 -7.526  1.00 0.00 ? 57 GLN B HE21 4  
ATOM 7787  H HE22 . GLN B 1 57 ? 18.935  -20.498 -6.163  1.00 0.00 ? 57 GLN B HE22 4  
ATOM 7788  N N    . GLN B 1 58 ? 14.373  -19.779 -10.518 1.00 0.00 ? 58 GLN B N    4  
ATOM 7789  C CA   . GLN B 1 58 ? 13.703  -20.659 -11.469 1.00 0.00 ? 58 GLN B CA   4  
ATOM 7790  C C    . GLN B 1 58 ? 14.375  -22.028 -11.510 1.00 0.00 ? 58 GLN B C    4  
ATOM 7791  O O    . GLN B 1 58 ? 15.587  -22.142 -11.328 1.00 0.00 ? 58 GLN B O    4  
ATOM 7792  C CB   . GLN B 1 58 ? 13.708  -20.033 -12.865 1.00 0.00 ? 58 GLN B CB   4  
ATOM 7793  C CG   . GLN B 1 58 ? 12.771  -18.844 -13.002 1.00 0.00 ? 58 GLN B CG   4  
ATOM 7794  C CD   . GLN B 1 58 ? 11.315  -19.257 -13.091 1.00 0.00 ? 58 GLN B CD   4  
ATOM 7795  O OE1  . GLN B 1 58 ? 10.749  -19.346 -14.181 1.00 0.00 ? 58 GLN B OE1  4  
ATOM 7796  N NE2  . GLN B 1 58 ? 10.700  -19.511 -11.942 1.00 0.00 ? 58 GLN B NE2  4  
ATOM 7797  H H    . GLN B 1 58 ? 14.994  -19.098 -10.852 1.00 0.00 ? 58 GLN B H    4  
ATOM 7798  H HA   . GLN B 1 58 ? 12.682  -20.782 -11.144 1.00 0.00 ? 58 GLN B HA   4  
ATOM 7799  H HB2  . GLN B 1 58 ? 14.710  -19.702 -13.095 1.00 0.00 ? 58 GLN B HB2  4  
ATOM 7800  H HB3  . GLN B 1 58 ? 13.412  -20.782 -13.584 1.00 0.00 ? 58 GLN B HB3  4  
ATOM 7801  H HG2  . GLN B 1 58 ? 12.895  -18.203 -12.141 1.00 0.00 ? 58 GLN B HG2  4  
ATOM 7802  H HG3  . GLN B 1 58 ? 13.031  -18.297 -13.896 1.00 0.00 ? 58 GLN B HG3  4  
ATOM 7803  H HE21 . GLN B 1 58 ? 11.213  -19.419 -11.112 1.00 0.00 ? 58 GLN B HE21 4  
ATOM 7804  H HE22 . GLN B 1 58 ? 9.758   -19.780 -11.970 1.00 0.00 ? 58 GLN B HE22 4  
ATOM 7805  N N    . SER B 1 59 ? 13.578  -23.064 -11.751 1.00 0.00 ? 59 SER B N    4  
ATOM 7806  C CA   . SER B 1 59 ? 14.095  -24.427 -11.816 1.00 0.00 ? 59 SER B CA   4  
ATOM 7807  C C    . SER B 1 59 ? 14.005  -24.976 -13.237 1.00 0.00 ? 59 SER B C    4  
ATOM 7808  O O    . SER B 1 59 ? 12.915  -25.108 -13.794 1.00 0.00 ? 59 SER B O    4  
ATOM 7809  C CB   . SER B 1 59 ? 13.322  -25.334 -10.857 1.00 0.00 ? 59 SER B CB   4  
ATOM 7810  O OG   . SER B 1 59 ? 13.265  -24.772 -9.558  1.00 0.00 ? 59 SER B OG   4  
ATOM 7811  H H    . SER B 1 59 ? 12.620  -22.910 -11.888 1.00 0.00 ? 59 SER B H    4  
ATOM 7812  H HA   . SER B 1 59 ? 15.132  -24.403 -11.518 1.00 0.00 ? 59 SER B HA   4  
ATOM 7813  H HB2  . SER B 1 59 ? 12.315  -25.466 -11.223 1.00 0.00 ? 59 SER B HB2  4  
ATOM 7814  H HB3  . SER B 1 59 ? 13.813  -26.294 -10.799 1.00 0.00 ? 59 SER B HB3  4  
ATOM 7815  H HG   . SER B 1 59 ? 12.688  -25.303 -9.004  1.00 0.00 ? 59 SER B HG   4  
ATOM 7816  N N    . SER B 1 60 ? 15.157  -25.293 -13.818 1.00 0.00 ? 60 SER B N    4  
ATOM 7817  C CA   . SER B 1 60 ? 15.209  -25.827 -15.173 1.00 0.00 ? 60 SER B CA   4  
ATOM 7818  C C    . SER B 1 60 ? 15.687  -27.275 -15.170 1.00 0.00 ? 60 SER B C    4  
ATOM 7819  O O    . SER B 1 60 ? 16.723  -27.596 -14.586 1.00 0.00 ? 60 SER B O    4  
ATOM 7820  C CB   . SER B 1 60 ? 16.132  -24.975 -16.045 1.00 0.00 ? 60 SER B CB   4  
ATOM 7821  O OG   . SER B 1 60 ? 17.418  -24.856 -15.462 1.00 0.00 ? 60 SER B OG   4  
ATOM 7822  H H    . SER B 1 60 ? 15.993  -25.164 -13.323 1.00 0.00 ? 60 SER B H    4  
ATOM 7823  H HA   . SER B 1 60 ? 14.210  -25.792 -15.582 1.00 0.00 ? 60 SER B HA   4  
ATOM 7824  H HB2  . SER B 1 60 ? 16.233  -25.435 -17.017 1.00 0.00 ? 60 SER B HB2  4  
ATOM 7825  H HB3  . SER B 1 60 ? 15.708  -23.988 -16.157 1.00 0.00 ? 60 SER B HB3  4  
ATOM 7826  H HG   . SER B 1 60 ? 18.057  -25.334 -15.995 1.00 0.00 ? 60 SER B HG   4  
ATOM 7827  N N    . TYR B 1 61 ? 14.927  -28.146 -15.825 1.00 0.00 ? 61 TYR B N    4  
ATOM 7828  C CA   . TYR B 1 61 ? 15.274  -29.561 -15.897 1.00 0.00 ? 61 TYR B CA   4  
ATOM 7829  C C    . TYR B 1 61 ? 14.363  -30.295 -16.875 1.00 0.00 ? 61 TYR B C    4  
ATOM 7830  O O    . TYR B 1 61 ? 13.134  -30.083 -16.811 1.00 0.00 ? 61 TYR B O    4  
ATOM 7831  C CB   . TYR B 1 61 ? 15.180  -30.201 -14.510 1.00 0.00 ? 61 TYR B CB   4  
ATOM 7832  C CG   . TYR B 1 61 ? 16.409  -30.992 -14.123 1.00 0.00 ? 61 TYR B CG   4  
ATOM 7833  C CD1  . TYR B 1 61 ? 16.959  -31.927 -14.992 1.00 0.00 ? 61 TYR B CD1  4  
ATOM 7834  C CD2  . TYR B 1 61 ? 17.021  -30.804 -12.890 1.00 0.00 ? 61 TYR B CD2  4  
ATOM 7835  C CE1  . TYR B 1 61 ? 18.082  -32.652 -14.642 1.00 0.00 ? 61 TYR B CE1  4  
ATOM 7836  C CE2  . TYR B 1 61 ? 18.144  -31.525 -12.533 1.00 0.00 ? 61 TYR B CE2  4  
ATOM 7837  C CZ   . TYR B 1 61 ? 18.671  -32.447 -13.413 1.00 0.00 ? 61 TYR B CZ   4  
ATOM 7838  O OH   . TYR B 1 61 ? 19.790  -33.167 -13.061 1.00 0.00 ? 61 TYR B OH   4  
ATOM 7839  O OXT  . TYR B 1 61 ? 14.886  -31.077 -17.697 1.00 0.00 ? 61 TYR B OXT  4  
ATOM 7840  H H    . TYR B 1 61 ? 14.113  -27.831 -16.270 1.00 0.00 ? 61 TYR B H    4  
ATOM 7841  H HA   . TYR B 1 61 ? 16.292  -29.634 -16.248 1.00 0.00 ? 61 TYR B HA   4  
ATOM 7842  H HB2  . TYR B 1 61 ? 15.041  -29.426 -13.772 1.00 0.00 ? 61 TYR B HB2  4  
ATOM 7843  H HB3  . TYR B 1 61 ? 14.332  -30.871 -14.485 1.00 0.00 ? 61 TYR B HB3  4  
ATOM 7844  H HD1  . TYR B 1 61 ? 16.495  -32.085 -15.955 1.00 0.00 ? 61 TYR B HD1  4  
ATOM 7845  H HD2  . TYR B 1 61 ? 16.605  -30.082 -12.203 1.00 0.00 ? 61 TYR B HD2  4  
ATOM 7846  H HE1  . TYR B 1 61 ? 18.495  -33.374 -15.332 1.00 0.00 ? 61 TYR B HE1  4  
ATOM 7847  H HE2  . TYR B 1 61 ? 18.605  -31.365 -11.570 1.00 0.00 ? 61 TYR B HE2  4  
ATOM 7848  H HH   . TYR B 1 61 ? 19.693  -34.075 -13.358 1.00 0.00 ? 61 TYR B HH   4  
ATOM 7849  N N    . MET A 1 1  ? -2.263  -9.405  -5.725  1.00 0.00 ? 1  MET A N    5  
ATOM 7850  C CA   . MET A 1 1  ? -2.164  -9.937  -4.340  1.00 0.00 ? 1  MET A CA   5  
ATOM 7851  C C    . MET A 1 1  ? -0.711  -10.164 -3.939  1.00 0.00 ? 1  MET A C    5  
ATOM 7852  O O    . MET A 1 1  ? -0.146  -11.229 -4.188  1.00 0.00 ? 1  MET A O    5  
ATOM 7853  C CB   . MET A 1 1  ? -2.943  -11.252 -4.267  1.00 0.00 ? 1  MET A CB   5  
ATOM 7854  C CG   . MET A 1 1  ? -4.353  -11.156 -4.827  1.00 0.00 ? 1  MET A CG   5  
ATOM 7855  S SD   . MET A 1 1  ? -5.510  -12.254 -3.986  1.00 0.00 ? 1  MET A SD   5  
ATOM 7856  C CE   . MET A 1 1  ? -7.043  -11.348 -4.184  1.00 0.00 ? 1  MET A CE   5  
ATOM 7857  H H1   . MET A 1 1  ? -3.215  -9.003  -5.843  1.00 0.00 ? 1  MET A H1   5  
ATOM 7858  H H2   . MET A 1 1  ? -2.106  -10.197 -6.380  1.00 0.00 ? 1  MET A H2   5  
ATOM 7859  H H3   . MET A 1 1  ? -1.533  -8.674  -5.836  1.00 0.00 ? 1  MET A H3   5  
ATOM 7860  H HA   . MET A 1 1  ? -2.609  -9.222  -3.664  1.00 0.00 ? 1  MET A HA   5  
ATOM 7861  H HB2  . MET A 1 1  ? -2.408  -12.005 -4.825  1.00 0.00 ? 1  MET A HB2  5  
ATOM 7862  H HB3  . MET A 1 1  ? -3.009  -11.560 -3.234  1.00 0.00 ? 1  MET A HB3  5  
ATOM 7863  H HG2  . MET A 1 1  ? -4.701  -10.139 -4.718  1.00 0.00 ? 1  MET A HG2  5  
ATOM 7864  H HG3  . MET A 1 1  ? -4.328  -11.416 -5.875  1.00 0.00 ? 1  MET A HG3  5  
ATOM 7865  H HE1  . MET A 1 1  ? -6.824  -10.319 -4.429  1.00 0.00 ? 1  MET A HE1  5  
ATOM 7866  H HE2  . MET A 1 1  ? -7.605  -11.386 -3.262  1.00 0.00 ? 1  MET A HE2  5  
ATOM 7867  H HE3  . MET A 1 1  ? -7.623  -11.792 -4.979  1.00 0.00 ? 1  MET A HE3  5  
ATOM 7868  N N    . LEU A 1 2  ? -0.110  -9.155  -3.317  1.00 0.00 ? 2  LEU A N    5  
ATOM 7869  C CA   . LEU A 1 2  ? 1.279   -9.243  -2.880  1.00 0.00 ? 2  LEU A CA   5  
ATOM 7870  C C    . LEU A 1 2  ? 1.386   -9.070  -1.368  1.00 0.00 ? 2  LEU A C    5  
ATOM 7871  O O    . LEU A 1 2  ? 1.127   -7.988  -0.841  1.00 0.00 ? 2  LEU A O    5  
ATOM 7872  C CB   . LEU A 1 2  ? 2.123   -8.177  -3.582  1.00 0.00 ? 2  LEU A CB   5  
ATOM 7873  C CG   . LEU A 1 2  ? 2.669   -8.584  -4.951  1.00 0.00 ? 2  LEU A CG   5  
ATOM 7874  C CD1  . LEU A 1 2  ? 3.550   -9.818  -4.828  1.00 0.00 ? 2  LEU A CD1  5  
ATOM 7875  C CD2  . LEU A 1 2  ? 1.527   -8.833  -5.926  1.00 0.00 ? 2  LEU A CD2  5  
ATOM 7876  H H    . LEU A 1 2  ? -0.613  -8.330  -3.147  1.00 0.00 ? 2  LEU A H    5  
ATOM 7877  H HA   . LEU A 1 2  ? 1.653   -10.219 -3.149  1.00 0.00 ? 2  LEU A HA   5  
ATOM 7878  H HB2  . LEU A 1 2  ? 1.515   -7.293  -3.708  1.00 0.00 ? 2  LEU A HB2  5  
ATOM 7879  H HB3  . LEU A 1 2  ? 2.959   -7.932  -2.945  1.00 0.00 ? 2  LEU A HB3  5  
ATOM 7880  H HG   . LEU A 1 2  ? 3.275   -7.780  -5.343  1.00 0.00 ? 2  LEU A HG   5  
ATOM 7881  H HD11 . LEU A 1 2  ? 4.475   -9.655  -5.362  1.00 0.00 ? 2  LEU A HD11 5  
ATOM 7882  H HD12 . LEU A 1 2  ? 3.038   -10.671 -5.249  1.00 0.00 ? 2  LEU A HD12 5  
ATOM 7883  H HD13 . LEU A 1 2  ? 3.765   -10.006 -3.787  1.00 0.00 ? 2  LEU A HD13 5  
ATOM 7884  H HD21 . LEU A 1 2  ? 1.810   -8.485  -6.908  1.00 0.00 ? 2  LEU A HD21 5  
ATOM 7885  H HD22 . LEU A 1 2  ? 0.648   -8.301  -5.594  1.00 0.00 ? 2  LEU A HD22 5  
ATOM 7886  H HD23 . LEU A 1 2  ? 1.313   -9.891  -5.966  1.00 0.00 ? 2  LEU A HD23 5  
ATOM 7887  N N    . ILE A 1 3  ? 1.776   -10.135 -0.673  1.00 0.00 ? 3  ILE A N    5  
ATOM 7888  C CA   . ILE A 1 3  ? 1.920   -10.078 0.776   1.00 0.00 ? 3  ILE A CA   5  
ATOM 7889  C C    . ILE A 1 3  ? 3.383   -9.900  1.169   1.00 0.00 ? 3  ILE A C    5  
ATOM 7890  O O    . ILE A 1 3  ? 4.180   -10.836 1.100   1.00 0.00 ? 3  ILE A O    5  
ATOM 7891  C CB   . ILE A 1 3  ? 1.339   -11.339 1.455   1.00 0.00 ? 3  ILE A CB   5  
ATOM 7892  C CG1  . ILE A 1 3  ? 1.308   -11.163 2.974   1.00 0.00 ? 3  ILE A CG1  5  
ATOM 7893  C CG2  . ILE A 1 3  ? 2.135   -12.578 1.074   1.00 0.00 ? 3  ILE A CG2  5  
ATOM 7894  C CD1  . ILE A 1 3  ? 0.115   -11.825 3.633   1.00 0.00 ? 3  ILE A CD1  5  
ATOM 7895  H H    . ILE A 1 3  ? 1.978   -10.971 -1.143  1.00 0.00 ? 3  ILE A H    5  
ATOM 7896  H HA   . ILE A 1 3  ? 1.367   -9.222  1.127   1.00 0.00 ? 3  ILE A HA   5  
ATOM 7897  H HB   . ILE A 1 3  ? 0.329   -11.473 1.099   1.00 0.00 ? 3  ILE A HB   5  
ATOM 7898  H HG12 . ILE A 1 3  ? 2.203   -11.593 3.399   1.00 0.00 ? 3  ILE A HG12 5  
ATOM 7899  H HG13 . ILE A 1 3  ? 1.275   -10.108 3.208   1.00 0.00 ? 3  ILE A HG13 5  
ATOM 7900  H HG21 . ILE A 1 3  ? 3.016   -12.646 1.696   1.00 0.00 ? 3  ILE A HG21 5  
ATOM 7901  H HG22 . ILE A 1 3  ? 2.430   -12.513 0.038   1.00 0.00 ? 3  ILE A HG22 5  
ATOM 7902  H HG23 . ILE A 1 3  ? 1.523   -13.456 1.221   1.00 0.00 ? 3  ILE A HG23 5  
ATOM 7903  H HD11 . ILE A 1 3  ? -0.738  -11.164 3.586   1.00 0.00 ? 3  ILE A HD11 5  
ATOM 7904  H HD12 . ILE A 1 3  ? 0.346   -12.040 4.667   1.00 0.00 ? 3  ILE A HD12 5  
ATOM 7905  H HD13 . ILE A 1 3  ? -0.115  -12.746 3.118   1.00 0.00 ? 3  ILE A HD13 5  
ATOM 7906  N N    . LEU A 1 4  ? 3.724   -8.686  1.585   1.00 0.00 ? 4  LEU A N    5  
ATOM 7907  C CA   . LEU A 1 4  ? 5.084   -8.367  1.999   1.00 0.00 ? 4  LEU A CA   5  
ATOM 7908  C C    . LEU A 1 4  ? 5.105   -7.786  3.409   1.00 0.00 ? 4  LEU A C    5  
ATOM 7909  O O    . LEU A 1 4  ? 4.471   -6.764  3.675   1.00 0.00 ? 4  LEU A O    5  
ATOM 7910  C CB   . LEU A 1 4  ? 5.721   -7.383  1.014   1.00 0.00 ? 4  LEU A CB   5  
ATOM 7911  C CG   . LEU A 1 4  ? 7.078   -7.816  0.455   1.00 0.00 ? 4  LEU A CG   5  
ATOM 7912  C CD1  . LEU A 1 4  ? 8.081   -8.011  1.581   1.00 0.00 ? 4  LEU A CD1  5  
ATOM 7913  C CD2  . LEU A 1 4  ? 6.934   -9.092  -0.360  1.00 0.00 ? 4  LEU A CD2  5  
ATOM 7914  H H    . LEU A 1 4  ? 3.037   -7.988  1.630   1.00 0.00 ? 4  LEU A H    5  
ATOM 7915  H HA   . LEU A 1 4  ? 5.654   -9.284  1.994   1.00 0.00 ? 4  LEU A HA   5  
ATOM 7916  H HB2  . LEU A 1 4  ? 5.041   -7.245  0.186   1.00 0.00 ? 4  LEU A HB2  5  
ATOM 7917  H HB3  . LEU A 1 4  ? 5.850   -6.434  1.513   1.00 0.00 ? 4  LEU A HB3  5  
ATOM 7918  H HG   . LEU A 1 4  ? 7.455   -7.042  -0.197  1.00 0.00 ? 4  LEU A HG   5  
ATOM 7919  H HD11 . LEU A 1 4  ? 9.079   -8.055  1.171   1.00 0.00 ? 4  LEU A HD11 5  
ATOM 7920  H HD12 . LEU A 1 4  ? 7.865   -8.933  2.100   1.00 0.00 ? 4  LEU A HD12 5  
ATOM 7921  H HD13 . LEU A 1 4  ? 8.012   -7.184  2.272   1.00 0.00 ? 4  LEU A HD13 5  
ATOM 7922  H HD21 . LEU A 1 4  ? 6.756   -9.925  0.304   1.00 0.00 ? 4  LEU A HD21 5  
ATOM 7923  H HD22 . LEU A 1 4  ? 7.842   -9.266  -0.920  1.00 0.00 ? 4  LEU A HD22 5  
ATOM 7924  H HD23 . LEU A 1 4  ? 6.104   -8.992  -1.043  1.00 0.00 ? 4  LEU A HD23 5  
ATOM 7925  N N    . THR A 1 5  ? 5.831   -8.433  4.314   1.00 0.00 ? 5  THR A N    5  
ATOM 7926  C CA   . THR A 1 5  ? 5.921   -7.953  5.688   1.00 0.00 ? 5  THR A CA   5  
ATOM 7927  C C    . THR A 1 5  ? 6.421   -6.515  5.722   1.00 0.00 ? 5  THR A C    5  
ATOM 7928  O O    . THR A 1 5  ? 7.305   -6.136  4.954   1.00 0.00 ? 5  THR A O    5  
ATOM 7929  C CB   . THR A 1 5  ? 6.844   -8.849  6.516   1.00 0.00 ? 5  THR A CB   5  
ATOM 7930  O OG1  . THR A 1 5  ? 7.203   -10.012 5.791   1.00 0.00 ? 5  THR A OG1  5  
ATOM 7931  C CG2  . THR A 1 5  ? 6.222   -9.293  7.821   1.00 0.00 ? 5  THR A CG2  5  
ATOM 7932  H H    . THR A 1 5  ? 6.312   -9.247  4.058   1.00 0.00 ? 5  THR A H    5  
ATOM 7933  H HA   . THR A 1 5  ? 4.930   -7.983  6.113   1.00 0.00 ? 5  THR A HA   5  
ATOM 7934  H HB   . THR A 1 5  ? 7.747   -8.301  6.750   1.00 0.00 ? 5  THR A HB   5  
ATOM 7935  H HG1  . THR A 1 5  ? 8.157   -10.119 5.810   1.00 0.00 ? 5  THR A HG1  5  
ATOM 7936  H HG21 . THR A 1 5  ? 5.598   -10.157 7.647   1.00 0.00 ? 5  THR A HG21 5  
ATOM 7937  H HG22 . THR A 1 5  ? 5.622   -8.491  8.225   1.00 0.00 ? 5  THR A HG22 5  
ATOM 7938  H HG23 . THR A 1 5  ? 7.002   -9.549  8.524   1.00 0.00 ? 5  THR A HG23 5  
ATOM 7939  N N    . ARG A 1 6  ? 5.848   -5.716  6.613   1.00 0.00 ? 6  ARG A N    5  
ATOM 7940  C CA   . ARG A 1 6  ? 6.238   -4.319  6.739   1.00 0.00 ? 6  ARG A CA   5  
ATOM 7941  C C    . ARG A 1 6  ? 5.921   -3.784  8.130   1.00 0.00 ? 6  ARG A C    5  
ATOM 7942  O O    . ARG A 1 6  ? 4.924   -4.167  8.745   1.00 0.00 ? 6  ARG A O    5  
ATOM 7943  C CB   . ARG A 1 6  ? 5.529   -3.472  5.681   1.00 0.00 ? 6  ARG A CB   5  
ATOM 7944  C CG   . ARG A 1 6  ? 6.149   -3.582  4.298   1.00 0.00 ? 6  ARG A CG   5  
ATOM 7945  C CD   . ARG A 1 6  ? 5.621   -2.504  3.364   1.00 0.00 ? 6  ARG A CD   5  
ATOM 7946  N NE   . ARG A 1 6  ? 6.228   -2.583  2.037   1.00 0.00 ? 6  ARG A NE   5  
ATOM 7947  C CZ   . ARG A 1 6  ? 5.846   -3.445  1.097   1.00 0.00 ? 6  ARG A CZ   5  
ATOM 7948  N NH1  . ARG A 1 6  ? 4.863   -4.304  1.334   1.00 0.00 ? 6  ARG A NH1  5  
ATOM 7949  N NH2  . ARG A 1 6  ? 6.449   -3.447  -0.084  1.00 0.00 ? 6  ARG A NH2  5  
ATOM 7950  H H    . ARG A 1 6  ? 5.149   -6.074  7.199   1.00 0.00 ? 6  ARG A H    5  
ATOM 7951  H HA   . ARG A 1 6  ? 7.304   -4.258  6.579   1.00 0.00 ? 6  ARG A HA   5  
ATOM 7952  H HB2  . ARG A 1 6  ? 4.498   -3.786  5.616   1.00 0.00 ? 6  ARG A HB2  5  
ATOM 7953  H HB3  . ARG A 1 6  ? 5.562   -2.436  5.985   1.00 0.00 ? 6  ARG A HB3  5  
ATOM 7954  H HG2  . ARG A 1 6  ? 7.220   -3.475  4.384   1.00 0.00 ? 6  ARG A HG2  5  
ATOM 7955  H HG3  . ARG A 1 6  ? 5.913   -4.552  3.884   1.00 0.00 ? 6  ARG A HG3  5  
ATOM 7956  H HD2  . ARG A 1 6  ? 4.552   -2.621  3.267   1.00 0.00 ? 6  ARG A HD2  5  
ATOM 7957  H HD3  . ARG A 1 6  ? 5.839   -1.537  3.792   1.00 0.00 ? 6  ARG A HD3  5  
ATOM 7958  H HE   . ARG A 1 6  ? 6.957   -1.961  1.836   1.00 0.00 ? 6  ARG A HE   5  
ATOM 7959  H HH11 . ARG A 1 6  ? 4.404   -4.308  2.222   1.00 0.00 ? 6  ARG A HH11 5  
ATOM 7960  H HH12 . ARG A 1 6  ? 4.581   -4.949  0.623   1.00 0.00 ? 6  ARG A HH12 5  
ATOM 7961  H HH21 . ARG A 1 6  ? 7.190   -2.801  -0.268  1.00 0.00 ? 6  ARG A HH21 5  
ATOM 7962  H HH22 . ARG A 1 6  ? 6.162   -4.094  -0.790  1.00 0.00 ? 6  ARG A HH22 5  
ATOM 7963  N N    . ARG A 1 7  ? 6.781   -2.894  8.614   1.00 0.00 ? 7  ARG A N    5  
ATOM 7964  C CA   . ARG A 1 7  ? 6.607   -2.290  9.934   1.00 0.00 ? 7  ARG A CA   5  
ATOM 7965  C C    . ARG A 1 7  ? 7.740   -1.313  10.272  1.00 0.00 ? 7  ARG A C    5  
ATOM 7966  O O    . ARG A 1 7  ? 7.756   -0.734  11.356  1.00 0.00 ? 7  ARG A O    5  
ATOM 7967  C CB   . ARG A 1 7  ? 6.525   -3.376  11.009  1.00 0.00 ? 7  ARG A CB   5  
ATOM 7968  C CG   . ARG A 1 7  ? 6.177   -2.843  12.391  1.00 0.00 ? 7  ARG A CG   5  
ATOM 7969  C CD   . ARG A 1 7  ? 7.217   -3.242  13.427  1.00 0.00 ? 7  ARG A CD   5  
ATOM 7970  N NE   . ARG A 1 7  ? 8.038   -2.109  13.847  1.00 0.00 ? 7  ARG A NE   5  
ATOM 7971  C CZ   . ARG A 1 7  ? 8.916   -2.159  14.847  1.00 0.00 ? 7  ARG A CZ   5  
ATOM 7972  N NH1  . ARG A 1 7  ? 9.092   -3.285  15.528  1.00 0.00 ? 7  ARG A NH1  5  
ATOM 7973  N NH2  . ARG A 1 7  ? 9.619   -1.082  15.167  1.00 0.00 ? 7  ARG A NH2  5  
ATOM 7974  H H    . ARG A 1 7  ? 7.549   -2.639  8.068   1.00 0.00 ? 7  ARG A H    5  
ATOM 7975  H HA   . ARG A 1 7  ? 5.675   -1.744  9.923   1.00 0.00 ? 7  ARG A HA   5  
ATOM 7976  H HB2  . ARG A 1 7  ? 5.769   -4.092  10.723  1.00 0.00 ? 7  ARG A HB2  5  
ATOM 7977  H HB3  . ARG A 1 7  ? 7.479   -3.879  11.069  1.00 0.00 ? 7  ARG A HB3  5  
ATOM 7978  H HG2  . ARG A 1 7  ? 6.121   -1.766  12.349  1.00 0.00 ? 7  ARG A HG2  5  
ATOM 7979  H HG3  . ARG A 1 7  ? 5.217   -3.242  12.687  1.00 0.00 ? 7  ARG A HG3  5  
ATOM 7980  H HD2  . ARG A 1 7  ? 6.710   -3.645  14.291  1.00 0.00 ? 7  ARG A HD2  5  
ATOM 7981  H HD3  . ARG A 1 7  ? 7.858   -4.001  13.003  1.00 0.00 ? 7  ARG A HD3  5  
ATOM 7982  H HE   . ARG A 1 7  ? 7.930   -1.266  13.359  1.00 0.00 ? 7  ARG A HE   5  
ATOM 7983  H HH11 . ARG A 1 7  ? 8.566   -4.101  15.292  1.00 0.00 ? 7  ARG A HH11 5  
ATOM 7984  H HH12 . ARG A 1 7  ? 9.753   -3.316  16.278  1.00 0.00 ? 7  ARG A HH12 5  
ATOM 7985  H HH21 . ARG A 1 7  ? 9.491   -0.231  14.657  1.00 0.00 ? 7  ARG A HH21 5  
ATOM 7986  H HH22 . ARG A 1 7  ? 10.278  -1.120  15.918  1.00 0.00 ? 7  ARG A HH22 5  
ATOM 7987  N N    . VAL A 1 8  ? 8.681   -1.125  9.344   1.00 0.00 ? 8  VAL A N    5  
ATOM 7988  C CA   . VAL A 1 8  ? 9.802   -0.213  9.563   1.00 0.00 ? 8  VAL A CA   5  
ATOM 7989  C C    . VAL A 1 8  ? 10.772  -0.229  8.381   1.00 0.00 ? 8  VAL A C    5  
ATOM 7990  O O    . VAL A 1 8  ? 11.974  -0.023  8.555   1.00 0.00 ? 8  VAL A O    5  
ATOM 7991  C CB   . VAL A 1 8  ? 10.586  -0.553  10.854  1.00 0.00 ? 8  VAL A CB   5  
ATOM 7992  C CG1  . VAL A 1 8  ? 10.123  0.320   12.011  1.00 0.00 ? 8  VAL A CG1  5  
ATOM 7993  C CG2  . VAL A 1 8  ? 10.455  -2.030  11.203  1.00 0.00 ? 8  VAL A CG2  5  
ATOM 7994  H H    . VAL A 1 8  ? 8.619   -1.602  8.495   1.00 0.00 ? 8  VAL A H    5  
ATOM 7995  H HA   . VAL A 1 8  ? 9.400   0.785   9.666   1.00 0.00 ? 8  VAL A HA   5  
ATOM 7996  H HB   . VAL A 1 8  ? 11.632  -0.342  10.680  1.00 0.00 ? 8  VAL A HB   5  
ATOM 7997  H HG11 . VAL A 1 8  ? 9.558   1.156   11.627  1.00 0.00 ? 8  VAL A HG11 5  
ATOM 7998  H HG12 . VAL A 1 8  ? 10.983  0.686   12.552  1.00 0.00 ? 8  VAL A HG12 5  
ATOM 7999  H HG13 . VAL A 1 8  ? 9.500   -0.261  12.674  1.00 0.00 ? 8  VAL A HG13 5  
ATOM 8000  H HG21 . VAL A 1 8  ? 10.263  -2.597  10.303  1.00 0.00 ? 8  VAL A HG21 5  
ATOM 8001  H HG22 . VAL A 1 8  ? 9.637   -2.166  11.895  1.00 0.00 ? 8  VAL A HG22 5  
ATOM 8002  H HG23 . VAL A 1 8  ? 11.371  -2.376  11.657  1.00 0.00 ? 8  VAL A HG23 5  
ATOM 8003  N N    . GLY A 1 9  ? 10.254  -0.478  7.180   1.00 0.00 ? 9  GLY A N    5  
ATOM 8004  C CA   . GLY A 1 9  ? 11.105  -0.516  6.004   1.00 0.00 ? 9  GLY A CA   5  
ATOM 8005  C C    . GLY A 1 9  ? 10.824  0.619   5.040   1.00 0.00 ? 9  GLY A C    5  
ATOM 8006  O O    . GLY A 1 9  ? 10.987  1.790   5.384   1.00 0.00 ? 9  GLY A O    5  
ATOM 8007  H H    . GLY A 1 9  ? 9.293   -0.640  7.086   1.00 0.00 ? 9  GLY A H    5  
ATOM 8008  H HA2  . GLY A 1 9  ? 12.137  -0.459  6.318   1.00 0.00 ? 9  GLY A HA2  5  
ATOM 8009  H HA3  . GLY A 1 9  ? 10.948  -1.454  5.493   1.00 0.00 ? 9  GLY A HA3  5  
ATOM 8010  N N    . GLU A 1 10 ? 10.405  0.273   3.826   1.00 0.00 ? 10 GLU A N    5  
ATOM 8011  C CA   . GLU A 1 10 ? 10.107  1.272   2.806   1.00 0.00 ? 10 GLU A CA   5  
ATOM 8012  C C    . GLU A 1 10 ? 8.608   1.347   2.528   1.00 0.00 ? 10 GLU A C    5  
ATOM 8013  O O    . GLU A 1 10 ? 7.813   0.645   3.153   1.00 0.00 ? 10 GLU A O    5  
ATOM 8014  C CB   . GLU A 1 10 ? 10.859  0.949   1.514   1.00 0.00 ? 10 GLU A CB   5  
ATOM 8015  C CG   . GLU A 1 10 ? 12.307  1.413   1.522   1.00 0.00 ? 10 GLU A CG   5  
ATOM 8016  C CD   . GLU A 1 10 ? 13.146  0.720   0.467   1.00 0.00 ? 10 GLU A CD   5  
ATOM 8017  O OE1  . GLU A 1 10 ? 13.123  1.168   -0.699  1.00 0.00 ? 10 GLU A OE1  5  
ATOM 8018  O OE2  . GLU A 1 10 ? 13.827  -0.271  0.806   1.00 0.00 ? 10 GLU A OE2  5  
ATOM 8019  H H    . GLU A 1 10 ? 10.298  -0.677  3.611   1.00 0.00 ? 10 GLU A H    5  
ATOM 8020  H HA   . GLU A 1 10 ? 10.440  2.230   3.175   1.00 0.00 ? 10 GLU A HA   5  
ATOM 8021  H HB2  . GLU A 1 10 ? 10.847  -0.120  1.361   1.00 0.00 ? 10 GLU A HB2  5  
ATOM 8022  H HB3  . GLU A 1 10 ? 10.355  1.428   0.688   1.00 0.00 ? 10 GLU A HB3  5  
ATOM 8023  H HG2  . GLU A 1 10 ? 12.332  2.476   1.338   1.00 0.00 ? 10 GLU A HG2  5  
ATOM 8024  H HG3  . GLU A 1 10 ? 12.732  1.206   2.493   1.00 0.00 ? 10 GLU A HG3  5  
ATOM 8025  N N    . THR A 1 11 ? 8.233   2.206   1.585   1.00 0.00 ? 11 THR A N    5  
ATOM 8026  C CA   . THR A 1 11 ? 6.831   2.383   1.215   1.00 0.00 ? 11 THR A CA   5  
ATOM 8027  C C    . THR A 1 11 ? 6.599   1.971   -0.235  1.00 0.00 ? 11 THR A C    5  
ATOM 8028  O O    . THR A 1 11 ? 7.547   1.770   -0.994  1.00 0.00 ? 11 THR A O    5  
ATOM 8029  C CB   . THR A 1 11 ? 6.396   3.843   1.428   1.00 0.00 ? 11 THR A CB   5  
ATOM 8030  O OG1  . THR A 1 11 ? 5.565   4.288   0.369   1.00 0.00 ? 11 THR A OG1  5  
ATOM 8031  C CG2  . THR A 1 11 ? 7.554   4.815   1.532   1.00 0.00 ? 11 THR A CG2  5  
ATOM 8032  H H    . THR A 1 11 ? 8.917   2.736   1.125   1.00 0.00 ? 11 THR A H    5  
ATOM 8033  H HA   . THR A 1 11 ? 6.237   1.745   1.853   1.00 0.00 ? 11 THR A HA   5  
ATOM 8034  H HB   . THR A 1 11 ? 5.832   3.905   2.348   1.00 0.00 ? 11 THR A HB   5  
ATOM 8035  H HG1  . THR A 1 11 ? 4.680   3.936   0.486   1.00 0.00 ? 11 THR A HG1  5  
ATOM 8036  H HG21 . THR A 1 11 ? 8.259   4.622   0.737   1.00 0.00 ? 11 THR A HG21 5  
ATOM 8037  H HG22 . THR A 1 11 ? 8.045   4.690   2.487   1.00 0.00 ? 11 THR A HG22 5  
ATOM 8038  H HG23 . THR A 1 11 ? 7.184   5.826   1.448   1.00 0.00 ? 11 THR A HG23 5  
ATOM 8039  N N    . LEU A 1 12 ? 5.331   1.853   -0.612  1.00 0.00 ? 12 LEU A N    5  
ATOM 8040  C CA   . LEU A 1 12 ? 4.969   1.471   -1.974  1.00 0.00 ? 12 LEU A CA   5  
ATOM 8041  C C    . LEU A 1 12 ? 4.315   2.643   -2.701  1.00 0.00 ? 12 LEU A C    5  
ATOM 8042  O O    . LEU A 1 12 ? 3.736   3.527   -2.070  1.00 0.00 ? 12 LEU A O    5  
ATOM 8043  C CB   . LEU A 1 12 ? 4.035   0.252   -1.960  1.00 0.00 ? 12 LEU A CB   5  
ATOM 8044  C CG   . LEU A 1 12 ? 2.546   0.557   -1.757  1.00 0.00 ? 12 LEU A CG   5  
ATOM 8045  C CD1  . LEU A 1 12 ? 1.687   -0.476  -2.468  1.00 0.00 ? 12 LEU A CD1  5  
ATOM 8046  C CD2  . LEU A 1 12 ? 2.206   0.604   -0.277  1.00 0.00 ? 12 LEU A CD2  5  
ATOM 8047  H H    . LEU A 1 12 ? 4.620   2.032   0.037   1.00 0.00 ? 12 LEU A H    5  
ATOM 8048  H HA   . LEU A 1 12 ? 5.879   1.208   -2.493  1.00 0.00 ? 12 LEU A HA   5  
ATOM 8049  H HB2  . LEU A 1 12 ? 4.147   -0.269  -2.900  1.00 0.00 ? 12 LEU A HB2  5  
ATOM 8050  H HB3  . LEU A 1 12 ? 4.353   -0.407  -1.167  1.00 0.00 ? 12 LEU A HB3  5  
ATOM 8051  H HG   . LEU A 1 12 ? 2.320   1.524   -2.181  1.00 0.00 ? 12 LEU A HG   5  
ATOM 8052  H HD11 . LEU A 1 12 ? 0.812   0.005   -2.881  1.00 0.00 ? 12 LEU A HD11 5  
ATOM 8053  H HD12 . LEU A 1 12 ? 1.383   -1.236  -1.765  1.00 0.00 ? 12 LEU A HD12 5  
ATOM 8054  H HD13 . LEU A 1 12 ? 2.257   -0.931  -3.265  1.00 0.00 ? 12 LEU A HD13 5  
ATOM 8055  H HD21 . LEU A 1 12 ? 2.401   -0.359  0.170   1.00 0.00 ? 12 LEU A HD21 5  
ATOM 8056  H HD22 . LEU A 1 12 ? 1.161   0.853   -0.157  1.00 0.00 ? 12 LEU A HD22 5  
ATOM 8057  H HD23 . LEU A 1 12 ? 2.810   1.356   0.207   1.00 0.00 ? 12 LEU A HD23 5  
ATOM 8058  N N    . MET A 1 13 ? 4.406   2.648   -4.027  1.00 0.00 ? 13 MET A N    5  
ATOM 8059  C CA   . MET A 1 13 ? 3.815   3.718   -4.818  1.00 0.00 ? 13 MET A CA   5  
ATOM 8060  C C    . MET A 1 13 ? 2.910   3.153   -5.905  1.00 0.00 ? 13 MET A C    5  
ATOM 8061  O O    . MET A 1 13 ? 3.379   2.707   -6.952  1.00 0.00 ? 13 MET A O    5  
ATOM 8062  C CB   . MET A 1 13 ? 4.912   4.586   -5.441  1.00 0.00 ? 13 MET A CB   5  
ATOM 8063  C CG   . MET A 1 13 ? 4.385   5.671   -6.370  1.00 0.00 ? 13 MET A CG   5  
ATOM 8064  S SD   . MET A 1 13 ? 5.240   7.245   -6.159  1.00 0.00 ? 13 MET A SD   5  
ATOM 8065  C CE   . MET A 1 13 ? 5.947   7.467   -7.790  1.00 0.00 ? 13 MET A CE   5  
ATOM 8066  H H    . MET A 1 13 ? 4.874   1.917   -4.482  1.00 0.00 ? 13 MET A H    5  
ATOM 8067  H HA   . MET A 1 13 ? 3.219   4.326   -4.155  1.00 0.00 ? 13 MET A HA   5  
ATOM 8068  H HB2  . MET A 1 13 ? 5.470   5.062   -4.649  1.00 0.00 ? 13 MET A HB2  5  
ATOM 8069  H HB3  . MET A 1 13 ? 5.578   3.952   -6.007  1.00 0.00 ? 13 MET A HB3  5  
ATOM 8070  H HG2  . MET A 1 13 ? 4.512   5.344   -7.391  1.00 0.00 ? 13 MET A HG2  5  
ATOM 8071  H HG3  . MET A 1 13 ? 3.334   5.818   -6.170  1.00 0.00 ? 13 MET A HG3  5  
ATOM 8072  H HE1  . MET A 1 13 ? 6.884   7.996   -7.706  1.00 0.00 ? 13 MET A HE1  5  
ATOM 8073  H HE2  . MET A 1 13 ? 5.265   8.038   -8.403  1.00 0.00 ? 13 MET A HE2  5  
ATOM 8074  H HE3  . MET A 1 13 ? 6.117   6.502   -8.243  1.00 0.00 ? 13 MET A HE3  5  
ATOM 8075  N N    . ILE A 1 14 ? 1.609   3.183   -5.648  1.00 0.00 ? 14 ILE A N    5  
ATOM 8076  C CA   . ILE A 1 14 ? 0.629   2.684   -6.594  1.00 0.00 ? 14 ILE A CA   5  
ATOM 8077  C C    . ILE A 1 14 ? -0.221  3.830   -7.143  1.00 0.00 ? 14 ILE A C    5  
ATOM 8078  O O    . ILE A 1 14 ? -0.819  4.591   -6.383  1.00 0.00 ? 14 ILE A O    5  
ATOM 8079  C CB   . ILE A 1 14 ? -0.282  1.625   -5.935  1.00 0.00 ? 14 ILE A CB   5  
ATOM 8080  C CG1  . ILE A 1 14 ? -1.403  1.194   -6.887  1.00 0.00 ? 14 ILE A CG1  5  
ATOM 8081  C CG2  . ILE A 1 14 ? -0.861  2.159   -4.634  1.00 0.00 ? 14 ILE A CG2  5  
ATOM 8082  C CD1  . ILE A 1 14 ? -0.909  0.763   -8.250  1.00 0.00 ? 14 ILE A CD1  5  
ATOM 8083  H H    . ILE A 1 14 ? 1.300   3.550   -4.798  1.00 0.00 ? 14 ILE A H    5  
ATOM 8084  H HA   . ILE A 1 14 ? 1.164   2.217   -7.407  1.00 0.00 ? 14 ILE A HA   5  
ATOM 8085  H HB   . ILE A 1 14 ? 0.328   0.767   -5.697  1.00 0.00 ? 14 ILE A HB   5  
ATOM 8086  H HG12 . ILE A 1 14 ? -1.936  0.363   -6.451  1.00 0.00 ? 14 ILE A HG12 5  
ATOM 8087  H HG13 . ILE A 1 14 ? -2.085  2.020   -7.026  1.00 0.00 ? 14 ILE A HG13 5  
ATOM 8088  H HG21 . ILE A 1 14 ? -0.797  3.237   -4.625  1.00 0.00 ? 14 ILE A HG21 5  
ATOM 8089  H HG22 . ILE A 1 14 ? -0.301  1.759   -3.801  1.00 0.00 ? 14 ILE A HG22 5  
ATOM 8090  H HG23 . ILE A 1 14 ? -1.895  1.859   -4.549  1.00 0.00 ? 14 ILE A HG23 5  
ATOM 8091  H HD11 . ILE A 1 14 ? -0.099  1.407   -8.557  1.00 0.00 ? 14 ILE A HD11 5  
ATOM 8092  H HD12 . ILE A 1 14 ? -1.716  0.835   -8.964  1.00 0.00 ? 14 ILE A HD12 5  
ATOM 8093  H HD13 . ILE A 1 14 ? -0.560  -0.257  -8.201  1.00 0.00 ? 14 ILE A HD13 5  
ATOM 8094  N N    . GLY A 1 15 ? -0.270  3.949   -8.466  1.00 0.00 ? 15 GLY A N    5  
ATOM 8095  C CA   . GLY A 1 15 ? -1.046  5.007   -9.089  1.00 0.00 ? 15 GLY A CA   5  
ATOM 8096  C C    . GLY A 1 15 ? -0.247  5.766   -10.131 1.00 0.00 ? 15 GLY A C    5  
ATOM 8097  O O    . GLY A 1 15 ? -0.008  5.260   -11.228 1.00 0.00 ? 15 GLY A O    5  
ATOM 8098  H H    . GLY A 1 15 ? 0.221   3.314   -9.029  1.00 0.00 ? 15 GLY A H    5  
ATOM 8099  H HA2  . GLY A 1 15 ? -1.914  4.572   -9.562  1.00 0.00 ? 15 GLY A HA2  5  
ATOM 8100  H HA3  . GLY A 1 15 ? -1.372  5.700   -8.326  1.00 0.00 ? 15 GLY A HA3  5  
ATOM 8101  N N    . ASP A 1 16 ? 0.169   6.982   -9.791  1.00 0.00 ? 16 ASP A N    5  
ATOM 8102  C CA   . ASP A 1 16 ? 0.948   7.805   -10.713 1.00 0.00 ? 16 ASP A CA   5  
ATOM 8103  C C    . ASP A 1 16 ? 1.782   8.861   -9.980  1.00 0.00 ? 16 ASP A C    5  
ATOM 8104  O O    . ASP A 1 16 ? 2.399   9.711   -10.620 1.00 0.00 ? 16 ASP A O    5  
ATOM 8105  C CB   . ASP A 1 16 ? 0.021   8.487   -11.720 1.00 0.00 ? 16 ASP A CB   5  
ATOM 8106  C CG   . ASP A 1 16 ? -0.483  7.530   -12.782 1.00 0.00 ? 16 ASP A CG   5  
ATOM 8107  O OD1  . ASP A 1 16 ? 0.290   7.210   -13.709 1.00 0.00 ? 16 ASP A OD1  5  
ATOM 8108  O OD2  . ASP A 1 16 ? -1.653  7.101   -12.687 1.00 0.00 ? 16 ASP A OD2  5  
ATOM 8109  H H    . ASP A 1 16 ? -0.052  7.331   -8.904  1.00 0.00 ? 16 ASP A H    5  
ATOM 8110  H HA   . ASP A 1 16 ? 1.618   7.150   -11.249 1.00 0.00 ? 16 ASP A HA   5  
ATOM 8111  H HB2  . ASP A 1 16 ? -0.831  8.896   -11.197 1.00 0.00 ? 16 ASP A HB2  5  
ATOM 8112  H HB3  . ASP A 1 16 ? 0.557   9.288   -12.208 1.00 0.00 ? 16 ASP A HB3  5  
ATOM 8113  N N    . GLU A 1 17 ? 1.801   8.798   -8.644  1.00 0.00 ? 17 GLU A N    5  
ATOM 8114  C CA   . GLU A 1 17 ? 2.561   9.744   -7.819  1.00 0.00 ? 17 GLU A CA   5  
ATOM 8115  C C    . GLU A 1 17 ? 2.036   9.726   -6.384  1.00 0.00 ? 17 GLU A C    5  
ATOM 8116  O O    . GLU A 1 17 ? 1.535   10.733  -5.882  1.00 0.00 ? 17 GLU A O    5  
ATOM 8117  C CB   . GLU A 1 17 ? 2.480   11.172  -8.383  1.00 0.00 ? 17 GLU A CB   5  
ATOM 8118  C CG   . GLU A 1 17 ? 3.131   12.222  -7.495  1.00 0.00 ? 17 GLU A CG   5  
ATOM 8119  C CD   . GLU A 1 17 ? 2.179   13.339  -7.114  1.00 0.00 ? 17 GLU A CD   5  
ATOM 8120  O OE1  . GLU A 1 17 ? 1.226   13.594  -7.880  1.00 0.00 ? 17 GLU A OE1  5  
ATOM 8121  O OE2  . GLU A 1 17 ? 2.387   13.959  -6.050  1.00 0.00 ? 17 GLU A OE2  5  
ATOM 8122  H H    . GLU A 1 17 ? 1.298   8.092   -8.194  1.00 0.00 ? 17 GLU A H    5  
ATOM 8123  H HA   . GLU A 1 17 ? 3.593   9.424   -7.814  1.00 0.00 ? 17 GLU A HA   5  
ATOM 8124  H HB2  . GLU A 1 17 ? 2.972   11.196  -9.343  1.00 0.00 ? 17 GLU A HB2  5  
ATOM 8125  H HB3  . GLU A 1 17 ? 1.441   11.436  -8.515  1.00 0.00 ? 17 GLU A HB3  5  
ATOM 8126  H HG2  . GLU A 1 17 ? 3.481   11.745  -6.592  1.00 0.00 ? 17 GLU A HG2  5  
ATOM 8127  H HG3  . GLU A 1 17 ? 3.971   12.650  -8.023  1.00 0.00 ? 17 GLU A HG3  5  
ATOM 8128  N N    . VAL A 1 18 ? 2.138   8.572   -5.733  1.00 0.00 ? 18 VAL A N    5  
ATOM 8129  C CA   . VAL A 1 18 ? 1.662   8.420   -4.373  1.00 0.00 ? 18 VAL A CA   5  
ATOM 8130  C C    . VAL A 1 18 ? 2.810   8.109   -3.407  1.00 0.00 ? 18 VAL A C    5  
ATOM 8131  O O    . VAL A 1 18 ? 3.969   8.410   -3.687  1.00 0.00 ? 18 VAL A O    5  
ATOM 8132  C CB   . VAL A 1 18 ? 0.598   7.306   -4.304  1.00 0.00 ? 18 VAL A CB   5  
ATOM 8133  C CG1  . VAL A 1 18 ? -0.438  7.488   -5.404  1.00 0.00 ? 18 VAL A CG1  5  
ATOM 8134  C CG2  . VAL A 1 18 ? 1.239   5.925   -4.388  1.00 0.00 ? 18 VAL A CG2  5  
ATOM 8135  H H    . VAL A 1 18 ? 2.531   7.801   -6.180  1.00 0.00 ? 18 VAL A H    5  
ATOM 8136  H HA   . VAL A 1 18 ? 1.197   9.349   -4.076  1.00 0.00 ? 18 VAL A HA   5  
ATOM 8137  H HB   . VAL A 1 18 ? 0.098   7.387   -3.362  1.00 0.00 ? 18 VAL A HB   5  
ATOM 8138  H HG11 . VAL A 1 18 ? -0.038  7.126   -6.339  1.00 0.00 ? 18 VAL A HG11 5  
ATOM 8139  H HG12 . VAL A 1 18 ? -0.682  8.536   -5.498  1.00 0.00 ? 18 VAL A HG12 5  
ATOM 8140  H HG13 . VAL A 1 18 ? -1.329  6.932   -5.154  1.00 0.00 ? 18 VAL A HG13 5  
ATOM 8141  H HG21 . VAL A 1 18 ? 0.839   5.393   -5.236  1.00 0.00 ? 18 VAL A HG21 5  
ATOM 8142  H HG22 . VAL A 1 18 ? 1.026   5.371   -3.484  1.00 0.00 ? 18 VAL A HG22 5  
ATOM 8143  H HG23 . VAL A 1 18 ? 2.308   6.027   -4.501  1.00 0.00 ? 18 VAL A HG23 5  
ATOM 8144  N N    . THR A 1 19 ? 2.471   7.498   -2.272  1.00 0.00 ? 19 THR A N    5  
ATOM 8145  C CA   . THR A 1 19 ? 3.451   7.130   -1.255  1.00 0.00 ? 19 THR A CA   5  
ATOM 8146  C C    . THR A 1 19 ? 2.729   6.622   -0.012  1.00 0.00 ? 19 THR A C    5  
ATOM 8147  O O    . THR A 1 19 ? 2.205   7.408   0.773   1.00 0.00 ? 19 THR A O    5  
ATOM 8148  C CB   . THR A 1 19 ? 4.339   8.325   -0.893  1.00 0.00 ? 19 THR A CB   5  
ATOM 8149  O OG1  . THR A 1 19 ? 3.703   9.548   -1.232  1.00 0.00 ? 19 THR A OG1  5  
ATOM 8150  C CG2  . THR A 1 19 ? 5.692   8.294   -1.574  1.00 0.00 ? 19 THR A CG2  5  
ATOM 8151  H H    . THR A 1 19 ? 1.530   7.280   -2.114  1.00 0.00 ? 19 THR A H    5  
ATOM 8152  H HA   . THR A 1 19 ? 4.065   6.336   -1.656  1.00 0.00 ? 19 THR A HA   5  
ATOM 8153  H HB   . THR A 1 19 ? 4.509   8.320   0.175   1.00 0.00 ? 19 THR A HB   5  
ATOM 8154  H HG1  . THR A 1 19 ? 3.984   9.831   -2.107  1.00 0.00 ? 19 THR A HG1  5  
ATOM 8155  H HG21 . THR A 1 19 ? 6.451   8.027   -0.854  1.00 0.00 ? 19 THR A HG21 5  
ATOM 8156  H HG22 . THR A 1 19 ? 5.911   9.270   -1.983  1.00 0.00 ? 19 THR A HG22 5  
ATOM 8157  H HG23 . THR A 1 19 ? 5.678   7.565   -2.370  1.00 0.00 ? 19 THR A HG23 5  
ATOM 8158  N N    . VAL A 1 20 ? 2.690   5.306   0.158   1.00 0.00 ? 20 VAL A N    5  
ATOM 8159  C CA   . VAL A 1 20 ? 2.011   4.713   1.303   1.00 0.00 ? 20 VAL A CA   5  
ATOM 8160  C C    . VAL A 1 20 ? 2.999   4.075   2.277   1.00 0.00 ? 20 VAL A C    5  
ATOM 8161  O O    . VAL A 1 20 ? 3.586   3.029   1.989   1.00 0.00 ? 20 VAL A O    5  
ATOM 8162  C CB   . VAL A 1 20 ? 0.986   3.653   0.854   1.00 0.00 ? 20 VAL A CB   5  
ATOM 8163  C CG1  . VAL A 1 20 ? 0.250   3.068   2.051   1.00 0.00 ? 20 VAL A CG1  5  
ATOM 8164  C CG2  . VAL A 1 20 ? 0.006   4.250   -0.144  1.00 0.00 ? 20 VAL A CG2  5  
ATOM 8165  H H    . VAL A 1 20 ? 3.118   4.721   -0.501  1.00 0.00 ? 20 VAL A H    5  
ATOM 8166  H HA   . VAL A 1 20 ? 1.476   5.502   1.814   1.00 0.00 ? 20 VAL A HA   5  
ATOM 8167  H HB   . VAL A 1 20 ? 1.520   2.854   0.364   1.00 0.00 ? 20 VAL A HB   5  
ATOM 8168  H HG11 . VAL A 1 20 ? -0.366  3.831   2.503   1.00 0.00 ? 20 VAL A HG11 5  
ATOM 8169  H HG12 . VAL A 1 20 ? 0.967   2.708   2.774   1.00 0.00 ? 20 VAL A HG12 5  
ATOM 8170  H HG13 . VAL A 1 20 ? -0.374  2.249   1.724   1.00 0.00 ? 20 VAL A HG13 5  
ATOM 8171  H HG21 . VAL A 1 20 ? 0.360   4.071   -1.148  1.00 0.00 ? 20 VAL A HG21 5  
ATOM 8172  H HG22 . VAL A 1 20 ? -0.078  5.313   0.025   1.00 0.00 ? 20 VAL A HG22 5  
ATOM 8173  H HG23 . VAL A 1 20 ? -0.963  3.788   -0.017  1.00 0.00 ? 20 VAL A HG23 5  
ATOM 8174  N N    . THR A 1 21 ? 3.175   4.717   3.429   1.00 0.00 ? 21 THR A N    5  
ATOM 8175  C CA   . THR A 1 21 ? 4.087   4.224   4.456   1.00 0.00 ? 21 THR A CA   5  
ATOM 8176  C C    . THR A 1 21 ? 3.317   3.601   5.619   1.00 0.00 ? 21 THR A C    5  
ATOM 8177  O O    . THR A 1 21 ? 2.645   4.300   6.380   1.00 0.00 ? 21 THR A O    5  
ATOM 8178  C CB   . THR A 1 21 ? 4.971   5.361   4.971   1.00 0.00 ? 21 THR A CB   5  
ATOM 8179  O OG1  . THR A 1 21 ? 4.215   6.547   5.140   1.00 0.00 ? 21 THR A OG1  5  
ATOM 8180  C CG2  . THR A 1 21 ? 6.131   5.682   4.053   1.00 0.00 ? 21 THR A CG2  5  
ATOM 8181  H H    . THR A 1 21 ? 2.682   5.549   3.588   1.00 0.00 ? 21 THR A H    5  
ATOM 8182  H HA   . THR A 1 21 ? 4.713   3.467   4.008   1.00 0.00 ? 21 THR A HA   5  
ATOM 8183  H HB   . THR A 1 21 ? 5.378   5.079   5.931   1.00 0.00 ? 21 THR A HB   5  
ATOM 8184  H HG1  . THR A 1 21 ? 3.972   6.898   4.280   1.00 0.00 ? 21 THR A HG1  5  
ATOM 8185  H HG21 . THR A 1 21 ? 6.848   4.875   4.083   1.00 0.00 ? 21 THR A HG21 5  
ATOM 8186  H HG22 . THR A 1 21 ? 6.605   6.596   4.379   1.00 0.00 ? 21 THR A HG22 5  
ATOM 8187  H HG23 . THR A 1 21 ? 5.768   5.804   3.044   1.00 0.00 ? 21 THR A HG23 5  
ATOM 8188  N N    . VAL A 1 22 ? 3.416   2.282   5.749   1.00 0.00 ? 22 VAL A N    5  
ATOM 8189  C CA   . VAL A 1 22 ? 2.730   1.565   6.819   1.00 0.00 ? 22 VAL A CA   5  
ATOM 8190  C C    . VAL A 1 22 ? 3.462   1.726   8.148   1.00 0.00 ? 22 VAL A C    5  
ATOM 8191  O O    . VAL A 1 22 ? 4.095   0.791   8.639   1.00 0.00 ? 22 VAL A O    5  
ATOM 8192  C CB   . VAL A 1 22 ? 2.595   0.065   6.497   1.00 0.00 ? 22 VAL A CB   5  
ATOM 8193  C CG1  . VAL A 1 22 ? 1.687   -0.144  5.294   1.00 0.00 ? 22 VAL A CG1  5  
ATOM 8194  C CG2  . VAL A 1 22 ? 3.963   -0.557  6.259   1.00 0.00 ? 22 VAL A CG2  5  
ATOM 8195  H H    . VAL A 1 22 ? 3.963   1.779   5.110   1.00 0.00 ? 22 VAL A H    5  
ATOM 8196  H HA   . VAL A 1 22 ? 1.737   1.982   6.914   1.00 0.00 ? 22 VAL A HA   5  
ATOM 8197  H HB   . VAL A 1 22 ? 2.144   -0.425  7.348   1.00 0.00 ? 22 VAL A HB   5  
ATOM 8198  H HG11 . VAL A 1 22 ? 2.037   -0.989  4.720   1.00 0.00 ? 22 VAL A HG11 5  
ATOM 8199  H HG12 . VAL A 1 22 ? 1.699   0.741   4.676   1.00 0.00 ? 22 VAL A HG12 5  
ATOM 8200  H HG13 . VAL A 1 22 ? 0.678   -0.332  5.633   1.00 0.00 ? 22 VAL A HG13 5  
ATOM 8201  H HG21 . VAL A 1 22 ? 3.917   -1.215  5.403   1.00 0.00 ? 22 VAL A HG21 5  
ATOM 8202  H HG22 . VAL A 1 22 ? 4.259   -1.121  7.131   1.00 0.00 ? 22 VAL A HG22 5  
ATOM 8203  H HG23 . VAL A 1 22 ? 4.687   0.223   6.073   1.00 0.00 ? 22 VAL A HG23 5  
ATOM 8204  N N    . LEU A 1 23 ? 3.373   2.921   8.724   1.00 0.00 ? 23 LEU A N    5  
ATOM 8205  C CA   . LEU A 1 23 ? 4.028   3.208   9.995   1.00 0.00 ? 23 LEU A CA   5  
ATOM 8206  C C    . LEU A 1 23 ? 3.056   2.997   11.164  1.00 0.00 ? 23 LEU A C    5  
ATOM 8207  O O    . LEU A 1 23 ? 2.233   2.083   11.128  1.00 0.00 ? 23 LEU A O    5  
ATOM 8208  C CB   . LEU A 1 23 ? 4.576   4.644   9.982   1.00 0.00 ? 23 LEU A CB   5  
ATOM 8209  C CG   . LEU A 1 23 ? 5.749   4.937   10.937  1.00 0.00 ? 23 LEU A CG   5  
ATOM 8210  C CD1  . LEU A 1 23 ? 6.235   3.674   11.641  1.00 0.00 ? 23 LEU A CD1  5  
ATOM 8211  C CD2  . LEU A 1 23 ? 6.894   5.598   10.184  1.00 0.00 ? 23 LEU A CD2  5  
ATOM 8212  H H    . LEU A 1 23 ? 2.857   3.626   8.281   1.00 0.00 ? 23 LEU A H    5  
ATOM 8213  H HA   . LEU A 1 23 ? 4.850   2.518   10.101  1.00 0.00 ? 23 LEU A HA   5  
ATOM 8214  H HB2  . LEU A 1 23 ? 4.899   4.868   8.976   1.00 0.00 ? 23 LEU A HB2  5  
ATOM 8215  H HB3  . LEU A 1 23 ? 3.766   5.313   10.233  1.00 0.00 ? 23 LEU A HB3  5  
ATOM 8216  H HG   . LEU A 1 23 ? 5.411   5.628   11.697  1.00 0.00 ? 23 LEU A HG   5  
ATOM 8217  H HD11 . LEU A 1 23 ? 5.412   3.217   12.171  1.00 0.00 ? 23 LEU A HD11 5  
ATOM 8218  H HD12 . LEU A 1 23 ? 7.016   3.929   12.340  1.00 0.00 ? 23 LEU A HD12 5  
ATOM 8219  H HD13 . LEU A 1 23 ? 6.620   2.979   10.908  1.00 0.00 ? 23 LEU A HD13 5  
ATOM 8220  H HD21 . LEU A 1 23 ? 7.795   5.542   10.777  1.00 0.00 ? 23 LEU A HD21 5  
ATOM 8221  H HD22 . LEU A 1 23 ? 6.652   6.633   9.995   1.00 0.00 ? 23 LEU A HD22 5  
ATOM 8222  H HD23 . LEU A 1 23 ? 7.050   5.087   9.245   1.00 0.00 ? 23 LEU A HD23 5  
ATOM 8223  N N    . GLY A 1 24 ? 3.151   3.837   12.199  1.00 0.00 ? 24 GLY A N    5  
ATOM 8224  C CA   . GLY A 1 24 ? 2.270   3.708   13.348  1.00 0.00 ? 24 GLY A CA   5  
ATOM 8225  C C    . GLY A 1 24 ? 2.191   2.287   13.872  1.00 0.00 ? 24 GLY A C    5  
ATOM 8226  O O    . GLY A 1 24 ? 1.192   1.598   13.665  1.00 0.00 ? 24 GLY A O    5  
ATOM 8227  H H    . GLY A 1 24 ? 3.821   4.547   12.186  1.00 0.00 ? 24 GLY A H    5  
ATOM 8228  H HA2  . GLY A 1 24 ? 2.632   4.349   14.138  1.00 0.00 ? 24 GLY A HA2  5  
ATOM 8229  H HA3  . GLY A 1 24 ? 1.280   4.031   13.065  1.00 0.00 ? 24 GLY A HA3  5  
ATOM 8230  N N    . VAL A 1 25 ? 3.246   1.845   14.547  1.00 0.00 ? 25 VAL A N    5  
ATOM 8231  C CA   . VAL A 1 25 ? 3.287   0.501   15.092  1.00 0.00 ? 25 VAL A CA   5  
ATOM 8232  C C    . VAL A 1 25 ? 2.796   0.474   16.536  1.00 0.00 ? 25 VAL A C    5  
ATOM 8233  O O    . VAL A 1 25 ? 3.476   0.951   17.444  1.00 0.00 ? 25 VAL A O    5  
ATOM 8234  C CB   . VAL A 1 25 ? 4.710   -0.087  15.034  1.00 0.00 ? 25 VAL A CB   5  
ATOM 8235  C CG1  . VAL A 1 25 ? 4.683   -1.581  15.318  1.00 0.00 ? 25 VAL A CG1  5  
ATOM 8236  C CG2  . VAL A 1 25 ? 5.351   0.196   13.683  1.00 0.00 ? 25 VAL A CG2  5  
ATOM 8237  H H    . VAL A 1 25 ? 4.012   2.432   14.676  1.00 0.00 ? 25 VAL A H    5  
ATOM 8238  H HA   . VAL A 1 25 ? 2.643   -0.114  14.491  1.00 0.00 ? 25 VAL A HA   5  
ATOM 8239  H HB   . VAL A 1 25 ? 5.306   0.390   15.799  1.00 0.00 ? 25 VAL A HB   5  
ATOM 8240  H HG11 . VAL A 1 25 ? 5.439   -2.074  14.725  1.00 0.00 ? 25 VAL A HG11 5  
ATOM 8241  H HG12 . VAL A 1 25 ? 3.711   -1.978  15.063  1.00 0.00 ? 25 VAL A HG12 5  
ATOM 8242  H HG13 . VAL A 1 25 ? 4.878   -1.753  16.366  1.00 0.00 ? 25 VAL A HG13 5  
ATOM 8243  H HG21 . VAL A 1 25 ? 5.277   1.251   13.463  1.00 0.00 ? 25 VAL A HG21 5  
ATOM 8244  H HG22 . VAL A 1 25 ? 4.840   -0.368  12.917  1.00 0.00 ? 25 VAL A HG22 5  
ATOM 8245  H HG23 . VAL A 1 25 ? 6.391   -0.093  13.711  1.00 0.00 ? 25 VAL A HG23 5  
ATOM 8246  N N    . LYS A 1 26 ? 1.608   -0.086  16.738  1.00 0.00 ? 26 LYS A N    5  
ATOM 8247  C CA   . LYS A 1 26 ? 1.021   -0.174  18.070  1.00 0.00 ? 26 LYS A CA   5  
ATOM 8248  C C    . LYS A 1 26 ? 0.353   -1.528  18.285  1.00 0.00 ? 26 LYS A C    5  
ATOM 8249  O O    . LYS A 1 26 ? -0.013  -2.211  17.329  1.00 0.00 ? 26 LYS A O    5  
ATOM 8250  C CB   . LYS A 1 26 ? 0.001   0.947   18.275  1.00 0.00 ? 26 LYS A CB   5  
ATOM 8251  C CG   . LYS A 1 26 ? -0.028  1.493   19.694  1.00 0.00 ? 26 LYS A CG   5  
ATOM 8252  C CD   . LYS A 1 26 ? 1.169   2.389   19.974  1.00 0.00 ? 26 LYS A CD   5  
ATOM 8253  C CE   . LYS A 1 26 ? 2.128   1.747   20.964  1.00 0.00 ? 26 LYS A CE   5  
ATOM 8254  N NZ   . LYS A 1 26 ? 2.718   2.747   21.895  1.00 0.00 ? 26 LYS A NZ   5  
ATOM 8255  H H    . LYS A 1 26 ? 1.114   -0.439  15.969  1.00 0.00 ? 26 LYS A H    5  
ATOM 8256  H HA   . LYS A 1 26 ? 1.816   -0.060  18.791  1.00 0.00 ? 26 LYS A HA   5  
ATOM 8257  H HB2  . LYS A 1 26 ? 0.237   1.760   17.604  1.00 0.00 ? 26 LYS A HB2  5  
ATOM 8258  H HB3  . LYS A 1 26 ? -0.983  0.571   18.037  1.00 0.00 ? 26 LYS A HB3  5  
ATOM 8259  H HG2  . LYS A 1 26 ? -0.933  2.067   19.829  1.00 0.00 ? 26 LYS A HG2  5  
ATOM 8260  H HG3  . LYS A 1 26 ? -0.018  0.664   20.387  1.00 0.00 ? 26 LYS A HG3  5  
ATOM 8261  H HD2  . LYS A 1 26 ? 1.694   2.574   19.049  1.00 0.00 ? 26 LYS A HD2  5  
ATOM 8262  H HD3  . LYS A 1 26 ? 0.817   3.325   20.383  1.00 0.00 ? 26 LYS A HD3  5  
ATOM 8263  H HE2  . LYS A 1 26 ? 1.591   1.007   21.538  1.00 0.00 ? 26 LYS A HE2  5  
ATOM 8264  H HE3  . LYS A 1 26 ? 2.924   1.266   20.414  1.00 0.00 ? 26 LYS A HE3  5  
ATOM 8265  H HZ1  . LYS A 1 26 ? 2.105   3.585   21.956  1.00 0.00 ? 26 LYS A HZ1  5  
ATOM 8266  H HZ2  . LYS A 1 26 ? 3.656   3.042   21.556  1.00 0.00 ? 26 LYS A HZ2  5  
ATOM 8267  H HZ3  . LYS A 1 26 ? 2.819   2.335   22.845  1.00 0.00 ? 26 LYS A HZ3  5  
ATOM 8268  N N    . GLY A 1 27 ? 0.198   -1.910  19.549  1.00 0.00 ? 27 GLY A N    5  
ATOM 8269  C CA   . GLY A 1 27 ? -0.425  -3.180  19.869  1.00 0.00 ? 27 GLY A CA   5  
ATOM 8270  C C    . GLY A 1 27 ? -1.873  -3.243  19.425  1.00 0.00 ? 27 GLY A C    5  
ATOM 8271  O O    . GLY A 1 27 ? -2.570  -2.228  19.411  1.00 0.00 ? 27 GLY A O    5  
ATOM 8272  H H    . GLY A 1 27 ? 0.510   -1.324  20.270  1.00 0.00 ? 27 GLY A H    5  
ATOM 8273  H HA2  . GLY A 1 27 ? 0.124   -3.971  19.380  1.00 0.00 ? 27 GLY A HA2  5  
ATOM 8274  H HA3  . GLY A 1 27 ? -0.381  -3.331  20.937  1.00 0.00 ? 27 GLY A HA3  5  
ATOM 8275  N N    . ASN A 1 28 ? -2.325  -4.438  19.057  1.00 0.00 ? 28 ASN A N    5  
ATOM 8276  C CA   . ASN A 1 28 ? -3.699  -4.639  18.603  1.00 0.00 ? 28 ASN A CA   5  
ATOM 8277  C C    . ASN A 1 28 ? -3.893  -4.074  17.198  1.00 0.00 ? 28 ASN A C    5  
ATOM 8278  O O    . ASN A 1 28 ? -3.878  -4.816  16.216  1.00 0.00 ? 28 ASN A O    5  
ATOM 8279  C CB   . ASN A 1 28 ? -4.694  -3.994  19.577  1.00 0.00 ? 28 ASN A CB   5  
ATOM 8280  C CG   . ASN A 1 28 ? -5.619  -5.012  20.216  1.00 0.00 ? 28 ASN A CG   5  
ATOM 8281  O OD1  . ASN A 1 28 ? -5.179  -6.066  20.674  1.00 0.00 ? 28 ASN A OD1  5  
ATOM 8282  N ND2  . ASN A 1 28 ? -6.909  -4.700  20.250  1.00 0.00 ? 28 ASN A ND2  5  
ATOM 8283  H H    . ASN A 1 28 ? -1.717  -5.206  19.085  1.00 0.00 ? 28 ASN A H    5  
ATOM 8284  H HA   . ASN A 1 28 ? -3.881  -5.703  18.573  1.00 0.00 ? 28 ASN A HA   5  
ATOM 8285  H HB2  . ASN A 1 28 ? -4.148  -3.492  20.361  1.00 0.00 ? 28 ASN A HB2  5  
ATOM 8286  H HB3  . ASN A 1 28 ? -5.297  -3.273  19.045  1.00 0.00 ? 28 ASN A HB3  5  
ATOM 8287  H HD21 . ASN A 1 28 ? -7.188  -3.843  19.866  1.00 0.00 ? 28 ASN A HD21 5  
ATOM 8288  H HD22 . ASN A 1 28 ? -7.530  -5.339  20.658  1.00 0.00 ? 28 ASN A HD22 5  
ATOM 8289  N N    . GLN A 1 29 ? -4.073  -2.760  17.105  1.00 0.00 ? 29 GLN A N    5  
ATOM 8290  C CA   . GLN A 1 29 ? -4.268  -2.106  15.816  1.00 0.00 ? 29 GLN A CA   5  
ATOM 8291  C C    . GLN A 1 29 ? -3.134  -1.129  15.522  1.00 0.00 ? 29 GLN A C    5  
ATOM 8292  O O    . GLN A 1 29 ? -2.828  -0.255  16.332  1.00 0.00 ? 29 GLN A O    5  
ATOM 8293  C CB   . GLN A 1 29 ? -5.609  -1.371  15.790  1.00 0.00 ? 29 GLN A CB   5  
ATOM 8294  C CG   . GLN A 1 29 ? -6.765  -2.230  15.303  1.00 0.00 ? 29 GLN A CG   5  
ATOM 8295  C CD   . GLN A 1 29 ? -7.946  -1.404  14.834  1.00 0.00 ? 29 GLN A CD   5  
ATOM 8296  O OE1  . GLN A 1 29 ? -8.216  -1.309  13.636  1.00 0.00 ? 29 GLN A OE1  5  
ATOM 8297  N NE2  . GLN A 1 29 ? -8.658  -0.800  15.778  1.00 0.00 ? 29 GLN A NE2  5  
ATOM 8298  H H    . GLN A 1 29 ? -4.077  -2.216  17.921  1.00 0.00 ? 29 GLN A H    5  
ATOM 8299  H HA   . GLN A 1 29 ? -4.274  -2.872  15.054  1.00 0.00 ? 29 GLN A HA   5  
ATOM 8300  H HB2  . GLN A 1 29 ? -5.839  -1.029  16.788  1.00 0.00 ? 29 GLN A HB2  5  
ATOM 8301  H HB3  . GLN A 1 29 ? -5.525  -0.516  15.136  1.00 0.00 ? 29 GLN A HB3  5  
ATOM 8302  H HG2  . GLN A 1 29 ? -6.422  -2.839  14.480  1.00 0.00 ? 29 GLN A HG2  5  
ATOM 8303  H HG3  . GLN A 1 29 ? -7.088  -2.868  16.112  1.00 0.00 ? 29 GLN A HG3  5  
ATOM 8304  H HE21 . GLN A 1 29 ? -8.385  -0.920  16.712  1.00 0.00 ? 29 GLN A HE21 5  
ATOM 8305  H HE22 . GLN A 1 29 ? -9.428  -0.260  15.503  1.00 0.00 ? 29 GLN A HE22 5  
ATOM 8306  N N    . VAL A 1 30 ? -2.508  -1.293  14.361  1.00 0.00 ? 30 VAL A N    5  
ATOM 8307  C CA   . VAL A 1 30 ? -1.398  -0.437  13.960  1.00 0.00 ? 30 VAL A CA   5  
ATOM 8308  C C    . VAL A 1 30 ? -1.882  0.738   13.118  1.00 0.00 ? 30 VAL A C    5  
ATOM 8309  O O    . VAL A 1 30 ? -2.713  0.572   12.225  1.00 0.00 ? 30 VAL A O    5  
ATOM 8310  C CB   . VAL A 1 30 ? -0.340  -1.223  13.163  1.00 0.00 ? 30 VAL A CB   5  
ATOM 8311  C CG1  . VAL A 1 30 ? 0.374   -2.222  14.062  1.00 0.00 ? 30 VAL A CG1  5  
ATOM 8312  C CG2  . VAL A 1 30 ? -0.978  -1.926  11.974  1.00 0.00 ? 30 VAL A CG2  5  
ATOM 8313  H H    . VAL A 1 30 ? -2.790  -2.021  13.765  1.00 0.00 ? 30 VAL A H    5  
ATOM 8314  H HA   . VAL A 1 30 ? -0.932  -0.055  14.857  1.00 0.00 ? 30 VAL A HA   5  
ATOM 8315  H HB   . VAL A 1 30 ? 0.393   -0.523  12.789  1.00 0.00 ? 30 VAL A HB   5  
ATOM 8316  H HG11 . VAL A 1 30 ? 0.193   -1.970  15.097  1.00 0.00 ? 30 VAL A HG11 5  
ATOM 8317  H HG12 . VAL A 1 30 ? 1.436   -2.188  13.865  1.00 0.00 ? 30 VAL A HG12 5  
ATOM 8318  H HG13 . VAL A 1 30 ? 0.003   -3.216  13.863  1.00 0.00 ? 30 VAL A HG13 5  
ATOM 8319  H HG21 . VAL A 1 30 ? -1.117  -2.971  12.206  1.00 0.00 ? 30 VAL A HG21 5  
ATOM 8320  H HG22 . VAL A 1 30 ? -0.335  -1.830  11.112  1.00 0.00 ? 30 VAL A HG22 5  
ATOM 8321  H HG23 . VAL A 1 30 ? -1.936  -1.474  11.760  1.00 0.00 ? 30 VAL A HG23 5  
ATOM 8322  N N    . ARG A 1 31 ? -1.348  1.924   13.398  1.00 0.00 ? 31 ARG A N    5  
ATOM 8323  C CA   . ARG A 1 31 ? -1.711  3.117   12.662  1.00 0.00 ? 31 ARG A CA   5  
ATOM 8324  C C    . ARG A 1 31 ? -1.001  3.142   11.315  1.00 0.00 ? 31 ARG A C    5  
ATOM 8325  O O    . ARG A 1 31 ? 0.199   3.398   11.243  1.00 0.00 ? 31 ARG A O    5  
ATOM 8326  C CB   . ARG A 1 31 ? -1.357  4.369   13.467  1.00 0.00 ? 31 ARG A CB   5  
ATOM 8327  C CG   . ARG A 1 31 ? -2.434  4.780   14.458  1.00 0.00 ? 31 ARG A CG   5  
ATOM 8328  C CD   . ARG A 1 31 ? -2.019  6.005   15.257  1.00 0.00 ? 31 ARG A CD   5  
ATOM 8329  N NE   . ARG A 1 31 ? -2.390  5.892   16.665  1.00 0.00 ? 31 ARG A NE   5  
ATOM 8330  C CZ   . ARG A 1 31 ? -1.699  5.189   17.560  1.00 0.00 ? 31 ARG A CZ   5  
ATOM 8331  N NH1  . ARG A 1 31 ? -0.604  4.532   17.196  1.00 0.00 ? 31 ARG A NH1  5  
ATOM 8332  N NH2  . ARG A 1 31 ? -2.104  5.142   18.821  1.00 0.00 ? 31 ARG A NH2  5  
ATOM 8333  H H    . ARG A 1 31 ? -0.680  1.998   14.098  1.00 0.00 ? 31 ARG A H    5  
ATOM 8334  H HA   . ARG A 1 31 ? -2.768  3.089   12.505  1.00 0.00 ? 31 ARG A HA   5  
ATOM 8335  H HB2  . ARG A 1 31 ? -0.445  4.183   14.016  1.00 0.00 ? 31 ARG A HB2  5  
ATOM 8336  H HB3  . ARG A 1 31 ? -1.194  5.189   12.784  1.00 0.00 ? 31 ARG A HB3  5  
ATOM 8337  H HG2  . ARG A 1 31 ? -3.340  5.006   13.916  1.00 0.00 ? 31 ARG A HG2  5  
ATOM 8338  H HG3  . ARG A 1 31 ? -2.614  3.961   15.139  1.00 0.00 ? 31 ARG A HG3  5  
ATOM 8339  H HD2  . ARG A 1 31 ? -0.948  6.121   15.185  1.00 0.00 ? 31 ARG A HD2  5  
ATOM 8340  H HD3  . ARG A 1 31 ? -2.503  6.874   14.835  1.00 0.00 ? 31 ARG A HD3  5  
ATOM 8341  H HE   . ARG A 1 31 ? -3.195  6.366   16.961  1.00 0.00 ? 31 ARG A HE   5  
ATOM 8342  H HH11 . ARG A 1 31 ? -0.294  4.563   16.246  1.00 0.00 ? 31 ARG A HH11 5  
ATOM 8343  H HH12 . ARG A 1 31 ? -0.090  4.005   17.872  1.00 0.00 ? 31 ARG A HH12 5  
ATOM 8344  H HH21 . ARG A 1 31 ? -2.928  5.635   19.101  1.00 0.00 ? 31 ARG A HH21 5  
ATOM 8345  H HH22 . ARG A 1 31 ? -1.585  4.613   19.494  1.00 0.00 ? 31 ARG A HH22 5  
ATOM 8346  N N    . ILE A 1 32 ? -1.741  2.857   10.251  1.00 0.00 ? 32 ILE A N    5  
ATOM 8347  C CA   . ILE A 1 32 ? -1.162  2.828   8.914   1.00 0.00 ? 32 ILE A CA   5  
ATOM 8348  C C    . ILE A 1 32 ? -1.184  4.210   8.270   1.00 0.00 ? 32 ILE A C    5  
ATOM 8349  O O    . ILE A 1 32 ? -2.170  4.939   8.374   1.00 0.00 ? 32 ILE A O    5  
ATOM 8350  C CB   . ILE A 1 32 ? -1.909  1.829   8.009   1.00 0.00 ? 32 ILE A CB   5  
ATOM 8351  C CG1  . ILE A 1 32 ? -2.190  0.531   8.775   1.00 0.00 ? 32 ILE A CG1  5  
ATOM 8352  C CG2  . ILE A 1 32 ? -1.104  1.547   6.749   1.00 0.00 ? 32 ILE A CG2  5  
ATOM 8353  C CD1  . ILE A 1 32 ? -0.937  -0.231  9.152   1.00 0.00 ? 32 ILE A CD1  5  
ATOM 8354  H H    . ILE A 1 32 ? -2.692  2.644   10.366  1.00 0.00 ? 32 ILE A H    5  
ATOM 8355  H HA   . ILE A 1 32 ? -0.136  2.501   9.003   1.00 0.00 ? 32 ILE A HA   5  
ATOM 8356  H HB   . ILE A 1 32 ? -2.847  2.275   7.715   1.00 0.00 ? 32 ILE A HB   5  
ATOM 8357  H HG12 . ILE A 1 32 ? -2.720  0.766   9.687   1.00 0.00 ? 32 ILE A HG12 5  
ATOM 8358  H HG13 . ILE A 1 32 ? -2.802  -0.117  8.165   1.00 0.00 ? 32 ILE A HG13 5  
ATOM 8359  H HG21 . ILE A 1 32 ? -1.758  1.154   5.984   1.00 0.00 ? 32 ILE A HG21 5  
ATOM 8360  H HG22 . ILE A 1 32 ? -0.332  0.825   6.969   1.00 0.00 ? 32 ILE A HG22 5  
ATOM 8361  H HG23 . ILE A 1 32 ? -0.651  2.463   6.399   1.00 0.00 ? 32 ILE A HG23 5  
ATOM 8362  H HD11 . ILE A 1 32 ? -0.642  0.036   10.156  1.00 0.00 ? 32 ILE A HD11 5  
ATOM 8363  H HD12 . ILE A 1 32 ? -0.143  0.019   8.465   1.00 0.00 ? 32 ILE A HD12 5  
ATOM 8364  H HD13 . ILE A 1 32 ? -1.134  -1.292  9.105   1.00 0.00 ? 32 ILE A HD13 5  
ATOM 8365  N N    . GLY A 1 33 ? -0.085  4.566   7.607   1.00 0.00 ? 33 GLY A N    5  
ATOM 8366  C CA   . GLY A 1 33 ? 0.006   5.860   6.959   1.00 0.00 ? 33 GLY A CA   5  
ATOM 8367  C C    . GLY A 1 33 ? -0.065  5.758   5.452   1.00 0.00 ? 33 GLY A C    5  
ATOM 8368  O O    . GLY A 1 33 ? 0.797   5.145   4.824   1.00 0.00 ? 33 GLY A O    5  
ATOM 8369  H H    . GLY A 1 33 ? 0.672   3.944   7.555   1.00 0.00 ? 33 GLY A H    5  
ATOM 8370  H HA2  . GLY A 1 33 ? -0.804  6.481   7.302   1.00 0.00 ? 33 GLY A HA2  5  
ATOM 8371  H HA3  . GLY A 1 33 ? 0.942   6.323   7.233   1.00 0.00 ? 33 GLY A HA3  5  
ATOM 8372  N N    . VAL A 1 34 ? -1.096  6.358   4.867   1.00 0.00 ? 34 VAL A N    5  
ATOM 8373  C CA   . VAL A 1 34 ? -1.268  6.325   3.422   1.00 0.00 ? 34 VAL A CA   5  
ATOM 8374  C C    . VAL A 1 34 ? -1.221  7.726   2.824   1.00 0.00 ? 34 VAL A C    5  
ATOM 8375  O O    . VAL A 1 34 ? -2.187  8.484   2.911   1.00 0.00 ? 34 VAL A O    5  
ATOM 8376  C CB   . VAL A 1 34 ? -2.600  5.660   3.031   1.00 0.00 ? 34 VAL A CB   5  
ATOM 8377  C CG1  . VAL A 1 34 ? -2.649  5.405   1.532   1.00 0.00 ? 34 VAL A CG1  5  
ATOM 8378  C CG2  . VAL A 1 34 ? -2.801  4.368   3.807   1.00 0.00 ? 34 VAL A CG2  5  
ATOM 8379  H H    . VAL A 1 34 ? -1.753  6.830   5.420   1.00 0.00 ? 34 VAL A H    5  
ATOM 8380  H HA   . VAL A 1 34 ? -0.463  5.740   3.005   1.00 0.00 ? 34 VAL A HA   5  
ATOM 8381  H HB   . VAL A 1 34 ? -3.404  6.336   3.284   1.00 0.00 ? 34 VAL A HB   5  
ATOM 8382  H HG11 . VAL A 1 34 ? -3.651  5.581   1.170   1.00 0.00 ? 34 VAL A HG11 5  
ATOM 8383  H HG12 . VAL A 1 34 ? -2.369  4.381   1.332   1.00 0.00 ? 34 VAL A HG12 5  
ATOM 8384  H HG13 . VAL A 1 34 ? -1.962  6.071   1.031   1.00 0.00 ? 34 VAL A HG13 5  
ATOM 8385  H HG21 . VAL A 1 34 ? -2.608  4.544   4.855   1.00 0.00 ? 34 VAL A HG21 5  
ATOM 8386  H HG22 . VAL A 1 34 ? -2.119  3.616   3.437   1.00 0.00 ? 34 VAL A HG22 5  
ATOM 8387  H HG23 . VAL A 1 34 ? -3.818  4.026   3.681   1.00 0.00 ? 34 VAL A HG23 5  
ATOM 8388  N N    . ASN A 1 35 ? -0.090  8.061   2.212   1.00 0.00 ? 35 ASN A N    5  
ATOM 8389  C CA   . ASN A 1 35 ? 0.078   9.369   1.592   1.00 0.00 ? 35 ASN A CA   5  
ATOM 8390  C C    . ASN A 1 35 ? -0.238  9.295   0.103   1.00 0.00 ? 35 ASN A C    5  
ATOM 8391  O O    . ASN A 1 35 ? 0.528   8.736   -0.682  1.00 0.00 ? 35 ASN A O    5  
ATOM 8392  C CB   . ASN A 1 35 ? 1.501   9.901   1.803   1.00 0.00 ? 35 ASN A CB   5  
ATOM 8393  C CG   . ASN A 1 35 ? 2.089   9.488   3.140   1.00 0.00 ? 35 ASN A CG   5  
ATOM 8394  O OD1  . ASN A 1 35 ? 1.363   9.125   4.066   1.00 0.00 ? 35 ASN A OD1  5  
ATOM 8395  N ND2  . ASN A 1 35 ? 3.411   9.543   3.247   1.00 0.00 ? 35 ASN A ND2  5  
ATOM 8396  H H    . ASN A 1 35 ? 0.643   7.411   2.185   1.00 0.00 ? 35 ASN A H    5  
ATOM 8397  H HA   . ASN A 1 35 ? -0.622  10.046  2.060   1.00 0.00 ? 35 ASN A HA   5  
ATOM 8398  H HB2  . ASN A 1 35 ? 2.140   9.527   1.019   1.00 0.00 ? 35 ASN A HB2  5  
ATOM 8399  H HB3  . ASN A 1 35 ? 1.482   10.980  1.759   1.00 0.00 ? 35 ASN A HB3  5  
ATOM 8400  H HD21 . ASN A 1 35 ? 3.927   9.843   2.469   1.00 0.00 ? 35 ASN A HD21 5  
ATOM 8401  H HD22 . ASN A 1 35 ? 3.818   9.282   4.100   1.00 0.00 ? 35 ASN A HD22 5  
ATOM 8402  N N    . ALA A 1 36 ? -1.380  9.856   -0.270  1.00 0.00 ? 36 ALA A N    5  
ATOM 8403  C CA   . ALA A 1 36 ? -1.817  9.852   -1.661  1.00 0.00 ? 36 ALA A CA   5  
ATOM 8404  C C    . ALA A 1 36 ? -2.318  11.226  -2.096  1.00 0.00 ? 36 ALA A C    5  
ATOM 8405  O O    . ALA A 1 36 ? -2.916  11.958  -1.308  1.00 0.00 ? 36 ALA A O    5  
ATOM 8406  C CB   . ALA A 1 36 ? -2.901  8.805   -1.867  1.00 0.00 ? 36 ALA A CB   5  
ATOM 8407  H H    . ALA A 1 36 ? -1.941  10.271  0.416   1.00 0.00 ? 36 ALA A H    5  
ATOM 8408  H HA   . ALA A 1 36 ? -0.969  9.580   -2.272  1.00 0.00 ? 36 ALA A HA   5  
ATOM 8409  H HB1  . ALA A 1 36 ? -2.588  7.871   -1.425  1.00 0.00 ? 36 ALA A HB1  5  
ATOM 8410  H HB2  . ALA A 1 36 ? -3.068  8.664   -2.925  1.00 0.00 ? 36 ALA A HB2  5  
ATOM 8411  H HB3  . ALA A 1 36 ? -3.816  9.136   -1.399  1.00 0.00 ? 36 ALA A HB3  5  
ATOM 8412  N N    . PRO A 1 37 ? -2.083  11.592  -3.369  1.00 0.00 ? 37 PRO A N    5  
ATOM 8413  C CA   . PRO A 1 37 ? -2.514  12.878  -3.917  1.00 0.00 ? 37 PRO A CA   5  
ATOM 8414  C C    . PRO A 1 37 ? -3.999  12.886  -4.263  1.00 0.00 ? 37 PRO A C    5  
ATOM 8415  O O    . PRO A 1 37 ? -4.596  11.835  -4.495  1.00 0.00 ? 37 PRO A O    5  
ATOM 8416  C CB   . PRO A 1 37 ? -1.670  13.014  -5.181  1.00 0.00 ? 37 PRO A CB   5  
ATOM 8417  C CG   . PRO A 1 37 ? -1.447  11.612  -5.630  1.00 0.00 ? 37 PRO A CG   5  
ATOM 8418  C CD   . PRO A 1 37 ? -1.380  10.774  -4.379  1.00 0.00 ? 37 PRO A CD   5  
ATOM 8419  H HA   . PRO A 1 37 ? -2.295  13.692  -3.242  1.00 0.00 ? 37 PRO A HA   5  
ATOM 8420  H HB2  . PRO A 1 37 ? -2.212  13.586  -5.920  1.00 0.00 ? 37 PRO A HB2  5  
ATOM 8421  H HB3  . PRO A 1 37 ? -0.739  13.506  -4.946  1.00 0.00 ? 37 PRO A HB3  5  
ATOM 8422  H HG2  . PRO A 1 37 ? -2.269  11.290  -6.252  1.00 0.00 ? 37 PRO A HG2  5  
ATOM 8423  H HG3  . PRO A 1 37 ? -0.517  11.545  -6.175  1.00 0.00 ? 37 PRO A HG3  5  
ATOM 8424  H HD2  . PRO A 1 37 ? -1.885  9.831   -4.530  1.00 0.00 ? 37 PRO A HD2  5  
ATOM 8425  H HD3  . PRO A 1 37 ? -0.352  10.609  -4.091  1.00 0.00 ? 37 PRO A HD3  5  
ATOM 8426  N N    . LYS A 1 38 ? -4.590  14.075  -4.296  1.00 0.00 ? 38 LYS A N    5  
ATOM 8427  C CA   . LYS A 1 38 ? -6.007  14.213  -4.614  1.00 0.00 ? 38 LYS A CA   5  
ATOM 8428  C C    . LYS A 1 38 ? -6.219  14.418  -6.113  1.00 0.00 ? 38 LYS A C    5  
ATOM 8429  O O    . LYS A 1 38 ? -7.209  15.020  -6.530  1.00 0.00 ? 38 LYS A O    5  
ATOM 8430  C CB   . LYS A 1 38 ? -6.612  15.383  -3.834  1.00 0.00 ? 38 LYS A CB   5  
ATOM 8431  C CG   . LYS A 1 38 ? -7.675  14.960  -2.832  1.00 0.00 ? 38 LYS A CG   5  
ATOM 8432  C CD   . LYS A 1 38 ? -8.972  15.726  -3.036  1.00 0.00 ? 38 LYS A CD   5  
ATOM 8433  C CE   . LYS A 1 38 ? -10.034 15.299  -2.035  1.00 0.00 ? 38 LYS A CE   5  
ATOM 8434  N NZ   . LYS A 1 38 ? -10.915 16.433  -1.642  1.00 0.00 ? 38 LYS A NZ   5  
ATOM 8435  H H    . LYS A 1 38 ? -4.063  14.878  -4.102  1.00 0.00 ? 38 LYS A H    5  
ATOM 8436  H HA   . LYS A 1 38 ? -6.502  13.301  -4.316  1.00 0.00 ? 38 LYS A HA   5  
ATOM 8437  H HB2  . LYS A 1 38 ? -5.822  15.888  -3.296  1.00 0.00 ? 38 LYS A HB2  5  
ATOM 8438  H HB3  . LYS A 1 38 ? -7.059  16.076  -4.531  1.00 0.00 ? 38 LYS A HB3  5  
ATOM 8439  H HG2  . LYS A 1 38 ? -7.869  13.905  -2.952  1.00 0.00 ? 38 LYS A HG2  5  
ATOM 8440  H HG3  . LYS A 1 38 ? -7.309  15.149  -1.833  1.00 0.00 ? 38 LYS A HG3  5  
ATOM 8441  H HD2  . LYS A 1 38 ? -8.780  16.781  -2.912  1.00 0.00 ? 38 LYS A HD2  5  
ATOM 8442  H HD3  . LYS A 1 38 ? -9.336  15.539  -4.035  1.00 0.00 ? 38 LYS A HD3  5  
ATOM 8443  H HE2  . LYS A 1 38 ? -10.639 14.523  -2.480  1.00 0.00 ? 38 LYS A HE2  5  
ATOM 8444  H HE3  . LYS A 1 38 ? -9.545  14.912  -1.153  1.00 0.00 ? 38 LYS A HE3  5  
ATOM 8445  H HZ1  . LYS A 1 38 ? -10.568 16.867  -0.763  1.00 0.00 ? 38 LYS A HZ1  5  
ATOM 8446  H HZ2  . LYS A 1 38 ? -11.886 16.096  -1.488  1.00 0.00 ? 38 LYS A HZ2  5  
ATOM 8447  H HZ3  . LYS A 1 38 ? -10.925 17.154  -2.392  1.00 0.00 ? 38 LYS A HZ3  5  
ATOM 8448  N N    . GLU A 1 39 ? -5.288  13.915  -6.921  1.00 0.00 ? 39 GLU A N    5  
ATOM 8449  C CA   . GLU A 1 39 ? -5.383  14.047  -8.370  1.00 0.00 ? 39 GLU A CA   5  
ATOM 8450  C C    . GLU A 1 39 ? -5.765  12.716  -9.013  1.00 0.00 ? 39 GLU A C    5  
ATOM 8451  O O    . GLU A 1 39 ? -6.565  12.674  -9.947  1.00 0.00 ? 39 GLU A O    5  
ATOM 8452  C CB   . GLU A 1 39 ? -4.055  14.546  -8.945  1.00 0.00 ? 39 GLU A CB   5  
ATOM 8453  C CG   . GLU A 1 39 ? -4.183  15.836  -9.738  1.00 0.00 ? 39 GLU A CG   5  
ATOM 8454  C CD   . GLU A 1 39 ? -3.874  17.066  -8.906  1.00 0.00 ? 39 GLU A CD   5  
ATOM 8455  O OE1  . GLU A 1 39 ? -3.135  16.937  -7.908  1.00 0.00 ? 39 GLU A OE1  5  
ATOM 8456  O OE2  . GLU A 1 39 ? -4.372  18.158  -9.253  1.00 0.00 ? 39 GLU A OE2  5  
ATOM 8457  H H    . GLU A 1 39 ? -4.521  13.445  -6.537  1.00 0.00 ? 39 GLU A H    5  
ATOM 8458  H HA   . GLU A 1 39 ? -6.154  14.771  -8.587  1.00 0.00 ? 39 GLU A HA   5  
ATOM 8459  H HB2  . GLU A 1 39 ? -3.366  14.717  -8.131  1.00 0.00 ? 39 GLU A HB2  5  
ATOM 8460  H HB3  . GLU A 1 39 ? -3.647  13.788  -9.597  1.00 0.00 ? 39 GLU A HB3  5  
ATOM 8461  H HG2  . GLU A 1 39 ? -3.496  15.802  -10.570 1.00 0.00 ? 39 GLU A HG2  5  
ATOM 8462  H HG3  . GLU A 1 39 ? -5.194  15.916  -10.111 1.00 0.00 ? 39 GLU A HG3  5  
ATOM 8463  N N    . VAL A 1 40 ? -5.190  11.630  -8.504  1.00 0.00 ? 40 VAL A N    5  
ATOM 8464  C CA   . VAL A 1 40 ? -5.475  10.299  -9.029  1.00 0.00 ? 40 VAL A CA   5  
ATOM 8465  C C    . VAL A 1 40 ? -6.764  9.744   -8.432  1.00 0.00 ? 40 VAL A C    5  
ATOM 8466  O O    . VAL A 1 40 ? -7.153  10.111  -7.323  1.00 0.00 ? 40 VAL A O    5  
ATOM 8467  C CB   . VAL A 1 40 ? -4.320  9.316   -8.745  1.00 0.00 ? 40 VAL A CB   5  
ATOM 8468  C CG1  . VAL A 1 40 ? -4.476  8.054   -9.579  1.00 0.00 ? 40 VAL A CG1  5  
ATOM 8469  C CG2  . VAL A 1 40 ? -2.976  9.976   -9.014  1.00 0.00 ? 40 VAL A CG2  5  
ATOM 8470  H H    . VAL A 1 40 ? -4.563  11.726  -7.758  1.00 0.00 ? 40 VAL A H    5  
ATOM 8471  H HA   . VAL A 1 40 ? -5.594  10.382  -10.100 1.00 0.00 ? 40 VAL A HA   5  
ATOM 8472  H HB   . VAL A 1 40 ? -4.357  9.036   -7.702  1.00 0.00 ? 40 VAL A HB   5  
ATOM 8473  H HG11 . VAL A 1 40 ? -4.367  8.298   -10.625 1.00 0.00 ? 40 VAL A HG11 5  
ATOM 8474  H HG12 . VAL A 1 40 ? -5.453  7.629   -9.408  1.00 0.00 ? 40 VAL A HG12 5  
ATOM 8475  H HG13 . VAL A 1 40 ? -3.718  7.339   -9.295  1.00 0.00 ? 40 VAL A HG13 5  
ATOM 8476  H HG21 . VAL A 1 40 ? -2.681  10.557  -8.152  1.00 0.00 ? 40 VAL A HG21 5  
ATOM 8477  H HG22 . VAL A 1 40 ? -3.058  10.624  -9.873  1.00 0.00 ? 40 VAL A HG22 5  
ATOM 8478  H HG23 . VAL A 1 40 ? -2.233  9.216   -9.206  1.00 0.00 ? 40 VAL A HG23 5  
ATOM 8479  N N    . SER A 1 41 ? -7.427  8.863   -9.174  1.00 0.00 ? 41 SER A N    5  
ATOM 8480  C CA   . SER A 1 41 ? -8.676  8.264   -8.717  1.00 0.00 ? 41 SER A CA   5  
ATOM 8481  C C    . SER A 1 41 ? -8.455  7.424   -7.464  1.00 0.00 ? 41 SER A C    5  
ATOM 8482  O O    . SER A 1 41 ? -8.027  6.273   -7.544  1.00 0.00 ? 41 SER A O    5  
ATOM 8483  C CB   . SER A 1 41 ? -9.284  7.399   -9.823  1.00 0.00 ? 41 SER A CB   5  
ATOM 8484  O OG   . SER A 1 41 ? -8.968  7.913   -11.105 1.00 0.00 ? 41 SER A OG   5  
ATOM 8485  H H    . SER A 1 41 ? -7.069  8.611   -10.051 1.00 0.00 ? 41 SER A H    5  
ATOM 8486  H HA   . SER A 1 41 ? -9.360  9.065   -8.483  1.00 0.00 ? 41 SER A HA   5  
ATOM 8487  H HB2  . SER A 1 41 ? -8.896  6.395   -9.746  1.00 0.00 ? 41 SER A HB2  5  
ATOM 8488  H HB3  . SER A 1 41 ? -10.358 7.379   -9.711  1.00 0.00 ? 41 SER A HB3  5  
ATOM 8489  H HG   . SER A 1 41 ? -9.129  7.239   -11.769 1.00 0.00 ? 41 SER A HG   5  
ATOM 8490  N N    . VAL A 1 42 ? -8.753  8.005   -6.306  1.00 0.00 ? 42 VAL A N    5  
ATOM 8491  C CA   . VAL A 1 42 ? -8.590  7.306   -5.037  1.00 0.00 ? 42 VAL A CA   5  
ATOM 8492  C C    . VAL A 1 42 ? -9.911  7.241   -4.271  1.00 0.00 ? 42 VAL A C    5  
ATOM 8493  O O    . VAL A 1 42 ? -10.495 8.272   -3.940  1.00 0.00 ? 42 VAL A O    5  
ATOM 8494  C CB   . VAL A 1 42 ? -7.529  7.993   -4.154  1.00 0.00 ? 42 VAL A CB   5  
ATOM 8495  C CG1  . VAL A 1 42 ? -7.958  9.408   -3.799  1.00 0.00 ? 42 VAL A CG1  5  
ATOM 8496  C CG2  . VAL A 1 42 ? -7.268  7.175   -2.897  1.00 0.00 ? 42 VAL A CG2  5  
ATOM 8497  H H    . VAL A 1 42 ? -9.095  8.924   -6.303  1.00 0.00 ? 42 VAL A H    5  
ATOM 8498  H HA   . VAL A 1 42 ? -8.254  6.302   -5.251  1.00 0.00 ? 42 VAL A HA   5  
ATOM 8499  H HB   . VAL A 1 42 ? -6.609  8.052   -4.715  1.00 0.00 ? 42 VAL A HB   5  
ATOM 8500  H HG11 . VAL A 1 42 ? -7.112  9.955   -3.410  1.00 0.00 ? 42 VAL A HG11 5  
ATOM 8501  H HG12 . VAL A 1 42 ? -8.737  9.372   -3.051  1.00 0.00 ? 42 VAL A HG12 5  
ATOM 8502  H HG13 . VAL A 1 42 ? -8.331  9.904   -4.683  1.00 0.00 ? 42 VAL A HG13 5  
ATOM 8503  H HG21 . VAL A 1 42 ? -6.245  7.319   -2.580  1.00 0.00 ? 42 VAL A HG21 5  
ATOM 8504  H HG22 . VAL A 1 42 ? -7.436  6.129   -3.107  1.00 0.00 ? 42 VAL A HG22 5  
ATOM 8505  H HG23 . VAL A 1 42 ? -7.937  7.497   -2.113  1.00 0.00 ? 42 VAL A HG23 5  
ATOM 8506  N N    . HIS A 1 43 ? -10.374 6.027   -3.985  1.00 0.00 ? 43 HIS A N    5  
ATOM 8507  C CA   . HIS A 1 43 ? -11.619 5.836   -3.251  1.00 0.00 ? 43 HIS A CA   5  
ATOM 8508  C C    . HIS A 1 43 ? -11.407 4.895   -2.070  1.00 0.00 ? 43 HIS A C    5  
ATOM 8509  O O    . HIS A 1 43 ? -10.748 3.863   -2.200  1.00 0.00 ? 43 HIS A O    5  
ATOM 8510  C CB   . HIS A 1 43 ? -12.702 5.276   -4.177  1.00 0.00 ? 43 HIS A CB   5  
ATOM 8511  C CG   . HIS A 1 43 ? -13.139 6.239   -5.237  1.00 0.00 ? 43 HIS A CG   5  
ATOM 8512  N ND1  . HIS A 1 43 ? -14.457 6.585   -5.444  1.00 0.00 ? 43 HIS A ND1  5  
ATOM 8513  C CD2  . HIS A 1 43 ? -12.423 6.933   -6.155  1.00 0.00 ? 43 HIS A CD2  5  
ATOM 8514  C CE1  . HIS A 1 43 ? -14.536 7.448   -6.441  1.00 0.00 ? 43 HIS A CE1  5  
ATOM 8515  N NE2  . HIS A 1 43 ? -13.315 7.676   -6.889  1.00 0.00 ? 43 HIS A NE2  5  
ATOM 8516  H H    . HIS A 1 43 ? -9.867  5.236   -4.266  1.00 0.00 ? 43 HIS A H    5  
ATOM 8517  H HA   . HIS A 1 43 ? -11.937 6.798   -2.879  1.00 0.00 ? 43 HIS A HA   5  
ATOM 8518  H HB2  . HIS A 1 43 ? -12.324 4.392   -4.668  1.00 0.00 ? 43 HIS A HB2  5  
ATOM 8519  H HB3  . HIS A 1 43 ? -13.568 5.013   -3.588  1.00 0.00 ? 43 HIS A HB3  5  
ATOM 8520  H HD2  . HIS A 1 43 ? -11.350 6.907   -6.285  1.00 0.00 ? 43 HIS A HD2  5  
ATOM 8521  H HE1  . HIS A 1 43 ? -15.443 7.892   -6.822  1.00 0.00 ? 43 HIS A HE1  5  
ATOM 8522  H HE2  . HIS A 1 43 ? -13.078 8.345   -7.565  1.00 0.00 ? 43 HIS A HE2  5  
ATOM 8523  N N    . ARG A 1 44 ? -11.967 5.249   -0.918  1.00 0.00 ? 44 ARG A N    5  
ATOM 8524  C CA   . ARG A 1 44 ? -11.833 4.422   0.277   1.00 0.00 ? 44 ARG A CA   5  
ATOM 8525  C C    . ARG A 1 44 ? -12.835 4.839   1.350   1.00 0.00 ? 44 ARG A C    5  
ATOM 8526  O O    . ARG A 1 44 ? -13.427 3.993   2.019   1.00 0.00 ? 44 ARG A O    5  
ATOM 8527  C CB   . ARG A 1 44 ? -10.406 4.504   0.828   1.00 0.00 ? 44 ARG A CB   5  
ATOM 8528  C CG   . ARG A 1 44 ? -9.947  5.920   1.142   1.00 0.00 ? 44 ARG A CG   5  
ATOM 8529  C CD   . ARG A 1 44 ? -8.694  5.922   2.004   1.00 0.00 ? 44 ARG A CD   5  
ATOM 8530  N NE   . ARG A 1 44 ? -7.611  6.690   1.395   1.00 0.00 ? 44 ARG A NE   5  
ATOM 8531  C CZ   . ARG A 1 44 ? -7.523  8.018   1.446   1.00 0.00 ? 44 ARG A CZ   5  
ATOM 8532  N NH1  . ARG A 1 44 ? -8.454  8.728   2.071   1.00 0.00 ? 44 ARG A NH1  5  
ATOM 8533  N NH2  . ARG A 1 44 ? -6.501  8.637   0.870   1.00 0.00 ? 44 ARG A NH2  5  
ATOM 8534  H H    . ARG A 1 44 ? -12.486 6.079   -0.869  1.00 0.00 ? 44 ARG A H    5  
ATOM 8535  H HA   . ARG A 1 44 ? -12.038 3.401   -0.007  1.00 0.00 ? 44 ARG A HA   5  
ATOM 8536  H HB2  . ARG A 1 44 ? -10.351 3.923   1.736   1.00 0.00 ? 44 ARG A HB2  5  
ATOM 8537  H HB3  . ARG A 1 44 ? -9.728  4.082   0.101   1.00 0.00 ? 44 ARG A HB3  5  
ATOM 8538  H HG2  . ARG A 1 44 ? -9.736  6.433   0.216   1.00 0.00 ? 44 ARG A HG2  5  
ATOM 8539  H HG3  . ARG A 1 44 ? -10.735 6.435   1.669   1.00 0.00 ? 44 ARG A HG3  5  
ATOM 8540  H HD2  . ARG A 1 44 ? -8.933  6.355   2.963   1.00 0.00 ? 44 ARG A HD2  5  
ATOM 8541  H HD3  . ARG A 1 44 ? -8.365  4.902   2.143   1.00 0.00 ? 44 ARG A HD3  5  
ATOM 8542  H HE   . ARG A 1 44 ? -6.911  6.191   0.924   1.00 0.00 ? 44 ARG A HE   5  
ATOM 8543  H HH11 . ARG A 1 44 ? -9.227  8.268   2.507   1.00 0.00 ? 44 ARG A HH11 5  
ATOM 8544  H HH12 . ARG A 1 44 ? -8.381  9.725   2.107   1.00 0.00 ? 44 ARG A HH12 5  
ATOM 8545  H HH21 . ARG A 1 44 ? -5.798  8.107   0.397   1.00 0.00 ? 44 ARG A HH21 5  
ATOM 8546  H HH22 . ARG A 1 44 ? -6.435  9.634   0.909   1.00 0.00 ? 44 ARG A HH22 5  
ATOM 8547  N N    . GLU A 1 45 ? -13.021 6.146   1.510   1.00 0.00 ? 45 GLU A N    5  
ATOM 8548  C CA   . GLU A 1 45 ? -13.954 6.670   2.502   1.00 0.00 ? 45 GLU A CA   5  
ATOM 8549  C C    . GLU A 1 45 ? -13.936 8.197   2.513   1.00 0.00 ? 45 GLU A C    5  
ATOM 8550  O O    . GLU A 1 45 ? -12.929 8.817   2.862   1.00 0.00 ? 45 GLU A O    5  
ATOM 8551  C CB   . GLU A 1 45 ? -13.612 6.129   3.894   1.00 0.00 ? 45 GLU A CB   5  
ATOM 8552  C CG   . GLU A 1 45 ? -14.576 5.061   4.384   1.00 0.00 ? 45 GLU A CG   5  
ATOM 8553  C CD   . GLU A 1 45 ? -15.718 5.636   5.200   1.00 0.00 ? 45 GLU A CD   5  
ATOM 8554  O OE1  . GLU A 1 45 ? -15.453 6.493   6.069   1.00 0.00 ? 45 GLU A OE1  5  
ATOM 8555  O OE2  . GLU A 1 45 ? -16.876 5.230   4.969   1.00 0.00 ? 45 GLU A OE2  5  
ATOM 8556  H H    . GLU A 1 45 ? -12.521 6.774   0.947   1.00 0.00 ? 45 GLU A H    5  
ATOM 8557  H HA   . GLU A 1 45 ? -14.944 6.337   2.231   1.00 0.00 ? 45 GLU A HA   5  
ATOM 8558  H HB2  . GLU A 1 45 ? -12.620 5.703   3.868   1.00 0.00 ? 45 GLU A HB2  5  
ATOM 8559  H HB3  . GLU A 1 45 ? -13.625 6.945   4.600   1.00 0.00 ? 45 GLU A HB3  5  
ATOM 8560  H HG2  . GLU A 1 45 ? -14.989 4.547   3.529   1.00 0.00 ? 45 GLU A HG2  5  
ATOM 8561  H HG3  . GLU A 1 45 ? -14.033 4.357   4.998   1.00 0.00 ? 45 GLU A HG3  5  
ATOM 8562  N N    . GLU A 1 46 ? -15.061 8.797   2.135   1.00 0.00 ? 46 GLU A N    5  
ATOM 8563  C CA   . GLU A 1 46 ? -15.181 10.249  2.104   1.00 0.00 ? 46 GLU A CA   5  
ATOM 8564  C C    . GLU A 1 46 ? -14.913 10.841  3.483   1.00 0.00 ? 46 GLU A C    5  
ATOM 8565  O O    . GLU A 1 46 ? -14.282 11.889  3.608   1.00 0.00 ? 46 GLU A O    5  
ATOM 8566  C CB   . GLU A 1 46 ? -16.573 10.658  1.621   1.00 0.00 ? 46 GLU A CB   5  
ATOM 8567  C CG   . GLU A 1 46 ? -16.905 10.156  0.225   1.00 0.00 ? 46 GLU A CG   5  
ATOM 8568  C CD   . GLU A 1 46 ? -17.857 8.976   0.241   1.00 0.00 ? 46 GLU A CD   5  
ATOM 8569  O OE1  . GLU A 1 46 ? -17.800 8.180   1.201   1.00 0.00 ? 46 GLU A OE1  5  
ATOM 8570  O OE2  . GLU A 1 46 ? -18.660 8.850   -0.707  1.00 0.00 ? 46 GLU A OE2  5  
ATOM 8571  H H    . GLU A 1 46 ? -15.832 8.249   1.877   1.00 0.00 ? 46 GLU A H    5  
ATOM 8572  H HA   . GLU A 1 46 ? -14.443 10.628  1.413   1.00 0.00 ? 46 GLU A HA   5  
ATOM 8573  H HB2  . GLU A 1 46 ? -17.310 10.265  2.306   1.00 0.00 ? 46 GLU A HB2  5  
ATOM 8574  H HB3  . GLU A 1 46 ? -16.638 11.736  1.617   1.00 0.00 ? 46 GLU A HB3  5  
ATOM 8575  H HG2  . GLU A 1 46 ? -17.361 10.959  -0.334  1.00 0.00 ? 46 GLU A HG2  5  
ATOM 8576  H HG3  . GLU A 1 46 ? -15.989 9.855   -0.261  1.00 0.00 ? 46 GLU A HG3  5  
ATOM 8577  N N    . ILE A 1 47 ? -15.394 10.156  4.516   1.00 0.00 ? 47 ILE A N    5  
ATOM 8578  C CA   . ILE A 1 47 ? -15.204 10.607  5.887   1.00 0.00 ? 47 ILE A CA   5  
ATOM 8579  C C    . ILE A 1 47 ? -13.742 10.483  6.301   1.00 0.00 ? 47 ILE A C    5  
ATOM 8580  O O    . ILE A 1 47 ? -13.186 11.379  6.935   1.00 0.00 ? 47 ILE A O    5  
ATOM 8581  C CB   . ILE A 1 47 ? -16.075 9.799   6.869   1.00 0.00 ? 47 ILE A CB   5  
ATOM 8582  C CG1  . ILE A 1 47 ? -17.526 9.763   6.386   1.00 0.00 ? 47 ILE A CG1  5  
ATOM 8583  C CG2  . ILE A 1 47 ? -15.991 10.392  8.267   1.00 0.00 ? 47 ILE A CG2  5  
ATOM 8584  C CD1  . ILE A 1 47 ? -18.144 11.135  6.224   1.00 0.00 ? 47 ILE A CD1  5  
ATOM 8585  H H    . ILE A 1 47 ? -15.885 9.324   4.351   1.00 0.00 ? 47 ILE A H    5  
ATOM 8586  H HA   . ILE A 1 47 ? -15.499 11.645  5.943   1.00 0.00 ? 47 ILE A HA   5  
ATOM 8587  H HB   . ILE A 1 47 ? -15.692 8.791   6.909   1.00 0.00 ? 47 ILE A HB   5  
ATOM 8588  H HG12 . ILE A 1 47 ? -17.568 9.267   5.428   1.00 0.00 ? 47 ILE A HG12 5  
ATOM 8589  H HG13 . ILE A 1 47 ? -18.122 9.211   7.098   1.00 0.00 ? 47 ILE A HG13 5  
ATOM 8590  H HG21 . ILE A 1 47 ? -16.385 9.684   8.982   1.00 0.00 ? 47 ILE A HG21 5  
ATOM 8591  H HG22 . ILE A 1 47 ? -16.569 11.304  8.307   1.00 0.00 ? 47 ILE A HG22 5  
ATOM 8592  H HG23 . ILE A 1 47 ? -14.960 10.608  8.505   1.00 0.00 ? 47 ILE A HG23 5  
ATOM 8593  H HD11 . ILE A 1 47 ? -17.496 11.752  5.620   1.00 0.00 ? 47 ILE A HD11 5  
ATOM 8594  H HD12 . ILE A 1 47 ? -18.270 11.589  7.196   1.00 0.00 ? 47 ILE A HD12 5  
ATOM 8595  H HD13 . ILE A 1 47 ? -19.105 11.042  5.742   1.00 0.00 ? 47 ILE A HD13 5  
ATOM 8596  N N    . TYR A 1 48 ? -13.127 9.361   5.942   1.00 0.00 ? 48 TYR A N    5  
ATOM 8597  C CA   . TYR A 1 48 ? -11.729 9.108   6.275   1.00 0.00 ? 48 TYR A CA   5  
ATOM 8598  C C    . TYR A 1 48 ? -10.837 10.274  5.858   1.00 0.00 ? 48 TYR A C    5  
ATOM 8599  O O    . TYR A 1 48 ? -9.941  10.675  6.599   1.00 0.00 ? 48 TYR A O    5  
ATOM 8600  C CB   . TYR A 1 48 ? -11.249 7.821   5.600   1.00 0.00 ? 48 TYR A CB   5  
ATOM 8601  C CG   . TYR A 1 48 ? -11.459 6.579   6.438   1.00 0.00 ? 48 TYR A CG   5  
ATOM 8602  C CD1  . TYR A 1 48 ? -12.610 6.417   7.201   1.00 0.00 ? 48 TYR A CD1  5  
ATOM 8603  C CD2  . TYR A 1 48 ? -10.506 5.568   6.466   1.00 0.00 ? 48 TYR A CD2  5  
ATOM 8604  C CE1  . TYR A 1 48 ? -12.804 5.283   7.967   1.00 0.00 ? 48 TYR A CE1  5  
ATOM 8605  C CE2  . TYR A 1 48 ? -10.694 4.431   7.229   1.00 0.00 ? 48 TYR A CE2  5  
ATOM 8606  C CZ   . TYR A 1 48 ? -11.844 4.294   7.977   1.00 0.00 ? 48 TYR A CZ   5  
ATOM 8607  O OH   . TYR A 1 48 ? -12.034 3.163   8.739   1.00 0.00 ? 48 TYR A OH   5  
ATOM 8608  H H    . TYR A 1 48 ? -13.627 8.683   5.444   1.00 0.00 ? 48 TYR A H    5  
ATOM 8609  H HA   . TYR A 1 48 ? -11.662 8.986   7.346   1.00 0.00 ? 48 TYR A HA   5  
ATOM 8610  H HB2  . TYR A 1 48 ? -11.785 7.688   4.673   1.00 0.00 ? 48 TYR A HB2  5  
ATOM 8611  H HB3  . TYR A 1 48 ? -10.193 7.906   5.390   1.00 0.00 ? 48 TYR A HB3  5  
ATOM 8612  H HD1  . TYR A 1 48 ? -13.360 7.193   7.190   1.00 0.00 ? 48 TYR A HD1  5  
ATOM 8613  H HD2  . TYR A 1 48 ? -9.606  5.679   5.879   1.00 0.00 ? 48 TYR A HD2  5  
ATOM 8614  H HE1  . TYR A 1 48 ? -13.705 5.175   8.552   1.00 0.00 ? 48 TYR A HE1  5  
ATOM 8615  H HE2  . TYR A 1 48 ? -9.941  3.657   7.237   1.00 0.00 ? 48 TYR A HE2  5  
ATOM 8616  H HH   . TYR A 1 48 ? -11.707 2.397   8.261   1.00 0.00 ? 48 TYR A HH   5  
ATOM 8617  N N    . GLN A 1 49 ? -11.079 10.810  4.667   1.00 0.00 ? 49 GLN A N    5  
ATOM 8618  C CA   . GLN A 1 49 ? -10.285 11.925  4.159   1.00 0.00 ? 49 GLN A CA   5  
ATOM 8619  C C    . GLN A 1 49 ? -10.855 13.270  4.608   1.00 0.00 ? 49 GLN A C    5  
ATOM 8620  O O    . GLN A 1 49 ? -10.169 14.061  5.254   1.00 0.00 ? 49 GLN A O    5  
ATOM 8621  C CB   . GLN A 1 49 ? -10.219 11.873  2.631   1.00 0.00 ? 49 GLN A CB   5  
ATOM 8622  C CG   . GLN A 1 49 ? -8.878  12.310  2.064   1.00 0.00 ? 49 GLN A CG   5  
ATOM 8623  C CD   . GLN A 1 49 ? -8.816  12.188  0.554   1.00 0.00 ? 49 GLN A CD   5  
ATOM 8624  O OE1  . GLN A 1 49 ? -9.472  11.331  -0.038  1.00 0.00 ? 49 GLN A OE1  5  
ATOM 8625  N NE2  . GLN A 1 49 ? -8.025  13.048  -0.077  1.00 0.00 ? 49 GLN A NE2  5  
ATOM 8626  H H    . GLN A 1 49 ? -11.804 10.444  4.113   1.00 0.00 ? 49 GLN A H    5  
ATOM 8627  H HA   . GLN A 1 49 ? -9.284  11.823  4.554   1.00 0.00 ? 49 GLN A HA   5  
ATOM 8628  H HB2  . GLN A 1 49 ? -10.409 10.861  2.308   1.00 0.00 ? 49 GLN A HB2  5  
ATOM 8629  H HB3  . GLN A 1 49 ? -10.984 12.520  2.228   1.00 0.00 ? 49 GLN A HB3  5  
ATOM 8630  H HG2  . GLN A 1 49 ? -8.707  13.342  2.334   1.00 0.00 ? 49 GLN A HG2  5  
ATOM 8631  H HG3  . GLN A 1 49 ? -8.102  11.694  2.493   1.00 0.00 ? 49 GLN A HG3  5  
ATOM 8632  H HE21 . GLN A 1 49 ? -7.532  13.703  0.460   1.00 0.00 ? 49 GLN A HE21 5  
ATOM 8633  H HE22 . GLN A 1 49 ? -7.966  12.991  -1.054  1.00 0.00 ? 49 GLN A HE22 5  
ATOM 8634  N N    . ARG A 1 50 ? -12.107 13.529  4.245   1.00 0.00 ? 50 ARG A N    5  
ATOM 8635  C CA   . ARG A 1 50 ? -12.769 14.787  4.591   1.00 0.00 ? 50 ARG A CA   5  
ATOM 8636  C C    . ARG A 1 50 ? -12.684 15.096  6.087   1.00 0.00 ? 50 ARG A C    5  
ATOM 8637  O O    . ARG A 1 50 ? -12.836 16.248  6.492   1.00 0.00 ? 50 ARG A O    5  
ATOM 8638  C CB   . ARG A 1 50 ? -14.235 14.747  4.159   1.00 0.00 ? 50 ARG A CB   5  
ATOM 8639  C CG   . ARG A 1 50 ? -14.426 14.762  2.650   1.00 0.00 ? 50 ARG A CG   5  
ATOM 8640  C CD   . ARG A 1 50 ? -14.980 16.094  2.170   1.00 0.00 ? 50 ARG A CD   5  
ATOM 8641  N NE   . ARG A 1 50 ? -16.436 16.066  2.040   1.00 0.00 ? 50 ARG A NE   5  
ATOM 8642  C CZ   . ARG A 1 50 ? -17.202 17.155  2.033   1.00 0.00 ? 50 ARG A CZ   5  
ATOM 8643  N NH1  . ARG A 1 50 ? -16.657 18.360  2.146   1.00 0.00 ? 50 ARG A NH1  5  
ATOM 8644  N NH2  . ARG A 1 50 ? -18.517 17.038  1.912   1.00 0.00 ? 50 ARG A NH2  5  
ATOM 8645  H H    . ARG A 1 50 ? -12.597 12.866  3.716   1.00 0.00 ? 50 ARG A H    5  
ATOM 8646  H HA   . ARG A 1 50 ? -12.271 15.577  4.049   1.00 0.00 ? 50 ARG A HA   5  
ATOM 8647  H HB2  . ARG A 1 50 ? -14.689 13.849  4.550   1.00 0.00 ? 50 ARG A HB2  5  
ATOM 8648  H HB3  . ARG A 1 50 ? -14.743 15.605  4.574   1.00 0.00 ? 50 ARG A HB3  5  
ATOM 8649  H HG2  . ARG A 1 50 ? -13.473 14.588  2.175   1.00 0.00 ? 50 ARG A HG2  5  
ATOM 8650  H HG3  . ARG A 1 50 ? -15.115 13.976  2.377   1.00 0.00 ? 50 ARG A HG3  5  
ATOM 8651  H HD2  . ARG A 1 50 ? -14.707 16.859  2.881   1.00 0.00 ? 50 ARG A HD2  5  
ATOM 8652  H HD3  . ARG A 1 50 ? -14.546 16.324  1.209   1.00 0.00 ? 50 ARG A HD3  5  
ATOM 8653  H HE   . ARG A 1 50 ? -16.865 15.189  1.954   1.00 0.00 ? 50 ARG A HE   5  
ATOM 8654  H HH11 . ARG A 1 50 ? -15.666 18.456  2.236   1.00 0.00 ? 50 ARG A HH11 5  
ATOM 8655  H HH12 . ARG A 1 50 ? -17.239 19.173  2.140   1.00 0.00 ? 50 ARG A HH12 5  
ATOM 8656  H HH21 . ARG A 1 50 ? -18.933 16.133  1.825   1.00 0.00 ? 50 ARG A HH21 5  
ATOM 8657  H HH22 . ARG A 1 50 ? -19.093 17.855  1.907   1.00 0.00 ? 50 ARG A HH22 5  
ATOM 8658  N N    . ILE A 1 51 ? -12.456 14.073  6.906   1.00 0.00 ? 51 ILE A N    5  
ATOM 8659  C CA   . ILE A 1 51 ? -12.371 14.266  8.351   1.00 0.00 ? 51 ILE A CA   5  
ATOM 8660  C C    . ILE A 1 51 ? -10.932 14.170  8.853   1.00 0.00 ? 51 ILE A C    5  
ATOM 8661  O O    . ILE A 1 51 ? -10.463 15.042  9.585   1.00 0.00 ? 51 ILE A O    5  
ATOM 8662  C CB   . ILE A 1 51 ? -13.238 13.238  9.107   1.00 0.00 ? 51 ILE A CB   5  
ATOM 8663  C CG1  . ILE A 1 51 ? -14.672 13.256  8.574   1.00 0.00 ? 51 ILE A CG1  5  
ATOM 8664  C CG2  . ILE A 1 51 ? -13.222 13.525  10.602  1.00 0.00 ? 51 ILE A CG2  5  
ATOM 8665  C CD1  . ILE A 1 51 ? -15.320 14.623  8.623   1.00 0.00 ? 51 ILE A CD1  5  
ATOM 8666  H H    . ILE A 1 51 ? -12.352 13.173  6.535   1.00 0.00 ? 51 ILE A H    5  
ATOM 8667  H HA   . ILE A 1 51 ? -12.750 15.253  8.575   1.00 0.00 ? 51 ILE A HA   5  
ATOM 8668  H HB   . ILE A 1 51 ? -12.814 12.258  8.950   1.00 0.00 ? 51 ILE A HB   5  
ATOM 8669  H HG12 . ILE A 1 51 ? -14.672 12.926  7.546   1.00 0.00 ? 51 ILE A HG12 5  
ATOM 8670  H HG13 . ILE A 1 51 ? -15.275 12.581  9.164   1.00 0.00 ? 51 ILE A HG13 5  
ATOM 8671  H HG21 . ILE A 1 51 ? -12.201 13.631  10.938  1.00 0.00 ? 51 ILE A HG21 5  
ATOM 8672  H HG22 . ILE A 1 51 ? -13.691 12.708  11.130  1.00 0.00 ? 51 ILE A HG22 5  
ATOM 8673  H HG23 . ILE A 1 51 ? -13.763 14.439  10.799  1.00 0.00 ? 51 ILE A HG23 5  
ATOM 8674  H HD11 . ILE A 1 51 ? -16.280 14.585  8.129   1.00 0.00 ? 51 ILE A HD11 5  
ATOM 8675  H HD12 . ILE A 1 51 ? -14.686 15.340  8.122   1.00 0.00 ? 51 ILE A HD12 5  
ATOM 8676  H HD13 . ILE A 1 51 ? -15.457 14.920  9.652   1.00 0.00 ? 51 ILE A HD13 5  
ATOM 8677  N N    . GLN A 1 52 ? -10.238 13.104  8.471   1.00 0.00 ? 52 GLN A N    5  
ATOM 8678  C CA   . GLN A 1 52 ? -8.857  12.902  8.900   1.00 0.00 ? 52 GLN A CA   5  
ATOM 8679  C C    . GLN A 1 52 ? -7.900  13.811  8.134   1.00 0.00 ? 52 GLN A C    5  
ATOM 8680  O O    . GLN A 1 52 ? -7.185  14.615  8.731   1.00 0.00 ? 52 GLN A O    5  
ATOM 8681  C CB   . GLN A 1 52 ? -8.450  11.440  8.717   1.00 0.00 ? 52 GLN A CB   5  
ATOM 8682  C CG   . GLN A 1 52 ? -7.496  10.936  9.787   1.00 0.00 ? 52 GLN A CG   5  
ATOM 8683  C CD   . GLN A 1 52 ? -6.258  11.801  9.917   1.00 0.00 ? 52 GLN A CD   5  
ATOM 8684  O OE1  . GLN A 1 52 ? -6.269  12.822  10.605  1.00 0.00 ? 52 GLN A OE1  5  
ATOM 8685  N NE2  . GLN A 1 52 ? -5.182  11.396  9.254   1.00 0.00 ? 52 GLN A NE2  5  
ATOM 8686  H H    . GLN A 1 52 ? -10.663 12.435  7.895   1.00 0.00 ? 52 GLN A H    5  
ATOM 8687  H HA   . GLN A 1 52 ? -8.801  13.150  9.949   1.00 0.00 ? 52 GLN A HA   5  
ATOM 8688  H HB2  . GLN A 1 52 ? -9.338  10.825  8.739   1.00 0.00 ? 52 GLN A HB2  5  
ATOM 8689  H HB3  . GLN A 1 52 ? -7.971  11.329  7.756   1.00 0.00 ? 52 GLN A HB3  5  
ATOM 8690  H HG2  . GLN A 1 52 ? -8.012  10.927  10.735  1.00 0.00 ? 52 GLN A HG2  5  
ATOM 8691  H HG3  . GLN A 1 52 ? -7.191  9.931   9.534   1.00 0.00 ? 52 GLN A HG3  5  
ATOM 8692  H HE21 . GLN A 1 52 ? -5.247  10.573  8.726   1.00 0.00 ? 52 GLN A HE21 5  
ATOM 8693  H HE22 . GLN A 1 52 ? -4.366  11.935  9.320   1.00 0.00 ? 52 GLN A HE22 5  
ATOM 8694  N N    . ALA A 1 53 ? -7.888  13.679  6.811   1.00 0.00 ? 53 ALA A N    5  
ATOM 8695  C CA   . ALA A 1 53 ? -7.016  14.489  5.972   1.00 0.00 ? 53 ALA A CA   5  
ATOM 8696  C C    . ALA A 1 53 ? -7.426  15.957  6.005   1.00 0.00 ? 53 ALA A C    5  
ATOM 8697  O O    . ALA A 1 53 ? -6.591  16.849  5.850   1.00 0.00 ? 53 ALA A O    5  
ATOM 8698  C CB   . ALA A 1 53 ? -7.027  13.969  4.541   1.00 0.00 ? 53 ALA A CB   5  
ATOM 8699  H H    . ALA A 1 53 ? -8.478  13.023  6.388   1.00 0.00 ? 53 ALA A H    5  
ATOM 8700  H HA   . ALA A 1 53 ? -6.011  14.398  6.354   1.00 0.00 ? 53 ALA A HA   5  
ATOM 8701  H HB1  . ALA A 1 53 ? -7.597  14.642  3.917   1.00 0.00 ? 53 ALA A HB1  5  
ATOM 8702  H HB2  . ALA A 1 53 ? -7.478  12.988  4.518   1.00 0.00 ? 53 ALA A HB2  5  
ATOM 8703  H HB3  . ALA A 1 53 ? -6.014  13.908  4.173   1.00 0.00 ? 53 ALA A HB3  5  
ATOM 8704  N N    . GLU A 1 54 ? -8.716  16.202  6.206   1.00 0.00 ? 54 GLU A N    5  
ATOM 8705  C CA   . GLU A 1 54 ? -9.235  17.563  6.258   1.00 0.00 ? 54 GLU A CA   5  
ATOM 8706  C C    . GLU A 1 54 ? -10.253 17.718  7.383   1.00 0.00 ? 54 GLU A C    5  
ATOM 8707  O O    . GLU A 1 54 ? -10.843 16.738  7.836   1.00 0.00 ? 54 GLU A O    5  
ATOM 8708  C CB   . GLU A 1 54 ? -9.874  17.938  4.918   1.00 0.00 ? 54 GLU A CB   5  
ATOM 8709  C CG   . GLU A 1 54 ? -9.465  19.312  4.414   1.00 0.00 ? 54 GLU A CG   5  
ATOM 8710  C CD   . GLU A 1 54 ? -9.205  19.331  2.920   1.00 0.00 ? 54 GLU A CD   5  
ATOM 8711  O OE1  . GLU A 1 54 ? -10.139 19.021  2.151   1.00 0.00 ? 54 GLU A OE1  5  
ATOM 8712  O OE2  . GLU A 1 54 ? -8.068  19.656  2.520   1.00 0.00 ? 54 GLU A OE2  5  
ATOM 8713  H H    . GLU A 1 54 ? -9.333  15.449  6.324   1.00 0.00 ? 54 GLU A H    5  
ATOM 8714  H HA   . GLU A 1 54 ? -8.405  18.226  6.448   1.00 0.00 ? 54 GLU A HA   5  
ATOM 8715  H HB2  . GLU A 1 54 ? -9.585  17.207  4.178   1.00 0.00 ? 54 GLU A HB2  5  
ATOM 8716  H HB3  . GLU A 1 54 ? -10.948 17.923  5.026   1.00 0.00 ? 54 GLU A HB3  5  
ATOM 8717  H HG2  . GLU A 1 54 ? -10.257 20.013  4.634   1.00 0.00 ? 54 GLU A HG2  5  
ATOM 8718  H HG3  . GLU A 1 54 ? -8.564  19.616  4.926   1.00 0.00 ? 54 GLU A HG3  5  
ATOM 8719  N N    . LYS A 1 55 ? -10.446 18.958  7.831   1.00 0.00 ? 55 LYS A N    5  
ATOM 8720  C CA   . LYS A 1 55 ? -11.387 19.262  8.910   1.00 0.00 ? 55 LYS A CA   5  
ATOM 8721  C C    . LYS A 1 55 ? -10.756 18.995  10.273  1.00 0.00 ? 55 LYS A C    5  
ATOM 8722  O O    . LYS A 1 55 ? -10.689 19.885  11.121  1.00 0.00 ? 55 LYS A O    5  
ATOM 8723  C CB   . LYS A 1 55 ? -12.678 18.450  8.760   1.00 0.00 ? 55 LYS A CB   5  
ATOM 8724  C CG   . LYS A 1 55 ? -13.936 19.242  9.079   1.00 0.00 ? 55 LYS A CG   5  
ATOM 8725  C CD   . LYS A 1 55 ? -15.182 18.541  8.561   1.00 0.00 ? 55 LYS A CD   5  
ATOM 8726  C CE   . LYS A 1 55 ? -16.163 19.526  7.947   1.00 0.00 ? 55 LYS A CE   5  
ATOM 8727  N NZ   . LYS A 1 55 ? -15.684 20.044  6.635   1.00 0.00 ? 55 LYS A NZ   5  
ATOM 8728  H H    . LYS A 1 55 ? -9.934  19.690  7.429   1.00 0.00 ? 55 LYS A H    5  
ATOM 8729  H HA   . LYS A 1 55 ? -11.628 20.313  8.845   1.00 0.00 ? 55 LYS A HA   5  
ATOM 8730  H HB2  . LYS A 1 55 ? -12.750 18.097  7.742   1.00 0.00 ? 55 LYS A HB2  5  
ATOM 8731  H HB3  . LYS A 1 55 ? -12.635 17.600  9.424   1.00 0.00 ? 55 LYS A HB3  5  
ATOM 8732  H HG2  . LYS A 1 55 ? -14.018 19.354  10.149  1.00 0.00 ? 55 LYS A HG2  5  
ATOM 8733  H HG3  . LYS A 1 55 ? -13.863 20.216  8.617   1.00 0.00 ? 55 LYS A HG3  5  
ATOM 8734  H HD2  . LYS A 1 55 ? -14.893 17.822  7.809   1.00 0.00 ? 55 LYS A HD2  5  
ATOM 8735  H HD3  . LYS A 1 55 ? -15.664 18.031  9.382   1.00 0.00 ? 55 LYS A HD3  5  
ATOM 8736  H HE2  . LYS A 1 55 ? -17.111 19.029  7.803   1.00 0.00 ? 55 LYS A HE2  5  
ATOM 8737  H HE3  . LYS A 1 55 ? -16.292 20.356  8.626   1.00 0.00 ? 55 LYS A HE3  5  
ATOM 8738  H HZ1  . LYS A 1 55 ? -15.010 19.374  6.211   1.00 0.00 ? 55 LYS A HZ1  5  
ATOM 8739  H HZ2  . LYS A 1 55 ? -15.211 20.960  6.763   1.00 0.00 ? 55 LYS A HZ2  5  
ATOM 8740  H HZ3  . LYS A 1 55 ? -16.487 20.169  5.986   1.00 0.00 ? 55 LYS A HZ3  5  
ATOM 8741  N N    . SER A 1 56 ? -10.290 17.767  10.478  1.00 0.00 ? 56 SER A N    5  
ATOM 8742  C CA   . SER A 1 56 ? -9.661  17.390  11.738  1.00 0.00 ? 56 SER A CA   5  
ATOM 8743  C C    . SER A 1 56 ? -8.141  17.395  11.605  1.00 0.00 ? 56 SER A C    5  
ATOM 8744  O O    . SER A 1 56 ? -7.606  17.312  10.500  1.00 0.00 ? 56 SER A O    5  
ATOM 8745  C CB   . SER A 1 56 ? -10.142 16.006  12.179  1.00 0.00 ? 56 SER A CB   5  
ATOM 8746  O OG   . SER A 1 56 ? -10.277 15.937  13.588  1.00 0.00 ? 56 SER A OG   5  
ATOM 8747  H H    . SER A 1 56 ? -10.368 17.099  9.766   1.00 0.00 ? 56 SER A H    5  
ATOM 8748  H HA   . SER A 1 56 ? -9.948  18.116  12.484  1.00 0.00 ? 56 SER A HA   5  
ATOM 8749  H HB2  . SER A 1 56 ? -11.101 15.800  11.728  1.00 0.00 ? 56 SER A HB2  5  
ATOM 8750  H HB3  . SER A 1 56 ? -9.427  15.261  11.861  1.00 0.00 ? 56 SER A HB3  5  
ATOM 8751  H HG   . SER A 1 56 ? -11.051 16.436  13.860  1.00 0.00 ? 56 SER A HG   5  
ATOM 8752  N N    . GLN A 1 57 ? -7.451  17.492  12.736  1.00 0.00 ? 57 GLN A N    5  
ATOM 8753  C CA   . GLN A 1 57 ? -5.992  17.508  12.740  1.00 0.00 ? 57 GLN A CA   5  
ATOM 8754  C C    . GLN A 1 57 ? -5.450  17.470  14.165  1.00 0.00 ? 57 GLN A C    5  
ATOM 8755  O O    . GLN A 1 57 ? -4.672  16.584  14.521  1.00 0.00 ? 57 GLN A O    5  
ATOM 8756  C CB   . GLN A 1 57 ? -5.474  18.751  12.013  1.00 0.00 ? 57 GLN A CB   5  
ATOM 8757  C CG   . GLN A 1 57 ? -4.559  18.433  10.841  1.00 0.00 ? 57 GLN A CG   5  
ATOM 8758  C CD   . GLN A 1 57 ? -3.441  19.444  10.683  1.00 0.00 ? 57 GLN A CD   5  
ATOM 8759  O OE1  . GLN A 1 57 ? -2.268  19.124  10.869  1.00 0.00 ? 57 GLN A OE1  5  
ATOM 8760  N NE2  . GLN A 1 57 ? -3.802  20.675  10.337  1.00 0.00 ? 57 GLN A NE2  5  
ATOM 8761  H H    . GLN A 1 57 ? -7.932  17.555  13.588  1.00 0.00 ? 57 GLN A H    5  
ATOM 8762  H HA   . GLN A 1 57 ? -5.651  16.628  12.216  1.00 0.00 ? 57 GLN A HA   5  
ATOM 8763  H HB2  . GLN A 1 57 ? -6.317  19.314  11.640  1.00 0.00 ? 57 GLN A HB2  5  
ATOM 8764  H HB3  . GLN A 1 57 ? -4.925  19.364  12.713  1.00 0.00 ? 57 GLN A HB3  5  
ATOM 8765  H HG2  . GLN A 1 57 ? -4.122  17.458  10.997  1.00 0.00 ? 57 GLN A HG2  5  
ATOM 8766  H HG3  . GLN A 1 57 ? -5.147  18.422  9.935   1.00 0.00 ? 57 GLN A HG3  5  
ATOM 8767  H HE21 . GLN A 1 57 ? -4.755  20.858  10.206  1.00 0.00 ? 57 GLN A HE21 5  
ATOM 8768  H HE22 . GLN A 1 57 ? -3.099  21.349  10.227  1.00 0.00 ? 57 GLN A HE22 5  
ATOM 8769  N N    . GLN A 1 58 ? -5.865  18.436  14.978  1.00 0.00 ? 58 GLN A N    5  
ATOM 8770  C CA   . GLN A 1 58 ? -5.420  18.511  16.364  1.00 0.00 ? 58 GLN A CA   5  
ATOM 8771  C C    . GLN A 1 58 ? -6.002  17.365  17.184  1.00 0.00 ? 58 GLN A C    5  
ATOM 8772  O O    . GLN A 1 58 ? -5.382  16.895  18.139  1.00 0.00 ? 58 GLN A O    5  
ATOM 8773  C CB   . GLN A 1 58 ? -5.826  19.852  16.980  1.00 0.00 ? 58 GLN A CB   5  
ATOM 8774  C CG   . GLN A 1 58 ? -7.308  20.160  16.843  1.00 0.00 ? 58 GLN A CG   5  
ATOM 8775  C CD   . GLN A 1 58 ? -7.937  20.600  18.151  1.00 0.00 ? 58 GLN A CD   5  
ATOM 8776  O OE1  . GLN A 1 58 ? -7.415  20.318  19.229  1.00 0.00 ? 58 GLN A OE1  5  
ATOM 8777  N NE2  . GLN A 1 58 ? -9.064  21.295  18.061  1.00 0.00 ? 58 GLN A NE2  5  
ATOM 8778  H H    . GLN A 1 58 ? -6.486  19.114  14.637  1.00 0.00 ? 58 GLN A H    5  
ATOM 8779  H HA   . GLN A 1 58 ? -4.343  18.433  16.371  1.00 0.00 ? 58 GLN A HA   5  
ATOM 8780  H HB2  . GLN A 1 58 ? -5.577  19.842  18.031  1.00 0.00 ? 58 GLN A HB2  5  
ATOM 8781  H HB3  . GLN A 1 58 ? -5.270  20.641  16.494  1.00 0.00 ? 58 GLN A HB3  5  
ATOM 8782  H HG2  . GLN A 1 58 ? -7.433  20.950  16.118  1.00 0.00 ? 58 GLN A HG2  5  
ATOM 8783  H HG3  . GLN A 1 58 ? -7.817  19.271  16.497  1.00 0.00 ? 58 GLN A HG3  5  
ATOM 8784  H HE21 . GLN A 1 58 ? -9.423  21.483  17.169  1.00 0.00 ? 58 GLN A HE21 5  
ATOM 8785  H HE22 . GLN A 1 58 ? -9.492  21.593  18.891  1.00 0.00 ? 58 GLN A HE22 5  
ATOM 8786  N N    . SER A 1 59 ? -7.195  16.919  16.806  1.00 0.00 ? 59 SER A N    5  
ATOM 8787  C CA   . SER A 1 59 ? -7.861  15.826  17.506  1.00 0.00 ? 59 SER A CA   5  
ATOM 8788  C C    . SER A 1 59 ? -8.044  14.623  16.587  1.00 0.00 ? 59 SER A C    5  
ATOM 8789  O O    . SER A 1 59 ? -9.122  14.410  16.033  1.00 0.00 ? 59 SER A O    5  
ATOM 8790  C CB   . SER A 1 59 ? -9.219  16.287  18.039  1.00 0.00 ? 59 SER A CB   5  
ATOM 8791  O OG   . SER A 1 59 ? -9.686  15.423  19.061  1.00 0.00 ? 59 SER A OG   5  
ATOM 8792  H H    . SER A 1 59 ? -7.639  17.334  16.037  1.00 0.00 ? 59 SER A H    5  
ATOM 8793  H HA   . SER A 1 59 ? -7.237  15.537  18.339  1.00 0.00 ? 59 SER A HA   5  
ATOM 8794  H HB2  . SER A 1 59 ? -9.126  17.284  18.442  1.00 0.00 ? 59 SER A HB2  5  
ATOM 8795  H HB3  . SER A 1 59 ? -9.937  16.290  17.232  1.00 0.00 ? 59 SER A HB3  5  
ATOM 8796  H HG   . SER A 1 59 ? -8.973  15.243  19.679  1.00 0.00 ? 59 SER A HG   5  
ATOM 8797  N N    . SER A 1 60 ? -6.983  13.837  16.432  1.00 0.00 ? 60 SER A N    5  
ATOM 8798  C CA   . SER A 1 60 ? -7.027  12.653  15.581  1.00 0.00 ? 60 SER A CA   5  
ATOM 8799  C C    . SER A 1 60 ? -6.672  11.400  16.375  1.00 0.00 ? 60 SER A C    5  
ATOM 8800  O O    . SER A 1 60 ? -5.585  11.300  16.943  1.00 0.00 ? 60 SER A O    5  
ATOM 8801  C CB   . SER A 1 60 ? -6.067  12.812  14.401  1.00 0.00 ? 60 SER A CB   5  
ATOM 8802  O OG   . SER A 1 60 ? -4.723  12.608  14.804  1.00 0.00 ? 60 SER A OG   5  
ATOM 8803  H H    . SER A 1 60 ? -6.152  14.058  16.901  1.00 0.00 ? 60 SER A H    5  
ATOM 8804  H HA   . SER A 1 60 ? -8.033  12.553  15.204  1.00 0.00 ? 60 SER A HA   5  
ATOM 8805  H HB2  . SER A 1 60 ? -6.314  12.088  13.639  1.00 0.00 ? 60 SER A HB2  5  
ATOM 8806  H HB3  . SER A 1 60 ? -6.161  13.808  13.994  1.00 0.00 ? 60 SER A HB3  5  
ATOM 8807  H HG   . SER A 1 60 ? -4.415  11.761  14.476  1.00 0.00 ? 60 SER A HG   5  
ATOM 8808  N N    . TYR A 1 61 ? -7.597  10.446  16.409  1.00 0.00 ? 61 TYR A N    5  
ATOM 8809  C CA   . TYR A 1 61 ? -7.383  9.199   17.134  1.00 0.00 ? 61 TYR A CA   5  
ATOM 8810  C C    . TYR A 1 61 ? -7.573  7.996   16.215  1.00 0.00 ? 61 TYR A C    5  
ATOM 8811  O O    . TYR A 1 61 ? -8.311  8.127   15.216  1.00 0.00 ? 61 TYR A O    5  
ATOM 8812  C CB   . TYR A 1 61 ? -8.342  9.104   18.322  1.00 0.00 ? 61 TYR A CB   5  
ATOM 8813  C CG   . TYR A 1 61 ? -7.724  8.478   19.552  1.00 0.00 ? 61 TYR A CG   5  
ATOM 8814  C CD1  . TYR A 1 61 ? -6.800  9.175   20.320  1.00 0.00 ? 61 TYR A CD1  5  
ATOM 8815  C CD2  . TYR A 1 61 ? -8.066  7.190   19.945  1.00 0.00 ? 61 TYR A CD2  5  
ATOM 8816  C CE1  . TYR A 1 61 ? -6.233  8.606   21.444  1.00 0.00 ? 61 TYR A CE1  5  
ATOM 8817  C CE2  . TYR A 1 61 ? -7.504  6.615   21.069  1.00 0.00 ? 61 TYR A CE2  5  
ATOM 8818  C CZ   . TYR A 1 61 ? -6.588  7.327   21.814  1.00 0.00 ? 61 TYR A CZ   5  
ATOM 8819  O OH   . TYR A 1 61 ? -6.026  6.757   22.934  1.00 0.00 ? 61 TYR A OH   5  
ATOM 8820  O OXT  . TYR A 1 61 ? -6.980  6.935   16.501  1.00 0.00 ? 61 TYR A OXT  5  
ATOM 8821  H H    . TYR A 1 61 ? -8.445  10.585  15.937  1.00 0.00 ? 61 TYR A H    5  
ATOM 8822  H HA   . TYR A 1 61 ? -6.368  9.199   17.502  1.00 0.00 ? 61 TYR A HA   5  
ATOM 8823  H HB2  . TYR A 1 61 ? -8.674  10.097  18.587  1.00 0.00 ? 61 TYR A HB2  5  
ATOM 8824  H HB3  . TYR A 1 61 ? -9.197  8.508   18.038  1.00 0.00 ? 61 TYR A HB3  5  
ATOM 8825  H HD1  . TYR A 1 61 ? -6.524  10.178  20.027  1.00 0.00 ? 61 TYR A HD1  5  
ATOM 8826  H HD2  . TYR A 1 61 ? -8.783  6.635   19.358  1.00 0.00 ? 61 TYR A HD2  5  
ATOM 8827  H HE1  . TYR A 1 61 ? -5.517  9.165   22.028  1.00 0.00 ? 61 TYR A HE1  5  
ATOM 8828  H HE2  . TYR A 1 61 ? -7.782  5.612   21.358  1.00 0.00 ? 61 TYR A HE2  5  
ATOM 8829  H HH   . TYR A 1 61 ? -6.368  7.190   23.720  1.00 0.00 ? 61 TYR A HH   5  
ATOM 8830  N N    . MET B 1 1  ? -1.009  12.536  3.416   1.00 0.00 ? 1  MET B N    5  
ATOM 8831  C CA   . MET B 1 1  ? -0.612  11.924  4.711   1.00 0.00 ? 1  MET B CA   5  
ATOM 8832  C C    . MET B 1 1  ? -1.832  11.611  5.570   1.00 0.00 ? 1  MET B C    5  
ATOM 8833  O O    . MET B 1 1  ? -2.303  12.458  6.330   1.00 0.00 ? 1  MET B O    5  
ATOM 8834  C CB   . MET B 1 1  ? 0.316   12.894  5.444   1.00 0.00 ? 1  MET B CB   5  
ATOM 8835  C CG   . MET B 1 1  ? 1.463   13.404  4.588   1.00 0.00 ? 1  MET B CG   5  
ATOM 8836  S SD   . MET B 1 1  ? 2.954   13.733  5.548   1.00 0.00 ? 1  MET B SD   5  
ATOM 8837  C CE   . MET B 1 1  ? 4.221   13.437  4.317   1.00 0.00 ? 1  MET B CE   5  
ATOM 8838  H H1   . MET B 1 1  ? -0.200  12.462  2.768   1.00 0.00 ? 1  MET B H1   5  
ATOM 8839  H H2   . MET B 1 1  ? -1.254  13.531  3.599   1.00 0.00 ? 1  MET B H2   5  
ATOM 8840  H H3   . MET B 1 1  ? -1.828  12.008  3.053   1.00 0.00 ? 1  MET B H3   5  
ATOM 8841  H HA   . MET B 1 1  ? -0.079  11.007  4.508   1.00 0.00 ? 1  MET B HA   5  
ATOM 8842  H HB2  . MET B 1 1  ? -0.262  13.744  5.777   1.00 0.00 ? 1  MET B HB2  5  
ATOM 8843  H HB3  . MET B 1 1  ? 0.733   12.394  6.306   1.00 0.00 ? 1  MET B HB3  5  
ATOM 8844  H HG2  . MET B 1 1  ? 1.692   12.662  3.837   1.00 0.00 ? 1  MET B HG2  5  
ATOM 8845  H HG3  . MET B 1 1  ? 1.154   14.320  4.104   1.00 0.00 ? 1  MET B HG3  5  
ATOM 8846  H HE1  . MET B 1 1  ? 3.806   12.861  3.503   1.00 0.00 ? 1  MET B HE1  5  
ATOM 8847  H HE2  . MET B 1 1  ? 5.037   12.889  4.766   1.00 0.00 ? 1  MET B HE2  5  
ATOM 8848  H HE3  . MET B 1 1  ? 4.586   14.381  3.941   1.00 0.00 ? 1  MET B HE3  5  
ATOM 8849  N N    . LEU B 1 2  ? -2.341  10.390  5.445   1.00 0.00 ? 2  LEU B N    5  
ATOM 8850  C CA   . LEU B 1 2  ? -3.507  9.964   6.211   1.00 0.00 ? 2  LEU B CA   5  
ATOM 8851  C C    . LEU B 1 2  ? -3.170  8.767   7.095   1.00 0.00 ? 2  LEU B C    5  
ATOM 8852  O O    . LEU B 1 2  ? -2.905  7.674   6.596   1.00 0.00 ? 2  LEU B O    5  
ATOM 8853  C CB   . LEU B 1 2  ? -4.655  9.602   5.268   1.00 0.00 ? 2  LEU B CB   5  
ATOM 8854  C CG   . LEU B 1 2  ? -5.535  10.776  4.838   1.00 0.00 ? 2  LEU B CG   5  
ATOM 8855  C CD1  . LEU B 1 2  ? -6.168  11.439  6.052   1.00 0.00 ? 2  LEU B CD1  5  
ATOM 8856  C CD2  . LEU B 1 2  ? -4.722  11.783  4.038   1.00 0.00 ? 2  LEU B CD2  5  
ATOM 8857  H H    . LEU B 1 2  ? -1.921  9.758   4.823   1.00 0.00 ? 2  LEU B H    5  
ATOM 8858  H HA   . LEU B 1 2  ? -3.814  10.788  6.838   1.00 0.00 ? 2  LEU B HA   5  
ATOM 8859  H HB2  . LEU B 1 2  ? -4.235  9.149   4.381   1.00 0.00 ? 2  LEU B HB2  5  
ATOM 8860  H HB3  . LEU B 1 2  ? -5.282  8.873   5.760   1.00 0.00 ? 2  LEU B HB3  5  
ATOM 8861  H HG   . LEU B 1 2  ? -6.330  10.409  4.206   1.00 0.00 ? 2  LEU B HG   5  
ATOM 8862  H HD11 . LEU B 1 2  ? -7.224  11.579  5.875   1.00 0.00 ? 2  LEU B HD11 5  
ATOM 8863  H HD12 . LEU B 1 2  ? -5.702  12.398  6.224   1.00 0.00 ? 2  LEU B HD12 5  
ATOM 8864  H HD13 . LEU B 1 2  ? -6.030  10.812  6.920   1.00 0.00 ? 2  LEU B HD13 5  
ATOM 8865  H HD21 . LEU B 1 2  ? -5.333  12.192  3.248   1.00 0.00 ? 2  LEU B HD21 5  
ATOM 8866  H HD22 . LEU B 1 2  ? -3.861  11.292  3.610   1.00 0.00 ? 2  LEU B HD22 5  
ATOM 8867  H HD23 . LEU B 1 2  ? -4.395  12.581  4.690   1.00 0.00 ? 2  LEU B HD23 5  
ATOM 8868  N N    . ILE B 1 3  ? -3.188  8.974   8.410   1.00 0.00 ? 3  ILE B N    5  
ATOM 8869  C CA   . ILE B 1 3  ? -2.890  7.898   9.346   1.00 0.00 ? 3  ILE B CA   5  
ATOM 8870  C C    . ILE B 1 3  ? -4.174  7.308   9.919   1.00 0.00 ? 3  ILE B C    5  
ATOM 8871  O O    . ILE B 1 3  ? -4.826  7.907   10.774  1.00 0.00 ? 3  ILE B O    5  
ATOM 8872  C CB   . ILE B 1 3  ? -1.972  8.380   10.491  1.00 0.00 ? 3  ILE B CB   5  
ATOM 8873  C CG1  . ILE B 1 3  ? -1.502  7.194   11.336  1.00 0.00 ? 3  ILE B CG1  5  
ATOM 8874  C CG2  . ILE B 1 3  ? -2.678  9.411   11.359  1.00 0.00 ? 3  ILE B CG2  5  
ATOM 8875  C CD1  . ILE B 1 3  ? -0.090  7.350   11.862  1.00 0.00 ? 3  ILE B CD1  5  
ATOM 8876  H H    . ILE B 1 3  ? -3.413  9.863   8.755   1.00 0.00 ? 3  ILE B H    5  
ATOM 8877  H HA   . ILE B 1 3  ? -2.372  7.124   8.803   1.00 0.00 ? 3  ILE B HA   5  
ATOM 8878  H HB   . ILE B 1 3  ? -1.109  8.855   10.048  1.00 0.00 ? 3  ILE B HB   5  
ATOM 8879  H HG12 . ILE B 1 3  ? -2.162  7.081   12.184  1.00 0.00 ? 3  ILE B HG12 5  
ATOM 8880  H HG13 . ILE B 1 3  ? -1.537  6.296   10.736  1.00 0.00 ? 3  ILE B HG13 5  
ATOM 8881  H HG21 . ILE B 1 3  ? -3.311  8.907   12.074  1.00 0.00 ? 3  ILE B HG21 5  
ATOM 8882  H HG22 . ILE B 1 3  ? -3.280  10.055  10.735  1.00 0.00 ? 3  ILE B HG22 5  
ATOM 8883  H HG23 . ILE B 1 3  ? -1.942  10.003  11.884  1.00 0.00 ? 3  ILE B HG23 5  
ATOM 8884  H HD11 . ILE B 1 3  ? 0.615   7.032   11.108  1.00 0.00 ? 3  ILE B HD11 5  
ATOM 8885  H HD12 . ILE B 1 3  ? 0.035   6.746   12.749  1.00 0.00 ? 3  ILE B HD12 5  
ATOM 8886  H HD13 . ILE B 1 3  ? 0.089   8.387   12.106  1.00 0.00 ? 3  ILE B HD13 5  
ATOM 8887  N N    . LEU B 1 4  ? -4.527  6.120   9.438   1.00 0.00 ? 4  LEU B N    5  
ATOM 8888  C CA   . LEU B 1 4  ? -5.725  5.430   9.894   1.00 0.00 ? 4  LEU B CA   5  
ATOM 8889  C C    . LEU B 1 4  ? -5.391  4.030   10.400  1.00 0.00 ? 4  LEU B C    5  
ATOM 8890  O O    . LEU B 1 4  ? -4.844  3.211   9.660   1.00 0.00 ? 4  LEU B O    5  
ATOM 8891  C CB   . LEU B 1 4  ? -6.754  5.350   8.763   1.00 0.00 ? 4  LEU B CB   5  
ATOM 8892  C CG   . LEU B 1 4  ? -8.148  5.868   9.121   1.00 0.00 ? 4  LEU B CG   5  
ATOM 8893  C CD1  . LEU B 1 4  ? -8.727  5.083   10.288  1.00 0.00 ? 4  LEU B CD1  5  
ATOM 8894  C CD2  . LEU B 1 4  ? -8.096  7.353   9.449   1.00 0.00 ? 4  LEU B CD2  5  
ATOM 8895  H H    . LEU B 1 4  ? -3.955  5.690   8.768   1.00 0.00 ? 4  LEU B H    5  
ATOM 8896  H HA   . LEU B 1 4  ? -6.145  6.001   10.709  1.00 0.00 ? 4  LEU B HA   5  
ATOM 8897  H HB2  . LEU B 1 4  ? -6.383  5.924   7.927   1.00 0.00 ? 4  LEU B HB2  5  
ATOM 8898  H HB3  . LEU B 1 4  ? -6.847  4.318   8.457   1.00 0.00 ? 4  LEU B HB3  5  
ATOM 8899  H HG   . LEU B 1 4  ? -8.803  5.735   8.272   1.00 0.00 ? 4  LEU B HG   5  
ATOM 8900  H HD11 . LEU B 1 4  ? -9.788  5.273   10.358  1.00 0.00 ? 4  LEU B HD11 5  
ATOM 8901  H HD12 . LEU B 1 4  ? -8.245  5.392   11.203  1.00 0.00 ? 4  LEU B HD12 5  
ATOM 8902  H HD13 . LEU B 1 4  ? -8.559  4.028   10.130  1.00 0.00 ? 4  LEU B HD13 5  
ATOM 8903  H HD21 . LEU B 1 4  ? -7.618  7.493   10.407  1.00 0.00 ? 4  LEU B HD21 5  
ATOM 8904  H HD22 . LEU B 1 4  ? -9.100  7.749   9.487   1.00 0.00 ? 4  LEU B HD22 5  
ATOM 8905  H HD23 . LEU B 1 4  ? -7.533  7.871   8.686   1.00 0.00 ? 4  LEU B HD23 5  
ATOM 8906  N N    . THR B 1 5  ? -5.718  3.753   11.658  1.00 0.00 ? 5  THR B N    5  
ATOM 8907  C CA   . THR B 1 5  ? -5.446  2.441   12.233  1.00 0.00 ? 5  THR B CA   5  
ATOM 8908  C C    . THR B 1 5  ? -6.094  1.345   11.397  1.00 0.00 ? 5  THR B C    5  
ATOM 8909  O O    . THR B 1 5  ? -7.211  1.503   10.905  1.00 0.00 ? 5  THR B O    5  
ATOM 8910  C CB   . THR B 1 5  ? -5.949  2.366   13.676  1.00 0.00 ? 5  THR B CB   5  
ATOM 8911  O OG1  . THR B 1 5  ? -6.357  3.643   14.135  1.00 0.00 ? 5  THR B OG1  5  
ATOM 8912  C CG2  . THR B 1 5  ? -4.906  1.842   14.640  1.00 0.00 ? 5  THR B CG2  5  
ATOM 8913  H H    . THR B 1 5  ? -6.144  4.441   12.211  1.00 0.00 ? 5  THR B H    5  
ATOM 8914  H HA   . THR B 1 5  ? -4.378  2.292   12.226  1.00 0.00 ? 5  THR B HA   5  
ATOM 8915  H HB   . THR B 1 5  ? -6.800  1.701   13.717  1.00 0.00 ? 5  THR B HB   5  
ATOM 8916  H HG1  . THR B 1 5  ? -7.237  3.581   14.514  1.00 0.00 ? 5  THR B HG1  5  
ATOM 8917  H HG21 . THR B 1 5  ? -4.258  2.651   14.943  1.00 0.00 ? 5  THR B HG21 5  
ATOM 8918  H HG22 . THR B 1 5  ? -4.321  1.075   14.153  1.00 0.00 ? 5  THR B HG22 5  
ATOM 8919  H HG23 . THR B 1 5  ? -5.395  1.427   15.508  1.00 0.00 ? 5  THR B HG23 5  
ATOM 8920  N N    . ARG B 1 6  ? -5.386  0.234   11.236  1.00 0.00 ? 6  ARG B N    5  
ATOM 8921  C CA   . ARG B 1 6  ? -5.897  -0.882  10.455  1.00 0.00 ? 6  ARG B CA   5  
ATOM 8922  C C    . ARG B 1 6  ? -5.244  -2.192  10.878  1.00 0.00 ? 6  ARG B C    5  
ATOM 8923  O O    . ARG B 1 6  ? -4.066  -2.226  11.240  1.00 0.00 ? 6  ARG B O    5  
ATOM 8924  C CB   . ARG B 1 6  ? -5.660  -0.640  8.963   1.00 0.00 ? 6  ARG B CB   5  
ATOM 8925  C CG   . ARG B 1 6  ? -6.652  0.327   8.338   1.00 0.00 ? 6  ARG B CG   5  
ATOM 8926  C CD   . ARG B 1 6  ? -6.578  0.297   6.820   1.00 0.00 ? 6  ARG B CD   5  
ATOM 8927  N NE   . ARG B 1 6  ? -7.544  1.205   6.205   1.00 0.00 ? 6  ARG B NE   5  
ATOM 8928  C CZ   . ARG B 1 6  ? -7.358  2.518   6.089   1.00 0.00 ? 6  ARG B CZ   5  
ATOM 8929  N NH1  . ARG B 1 6  ? -6.247  3.081   6.546   1.00 0.00 ? 6  ARG B NH1  5  
ATOM 8930  N NH2  . ARG B 1 6  ? -8.286  3.270   5.514   1.00 0.00 ? 6  ARG B NH2  5  
ATOM 8931  H H    . ARG B 1 6  ? -4.501  0.165   11.652  1.00 0.00 ? 6  ARG B H    5  
ATOM 8932  H HA   . ARG B 1 6  ? -6.959  -0.951  10.633  1.00 0.00 ? 6  ARG B HA   5  
ATOM 8933  H HB2  . ARG B 1 6  ? -4.666  -0.240  8.828   1.00 0.00 ? 6  ARG B HB2  5  
ATOM 8934  H HB3  . ARG B 1 6  ? -5.733  -1.583  8.442   1.00 0.00 ? 6  ARG B HB3  5  
ATOM 8935  H HG2  . ARG B 1 6  ? -7.650  0.053   8.645   1.00 0.00 ? 6  ARG B HG2  5  
ATOM 8936  H HG3  . ARG B 1 6  ? -6.430  1.327   8.681   1.00 0.00 ? 6  ARG B HG3  5  
ATOM 8937  H HD2  . ARG B 1 6  ? -5.583  0.586   6.515   1.00 0.00 ? 6  ARG B HD2  5  
ATOM 8938  H HD3  . ARG B 1 6  ? -6.779  -0.709  6.483   1.00 0.00 ? 6  ARG B HD3  5  
ATOM 8939  H HE   . ARG B 1 6  ? -8.374  0.816   5.860   1.00 0.00 ? 6  ARG B HE   5  
ATOM 8940  H HH11 . ARG B 1 6  ? -5.542  2.520   6.981   1.00 0.00 ? 6  ARG B HH11 5  
ATOM 8941  H HH12 . ARG B 1 6  ? -6.113  4.068   6.456   1.00 0.00 ? 6  ARG B HH12 5  
ATOM 8942  H HH21 . ARG B 1 6  ? -9.126  2.851   5.168   1.00 0.00 ? 6  ARG B HH21 5  
ATOM 8943  H HH22 . ARG B 1 6  ? -8.147  4.256   5.427   1.00 0.00 ? 6  ARG B HH22 5  
ATOM 8944  N N    . ARG B 1 7  ? -6.023  -3.267  10.826  1.00 0.00 ? 7  ARG B N    5  
ATOM 8945  C CA   . ARG B 1 7  ? -5.535  -4.594  11.198  1.00 0.00 ? 7  ARG B CA   5  
ATOM 8946  C C    . ARG B 1 7  ? -6.629  -5.663  11.075  1.00 0.00 ? 7  ARG B C    5  
ATOM 8947  O O    . ARG B 1 7  ? -6.389  -6.831  11.372  1.00 0.00 ? 7  ARG B O    5  
ATOM 8948  C CB   . ARG B 1 7  ? -4.990  -4.577  12.628  1.00 0.00 ? 7  ARG B CB   5  
ATOM 8949  C CG   . ARG B 1 7  ? -4.309  -5.876  13.038  1.00 0.00 ? 7  ARG B CG   5  
ATOM 8950  C CD   . ARG B 1 7  ? -4.924  -6.459  14.301  1.00 0.00 ? 7  ARG B CD   5  
ATOM 8951  N NE   . ARG B 1 7  ? -5.718  -7.654  14.025  1.00 0.00 ? 7  ARG B NE   5  
ATOM 8952  C CZ   . ARG B 1 7  ? -6.235  -8.435  14.971  1.00 0.00 ? 7  ARG B CZ   5  
ATOM 8953  N NH1  . ARG B 1 7  ? -6.048  -8.148  16.254  1.00 0.00 ? 7  ARG B NH1  5  
ATOM 8954  N NH2  . ARG B 1 7  ? -6.942  -9.506  14.635  1.00 0.00 ? 7  ARG B NH2  5  
ATOM 8955  H H    . ARG B 1 7  ? -6.948  -3.162  10.529  1.00 0.00 ? 7  ARG B H    5  
ATOM 8956  H HA   . ARG B 1 7  ? -4.731  -4.847  10.524  1.00 0.00 ? 7  ARG B HA   5  
ATOM 8957  H HB2  . ARG B 1 7  ? -4.271  -3.777  12.717  1.00 0.00 ? 7  ARG B HB2  5  
ATOM 8958  H HB3  . ARG B 1 7  ? -5.807  -4.392  13.310  1.00 0.00 ? 7  ARG B HB3  5  
ATOM 8959  H HG2  . ARG B 1 7  ? -4.410  -6.593  12.237  1.00 0.00 ? 7  ARG B HG2  5  
ATOM 8960  H HG3  . ARG B 1 7  ? -3.262  -5.679  13.216  1.00 0.00 ? 7  ARG B HG3  5  
ATOM 8961  H HD2  . ARG B 1 7  ? -4.130  -6.718  14.986  1.00 0.00 ? 7  ARG B HD2  5  
ATOM 8962  H HD3  . ARG B 1 7  ? -5.560  -5.713  14.756  1.00 0.00 ? 7  ARG B HD3  5  
ATOM 8963  H HE   . ARG B 1 7  ? -5.873  -7.887  13.087  1.00 0.00 ? 7  ARG B HE   5  
ATOM 8964  H HH11 . ARG B 1 7  ? -5.518  -7.342  16.515  1.00 0.00 ? 7  ARG B HH11 5  
ATOM 8965  H HH12 . ARG B 1 7  ? -6.439  -8.739  16.960  1.00 0.00 ? 7  ARG B HH12 5  
ATOM 8966  H HH21 . ARG B 1 7  ? -7.086  -9.726  13.670  1.00 0.00 ? 7  ARG B HH21 5  
ATOM 8967  H HH22 . ARG B 1 7  ? -7.330  -10.092 15.346  1.00 0.00 ? 7  ARG B HH22 5  
ATOM 8968  N N    . VAL B 1 8  ? -7.823  -5.266  10.632  1.00 0.00 ? 8  VAL B N    5  
ATOM 8969  C CA   . VAL B 1 8  ? -8.933  -6.204  10.473  1.00 0.00 ? 8  VAL B CA   5  
ATOM 8970  C C    . VAL B 1 8  ? -10.206 -5.489  10.020  1.00 0.00 ? 8  VAL B C    5  
ATOM 8971  O O    . VAL B 1 8  ? -11.314 -5.912  10.352  1.00 0.00 ? 8  VAL B O    5  
ATOM 8972  C CB   . VAL B 1 8  ? -9.236  -6.974  11.782  1.00 0.00 ? 8  VAL B CB   5  
ATOM 8973  C CG1  . VAL B 1 8  ? -8.560  -8.337  11.772  1.00 0.00 ? 8  VAL B CG1  5  
ATOM 8974  C CG2  . VAL B 1 8  ? -8.814  -6.168  13.004  1.00 0.00 ? 8  VAL B CG2  5  
ATOM 8975  H H    . VAL B 1 8  ? -7.961  -4.328  10.401  1.00 0.00 ? 8  VAL B H    5  
ATOM 8976  H HA   . VAL B 1 8  ? -8.651  -6.923  9.717   1.00 0.00 ? 8  VAL B HA   5  
ATOM 8977  H HB   . VAL B 1 8  ? -10.302 -7.136  11.840  1.00 0.00 ? 8  VAL B HB   5  
ATOM 8978  H HG11 . VAL B 1 8  ? -8.252  -8.580  10.766  1.00 0.00 ? 8  VAL B HG11 5  
ATOM 8979  H HG12 . VAL B 1 8  ? -9.253  -9.085  12.127  1.00 0.00 ? 8  VAL B HG12 5  
ATOM 8980  H HG13 . VAL B 1 8  ? -7.695  -8.315  12.418  1.00 0.00 ? 8  VAL B HG13 5  
ATOM 8981  H HG21 . VAL B 1 8  ? -8.832  -5.114  12.764  1.00 0.00 ? 8  VAL B HG21 5  
ATOM 8982  H HG22 . VAL B 1 8  ? -7.813  -6.452  13.296  1.00 0.00 ? 8  VAL B HG22 5  
ATOM 8983  H HG23 . VAL B 1 8  ? -9.496  -6.364  13.818  1.00 0.00 ? 8  VAL B HG23 5  
ATOM 8984  N N    . GLY B 1 9  ? -10.051 -4.405  9.263   1.00 0.00 ? 9  GLY B N    5  
ATOM 8985  C CA   . GLY B 1 9  ? -11.207 -3.662  8.793   1.00 0.00 ? 9  GLY B CA   5  
ATOM 8986  C C    . GLY B 1 9  ? -11.383 -3.744  7.289   1.00 0.00 ? 9  GLY B C    5  
ATOM 8987  O O    . GLY B 1 9  ? -11.584 -4.826  6.738   1.00 0.00 ? 9  GLY B O    5  
ATOM 8988  H H    . GLY B 1 9  ? -9.152  -4.099  9.024   1.00 0.00 ? 9  GLY B H    5  
ATOM 8989  H HA2  . GLY B 1 9  ? -12.092 -4.057  9.268   1.00 0.00 ? 9  GLY B HA2  5  
ATOM 8990  H HA3  . GLY B 1 9  ? -11.093 -2.626  9.074   1.00 0.00 ? 9  GLY B HA3  5  
ATOM 8991  N N    . GLU B 1 10 ? -11.312 -2.594  6.623   1.00 0.00 ? 10 GLU B N    5  
ATOM 8992  C CA   . GLU B 1 10 ? -11.471 -2.539  5.174   1.00 0.00 ? 10 GLU B CA   5  
ATOM 8993  C C    . GLU B 1 10 ? -10.151 -2.201  4.487   1.00 0.00 ? 10 GLU B C    5  
ATOM 8994  O O    . GLU B 1 10 ? -9.119  -2.045  5.140   1.00 0.00 ? 10 GLU B O    5  
ATOM 8995  C CB   . GLU B 1 10 ? -12.533 -1.504  4.798   1.00 0.00 ? 10 GLU B CB   5  
ATOM 8996  C CG   . GLU B 1 10 ? -13.957 -2.022  4.918   1.00 0.00 ? 10 GLU B CG   5  
ATOM 8997  C CD   . GLU B 1 10 ? -14.980 -0.905  4.981   1.00 0.00 ? 10 GLU B CD   5  
ATOM 8998  O OE1  . GLU B 1 10 ? -15.370 -0.397  3.909   1.00 0.00 ? 10 GLU B OE1  5  
ATOM 8999  O OE2  . GLU B 1 10 ? -15.391 -0.538  6.102   1.00 0.00 ? 10 GLU B OE2  5  
ATOM 9000  H H    . GLU B 1 10 ? -11.153 -1.764  7.119   1.00 0.00 ? 10 GLU B H    5  
ATOM 9001  H HA   . GLU B 1 10 ? -11.797 -3.512  4.840   1.00 0.00 ? 10 GLU B HA   5  
ATOM 9002  H HB2  . GLU B 1 10 ? -12.429 -0.646  5.446   1.00 0.00 ? 10 GLU B HB2  5  
ATOM 9003  H HB3  . GLU B 1 10 ? -12.371 -1.194  3.776   1.00 0.00 ? 10 GLU B HB3  5  
ATOM 9004  H HG2  . GLU B 1 10 ? -14.174 -2.641  4.061   1.00 0.00 ? 10 GLU B HG2  5  
ATOM 9005  H HG3  . GLU B 1 10 ? -14.036 -2.614  5.818   1.00 0.00 ? 10 GLU B HG3  5  
ATOM 9006  N N    . THR B 1 11 ? -10.196 -2.092  3.162   1.00 0.00 ? 11 THR B N    5  
ATOM 9007  C CA   . THR B 1 11 ? -9.009  -1.773  2.373   1.00 0.00 ? 11 THR B CA   5  
ATOM 9008  C C    . THR B 1 11 ? -9.177  -0.437  1.658   1.00 0.00 ? 11 THR B C    5  
ATOM 9009  O O    . THR B 1 11 ? -10.277 0.114   1.599   1.00 0.00 ? 11 THR B O    5  
ATOM 9010  C CB   . THR B 1 11 ? -8.723  -2.888  1.353   1.00 0.00 ? 11 THR B CB   5  
ATOM 9011  O OG1  . THR B 1 11 ? -8.319  -2.348  0.106   1.00 0.00 ? 11 THR B OG1  5  
ATOM 9012  C CG2  . THR B 1 11 ? -9.910  -3.793  1.090   1.00 0.00 ? 11 THR B CG2  5  
ATOM 9013  H H    . THR B 1 11 ? -11.050 -2.229  2.702   1.00 0.00 ? 11 THR B H    5  
ATOM 9014  H HA   . THR B 1 11 ? -8.171  -1.697  3.051   1.00 0.00 ? 11 THR B HA   5  
ATOM 9015  H HB   . THR B 1 11 ? -7.918  -3.504  1.730   1.00 0.00 ? 11 THR B HB   5  
ATOM 9016  H HG1  . THR B 1 11 ? -7.403  -2.069  0.159   1.00 0.00 ? 11 THR B HG1  5  
ATOM 9017  H HG21 . THR B 1 11 ? -10.792 -3.191  0.928   1.00 0.00 ? 11 THR B HG21 5  
ATOM 9018  H HG22 . THR B 1 11 ? -10.066 -4.439  1.941   1.00 0.00 ? 11 THR B HG22 5  
ATOM 9019  H HG23 . THR B 1 11 ? -9.718  -4.393  0.213   1.00 0.00 ? 11 THR B HG23 5  
ATOM 9020  N N    . LEU B 1 12 ? -8.080  0.076   1.112   1.00 0.00 ? 12 LEU B N    5  
ATOM 9021  C CA   . LEU B 1 12 ? -8.103  1.345   0.394   1.00 0.00 ? 12 LEU B CA   5  
ATOM 9022  C C    . LEU B 1 12 ? -7.860  1.121   -1.096  1.00 0.00 ? 12 LEU B C    5  
ATOM 9023  O O    . LEU B 1 12 ? -7.236  0.135   -1.487  1.00 0.00 ? 12 LEU B O    5  
ATOM 9024  C CB   . LEU B 1 12 ? -7.058  2.310   0.973   1.00 0.00 ? 12 LEU B CB   5  
ATOM 9025  C CG   . LEU B 1 12 ? -5.631  2.148   0.437   1.00 0.00 ? 12 LEU B CG   5  
ATOM 9026  C CD1  . LEU B 1 12 ? -4.904  3.484   0.444   1.00 0.00 ? 12 LEU B CD1  5  
ATOM 9027  C CD2  . LEU B 1 12 ? -4.866  1.121   1.254   1.00 0.00 ? 12 LEU B CD2  5  
ATOM 9028  H H    . LEU B 1 12 ? -7.235  -0.413  1.188   1.00 0.00 ? 12 LEU B H    5  
ATOM 9029  H HA   . LEU B 1 12 ? -9.085  1.776   0.521   1.00 0.00 ? 12 LEU B HA   5  
ATOM 9030  H HB2  . LEU B 1 12 ? -7.382  3.320   0.767   1.00 0.00 ? 12 LEU B HB2  5  
ATOM 9031  H HB3  . LEU B 1 12 ? -7.032  2.173   2.044   1.00 0.00 ? 12 LEU B HB3  5  
ATOM 9032  H HG   . LEU B 1 12 ? -5.672  1.799   -0.583  1.00 0.00 ? 12 LEU B HG   5  
ATOM 9033  H HD11 . LEU B 1 12 ? -4.267  3.552   -0.426  1.00 0.00 ? 12 LEU B HD11 5  
ATOM 9034  H HD12 . LEU B 1 12 ? -4.304  3.562   1.338   1.00 0.00 ? 12 LEU B HD12 5  
ATOM 9035  H HD13 . LEU B 1 12 ? -5.626  4.287   0.424   1.00 0.00 ? 12 LEU B HD13 5  
ATOM 9036  H HD21 . LEU B 1 12 ? -4.790  1.457   2.277   1.00 0.00 ? 12 LEU B HD21 5  
ATOM 9037  H HD22 . LEU B 1 12 ? -3.876  0.999   0.839   1.00 0.00 ? 12 LEU B HD22 5  
ATOM 9038  H HD23 . LEU B 1 12 ? -5.387  0.176   1.222   1.00 0.00 ? 12 LEU B HD23 5  
ATOM 9039  N N    . MET B 1 13 ? -8.350  2.037   -1.925  1.00 0.00 ? 13 MET B N    5  
ATOM 9040  C CA   . MET B 1 13 ? -8.173  1.921   -3.366  1.00 0.00 ? 13 MET B CA   5  
ATOM 9041  C C    . MET B 1 13 ? -7.577  3.197   -3.945  1.00 0.00 ? 13 MET B C    5  
ATOM 9042  O O    . MET B 1 13 ? -8.280  4.184   -4.162  1.00 0.00 ? 13 MET B O    5  
ATOM 9043  C CB   . MET B 1 13 ? -9.511  1.608   -4.043  1.00 0.00 ? 13 MET B CB   5  
ATOM 9044  C CG   . MET B 1 13 ? -9.437  1.569   -5.562  1.00 0.00 ? 13 MET B CG   5  
ATOM 9045  S SD   . MET B 1 13 ? -10.384 0.209   -6.271  1.00 0.00 ? 13 MET B SD   5  
ATOM 9046  C CE   . MET B 1 13 ? -11.576 1.105   -7.262  1.00 0.00 ? 13 MET B CE   5  
ATOM 9047  H H    . MET B 1 13 ? -8.835  2.807   -1.562  1.00 0.00 ? 13 MET B H    5  
ATOM 9048  H HA   . MET B 1 13 ? -7.487  1.107   -3.548  1.00 0.00 ? 13 MET B HA   5  
ATOM 9049  H HB2  . MET B 1 13 ? -9.858  0.646   -3.697  1.00 0.00 ? 13 MET B HB2  5  
ATOM 9050  H HB3  . MET B 1 13 ? -10.229 2.362   -3.759  1.00 0.00 ? 13 MET B HB3  5  
ATOM 9051  H HG2  . MET B 1 13 ? -9.825  2.499   -5.951  1.00 0.00 ? 13 MET B HG2  5  
ATOM 9052  H HG3  . MET B 1 13 ? -8.403  1.463   -5.856  1.00 0.00 ? 13 MET B HG3  5  
ATOM 9053  H HE1  . MET B 1 13 ? -12.504 0.554   -7.295  1.00 0.00 ? 13 MET B HE1  5  
ATOM 9054  H HE2  . MET B 1 13 ? -11.193 1.226   -8.265  1.00 0.00 ? 13 MET B HE2  5  
ATOM 9055  H HE3  . MET B 1 13 ? -11.750 2.077   -6.824  1.00 0.00 ? 13 MET B HE3  5  
ATOM 9056  N N    . ILE B 1 14 ? -6.274  3.165   -4.196  1.00 0.00 ? 14 ILE B N    5  
ATOM 9057  C CA   . ILE B 1 14 ? -5.573  4.307   -4.752  1.00 0.00 ? 14 ILE B CA   5  
ATOM 9058  C C    . ILE B 1 14 ? -5.087  4.001   -6.169  1.00 0.00 ? 14 ILE B C    5  
ATOM 9059  O O    . ILE B 1 14 ? -4.390  3.012   -6.397  1.00 0.00 ? 14 ILE B O    5  
ATOM 9060  C CB   . ILE B 1 14 ? -4.376  4.704   -3.862  1.00 0.00 ? 14 ILE B CB   5  
ATOM 9061  C CG1  . ILE B 1 14 ? -3.552  5.820   -4.513  1.00 0.00 ? 14 ILE B CG1  5  
ATOM 9062  C CG2  . ILE B 1 14 ? -3.502  3.492   -3.575  1.00 0.00 ? 14 ILE B CG2  5  
ATOM 9063  C CD1  . ILE B 1 14 ? -4.376  7.014   -4.938  1.00 0.00 ? 14 ILE B CD1  5  
ATOM 9064  H H    . ILE B 1 14 ? -5.772  2.352   -4.001  1.00 0.00 ? 14 ILE B H    5  
ATOM 9065  H HA   . ILE B 1 14 ? -6.265  5.135   -4.785  1.00 0.00 ? 14 ILE B HA   5  
ATOM 9066  H HB   . ILE B 1 14 ? -4.767  5.058   -2.921  1.00 0.00 ? 14 ILE B HB   5  
ATOM 9067  H HG12 . ILE B 1 14 ? -2.807  6.165   -3.812  1.00 0.00 ? 14 ILE B HG12 5  
ATOM 9068  H HG13 . ILE B 1 14 ? -3.057  5.428   -5.391  1.00 0.00 ? 14 ILE B HG13 5  
ATOM 9069  H HG21 . ILE B 1 14 ? -3.699  2.723   -4.307  1.00 0.00 ? 14 ILE B HG21 5  
ATOM 9070  H HG22 . ILE B 1 14 ? -3.725  3.114   -2.588  1.00 0.00 ? 14 ILE B HG22 5  
ATOM 9071  H HG23 . ILE B 1 14 ? -2.462  3.778   -3.624  1.00 0.00 ? 14 ILE B HG23 5  
ATOM 9072  H HD11 . ILE B 1 14 ? -5.318  6.674   -5.340  1.00 0.00 ? 14 ILE B HD11 5  
ATOM 9073  H HD12 . ILE B 1 14 ? -3.842  7.571   -5.693  1.00 0.00 ? 14 ILE B HD12 5  
ATOM 9074  H HD13 . ILE B 1 14 ? -4.558  7.649   -4.083  1.00 0.00 ? 14 ILE B HD13 5  
ATOM 9075  N N    . GLY B 1 15 ? -5.459  4.853   -7.119  1.00 0.00 ? 15 GLY B N    5  
ATOM 9076  C CA   . GLY B 1 15 ? -5.054  4.650   -8.499  1.00 0.00 ? 15 GLY B CA   5  
ATOM 9077  C C    . GLY B 1 15 ? -6.224  4.747   -9.460  1.00 0.00 ? 15 GLY B C    5  
ATOM 9078  O O    . GLY B 1 15 ? -6.718  5.840   -9.737  1.00 0.00 ? 15 GLY B O    5  
ATOM 9079  H H    . GLY B 1 15 ? -6.011  5.628   -6.886  1.00 0.00 ? 15 GLY B H    5  
ATOM 9080  H HA2  . GLY B 1 15 ? -4.322  5.400   -8.762  1.00 0.00 ? 15 GLY B HA2  5  
ATOM 9081  H HA3  . GLY B 1 15 ? -4.603  3.672   -8.594  1.00 0.00 ? 15 GLY B HA3  5  
ATOM 9082  N N    . ASP B 1 16 ? -6.671  3.602   -9.968  1.00 0.00 ? 16 ASP B N    5  
ATOM 9083  C CA   . ASP B 1 16 ? -7.793  3.572   -10.902 1.00 0.00 ? 16 ASP B CA   5  
ATOM 9084  C C    . ASP B 1 16 ? -8.493  2.209   -10.919 1.00 0.00 ? 16 ASP B C    5  
ATOM 9085  O O    . ASP B 1 16 ? -9.381  1.983   -11.740 1.00 0.00 ? 16 ASP B O    5  
ATOM 9086  C CB   . ASP B 1 16 ? -7.314  3.923   -12.312 1.00 0.00 ? 16 ASP B CB   5  
ATOM 9087  C CG   . ASP B 1 16 ? -7.037  5.404   -12.477 1.00 0.00 ? 16 ASP B CG   5  
ATOM 9088  O OD1  . ASP B 1 16 ? -8.007  6.178   -12.613 1.00 0.00 ? 16 ASP B OD1  5  
ATOM 9089  O OD2  . ASP B 1 16 ? -5.849  5.790   -12.470 1.00 0.00 ? 16 ASP B OD2  5  
ATOM 9090  H H    . ASP B 1 16 ? -6.237  2.764   -9.709  1.00 0.00 ? 16 ASP B H    5  
ATOM 9091  H HA   . ASP B 1 16 ? -8.504  4.320   -10.584 1.00 0.00 ? 16 ASP B HA   5  
ATOM 9092  H HB2  . ASP B 1 16 ? -6.404  3.380   -12.521 1.00 0.00 ? 16 ASP B HB2  5  
ATOM 9093  H HB3  . ASP B 1 16 ? -8.072  3.635   -13.026 1.00 0.00 ? 16 ASP B HB3  5  
ATOM 9094  N N    . GLU B 1 17 ? -8.097  1.313   -10.009 1.00 0.00 ? 17 GLU B N    5  
ATOM 9095  C CA   . GLU B 1 17 ? -8.686  -0.028  -9.910  1.00 0.00 ? 17 GLU B CA   5  
ATOM 9096  C C    . GLU B 1 17 ? -7.751  -0.954  -9.134  1.00 0.00 ? 17 GLU B C    5  
ATOM 9097  O O    . GLU B 1 17 ? -7.256  -1.946  -9.670  1.00 0.00 ? 17 GLU B O    5  
ATOM 9098  C CB   . GLU B 1 17 ? -8.966  -0.620  -11.301 1.00 0.00 ? 17 GLU B CB   5  
ATOM 9099  C CG   . GLU B 1 17 ? -9.447  -2.064  -11.269 1.00 0.00 ? 17 GLU B CG   5  
ATOM 9100  C CD   . GLU B 1 17 ? -8.577  -2.989  -12.097 1.00 0.00 ? 17 GLU B CD   5  
ATOM 9101  O OE1  . GLU B 1 17 ? -7.943  -2.505  -13.059 1.00 0.00 ? 17 GLU B OE1  5  
ATOM 9102  O OE2  . GLU B 1 17 ? -8.530  -4.197  -11.785 1.00 0.00 ? 17 GLU B OE2  5  
ATOM 9103  H H    . GLU B 1 17 ? -7.393  1.557   -9.376  1.00 0.00 ? 17 GLU B H    5  
ATOM 9104  H HA   . GLU B 1 17 ? -9.616  0.059   -9.368  1.00 0.00 ? 17 GLU B HA   5  
ATOM 9105  H HB2  . GLU B 1 17 ? -9.727  -0.028  -11.785 1.00 0.00 ? 17 GLU B HB2  5  
ATOM 9106  H HB3  . GLU B 1 17 ? -8.060  -0.577  -11.887 1.00 0.00 ? 17 GLU B HB3  5  
ATOM 9107  H HG2  . GLU B 1 17 ? -9.440  -2.410  -10.246 1.00 0.00 ? 17 GLU B HG2  5  
ATOM 9108  H HG3  . GLU B 1 17 ? -10.456 -2.102  -11.653 1.00 0.00 ? 17 GLU B HG3  5  
ATOM 9109  N N    . VAL B 1 18 ? -7.499  -0.617  -7.874  1.00 0.00 ? 18 VAL B N    5  
ATOM 9110  C CA   . VAL B 1 18 ? -6.616  -1.403  -7.036  1.00 0.00 ? 18 VAL B CA   5  
ATOM 9111  C C    . VAL B 1 18 ? -7.364  -2.013  -5.846  1.00 0.00 ? 18 VAL B C    5  
ATOM 9112  O O    . VAL B 1 18 ? -8.583  -2.178  -5.885  1.00 0.00 ? 18 VAL B O    5  
ATOM 9113  C CB   . VAL B 1 18 ? -5.447  -0.533  -6.534  1.00 0.00 ? 18 VAL B CB   5  
ATOM 9114  C CG1  . VAL B 1 18 ? -4.828  0.247   -7.684  1.00 0.00 ? 18 VAL B CG1  5  
ATOM 9115  C CG2  . VAL B 1 18 ? -5.898  0.410   -5.422  1.00 0.00 ? 18 VAL B CG2  5  
ATOM 9116  H H    . VAL B 1 18 ? -7.906  0.186   -7.500  1.00 0.00 ? 18 VAL B H    5  
ATOM 9117  H HA   . VAL B 1 18 ? -6.208  -2.201  -7.639  1.00 0.00 ? 18 VAL B HA   5  
ATOM 9118  H HB   . VAL B 1 18 ? -4.699  -1.186  -6.136  1.00 0.00 ? 18 VAL B HB   5  
ATOM 9119  H HG11 . VAL B 1 18 ? -5.443  1.105   -7.910  1.00 0.00 ? 18 VAL B HG11 5  
ATOM 9120  H HG12 . VAL B 1 18 ? -4.762  -0.389  -8.555  1.00 0.00 ? 18 VAL B HG12 5  
ATOM 9121  H HG13 . VAL B 1 18 ? -3.838  0.577   -7.404  1.00 0.00 ? 18 VAL B HG13 5  
ATOM 9122  H HG21 . VAL B 1 18 ? -5.709  1.430   -5.717  1.00 0.00 ? 18 VAL B HG21 5  
ATOM 9123  H HG22 . VAL B 1 18 ? -5.349  0.190   -4.517  1.00 0.00 ? 18 VAL B HG22 5  
ATOM 9124  H HG23 . VAL B 1 18 ? -6.954  0.278   -5.242  1.00 0.00 ? 18 VAL B HG23 5  
ATOM 9125  N N    . THR B 1 19 ? -6.620  -2.338  -4.790  1.00 0.00 ? 19 THR B N    5  
ATOM 9126  C CA   . THR B 1 19 ? -7.187  -2.922  -3.579  1.00 0.00 ? 19 THR B CA   5  
ATOM 9127  C C    . THR B 1 19 ? -6.062  -3.345  -2.641  1.00 0.00 ? 19 THR B C    5  
ATOM 9128  O O    . THR B 1 19 ? -5.431  -4.378  -2.848  1.00 0.00 ? 19 THR B O    5  
ATOM 9129  C CB   . THR B 1 19 ? -8.070  -4.129  -3.915  1.00 0.00 ? 19 THR B CB   5  
ATOM 9130  O OG1  . THR B 1 19 ? -7.733  -4.664  -5.186  1.00 0.00 ? 19 THR B OG1  5  
ATOM 9131  C CG2  . THR B 1 19 ? -9.550  -3.805  -3.920  1.00 0.00 ? 19 THR B CG2  5  
ATOM 9132  H H    . THR B 1 19 ? -5.656  -2.174  -4.821  1.00 0.00 ? 19 THR B H    5  
ATOM 9133  H HA   . THR B 1 19 ? -7.785  -2.165  -3.092  1.00 0.00 ? 19 THR B HA   5  
ATOM 9134  H HB   . THR B 1 19 ? -7.905  -4.897  -3.172  1.00 0.00 ? 19 THR B HB   5  
ATOM 9135  H HG1  . THR B 1 19 ? -8.301  -4.284  -5.861  1.00 0.00 ? 19 THR B HG1  5  
ATOM 9136  H HG21 . THR B 1 19 ? -10.013 -4.222  -3.038  1.00 0.00 ? 19 THR B HG21 5  
ATOM 9137  H HG22 . THR B 1 19 ? -10.008 -4.229  -4.801  1.00 0.00 ? 19 THR B HG22 5  
ATOM 9138  H HG23 . THR B 1 19 ? -9.685  -2.733  -3.924  1.00 0.00 ? 19 THR B HG23 5  
ATOM 9139  N N    . VAL B 1 20 ? -5.802  -2.538  -1.620  1.00 0.00 ? 20 VAL B N    5  
ATOM 9140  C CA   . VAL B 1 20 ? -4.736  -2.838  -0.673  1.00 0.00 ? 20 VAL B CA   5  
ATOM 9141  C C    . VAL B 1 20 ? -5.288  -3.204  0.703   1.00 0.00 ? 20 VAL B C    5  
ATOM 9142  O O    . VAL B 1 20 ? -5.794  -2.345  1.430   1.00 0.00 ? 20 VAL B O    5  
ATOM 9143  C CB   . VAL B 1 20 ? -3.768  -1.647  -0.529  1.00 0.00 ? 20 VAL B CB   5  
ATOM 9144  C CG1  . VAL B 1 20 ? -2.632  -1.982  0.428   1.00 0.00 ? 20 VAL B CG1  5  
ATOM 9145  C CG2  . VAL B 1 20 ? -3.224  -1.237  -1.889  1.00 0.00 ? 20 VAL B CG2  5  
ATOM 9146  H H    . VAL B 1 20 ? -6.332  -1.721  -1.504  1.00 0.00 ? 20 VAL B H    5  
ATOM 9147  H HA   . VAL B 1 20 ? -4.178  -3.680  -1.061  1.00 0.00 ? 20 VAL B HA   5  
ATOM 9148  H HB   . VAL B 1 20 ? -4.317  -0.814  -0.121  1.00 0.00 ? 20 VAL B HB   5  
ATOM 9149  H HG11 . VAL B 1 20 ? -2.012  -2.753  -0.005  1.00 0.00 ? 20 VAL B HG11 5  
ATOM 9150  H HG12 . VAL B 1 20 ? -3.042  -2.332  1.363   1.00 0.00 ? 20 VAL B HG12 5  
ATOM 9151  H HG13 . VAL B 1 20 ? -2.037  -1.098  0.604   1.00 0.00 ? 20 VAL B HG13 5  
ATOM 9152  H HG21 . VAL B 1 20 ? -3.842  -0.453  -2.303  1.00 0.00 ? 20 VAL B HG21 5  
ATOM 9153  H HG22 . VAL B 1 20 ? -3.232  -2.089  -2.553  1.00 0.00 ? 20 VAL B HG22 5  
ATOM 9154  H HG23 . VAL B 1 20 ? -2.212  -0.877  -1.779  1.00 0.00 ? 20 VAL B HG23 5  
ATOM 9155  N N    . THR B 1 21 ? -5.188  -4.485  1.047   1.00 0.00 ? 21 THR B N    5  
ATOM 9156  C CA   . THR B 1 21 ? -5.671  -4.980  2.331   1.00 0.00 ? 21 THR B CA   5  
ATOM 9157  C C    . THR B 1 21 ? -4.509  -5.260  3.283   1.00 0.00 ? 21 THR B C    5  
ATOM 9158  O O    . THR B 1 21 ? -3.735  -6.196  3.079   1.00 0.00 ? 21 THR B O    5  
ATOM 9159  C CB   . THR B 1 21 ? -6.496  -6.253  2.134   1.00 0.00 ? 21 THR B CB   5  
ATOM 9160  O OG1  . THR B 1 21 ? -5.886  -7.103  1.179   1.00 0.00 ? 21 THR B OG1  5  
ATOM 9161  C CG2  . THR B 1 21 ? -7.912  -5.984  1.671   1.00 0.00 ? 21 THR B CG2  5  
ATOM 9162  H H    . THR B 1 21 ? -4.783  -5.115  0.414   1.00 0.00 ? 21 THR B H    5  
ATOM 9163  H HA   . THR B 1 21 ? -6.301  -4.217  2.765   1.00 0.00 ? 21 THR B HA   5  
ATOM 9164  H HB   . THR B 1 21 ? -6.551  -6.783  3.074   1.00 0.00 ? 21 THR B HB   5  
ATOM 9165  H HG1  . THR B 1 21 ? -5.964  -6.713  0.305   1.00 0.00 ? 21 THR B HG1  5  
ATOM 9166  H HG21 . THR B 1 21 ? -8.475  -5.534  2.475   1.00 0.00 ? 21 THR B HG21 5  
ATOM 9167  H HG22 . THR B 1 21 ? -8.379  -6.915  1.382   1.00 0.00 ? 21 THR B HG22 5  
ATOM 9168  H HG23 . THR B 1 21 ? -7.893  -5.314  0.824   1.00 0.00 ? 21 THR B HG23 5  
ATOM 9169  N N    . VAL B 1 22 ? -4.392  -4.441  4.324   1.00 0.00 ? 22 VAL B N    5  
ATOM 9170  C CA   . VAL B 1 22 ? -3.326  -4.601  5.306   1.00 0.00 ? 22 VAL B CA   5  
ATOM 9171  C C    . VAL B 1 22 ? -3.633  -5.742  6.272   1.00 0.00 ? 22 VAL B C    5  
ATOM 9172  O O    . VAL B 1 22 ? -3.958  -5.515  7.437   1.00 0.00 ? 22 VAL B O    5  
ATOM 9173  C CB   . VAL B 1 22 ? -3.102  -3.306  6.111   1.00 0.00 ? 22 VAL B CB   5  
ATOM 9174  C CG1  . VAL B 1 22 ? -2.584  -2.198  5.208   1.00 0.00 ? 22 VAL B CG1  5  
ATOM 9175  C CG2  . VAL B 1 22 ? -4.385  -2.882  6.811   1.00 0.00 ? 22 VAL B CG2  5  
ATOM 9176  H H    . VAL B 1 22 ? -5.037  -3.711  4.431   1.00 0.00 ? 22 VAL B H    5  
ATOM 9177  H HA   . VAL B 1 22 ? -2.415  -4.830  4.773   1.00 0.00 ? 22 VAL B HA   5  
ATOM 9178  H HB   . VAL B 1 22 ? -2.354  -3.502  6.866   1.00 0.00 ? 22 VAL B HB   5  
ATOM 9179  H HG11 . VAL B 1 22 ? -2.980  -1.249  5.538   1.00 0.00 ? 22 VAL B HG11 5  
ATOM 9180  H HG12 . VAL B 1 22 ? -2.899  -2.385  4.192   1.00 0.00 ? 22 VAL B HG12 5  
ATOM 9181  H HG13 . VAL B 1 22 ? -1.505  -2.173  5.251   1.00 0.00 ? 22 VAL B HG13 5  
ATOM 9182  H HG21 . VAL B 1 22 ? -4.517  -1.815  6.709   1.00 0.00 ? 22 VAL B HG21 5  
ATOM 9183  H HG22 . VAL B 1 22 ? -4.325  -3.138  7.859   1.00 0.00 ? 22 VAL B HG22 5  
ATOM 9184  H HG23 . VAL B 1 22 ? -5.226  -3.392  6.365   1.00 0.00 ? 22 VAL B HG23 5  
ATOM 9185  N N    . LEU B 1 23 ? -3.529  -6.971  5.777   1.00 0.00 ? 23 LEU B N    5  
ATOM 9186  C CA   . LEU B 1 23 ? -3.797  -8.151  6.592   1.00 0.00 ? 23 LEU B CA   5  
ATOM 9187  C C    . LEU B 1 23 ? -2.497  -8.697  7.197   1.00 0.00 ? 23 LEU B C    5  
ATOM 9188  O O    . LEU B 1 23 ? -1.613  -7.924  7.566   1.00 0.00 ? 23 LEU B O    5  
ATOM 9189  C CB   . LEU B 1 23 ? -4.505  -9.218  5.743   1.00 0.00 ? 23 LEU B CB   5  
ATOM 9190  C CG   . LEU B 1 23 ? -5.359  -10.246 6.508   1.00 0.00 ? 23 LEU B CG   5  
ATOM 9191  C CD1  . LEU B 1 23 ? -5.439  -9.919  7.996   1.00 0.00 ? 23 LEU B CD1  5  
ATOM 9192  C CD2  . LEU B 1 23 ? -6.755  -10.329 5.908   1.00 0.00 ? 23 LEU B CD2  5  
ATOM 9193  H H    . LEU B 1 23 ? -3.268  -7.087  4.839   1.00 0.00 ? 23 LEU B H    5  
ATOM 9194  H HA   . LEU B 1 23 ? -4.451  -7.848  7.396   1.00 0.00 ? 23 LEU B HA   5  
ATOM 9195  H HB2  . LEU B 1 23 ? -5.144  -8.710  5.036   1.00 0.00 ? 23 LEU B HB2  5  
ATOM 9196  H HB3  . LEU B 1 23 ? -3.750  -9.757  5.189   1.00 0.00 ? 23 LEU B HB3  5  
ATOM 9197  H HG   . LEU B 1 23 ? -4.899  -11.220 6.410   1.00 0.00 ? 23 LEU B HG   5  
ATOM 9198  H HD11 . LEU B 1 23 ? -4.442  -9.864  8.409   1.00 0.00 ? 23 LEU B HD11 5  
ATOM 9199  H HD12 . LEU B 1 23 ? -5.996  -10.690 8.506   1.00 0.00 ? 23 LEU B HD12 5  
ATOM 9200  H HD13 . LEU B 1 23 ? -5.936  -8.969  8.130   1.00 0.00 ? 23 LEU B HD13 5  
ATOM 9201  H HD21 . LEU B 1 23 ? -7.417  -10.823 6.604   1.00 0.00 ? 23 LEU B HD21 5  
ATOM 9202  H HD22 . LEU B 1 23 ? -6.718  -10.889 4.986   1.00 0.00 ? 23 LEU B HD22 5  
ATOM 9203  H HD23 . LEU B 1 23 ? -7.121  -9.332  5.710   1.00 0.00 ? 23 LEU B HD23 5  
ATOM 9204  N N    . GLY B 1 24 ? -2.380  -10.024 7.303   1.00 0.00 ? 24 GLY B N    5  
ATOM 9205  C CA   . GLY B 1 24 ? -1.182  -10.625 7.865   1.00 0.00 ? 24 GLY B CA   5  
ATOM 9206  C C    . GLY B 1 24 ? -0.764  -9.988  9.175   1.00 0.00 ? 24 GLY B C    5  
ATOM 9207  O O    . GLY B 1 24 ? 0.205   -9.231  9.222   1.00 0.00 ? 24 GLY B O    5  
ATOM 9208  H H    . GLY B 1 24 ? -3.108  -10.598 7.000   1.00 0.00 ? 24 GLY B H    5  
ATOM 9209  H HA2  . GLY B 1 24 ? -1.367  -11.676 8.033   1.00 0.00 ? 24 GLY B HA2  5  
ATOM 9210  H HA3  . GLY B 1 24 ? -0.376  -10.524 7.154   1.00 0.00 ? 24 GLY B HA3  5  
ATOM 9211  N N    . VAL B 1 25 ? -1.496  -10.290 10.242  1.00 0.00 ? 25 VAL B N    5  
ATOM 9212  C CA   . VAL B 1 25 ? -1.194  -9.737  11.549  1.00 0.00 ? 25 VAL B CA   5  
ATOM 9213  C C    . VAL B 1 25 ? -0.288  -10.668 12.348  1.00 0.00 ? 25 VAL B C    5  
ATOM 9214  O O    . VAL B 1 25 ? -0.715  -11.728 12.804  1.00 0.00 ? 25 VAL B O    5  
ATOM 9215  C CB   . VAL B 1 25 ? -2.478  -9.470  12.357  1.00 0.00 ? 25 VAL B CB   5  
ATOM 9216  C CG1  . VAL B 1 25 ? -2.172  -8.619  13.581  1.00 0.00 ? 25 VAL B CG1  5  
ATOM 9217  C CG2  . VAL B 1 25 ? -3.531  -8.803  11.484  1.00 0.00 ? 25 VAL B CG2  5  
ATOM 9218  H H    . VAL B 1 25 ? -2.256  -10.891 10.146  1.00 0.00 ? 25 VAL B H    5  
ATOM 9219  H HA   . VAL B 1 25 ? -0.690  -8.801  11.397  1.00 0.00 ? 25 VAL B HA   5  
ATOM 9220  H HB   . VAL B 1 25 ? -2.870  -10.418 12.696  1.00 0.00 ? 25 VAL B HB   5  
ATOM 9221  H HG11 . VAL B 1 25 ? -3.003  -7.958  13.776  1.00 0.00 ? 25 VAL B HG11 5  
ATOM 9222  H HG12 . VAL B 1 25 ? -1.282  -8.036  13.400  1.00 0.00 ? 25 VAL B HG12 5  
ATOM 9223  H HG13 . VAL B 1 25 ? -2.015  -9.261  14.435  1.00 0.00 ? 25 VAL B HG13 5  
ATOM 9224  H HG21 . VAL B 1 25 ? -3.665  -9.378  10.578  1.00 0.00 ? 25 VAL B HG21 5  
ATOM 9225  H HG22 . VAL B 1 25 ? -3.210  -7.804  11.231  1.00 0.00 ? 25 VAL B HG22 5  
ATOM 9226  H HG23 . VAL B 1 25 ? -4.467  -8.756  12.021  1.00 0.00 ? 25 VAL B HG23 5  
ATOM 9227  N N    . LYS B 1 26 ? 0.967   -10.263 12.510  1.00 0.00 ? 26 LYS B N    5  
ATOM 9228  C CA   . LYS B 1 26 ? 1.939   -11.060 13.250  1.00 0.00 ? 26 LYS B CA   5  
ATOM 9229  C C    . LYS B 1 26 ? 2.809   -10.176 14.136  1.00 0.00 ? 26 LYS B C    5  
ATOM 9230  O O    . LYS B 1 26 ? 2.952   -8.979  13.888  1.00 0.00 ? 26 LYS B O    5  
ATOM 9231  C CB   . LYS B 1 26 ? 2.818   -11.856 12.284  1.00 0.00 ? 26 LYS B CB   5  
ATOM 9232  C CG   . LYS B 1 26 ? 3.207   -13.230 12.805  1.00 0.00 ? 26 LYS B CG   5  
ATOM 9233  C CD   . LYS B 1 26 ? 2.046   -14.210 12.720  1.00 0.00 ? 26 LYS B CD   5  
ATOM 9234  C CE   . LYS B 1 26 ? 1.525   -14.580 14.100  1.00 0.00 ? 26 LYS B CE   5  
ATOM 9235  N NZ   . LYS B 1 26 ? 1.123   -16.012 14.177  1.00 0.00 ? 26 LYS B NZ   5  
ATOM 9236  H H    . LYS B 1 26 ? 1.245   -9.411  12.112  1.00 0.00 ? 26 LYS B H    5  
ATOM 9237  H HA   . LYS B 1 26 ? 1.393   -11.750 13.876  1.00 0.00 ? 26 LYS B HA   5  
ATOM 9238  H HB2  . LYS B 1 26 ? 2.285   -11.985 11.353  1.00 0.00 ? 26 LYS B HB2  5  
ATOM 9239  H HB3  . LYS B 1 26 ? 3.723   -11.297 12.095  1.00 0.00 ? 26 LYS B HB3  5  
ATOM 9240  H HG2  . LYS B 1 26 ? 4.027   -13.609 12.215  1.00 0.00 ? 26 LYS B HG2  5  
ATOM 9241  H HG3  . LYS B 1 26 ? 3.515   -13.138 13.836  1.00 0.00 ? 26 LYS B HG3  5  
ATOM 9242  H HD2  . LYS B 1 26 ? 1.245   -13.758 12.154  1.00 0.00 ? 26 LYS B HD2  5  
ATOM 9243  H HD3  . LYS B 1 26 ? 2.381   -15.107 12.219  1.00 0.00 ? 26 LYS B HD3  5  
ATOM 9244  H HE2  . LYS B 1 26 ? 2.302   -14.395 14.826  1.00 0.00 ? 26 LYS B HE2  5  
ATOM 9245  H HE3  . LYS B 1 26 ? 0.668   -13.962 14.325  1.00 0.00 ? 26 LYS B HE3  5  
ATOM 9246  H HZ1  . LYS B 1 26 ? 1.612   -16.561 13.441  1.00 0.00 ? 26 LYS B HZ1  5  
ATOM 9247  H HZ2  . LYS B 1 26 ? 0.096   -16.104 14.037  1.00 0.00 ? 26 LYS B HZ2  5  
ATOM 9248  H HZ3  . LYS B 1 26 ? 1.370   -16.403 15.109  1.00 0.00 ? 26 LYS B HZ3  5  
ATOM 9249  N N    . GLY B 1 27 ? 3.390   -10.776 15.170  1.00 0.00 ? 27 GLY B N    5  
ATOM 9250  C CA   . GLY B 1 27 ? 4.241   -10.030 16.078  1.00 0.00 ? 27 GLY B CA   5  
ATOM 9251  C C    . GLY B 1 27 ? 5.480   -9.486  15.396  1.00 0.00 ? 27 GLY B C    5  
ATOM 9252  O O    . GLY B 1 27 ? 6.001   -10.096 14.462  1.00 0.00 ? 27 GLY B O    5  
ATOM 9253  H H    . GLY B 1 27 ? 3.240   -11.733 15.318  1.00 0.00 ? 27 GLY B H    5  
ATOM 9254  H HA2  . GLY B 1 27 ? 3.676   -9.205  16.487  1.00 0.00 ? 27 GLY B HA2  5  
ATOM 9255  H HA3  . GLY B 1 27 ? 4.543   -10.680 16.886  1.00 0.00 ? 27 GLY B HA3  5  
ATOM 9256  N N    . ASN B 1 28 ? 5.950   -8.332  15.861  1.00 0.00 ? 28 ASN B N    5  
ATOM 9257  C CA   . ASN B 1 28 ? 7.134   -7.694  15.292  1.00 0.00 ? 28 ASN B CA   5  
ATOM 9258  C C    . ASN B 1 28 ? 6.815   -7.077  13.932  1.00 0.00 ? 28 ASN B C    5  
ATOM 9259  O O    . ASN B 1 28 ? 6.599   -5.871  13.826  1.00 0.00 ? 28 ASN B O    5  
ATOM 9260  C CB   . ASN B 1 28 ? 8.286   -8.699  15.163  1.00 0.00 ? 28 ASN B CB   5  
ATOM 9261  C CG   . ASN B 1 28 ? 9.485   -8.316  16.008  1.00 0.00 ? 28 ASN B CG   5  
ATOM 9262  O OD1  . ASN B 1 28 ? 9.346   -7.957  17.177  1.00 0.00 ? 28 ASN B OD1  5  
ATOM 9263  N ND2  . ASN B 1 28 ? 10.673  -8.389  15.418  1.00 0.00 ? 28 ASN B ND2  5  
ATOM 9264  H H    . ASN B 1 28 ? 5.484   -7.893  16.603  1.00 0.00 ? 28 ASN B H    5  
ATOM 9265  H HA   . ASN B 1 28 ? 7.435   -6.904  15.965  1.00 0.00 ? 28 ASN B HA   5  
ATOM 9266  H HB2  . ASN B 1 28 ? 7.944   -9.672  15.481  1.00 0.00 ? 28 ASN B HB2  5  
ATOM 9267  H HB3  . ASN B 1 28 ? 8.599   -8.752  14.130  1.00 0.00 ? 28 ASN B HB3  5  
ATOM 9268  H HD21 . ASN B 1 28 ? 10.708  -8.683  14.484  1.00 0.00 ? 28 ASN B HD21 5  
ATOM 9269  H HD22 . ASN B 1 28 ? 11.465  -8.147  15.941  1.00 0.00 ? 28 ASN B HD22 5  
ATOM 9270  N N    . GLN B 1 29 ? 6.787   -7.909  12.894  1.00 0.00 ? 29 GLN B N    5  
ATOM 9271  C CA   . GLN B 1 29 ? 6.494   -7.436  11.546  1.00 0.00 ? 29 GLN B CA   5  
ATOM 9272  C C    . GLN B 1 29 ? 5.207   -8.061  11.016  1.00 0.00 ? 29 GLN B C    5  
ATOM 9273  O O    . GLN B 1 29 ? 5.051   -9.282  11.016  1.00 0.00 ? 29 GLN B O    5  
ATOM 9274  C CB   . GLN B 1 29 ? 7.656   -7.758  10.605  1.00 0.00 ? 29 GLN B CB   5  
ATOM 9275  C CG   . GLN B 1 29 ? 8.709   -6.664  10.543  1.00 0.00 ? 29 GLN B CG   5  
ATOM 9276  C CD   . GLN B 1 29 ? 9.574   -6.759  9.302   1.00 0.00 ? 29 GLN B CD   5  
ATOM 9277  O OE1  . GLN B 1 29 ? 9.452   -5.949  8.382   1.00 0.00 ? 29 GLN B OE1  5  
ATOM 9278  N NE2  . GLN B 1 29 ? 10.455  -7.752  9.269   1.00 0.00 ? 29 GLN B NE2  5  
ATOM 9279  H H    . GLN B 1 29 ? 6.968   -8.862  13.036  1.00 0.00 ? 29 GLN B H    5  
ATOM 9280  H HA   . GLN B 1 29 ? 6.366   -6.365  11.591  1.00 0.00 ? 29 GLN B HA   5  
ATOM 9281  H HB2  . GLN B 1 29 ? 8.132   -8.668  10.938  1.00 0.00 ? 29 GLN B HB2  5  
ATOM 9282  H HB3  . GLN B 1 29 ? 7.266   -7.909  9.609   1.00 0.00 ? 29 GLN B HB3  5  
ATOM 9283  H HG2  . GLN B 1 29 ? 8.214   -5.704  10.546  1.00 0.00 ? 29 GLN B HG2  5  
ATOM 9284  H HG3  . GLN B 1 29 ? 9.343   -6.743  11.414  1.00 0.00 ? 29 GLN B HG3  5  
ATOM 9285  H HE21 . GLN B 1 29 ? 10.496  -8.359  10.037  1.00 0.00 ? 29 GLN B HE21 5  
ATOM 9286  H HE22 . GLN B 1 29 ? 11.027  -7.837  8.478   1.00 0.00 ? 29 GLN B HE22 5  
ATOM 9287  N N    . VAL B 1 30 ? 4.284   -7.213  10.575  1.00 0.00 ? 30 VAL B N    5  
ATOM 9288  C CA   . VAL B 1 30 ? 3.004   -7.676  10.053  1.00 0.00 ? 30 VAL B CA   5  
ATOM 9289  C C    . VAL B 1 30 ? 3.052   -7.843  8.539   1.00 0.00 ? 30 VAL B C    5  
ATOM 9290  O O    . VAL B 1 30 ? 3.585   -6.992  7.827   1.00 0.00 ? 30 VAL B O    5  
ATOM 9291  C CB   . VAL B 1 30 ? 1.865   -6.704  10.414  1.00 0.00 ? 30 VAL B CB   5  
ATOM 9292  C CG1  . VAL B 1 30 ? 1.594   -6.728  11.911  1.00 0.00 ? 30 VAL B CG1  5  
ATOM 9293  C CG2  . VAL B 1 30 ? 2.196   -5.294  9.948   1.00 0.00 ? 30 VAL B CG2  5  
ATOM 9294  H H    . VAL B 1 30 ? 4.463   -6.248  10.616  1.00 0.00 ? 30 VAL B H    5  
ATOM 9295  H HA   . VAL B 1 30 ? 2.787   -8.633  10.504  1.00 0.00 ? 30 VAL B HA   5  
ATOM 9296  H HB   . VAL B 1 30 ? 0.969   -7.026  9.904   1.00 0.00 ? 30 VAL B HB   5  
ATOM 9297  H HG11 . VAL B 1 30 ? 2.048   -7.607  12.345  1.00 0.00 ? 30 VAL B HG11 5  
ATOM 9298  H HG12 . VAL B 1 30 ? 0.528   -6.752  12.084  1.00 0.00 ? 30 VAL B HG12 5  
ATOM 9299  H HG13 . VAL B 1 30 ? 2.013   -5.844  12.368  1.00 0.00 ? 30 VAL B HG13 5  
ATOM 9300  H HG21 . VAL B 1 30 ? 2.534   -4.706  10.789  1.00 0.00 ? 30 VAL B HG21 5  
ATOM 9301  H HG22 . VAL B 1 30 ? 1.314   -4.839  9.522   1.00 0.00 ? 30 VAL B HG22 5  
ATOM 9302  H HG23 . VAL B 1 30 ? 2.976   -5.335  9.201   1.00 0.00 ? 30 VAL B HG23 5  
ATOM 9303  N N    . ARG B 1 31 ? 2.479   -8.940  8.049   1.00 0.00 ? 31 ARG B N    5  
ATOM 9304  C CA   . ARG B 1 31 ? 2.443   -9.211  6.627   1.00 0.00 ? 31 ARG B CA   5  
ATOM 9305  C C    . ARG B 1 31 ? 1.359   -8.375  5.958   1.00 0.00 ? 31 ARG B C    5  
ATOM 9306  O O    . ARG B 1 31 ? 0.171   -8.660  6.097   1.00 0.00 ? 31 ARG B O    5  
ATOM 9307  C CB   . ARG B 1 31 ? 2.191   -10.699 6.374   1.00 0.00 ? 31 ARG B CB   5  
ATOM 9308  C CG   . ARG B 1 31 ? 3.455   -11.542 6.395   1.00 0.00 ? 31 ARG B CG   5  
ATOM 9309  C CD   . ARG B 1 31 ? 3.148   -13.015 6.175   1.00 0.00 ? 31 ARG B CD   5  
ATOM 9310  N NE   . ARG B 1 31 ? 3.941   -13.876 7.048   1.00 0.00 ? 31 ARG B NE   5  
ATOM 9311  C CZ   . ARG B 1 31 ? 3.653   -14.102 8.328   1.00 0.00 ? 31 ARG B CZ   5  
ATOM 9312  N NH1  . ARG B 1 31 ? 2.595   -13.529 8.888   1.00 0.00 ? 31 ARG B NH1  5  
ATOM 9313  N NH2  . ARG B 1 31 ? 4.426   -14.902 9.050   1.00 0.00 ? 31 ARG B NH2  5  
ATOM 9314  H H    . ARG B 1 31 ? 2.052   -9.570  8.651   1.00 0.00 ? 31 ARG B H    5  
ATOM 9315  H HA   . ARG B 1 31 ? 3.396   -8.943  6.223   1.00 0.00 ? 31 ARG B HA   5  
ATOM 9316  H HB2  . ARG B 1 31 ? 1.522   -11.073 7.135   1.00 0.00 ? 31 ARG B HB2  5  
ATOM 9317  H HB3  . ARG B 1 31 ? 1.723   -10.814 5.408   1.00 0.00 ? 31 ARG B HB3  5  
ATOM 9318  H HG2  . ARG B 1 31 ? 4.116   -11.202 5.612   1.00 0.00 ? 31 ARG B HG2  5  
ATOM 9319  H HG3  . ARG B 1 31 ? 3.939   -11.424 7.354   1.00 0.00 ? 31 ARG B HG3  5  
ATOM 9320  H HD2  . ARG B 1 31 ? 2.100   -13.185 6.373   1.00 0.00 ? 31 ARG B HD2  5  
ATOM 9321  H HD3  . ARG B 1 31 ? 3.363   -13.264 5.146   1.00 0.00 ? 31 ARG B HD3  5  
ATOM 9322  H HE   . ARG B 1 31 ? 4.730   -14.310 6.660   1.00 0.00 ? 31 ARG B HE   5  
ATOM 9323  H HH11 . ARG B 1 31 ? 2.009   -12.924 8.350   1.00 0.00 ? 31 ARG B HH11 5  
ATOM 9324  H HH12 . ARG B 1 31 ? 2.384   -13.703 9.850   1.00 0.00 ? 31 ARG B HH12 5  
ATOM 9325  H HH21 . ARG B 1 31 ? 5.224   -15.336 8.633   1.00 0.00 ? 31 ARG B HH21 5  
ATOM 9326  H HH22 . ARG B 1 31 ? 4.210   -15.072 10.012  1.00 0.00 ? 31 ARG B HH22 5  
ATOM 9327  N N    . ILE B 1 32 ? 1.770   -7.332  5.248   1.00 0.00 ? 32 ILE B N    5  
ATOM 9328  C CA   . ILE B 1 32 ? 0.820   -6.449  4.584   1.00 0.00 ? 32 ILE B CA   5  
ATOM 9329  C C    . ILE B 1 32 ? 0.466   -6.962  3.193   1.00 0.00 ? 32 ILE B C    5  
ATOM 9330  O O    . ILE B 1 32 ? 1.334   -7.417  2.448   1.00 0.00 ? 32 ILE B O    5  
ATOM 9331  C CB   . ILE B 1 32 ? 1.380   -5.017  4.476   1.00 0.00 ? 32 ILE B CB   5  
ATOM 9332  C CG1  . ILE B 1 32 ? 2.046   -4.609  5.795   1.00 0.00 ? 32 ILE B CG1  5  
ATOM 9333  C CG2  . ILE B 1 32 ? 0.273   -4.040  4.107   1.00 0.00 ? 32 ILE B CG2  5  
ATOM 9334  C CD1  . ILE B 1 32 ? 1.078   -4.503  6.954   1.00 0.00 ? 32 ILE B CD1  5  
ATOM 9335  H H    . ILE B 1 32 ? 2.730   -7.140  5.183   1.00 0.00 ? 32 ILE B H    5  
ATOM 9336  H HA   . ILE B 1 32 ? -0.078  -6.416  5.183   1.00 0.00 ? 32 ILE B HA   5  
ATOM 9337  H HB   . ILE B 1 32 ? 2.118   -5.000  3.688   1.00 0.00 ? 32 ILE B HB   5  
ATOM 9338  H HG12 . ILE B 1 32 ? 2.794   -5.344  6.055   1.00 0.00 ? 32 ILE B HG12 5  
ATOM 9339  H HG13 . ILE B 1 32 ? 2.522   -3.647  5.671   1.00 0.00 ? 32 ILE B HG13 5  
ATOM 9340  H HG21 . ILE B 1 32 ? 0.708   -3.143  3.692   1.00 0.00 ? 32 ILE B HG21 5  
ATOM 9341  H HG22 . ILE B 1 32 ? -0.295  -3.789  4.991   1.00 0.00 ? 32 ILE B HG22 5  
ATOM 9342  H HG23 . ILE B 1 32 ? -0.380  -4.495  3.376   1.00 0.00 ? 32 ILE B HG23 5  
ATOM 9343  H HD11 . ILE B 1 32 ? 1.071   -5.434  7.502   1.00 0.00 ? 32 ILE B HD11 5  
ATOM 9344  H HD12 . ILE B 1 32 ? 0.086   -4.300  6.578   1.00 0.00 ? 32 ILE B HD12 5  
ATOM 9345  H HD13 . ILE B 1 32 ? 1.386   -3.702  7.609   1.00 0.00 ? 32 ILE B HD13 5  
ATOM 9346  N N    . GLY B 1 33 ? -0.819  -6.888  2.850   1.00 0.00 ? 33 GLY B N    5  
ATOM 9347  C CA   . GLY B 1 33 ? -1.270  -7.351  1.552   1.00 0.00 ? 33 GLY B CA   5  
ATOM 9348  C C    . GLY B 1 33 ? -1.649  -6.212  0.632   1.00 0.00 ? 33 GLY B C    5  
ATOM 9349  O O    . GLY B 1 33 ? -2.575  -5.454  0.920   1.00 0.00 ? 33 GLY B O    5  
ATOM 9350  H H    . GLY B 1 33 ? -1.469  -6.515  3.483   1.00 0.00 ? 33 GLY B H    5  
ATOM 9351  H HA2  . GLY B 1 33 ? -0.483  -7.921  1.090   1.00 0.00 ? 33 GLY B HA2  5  
ATOM 9352  H HA3  . GLY B 1 33 ? -2.131  -7.989  1.688   1.00 0.00 ? 33 GLY B HA3  5  
ATOM 9353  N N    . VAL B 1 34 ? -0.933  -6.087  -0.479  1.00 0.00 ? 34 VAL B N    5  
ATOM 9354  C CA   . VAL B 1 34 ? -1.206  -5.028  -1.439  1.00 0.00 ? 34 VAL B CA   5  
ATOM 9355  C C    . VAL B 1 34 ? -1.615  -5.594  -2.793  1.00 0.00 ? 34 VAL B C    5  
ATOM 9356  O O    . VAL B 1 34 ? -0.774  -6.060  -3.563  1.00 0.00 ? 34 VAL B O    5  
ATOM 9357  C CB   . VAL B 1 34 ? 0.018   -4.114  -1.630  1.00 0.00 ? 34 VAL B CB   5  
ATOM 9358  C CG1  . VAL B 1 34 ? -0.358  -2.877  -2.430  1.00 0.00 ? 34 VAL B CG1  5  
ATOM 9359  C CG2  . VAL B 1 34 ? 0.612   -3.728  -0.283  1.00 0.00 ? 34 VAL B CG2  5  
ATOM 9360  H H    . VAL B 1 34 ? -0.206  -6.721  -0.655  1.00 0.00 ? 34 VAL B H    5  
ATOM 9361  H HA   . VAL B 1 34 ? -2.017  -4.429  -1.051  1.00 0.00 ? 34 VAL B HA   5  
ATOM 9362  H HB   . VAL B 1 34 ? 0.766   -4.660  -2.186  1.00 0.00 ? 34 VAL B HB   5  
ATOM 9363  H HG11 . VAL B 1 34 ? 0.454   -2.615  -3.092  1.00 0.00 ? 34 VAL B HG11 5  
ATOM 9364  H HG12 . VAL B 1 34 ? -0.551  -2.056  -1.755  1.00 0.00 ? 34 VAL B HG12 5  
ATOM 9365  H HG13 . VAL B 1 34 ? -1.245  -3.081  -3.011  1.00 0.00 ? 34 VAL B HG13 5  
ATOM 9366  H HG21 . VAL B 1 34 ? 0.727   -4.613  0.326   1.00 0.00 ? 34 VAL B HG21 5  
ATOM 9367  H HG22 . VAL B 1 34 ? -0.046  -3.031  0.214   1.00 0.00 ? 34 VAL B HG22 5  
ATOM 9368  H HG23 . VAL B 1 34 ? 1.577   -3.267  -0.434  1.00 0.00 ? 34 VAL B HG23 5  
ATOM 9369  N N    . ASN B 1 35 ? -2.911  -5.546  -3.078  1.00 0.00 ? 35 ASN B N    5  
ATOM 9370  C CA   . ASN B 1 35 ? -3.428  -6.049  -4.345  1.00 0.00 ? 35 ASN B CA   5  
ATOM 9371  C C    . ASN B 1 35 ? -3.574  -4.910  -5.347  1.00 0.00 ? 35 ASN B C    5  
ATOM 9372  O O    . ASN B 1 35 ? -4.463  -4.067  -5.227  1.00 0.00 ? 35 ASN B O    5  
ATOM 9373  C CB   . ASN B 1 35 ? -4.775  -6.755  -4.149  1.00 0.00 ? 35 ASN B CB   5  
ATOM 9374  C CG   . ASN B 1 35 ? -4.870  -7.481  -2.820  1.00 0.00 ? 35 ASN B CG   5  
ATOM 9375  O OD1  . ASN B 1 35 ? -3.856  -7.782  -2.190  1.00 0.00 ? 35 ASN B OD1  5  
ATOM 9376  N ND2  . ASN B 1 35 ? -6.092  -7.767  -2.387  1.00 0.00 ? 35 ASN B ND2  5  
ATOM 9377  H H    . ASN B 1 35 ? -3.527  -5.168  -2.416  1.00 0.00 ? 35 ASN B H    5  
ATOM 9378  H HA   . ASN B 1 35 ? -2.713  -6.760  -4.732  1.00 0.00 ? 35 ASN B HA   5  
ATOM 9379  H HB2  . ASN B 1 35 ? -5.569  -6.026  -4.197  1.00 0.00 ? 35 ASN B HB2  5  
ATOM 9380  H HB3  . ASN B 1 35 ? -4.911  -7.477  -4.941  1.00 0.00 ? 35 ASN B HB3  5  
ATOM 9381  H HD21 . ASN B 1 35 ? -6.854  -7.498  -2.942  1.00 0.00 ? 35 ASN B HD21 5  
ATOM 9382  H HD22 . ASN B 1 35 ? -6.182  -8.236  -1.531  1.00 0.00 ? 35 ASN B HD22 5  
ATOM 9383  N N    . ALA B 1 36 ? -2.683  -4.892  -6.329  1.00 0.00 ? 36 ALA B N    5  
ATOM 9384  C CA   . ALA B 1 36 ? -2.694  -3.856  -7.354  1.00 0.00 ? 36 ALA B CA   5  
ATOM 9385  C C    . ALA B 1 36 ? -2.531  -4.447  -8.752  1.00 0.00 ? 36 ALA B C    5  
ATOM 9386  O O    . ALA B 1 36 ? -1.822  -5.436  -8.941  1.00 0.00 ? 36 ALA B O    5  
ATOM 9387  C CB   . ALA B 1 36 ? -1.598  -2.837  -7.082  1.00 0.00 ? 36 ALA B CB   5  
ATOM 9388  H H    . ALA B 1 36 ? -1.998  -5.592  -6.350  1.00 0.00 ? 36 ALA B H    5  
ATOM 9389  H HA   . ALA B 1 36 ? -3.644  -3.347  -7.299  1.00 0.00 ? 36 ALA B HA   5  
ATOM 9390  H HB1  . ALA B 1 36 ? -1.635  -2.536  -6.046  1.00 0.00 ? 36 ALA B HB1  5  
ATOM 9391  H HB2  . ALA B 1 36 ? -1.744  -1.973  -7.714  1.00 0.00 ? 36 ALA B HB2  5  
ATOM 9392  H HB3  . ALA B 1 36 ? -0.635  -3.279  -7.294  1.00 0.00 ? 36 ALA B HB3  5  
ATOM 9393  N N    . PRO B 1 37 ? -3.188  -3.840  -9.757  1.00 0.00 ? 37 PRO B N    5  
ATOM 9394  C CA   . PRO B 1 37 ? -3.115  -4.300  -11.144 1.00 0.00 ? 37 PRO B CA   5  
ATOM 9395  C C    . PRO B 1 37 ? -1.820  -3.869  -11.823 1.00 0.00 ? 37 PRO B C    5  
ATOM 9396  O O    . PRO B 1 37 ? -1.191  -2.893  -11.416 1.00 0.00 ? 37 PRO B O    5  
ATOM 9397  C CB   . PRO B 1 37 ? -4.314  -3.617  -11.796 1.00 0.00 ? 37 PRO B CB   5  
ATOM 9398  C CG   . PRO B 1 37 ? -4.480  -2.350  -11.032 1.00 0.00 ? 37 PRO B CG   5  
ATOM 9399  C CD   . PRO B 1 37 ? -4.053  -2.650  -9.618  1.00 0.00 ? 37 PRO B CD   5  
ATOM 9400  H HA   . PRO B 1 37 ? -3.221  -5.373  -11.214 1.00 0.00 ? 37 PRO B HA   5  
ATOM 9401  H HB2  . PRO B 1 37 ? -4.102  -3.428  -12.839 1.00 0.00 ? 37 PRO B HB2  5  
ATOM 9402  H HB3  . PRO B 1 37 ? -5.185  -4.248  -11.707 1.00 0.00 ? 37 PRO B HB3  5  
ATOM 9403  H HG2  . PRO B 1 37 ? -3.851  -1.581  -11.457 1.00 0.00 ? 37 PRO B HG2  5  
ATOM 9404  H HG3  . PRO B 1 37 ? -5.514  -2.042  -11.053 1.00 0.00 ? 37 PRO B HG3  5  
ATOM 9405  H HD2  . PRO B 1 37 ? -3.499  -1.819  -9.207  1.00 0.00 ? 37 PRO B HD2  5  
ATOM 9406  H HD3  . PRO B 1 37 ? -4.914  -2.871  -9.004  1.00 0.00 ? 37 PRO B HD3  5  
ATOM 9407  N N    . LYS B 1 38 ? -1.427  -4.602  -12.859 1.00 0.00 ? 38 LYS B N    5  
ATOM 9408  C CA   . LYS B 1 38 ? -0.205  -4.290  -13.592 1.00 0.00 ? 38 LYS B CA   5  
ATOM 9409  C C    . LYS B 1 38 ? -0.488  -3.353  -14.766 1.00 0.00 ? 38 LYS B C    5  
ATOM 9410  O O    . LYS B 1 38 ? 0.241   -3.353  -15.758 1.00 0.00 ? 38 LYS B O    5  
ATOM 9411  C CB   . LYS B 1 38 ? 0.451   -5.579  -14.096 1.00 0.00 ? 38 LYS B CB   5  
ATOM 9412  C CG   . LYS B 1 38 ? 1.815   -5.848  -13.477 1.00 0.00 ? 38 LYS B CG   5  
ATOM 9413  C CD   . LYS B 1 38 ? 2.877   -6.072  -14.541 1.00 0.00 ? 38 LYS B CD   5  
ATOM 9414  C CE   . LYS B 1 38 ? 4.239   -6.336  -13.921 1.00 0.00 ? 38 LYS B CE   5  
ATOM 9415  N NZ   . LYS B 1 38 ? 5.043   -7.292  -14.732 1.00 0.00 ? 38 LYS B NZ   5  
ATOM 9416  H H    . LYS B 1 38 ? -1.970  -5.369  -13.138 1.00 0.00 ? 38 LYS B H    5  
ATOM 9417  H HA   . LYS B 1 38 ? 0.472   -3.797  -12.911 1.00 0.00 ? 38 LYS B HA   5  
ATOM 9418  H HB2  . LYS B 1 38 ? -0.195  -6.412  -13.864 1.00 0.00 ? 38 LYS B HB2  5  
ATOM 9419  H HB3  . LYS B 1 38 ? 0.571   -5.515  -15.168 1.00 0.00 ? 38 LYS B HB3  5  
ATOM 9420  H HG2  . LYS B 1 38 ? 2.099   -4.999  -12.873 1.00 0.00 ? 38 LYS B HG2  5  
ATOM 9421  H HG3  . LYS B 1 38 ? 1.749   -6.729  -12.856 1.00 0.00 ? 38 LYS B HG3  5  
ATOM 9422  H HD2  . LYS B 1 38 ? 2.596   -6.922  -15.144 1.00 0.00 ? 38 LYS B HD2  5  
ATOM 9423  H HD3  . LYS B 1 38 ? 2.940   -5.191  -15.164 1.00 0.00 ? 38 LYS B HD3  5  
ATOM 9424  H HE2  . LYS B 1 38 ? 4.775   -5.402  -13.847 1.00 0.00 ? 38 LYS B HE2  5  
ATOM 9425  H HE3  . LYS B 1 38 ? 4.096   -6.748  -12.932 1.00 0.00 ? 38 LYS B HE3  5  
ATOM 9426  H HZ1  . LYS B 1 38 ? 4.927   -8.258  -14.365 1.00 0.00 ? 38 LYS B HZ1  5  
ATOM 9427  H HZ2  . LYS B 1 38 ? 6.050   -7.037  -14.692 1.00 0.00 ? 38 LYS B HZ2  5  
ATOM 9428  H HZ3  . LYS B 1 38 ? 4.731   -7.269  -15.724 1.00 0.00 ? 38 LYS B HZ3  5  
ATOM 9429  N N    . GLU B 1 39 ? -1.547  -2.555  -14.650 1.00 0.00 ? 39 GLU B N    5  
ATOM 9430  C CA   . GLU B 1 39 ? -1.915  -1.618  -15.704 1.00 0.00 ? 39 GLU B CA   5  
ATOM 9431  C C    . GLU B 1 39 ? -1.577  -0.185  -15.299 1.00 0.00 ? 39 GLU B C    5  
ATOM 9432  O O    . GLU B 1 39 ? -1.101  0.604   -16.115 1.00 0.00 ? 39 GLU B O    5  
ATOM 9433  C CB   . GLU B 1 39 ? -3.409  -1.737  -16.021 1.00 0.00 ? 39 GLU B CB   5  
ATOM 9434  C CG   . GLU B 1 39 ? -3.697  -2.066  -17.476 1.00 0.00 ? 39 GLU B CG   5  
ATOM 9435  C CD   . GLU B 1 39 ? -3.895  -3.551  -17.709 1.00 0.00 ? 39 GLU B CD   5  
ATOM 9436  O OE1  . GLU B 1 39 ? -4.272  -4.258  -16.751 1.00 0.00 ? 39 GLU B OE1  5  
ATOM 9437  O OE2  . GLU B 1 39 ? -3.673  -4.008  -18.851 1.00 0.00 ? 39 GLU B OE2  5  
ATOM 9438  H H    . GLU B 1 39 ? -2.093  -2.596  -13.839 1.00 0.00 ? 39 GLU B H    5  
ATOM 9439  H HA   . GLU B 1 39 ? -1.348  -1.873  -16.587 1.00 0.00 ? 39 GLU B HA   5  
ATOM 9440  H HB2  . GLU B 1 39 ? -3.833  -2.517  -15.407 1.00 0.00 ? 39 GLU B HB2  5  
ATOM 9441  H HB3  . GLU B 1 39 ? -3.894  -0.801  -15.783 1.00 0.00 ? 39 GLU B HB3  5  
ATOM 9442  H HG2  . GLU B 1 39 ? -4.594  -1.548  -17.778 1.00 0.00 ? 39 GLU B HG2  5  
ATOM 9443  H HG3  . GLU B 1 39 ? -2.867  -1.729  -18.079 1.00 0.00 ? 39 GLU B HG3  5  
ATOM 9444  N N    . VAL B 1 40 ? -1.825  0.143   -14.034 1.00 0.00 ? 40 VAL B N    5  
ATOM 9445  C CA   . VAL B 1 40 ? -1.543  1.480   -13.524 1.00 0.00 ? 40 VAL B CA   5  
ATOM 9446  C C    . VAL B 1 40 ? -0.072  1.617   -13.142 1.00 0.00 ? 40 VAL B C    5  
ATOM 9447  O O    . VAL B 1 40 ? 0.585   0.633   -12.804 1.00 0.00 ? 40 VAL B O    5  
ATOM 9448  C CB   . VAL B 1 40 ? -2.419  1.818   -12.299 1.00 0.00 ? 40 VAL B CB   5  
ATOM 9449  C CG1  . VAL B 1 40 ? -2.362  3.307   -11.998 1.00 0.00 ? 40 VAL B CG1  5  
ATOM 9450  C CG2  . VAL B 1 40 ? -3.855  1.370   -12.527 1.00 0.00 ? 40 VAL B CG2  5  
ATOM 9451  H H    . VAL B 1 40 ? -2.203  -0.530  -13.430 1.00 0.00 ? 40 VAL B H    5  
ATOM 9452  H HA   . VAL B 1 40 ? -1.768  2.189   -14.308 1.00 0.00 ? 40 VAL B HA   5  
ATOM 9453  H HB   . VAL B 1 40 ? -2.030  1.287   -11.443 1.00 0.00 ? 40 VAL B HB   5  
ATOM 9454  H HG11 . VAL B 1 40 ? -2.815  3.857   -12.810 1.00 0.00 ? 40 VAL B HG11 5  
ATOM 9455  H HG12 . VAL B 1 40 ? -1.332  3.613   -11.887 1.00 0.00 ? 40 VAL B HG12 5  
ATOM 9456  H HG13 . VAL B 1 40 ? -2.898  3.510   -11.082 1.00 0.00 ? 40 VAL B HG13 5  
ATOM 9457  H HG21 . VAL B 1 40 ? -3.946  0.320   -12.290 1.00 0.00 ? 40 VAL B HG21 5  
ATOM 9458  H HG22 . VAL B 1 40 ? -4.123  1.531   -13.561 1.00 0.00 ? 40 VAL B HG22 5  
ATOM 9459  H HG23 . VAL B 1 40 ? -4.515  1.941   -11.891 1.00 0.00 ? 40 VAL B HG23 5  
ATOM 9460  N N    . SER B 1 41 ? 0.441   2.842   -13.204 1.00 0.00 ? 41 SER B N    5  
ATOM 9461  C CA   . SER B 1 41 ? 1.836   3.103   -12.869 1.00 0.00 ? 41 SER B CA   5  
ATOM 9462  C C    . SER B 1 41 ? 2.119   2.782   -11.405 1.00 0.00 ? 41 SER B C    5  
ATOM 9463  O O    . SER B 1 41 ? 1.840   3.589   -10.518 1.00 0.00 ? 41 SER B O    5  
ATOM 9464  C CB   . SER B 1 41 ? 2.186   4.564   -13.159 1.00 0.00 ? 41 SER B CB   5  
ATOM 9465  O OG   . SER B 1 41 ? 1.431   5.063   -14.249 1.00 0.00 ? 41 SER B OG   5  
ATOM 9466  H H    . SER B 1 41 ? -0.131  3.587   -13.483 1.00 0.00 ? 41 SER B H    5  
ATOM 9467  H HA   . SER B 1 41 ? 2.450   2.467   -13.489 1.00 0.00 ? 41 SER B HA   5  
ATOM 9468  H HB2  . SER B 1 41 ? 1.973   5.163   -12.286 1.00 0.00 ? 41 SER B HB2  5  
ATOM 9469  H HB3  . SER B 1 41 ? 3.236   4.639   -13.399 1.00 0.00 ? 41 SER B HB3  5  
ATOM 9470  H HG   . SER B 1 41 ? 1.468   6.022   -14.252 1.00 0.00 ? 41 SER B HG   5  
ATOM 9471  N N    . VAL B 1 42 ? 2.677   1.601   -11.158 1.00 0.00 ? 42 VAL B N    5  
ATOM 9472  C CA   . VAL B 1 42 ? 3.000   1.179   -9.801  1.00 0.00 ? 42 VAL B CA   5  
ATOM 9473  C C    . VAL B 1 42 ? 4.488   0.858   -9.664  1.00 0.00 ? 42 VAL B C    5  
ATOM 9474  O O    . VAL B 1 42 ? 5.006   -0.020  -10.353 1.00 0.00 ? 42 VAL B O    5  
ATOM 9475  C CB   . VAL B 1 42 ? 2.179   -0.060  -9.392  1.00 0.00 ? 42 VAL B CB   5  
ATOM 9476  C CG1  . VAL B 1 42 ? 2.509   -1.245  -10.288 1.00 0.00 ? 42 VAL B CG1  5  
ATOM 9477  C CG2  . VAL B 1 42 ? 2.421   -0.404  -7.929  1.00 0.00 ? 42 VAL B CG2  5  
ATOM 9478  H H    . VAL B 1 42 ? 2.881   1.001   -11.906 1.00 0.00 ? 42 VAL B H    5  
ATOM 9479  H HA   . VAL B 1 42 ? 2.749   1.988   -9.132  1.00 0.00 ? 42 VAL B HA   5  
ATOM 9480  H HB   . VAL B 1 42 ? 1.132   0.172   -9.515  1.00 0.00 ? 42 VAL B HB   5  
ATOM 9481  H HG11 . VAL B 1 42 ? 1.757   -2.011  -10.163 1.00 0.00 ? 42 VAL B HG11 5  
ATOM 9482  H HG12 . VAL B 1 42 ? 3.476   -1.643  -10.018 1.00 0.00 ? 42 VAL B HG12 5  
ATOM 9483  H HG13 . VAL B 1 42 ? 2.526   -0.923  -11.319 1.00 0.00 ? 42 VAL B HG13 5  
ATOM 9484  H HG21 . VAL B 1 42 ? 1.534   -0.861  -7.515  1.00 0.00 ? 42 VAL B HG21 5  
ATOM 9485  H HG22 . VAL B 1 42 ? 2.652   0.497   -7.381  1.00 0.00 ? 42 VAL B HG22 5  
ATOM 9486  H HG23 . VAL B 1 42 ? 3.250   -1.094  -7.854  1.00 0.00 ? 42 VAL B HG23 5  
ATOM 9487  N N    . HIS B 1 43 ? 5.170   1.568   -8.768  1.00 0.00 ? 43 HIS B N    5  
ATOM 9488  C CA   . HIS B 1 43 ? 6.594   1.349   -8.541  1.00 0.00 ? 43 HIS B CA   5  
ATOM 9489  C C    . HIS B 1 43 ? 6.875   1.150   -7.055  1.00 0.00 ? 43 HIS B C    5  
ATOM 9490  O O    . HIS B 1 43 ? 6.348   1.878   -6.215  1.00 0.00 ? 43 HIS B O    5  
ATOM 9491  C CB   . HIS B 1 43 ? 7.406   2.531   -9.073  1.00 0.00 ? 43 HIS B CB   5  
ATOM 9492  C CG   . HIS B 1 43 ? 7.370   2.658   -10.565 1.00 0.00 ? 43 HIS B CG   5  
ATOM 9493  N ND1  . HIS B 1 43 ? 8.506   2.733   -11.342 1.00 0.00 ? 43 HIS B ND1  5  
ATOM 9494  C CD2  . HIS B 1 43 ? 6.325   2.724   -11.425 1.00 0.00 ? 43 HIS B CD2  5  
ATOM 9495  C CE1  . HIS B 1 43 ? 8.165   2.839   -12.614 1.00 0.00 ? 43 HIS B CE1  5  
ATOM 9496  N NE2  . HIS B 1 43 ? 6.847   2.835   -12.691 1.00 0.00 ? 43 HIS B NE2  5  
ATOM 9497  H H    . HIS B 1 43 ? 4.709   2.252   -8.240  1.00 0.00 ? 43 HIS B H    5  
ATOM 9498  H HA   . HIS B 1 43 ? 6.882   0.455   -9.074  1.00 0.00 ? 43 HIS B HA   5  
ATOM 9499  H HB2  . HIS B 1 43 ? 7.015   3.446   -8.653  1.00 0.00 ? 43 HIS B HB2  5  
ATOM 9500  H HB3  . HIS B 1 43 ? 8.437   2.415   -8.773  1.00 0.00 ? 43 HIS B HB3  5  
ATOM 9501  H HD2  . HIS B 1 43 ? 5.277   2.694   -11.163 1.00 0.00 ? 43 HIS B HD2  5  
ATOM 9502  H HE1  . HIS B 1 43 ? 8.847   2.914   -13.447 1.00 0.00 ? 43 HIS B HE1  5  
ATOM 9503  H HE2  . HIS B 1 43 ? 6.330   2.811   -13.523 1.00 0.00 ? 43 HIS B HE2  5  
ATOM 9504  N N    . ARG B 1 44 ? 7.708   0.167   -6.733  1.00 0.00 ? 44 ARG B N    5  
ATOM 9505  C CA   . ARG B 1 44 ? 8.052   -0.111  -5.343  1.00 0.00 ? 44 ARG B CA   5  
ATOM 9506  C C    . ARG B 1 44 ? 9.270   -1.026  -5.250  1.00 0.00 ? 44 ARG B C    5  
ATOM 9507  O O    . ARG B 1 44 ? 10.143  -0.826  -4.405  1.00 0.00 ? 44 ARG B O    5  
ATOM 9508  C CB   . ARG B 1 44 ? 6.864   -0.741  -4.611  1.00 0.00 ? 44 ARG B CB   5  
ATOM 9509  C CG   . ARG B 1 44 ? 6.342   -2.012  -5.263  1.00 0.00 ? 44 ARG B CG   5  
ATOM 9510  C CD   . ARG B 1 44 ? 5.422   -2.782  -4.329  1.00 0.00 ? 44 ARG B CD   5  
ATOM 9511  N NE   . ARG B 1 44 ? 4.115   -3.034  -4.931  1.00 0.00 ? 44 ARG B NE   5  
ATOM 9512  C CZ   . ARG B 1 44 ? 3.875   -4.011  -5.803  1.00 0.00 ? 44 ARG B CZ   5  
ATOM 9513  N NH1  . ARG B 1 44 ? 4.852   -4.825  -6.183  1.00 0.00 ? 44 ARG B NH1  5  
ATOM 9514  N NH2  . ARG B 1 44 ? 2.656   -4.173  -6.298  1.00 0.00 ? 44 ARG B NH2  5  
ATOM 9515  H H    . ARG B 1 44 ? 8.105   -0.382  -7.442  1.00 0.00 ? 44 ARG B H    5  
ATOM 9516  H HA   . ARG B 1 44 ? 8.292   0.830   -4.871  1.00 0.00 ? 44 ARG B HA   5  
ATOM 9517  H HB2  . ARG B 1 44 ? 7.164   -0.979  -3.601  1.00 0.00 ? 44 ARG B HB2  5  
ATOM 9518  H HB3  . ARG B 1 44 ? 6.057   -0.024  -4.576  1.00 0.00 ? 44 ARG B HB3  5  
ATOM 9519  H HG2  . ARG B 1 44 ? 5.794   -1.749  -6.155  1.00 0.00 ? 44 ARG B HG2  5  
ATOM 9520  H HG3  . ARG B 1 44 ? 7.180   -2.641  -5.525  1.00 0.00 ? 44 ARG B HG3  5  
ATOM 9521  H HD2  . ARG B 1 44 ? 5.884   -3.728  -4.088  1.00 0.00 ? 44 ARG B HD2  5  
ATOM 9522  H HD3  . ARG B 1 44 ? 5.286   -2.209  -3.423  1.00 0.00 ? 44 ARG B HD3  5  
ATOM 9523  H HE   . ARG B 1 44 ? 3.376   -2.445  -4.670  1.00 0.00 ? 44 ARG B HE   5  
ATOM 9524  H HH11 . ARG B 1 44 ? 5.774   -4.708  -5.814  1.00 0.00 ? 44 ARG B HH11 5  
ATOM 9525  H HH12 . ARG B 1 44 ? 4.665   -5.557  -6.838  1.00 0.00 ? 44 ARG B HH12 5  
ATOM 9526  H HH21 . ARG B 1 44 ? 1.916   -3.561  -6.016  1.00 0.00 ? 44 ARG B HH21 5  
ATOM 9527  H HH22 . ARG B 1 44 ? 2.475   -4.906  -6.953  1.00 0.00 ? 44 ARG B HH22 5  
ATOM 9528  N N    . GLU B 1 45 ? 9.326   -2.029  -6.121  1.00 0.00 ? 45 GLU B N    5  
ATOM 9529  C CA   . GLU B 1 45 ? 10.440  -2.971  -6.134  1.00 0.00 ? 45 GLU B CA   5  
ATOM 9530  C C    . GLU B 1 45 ? 10.229  -4.050  -7.193  1.00 0.00 ? 45 GLU B C    5  
ATOM 9531  O O    . GLU B 1 45 ? 9.304   -4.860  -7.098  1.00 0.00 ? 45 GLU B O    5  
ATOM 9532  C CB   . GLU B 1 45 ? 10.611  -3.614  -4.754  1.00 0.00 ? 45 GLU B CB   5  
ATOM 9533  C CG   . GLU B 1 45 ? 11.809  -3.084  -3.982  1.00 0.00 ? 45 GLU B CG   5  
ATOM 9534  C CD   . GLU B 1 45 ? 13.060  -3.911  -4.208  1.00 0.00 ? 45 GLU B CD   5  
ATOM 9535  O OE1  . GLU B 1 45 ? 12.963  -5.156  -4.168  1.00 0.00 ? 45 GLU B OE1  5  
ATOM 9536  O OE2  . GLU B 1 45 ? 14.135  -3.314  -4.424  1.00 0.00 ? 45 GLU B OE2  5  
ATOM 9537  H H    . GLU B 1 45 ? 8.601   -2.138  -6.772  1.00 0.00 ? 45 GLU B H    5  
ATOM 9538  H HA   . GLU B 1 45 ? 11.336  -2.419  -6.376  1.00 0.00 ? 45 GLU B HA   5  
ATOM 9539  H HB2  . GLU B 1 45 ? 9.723   -3.427  -4.169  1.00 0.00 ? 45 GLU B HB2  5  
ATOM 9540  H HB3  . GLU B 1 45 ? 10.733  -4.679  -4.876  1.00 0.00 ? 45 GLU B HB3  5  
ATOM 9541  H HG2  . GLU B 1 45 ? 12.005  -2.070  -4.297  1.00 0.00 ? 45 GLU B HG2  5  
ATOM 9542  H HG3  . GLU B 1 45 ? 11.574  -3.093  -2.927  1.00 0.00 ? 45 GLU B HG3  5  
ATOM 9543  N N    . GLU B 1 46 ? 11.098  -4.057  -8.200  1.00 0.00 ? 46 GLU B N    5  
ATOM 9544  C CA   . GLU B 1 46 ? 11.012  -5.037  -9.276  1.00 0.00 ? 46 GLU B CA   5  
ATOM 9545  C C    . GLU B 1 46 ? 11.103  -6.454  -8.723  1.00 0.00 ? 46 GLU B C    5  
ATOM 9546  O O    . GLU B 1 46 ? 10.409  -7.358  -9.186  1.00 0.00 ? 46 GLU B O    5  
ATOM 9547  C CB   . GLU B 1 46 ? 12.126  -4.803  -10.298 1.00 0.00 ? 46 GLU B CB   5  
ATOM 9548  C CG   . GLU B 1 46 ? 12.079  -3.428  -10.945 1.00 0.00 ? 46 GLU B CG   5  
ATOM 9549  C CD   . GLU B 1 46 ? 13.136  -2.490  -10.396 1.00 0.00 ? 46 GLU B CD   5  
ATOM 9550  O OE1  . GLU B 1 46 ? 13.477  -2.613  -9.201  1.00 0.00 ? 46 GLU B OE1  5  
ATOM 9551  O OE2  . GLU B 1 46 ? 13.622  -1.631  -11.162 1.00 0.00 ? 46 GLU B OE2  5  
ATOM 9552  H H    . GLU B 1 46 ? 11.817  -3.392  -8.216  1.00 0.00 ? 46 GLU B H    5  
ATOM 9553  H HA   . GLU B 1 46 ? 10.056  -4.914  -9.763  1.00 0.00 ? 46 GLU B HA   5  
ATOM 9554  H HB2  . GLU B 1 46 ? 13.080  -4.913  -9.805  1.00 0.00 ? 46 GLU B HB2  5  
ATOM 9555  H HB3  . GLU B 1 46 ? 12.045  -5.546  -11.078 1.00 0.00 ? 46 GLU B HB3  5  
ATOM 9556  H HG2  . GLU B 1 46 ? 12.235  -3.539  -12.008 1.00 0.00 ? 46 GLU B HG2  5  
ATOM 9557  H HG3  . GLU B 1 46 ? 11.106  -2.994  -10.768 1.00 0.00 ? 46 GLU B HG3  5  
ATOM 9558  N N    . ILE B 1 47 ? 11.959  -6.637  -7.723  1.00 0.00 ? 47 ILE B N    5  
ATOM 9559  C CA   . ILE B 1 47 ? 12.139  -7.941  -7.099  1.00 0.00 ? 47 ILE B CA   5  
ATOM 9560  C C    . ILE B 1 47 ? 10.901  -8.335  -6.301  1.00 0.00 ? 47 ILE B C    5  
ATOM 9561  O O    . ILE B 1 47 ? 10.453  -9.479  -6.353  1.00 0.00 ? 47 ILE B O    5  
ATOM 9562  C CB   . ILE B 1 47 ? 13.365  -7.951  -6.166  1.00 0.00 ? 47 ILE B CB   5  
ATOM 9563  C CG1  . ILE B 1 47 ? 14.592  -7.397  -6.893  1.00 0.00 ? 47 ILE B CG1  5  
ATOM 9564  C CG2  . ILE B 1 47 ? 13.635  -9.359  -5.656  1.00 0.00 ? 47 ILE B CG2  5  
ATOM 9565  C CD1  . ILE B 1 47 ? 14.948  -8.164  -8.148  1.00 0.00 ? 47 ILE B CD1  5  
ATOM 9566  H H    . ILE B 1 47 ? 12.481  -5.875  -7.394  1.00 0.00 ? 47 ILE B H    5  
ATOM 9567  H HA   . ILE B 1 47 ? 12.299  -8.668  -7.882  1.00 0.00 ? 47 ILE B HA   5  
ATOM 9568  H HB   . ILE B 1 47 ? 13.146  -7.323  -5.315  1.00 0.00 ? 47 ILE B HB   5  
ATOM 9569  H HG12 . ILE B 1 47 ? 14.404  -6.372  -7.174  1.00 0.00 ? 47 ILE B HG12 5  
ATOM 9570  H HG13 . ILE B 1 47 ? 15.442  -7.434  -6.228  1.00 0.00 ? 47 ILE B HG13 5  
ATOM 9571  H HG21 . ILE B 1 47 ? 14.316  -9.314  -4.820  1.00 0.00 ? 47 ILE B HG21 5  
ATOM 9572  H HG22 . ILE B 1 47 ? 14.074  -9.950  -6.447  1.00 0.00 ? 47 ILE B HG22 5  
ATOM 9573  H HG23 . ILE B 1 47 ? 12.707  -9.811  -5.341  1.00 0.00 ? 47 ILE B HG23 5  
ATOM 9574  H HD11 . ILE B 1 47 ? 14.072  -8.256  -8.774  1.00 0.00 ? 47 ILE B HD11 5  
ATOM 9575  H HD12 . ILE B 1 47 ? 15.304  -9.148  -7.880  1.00 0.00 ? 47 ILE B HD12 5  
ATOM 9576  H HD13 . ILE B 1 47 ? 15.721  -7.635  -8.686  1.00 0.00 ? 47 ILE B HD13 5  
ATOM 9577  N N    . TYR B 1 48 ? 10.357  -7.377  -5.558  1.00 0.00 ? 48 TYR B N    5  
ATOM 9578  C CA   . TYR B 1 48 ? 9.172   -7.615  -4.739  1.00 0.00 ? 48 TYR B CA   5  
ATOM 9579  C C    . TYR B 1 48 ? 8.052   -8.256  -5.555  1.00 0.00 ? 48 TYR B C    5  
ATOM 9580  O O    . TYR B 1 48 ? 7.381   -9.174  -5.088  1.00 0.00 ? 48 TYR B O    5  
ATOM 9581  C CB   . TYR B 1 48 ? 8.681   -6.302  -4.124  1.00 0.00 ? 48 TYR B CB   5  
ATOM 9582  C CG   . TYR B 1 48 ? 9.296   -5.994  -2.777  1.00 0.00 ? 48 TYR B CG   5  
ATOM 9583  C CD1  . TYR B 1 48 ? 10.635  -6.266  -2.522  1.00 0.00 ? 48 TYR B CD1  5  
ATOM 9584  C CD2  . TYR B 1 48 ? 8.537   -5.430  -1.759  1.00 0.00 ? 48 TYR B CD2  5  
ATOM 9585  C CE1  . TYR B 1 48 ? 11.198  -5.986  -1.292  1.00 0.00 ? 48 TYR B CE1  5  
ATOM 9586  C CE2  . TYR B 1 48 ? 9.093   -5.146  -0.526  1.00 0.00 ? 48 TYR B CE2  5  
ATOM 9587  C CZ   . TYR B 1 48 ? 10.424  -5.426  -0.298  1.00 0.00 ? 48 TYR B CZ   5  
ATOM 9588  O OH   . TYR B 1 48 ? 10.982  -5.145  0.928   1.00 0.00 ? 48 TYR B OH   5  
ATOM 9589  H H    . TYR B 1 48 ? 10.766  -6.487  -5.554  1.00 0.00 ? 48 TYR B H    5  
ATOM 9590  H HA   . TYR B 1 48 ? 9.451   -8.290  -3.944  1.00 0.00 ? 48 TYR B HA   5  
ATOM 9591  H HB2  . TYR B 1 48 ? 8.921   -5.487  -4.791  1.00 0.00 ? 48 TYR B HB2  5  
ATOM 9592  H HB3  . TYR B 1 48 ? 7.609   -6.350  -3.996  1.00 0.00 ? 48 TYR B HB3  5  
ATOM 9593  H HD1  . TYR B 1 48 ? 11.239  -6.705  -3.303  1.00 0.00 ? 48 TYR B HD1  5  
ATOM 9594  H HD2  . TYR B 1 48 ? 7.494   -5.213  -1.940  1.00 0.00 ? 48 TYR B HD2  5  
ATOM 9595  H HE1  . TYR B 1 48 ? 12.241  -6.205  -1.114  1.00 0.00 ? 48 TYR B HE1  5  
ATOM 9596  H HE2  . TYR B 1 48 ? 8.487   -4.708  0.252   1.00 0.00 ? 48 TYR B HE2  5  
ATOM 9597  H HH   . TYR B 1 48 ? 10.629  -4.316  1.258   1.00 0.00 ? 48 TYR B HH   5  
ATOM 9598  N N    . GLN B 1 49 ? 7.848   -7.763  -6.772  1.00 0.00 ? 49 GLN B N    5  
ATOM 9599  C CA   . GLN B 1 49 ? 6.799   -8.291  -7.640  1.00 0.00 ? 49 GLN B CA   5  
ATOM 9600  C C    . GLN B 1 49 ? 7.300   -9.473  -8.470  1.00 0.00 ? 49 GLN B C    5  
ATOM 9601  O O    . GLN B 1 49 ? 6.747   -10.570 -8.401  1.00 0.00 ? 49 GLN B O    5  
ATOM 9602  C CB   . GLN B 1 49 ? 6.279   -7.191  -8.568  1.00 0.00 ? 49 GLN B CB   5  
ATOM 9603  C CG   . GLN B 1 49 ? 4.785   -7.273  -8.831  1.00 0.00 ? 49 GLN B CG   5  
ATOM 9604  C CD   . GLN B 1 49 ? 4.282   -6.136  -9.699  1.00 0.00 ? 49 GLN B CD   5  
ATOM 9605  O OE1  . GLN B 1 49 ? 4.832   -5.034  -9.678  1.00 0.00 ? 49 GLN B OE1  5  
ATOM 9606  N NE2  . GLN B 1 49 ? 3.232   -6.397  -10.468 1.00 0.00 ? 49 GLN B NE2  5  
ATOM 9607  H H    . GLN B 1 49 ? 8.411   -7.023  -7.092  1.00 0.00 ? 49 GLN B H    5  
ATOM 9608  H HA   . GLN B 1 49 ? 5.988   -8.628  -7.010  1.00 0.00 ? 49 GLN B HA   5  
ATOM 9609  H HB2  . GLN B 1 49 ? 6.492   -6.230  -8.123  1.00 0.00 ? 49 GLN B HB2  5  
ATOM 9610  H HB3  . GLN B 1 49 ? 6.794   -7.261  -9.515  1.00 0.00 ? 49 GLN B HB3  5  
ATOM 9611  H HG2  . GLN B 1 49 ? 4.571   -8.207  -9.330  1.00 0.00 ? 49 GLN B HG2  5  
ATOM 9612  H HG3  . GLN B 1 49 ? 4.263   -7.244  -7.886  1.00 0.00 ? 49 GLN B HG3  5  
ATOM 9613  H HE21 . GLN B 1 49 ? 2.845   -7.297  -10.433 1.00 0.00 ? 49 GLN B HE21 5  
ATOM 9614  H HE22 . GLN B 1 49 ? 2.886   -5.680  -11.039 1.00 0.00 ? 49 GLN B HE22 5  
ATOM 9615  N N    . ARG B 1 50 ? 8.337   -9.237  -9.266  1.00 0.00 ? 50 ARG B N    5  
ATOM 9616  C CA   . ARG B 1 50 ? 8.904   -10.274 -10.127 1.00 0.00 ? 50 ARG B CA   5  
ATOM 9617  C C    . ARG B 1 50 ? 9.238   -11.552 -9.356  1.00 0.00 ? 50 ARG B C    5  
ATOM 9618  O O    . ARG B 1 50 ? 9.354   -12.623 -9.951  1.00 0.00 ? 50 ARG B O    5  
ATOM 9619  C CB   . ARG B 1 50 ? 10.161  -9.752  -10.824 1.00 0.00 ? 50 ARG B CB   5  
ATOM 9620  C CG   . ARG B 1 50 ? 9.880   -8.678  -11.864 1.00 0.00 ? 50 ARG B CG   5  
ATOM 9621  C CD   . ARG B 1 50 ? 10.085  -9.201  -13.277 1.00 0.00 ? 50 ARG B CD   5  
ATOM 9622  N NE   . ARG B 1 50 ? 11.422  -8.901  -13.784 1.00 0.00 ? 50 ARG B NE   5  
ATOM 9623  C CZ   . ARG B 1 50 ? 12.001  -9.558  -14.786 1.00 0.00 ? 50 ARG B CZ   5  
ATOM 9624  N NH1  . ARG B 1 50 ? 11.365  -10.552 -15.394 1.00 0.00 ? 50 ARG B NH1  5  
ATOM 9625  N NH2  . ARG B 1 50 ? 13.220  -9.220  -15.182 1.00 0.00 ? 50 ARG B NH2  5  
ATOM 9626  H H    . ARG B 1 50 ? 8.725   -8.337  -9.290  1.00 0.00 ? 50 ARG B H    5  
ATOM 9627  H HA   . ARG B 1 50 ? 8.167   -10.511 -10.880 1.00 0.00 ? 50 ARG B HA   5  
ATOM 9628  H HB2  . ARG B 1 50 ? 10.826  -9.338  -10.080 1.00 0.00 ? 50 ARG B HB2  5  
ATOM 9629  H HB3  . ARG B 1 50 ? 10.655  -10.578 -11.315 1.00 0.00 ? 50 ARG B HB3  5  
ATOM 9630  H HG2  . ARG B 1 50 ? 8.858   -8.346  -11.758 1.00 0.00 ? 50 ARG B HG2  5  
ATOM 9631  H HG3  . ARG B 1 50 ? 10.550  -7.846  -11.697 1.00 0.00 ? 50 ARG B HG3  5  
ATOM 9632  H HD2  . ARG B 1 50 ? 9.944   -10.272 -13.274 1.00 0.00 ? 50 ARG B HD2  5  
ATOM 9633  H HD3  . ARG B 1 50 ? 9.352   -8.744  -13.926 1.00 0.00 ? 50 ARG B HD3  5  
ATOM 9634  H HE   . ARG B 1 50 ? 11.915  -8.171  -13.355 1.00 0.00 ? 50 ARG B HE   5  
ATOM 9635  H HH11 . ARG B 1 50 ? 10.445  -10.812 -15.102 1.00 0.00 ? 50 ARG B HH11 5  
ATOM 9636  H HH12 . ARG B 1 50 ? 11.806  -11.041 -16.146 1.00 0.00 ? 50 ARG B HH12 5  
ATOM 9637  H HH21 . ARG B 1 50 ? 13.704  -8.472  -14.728 1.00 0.00 ? 50 ARG B HH21 5  
ATOM 9638  H HH22 . ARG B 1 50 ? 13.656  -9.714  -15.935 1.00 0.00 ? 50 ARG B HH22 5  
ATOM 9639  N N    . ILE B 1 51 ? 9.407   -11.441 -8.042  1.00 0.00 ? 51 ILE B N    5  
ATOM 9640  C CA   . ILE B 1 51 ? 9.741   -12.602 -7.221  1.00 0.00 ? 51 ILE B CA   5  
ATOM 9641  C C    . ILE B 1 51 ? 8.549   -13.075 -6.393  1.00 0.00 ? 51 ILE B C    5  
ATOM 9642  O O    . ILE B 1 51 ? 8.217   -14.261 -6.391  1.00 0.00 ? 51 ILE B O    5  
ATOM 9643  C CB   . ILE B 1 51 ? 10.923  -12.300 -6.276  1.00 0.00 ? 51 ILE B CB   5  
ATOM 9644  C CG1  . ILE B 1 51 ? 12.112  -11.750 -7.068  1.00 0.00 ? 51 ILE B CG1  5  
ATOM 9645  C CG2  . ILE B 1 51 ? 11.326  -13.552 -5.511  1.00 0.00 ? 51 ILE B CG2  5  
ATOM 9646  C CD1  . ILE B 1 51 ? 12.561  -12.657 -8.193  1.00 0.00 ? 51 ILE B CD1  5  
ATOM 9647  H H    . ILE B 1 51 ? 9.314   -10.563 -7.617  1.00 0.00 ? 51 ILE B H    5  
ATOM 9648  H HA   . ILE B 1 51 ? 10.040  -13.400 -7.886  1.00 0.00 ? 51 ILE B HA   5  
ATOM 9649  H HB   . ILE B 1 51 ? 10.602  -11.559 -5.560  1.00 0.00 ? 51 ILE B HB   5  
ATOM 9650  H HG12 . ILE B 1 51 ? 11.841  -10.798 -7.498  1.00 0.00 ? 51 ILE B HG12 5  
ATOM 9651  H HG13 . ILE B 1 51 ? 12.948  -11.613 -6.398  1.00 0.00 ? 51 ILE B HG13 5  
ATOM 9652  H HG21 . ILE B 1 51 ? 10.451  -13.995 -5.058  1.00 0.00 ? 51 ILE B HG21 5  
ATOM 9653  H HG22 . ILE B 1 51 ? 12.036  -13.290 -4.740  1.00 0.00 ? 51 ILE B HG22 5  
ATOM 9654  H HG23 . ILE B 1 51 ? 11.778  -14.260 -6.190  1.00 0.00 ? 51 ILE B HG23 5  
ATOM 9655  H HD11 . ILE B 1 51 ? 13.321  -12.159 -8.777  1.00 0.00 ? 51 ILE B HD11 5  
ATOM 9656  H HD12 . ILE B 1 51 ? 11.717  -12.890 -8.826  1.00 0.00 ? 51 ILE B HD12 5  
ATOM 9657  H HD13 . ILE B 1 51 ? 12.965  -13.570 -7.781  1.00 0.00 ? 51 ILE B HD13 5  
ATOM 9658  N N    . GLN B 1 52 ? 7.916   -12.151 -5.681  1.00 0.00 ? 52 GLN B N    5  
ATOM 9659  C CA   . GLN B 1 52 ? 6.770   -12.490 -4.842  1.00 0.00 ? 52 GLN B CA   5  
ATOM 9660  C C    . GLN B 1 52 ? 5.515   -12.713 -5.681  1.00 0.00 ? 52 GLN B C    5  
ATOM 9661  O O    . GLN B 1 52 ? 4.917   -13.788 -5.644  1.00 0.00 ? 52 GLN B O    5  
ATOM 9662  C CB   . GLN B 1 52 ? 6.520   -11.390 -3.809  1.00 0.00 ? 52 GLN B CB   5  
ATOM 9663  C CG   . GLN B 1 52 ? 6.011   -11.913 -2.476  1.00 0.00 ? 52 GLN B CG   5  
ATOM 9664  C CD   . GLN B 1 52 ? 4.770   -12.771 -2.622  1.00 0.00 ? 52 GLN B CD   5  
ATOM 9665  O OE1  . GLN B 1 52 ? 4.857   -13.967 -2.900  1.00 0.00 ? 52 GLN B OE1  5  
ATOM 9666  N NE2  . GLN B 1 52 ? 3.605   -12.162 -2.436  1.00 0.00 ? 52 GLN B NE2  5  
ATOM 9667  H H    . GLN B 1 52 ? 8.229   -11.223 -5.713  1.00 0.00 ? 52 GLN B H    5  
ATOM 9668  H HA   . GLN B 1 52 ? 7.005   -13.407 -4.323  1.00 0.00 ? 52 GLN B HA   5  
ATOM 9669  H HB2  . GLN B 1 52 ? 7.445   -10.861 -3.634  1.00 0.00 ? 52 GLN B HB2  5  
ATOM 9670  H HB3  . GLN B 1 52 ? 5.790   -10.700 -4.204  1.00 0.00 ? 52 GLN B HB3  5  
ATOM 9671  H HG2  . GLN B 1 52 ? 6.787   -12.506 -2.016  1.00 0.00 ? 52 GLN B HG2  5  
ATOM 9672  H HG3  . GLN B 1 52 ? 5.777   -11.072 -1.840  1.00 0.00 ? 52 GLN B HG3  5  
ATOM 9673  H HE21 . GLN B 1 52 ? 3.612   -11.206 -2.218  1.00 0.00 ? 52 GLN B HE21 5  
ATOM 9674  H HE22 . GLN B 1 52 ? 2.786   -12.692 -2.524  1.00 0.00 ? 52 GLN B HE22 5  
ATOM 9675  N N    . ALA B 1 53 ? 5.118   -11.693 -6.436  1.00 0.00 ? 53 ALA B N    5  
ATOM 9676  C CA   . ALA B 1 53 ? 3.934   -11.784 -7.279  1.00 0.00 ? 53 ALA B CA   5  
ATOM 9677  C C    . ALA B 1 53 ? 4.140   -12.782 -8.413  1.00 0.00 ? 53 ALA B C    5  
ATOM 9678  O O    . ALA B 1 53 ? 3.189   -13.407 -8.884  1.00 0.00 ? 53 ALA B O    5  
ATOM 9679  C CB   . ALA B 1 53 ? 3.577   -10.414 -7.838  1.00 0.00 ? 53 ALA B CB   5  
ATOM 9680  H H    . ALA B 1 53 ? 5.631   -10.860 -6.428  1.00 0.00 ? 53 ALA B H    5  
ATOM 9681  H HA   . ALA B 1 53 ? 3.114   -12.119 -6.663  1.00 0.00 ? 53 ALA B HA   5  
ATOM 9682  H HB1  . ALA B 1 53 ? 3.837   -10.372 -8.886  1.00 0.00 ? 53 ALA B HB1  5  
ATOM 9683  H HB2  . ALA B 1 53 ? 4.123   -9.653  -7.302  1.00 0.00 ? 53 ALA B HB2  5  
ATOM 9684  H HB3  . ALA B 1 53 ? 2.516   -10.245 -7.724  1.00 0.00 ? 53 ALA B HB3  5  
ATOM 9685  N N    . GLU B 1 54 ? 5.387   -12.927 -8.848  1.00 0.00 ? 54 GLU B N    5  
ATOM 9686  C CA   . GLU B 1 54 ? 5.718   -13.849 -9.927  1.00 0.00 ? 54 GLU B CA   5  
ATOM 9687  C C    . GLU B 1 54 ? 7.003   -14.610 -9.617  1.00 0.00 ? 54 GLU B C    5  
ATOM 9688  O O    . GLU B 1 54 ? 7.829   -14.154 -8.828  1.00 0.00 ? 54 GLU B O    5  
ATOM 9689  C CB   . GLU B 1 54 ? 5.864   -13.088 -11.248 1.00 0.00 ? 54 GLU B CB   5  
ATOM 9690  C CG   . GLU B 1 54 ? 5.146   -13.749 -12.413 1.00 0.00 ? 54 GLU B CG   5  
ATOM 9691  C CD   . GLU B 1 54 ? 4.443   -12.747 -13.309 1.00 0.00 ? 54 GLU B CD   5  
ATOM 9692  O OE1  . GLU B 1 54 ? 5.130   -11.867 -13.869 1.00 0.00 ? 54 GLU B OE1  5  
ATOM 9693  O OE2  . GLU B 1 54 ? 3.205   -12.842 -13.449 1.00 0.00 ? 54 GLU B OE2  5  
ATOM 9694  H H    . GLU B 1 54 ? 6.101   -12.401 -8.431  1.00 0.00 ? 54 GLU B H    5  
ATOM 9695  H HA   . GLU B 1 54 ? 4.907   -14.557 -10.018 1.00 0.00 ? 54 GLU B HA   5  
ATOM 9696  H HB2  . GLU B 1 54 ? 5.461   -12.094 -11.123 1.00 0.00 ? 54 GLU B HB2  5  
ATOM 9697  H HB3  . GLU B 1 54 ? 6.912   -13.014 -11.495 1.00 0.00 ? 54 GLU B HB3  5  
ATOM 9698  H HG2  . GLU B 1 54 ? 5.869   -14.291 -13.005 1.00 0.00 ? 54 GLU B HG2  5  
ATOM 9699  H HG3  . GLU B 1 54 ? 4.411   -14.439 -12.023 1.00 0.00 ? 54 GLU B HG3  5  
ATOM 9700  N N    . LYS B 1 55 ? 7.163   -15.772 -10.238 1.00 0.00 ? 55 LYS B N    5  
ATOM 9701  C CA   . LYS B 1 55 ? 8.348   -16.594 -10.026 1.00 0.00 ? 55 LYS B CA   5  
ATOM 9702  C C    . LYS B 1 55 ? 9.415   -16.284 -11.070 1.00 0.00 ? 55 LYS B C    5  
ATOM 9703  O O    . LYS B 1 55 ? 9.539   -16.988 -12.072 1.00 0.00 ? 55 LYS B O    5  
ATOM 9704  C CB   . LYS B 1 55 ? 7.982   -18.078 -10.078 1.00 0.00 ? 55 LYS B CB   5  
ATOM 9705  C CG   . LYS B 1 55 ? 7.129   -18.453 -11.281 1.00 0.00 ? 55 LYS B CG   5  
ATOM 9706  C CD   . LYS B 1 55 ? 7.373   -19.890 -11.715 1.00 0.00 ? 55 LYS B CD   5  
ATOM 9707  C CE   . LYS B 1 55 ? 7.969   -19.958 -13.112 1.00 0.00 ? 55 LYS B CE   5  
ATOM 9708  N NZ   . LYS B 1 55 ? 8.090   -21.361 -13.597 1.00 0.00 ? 55 LYS B NZ   5  
ATOM 9709  H H    . LYS B 1 55 ? 6.466   -16.086 -10.851 1.00 0.00 ? 55 LYS B H    5  
ATOM 9710  H HA   . LYS B 1 55 ? 8.741   -16.363 -9.047  1.00 0.00 ? 55 LYS B HA   5  
ATOM 9711  H HB2  . LYS B 1 55 ? 8.891   -18.661 -10.113 1.00 0.00 ? 55 LYS B HB2  5  
ATOM 9712  H HB3  . LYS B 1 55 ? 7.435   -18.334 -9.183  1.00 0.00 ? 55 LYS B HB3  5  
ATOM 9713  H HG2  . LYS B 1 55 ? 6.088   -18.339 -11.020 1.00 0.00 ? 55 LYS B HG2  5  
ATOM 9714  H HG3  . LYS B 1 55 ? 7.371   -17.791 -12.100 1.00 0.00 ? 55 LYS B HG3  5  
ATOM 9715  H HD2  . LYS B 1 55 ? 8.057   -20.356 -11.021 1.00 0.00 ? 55 LYS B HD2  5  
ATOM 9716  H HD3  . LYS B 1 55 ? 6.433   -20.422 -11.708 1.00 0.00 ? 55 LYS B HD3  5  
ATOM 9717  H HE2  . LYS B 1 55 ? 7.333   -19.407 -13.788 1.00 0.00 ? 55 LYS B HE2  5  
ATOM 9718  H HE3  . LYS B 1 55 ? 8.950   -19.507 -13.094 1.00 0.00 ? 55 LYS B HE3  5  
ATOM 9719  H HZ1  . LYS B 1 55 ? 7.886   -21.406 -14.616 1.00 0.00 ? 55 LYS B HZ1  5  
ATOM 9720  H HZ2  . LYS B 1 55 ? 7.417   -21.973 -13.093 1.00 0.00 ? 55 LYS B HZ2  5  
ATOM 9721  H HZ3  . LYS B 1 55 ? 9.054   -21.715 -13.431 1.00 0.00 ? 55 LYS B HZ3  5  
ATOM 9722  N N    . SER B 1 56 ? 10.183  -15.224 -10.830 1.00 0.00 ? 56 SER B N    5  
ATOM 9723  C CA   . SER B 1 56 ? 11.239  -14.818 -11.754 1.00 0.00 ? 56 SER B CA   5  
ATOM 9724  C C    . SER B 1 56 ? 12.186  -15.976 -12.053 1.00 0.00 ? 56 SER B C    5  
ATOM 9725  O O    . SER B 1 56 ? 12.690  -16.104 -13.169 1.00 0.00 ? 56 SER B O    5  
ATOM 9726  C CB   . SER B 1 56 ? 12.027  -13.641 -11.177 1.00 0.00 ? 56 SER B CB   5  
ATOM 9727  O OG   . SER B 1 56 ? 12.947  -13.129 -12.125 1.00 0.00 ? 56 SER B OG   5  
ATOM 9728  H H    . SER B 1 56 ? 10.033  -14.700 -10.015 1.00 0.00 ? 56 SER B H    5  
ATOM 9729  H HA   . SER B 1 56 ? 10.770  -14.507 -12.675 1.00 0.00 ? 56 SER B HA   5  
ATOM 9730  H HB2  . SER B 1 56 ? 11.342  -12.854 -10.898 1.00 0.00 ? 56 SER B HB2  5  
ATOM 9731  H HB3  . SER B 1 56 ? 12.572  -13.970 -10.304 1.00 0.00 ? 56 SER B HB3  5  
ATOM 9732  H HG   . SER B 1 56 ? 13.249  -12.263 -11.843 1.00 0.00 ? 56 SER B HG   5  
ATOM 9733  N N    . GLN B 1 57 ? 12.428  -16.815 -11.050 1.00 0.00 ? 57 GLN B N    5  
ATOM 9734  C CA   . GLN B 1 57 ? 13.319  -17.960 -11.206 1.00 0.00 ? 57 GLN B CA   5  
ATOM 9735  C C    . GLN B 1 57 ? 14.751  -17.503 -11.468 1.00 0.00 ? 57 GLN B C    5  
ATOM 9736  O O    . GLN B 1 57 ? 15.258  -17.621 -12.585 1.00 0.00 ? 57 GLN B O    5  
ATOM 9737  C CB   . GLN B 1 57 ? 12.840  -18.861 -12.348 1.00 0.00 ? 57 GLN B CB   5  
ATOM 9738  C CG   . GLN B 1 57 ? 11.406  -19.338 -12.185 1.00 0.00 ? 57 GLN B CG   5  
ATOM 9739  C CD   . GLN B 1 57 ? 11.222  -20.784 -12.601 1.00 0.00 ? 57 GLN B CD   5  
ATOM 9740  O OE1  . GLN B 1 57 ? 11.556  -21.168 -13.722 1.00 0.00 ? 57 GLN B OE1  5  
ATOM 9741  N NE2  . GLN B 1 57 ? 10.688  -21.597 -11.696 1.00 0.00 ? 57 GLN B NE2  5  
ATOM 9742  H H    . GLN B 1 57 ? 12.001  -16.659 -10.182 1.00 0.00 ? 57 GLN B H    5  
ATOM 9743  H HA   . GLN B 1 57 ? 13.298  -18.522 -10.284 1.00 0.00 ? 57 GLN B HA   5  
ATOM 9744  H HB2  . GLN B 1 57 ? 12.912  -18.316 -13.277 1.00 0.00 ? 57 GLN B HB2  5  
ATOM 9745  H HB3  . GLN B 1 57 ? 13.481  -19.729 -12.399 1.00 0.00 ? 57 GLN B HB3  5  
ATOM 9746  H HG2  . GLN B 1 57 ? 11.122  -19.238 -11.148 1.00 0.00 ? 57 GLN B HG2  5  
ATOM 9747  H HG3  . GLN B 1 57 ? 10.763  -18.719 -12.795 1.00 0.00 ? 57 GLN B HG3  5  
ATOM 9748  H HE21 . GLN B 1 57 ? 10.446  -21.222 -10.824 1.00 0.00 ? 57 GLN B HE21 5  
ATOM 9749  H HE22 . GLN B 1 57 ? 10.558  -22.537 -11.938 1.00 0.00 ? 57 GLN B HE22 5  
ATOM 9750  N N    . GLN B 1 58 ? 15.399  -16.981 -10.432 1.00 0.00 ? 58 GLN B N    5  
ATOM 9751  C CA   . GLN B 1 58 ? 16.772  -16.505 -10.549 1.00 0.00 ? 58 GLN B CA   5  
ATOM 9752  C C    . GLN B 1 58 ? 17.630  -17.029 -9.401  1.00 0.00 ? 58 GLN B C    5  
ATOM 9753  O O    . GLN B 1 58 ? 18.646  -17.687 -9.622  1.00 0.00 ? 58 GLN B O    5  
ATOM 9754  C CB   . GLN B 1 58 ? 16.805  -14.976 -10.567 1.00 0.00 ? 58 GLN B CB   5  
ATOM 9755  C CG   . GLN B 1 58 ? 18.182  -14.400 -10.855 1.00 0.00 ? 58 GLN B CG   5  
ATOM 9756  C CD   . GLN B 1 58 ? 18.128  -13.192 -11.770 1.00 0.00 ? 58 GLN B CD   5  
ATOM 9757  O OE1  . GLN B 1 58 ? 17.446  -12.209 -11.481 1.00 0.00 ? 58 GLN B OE1  5  
ATOM 9758  N NE2  . GLN B 1 58 ? 18.850  -13.261 -12.883 1.00 0.00 ? 58 GLN B NE2  5  
ATOM 9759  H H    . GLN B 1 58 ? 14.941  -16.913 -9.568  1.00 0.00 ? 58 GLN B H    5  
ATOM 9760  H HA   . GLN B 1 58 ? 17.173  -16.876 -11.480 1.00 0.00 ? 58 GLN B HA   5  
ATOM 9761  H HB2  . GLN B 1 58 ? 16.124  -14.622 -11.328 1.00 0.00 ? 58 GLN B HB2  5  
ATOM 9762  H HB3  . GLN B 1 58 ? 16.478  -14.609 -9.606  1.00 0.00 ? 58 GLN B HB3  5  
ATOM 9763  H HG2  . GLN B 1 58 ? 18.636  -14.104 -9.921  1.00 0.00 ? 58 GLN B HG2  5  
ATOM 9764  H HG3  . GLN B 1 58 ? 18.787  -15.162 -11.323 1.00 0.00 ? 58 GLN B HG3  5  
ATOM 9765  H HE21 . GLN B 1 58 ? 19.369  -14.076 -13.049 1.00 0.00 ? 58 GLN B HE21 5  
ATOM 9766  H HE22 . GLN B 1 58 ? 18.834  -12.494 -13.493 1.00 0.00 ? 58 GLN B HE22 5  
ATOM 9767  N N    . SER B 1 59 ? 17.212  -16.733 -8.175  1.00 0.00 ? 59 SER B N    5  
ATOM 9768  C CA   . SER B 1 59 ? 17.942  -17.174 -6.991  1.00 0.00 ? 59 SER B CA   5  
ATOM 9769  C C    . SER B 1 59 ? 17.844  -18.687 -6.824  1.00 0.00 ? 59 SER B C    5  
ATOM 9770  O O    . SER B 1 59 ? 17.049  -19.345 -7.494  1.00 0.00 ? 59 SER B O    5  
ATOM 9771  C CB   . SER B 1 59 ? 17.401  -16.475 -5.743  1.00 0.00 ? 59 SER B CB   5  
ATOM 9772  O OG   . SER B 1 59 ? 17.204  -15.091 -5.977  1.00 0.00 ? 59 SER B OG   5  
ATOM 9773  H H    . SER B 1 59 ? 16.394  -16.205 -8.062  1.00 0.00 ? 59 SER B H    5  
ATOM 9774  H HA   . SER B 1 59 ? 18.979  -16.905 -7.122  1.00 0.00 ? 59 SER B HA   5  
ATOM 9775  H HB2  . SER B 1 59 ? 16.456  -16.918 -5.466  1.00 0.00 ? 59 SER B HB2  5  
ATOM 9776  H HB3  . SER B 1 59 ? 18.105  -16.594 -4.933  1.00 0.00 ? 59 SER B HB3  5  
ATOM 9777  H HG   . SER B 1 59 ? 17.495  -14.592 -5.211  1.00 0.00 ? 59 SER B HG   5  
ATOM 9778  N N    . SER B 1 60 ? 18.657  -19.231 -5.924  1.00 0.00 ? 60 SER B N    5  
ATOM 9779  C CA   . SER B 1 60 ? 18.662  -20.666 -5.668  1.00 0.00 ? 60 SER B CA   5  
ATOM 9780  C C    . SER B 1 60 ? 17.829  -21.001 -4.435  1.00 0.00 ? 60 SER B C    5  
ATOM 9781  O O    . SER B 1 60 ? 17.880  -20.294 -3.428  1.00 0.00 ? 60 SER B O    5  
ATOM 9782  C CB   . SER B 1 60 ? 20.096  -21.167 -5.481  1.00 0.00 ? 60 SER B CB   5  
ATOM 9783  O OG   . SER B 1 60 ? 20.253  -22.472 -6.010  1.00 0.00 ? 60 SER B OG   5  
ATOM 9784  H H    . SER B 1 60 ? 19.268  -18.653 -5.421  1.00 0.00 ? 60 SER B H    5  
ATOM 9785  H HA   . SER B 1 60 ? 18.228  -21.157 -6.525  1.00 0.00 ? 60 SER B HA   5  
ATOM 9786  H HB2  . SER B 1 60 ? 20.776  -20.502 -5.991  1.00 0.00 ? 60 SER B HB2  5  
ATOM 9787  H HB3  . SER B 1 60 ? 20.333  -21.187 -4.427  1.00 0.00 ? 60 SER B HB3  5  
ATOM 9788  H HG   . SER B 1 60 ? 20.208  -22.438 -6.968  1.00 0.00 ? 60 SER B HG   5  
ATOM 9789  N N    . TYR B 1 61 ? 17.063  -22.084 -4.520  1.00 0.00 ? 61 TYR B N    5  
ATOM 9790  C CA   . TYR B 1 61 ? 16.219  -22.513 -3.411  1.00 0.00 ? 61 TYR B CA   5  
ATOM 9791  C C    . TYR B 1 61 ? 15.197  -21.437 -3.058  1.00 0.00 ? 61 TYR B C    5  
ATOM 9792  O O    . TYR B 1 61 ? 14.093  -21.457 -3.642  1.00 0.00 ? 61 TYR B O    5  
ATOM 9793  C CB   . TYR B 1 61 ? 17.076  -22.840 -2.187  1.00 0.00 ? 61 TYR B CB   5  
ATOM 9794  C CG   . TYR B 1 61 ? 18.025  -23.997 -2.403  1.00 0.00 ? 61 TYR B CG   5  
ATOM 9795  C CD1  . TYR B 1 61 ? 17.554  -25.242 -2.799  1.00 0.00 ? 61 TYR B CD1  5  
ATOM 9796  C CD2  . TYR B 1 61 ? 19.392  -23.844 -2.211  1.00 0.00 ? 61 TYR B CD2  5  
ATOM 9797  C CE1  . TYR B 1 61 ? 18.418  -26.302 -2.997  1.00 0.00 ? 61 TYR B CE1  5  
ATOM 9798  C CE2  . TYR B 1 61 ? 20.263  -24.899 -2.408  1.00 0.00 ? 61 TYR B CE2  5  
ATOM 9799  C CZ   . TYR B 1 61 ? 19.771  -26.126 -2.800  1.00 0.00 ? 61 TYR B CZ   5  
ATOM 9800  O OH   . TYR B 1 61 ? 20.635  -27.178 -2.997  1.00 0.00 ? 61 TYR B OH   5  
ATOM 9801  O OXT  . TYR B 1 61 ? 15.508  -20.585 -2.200  1.00 0.00 ? 61 TYR B OXT  5  
ATOM 9802  H H    . TYR B 1 61 ? 17.065  -22.607 -5.349  1.00 0.00 ? 61 TYR B H    5  
ATOM 9803  H HA   . TYR B 1 61 ? 15.694  -23.404 -3.720  1.00 0.00 ? 61 TYR B HA   5  
ATOM 9804  H HB2  . TYR B 1 61 ? 17.665  -21.973 -1.926  1.00 0.00 ? 61 TYR B HB2  5  
ATOM 9805  H HB3  . TYR B 1 61 ? 16.428  -23.091 -1.360  1.00 0.00 ? 61 TYR B HB3  5  
ATOM 9806  H HD1  . TYR B 1 61 ? 16.493  -25.378 -2.953  1.00 0.00 ? 61 TYR B HD1  5  
ATOM 9807  H HD2  . TYR B 1 61 ? 19.775  -22.882 -1.903  1.00 0.00 ? 61 TYR B HD2  5  
ATOM 9808  H HE1  . TYR B 1 61 ? 18.032  -27.263 -3.305  1.00 0.00 ? 61 TYR B HE1  5  
ATOM 9809  H HE2  . TYR B 1 61 ? 21.323  -24.760 -2.253  1.00 0.00 ? 61 TYR B HE2  5  
ATOM 9810  H HH   . TYR B 1 61 ? 20.375  -27.663 -3.784  1.00 0.00 ? 61 TYR B HH   5  
ATOM 9811  N N    . MET A 1 1  ? -1.458  -11.325 -6.103  1.00 0.00 ? 1  MET A N    6  
ATOM 9812  C CA   . MET A 1 1  ? -0.969  -10.133 -5.362  1.00 0.00 ? 1  MET A CA   6  
ATOM 9813  C C    . MET A 1 1  ? 0.471   -10.323 -4.898  1.00 0.00 ? 1  MET A C    6  
ATOM 9814  O O    . MET A 1 1  ? 1.069   -11.377 -5.114  1.00 0.00 ? 1  MET A O    6  
ATOM 9815  C CB   . MET A 1 1  ? -1.884  -9.899  -4.159  1.00 0.00 ? 1  MET A CB   6  
ATOM 9816  C CG   . MET A 1 1  ? -1.897  -11.053 -3.170  1.00 0.00 ? 1  MET A CG   6  
ATOM 9817  S SD   . MET A 1 1  ? -3.315  -12.144 -3.396  1.00 0.00 ? 1  MET A SD   6  
ATOM 9818  C CE   . MET A 1 1  ? -3.717  -12.533 -1.695  1.00 0.00 ? 1  MET A CE   6  
ATOM 9819  H H1   . MET A 1 1  ? -1.450  -12.131 -5.447  1.00 0.00 ? 1  MET A H1   6  
ATOM 9820  H H2   . MET A 1 1  ? -0.813  -11.485 -6.904  1.00 0.00 ? 1  MET A H2   6  
ATOM 9821  H H3   . MET A 1 1  ? -2.422  -11.120 -6.433  1.00 0.00 ? 1  MET A H3   6  
ATOM 9822  H HA   . MET A 1 1  ? -1.018  -9.276  -6.018  1.00 0.00 ? 1  MET A HA   6  
ATOM 9823  H HB2  . MET A 1 1  ? -1.556  -9.011  -3.638  1.00 0.00 ? 1  MET A HB2  6  
ATOM 9824  H HB3  . MET A 1 1  ? -2.893  -9.745  -4.513  1.00 0.00 ? 1  MET A HB3  6  
ATOM 9825  H HG2  . MET A 1 1  ? -0.994  -11.630 -3.300  1.00 0.00 ? 1  MET A HG2  6  
ATOM 9826  H HG3  . MET A 1 1  ? -1.926  -10.651 -2.168  1.00 0.00 ? 1  MET A HG3  6  
ATOM 9827  H HE1  . MET A 1 1  ? -4.662  -12.080 -1.435  1.00 0.00 ? 1  MET A HE1  6  
ATOM 9828  H HE2  . MET A 1 1  ? -2.943  -12.150 -1.045  1.00 0.00 ? 1  MET A HE2  6  
ATOM 9829  H HE3  . MET A 1 1  ? -3.787  -13.604 -1.577  1.00 0.00 ? 1  MET A HE3  6  
ATOM 9830  N N    . LEU A 1 2  ? 1.022   -9.296  -4.260  1.00 0.00 ? 2  LEU A N    6  
ATOM 9831  C CA   . LEU A 1 2  ? 2.394   -9.349  -3.766  1.00 0.00 ? 2  LEU A CA   6  
ATOM 9832  C C    . LEU A 1 2  ? 2.428   -9.242  -2.244  1.00 0.00 ? 2  LEU A C    6  
ATOM 9833  O O    . LEU A 1 2  ? 2.274   -8.154  -1.689  1.00 0.00 ? 2  LEU A O    6  
ATOM 9834  C CB   . LEU A 1 2  ? 3.221   -8.222  -4.388  1.00 0.00 ? 2  LEU A CB   6  
ATOM 9835  C CG   . LEU A 1 2  ? 4.729   -8.313  -4.148  1.00 0.00 ? 2  LEU A CG   6  
ATOM 9836  C CD1  . LEU A 1 2  ? 5.495   -7.887  -5.391  1.00 0.00 ? 2  LEU A CD1  6  
ATOM 9837  C CD2  . LEU A 1 2  ? 5.132   -7.460  -2.955  1.00 0.00 ? 2  LEU A CD2  6  
ATOM 9838  H H    . LEU A 1 2  ? 0.494   -8.481  -4.119  1.00 0.00 ? 2  LEU A H    6  
ATOM 9839  H HA   . LEU A 1 2  ? 2.817   -10.298 -4.060  1.00 0.00 ? 2  LEU A HA   6  
ATOM 9840  H HB2  . LEU A 1 2  ? 3.045   -8.222  -5.454  1.00 0.00 ? 2  LEU A HB2  6  
ATOM 9841  H HB3  . LEU A 1 2  ? 2.871   -7.283  -3.984  1.00 0.00 ? 2  LEU A HB3  6  
ATOM 9842  H HG   . LEU A 1 2  ? 4.991   -9.339  -3.931  1.00 0.00 ? 2  LEU A HG   6  
ATOM 9843  H HD11 . LEU A 1 2  ? 5.657   -8.745  -6.027  1.00 0.00 ? 2  LEU A HD11 6  
ATOM 9844  H HD12 . LEU A 1 2  ? 6.447   -7.468  -5.102  1.00 0.00 ? 2  LEU A HD12 6  
ATOM 9845  H HD13 . LEU A 1 2  ? 4.924   -7.144  -5.929  1.00 0.00 ? 2  LEU A HD13 6  
ATOM 9846  H HD21 . LEU A 1 2  ? 4.315   -7.417  -2.250  1.00 0.00 ? 2  LEU A HD21 6  
ATOM 9847  H HD22 . LEU A 1 2  ? 5.370   -6.461  -3.291  1.00 0.00 ? 2  LEU A HD22 6  
ATOM 9848  H HD23 . LEU A 1 2  ? 5.997   -7.895  -2.477  1.00 0.00 ? 2  LEU A HD23 6  
ATOM 9849  N N    . ILE A 1 3  ? 2.637   -10.372 -1.573  1.00 0.00 ? 3  ILE A N    6  
ATOM 9850  C CA   . ILE A 1 3  ? 2.695   -10.386 -0.116  1.00 0.00 ? 3  ILE A CA   6  
ATOM 9851  C C    . ILE A 1 3  ? 4.143   -10.363 0.369   1.00 0.00 ? 3  ILE A C    6  
ATOM 9852  O O    . ILE A 1 3  ? 4.854   -11.366 0.302   1.00 0.00 ? 3  ILE A O    6  
ATOM 9853  C CB   . ILE A 1 3  ? 1.956   -11.610 0.472   1.00 0.00 ? 3  ILE A CB   6  
ATOM 9854  C CG1  . ILE A 1 3  ? 1.822   -11.480 1.991   1.00 0.00 ? 3  ILE A CG1  6  
ATOM 9855  C CG2  . ILE A 1 3  ? 2.666   -12.905 0.105   1.00 0.00 ? 3  ILE A CG2  6  
ATOM 9856  C CD1  . ILE A 1 3  ? 0.526   -12.049 2.534   1.00 0.00 ? 3  ILE A CD1  6  
ATOM 9857  H H    . ILE A 1 3  ? 2.759   -11.210 -2.066  1.00 0.00 ? 3  ILE A H    6  
ATOM 9858  H HA   . ILE A 1 3  ? 2.204   -9.495  0.239   1.00 0.00 ? 3  ILE A HA   6  
ATOM 9859  H HB   . ILE A 1 3  ? 0.968   -11.642 0.037   1.00 0.00 ? 3  ILE A HB   6  
ATOM 9860  H HG12 . ILE A 1 3  ? 2.639   -12.004 2.464   1.00 0.00 ? 3  ILE A HG12 6  
ATOM 9861  H HG13 . ILE A 1 3  ? 1.866   -10.434 2.261   1.00 0.00 ? 3  ILE A HG13 6  
ATOM 9862  H HG21 . ILE A 1 3  ? 3.035   -12.840 -0.907  1.00 0.00 ? 3  ILE A HG21 6  
ATOM 9863  H HG22 . ILE A 1 3  ? 1.972   -13.729 0.184   1.00 0.00 ? 3  ILE A HG22 6  
ATOM 9864  H HG23 . ILE A 1 3  ? 3.493   -13.066 0.781   1.00 0.00 ? 3  ILE A HG23 6  
ATOM 9865  H HD11 . ILE A 1 3  ? 0.215   -12.883 1.921   1.00 0.00 ? 3  ILE A HD11 6  
ATOM 9866  H HD12 . ILE A 1 3  ? -0.241  -11.287 2.518   1.00 0.00 ? 3  ILE A HD12 6  
ATOM 9867  H HD13 . ILE A 1 3  ? 0.675   -12.386 3.550   1.00 0.00 ? 3  ILE A HD13 6  
ATOM 9868  N N    . LEU A 1 4  ? 4.566   -9.206  0.867   1.00 0.00 ? 4  LEU A N    6  
ATOM 9869  C CA   . LEU A 1 4  ? 5.919   -9.034  1.380   1.00 0.00 ? 4  LEU A CA   6  
ATOM 9870  C C    . LEU A 1 4  ? 5.896   -8.509  2.812   1.00 0.00 ? 4  LEU A C    6  
ATOM 9871  O O    . LEU A 1 4  ? 5.346   -7.438  3.073   1.00 0.00 ? 4  LEU A O    6  
ATOM 9872  C CB   . LEU A 1 4  ? 6.708   -8.076  0.485   1.00 0.00 ? 4  LEU A CB   6  
ATOM 9873  C CG   . LEU A 1 4  ? 8.220   -8.311  0.457   1.00 0.00 ? 4  LEU A CG   6  
ATOM 9874  C CD1  . LEU A 1 4  ? 8.532   -9.723  -0.012  1.00 0.00 ? 4  LEU A CD1  6  
ATOM 9875  C CD2  . LEU A 1 4  ? 8.900   -7.288  -0.440  1.00 0.00 ? 4  LEU A CD2  6  
ATOM 9876  H H    . LEU A 1 4  ? 3.940   -8.453  0.916   1.00 0.00 ? 4  LEU A H    6  
ATOM 9877  H HA   . LEU A 1 4  ? 6.402   -10.000 1.371   1.00 0.00 ? 4  LEU A HA   6  
ATOM 9878  H HB2  . LEU A 1 4  ? 6.332   -8.166  -0.523  1.00 0.00 ? 4  LEU A HB2  6  
ATOM 9879  H HB3  . LEU A 1 4  ? 6.530   -7.068  0.829   1.00 0.00 ? 4  LEU A HB3  6  
ATOM 9880  H HG   . LEU A 1 4  ? 8.614   -8.196  1.456   1.00 0.00 ? 4  LEU A HG   6  
ATOM 9881  H HD11 . LEU A 1 4  ? 7.889   -9.978  -0.841  1.00 0.00 ? 4  LEU A HD11 6  
ATOM 9882  H HD12 . LEU A 1 4  ? 8.364   -10.417 0.799   1.00 0.00 ? 4  LEU A HD12 6  
ATOM 9883  H HD13 . LEU A 1 4  ? 9.563   -9.779  -0.326  1.00 0.00 ? 4  LEU A HD13 6  
ATOM 9884  H HD21 . LEU A 1 4  ? 9.053   -7.714  -1.421  1.00 0.00 ? 4  LEU A HD21 6  
ATOM 9885  H HD22 . LEU A 1 4  ? 9.855   -7.014  -0.014  1.00 0.00 ? 4  LEU A HD22 6  
ATOM 9886  H HD23 . LEU A 1 4  ? 8.278   -6.409  -0.522  1.00 0.00 ? 4  LEU A HD23 6  
ATOM 9887  N N    . THR A 1 5  ? 6.490   -9.250  3.743   1.00 0.00 ? 5  THR A N    6  
ATOM 9888  C CA   . THR A 1 5  ? 6.521   -8.814  5.135   1.00 0.00 ? 5  THR A CA   6  
ATOM 9889  C C    . THR A 1 5  ? 7.166   -7.442  5.246   1.00 0.00 ? 5  THR A C    6  
ATOM 9890  O O    . THR A 1 5  ? 8.039   -7.091  4.453   1.00 0.00 ? 5  THR A O    6  
ATOM 9891  C CB   . THR A 1 5  ? 7.280   -9.811  6.010   1.00 0.00 ? 5  THR A CB   6  
ATOM 9892  O OG1  . THR A 1 5  ? 7.514   -11.022 5.313   1.00 0.00 ? 5  THR A OG1  6  
ATOM 9893  C CG2  . THR A 1 5  ? 6.549   -10.147 7.291   1.00 0.00 ? 5  THR A CG2  6  
ATOM 9894  H H    . THR A 1 5  ? 6.913   -10.099 3.495   1.00 0.00 ? 5  THR A H    6  
ATOM 9895  H HA   . THR A 1 5  ? 5.504   -8.745  5.483   1.00 0.00 ? 5  THR A HA   6  
ATOM 9896  H HB   . THR A 1 5  ? 8.236   -9.380  6.280   1.00 0.00 ? 5  THR A HB   6  
ATOM 9897  H HG1  . THR A 1 5  ? 8.440   -11.077 5.069   1.00 0.00 ? 5  THR A HG1  6  
ATOM 9898  H HG21 . THR A 1 5  ? 5.912   -9.319  7.568   1.00 0.00 ? 5  THR A HG21 6  
ATOM 9899  H HG22 . THR A 1 5  ? 7.266   -10.329 8.078   1.00 0.00 ? 5  THR A HG22 6  
ATOM 9900  H HG23 . THR A 1 5  ? 5.947   -11.030 7.141   1.00 0.00 ? 5  THR A HG23 6  
ATOM 9901  N N    . ARG A 1 6  ? 6.734   -6.667  6.232   1.00 0.00 ? 6  ARG A N    6  
ATOM 9902  C CA   . ARG A 1 6  ? 7.279   -5.335  6.431   1.00 0.00 ? 6  ARG A CA   6  
ATOM 9903  C C    . ARG A 1 6  ? 6.637   -4.645  7.627   1.00 0.00 ? 6  ARG A C    6  
ATOM 9904  O O    . ARG A 1 6  ? 5.442   -4.795  7.885   1.00 0.00 ? 6  ARG A O    6  
ATOM 9905  C CB   . ARG A 1 6  ? 7.075   -4.488  5.173   1.00 0.00 ? 6  ARG A CB   6  
ATOM 9906  C CG   . ARG A 1 6  ? 8.298   -3.676  4.782   1.00 0.00 ? 6  ARG A CG   6  
ATOM 9907  C CD   . ARG A 1 6  ? 9.452   -4.571  4.362   1.00 0.00 ? 6  ARG A CD   6  
ATOM 9908  N NE   . ARG A 1 6  ? 10.738  -3.884  4.455   1.00 0.00 ? 6  ARG A NE   6  
ATOM 9909  C CZ   . ARG A 1 6  ? 11.850  -4.310  3.861   1.00 0.00 ? 6  ARG A CZ   6  
ATOM 9910  N NH1  . ARG A 1 6  ? 11.839  -5.420  3.134   1.00 0.00 ? 6  ARG A NH1  6  
ATOM 9911  N NH2  . ARG A 1 6  ? 12.977  -3.623  3.995   1.00 0.00 ? 6  ARG A NH2  6  
ATOM 9912  H H    . ARG A 1 6  ? 6.036   -6.998  6.834   1.00 0.00 ? 6  ARG A H    6  
ATOM 9913  H HA   . ARG A 1 6  ? 8.337   -5.435  6.616   1.00 0.00 ? 6  ARG A HA   6  
ATOM 9914  H HB2  . ARG A 1 6  ? 6.826   -5.141  4.350   1.00 0.00 ? 6  ARG A HB2  6  
ATOM 9915  H HB3  . ARG A 1 6  ? 6.255   -3.805  5.340   1.00 0.00 ? 6  ARG A HB3  6  
ATOM 9916  H HG2  . ARG A 1 6  ? 8.039   -3.032  3.957   1.00 0.00 ? 6  ARG A HG2  6  
ATOM 9917  H HG3  . ARG A 1 6  ? 8.606   -3.078  5.627   1.00 0.00 ? 6  ARG A HG3  6  
ATOM 9918  H HD2  . ARG A 1 6  ? 9.471   -5.439  5.004   1.00 0.00 ? 6  ARG A HD2  6  
ATOM 9919  H HD3  . ARG A 1 6  ? 9.295   -4.884  3.340   1.00 0.00 ? 6  ARG A HD3  6  
ATOM 9920  H HE   . ARG A 1 6  ? 10.774  -3.062  4.987   1.00 0.00 ? 6  ARG A HE   6  
ATOM 9921  H HH11 . ARG A 1 6  ? 10.993  -5.942  3.029   1.00 0.00 ? 6  ARG A HH11 6  
ATOM 9922  H HH12 . ARG A 1 6  ? 12.679  -5.734  2.690   1.00 0.00 ? 6  ARG A HH12 6  
ATOM 9923  H HH21 . ARG A 1 6  ? 12.990  -2.786  4.542   1.00 0.00 ? 6  ARG A HH21 6  
ATOM 9924  H HH22 . ARG A 1 6  ? 13.813  -3.943  3.550   1.00 0.00 ? 6  ARG A HH22 6  
ATOM 9925  N N    . ARG A 1 7  ? 7.448   -3.886  8.349   1.00 0.00 ? 7  ARG A N    6  
ATOM 9926  C CA   . ARG A 1 7  ? 6.979   -3.153  9.518   1.00 0.00 ? 7  ARG A CA   6  
ATOM 9927  C C    . ARG A 1 7  ? 8.043   -2.176  10.017  1.00 0.00 ? 7  ARG A C    6  
ATOM 9928  O O    . ARG A 1 7  ? 8.047   -1.794  11.186  1.00 0.00 ? 7  ARG A O    6  
ATOM 9929  C CB   . ARG A 1 7  ? 6.595   -4.123  10.634  1.00 0.00 ? 7  ARG A CB   6  
ATOM 9930  C CG   . ARG A 1 7  ? 5.724   -3.499  11.712  1.00 0.00 ? 7  ARG A CG   6  
ATOM 9931  C CD   . ARG A 1 7  ? 5.622   -4.403  12.929  1.00 0.00 ? 7  ARG A CD   6  
ATOM 9932  N NE   . ARG A 1 7  ? 4.586   -3.959  13.858  1.00 0.00 ? 7  ARG A NE   6  
ATOM 9933  C CZ   . ARG A 1 7  ? 4.069   -4.728  14.813  1.00 0.00 ? 7  ARG A CZ   6  
ATOM 9934  N NH1  . ARG A 1 7  ? 4.484   -5.979  14.965  1.00 0.00 ? 7  ARG A NH1  6  
ATOM 9935  N NH2  . ARG A 1 7  ? 3.132   -4.245  15.618  1.00 0.00 ? 7  ARG A NH2  6  
ATOM 9936  H H    . ARG A 1 7  ? 8.388   -3.817  8.084   1.00 0.00 ? 7  ARG A H    6  
ATOM 9937  H HA   . ARG A 1 7  ? 6.104   -2.592  9.226   1.00 0.00 ? 7  ARG A HA   6  
ATOM 9938  H HB2  . ARG A 1 7  ? 6.055   -4.953  10.201  1.00 0.00 ? 7  ARG A HB2  6  
ATOM 9939  H HB3  . ARG A 1 7  ? 7.497   -4.494  11.099  1.00 0.00 ? 7  ARG A HB3  6  
ATOM 9940  H HG2  . ARG A 1 7  ? 6.155   -2.552  12.010  1.00 0.00 ? 7  ARG A HG2  6  
ATOM 9941  H HG3  . ARG A 1 7  ? 4.734   -3.336  11.311  1.00 0.00 ? 7  ARG A HG3  6  
ATOM 9942  H HD2  . ARG A 1 7  ? 5.389   -5.405  12.599  1.00 0.00 ? 7  ARG A HD2  6  
ATOM 9943  H HD3  . ARG A 1 7  ? 6.574   -4.407  13.440  1.00 0.00 ? 7  ARG A HD3  6  
ATOM 9944  H HE   . ARG A 1 7  ? 4.261   -3.039  13.767  1.00 0.00 ? 7  ARG A HE   6  
ATOM 9945  H HH11 . ARG A 1 7  ? 5.189   -6.349  14.361  1.00 0.00 ? 7  ARG A HH11 6  
ATOM 9946  H HH12 . ARG A 1 7  ? 4.093   -6.551  15.686  1.00 0.00 ? 7  ARG A HH12 6  
ATOM 9947  H HH21 . ARG A 1 7  ? 2.814   -3.304  15.507  1.00 0.00 ? 7  ARG A HH21 6  
ATOM 9948  H HH22 . ARG A 1 7  ? 2.743   -4.823  16.336  1.00 0.00 ? 7  ARG A HH22 6  
ATOM 9949  N N    . VAL A 1 8  ? 8.948   -1.779  9.125   1.00 0.00 ? 8  VAL A N    6  
ATOM 9950  C CA   . VAL A 1 8  ? 10.015  -0.853  9.483   1.00 0.00 ? 8  VAL A CA   6  
ATOM 9951  C C    . VAL A 1 8  ? 10.053  0.338   8.531   1.00 0.00 ? 8  VAL A C    6  
ATOM 9952  O O    . VAL A 1 8  ? 10.020  1.490   8.964   1.00 0.00 ? 8  VAL A O    6  
ATOM 9953  C CB   . VAL A 1 8  ? 11.391  -1.549  9.471   1.00 0.00 ? 8  VAL A CB   6  
ATOM 9954  C CG1  . VAL A 1 8  ? 12.421  -0.708  10.208  1.00 0.00 ? 8  VAL A CG1  6  
ATOM 9955  C CG2  . VAL A 1 8  ? 11.294  -2.941  10.081  1.00 0.00 ? 8  VAL A CG2  6  
ATOM 9956  H H    . VAL A 1 8  ? 8.902   -2.121  8.209   1.00 0.00 ? 8  VAL A H    6  
ATOM 9957  H HA   . VAL A 1 8  ? 9.825   -0.496  10.484  1.00 0.00 ? 8  VAL A HA   6  
ATOM 9958  H HB   . VAL A 1 8  ? 11.711  -1.651  8.444   1.00 0.00 ? 8  VAL A HB   6  
ATOM 9959  H HG11 . VAL A 1 8  ? 12.523  -1.069  11.221  1.00 0.00 ? 8  VAL A HG11 6  
ATOM 9960  H HG12 . VAL A 1 8  ? 12.100  0.323   10.223  1.00 0.00 ? 8  VAL A HG12 6  
ATOM 9961  H HG13 . VAL A 1 8  ? 13.373  -0.781  9.702   1.00 0.00 ? 8  VAL A HG13 6  
ATOM 9962  H HG21 . VAL A 1 8  ? 10.845  -3.617  9.367   1.00 0.00 ? 8  VAL A HG21 6  
ATOM 9963  H HG22 . VAL A 1 8  ? 10.685  -2.902  10.972  1.00 0.00 ? 8  VAL A HG22 6  
ATOM 9964  H HG23 . VAL A 1 8  ? 12.283  -3.293  10.335  1.00 0.00 ? 8  VAL A HG23 6  
ATOM 9965  N N    . GLY A 1 9  ? 10.121  0.055   7.234   1.00 0.00 ? 9  GLY A N    6  
ATOM 9966  C CA   . GLY A 1 9  ? 10.162  1.117   6.246   1.00 0.00 ? 9  GLY A CA   6  
ATOM 9967  C C    . GLY A 1 9  ? 10.358  0.596   4.835   1.00 0.00 ? 9  GLY A C    6  
ATOM 9968  O O    . GLY A 1 9  ? 11.458  0.186   4.465   1.00 0.00 ? 9  GLY A O    6  
ATOM 9969  H H    . GLY A 1 9  ? 10.144  -0.882  6.946   1.00 0.00 ? 9  GLY A H    6  
ATOM 9970  H HA2  . GLY A 1 9  ? 9.234   1.668   6.288   1.00 0.00 ? 9  GLY A HA2  6  
ATOM 9971  H HA3  . GLY A 1 9  ? 10.975  1.786   6.487   1.00 0.00 ? 9  GLY A HA3  6  
ATOM 9972  N N    . GLU A 1 10 ? 9.288   0.615   4.046   1.00 0.00 ? 10 GLU A N    6  
ATOM 9973  C CA   . GLU A 1 10 ? 9.346   0.143   2.666   1.00 0.00 ? 10 GLU A CA   6  
ATOM 9974  C C    . GLU A 1 10 ? 9.141   1.295   1.689   1.00 0.00 ? 10 GLU A C    6  
ATOM 9975  O O    . GLU A 1 10 ? 9.993   1.564   0.842   1.00 0.00 ? 10 GLU A O    6  
ATOM 9976  C CB   . GLU A 1 10 ? 8.287   -0.934  2.428   1.00 0.00 ? 10 GLU A CB   6  
ATOM 9977  C CG   . GLU A 1 10 ? 8.818   -2.158  1.699   1.00 0.00 ? 10 GLU A CG   6  
ATOM 9978  C CD   . GLU A 1 10 ? 7.736   -2.900  0.940   1.00 0.00 ? 10 GLU A CD   6  
ATOM 9979  O OE1  . GLU A 1 10 ? 7.003   -3.690  1.572   1.00 0.00 ? 10 GLU A OE1  6  
ATOM 9980  O OE2  . GLU A 1 10 ? 7.621   -2.691  -0.286  1.00 0.00 ? 10 GLU A OE2  6  
ATOM 9981  H H    . GLU A 1 10 ? 8.440   0.955   4.399   1.00 0.00 ? 10 GLU A H    6  
ATOM 9982  H HA   . GLU A 1 10 ? 10.324  -0.283  2.501   1.00 0.00 ? 10 GLU A HA   6  
ATOM 9983  H HB2  . GLU A 1 10 ? 7.893   -1.250  3.382   1.00 0.00 ? 10 GLU A HB2  6  
ATOM 9984  H HB3  . GLU A 1 10 ? 7.484   -0.513  1.840   1.00 0.00 ? 10 GLU A HB3  6  
ATOM 9985  H HG2  . GLU A 1 10 ? 9.575   -1.842  0.997   1.00 0.00 ? 10 GLU A HG2  6  
ATOM 9986  H HG3  . GLU A 1 10 ? 9.257   -2.830  2.422   1.00 0.00 ? 10 GLU A HG3  6  
ATOM 9987  N N    . THR A 1 11 ? 8.001   1.968   1.813   1.00 0.00 ? 11 THR A N    6  
ATOM 9988  C CA   . THR A 1 11 ? 7.668   3.093   0.946   1.00 0.00 ? 11 THR A CA   6  
ATOM 9989  C C    . THR A 1 11 ? 7.485   2.638   -0.500  1.00 0.00 ? 11 THR A C    6  
ATOM 9990  O O    . THR A 1 11 ? 8.452   2.501   -1.250  1.00 0.00 ? 11 THR A O    6  
ATOM 9991  C CB   . THR A 1 11 ? 8.746   4.182   1.027   1.00 0.00 ? 11 THR A CB   6  
ATOM 9992  O OG1  . THR A 1 11 ? 9.834   3.885   0.170   1.00 0.00 ? 11 THR A OG1  6  
ATOM 9993  C CG2  . THR A 1 11 ? 9.302   4.376   2.422   1.00 0.00 ? 11 THR A CG2  6  
ATOM 9994  H H    . THR A 1 11 ? 7.362   1.701   2.507   1.00 0.00 ? 11 THR A H    6  
ATOM 9995  H HA   . THR A 1 11 ? 6.732   3.506   1.294   1.00 0.00 ? 11 THR A HA   6  
ATOM 9996  H HB   . THR A 1 11 ? 8.315   5.121   0.712   1.00 0.00 ? 11 THR A HB   6  
ATOM 9997  H HG1  . THR A 1 11 ? 9.569   4.021   -0.743  1.00 0.00 ? 11 THR A HG1  6  
ATOM 9998  H HG21 . THR A 1 11 ? 10.333  4.057   2.446   1.00 0.00 ? 11 THR A HG21 6  
ATOM 9999  H HG22 . THR A 1 11 ? 8.727   3.789   3.124   1.00 0.00 ? 11 THR A HG22 6  
ATOM 10000 H HG23 . THR A 1 11 ? 9.241   5.420   2.692   1.00 0.00 ? 11 THR A HG23 6  
ATOM 10001 N N    . LEU A 1 12 ? 6.233   2.415   -0.888  1.00 0.00 ? 12 LEU A N    6  
ATOM 10002 C CA   . LEU A 1 12 ? 5.914   1.988   -2.248  1.00 0.00 ? 12 LEU A CA   6  
ATOM 10003 C C    . LEU A 1 12 ? 5.112   3.071   -2.962  1.00 0.00 ? 12 LEU A C    6  
ATOM 10004 O O    . LEU A 1 12 ? 4.438   3.874   -2.318  1.00 0.00 ? 12 LEU A O    6  
ATOM 10005 C CB   . LEU A 1 12 ? 5.142   0.659   -2.238  1.00 0.00 ? 12 LEU A CB   6  
ATOM 10006 C CG   . LEU A 1 12 ? 3.636   0.767   -1.970  1.00 0.00 ? 12 LEU A CG   6  
ATOM 10007 C CD1  . LEU A 1 12 ? 2.902   -0.440  -2.536  1.00 0.00 ? 12 LEU A CD1  6  
ATOM 10008 C CD2  . LEU A 1 12 ? 3.372   0.903   -0.480  1.00 0.00 ? 12 LEU A CD2  6  
ATOM 10009 H H    . LEU A 1 12 ? 5.504   2.550   -0.248  1.00 0.00 ? 12 LEU A H    6  
ATOM 10010 H HA   . LEU A 1 12 ? 6.847   1.847   -2.774  1.00 0.00 ? 12 LEU A HA   6  
ATOM 10011 H HB2  . LEU A 1 12 ? 5.280   0.183   -3.198  1.00 0.00 ? 12 LEU A HB2  6  
ATOM 10012 H HB3  . LEU A 1 12 ? 5.574   0.025   -1.479  1.00 0.00 ? 12 LEU A HB3  6  
ATOM 10013 H HG   . LEU A 1 12 ? 3.250   1.648   -2.460  1.00 0.00 ? 12 LEU A HG   6  
ATOM 10014 H HD11 . LEU A 1 12 ? 3.560   -0.986  -3.197  1.00 0.00 ? 12 LEU A HD11 6  
ATOM 10015 H HD12 . LEU A 1 12 ? 2.034   -0.107  -3.088  1.00 0.00 ? 12 LEU A HD12 6  
ATOM 10016 H HD13 . LEU A 1 12 ? 2.589   -1.084  -1.728  1.00 0.00 ? 12 LEU A HD13 6  
ATOM 10017 H HD21 . LEU A 1 12 ? 2.317   0.773   -0.288  1.00 0.00 ? 12 LEU A HD21 6  
ATOM 10018 H HD22 . LEU A 1 12 ? 3.679   1.883   -0.150  1.00 0.00 ? 12 LEU A HD22 6  
ATOM 10019 H HD23 . LEU A 1 12 ? 3.931   0.150   0.056   1.00 0.00 ? 12 LEU A HD23 6  
ATOM 10020 N N    . MET A 1 13 ? 5.182   3.096   -4.289  1.00 0.00 ? 13 MET A N    6  
ATOM 10021 C CA   . MET A 1 13 ? 4.452   4.092   -5.059  1.00 0.00 ? 13 MET A CA   6  
ATOM 10022 C C    . MET A 1 13 ? 3.635   3.437   -6.163  1.00 0.00 ? 13 MET A C    6  
ATOM 10023 O O    . MET A 1 13 ? 4.160   3.090   -7.221  1.00 0.00 ? 13 MET A O    6  
ATOM 10024 C CB   . MET A 1 13 ? 5.422   5.108   -5.661  1.00 0.00 ? 13 MET A CB   6  
ATOM 10025 C CG   . MET A 1 13 ? 4.735   6.222   -6.433  1.00 0.00 ? 13 MET A CG   6  
ATOM 10026 S SD   . MET A 1 13 ? 5.844   7.056   -7.583  1.00 0.00 ? 13 MET A SD   6  
ATOM 10027 C CE   . MET A 1 13 ? 7.030   7.776   -6.450  1.00 0.00 ? 13 MET A CE   6  
ATOM 10028 H H    . MET A 1 13 ? 5.725   2.430   -4.760  1.00 0.00 ? 13 MET A H    6  
ATOM 10029 H HA   . MET A 1 13 ? 3.780   4.604   -4.386  1.00 0.00 ? 13 MET A HA   6  
ATOM 10030 H HB2  . MET A 1 13 ? 5.998   5.554   -4.863  1.00 0.00 ? 13 MET A HB2  6  
ATOM 10031 H HB3  . MET A 1 13 ? 6.092   4.594   -6.334  1.00 0.00 ? 13 MET A HB3  6  
ATOM 10032 H HG2  . MET A 1 13 ? 3.912   5.801   -6.990  1.00 0.00 ? 13 MET A HG2  6  
ATOM 10033 H HG3  . MET A 1 13 ? 4.357   6.948   -5.729  1.00 0.00 ? 13 MET A HG3  6  
ATOM 10034 H HE1  . MET A 1 13 ? 6.742   7.547   -5.435  1.00 0.00 ? 13 MET A HE1  6  
ATOM 10035 H HE2  . MET A 1 13 ? 7.052   8.847   -6.585  1.00 0.00 ? 13 MET A HE2  6  
ATOM 10036 H HE3  . MET A 1 13 ? 8.010   7.368   -6.647  1.00 0.00 ? 13 MET A HE3  6  
ATOM 10037 N N    . ILE A 1 14 ? 2.344   3.273   -5.906  1.00 0.00 ? 14 ILE A N    6  
ATOM 10038 C CA   . ILE A 1 14 ? 1.443   2.663   -6.868  1.00 0.00 ? 14 ILE A CA   6  
ATOM 10039 C C    . ILE A 1 14 ? 0.355   3.646   -7.291  1.00 0.00 ? 14 ILE A C    6  
ATOM 10040 O O    . ILE A 1 14 ? -0.597  3.887   -6.550  1.00 0.00 ? 14 ILE A O    6  
ATOM 10041 C CB   . ILE A 1 14 ? 0.788   1.391   -6.287  1.00 0.00 ? 14 ILE A CB   6  
ATOM 10042 C CG1  . ILE A 1 14 ? -0.163  0.761   -7.306  1.00 0.00 ? 14 ILE A CG1  6  
ATOM 10043 C CG2  . ILE A 1 14 ? 0.053   1.713   -4.992  1.00 0.00 ? 14 ILE A CG2  6  
ATOM 10044 C CD1  . ILE A 1 14 ? 0.506   0.428   -8.619  1.00 0.00 ? 14 ILE A CD1  6  
ATOM 10045 H H    . ILE A 1 14 ? 1.991   3.563   -5.042  1.00 0.00 ? 14 ILE A H    6  
ATOM 10046 H HA   . ILE A 1 14 ? 2.025   2.383   -7.733  1.00 0.00 ? 14 ILE A HA   6  
ATOM 10047 H HB   . ILE A 1 14 ? 1.573   0.686   -6.056  1.00 0.00 ? 14 ILE A HB   6  
ATOM 10048 H HG12 . ILE A 1 14 ? -0.565  -0.154  -6.898  1.00 0.00 ? 14 ILE A HG12 6  
ATOM 10049 H HG13 . ILE A 1 14 ? -0.972  1.447   -7.508  1.00 0.00 ? 14 ILE A HG13 6  
ATOM 10050 H HG21 . ILE A 1 14 ? 0.469   1.123   -4.187  1.00 0.00 ? 14 ILE A HG21 6  
ATOM 10051 H HG22 . ILE A 1 14 ? -0.996  1.480   -5.104  1.00 0.00 ? 14 ILE A HG22 6  
ATOM 10052 H HG23 . ILE A 1 14 ? 0.167   2.762   -4.763  1.00 0.00 ? 14 ILE A HG23 6  
ATOM 10053 H HD11 . ILE A 1 14 ? 1.528   0.775   -8.595  1.00 0.00 ? 14 ILE A HD11 6  
ATOM 10054 H HD12 . ILE A 1 14 ? -0.022  0.915   -9.426  1.00 0.00 ? 14 ILE A HD12 6  
ATOM 10055 H HD13 . ILE A 1 14 ? 0.491   -0.641  -8.772  1.00 0.00 ? 14 ILE A HD13 6  
ATOM 10056 N N    . GLY A 1 15 ? 0.503   4.217   -8.484  1.00 0.00 ? 15 GLY A N    6  
ATOM 10057 C CA   . GLY A 1 15 ? -0.472  5.171   -8.982  1.00 0.00 ? 15 GLY A CA   6  
ATOM 10058 C C    . GLY A 1 15 ? 0.120   6.086   -10.037 1.00 0.00 ? 15 GLY A C    6  
ATOM 10059 O O    . GLY A 1 15 ? 0.376   5.662   -11.164 1.00 0.00 ? 15 GLY A O    6  
ATOM 10060 H H    . GLY A 1 15 ? 1.282   3.996   -9.036  1.00 0.00 ? 15 GLY A H    6  
ATOM 10061 H HA2  . GLY A 1 15 ? -1.303  4.632   -9.412  1.00 0.00 ? 15 GLY A HA2  6  
ATOM 10062 H HA3  . GLY A 1 15 ? -0.831  5.774   -8.159  1.00 0.00 ? 15 GLY A HA3  6  
ATOM 10063 N N    . ASP A 1 16 ? 0.344   7.343   -9.668  1.00 0.00 ? 16 ASP A N    6  
ATOM 10064 C CA   . ASP A 1 16 ? 0.918   8.322   -10.589 1.00 0.00 ? 16 ASP A CA   6  
ATOM 10065 C C    . ASP A 1 16 ? 1.851   9.298   -9.864  1.00 0.00 ? 16 ASP A C    6  
ATOM 10066 O O    . ASP A 1 16 ? 2.481   10.146  -10.497 1.00 0.00 ? 16 ASP A O    6  
ATOM 10067 C CB   . ASP A 1 16 ? -0.195  9.096   -11.297 1.00 0.00 ? 16 ASP A CB   6  
ATOM 10068 C CG   . ASP A 1 16 ? -0.552  8.494   -12.642 1.00 0.00 ? 16 ASP A CG   6  
ATOM 10069 O OD1  . ASP A 1 16 ? -1.321  7.510   -12.666 1.00 0.00 ? 16 ASP A OD1  6  
ATOM 10070 O OD2  . ASP A 1 16 ? -0.063  9.006   -13.671 1.00 0.00 ? 16 ASP A OD2  6  
ATOM 10071 H H    . ASP A 1 16 ? 0.121   7.616   -8.756  1.00 0.00 ? 16 ASP A H    6  
ATOM 10072 H HA   . ASP A 1 16 ? 1.490   7.782   -11.328 1.00 0.00 ? 16 ASP A HA   6  
ATOM 10073 H HB2  . ASP A 1 16 ? -1.079  9.093   -10.677 1.00 0.00 ? 16 ASP A HB2  6  
ATOM 10074 H HB3  . ASP A 1 16 ? 0.126   10.116  -11.454 1.00 0.00 ? 16 ASP A HB3  6  
ATOM 10075 N N    . GLU A 1 17 ? 1.935   9.173   -8.538  1.00 0.00 ? 17 GLU A N    6  
ATOM 10076 C CA   . GLU A 1 17 ? 2.785   10.038  -7.720  1.00 0.00 ? 17 GLU A CA   6  
ATOM 10077 C C    . GLU A 1 17 ? 2.392   9.903   -6.251  1.00 0.00 ? 17 GLU A C    6  
ATOM 10078 O O    . GLU A 1 17 ? 2.024   10.880  -5.599  1.00 0.00 ? 17 GLU A O    6  
ATOM 10079 C CB   . GLU A 1 17 ? 2.668   11.503  -8.167  1.00 0.00 ? 17 GLU A CB   6  
ATOM 10080 C CG   . GLU A 1 17 ? 3.942   12.053  -8.788  1.00 0.00 ? 17 GLU A CG   6  
ATOM 10081 C CD   . GLU A 1 17 ? 4.208   13.492  -8.393  1.00 0.00 ? 17 GLU A CD   6  
ATOM 10082 O OE1  . GLU A 1 17 ? 4.437   13.746  -7.192  1.00 0.00 ? 17 GLU A OE1  6  
ATOM 10083 O OE2  . GLU A 1 17 ? 4.185   14.366  -9.285  1.00 0.00 ? 17 GLU A OE2  6  
ATOM 10084 H H    . GLU A 1 17 ? 1.413   8.479   -8.091  1.00 0.00 ? 17 GLU A H    6  
ATOM 10085 H HA   . GLU A 1 17 ? 3.808   9.710   -7.840  1.00 0.00 ? 17 GLU A HA   6  
ATOM 10086 H HB2  . GLU A 1 17 ? 1.876   11.582  -8.896  1.00 0.00 ? 17 GLU A HB2  6  
ATOM 10087 H HB3  . GLU A 1 17 ? 2.419   12.114  -7.312  1.00 0.00 ? 17 GLU A HB3  6  
ATOM 10088 H HG2  . GLU A 1 17 ? 4.776   11.447  -8.464  1.00 0.00 ? 17 GLU A HG2  6  
ATOM 10089 H HG3  . GLU A 1 17 ? 3.856   11.999  -9.863  1.00 0.00 ? 17 GLU A HG3  6  
ATOM 10090 N N    . VAL A 1 18 ? 2.456   8.678   -5.740  1.00 0.00 ? 18 VAL A N    6  
ATOM 10091 C CA   . VAL A 1 18 ? 2.092   8.403   -4.365  1.00 0.00 ? 18 VAL A CA   6  
ATOM 10092 C C    . VAL A 1 18 ? 3.305   7.990   -3.527  1.00 0.00 ? 18 VAL A C    6  
ATOM 10093 O O    . VAL A 1 18 ? 4.451   8.237   -3.906  1.00 0.00 ? 18 VAL A O    6  
ATOM 10094 C CB   . VAL A 1 18 ? 1.023   7.295   -4.314  1.00 0.00 ? 18 VAL A CB   6  
ATOM 10095 C CG1  . VAL A 1 18 ? -0.155  7.647   -5.211  1.00 0.00 ? 18 VAL A CG1  6  
ATOM 10096 C CG2  . VAL A 1 18 ? 1.619   5.948   -4.707  1.00 0.00 ? 18 VAL A CG2  6  
ATOM 10097 H H    . VAL A 1 18 ? 2.744   7.936   -6.305  1.00 0.00 ? 18 VAL A H    6  
ATOM 10098 H HA   . VAL A 1 18 ? 1.666   9.302   -3.946  1.00 0.00 ? 18 VAL A HA   6  
ATOM 10099 H HB   . VAL A 1 18 ? 0.665   7.223   -3.307  1.00 0.00 ? 18 VAL A HB   6  
ATOM 10100 H HG11 . VAL A 1 18 ? -0.089  7.084   -6.130  1.00 0.00 ? 18 VAL A HG11 6  
ATOM 10101 H HG12 . VAL A 1 18 ? -0.135  8.704   -5.433  1.00 0.00 ? 18 VAL A HG12 6  
ATOM 10102 H HG13 . VAL A 1 18 ? -1.077  7.403   -4.705  1.00 0.00 ? 18 VAL A HG13 6  
ATOM 10103 H HG21 . VAL A 1 18 ? 1.013   5.496   -5.478  1.00 0.00 ? 18 VAL A HG21 6  
ATOM 10104 H HG22 . VAL A 1 18 ? 1.644   5.300   -3.842  1.00 0.00 ? 18 VAL A HG22 6  
ATOM 10105 H HG23 . VAL A 1 18 ? 2.623   6.092   -5.077  1.00 0.00 ? 18 VAL A HG23 6  
ATOM 10106 N N    . THR A 1 19 ? 3.037   7.361   -2.385  1.00 0.00 ? 19 THR A N    6  
ATOM 10107 C CA   . THR A 1 19 ? 4.079   6.904   -1.473  1.00 0.00 ? 19 THR A CA   6  
ATOM 10108 C C    . THR A 1 19 ? 3.444   6.451   -0.163  1.00 0.00 ? 19 THR A C    6  
ATOM 10109 O O    . THR A 1 19 ? 3.043   7.275   0.656   1.00 0.00 ? 19 THR A O    6  
ATOM 10110 C CB   . THR A 1 19 ? 5.098   8.017   -1.206  1.00 0.00 ? 19 THR A CB   6  
ATOM 10111 O OG1  . THR A 1 19 ? 5.865   7.728   -0.051  1.00 0.00 ? 19 THR A OG1  6  
ATOM 10112 C CG2  . THR A 1 19 ? 4.464   9.377   -1.008  1.00 0.00 ? 19 THR A CG2  6  
ATOM 10113 H H    . THR A 1 19 ? 2.103   7.197   -2.144  1.00 0.00 ? 19 THR A H    6  
ATOM 10114 H HA   . THR A 1 19 ? 4.580   6.064   -1.930  1.00 0.00 ? 19 THR A HA   6  
ATOM 10115 H HB   . THR A 1 19 ? 5.769   8.085   -2.050  1.00 0.00 ? 19 THR A HB   6  
ATOM 10116 H HG1  . THR A 1 19 ? 6.571   7.119   -0.279  1.00 0.00 ? 19 THR A HG1  6  
ATOM 10117 H HG21 . THR A 1 19 ? 4.825   10.056  -1.766  1.00 0.00 ? 19 THR A HG21 6  
ATOM 10118 H HG22 . THR A 1 19 ? 4.724   9.756   -0.031  1.00 0.00 ? 19 THR A HG22 6  
ATOM 10119 H HG23 . THR A 1 19 ? 3.390   9.288   -1.086  1.00 0.00 ? 19 THR A HG23 6  
ATOM 10120 N N    . VAL A 1 20 ? 3.335   5.141   0.024   1.00 0.00 ? 20 VAL A N    6  
ATOM 10121 C CA   . VAL A 1 20 ? 2.724   4.599   1.232   1.00 0.00 ? 20 VAL A CA   6  
ATOM 10122 C C    . VAL A 1 20 ? 3.747   3.898   2.122   1.00 0.00 ? 20 VAL A C    6  
ATOM 10123 O O    . VAL A 1 20 ? 4.260   2.831   1.778   1.00 0.00 ? 20 VAL A O    6  
ATOM 10124 C CB   . VAL A 1 20 ? 1.596   3.605   0.891   1.00 0.00 ? 20 VAL A CB   6  
ATOM 10125 C CG1  . VAL A 1 20 ? 0.836   3.202   2.146   1.00 0.00 ? 20 VAL A CG1  6  
ATOM 10126 C CG2  . VAL A 1 20 ? 0.654   4.198   -0.145  1.00 0.00 ? 20 VAL A CG2  6  
ATOM 10127 H H    . VAL A 1 20 ? 3.664   4.526   -0.666  1.00 0.00 ? 20 VAL A H    6  
ATOM 10128 H HA   . VAL A 1 20 ? 2.289   5.424   1.781   1.00 0.00 ? 20 VAL A HA   6  
ATOM 10129 H HB   . VAL A 1 20 ? 2.043   2.717   0.472   1.00 0.00 ? 20 VAL A HB   6  
ATOM 10130 H HG11 . VAL A 1 20 ? 0.691   2.131   2.150   1.00 0.00 ? 20 VAL A HG11 6  
ATOM 10131 H HG12 . VAL A 1 20 ? -0.125  3.694   2.158   1.00 0.00 ? 20 VAL A HG12 6  
ATOM 10132 H HG13 . VAL A 1 20 ? 1.400   3.493   3.019   1.00 0.00 ? 20 VAL A HG13 6  
ATOM 10133 H HG21 . VAL A 1 20 ? 1.214   4.469   -1.028  1.00 0.00 ? 20 VAL A HG21 6  
ATOM 10134 H HG22 . VAL A 1 20 ? 0.177   5.076   0.263   1.00 0.00 ? 20 VAL A HG22 6  
ATOM 10135 H HG23 . VAL A 1 20 ? -0.098  3.468   -0.406  1.00 0.00 ? 20 VAL A HG23 6  
ATOM 10136 N N    . THR A 1 21 ? 4.037   4.509   3.267   1.00 0.00 ? 21 THR A N    6  
ATOM 10137 C CA   . THR A 1 21 ? 4.994   3.950   4.217   1.00 0.00 ? 21 THR A CA   6  
ATOM 10138 C C    . THR A 1 21 ? 4.272   3.201   5.336   1.00 0.00 ? 21 THR A C    6  
ATOM 10139 O O    . THR A 1 21 ? 3.586   3.807   6.161   1.00 0.00 ? 21 THR A O    6  
ATOM 10140 C CB   . THR A 1 21 ? 5.865   5.059   4.808   1.00 0.00 ? 21 THR A CB   6  
ATOM 10141 O OG1  . THR A 1 21 ? 6.301   5.947   3.795   1.00 0.00 ? 21 THR A OG1  6  
ATOM 10142 C CG2  . THR A 1 21 ? 7.093   4.538   5.523   1.00 0.00 ? 21 THR A CG2  6  
ATOM 10143 H H    . THR A 1 21 ? 3.600   5.361   3.473   1.00 0.00 ? 21 THR A H    6  
ATOM 10144 H HA   . THR A 1 21 ? 5.624   3.255   3.682   1.00 0.00 ? 21 THR A HA   6  
ATOM 10145 H HB   . THR A 1 21 ? 5.279   5.620   5.522   1.00 0.00 ? 21 THR A HB   6  
ATOM 10146 H HG1  . THR A 1 21 ? 5.564   6.490   3.505   1.00 0.00 ? 21 THR A HG1  6  
ATOM 10147 H HG21 . THR A 1 21 ? 7.908   4.448   4.820   1.00 0.00 ? 21 THR A HG21 6  
ATOM 10148 H HG22 . THR A 1 21 ? 6.878   3.570   5.951   1.00 0.00 ? 21 THR A HG22 6  
ATOM 10149 H HG23 . THR A 1 21 ? 7.371   5.225   6.309   1.00 0.00 ? 21 THR A HG23 6  
ATOM 10150 N N    . VAL A 1 22 ? 4.428   1.881   5.354   1.00 0.00 ? 22 VAL A N    6  
ATOM 10151 C CA   . VAL A 1 22 ? 3.789   1.047   6.367   1.00 0.00 ? 22 VAL A CA   6  
ATOM 10152 C C    . VAL A 1 22 ? 4.525   1.132   7.702   1.00 0.00 ? 22 VAL A C    6  
ATOM 10153 O O    . VAL A 1 22 ? 5.144   0.164   8.146   1.00 0.00 ? 22 VAL A O    6  
ATOM 10154 C CB   . VAL A 1 22 ? 3.727   -0.426  5.921   1.00 0.00 ? 22 VAL A CB   6  
ATOM 10155 C CG1  . VAL A 1 22 ? 2.764   -0.593  4.756   1.00 0.00 ? 22 VAL A CG1  6  
ATOM 10156 C CG2  . VAL A 1 22 ? 5.115   -0.929  5.553   1.00 0.00 ? 22 VAL A CG2  6  
ATOM 10157 H H    . VAL A 1 22 ? 4.982   1.457   4.666   1.00 0.00 ? 22 VAL A H    6  
ATOM 10158 H HA   . VAL A 1 22 ? 2.778   1.402   6.502   1.00 0.00 ? 22 VAL A HA   6  
ATOM 10159 H HB   . VAL A 1 22 ? 3.362   -1.017  6.748   1.00 0.00 ? 22 VAL A HB   6  
ATOM 10160 H HG11 . VAL A 1 22 ? 3.132   -1.362  4.092   1.00 0.00 ? 22 VAL A HG11 6  
ATOM 10161 H HG12 . VAL A 1 22 ? 2.686   0.339   4.218   1.00 0.00 ? 22 VAL A HG12 6  
ATOM 10162 H HG13 . VAL A 1 22 ? 1.792   -0.876  5.130   1.00 0.00 ? 22 VAL A HG13 6  
ATOM 10163 H HG21 . VAL A 1 22 ? 5.241   -0.885  4.481   1.00 0.00 ? 22 VAL A HG21 6  
ATOM 10164 H HG22 . VAL A 1 22 ? 5.229   -1.950  5.887   1.00 0.00 ? 22 VAL A HG22 6  
ATOM 10165 H HG23 . VAL A 1 22 ? 5.860   -0.309  6.028   1.00 0.00 ? 22 VAL A HG23 6  
ATOM 10166 N N    . LEU A 1 23 ? 4.457   2.297   8.337   1.00 0.00 ? 23 LEU A N    6  
ATOM 10167 C CA   . LEU A 1 23 ? 5.120   2.508   9.619   1.00 0.00 ? 23 LEU A CA   6  
ATOM 10168 C C    . LEU A 1 23 ? 4.144   2.275   10.781  1.00 0.00 ? 23 LEU A C    6  
ATOM 10169 O O    . LEU A 1 23 ? 3.310   1.372   10.718  1.00 0.00 ? 23 LEU A O    6  
ATOM 10170 C CB   . LEU A 1 23 ? 5.716   3.922   9.671   1.00 0.00 ? 23 LEU A CB   6  
ATOM 10171 C CG   . LEU A 1 23 ? 6.880   4.133   10.657  1.00 0.00 ? 23 LEU A CG   6  
ATOM 10172 C CD1  . LEU A 1 23 ? 7.315   2.821   11.307  1.00 0.00 ? 23 LEU A CD1  6  
ATOM 10173 C CD2  . LEU A 1 23 ? 8.059   4.792   9.954   1.00 0.00 ? 23 LEU A CD2  6  
ATOM 10174 H H    . LEU A 1 23 ? 3.953   3.033   7.931   1.00 0.00 ? 23 LEU A H    6  
ATOM 10175 H HA   . LEU A 1 23 ? 5.920   1.786   9.692   1.00 0.00 ? 23 LEU A HA   6  
ATOM 10176 H HB2  . LEU A 1 23 ? 6.064   4.174   8.680   1.00 0.00 ? 23 LEU A HB2  6  
ATOM 10177 H HB3  . LEU A 1 23 ? 4.925   4.608   9.937   1.00 0.00 ? 23 LEU A HB3  6  
ATOM 10178 H HG   . LEU A 1 23 ? 6.550   4.799   11.444  1.00 0.00 ? 23 LEU A HG   6  
ATOM 10179 H HD11 . LEU A 1 23 ? 7.757   2.178   10.560  1.00 0.00 ? 23 LEU A HD11 6  
ATOM 10180 H HD12 . LEU A 1 23 ? 6.456   2.329   11.740  1.00 0.00 ? 23 LEU A HD12 6  
ATOM 10181 H HD13 . LEU A 1 23 ? 8.040   3.025   12.081  1.00 0.00 ? 23 LEU A HD13 6  
ATOM 10182 H HD21 . LEU A 1 23 ? 8.576   5.438   10.647  1.00 0.00 ? 23 LEU A HD21 6  
ATOM 10183 H HD22 . LEU A 1 23 ? 7.699   5.375   9.119   1.00 0.00 ? 23 LEU A HD22 6  
ATOM 10184 H HD23 . LEU A 1 23 ? 8.736   4.030   9.597   1.00 0.00 ? 23 LEU A HD23 6  
ATOM 10185 N N    . GLY A 1 24 ? 4.250   3.081   11.841  1.00 0.00 ? 24 GLY A N    6  
ATOM 10186 C CA   . GLY A 1 24 ? 3.369   2.926   12.984  1.00 0.00 ? 24 GLY A CA   6  
ATOM 10187 C C    . GLY A 1 24 ? 3.377   1.516   13.537  1.00 0.00 ? 24 GLY A C    6  
ATOM 10188 O O    . GLY A 1 24 ? 2.401   0.780   13.391  1.00 0.00 ? 24 GLY A O    6  
ATOM 10189 H H    . GLY A 1 24 ? 4.929   3.782   11.851  1.00 0.00 ? 24 GLY A H    6  
ATOM 10190 H HA2  . GLY A 1 24 ? 3.681   3.608   13.761  1.00 0.00 ? 24 GLY A HA2  6  
ATOM 10191 H HA3  . GLY A 1 24 ? 2.364   3.177   12.684  1.00 0.00 ? 24 GLY A HA3  6  
ATOM 10192 N N    . VAL A 1 25 ? 4.483   1.132   14.167  1.00 0.00 ? 25 VAL A N    6  
ATOM 10193 C CA   . VAL A 1 25 ? 4.607   -0.199  14.731  1.00 0.00 ? 25 VAL A CA   6  
ATOM 10194 C C    . VAL A 1 25 ? 4.027   -0.264  16.141  1.00 0.00 ? 25 VAL A C    6  
ATOM 10195 O O    . VAL A 1 25 ? 4.606   0.268   17.088  1.00 0.00 ? 25 VAL A O    6  
ATOM 10196 C CB   . VAL A 1 25 ? 6.081   -0.648  14.773  1.00 0.00 ? 25 VAL A CB   6  
ATOM 10197 C CG1  . VAL A 1 25 ? 6.196   -2.088  15.255  1.00 0.00 ? 25 VAL A CG1  6  
ATOM 10198 C CG2  . VAL A 1 25 ? 6.728   -0.480  13.406  1.00 0.00 ? 25 VAL A CG2  6  
ATOM 10199 H H    . VAL A 1 25 ? 5.228   1.754   14.248  1.00 0.00 ? 25 VAL A H    6  
ATOM 10200 H HA   . VAL A 1 25 ? 4.065   -0.876  14.096  1.00 0.00 ? 25 VAL A HA   6  
ATOM 10201 H HB   . VAL A 1 25 ? 6.607   -0.017  15.474  1.00 0.00 ? 25 VAL A HB   6  
ATOM 10202 H HG11 . VAL A 1 25 ? 6.592   -2.704  14.461  1.00 0.00 ? 25 VAL A HG11 6  
ATOM 10203 H HG12 . VAL A 1 25 ? 5.221   -2.453  15.541  1.00 0.00 ? 25 VAL A HG12 6  
ATOM 10204 H HG13 . VAL A 1 25 ? 6.859   -2.130  16.107  1.00 0.00 ? 25 VAL A HG13 6  
ATOM 10205 H HG21 . VAL A 1 25 ? 7.101   0.529   13.306  1.00 0.00 ? 25 VAL A HG21 6  
ATOM 10206 H HG22 . VAL A 1 25 ? 5.996   -0.670  12.635  1.00 0.00 ? 25 VAL A HG22 6  
ATOM 10207 H HG23 . VAL A 1 25 ? 7.546   -1.178  13.305  1.00 0.00 ? 25 VAL A HG23 6  
ATOM 10208 N N    . LYS A 1 26 ? 2.877   -0.917  16.268  1.00 0.00 ? 26 LYS A N    6  
ATOM 10209 C CA   . LYS A 1 26 ? 2.211   -1.051  17.558  1.00 0.00 ? 26 LYS A CA   6  
ATOM 10210 C C    . LYS A 1 26 ? 1.534   -2.411  17.686  1.00 0.00 ? 26 LYS A C    6  
ATOM 10211 O O    . LYS A 1 26 ? 1.126   -3.009  16.691  1.00 0.00 ? 26 LYS A O    6  
ATOM 10212 C CB   . LYS A 1 26 ? 1.178   0.063   17.739  1.00 0.00 ? 26 LYS A CB   6  
ATOM 10213 C CG   . LYS A 1 26 ? 0.841   0.350   19.194  1.00 0.00 ? 26 LYS A CG   6  
ATOM 10214 C CD   . LYS A 1 26 ? 1.518   1.620   19.684  1.00 0.00 ? 26 LYS A CD   6  
ATOM 10215 C CE   . LYS A 1 26 ? 0.762   2.241   20.847  1.00 0.00 ? 26 LYS A CE   6  
ATOM 10216 N NZ   . LYS A 1 26 ? 0.537   1.266   21.950  1.00 0.00 ? 26 LYS A NZ   6  
ATOM 10217 H H    . LYS A 1 26 ? 2.462   -1.302  15.468  1.00 0.00 ? 26 LYS A H    6  
ATOM 10218 H HA   . LYS A 1 26 ? 2.961   -0.962  18.329  1.00 0.00 ? 26 LYS A HA   6  
ATOM 10219 H HB2  . LYS A 1 26 ? 1.562   0.970   17.294  1.00 0.00 ? 26 LYS A HB2  6  
ATOM 10220 H HB3  . LYS A 1 26 ? 0.268   -0.219  17.230  1.00 0.00 ? 26 LYS A HB3  6  
ATOM 10221 H HG2  . LYS A 1 26 ? -0.229  0.465   19.289  1.00 0.00 ? 26 LYS A HG2  6  
ATOM 10222 H HG3  . LYS A 1 26 ? 1.171   -0.481  19.800  1.00 0.00 ? 26 LYS A HG3  6  
ATOM 10223 H HD2  . LYS A 1 26 ? 2.520   1.380   20.006  1.00 0.00 ? 26 LYS A HD2  6  
ATOM 10224 H HD3  . LYS A 1 26 ? 1.559   2.330   18.872  1.00 0.00 ? 26 LYS A HD3  6  
ATOM 10225 H HE2  . LYS A 1 26 ? 1.334   3.074   21.228  1.00 0.00 ? 26 LYS A HE2  6  
ATOM 10226 H HE3  . LYS A 1 26 ? -0.194  2.596   20.490  1.00 0.00 ? 26 LYS A HE3  6  
ATOM 10227 H HZ1  . LYS A 1 26 ? -0.088  1.680   22.671  1.00 0.00 ? 26 LYS A HZ1  6  
ATOM 10228 H HZ2  . LYS A 1 26 ? 1.442   1.014   22.394  1.00 0.00 ? 26 LYS A HZ2  6  
ATOM 10229 H HZ3  . LYS A 1 26 ? 0.094   0.402   21.577  1.00 0.00 ? 26 LYS A HZ3  6  
ATOM 10230 N N    . GLY A 1 27 ? 1.416   -2.891  18.919  1.00 0.00 ? 27 GLY A N    6  
ATOM 10231 C CA   . GLY A 1 27 ? 0.786   -4.175  19.157  1.00 0.00 ? 27 GLY A CA   6  
ATOM 10232 C C    . GLY A 1 27 ? -0.668  -4.194  18.728  1.00 0.00 ? 27 GLY A C    6  
ATOM 10233 O O    . GLY A 1 27 ? -1.342  -3.165  18.752  1.00 0.00 ? 27 GLY A O    6  
ATOM 10234 H H    . GLY A 1 27 ? 1.758   -2.368  19.673  1.00 0.00 ? 27 GLY A H    6  
ATOM 10235 H HA2  . GLY A 1 27 ? 1.323   -4.935  18.607  1.00 0.00 ? 27 GLY A HA2  6  
ATOM 10236 H HA3  . GLY A 1 27 ? 0.842   -4.402  20.211  1.00 0.00 ? 27 GLY A HA3  6  
ATOM 10237 N N    . ASN A 1 28 ? -1.148  -5.369  18.332  1.00 0.00 ? 28 ASN A N    6  
ATOM 10238 C CA   . ASN A 1 28 ? -2.531  -5.531  17.889  1.00 0.00 ? 28 ASN A CA   6  
ATOM 10239 C C    . ASN A 1 28 ? -2.743  -4.900  16.515  1.00 0.00 ? 28 ASN A C    6  
ATOM 10240 O O    . ASN A 1 28 ? -2.842  -5.604  15.511  1.00 0.00 ? 28 ASN A O    6  
ATOM 10241 C CB   . ASN A 1 28 ? -3.503  -4.926  18.907  1.00 0.00 ? 28 ASN A CB   6  
ATOM 10242 C CG   . ASN A 1 28 ? -3.217  -5.385  20.324  1.00 0.00 ? 28 ASN A CG   6  
ATOM 10243 O OD1  . ASN A 1 28 ? -3.549  -6.508  20.704  1.00 0.00 ? 28 ASN A OD1  6  
ATOM 10244 N ND2  . ASN A 1 28 ? -2.597  -4.516  21.114  1.00 0.00 ? 28 ASN A ND2  6  
ATOM 10245 H H    . ASN A 1 28 ? -0.555  -6.150  18.332  1.00 0.00 ? 28 ASN A H    6  
ATOM 10246 H HA   . ASN A 1 28 ? -2.725  -6.591  17.812  1.00 0.00 ? 28 ASN A HA   6  
ATOM 10247 H HB2  . ASN A 1 28 ? -3.428  -3.850  18.877  1.00 0.00 ? 28 ASN A HB2  6  
ATOM 10248 H HB3  . ASN A 1 28 ? -4.511  -5.219  18.651  1.00 0.00 ? 28 ASN A HB3  6  
ATOM 10249 H HD21 . ASN A 1 28 ? -2.363  -3.639  20.744  1.00 0.00 ? 28 ASN A HD21 6  
ATOM 10250 H HD22 . ASN A 1 28 ? -2.400  -4.787  22.034  1.00 0.00 ? 28 ASN A HD22 6  
ATOM 10251 N N    . GLN A 1 29 ? -2.817  -3.572  16.473  1.00 0.00 ? 29 GLN A N    6  
ATOM 10252 C CA   . GLN A 1 29 ? -3.021  -2.861  15.216  1.00 0.00 ? 29 GLN A CA   6  
ATOM 10253 C C    . GLN A 1 29 ? -1.875  -1.893  14.940  1.00 0.00 ? 29 GLN A C    6  
ATOM 10254 O O    . GLN A 1 29 ? -1.505  -1.089  15.795  1.00 0.00 ? 29 GLN A O    6  
ATOM 10255 C CB   . GLN A 1 29 ? -4.349  -2.101  15.245  1.00 0.00 ? 29 GLN A CB   6  
ATOM 10256 C CG   . GLN A 1 29 ? -5.534  -2.927  14.771  1.00 0.00 ? 29 GLN A CG   6  
ATOM 10257 C CD   . GLN A 1 29 ? -5.654  -4.250  15.502  1.00 0.00 ? 29 GLN A CD   6  
ATOM 10258 O OE1  . GLN A 1 29 ? -5.582  -4.303  16.730  1.00 0.00 ? 29 GLN A OE1  6  
ATOM 10259 N NE2  . GLN A 1 29 ? -5.838  -5.328  14.749  1.00 0.00 ? 29 GLN A NE2  6  
ATOM 10260 H H    . GLN A 1 29 ? -2.736  -3.057  17.302  1.00 0.00 ? 29 GLN A H    6  
ATOM 10261 H HA   . GLN A 1 29 ? -3.055  -3.594  14.423  1.00 0.00 ? 29 GLN A HA   6  
ATOM 10262 H HB2  . GLN A 1 29 ? -4.544  -1.778  16.257  1.00 0.00 ? 29 GLN A HB2  6  
ATOM 10263 H HB3  . GLN A 1 29 ? -4.267  -1.233  14.609  1.00 0.00 ? 29 GLN A HB3  6  
ATOM 10264 H HG2  . GLN A 1 29 ? -6.439  -2.361  14.933  1.00 0.00 ? 29 GLN A HG2  6  
ATOM 10265 H HG3  . GLN A 1 29 ? -5.419  -3.125  13.715  1.00 0.00 ? 29 GLN A HG3  6  
ATOM 10266 H HE21 . GLN A 1 29 ? -5.885  -5.211  13.777  1.00 0.00 ? 29 GLN A HE21 6  
ATOM 10267 H HE22 . GLN A 1 29 ? -5.918  -6.196  15.195  1.00 0.00 ? 29 GLN A HE22 6  
ATOM 10268 N N    . VAL A 1 30 ? -1.310  -1.987  13.741  1.00 0.00 ? 30 VAL A N    6  
ATOM 10269 C CA   . VAL A 1 30 ? -0.195  -1.132  13.346  1.00 0.00 ? 30 VAL A CA   6  
ATOM 10270 C C    . VAL A 1 30 ? -0.685  0.113   12.618  1.00 0.00 ? 30 VAL A C    6  
ATOM 10271 O O    . VAL A 1 30 ? -1.569  0.037   11.764  1.00 0.00 ? 30 VAL A O    6  
ATOM 10272 C CB   . VAL A 1 30 ? 0.797   -1.886  12.441  1.00 0.00 ? 30 VAL A CB   6  
ATOM 10273 C CG1  . VAL A 1 30 ? 1.588   -2.903  13.248  1.00 0.00 ? 30 VAL A CG1  6  
ATOM 10274 C CG2  . VAL A 1 30 ? 0.065   -2.559  11.290  1.00 0.00 ? 30 VAL A CG2  6  
ATOM 10275 H H    . VAL A 1 30 ? -1.640  -2.662  13.110  1.00 0.00 ? 30 VAL A H    6  
ATOM 10276 H HA   . VAL A 1 30 ? 0.326   -0.831  14.243  1.00 0.00 ? 30 VAL A HA   6  
ATOM 10277 H HB   . VAL A 1 30 ? 1.492   -1.169  12.028  1.00 0.00 ? 30 VAL A HB   6  
ATOM 10278 H HG11 . VAL A 1 30 ? 2.005   -3.645  12.583  1.00 0.00 ? 30 VAL A HG11 6  
ATOM 10279 H HG12 . VAL A 1 30 ? 0.934   -3.385  13.960  1.00 0.00 ? 30 VAL A HG12 6  
ATOM 10280 H HG13 . VAL A 1 30 ? 2.387   -2.402  13.775  1.00 0.00 ? 30 VAL A HG13 6  
ATOM 10281 H HG21 . VAL A 1 30 ? 0.725   -2.634  10.438  1.00 0.00 ? 30 VAL A HG21 6  
ATOM 10282 H HG22 . VAL A 1 30 ? -0.802  -1.973  11.023  1.00 0.00 ? 30 VAL A HG22 6  
ATOM 10283 H HG23 . VAL A 1 30 ? -0.247  -3.548  11.591  1.00 0.00 ? 30 VAL A HG23 6  
ATOM 10284 N N    . ARG A 1 31 ? -0.099  1.260   12.952  1.00 0.00 ? 31 ARG A N    6  
ATOM 10285 C CA   . ARG A 1 31 ? -0.466  2.514   12.325  1.00 0.00 ? 31 ARG A CA   6  
ATOM 10286 C C    . ARG A 1 31 ? 0.124   2.596   10.924  1.00 0.00 ? 31 ARG A C    6  
ATOM 10287 O O    . ARG A 1 31 ? 1.323   2.813   10.757  1.00 0.00 ? 31 ARG A O    6  
ATOM 10288 C CB   . ARG A 1 31 ? 0.014   3.696   13.172  1.00 0.00 ? 31 ARG A CB   6  
ATOM 10289 C CG   . ARG A 1 31 ? -1.090  4.345   13.990  1.00 0.00 ? 31 ARG A CG   6  
ATOM 10290 C CD   . ARG A 1 31 ? -0.947  4.030   15.471  1.00 0.00 ? 31 ARG A CD   6  
ATOM 10291 N NE   . ARG A 1 31 ? -2.161  4.348   16.218  1.00 0.00 ? 31 ARG A NE   6  
ATOM 10292 C CZ   . ARG A 1 31 ? -2.498  5.579   16.595  1.00 0.00 ? 31 ARG A CZ   6  
ATOM 10293 N NH1  . ARG A 1 31 ? -1.715  6.609   16.299  1.00 0.00 ? 31 ARG A NH1  6  
ATOM 10294 N NH2  . ARG A 1 31 ? -3.621  5.782   17.270  1.00 0.00 ? 31 ARG A NH2  6  
ATOM 10295 H H    . ARG A 1 31 ? 0.607   1.264   13.618  1.00 0.00 ? 31 ARG A H    6  
ATOM 10296 H HA   . ARG A 1 31 ? -1.533  2.541   12.260  1.00 0.00 ? 31 ARG A HA   6  
ATOM 10297 H HB2  . ARG A 1 31 ? 0.780   3.350   13.850  1.00 0.00 ? 31 ARG A HB2  6  
ATOM 10298 H HB3  . ARG A 1 31 ? 0.436   4.446   12.518  1.00 0.00 ? 31 ARG A HB3  6  
ATOM 10299 H HG2  . ARG A 1 31 ? -1.044  5.415   13.855  1.00 0.00 ? 31 ARG A HG2  6  
ATOM 10300 H HG3  . ARG A 1 31 ? -2.045  3.977   13.644  1.00 0.00 ? 31 ARG A HG3  6  
ATOM 10301 H HD2  . ARG A 1 31 ? -0.733  2.977   15.583  1.00 0.00 ? 31 ARG A HD2  6  
ATOM 10302 H HD3  . ARG A 1 31 ? -0.127  4.608   15.871  1.00 0.00 ? 31 ARG A HD3  6  
ATOM 10303 H HE   . ARG A 1 31 ? -2.758  3.606   16.450  1.00 0.00 ? 31 ARG A HE   6  
ATOM 10304 H HH11 . ARG A 1 31 ? -0.867  6.464   15.789  1.00 0.00 ? 31 ARG A HH11 6  
ATOM 10305 H HH12 . ARG A 1 31 ? -1.973  7.532   16.585  1.00 0.00 ? 31 ARG A HH12 6  
ATOM 10306 H HH21 . ARG A 1 31 ? -4.215  5.009   17.496  1.00 0.00 ? 31 ARG A HH21 6  
ATOM 10307 H HH22 . ARG A 1 31 ? -3.874  6.707   17.554  1.00 0.00 ? 31 ARG A HH22 6  
ATOM 10308 N N    . ILE A 1 32 ? -0.721  2.407   9.918   1.00 0.00 ? 32 ILE A N    6  
ATOM 10309 C CA   . ILE A 1 32 ? -0.271  2.444   8.533   1.00 0.00 ? 32 ILE A CA   6  
ATOM 10310 C C    . ILE A 1 32 ? -0.299  3.864   7.982   1.00 0.00 ? 32 ILE A C    6  
ATOM 10311 O O    . ILE A 1 32 ? -1.302  4.567   8.100   1.00 0.00 ? 32 ILE A O    6  
ATOM 10312 C CB   . ILE A 1 32 ? -1.139  1.535   7.641   1.00 0.00 ? 32 ILE A CB   6  
ATOM 10313 C CG1  . ILE A 1 32 ? -1.422  0.206   8.351   1.00 0.00 ? 32 ILE A CG1  6  
ATOM 10314 C CG2  . ILE A 1 32 ? -0.454  1.295   6.303   1.00 0.00 ? 32 ILE A CG2  6  
ATOM 10315 C CD1  . ILE A 1 32 ? -0.193  -0.659  8.532   1.00 0.00 ? 32 ILE A CD1  6  
ATOM 10316 H H    . ILE A 1 32 ? -1.666  2.226   10.111  1.00 0.00 ? 32 ILE A H    6  
ATOM 10317 H HA   . ILE A 1 32 ? 0.745   2.077   8.504   1.00 0.00 ? 32 ILE A HA   6  
ATOM 10318 H HB   . ILE A 1 32 ? -2.074  2.040   7.453   1.00 0.00 ? 32 ILE A HB   6  
ATOM 10319 H HG12 . ILE A 1 32 ? -1.830  0.408   9.331   1.00 0.00 ? 32 ILE A HG12 6  
ATOM 10320 H HG13 . ILE A 1 32 ? -2.143  -0.357  7.776   1.00 0.00 ? 32 ILE A HG13 6  
ATOM 10321 H HG21 . ILE A 1 32 ? 0.616   1.371   6.428   1.00 0.00 ? 32 ILE A HG21 6  
ATOM 10322 H HG22 . ILE A 1 32 ? -0.787  2.035   5.591   1.00 0.00 ? 32 ILE A HG22 6  
ATOM 10323 H HG23 . ILE A 1 32 ? -0.706  0.309   5.942   1.00 0.00 ? 32 ILE A HG23 6  
ATOM 10324 H HD11 . ILE A 1 32 ? 0.467   -0.200  9.253   1.00 0.00 ? 32 ILE A HD11 6  
ATOM 10325 H HD12 . ILE A 1 32 ? 0.320   -0.758  7.586   1.00 0.00 ? 32 ILE A HD12 6  
ATOM 10326 H HD13 . ILE A 1 32 ? -0.489  -1.636  8.885   1.00 0.00 ? 32 ILE A HD13 6  
ATOM 10327 N N    . GLY A 1 33 ? 0.811   4.279   7.375   1.00 0.00 ? 33 GLY A N    6  
ATOM 10328 C CA   . GLY A 1 33 ? 0.897   5.612   6.810   1.00 0.00 ? 33 GLY A CA   6  
ATOM 10329 C C    . GLY A 1 33 ? 0.770   5.602   5.302   1.00 0.00 ? 33 GLY A C    6  
ATOM 10330 O O    . GLY A 1 33 ? 1.679   5.159   4.601   1.00 0.00 ? 33 GLY A O    6  
ATOM 10331 H H    . GLY A 1 33 ? 1.578   3.672   7.304   1.00 0.00 ? 33 GLY A H    6  
ATOM 10332 H HA2  . GLY A 1 33 ? 0.109   6.220   7.222   1.00 0.00 ? 33 GLY A HA2  6  
ATOM 10333 H HA3  . GLY A 1 33 ? 1.849   6.044   7.077   1.00 0.00 ? 33 GLY A HA3  6  
ATOM 10334 N N    . VAL A 1 34 ? -0.361  6.084   4.798   1.00 0.00 ? 34 VAL A N    6  
ATOM 10335 C CA   . VAL A 1 34 ? -0.592  6.115   3.362   1.00 0.00 ? 34 VAL A CA   6  
ATOM 10336 C C    . VAL A 1 34 ? -0.506  7.533   2.810   1.00 0.00 ? 34 VAL A C    6  
ATOM 10337 O O    . VAL A 1 34 ? -1.433  8.329   2.963   1.00 0.00 ? 34 VAL A O    6  
ATOM 10338 C CB   . VAL A 1 34 ? -1.970  5.525   3.003   1.00 0.00 ? 34 VAL A CB   6  
ATOM 10339 C CG1  . VAL A 1 34 ? -2.085  5.306   1.503   1.00 0.00 ? 34 VAL A CG1  6  
ATOM 10340 C CG2  . VAL A 1 34 ? -2.210  4.227   3.760   1.00 0.00 ? 34 VAL A CG2  6  
ATOM 10341 H H    . VAL A 1 34 ? -1.054  6.419   5.405   1.00 0.00 ? 34 VAL A H    6  
ATOM 10342 H HA   . VAL A 1 34 ? 0.167   5.510   2.889   1.00 0.00 ? 34 VAL A HA   6  
ATOM 10343 H HB   . VAL A 1 34 ? -2.729  6.234   3.299   1.00 0.00 ? 34 VAL A HB   6  
ATOM 10344 H HG11 . VAL A 1 34 ? -3.106  5.471   1.193   1.00 0.00 ? 34 VAL A HG11 6  
ATOM 10345 H HG12 . VAL A 1 34 ? -1.796  4.293   1.263   1.00 0.00 ? 34 VAL A HG12 6  
ATOM 10346 H HG13 . VAL A 1 34 ? -1.436  5.998   0.987   1.00 0.00 ? 34 VAL A HG13 6  
ATOM 10347 H HG21 . VAL A 1 34 ? -2.470  4.451   4.784   1.00 0.00 ? 34 VAL A HG21 6  
ATOM 10348 H HG22 . VAL A 1 34 ? -1.313  3.627   3.739   1.00 0.00 ? 34 VAL A HG22 6  
ATOM 10349 H HG23 . VAL A 1 34 ? -3.018  3.683   3.294   1.00 0.00 ? 34 VAL A HG23 6  
ATOM 10350 N N    . ASN A 1 35 ? 0.614   7.838   2.163   1.00 0.00 ? 35 ASN A N    6  
ATOM 10351 C CA   . ASN A 1 35 ? 0.817   9.157   1.581   1.00 0.00 ? 35 ASN A CA   6  
ATOM 10352 C C    . ASN A 1 35 ? 0.449   9.147   0.102   1.00 0.00 ? 35 ASN A C    6  
ATOM 10353 O O    . ASN A 1 35 ? 1.162   8.583   -0.726  1.00 0.00 ? 35 ASN A O    6  
ATOM 10354 C CB   . ASN A 1 35 ? 2.268   9.609   1.761   1.00 0.00 ? 35 ASN A CB   6  
ATOM 10355 C CG   . ASN A 1 35 ? 2.373   11.061  2.184   1.00 0.00 ? 35 ASN A CG   6  
ATOM 10356 O OD1  . ASN A 1 35 ? 1.512   11.878  1.858   1.00 0.00 ? 35 ASN A OD1  6  
ATOM 10357 N ND2  . ASN A 1 35 ? 3.432   11.390  2.915   1.00 0.00 ? 35 ASN A ND2  6  
ATOM 10358 H H    . ASN A 1 35 ? 1.314   7.157   2.086   1.00 0.00 ? 35 ASN A H    6  
ATOM 10359 H HA   . ASN A 1 35 ? 0.167   9.849   2.096   1.00 0.00 ? 35 ASN A HA   6  
ATOM 10360 H HB2  . ASN A 1 35 ? 2.738   8.998   2.518   1.00 0.00 ? 35 ASN A HB2  6  
ATOM 10361 H HB3  . ASN A 1 35 ? 2.796   9.487   0.827   1.00 0.00 ? 35 ASN A HB3  6  
ATOM 10362 H HD21 . ASN A 1 35 ? 4.077   10.687  3.137   1.00 0.00 ? 35 ASN A HD21 6  
ATOM 10363 H HD22 . ASN A 1 35 ? 3.524   12.322  3.203   1.00 0.00 ? 35 ASN A HD22 6  
ATOM 10364 N N    . ALA A 1 36 ? -0.679  9.768   -0.215  1.00 0.00 ? 36 ALA A N    6  
ATOM 10365 C CA   . ALA A 1 36 ? -1.159  9.826   -1.591  1.00 0.00 ? 36 ALA A CA   6  
ATOM 10366 C C    . ALA A 1 36 ? -1.655  11.223  -1.958  1.00 0.00 ? 36 ALA A C    6  
ATOM 10367 O O    . ALA A 1 36 ? -2.198  11.941  -1.118  1.00 0.00 ? 36 ALA A O    6  
ATOM 10368 C CB   . ALA A 1 36 ? -2.264  8.803   -1.804  1.00 0.00 ? 36 ALA A CB   6  
ATOM 10369 H H    . ALA A 1 36 ? -1.200  10.182  0.503   1.00 0.00 ? 36 ALA A H    6  
ATOM 10370 H HA   . ALA A 1 36 ? -0.335  9.568   -2.239  1.00 0.00 ? 36 ALA A HA   6  
ATOM 10371 H HB1  . ALA A 1 36 ? -3.224  9.268   -1.636  1.00 0.00 ? 36 ALA A HB1  6  
ATOM 10372 H HB2  . ALA A 1 36 ? -2.134  7.984   -1.112  1.00 0.00 ? 36 ALA A HB2  6  
ATOM 10373 H HB3  . ALA A 1 36 ? -2.218  8.429   -2.816  1.00 0.00 ? 36 ALA A HB3  6  
ATOM 10374 N N    . PRO A 1 37 ? -1.478  11.622  -3.230  1.00 0.00 ? 37 PRO A N    6  
ATOM 10375 C CA   . PRO A 1 37 ? -1.910  12.930  -3.721  1.00 0.00 ? 37 PRO A CA   6  
ATOM 10376 C C    . PRO A 1 37 ? -3.398  12.958  -4.044  1.00 0.00 ? 37 PRO A C    6  
ATOM 10377 O O    . PRO A 1 37 ? -4.005  11.920  -4.308  1.00 0.00 ? 37 PRO A O    6  
ATOM 10378 C CB   . PRO A 1 37 ? -1.085  13.103  -4.992  1.00 0.00 ? 37 PRO A CB   6  
ATOM 10379 C CG   . PRO A 1 37 ? -0.915  11.717  -5.509  1.00 0.00 ? 37 PRO A CG   6  
ATOM 10380 C CD   . PRO A 1 37 ? -0.842  10.822  -4.298  1.00 0.00 ? 37 PRO A CD   6  
ATOM 10381 H HA   . PRO A 1 37 ? -1.674  13.718  -3.020  1.00 0.00 ? 37 PRO A HA   6  
ATOM 10382 H HB2  . PRO A 1 37 ? -1.622  13.727  -5.692  1.00 0.00 ? 37 PRO A HB2  6  
ATOM 10383 H HB3  . PRO A 1 37 ? -0.134  13.554  -4.752  1.00 0.00 ? 37 PRO A HB3  6  
ATOM 10384 H HG2  . PRO A 1 37 ? -1.763  11.449  -6.122  1.00 0.00 ? 37 PRO A HG2  6  
ATOM 10385 H HG3  . PRO A 1 37 ? -0.002  11.648  -6.081  1.00 0.00 ? 37 PRO A HG3  6  
ATOM 10386 H HD2  . PRO A 1 37 ? -1.392  9.908   -4.471  1.00 0.00 ? 37 PRO A HD2  6  
ATOM 10387 H HD3  . PRO A 1 37 ? 0.186   10.603  -4.053  1.00 0.00 ? 37 PRO A HD3  6  
ATOM 10388 N N    . LYS A 1 38 ? -3.984  14.150  -4.023  1.00 0.00 ? 38 LYS A N    6  
ATOM 10389 C CA   . LYS A 1 38 ? -5.404  14.306  -4.316  1.00 0.00 ? 38 LYS A CA   6  
ATOM 10390 C C    . LYS A 1 38 ? -5.633  14.599  -5.797  1.00 0.00 ? 38 LYS A C    6  
ATOM 10391 O O    . LYS A 1 38 ? -6.563  15.320  -6.157  1.00 0.00 ? 38 LYS A O    6  
ATOM 10392 C CB   . LYS A 1 38 ? -6.000  15.429  -3.465  1.00 0.00 ? 38 LYS A CB   6  
ATOM 10393 C CG   . LYS A 1 38 ? -6.385  14.989  -2.062  1.00 0.00 ? 38 LYS A CG   6  
ATOM 10394 C CD   . LYS A 1 38 ? -5.387  15.486  -1.027  1.00 0.00 ? 38 LYS A CD   6  
ATOM 10395 C CE   . LYS A 1 38 ? -5.988  15.487  0.370   1.00 0.00 ? 38 LYS A CE   6  
ATOM 10396 N NZ   . LYS A 1 38 ? -4.944  15.358  1.424   1.00 0.00 ? 38 LYS A NZ   6  
ATOM 10397 H H    . LYS A 1 38 ? -3.450  14.942  -3.807  1.00 0.00 ? 38 LYS A H    6  
ATOM 10398 H HA   . LYS A 1 38 ? -5.897  13.378  -4.066  1.00 0.00 ? 38 LYS A HA   6  
ATOM 10399 H HB2  . LYS A 1 38 ? -5.276  16.227  -3.385  1.00 0.00 ? 38 LYS A HB2  6  
ATOM 10400 H HB3  . LYS A 1 38 ? -6.884  15.806  -3.957  1.00 0.00 ? 38 LYS A HB3  6  
ATOM 10401 H HG2  . LYS A 1 38 ? -7.360  15.387  -1.825  1.00 0.00 ? 38 LYS A HG2  6  
ATOM 10402 H HG3  . LYS A 1 38 ? -6.417  13.910  -2.029  1.00 0.00 ? 38 LYS A HG3  6  
ATOM 10403 H HD2  . LYS A 1 38 ? -4.522  14.839  -1.035  1.00 0.00 ? 38 LYS A HD2  6  
ATOM 10404 H HD3  . LYS A 1 38 ? -5.089  16.492  -1.282  1.00 0.00 ? 38 LYS A HD3  6  
ATOM 10405 H HE2  . LYS A 1 38 ? -6.522  16.413  0.517   1.00 0.00 ? 38 LYS A HE2  6  
ATOM 10406 H HE3  . LYS A 1 38 ? -6.675  14.658  0.453   1.00 0.00 ? 38 LYS A HE3  6  
ATOM 10407 H HZ1  . LYS A 1 38 ? -5.299  14.778  2.211   1.00 0.00 ? 38 LYS A HZ1  6  
ATOM 10408 H HZ2  . LYS A 1 38 ? -4.686  16.297  1.789   1.00 0.00 ? 38 LYS A HZ2  6  
ATOM 10409 H HZ3  . LYS A 1 38 ? -4.093  14.907  1.031   1.00 0.00 ? 38 LYS A HZ3  6  
ATOM 10410 N N    . GLU A 1 39 ? -4.781  14.039  -6.653  1.00 0.00 ? 39 GLU A N    6  
ATOM 10411 C CA   . GLU A 1 39 ? -4.898  14.247  -8.092  1.00 0.00 ? 39 GLU A CA   6  
ATOM 10412 C C    . GLU A 1 39 ? -5.220  12.938  -8.808  1.00 0.00 ? 39 GLU A C    6  
ATOM 10413 O O    . GLU A 1 39 ? -6.040  12.908  -9.726  1.00 0.00 ? 39 GLU A O    6  
ATOM 10414 C CB   . GLU A 1 39 ? -3.603  14.840  -8.649  1.00 0.00 ? 39 GLU A CB   6  
ATOM 10415 C CG   . GLU A 1 39 ? -3.067  16.006  -7.834  1.00 0.00 ? 39 GLU A CG   6  
ATOM 10416 C CD   . GLU A 1 39 ? -3.070  17.311  -8.607  1.00 0.00 ? 39 GLU A CD   6  
ATOM 10417 O OE1  . GLU A 1 39 ? -4.119  17.652  -9.192  1.00 0.00 ? 39 GLU A OE1  6  
ATOM 10418 O OE2  . GLU A 1 39 ? -2.022  17.990  -8.629  1.00 0.00 ? 39 GLU A OE2  6  
ATOM 10419 H H    . GLU A 1 39 ? -4.057  13.475  -6.315  1.00 0.00 ? 39 GLU A H    6  
ATOM 10420 H HA   . GLU A 1 39 ? -5.705  14.944  -8.262  1.00 0.00 ? 39 GLU A HA   6  
ATOM 10421 H HB2  . GLU A 1 39 ? -2.848  14.068  -8.673  1.00 0.00 ? 39 GLU A HB2  6  
ATOM 10422 H HB3  . GLU A 1 39 ? -3.783  15.186  -9.657  1.00 0.00 ? 39 GLU A HB3  6  
ATOM 10423 H HG2  . GLU A 1 39 ? -3.682  16.127  -6.954  1.00 0.00 ? 39 GLU A HG2  6  
ATOM 10424 H HG3  . GLU A 1 39 ? -2.053  15.784  -7.535  1.00 0.00 ? 39 GLU A HG3  6  
ATOM 10425 N N    . VAL A 1 40 ? -4.572  11.857  -8.383  1.00 0.00 ? 40 VAL A N    6  
ATOM 10426 C CA   . VAL A 1 40 ? -4.795  10.547  -8.986  1.00 0.00 ? 40 VAL A CA   6  
ATOM 10427 C C    . VAL A 1 40 ? -6.095  9.932   -8.479  1.00 0.00 ? 40 VAL A C    6  
ATOM 10428 O O    . VAL A 1 40 ? -6.618  10.336  -7.440  1.00 0.00 ? 40 VAL A O    6  
ATOM 10429 C CB   . VAL A 1 40 ? -3.627  9.581   -8.698  1.00 0.00 ? 40 VAL A CB   6  
ATOM 10430 C CG1  . VAL A 1 40 ? -3.704  8.365   -9.606  1.00 0.00 ? 40 VAL A CG1  6  
ATOM 10431 C CG2  . VAL A 1 40 ? -2.291  10.292  -8.861  1.00 0.00 ? 40 VAL A CG2  6  
ATOM 10432 H H    . VAL A 1 40 ? -3.932  11.940  -7.646  1.00 0.00 ? 40 VAL A H    6  
ATOM 10433 H HA   . VAL A 1 40 ? -4.868  10.682  -10.056 1.00 0.00 ? 40 VAL A HA   6  
ATOM 10434 H HB   . VAL A 1 40 ? -3.707  9.242   -7.675  1.00 0.00 ? 40 VAL A HB   6  
ATOM 10435 H HG11 . VAL A 1 40 ? -4.538  7.748   -9.310  1.00 0.00 ? 40 VAL A HG11 6  
ATOM 10436 H HG12 . VAL A 1 40 ? -2.789  7.797   -9.526  1.00 0.00 ? 40 VAL A HG12 6  
ATOM 10437 H HG13 . VAL A 1 40 ? -3.839  8.687   -10.629 1.00 0.00 ? 40 VAL A HG13 6  
ATOM 10438 H HG21 . VAL A 1 40 ? -2.196  11.057  -8.105  1.00 0.00 ? 40 VAL A HG21 6  
ATOM 10439 H HG22 . VAL A 1 40 ? -2.241  10.744  -9.840  1.00 0.00 ? 40 VAL A HG22 6  
ATOM 10440 H HG23 . VAL A 1 40 ? -1.488  9.577   -8.753  1.00 0.00 ? 40 VAL A HG23 6  
ATOM 10441 N N    . SER A 1 41 ? -6.617  8.956   -9.216  1.00 0.00 ? 41 SER A N    6  
ATOM 10442 C CA   . SER A 1 41 ? -7.860  8.295   -8.832  1.00 0.00 ? 41 SER A CA   6  
ATOM 10443 C C    . SER A 1 41 ? -7.675  7.495   -7.548  1.00 0.00 ? 41 SER A C    6  
ATOM 10444 O O    . SER A 1 41 ? -7.042  6.439   -7.548  1.00 0.00 ? 41 SER A O    6  
ATOM 10445 C CB   . SER A 1 41 ? -8.349  7.381   -9.959  1.00 0.00 ? 41 SER A CB   6  
ATOM 10446 O OG   . SER A 1 41 ? -9.241  6.394   -9.468  1.00 0.00 ? 41 SER A OG   6  
ATOM 10447 H H    . SER A 1 41 ? -6.158  8.675   -10.035 1.00 0.00 ? 41 SER A H    6  
ATOM 10448 H HA   . SER A 1 41 ? -8.600  9.062   -8.658  1.00 0.00 ? 41 SER A HA   6  
ATOM 10449 H HB2  . SER A 1 41 ? -8.862  7.972   -10.702 1.00 0.00 ? 41 SER A HB2  6  
ATOM 10450 H HB3  . SER A 1 41 ? -7.502  6.889   -10.414 1.00 0.00 ? 41 SER A HB3  6  
ATOM 10451 H HG   . SER A 1 41 ? -9.912  6.212   -10.130 1.00 0.00 ? 41 SER A HG   6  
ATOM 10452 N N    . VAL A 1 42 ? -8.230  8.007   -6.453  1.00 0.00 ? 42 VAL A N    6  
ATOM 10453 C CA   . VAL A 1 42 ? -8.125  7.342   -5.160  1.00 0.00 ? 42 VAL A CA   6  
ATOM 10454 C C    . VAL A 1 42 ? -9.506  7.034   -4.586  1.00 0.00 ? 42 VAL A C    6  
ATOM 10455 O O    . VAL A 1 42 ? -10.342 7.928   -4.447  1.00 0.00 ? 42 VAL A O    6  
ATOM 10456 C CB   . VAL A 1 42 ? -7.340  8.204   -4.152  1.00 0.00 ? 42 VAL A CB   6  
ATOM 10457 C CG1  . VAL A 1 42 ? -8.061  9.518   -3.888  1.00 0.00 ? 42 VAL A CG1  6  
ATOM 10458 C CG2  . VAL A 1 42 ? -7.115  7.441   -2.854  1.00 0.00 ? 42 VAL A CG2  6  
ATOM 10459 H H    . VAL A 1 42 ? -8.721  8.852   -6.516  1.00 0.00 ? 42 VAL A H    6  
ATOM 10460 H HA   . VAL A 1 42 ? -7.588  6.416   -5.305  1.00 0.00 ? 42 VAL A HA   6  
ATOM 10461 H HB   . VAL A 1 42 ? -6.375  8.432   -4.581  1.00 0.00 ? 42 VAL A HB   6  
ATOM 10462 H HG11 . VAL A 1 42 ? -7.419  10.173  -3.319  1.00 0.00 ? 42 VAL A HG11 6  
ATOM 10463 H HG12 . VAL A 1 42 ? -8.966  9.326   -3.331  1.00 0.00 ? 42 VAL A HG12 6  
ATOM 10464 H HG13 . VAL A 1 42 ? -8.310  9.986   -4.829  1.00 0.00 ? 42 VAL A HG13 6  
ATOM 10465 H HG21 . VAL A 1 42 ? -7.840  7.759   -2.119  1.00 0.00 ? 42 VAL A HG21 6  
ATOM 10466 H HG22 . VAL A 1 42 ? -6.119  7.640   -2.487  1.00 0.00 ? 42 VAL A HG22 6  
ATOM 10467 H HG23 . VAL A 1 42 ? -7.227  6.382   -3.035  1.00 0.00 ? 42 VAL A HG23 6  
ATOM 10468 N N    . HIS A 1 43 ? -9.736  5.771   -4.238  1.00 0.00 ? 43 HIS A N    6  
ATOM 10469 C CA   . HIS A 1 43 ? -11.008 5.352   -3.662  1.00 0.00 ? 43 HIS A CA   6  
ATOM 10470 C C    . HIS A 1 43 ? -10.771 4.567   -2.377  1.00 0.00 ? 43 HIS A C    6  
ATOM 10471 O O    . HIS A 1 43 ? -10.049 3.570   -2.379  1.00 0.00 ? 43 HIS A O    6  
ATOM 10472 C CB   . HIS A 1 43 ? -11.792 4.499   -4.662  1.00 0.00 ? 43 HIS A CB   6  
ATOM 10473 C CG   . HIS A 1 43 ? -13.275 4.564   -4.470  1.00 0.00 ? 43 HIS A CG   6  
ATOM 10474 N ND1  . HIS A 1 43 ? -14.123 5.190   -5.359  1.00 0.00 ? 43 HIS A ND1  6  
ATOM 10475 C CD2  . HIS A 1 43 ? -14.064 4.075   -3.484  1.00 0.00 ? 43 HIS A CD2  6  
ATOM 10476 C CE1  . HIS A 1 43 ? -15.367 5.087   -4.929  1.00 0.00 ? 43 HIS A CE1  6  
ATOM 10477 N NE2  . HIS A 1 43 ? -15.360 4.414   -3.793  1.00 0.00 ? 43 HIS A NE2  6  
ATOM 10478 H H    . HIS A 1 43 ? -9.029  5.102   -4.351  1.00 0.00 ? 43 HIS A H    6  
ATOM 10479 H HA   . HIS A 1 43 ? -11.578 6.240   -3.431  1.00 0.00 ? 43 HIS A HA   6  
ATOM 10480 H HB2  . HIS A 1 43 ? -11.571 4.837   -5.663  1.00 0.00 ? 43 HIS A HB2  6  
ATOM 10481 H HB3  . HIS A 1 43 ? -11.487 3.467   -4.560  1.00 0.00 ? 43 HIS A HB3  6  
ATOM 10482 H HD2  . HIS A 1 43 ? -13.736 3.521   -2.615  1.00 0.00 ? 43 HIS A HD2  6  
ATOM 10483 H HE1  . HIS A 1 43 ? -16.242 5.483   -5.423  1.00 0.00 ? 43 HIS A HE1  6  
ATOM 10484 H HE2  . HIS A 1 43 ? -16.133 4.296   -3.202  1.00 0.00 ? 43 HIS A HE2  6  
ATOM 10485 N N    . ARG A 1 44 ? -11.374 5.013   -1.279  1.00 0.00 ? 44 ARG A N    6  
ATOM 10486 C CA   . ARG A 1 44 ? -11.215 4.338   0.004   1.00 0.00 ? 44 ARG A CA   6  
ATOM 10487 C C    . ARG A 1 44 ? -12.390 4.656   0.923   1.00 0.00 ? 44 ARG A C    6  
ATOM 10488 O O    . ARG A 1 44 ? -13.181 3.778   1.267   1.00 0.00 ? 44 ARG A O    6  
ATOM 10489 C CB   . ARG A 1 44 ? -9.906  4.763   0.676   1.00 0.00 ? 44 ARG A CB   6  
ATOM 10490 C CG   . ARG A 1 44 ? -8.688  4.662   -0.230  1.00 0.00 ? 44 ARG A CG   6  
ATOM 10491 C CD   . ARG A 1 44 ? -7.418  5.083   0.493   1.00 0.00 ? 44 ARG A CD   6  
ATOM 10492 N NE   . ARG A 1 44 ? -7.331  4.509   1.834   1.00 0.00 ? 44 ARG A NE   6  
ATOM 10493 C CZ   . ARG A 1 44 ? -6.561  5.001   2.802   1.00 0.00 ? 44 ARG A CZ   6  
ATOM 10494 N NH1  . ARG A 1 44 ? -5.804  6.068   2.581   1.00 0.00 ? 44 ARG A NH1  6  
ATOM 10495 N NH2  . ARG A 1 44 ? -6.548  4.423   3.996   1.00 0.00 ? 44 ARG A NH2  6  
ATOM 10496 H H    . ARG A 1 44 ? -11.944 5.810   -1.321  1.00 0.00 ? 44 ARG A H    6  
ATOM 10497 H HA   . ARG A 1 44 ? -11.191 3.274   -0.178  1.00 0.00 ? 44 ARG A HA   6  
ATOM 10498 H HB2  . ARG A 1 44 ? -9.999  5.787   1.003   1.00 0.00 ? 44 ARG A HB2  6  
ATOM 10499 H HB3  . ARG A 1 44 ? -9.739  4.134   1.538   1.00 0.00 ? 44 ARG A HB3  6  
ATOM 10500 H HG2  . ARG A 1 44 ? -8.580  3.640   -0.561  1.00 0.00 ? 44 ARG A HG2  6  
ATOM 10501 H HG3  . ARG A 1 44 ? -8.834  5.306   -1.085  1.00 0.00 ? 44 ARG A HG3  6  
ATOM 10502 H HD2  . ARG A 1 44 ? -6.566  4.756   -0.084  1.00 0.00 ? 44 ARG A HD2  6  
ATOM 10503 H HD3  . ARG A 1 44 ? -7.406  6.160   0.571   1.00 0.00 ? 44 ARG A HD3  6  
ATOM 10504 H HE   . ARG A 1 44 ? -7.875  3.716   2.023   1.00 0.00 ? 44 ARG A HE   6  
ATOM 10505 H HH11 . ARG A 1 44 ? -5.808  6.508   1.683   1.00 0.00 ? 44 ARG A HH11 6  
ATOM 10506 H HH12 . ARG A 1 44 ? -5.229  6.433   3.313   1.00 0.00 ? 44 ARG A HH12 6  
ATOM 10507 H HH21 . ARG A 1 44 ? -7.115  3.618   4.168   1.00 0.00 ? 44 ARG A HH21 6  
ATOM 10508 H HH22 . ARG A 1 44 ? -5.970  4.793   4.724   1.00 0.00 ? 44 ARG A HH22 6  
ATOM 10509 N N    . GLU A 1 45 ? -12.497 5.923   1.312   1.00 0.00 ? 45 GLU A N    6  
ATOM 10510 C CA   . GLU A 1 45 ? -13.573 6.371   2.187   1.00 0.00 ? 45 GLU A CA   6  
ATOM 10511 C C    . GLU A 1 45 ? -13.571 7.892   2.303   1.00 0.00 ? 45 GLU A C    6  
ATOM 10512 O O    . GLU A 1 45 ? -12.534 8.504   2.563   1.00 0.00 ? 45 GLU A O    6  
ATOM 10513 C CB   . GLU A 1 45 ? -13.436 5.737   3.573   1.00 0.00 ? 45 GLU A CB   6  
ATOM 10514 C CG   . GLU A 1 45 ? -14.769 5.400   4.222   1.00 0.00 ? 45 GLU A CG   6  
ATOM 10515 C CD   . GLU A 1 45 ? -15.641 4.523   3.345   1.00 0.00 ? 45 GLU A CD   6  
ATOM 10516 O OE1  . GLU A 1 45 ? -15.124 3.523   2.805   1.00 0.00 ? 45 GLU A OE1  6  
ATOM 10517 O OE2  . GLU A 1 45 ? -16.841 4.837   3.199   1.00 0.00 ? 45 GLU A OE2  6  
ATOM 10518 H H    . GLU A 1 45 ? -11.835 6.574   0.999   1.00 0.00 ? 45 GLU A H    6  
ATOM 10519 H HA   . GLU A 1 45 ? -14.509 6.058   1.747   1.00 0.00 ? 45 GLU A HA   6  
ATOM 10520 H HB2  . GLU A 1 45 ? -12.863 4.826   3.484   1.00 0.00 ? 45 GLU A HB2  6  
ATOM 10521 H HB3  . GLU A 1 45 ? -12.909 6.423   4.219   1.00 0.00 ? 45 GLU A HB3  6  
ATOM 10522 H HG2  . GLU A 1 45 ? -14.581 4.881   5.150   1.00 0.00 ? 45 GLU A HG2  6  
ATOM 10523 H HG3  . GLU A 1 45 ? -15.298 6.320   4.426   1.00 0.00 ? 45 GLU A HG3  6  
ATOM 10524 N N    . GLU A 1 46 ? -14.738 8.497   2.108   1.00 0.00 ? 46 GLU A N    6  
ATOM 10525 C CA   . GLU A 1 46 ? -14.871 9.947   2.188   1.00 0.00 ? 46 GLU A CA   6  
ATOM 10526 C C    . GLU A 1 46 ? -14.446 10.461  3.559   1.00 0.00 ? 46 GLU A C    6  
ATOM 10527 O O    . GLU A 1 46 ? -13.820 11.514  3.671   1.00 0.00 ? 46 GLU A O    6  
ATOM 10528 C CB   . GLU A 1 46 ? -16.314 10.364  1.899   1.00 0.00 ? 46 GLU A CB   6  
ATOM 10529 C CG   . GLU A 1 46 ? -17.350 9.509   2.613   1.00 0.00 ? 46 GLU A CG   6  
ATOM 10530 C CD   . GLU A 1 46 ? -18.302 8.821   1.654   1.00 0.00 ? 46 GLU A CD   6  
ATOM 10531 O OE1  . GLU A 1 46 ? -17.873 8.488   0.529   1.00 0.00 ? 46 GLU A OE1  6  
ATOM 10532 O OE2  . GLU A 1 46 ? -19.475 8.614   2.027   1.00 0.00 ? 46 GLU A OE2  6  
ATOM 10533 H H    . GLU A 1 46 ? -15.530 7.956   1.905   1.00 0.00 ? 46 GLU A H    6  
ATOM 10534 H HA   . GLU A 1 46 ? -14.225 10.380  1.439   1.00 0.00 ? 46 GLU A HA   6  
ATOM 10535 H HB2  . GLU A 1 46 ? -16.449 11.389  2.211   1.00 0.00 ? 46 GLU A HB2  6  
ATOM 10536 H HB3  . GLU A 1 46 ? -16.491 10.294  0.836   1.00 0.00 ? 46 GLU A HB3  6  
ATOM 10537 H HG2  . GLU A 1 46 ? -16.838 8.754   3.191   1.00 0.00 ? 46 GLU A HG2  6  
ATOM 10538 H HG3  . GLU A 1 46 ? -17.924 10.140  3.276   1.00 0.00 ? 46 GLU A HG3  6  
ATOM 10539 N N    . ILE A 1 47 ? -14.792 9.711   4.600   1.00 0.00 ? 47 ILE A N    6  
ATOM 10540 C CA   . ILE A 1 47 ? -14.450 10.090  5.965   1.00 0.00 ? 47 ILE A CA   6  
ATOM 10541 C C    . ILE A 1 47 ? -12.962 9.892   6.239   1.00 0.00 ? 47 ILE A C    6  
ATOM 10542 O O    . ILE A 1 47 ? -12.316 10.739  6.855   1.00 0.00 ? 47 ILE A O    6  
ATOM 10543 C CB   . ILE A 1 47 ? -15.261 9.273   6.990   1.00 0.00 ? 47 ILE A CB   6  
ATOM 10544 C CG1  . ILE A 1 47 ? -16.753 9.325   6.655   1.00 0.00 ? 47 ILE A CG1  6  
ATOM 10545 C CG2  . ILE A 1 47 ? -15.012 9.788   8.400   1.00 0.00 ? 47 ILE A CG2  6  
ATOM 10546 C CD1  . ILE A 1 47 ? -17.535 8.149   7.196   1.00 0.00 ? 47 ILE A CD1  6  
ATOM 10547 H H    . ILE A 1 47 ? -15.292 8.882   4.447   1.00 0.00 ? 47 ILE A H    6  
ATOM 10548 H HA   . ILE A 1 47 ? -14.695 11.134  6.093   1.00 0.00 ? 47 ILE A HA   6  
ATOM 10549 H HB   . ILE A 1 47 ? -14.926 8.247   6.945   1.00 0.00 ? 47 ILE A HB   6  
ATOM 10550 H HG12 . ILE A 1 47 ? -17.178 10.225  7.074   1.00 0.00 ? 47 ILE A HG12 6  
ATOM 10551 H HG13 . ILE A 1 47 ? -16.874 9.341   5.582   1.00 0.00 ? 47 ILE A HG13 6  
ATOM 10552 H HG21 . ILE A 1 47 ? -15.403 9.081   9.116   1.00 0.00 ? 47 ILE A HG21 6  
ATOM 10553 H HG22 . ILE A 1 47 ? -15.505 10.740  8.527   1.00 0.00 ? 47 ILE A HG22 6  
ATOM 10554 H HG23 . ILE A 1 47 ? -13.950 9.908   8.556   1.00 0.00 ? 47 ILE A HG23 6  
ATOM 10555 H HD11 . ILE A 1 47 ? -17.010 7.232   6.969   1.00 0.00 ? 47 ILE A HD11 6  
ATOM 10556 H HD12 . ILE A 1 47 ? -18.514 8.126   6.739   1.00 0.00 ? 47 ILE A HD12 6  
ATOM 10557 H HD13 . ILE A 1 47 ? -17.640 8.247   8.266   1.00 0.00 ? 47 ILE A HD13 6  
ATOM 10558 N N    . TYR A 1 48 ? -12.427 8.763   5.787   1.00 0.00 ? 48 TYR A N    6  
ATOM 10559 C CA   . TYR A 1 48 ? -11.016 8.444   5.990   1.00 0.00 ? 48 TYR A CA   6  
ATOM 10560 C C    . TYR A 1 48 ? -10.111 9.597   5.564   1.00 0.00 ? 48 TYR A C    6  
ATOM 10561 O O    . TYR A 1 48 ? -9.183  9.964   6.282   1.00 0.00 ? 48 TYR A O    6  
ATOM 10562 C CB   . TYR A 1 48 ? -10.641 7.180   5.214   1.00 0.00 ? 48 TYR A CB   6  
ATOM 10563 C CG   . TYR A 1 48 ? -11.027 5.896   5.914   1.00 0.00 ? 48 TYR A CG   6  
ATOM 10564 C CD1  . TYR A 1 48 ? -12.241 5.781   6.580   1.00 0.00 ? 48 TYR A CD1  6  
ATOM 10565 C CD2  . TYR A 1 48 ? -10.176 4.797   5.907   1.00 0.00 ? 48 TYR A CD2  6  
ATOM 10566 C CE1  . TYR A 1 48 ? -12.595 4.608   7.220   1.00 0.00 ? 48 TYR A CE1  6  
ATOM 10567 C CE2  . TYR A 1 48 ? -10.524 3.621   6.544   1.00 0.00 ? 48 TYR A CE2  6  
ATOM 10568 C CZ   . TYR A 1 48 ? -11.734 3.532   7.199   1.00 0.00 ? 48 TYR A CZ   6  
ATOM 10569 O OH   . TYR A 1 48 ? -12.083 2.362   7.834   1.00 0.00 ? 48 TYR A OH   6  
ATOM 10570 H H    . TYR A 1 48 ? -12.996 8.122   5.311   1.00 0.00 ? 48 TYR A H    6  
ATOM 10571 H HA   . TYR A 1 48 ? -10.870 8.261   7.044   1.00 0.00 ? 48 TYR A HA   6  
ATOM 10572 H HB2  . TYR A 1 48 ? -11.134 7.196   4.254   1.00 0.00 ? 48 TYR A HB2  6  
ATOM 10573 H HB3  . TYR A 1 48 ? -9.571  7.167   5.062   1.00 0.00 ? 48 TYR A HB3  6  
ATOM 10574 H HD1  . TYR A 1 48 ? -12.914 6.625   6.596   1.00 0.00 ? 48 TYR A HD1  6  
ATOM 10575 H HD2  . TYR A 1 48 ? -9.229  4.870   5.394   1.00 0.00 ? 48 TYR A HD2  6  
ATOM 10576 H HE1  . TYR A 1 48 ? -13.543 4.538   7.732   1.00 0.00 ? 48 TYR A HE1  6  
ATOM 10577 H HE2  . TYR A 1 48 ? -9.849  2.778   6.527   1.00 0.00 ? 48 TYR A HE2  6  
ATOM 10578 H HH   . TYR A 1 48 ? -12.205 2.530   8.771   1.00 0.00 ? 48 TYR A HH   6  
ATOM 10579 N N    . GLN A 1 49 ? -10.374 10.155  4.387   1.00 0.00 ? 49 GLN A N    6  
ATOM 10580 C CA   . GLN A 1 49 ? -9.565  11.254  3.868   1.00 0.00 ? 49 GLN A CA   6  
ATOM 10581 C C    . GLN A 1 49 ? -10.006 12.603  4.435   1.00 0.00 ? 49 GLN A C    6  
ATOM 10582 O O    . GLN A 1 49 ? -9.209  13.320  5.037   1.00 0.00 ? 49 GLN A O    6  
ATOM 10583 C CB   . GLN A 1 49 ? -9.639  11.286  2.340   1.00 0.00 ? 49 GLN A CB   6  
ATOM 10584 C CG   . GLN A 1 49 ? -8.350  11.744  1.679   1.00 0.00 ? 49 GLN A CG   6  
ATOM 10585 C CD   . GLN A 1 49 ? -8.594  12.669  0.503   1.00 0.00 ? 49 GLN A CD   6  
ATOM 10586 O OE1  . GLN A 1 49 ? -8.520  12.255  -0.654  1.00 0.00 ? 49 GLN A OE1  6  
ATOM 10587 N NE2  . GLN A 1 49 ? -8.887  13.931  0.794   1.00 0.00 ? 49 GLN A NE2  6  
ATOM 10588 H H    . GLN A 1 49 ? -11.122 9.814   3.851   1.00 0.00 ? 49 GLN A H    6  
ATOM 10589 H HA   . GLN A 1 49 ? -8.541  11.075  4.162   1.00 0.00 ? 49 GLN A HA   6  
ATOM 10590 H HB2  . GLN A 1 49 ? -9.869  10.294  1.982   1.00 0.00 ? 49 GLN A HB2  6  
ATOM 10591 H HB3  . GLN A 1 49 ? -10.430 11.959  2.043   1.00 0.00 ? 49 GLN A HB3  6  
ATOM 10592 H HG2  . GLN A 1 49 ? -7.751  12.267  2.410   1.00 0.00 ? 49 GLN A HG2  6  
ATOM 10593 H HG3  . GLN A 1 49 ? -7.811  10.875  1.329   1.00 0.00 ? 49 GLN A HG3  6  
ATOM 10594 H HE21 . GLN A 1 49 ? -8.929  14.191  1.738   1.00 0.00 ? 49 GLN A HE21 6  
ATOM 10595 H HE22 . GLN A 1 49 ? -9.050  14.552  0.053   1.00 0.00 ? 49 GLN A HE22 6  
ATOM 10596 N N    . ARG A 1 50 ? -11.272 12.950  4.220   1.00 0.00 ? 50 ARG A N    6  
ATOM 10597 C CA   . ARG A 1 50 ? -11.821 14.225  4.686   1.00 0.00 ? 50 ARG A CA   6  
ATOM 10598 C C    . ARG A 1 50 ? -11.634 14.445  6.191   1.00 0.00 ? 50 ARG A C    6  
ATOM 10599 O O    . ARG A 1 50 ? -11.891 15.540  6.692   1.00 0.00 ? 50 ARG A O    6  
ATOM 10600 C CB   . ARG A 1 50 ? -13.308 14.313  4.338   1.00 0.00 ? 50 ARG A CB   6  
ATOM 10601 C CG   . ARG A 1 50 ? -13.583 14.366  2.844   1.00 0.00 ? 50 ARG A CG   6  
ATOM 10602 C CD   . ARG A 1 50 ? -15.022 14.762  2.554   1.00 0.00 ? 50 ARG A CD   6  
ATOM 10603 N NE   . ARG A 1 50 ? -15.111 16.072  1.911   1.00 0.00 ? 50 ARG A NE   6  
ATOM 10604 C CZ   . ARG A 1 50 ? -14.909 16.276  0.611   1.00 0.00 ? 50 ARG A CZ   6  
ATOM 10605 N NH1  . ARG A 1 50 ? -14.602 15.261  -0.187  1.00 0.00 ? 50 ARG A NH1  6  
ATOM 10606 N NH2  . ARG A 1 50 ? -15.012 17.498  0.108   1.00 0.00 ? 50 ARG A NH2  6  
ATOM 10607 H H    . ARG A 1 50 ? -11.852 12.341  3.716   1.00 0.00 ? 50 ARG A H    6  
ATOM 10608 H HA   . ARG A 1 50 ? -11.302 15.011  4.160   1.00 0.00 ? 50 ARG A HA   6  
ATOM 10609 H HB2  . ARG A 1 50 ? -13.813 13.451  4.746   1.00 0.00 ? 50 ARG A HB2  6  
ATOM 10610 H HB3  . ARG A 1 50 ? -13.718 15.205  4.789   1.00 0.00 ? 50 ARG A HB3  6  
ATOM 10611 H HG2  . ARG A 1 50 ? -12.923 15.091  2.392   1.00 0.00 ? 50 ARG A HG2  6  
ATOM 10612 H HG3  . ARG A 1 50 ? -13.394 13.391  2.419   1.00 0.00 ? 50 ARG A HG3  6  
ATOM 10613 H HD2  . ARG A 1 50 ? -15.461 14.022  1.902   1.00 0.00 ? 50 ARG A HD2  6  
ATOM 10614 H HD3  . ARG A 1 50 ? -15.570 14.790  3.484   1.00 0.00 ? 50 ARG A HD3  6  
ATOM 10615 H HE   . ARG A 1 50 ? -15.335 16.839  2.478   1.00 0.00 ? 50 ARG A HE   6  
ATOM 10616 H HH11 . ARG A 1 50 ? -14.522 14.336  0.185   1.00 0.00 ? 50 ARG A HH11 6  
ATOM 10617 H HH12 . ARG A 1 50 ? -14.452 15.421  -1.163  1.00 0.00 ? 50 ARG A HH12 6  
ATOM 10618 H HH21 . ARG A 1 50 ? -15.243 18.267  0.706   1.00 0.00 ? 50 ARG A HH21 6  
ATOM 10619 H HH22 . ARG A 1 50 ? -14.860 17.652  -0.868  1.00 0.00 ? 50 ARG A HH22 6  
ATOM 10620 N N    . ILE A 1 51 ? -11.201 13.416  6.916   1.00 0.00 ? 51 ILE A N    6  
ATOM 10621 C CA   . ILE A 1 51 ? -11.006 13.537  8.357   1.00 0.00 ? 51 ILE A CA   6  
ATOM 10622 C C    . ILE A 1 51 ? -9.531  13.438  8.738   1.00 0.00 ? 51 ILE A C    6  
ATOM 10623 O O    . ILE A 1 51 ? -8.991  14.330  9.392   1.00 0.00 ? 51 ILE A O    6  
ATOM 10624 C CB   . ILE A 1 51 ? -11.803 12.459  9.123   1.00 0.00 ? 51 ILE A CB   6  
ATOM 10625 C CG1  . ILE A 1 51 ? -13.291 12.560  8.781   1.00 0.00 ? 51 ILE A CG1  6  
ATOM 10626 C CG2  . ILE A 1 51 ? -11.591 12.595  10.627  1.00 0.00 ? 51 ILE A CG2  6  
ATOM 10627 C CD1  . ILE A 1 51 ? -13.918 13.874  9.196   1.00 0.00 ? 51 ILE A CD1  6  
ATOM 10628 H H    . ILE A 1 51 ? -11.017 12.564  6.480   1.00 0.00 ? 51 ILE A H    6  
ATOM 10629 H HA   . ILE A 1 51 ? -11.377 14.506  8.660   1.00 0.00 ? 51 ILE A HA   6  
ATOM 10630 H HB   . ILE A 1 51 ? -11.437 11.490  8.820   1.00 0.00 ? 51 ILE A HB   6  
ATOM 10631 H HG12 . ILE A 1 51 ? -13.418 12.456  7.714   1.00 0.00 ? 51 ILE A HG12 6  
ATOM 10632 H HG13 . ILE A 1 51 ? -13.823 11.765  9.282   1.00 0.00 ? 51 ILE A HG13 6  
ATOM 10633 H HG21 . ILE A 1 51 ? -10.870 13.376  10.821  1.00 0.00 ? 51 ILE A HG21 6  
ATOM 10634 H HG22 . ILE A 1 51 ? -11.225 11.661  11.024  1.00 0.00 ? 51 ILE A HG22 6  
ATOM 10635 H HG23 . ILE A 1 51 ? -12.528 12.845  11.103  1.00 0.00 ? 51 ILE A HG23 6  
ATOM 10636 H HD11 . ILE A 1 51 ? -13.884 13.965  10.271  1.00 0.00 ? 51 ILE A HD11 6  
ATOM 10637 H HD12 . ILE A 1 51 ? -14.946 13.904  8.865   1.00 0.00 ? 51 ILE A HD12 6  
ATOM 10638 H HD13 . ILE A 1 51 ? -13.372 14.691  8.748   1.00 0.00 ? 51 ILE A HD13 6  
ATOM 10639 N N    . GLN A 1 52 ? -8.882  12.352  8.331   1.00 0.00 ? 52 GLN A N    6  
ATOM 10640 C CA   . GLN A 1 52 ? -7.471  12.152  8.643   1.00 0.00 ? 52 GLN A CA   6  
ATOM 10641 C C    . GLN A 1 52 ? -6.588  13.026  7.762   1.00 0.00 ? 52 GLN A C    6  
ATOM 10642 O O    . GLN A 1 52 ? -5.762  13.791  8.261   1.00 0.00 ? 52 GLN A O    6  
ATOM 10643 C CB   . GLN A 1 52 ? -7.085  10.681  8.479   1.00 0.00 ? 52 GLN A CB   6  
ATOM 10644 C CG   . GLN A 1 52 ? -7.619  9.785   9.585   1.00 0.00 ? 52 GLN A CG   6  
ATOM 10645 C CD   . GLN A 1 52 ? -8.886  9.055   9.184   1.00 0.00 ? 52 GLN A CD   6  
ATOM 10646 O OE1  . GLN A 1 52 ? -8.921  8.360   8.169   1.00 0.00 ? 52 GLN A OE1  6  
ATOM 10647 N NE2  . GLN A 1 52 ? -9.936  9.210   9.982   1.00 0.00 ? 52 GLN A NE2  6  
ATOM 10648 H H    . GLN A 1 52 ? -9.362  11.672  7.813   1.00 0.00 ? 52 GLN A H    6  
ATOM 10649 H HA   . GLN A 1 52 ? -7.320  12.439  9.674   1.00 0.00 ? 52 GLN A HA   6  
ATOM 10650 H HB2  . GLN A 1 52 ? -7.467  10.322  7.537   1.00 0.00 ? 52 GLN A HB2  6  
ATOM 10651 H HB3  . GLN A 1 52 ? -6.007  10.603  8.473   1.00 0.00 ? 52 GLN A HB3  6  
ATOM 10652 H HG2  . GLN A 1 52 ? -6.865  9.054   9.834   1.00 0.00 ? 52 GLN A HG2  6  
ATOM 10653 H HG3  . GLN A 1 52 ? -7.830  10.393  10.452  1.00 0.00 ? 52 GLN A HG3  6  
ATOM 10654 H HE21 . GLN A 1 52 ? -9.835  9.779   10.774  1.00 0.00 ? 52 GLN A HE21 6  
ATOM 10655 H HE22 . GLN A 1 52 ? -10.768 8.749   9.747   1.00 0.00 ? 52 GLN A HE22 6  
ATOM 10656 N N    . ALA A 1 53 ? -6.765  12.913  6.449   1.00 0.00 ? 53 ALA A N    6  
ATOM 10657 C CA   . ALA A 1 53 ? -5.983  13.696  5.507   1.00 0.00 ? 53 ALA A CA   6  
ATOM 10658 C C    . ALA A 1 53 ? -6.458  15.144  5.475   1.00 0.00 ? 53 ALA A C    6  
ATOM 10659 O O    . ALA A 1 53 ? -5.657  16.069  5.343   1.00 0.00 ? 53 ALA A O    6  
ATOM 10660 C CB   . ALA A 1 53 ? -6.060  13.080  4.118   1.00 0.00 ? 53 ALA A CB   6  
ATOM 10661 H H    . ALA A 1 53 ? -7.435  12.291  6.105   1.00 0.00 ? 53 ALA A H    6  
ATOM 10662 H HA   . ALA A 1 53 ? -4.955  13.670  5.830   1.00 0.00 ? 53 ALA A HA   6  
ATOM 10663 H HB1  . ALA A 1 53 ? -5.092  13.141  3.643   1.00 0.00 ? 53 ALA A HB1  6  
ATOM 10664 H HB2  . ALA A 1 53 ? -6.786  13.617  3.526   1.00 0.00 ? 53 ALA A HB2  6  
ATOM 10665 H HB3  . ALA A 1 53 ? -6.356  12.045  4.199   1.00 0.00 ? 53 ALA A HB3  6  
ATOM 10666 N N    . GLU A 1 54 ? -7.768  15.332  5.598   1.00 0.00 ? 54 GLU A N    6  
ATOM 10667 C CA   . GLU A 1 54 ? -8.355  16.665  5.586   1.00 0.00 ? 54 GLU A CA   6  
ATOM 10668 C C    . GLU A 1 54 ? -8.737  17.100  6.997   1.00 0.00 ? 54 GLU A C    6  
ATOM 10669 O O    . GLU A 1 54 ? -9.506  16.426  7.681   1.00 0.00 ? 54 GLU A O    6  
ATOM 10670 C CB   . GLU A 1 54 ? -9.584  16.699  4.676   1.00 0.00 ? 54 GLU A CB   6  
ATOM 10671 C CG   . GLU A 1 54 ? -9.766  18.021  3.948   1.00 0.00 ? 54 GLU A CG   6  
ATOM 10672 C CD   . GLU A 1 54 ? -8.670  18.285  2.934   1.00 0.00 ? 54 GLU A CD   6  
ATOM 10673 O OE1  . GLU A 1 54 ? -8.680  17.636  1.867   1.00 0.00 ? 54 GLU A OE1  6  
ATOM 10674 O OE2  . GLU A 1 54 ? -7.802  19.140  3.207   1.00 0.00 ? 54 GLU A OE2  6  
ATOM 10675 H H    . GLU A 1 54 ? -8.354  14.554  5.701   1.00 0.00 ? 54 GLU A H    6  
ATOM 10676 H HA   . GLU A 1 54 ? -7.614  17.349  5.201   1.00 0.00 ? 54 GLU A HA   6  
ATOM 10677 H HB2  . GLU A 1 54 ? -9.492  15.916  3.937   1.00 0.00 ? 54 GLU A HB2  6  
ATOM 10678 H HB3  . GLU A 1 54 ? -10.465 16.517  5.272   1.00 0.00 ? 54 GLU A HB3  6  
ATOM 10679 H HG2  . GLU A 1 54 ? -10.715 18.006  3.433   1.00 0.00 ? 54 GLU A HG2  6  
ATOM 10680 H HG3  . GLU A 1 54 ? -9.765  18.820  4.674   1.00 0.00 ? 54 GLU A HG3  6  
ATOM 10681 N N    . LYS A 1 55 ? -8.180  18.229  7.425   1.00 0.00 ? 55 LYS A N    6  
ATOM 10682 C CA   . LYS A 1 55 ? -8.433  18.775  8.753   1.00 0.00 ? 55 LYS A CA   6  
ATOM 10683 C C    . LYS A 1 55 ? -9.906  18.662  9.144   1.00 0.00 ? 55 LYS A C    6  
ATOM 10684 O O    . LYS A 1 55 ? -10.723 19.506  8.776   1.00 0.00 ? 55 LYS A O    6  
ATOM 10685 C CB   . LYS A 1 55 ? -7.991  20.239  8.813   1.00 0.00 ? 55 LYS A CB   6  
ATOM 10686 C CG   . LYS A 1 55 ? -7.215  20.590  10.072  1.00 0.00 ? 55 LYS A CG   6  
ATOM 10687 C CD   . LYS A 1 55 ? -8.126  21.156  11.149  1.00 0.00 ? 55 LYS A CD   6  
ATOM 10688 C CE   . LYS A 1 55 ? -7.519  20.994  12.533  1.00 0.00 ? 55 LYS A CE   6  
ATOM 10689 N NZ   . LYS A 1 55 ? -8.564  20.827  13.581  1.00 0.00 ? 55 LYS A NZ   6  
ATOM 10690 H H    . LYS A 1 55 ? -7.572  18.704  6.833   1.00 0.00 ? 55 LYS A H    6  
ATOM 10691 H HA   . LYS A 1 55 ? -7.844  18.207  9.451   1.00 0.00 ? 55 LYS A HA   6  
ATOM 10692 H HB2  . LYS A 1 55 ? -7.363  20.448  7.959   1.00 0.00 ? 55 LYS A HB2  6  
ATOM 10693 H HB3  . LYS A 1 55 ? -8.866  20.871  8.767   1.00 0.00 ? 55 LYS A HB3  6  
ATOM 10694 H HG2  . LYS A 1 55 ? -6.738  19.698  10.450  1.00 0.00 ? 55 LYS A HG2  6  
ATOM 10695 H HG3  . LYS A 1 55 ? -6.463  21.326  9.825   1.00 0.00 ? 55 LYS A HG3  6  
ATOM 10696 H HD2  . LYS A 1 55 ? -8.283  22.207  10.958  1.00 0.00 ? 55 LYS A HD2  6  
ATOM 10697 H HD3  . LYS A 1 55 ? -9.072  20.636  11.116  1.00 0.00 ? 55 LYS A HD3  6  
ATOM 10698 H HE2  . LYS A 1 55 ? -6.881  20.123  12.533  1.00 0.00 ? 55 LYS A HE2  6  
ATOM 10699 H HE3  . LYS A 1 55 ? -6.930  21.870  12.759  1.00 0.00 ? 55 LYS A HE3  6  
ATOM 10700 H HZ1  . LYS A 1 55 ? -8.146  20.952  14.525  1.00 0.00 ? 55 LYS A HZ1  6  
ATOM 10701 H HZ2  . LYS A 1 55 ? -8.981  19.877  13.522  1.00 0.00 ? 55 LYS A HZ2  6  
ATOM 10702 H HZ3  . LYS A 1 55 ? -9.317  21.533  13.450  1.00 0.00 ? 55 LYS A HZ3  6  
ATOM 10703 N N    . SER A 1 56 ? -10.235 17.615  9.893   1.00 0.00 ? 56 SER A N    6  
ATOM 10704 C CA   . SER A 1 56 ? -11.606 17.392  10.337  1.00 0.00 ? 56 SER A CA   6  
ATOM 10705 C C    . SER A 1 56 ? -12.077 18.528  11.239  1.00 0.00 ? 56 SER A C    6  
ATOM 10706 O O    . SER A 1 56 ? -11.267 19.232  11.842  1.00 0.00 ? 56 SER A O    6  
ATOM 10707 C CB   . SER A 1 56 ? -11.713 16.060  11.082  1.00 0.00 ? 56 SER A CB   6  
ATOM 10708 O OG   . SER A 1 56 ? -13.064 15.741  11.364  1.00 0.00 ? 56 SER A OG   6  
ATOM 10709 H H    . SER A 1 56 ? -9.538  16.978  10.154  1.00 0.00 ? 56 SER A H    6  
ATOM 10710 H HA   . SER A 1 56 ? -12.237 17.357  9.462   1.00 0.00 ? 56 SER A HA   6  
ATOM 10711 H HB2  . SER A 1 56 ? -11.290 15.275  10.474  1.00 0.00 ? 56 SER A HB2  6  
ATOM 10712 H HB3  . SER A 1 56 ? -11.169 16.127  12.013  1.00 0.00 ? 56 SER A HB3  6  
ATOM 10713 H HG   . SER A 1 56 ? -13.425 16.387  11.975  1.00 0.00 ? 56 SER A HG   6  
ATOM 10714 N N    . GLN A 1 57 ? -13.392 18.701  11.327  1.00 0.00 ? 57 GLN A N    6  
ATOM 10715 C CA   . GLN A 1 57 ? -13.970 19.752  12.157  1.00 0.00 ? 57 GLN A CA   6  
ATOM 10716 C C    . GLN A 1 57 ? -14.341 19.214  13.535  1.00 0.00 ? 57 GLN A C    6  
ATOM 10717 O O    . GLN A 1 57 ? -15.076 18.233  13.652  1.00 0.00 ? 57 GLN A O    6  
ATOM 10718 C CB   . GLN A 1 57 ? -15.205 20.348  11.480  1.00 0.00 ? 57 GLN A CB   6  
ATOM 10719 C CG   . GLN A 1 57 ? -15.520 21.765  11.930  1.00 0.00 ? 57 GLN A CG   6  
ATOM 10720 C CD   . GLN A 1 57 ? -17.010 22.030  12.024  1.00 0.00 ? 57 GLN A CD   6  
ATOM 10721 O OE1  . GLN A 1 57 ? -17.805 21.112  12.225  1.00 0.00 ? 57 GLN A OE1  6  
ATOM 10722 N NE2  . GLN A 1 57 ? -17.396 23.292  11.877  1.00 0.00 ? 57 GLN A NE2  6  
ATOM 10723 H H    . GLN A 1 57 ? -13.988 18.109  10.822  1.00 0.00 ? 57 GLN A H    6  
ATOM 10724 H HA   . GLN A 1 57 ? -13.227 20.526  12.275  1.00 0.00 ? 57 GLN A HA   6  
ATOM 10725 H HB2  . GLN A 1 57 ? -15.046 20.359  10.412  1.00 0.00 ? 57 GLN A HB2  6  
ATOM 10726 H HB3  . GLN A 1 57 ? -16.059 19.724  11.701  1.00 0.00 ? 57 GLN A HB3  6  
ATOM 10727 H HG2  . GLN A 1 57 ? -15.081 21.926  12.903  1.00 0.00 ? 57 GLN A HG2  6  
ATOM 10728 H HG3  . GLN A 1 57 ? -15.089 22.458  11.223  1.00 0.00 ? 57 GLN A HG3  6  
ATOM 10729 H HE21 . GLN A 1 57 ? -16.708 23.972  11.719  1.00 0.00 ? 57 GLN A HE21 6  
ATOM 10730 H HE22 . GLN A 1 57 ? -18.354 23.493  11.933  1.00 0.00 ? 57 GLN A HE22 6  
ATOM 10731 N N    . GLN A 1 58 ? -13.829 19.863  14.576  1.00 0.00 ? 58 GLN A N    6  
ATOM 10732 C CA   . GLN A 1 58 ? -14.108 19.450  15.946  1.00 0.00 ? 58 GLN A CA   6  
ATOM 10733 C C    . GLN A 1 58 ? -15.590 19.607  16.271  1.00 0.00 ? 58 GLN A C    6  
ATOM 10734 O O    . GLN A 1 58 ? -16.178 20.663  16.039  1.00 0.00 ? 58 GLN A O    6  
ATOM 10735 C CB   . GLN A 1 58 ? -13.270 20.270  16.929  1.00 0.00 ? 58 GLN A CB   6  
ATOM 10736 C CG   . GLN A 1 58 ? -13.599 21.754  16.918  1.00 0.00 ? 58 GLN A CG   6  
ATOM 10737 C CD   . GLN A 1 58 ? -12.487 22.602  17.502  1.00 0.00 ? 58 GLN A CD   6  
ATOM 10738 O OE1  . GLN A 1 58 ? -12.609 23.130  18.607  1.00 0.00 ? 58 GLN A OE1  6  
ATOM 10739 N NE2  . GLN A 1 58 ? -11.394 22.738  16.760  1.00 0.00 ? 58 GLN A NE2  6  
ATOM 10740 H H    . GLN A 1 58 ? -13.251 20.638  14.418  1.00 0.00 ? 58 GLN A H    6  
ATOM 10741 H HA   . GLN A 1 58 ? -13.839 18.408  16.040  1.00 0.00 ? 58 GLN A HA   6  
ATOM 10742 H HB2  . GLN A 1 58 ? -13.436 19.893  17.927  1.00 0.00 ? 58 GLN A HB2  6  
ATOM 10743 H HB3  . GLN A 1 58 ? -12.226 20.153  16.678  1.00 0.00 ? 58 GLN A HB3  6  
ATOM 10744 H HG2  . GLN A 1 58 ? -13.770 22.064  15.898  1.00 0.00 ? 58 GLN A HG2  6  
ATOM 10745 H HG3  . GLN A 1 58 ? -14.497 21.914  17.497  1.00 0.00 ? 58 GLN A HG3  6  
ATOM 10746 H HE21 . GLN A 1 58 ? -11.367 22.289  15.889  1.00 0.00 ? 58 GLN A HE21 6  
ATOM 10747 H HE22 . GLN A 1 58 ? -10.659 23.282  17.113  1.00 0.00 ? 58 GLN A HE22 6  
ATOM 10748 N N    . SER A 1 59 ? -16.188 18.549  16.809  1.00 0.00 ? 59 SER A N    6  
ATOM 10749 C CA   . SER A 1 59 ? -17.602 18.570  17.166  1.00 0.00 ? 59 SER A CA   6  
ATOM 10750 C C    . SER A 1 59 ? -17.808 19.231  18.526  1.00 0.00 ? 59 SER A C    6  
ATOM 10751 O O    . SER A 1 59 ? -16.890 19.838  19.076  1.00 0.00 ? 59 SER A O    6  
ATOM 10752 C CB   . SER A 1 59 ? -18.170 17.147  17.181  1.00 0.00 ? 59 SER A CB   6  
ATOM 10753 O OG   . SER A 1 59 ? -17.138 16.183  17.060  1.00 0.00 ? 59 SER A OG   6  
ATOM 10754 H H    . SER A 1 59 ? -15.666 17.735  16.970  1.00 0.00 ? 59 SER A H    6  
ATOM 10755 H HA   . SER A 1 59 ? -18.123 19.148  16.417  1.00 0.00 ? 59 SER A HA   6  
ATOM 10756 H HB2  . SER A 1 59 ? -18.694 16.979  18.110  1.00 0.00 ? 59 SER A HB2  6  
ATOM 10757 H HB3  . SER A 1 59 ? -18.855 17.028  16.355  1.00 0.00 ? 59 SER A HB3  6  
ATOM 10758 H HG   . SER A 1 59 ? -17.524 15.304  17.022  1.00 0.00 ? 59 SER A HG   6  
ATOM 10759 N N    . SER A 1 60 ? -19.018 19.109  19.062  1.00 0.00 ? 60 SER A N    6  
ATOM 10760 C CA   . SER A 1 60 ? -19.341 19.696  20.357  1.00 0.00 ? 60 SER A CA   6  
ATOM 10761 C C    . SER A 1 60 ? -19.098 18.695  21.483  1.00 0.00 ? 60 SER A C    6  
ATOM 10762 O O    . SER A 1 60 ? -19.688 17.615  21.505  1.00 0.00 ? 60 SER A O    6  
ATOM 10763 C CB   . SER A 1 60 ? -20.798 20.163  20.380  1.00 0.00 ? 60 SER A CB   6  
ATOM 10764 O OG   . SER A 1 60 ? -21.078 20.903  21.555  1.00 0.00 ? 60 SER A OG   6  
ATOM 10765 H H    . SER A 1 60 ? -19.710 18.614  18.576  1.00 0.00 ? 60 SER A H    6  
ATOM 10766 H HA   . SER A 1 60 ? -18.696 20.549  20.504  1.00 0.00 ? 60 SER A HA   6  
ATOM 10767 H HB2  . SER A 1 60 ? -20.986 20.790  19.521  1.00 0.00 ? 60 SER A HB2  6  
ATOM 10768 H HB3  . SER A 1 60 ? -21.450 19.302  20.347  1.00 0.00 ? 60 SER A HB3  6  
ATOM 10769 H HG   . SER A 1 60 ? -21.978 20.724  21.839  1.00 0.00 ? 60 SER A HG   6  
ATOM 10770 N N    . TYR A 1 61 ? -18.225 19.063  22.415  1.00 0.00 ? 61 TYR A N    6  
ATOM 10771 C CA   . TYR A 1 61 ? -17.902 18.198  23.543  1.00 0.00 ? 61 TYR A CA   6  
ATOM 10772 C C    . TYR A 1 61 ? -18.632 18.653  24.803  1.00 0.00 ? 61 TYR A C    6  
ATOM 10773 O O    . TYR A 1 61 ? -18.758 19.880  25.002  1.00 0.00 ? 61 TYR A O    6  
ATOM 10774 C CB   . TYR A 1 61 ? -16.392 18.189  23.789  1.00 0.00 ? 61 TYR A CB   6  
ATOM 10775 C CG   . TYR A 1 61 ? -15.956 17.204  24.850  1.00 0.00 ? 61 TYR A CG   6  
ATOM 10776 C CD1  . TYR A 1 61 ? -16.001 15.835  24.616  1.00 0.00 ? 61 TYR A CD1  6  
ATOM 10777 C CD2  . TYR A 1 61 ? -15.499 17.643  26.087  1.00 0.00 ? 61 TYR A CD2  6  
ATOM 10778 C CE1  . TYR A 1 61 ? -15.603 14.932  25.583  1.00 0.00 ? 61 TYR A CE1  6  
ATOM 10779 C CE2  . TYR A 1 61 ? -15.099 16.746  27.059  1.00 0.00 ? 61 TYR A CE2  6  
ATOM 10780 C CZ   . TYR A 1 61 ? -15.153 15.393  26.802  1.00 0.00 ? 61 TYR A CZ   6  
ATOM 10781 O OH   . TYR A 1 61 ? -14.755 14.497  27.768  1.00 0.00 ? 61 TYR A OH   6  
ATOM 10782 O OXT  . TYR A 1 61 ? -19.070 17.779  25.580  1.00 0.00 ? 61 TYR A OXT  6  
ATOM 10783 H H    . TYR A 1 61 ? -17.787 19.936  22.341  1.00 0.00 ? 61 TYR A H    6  
ATOM 10784 H HA   . TYR A 1 61 ? -18.224 17.197  23.297  1.00 0.00 ? 61 TYR A HA   6  
ATOM 10785 H HB2  . TYR A 1 61 ? -15.887 17.931  22.870  1.00 0.00 ? 61 TYR A HB2  6  
ATOM 10786 H HB3  . TYR A 1 61 ? -16.080 19.174  24.101  1.00 0.00 ? 61 TYR A HB3  6  
ATOM 10787 H HD1  . TYR A 1 61 ? -16.353 15.478  23.659  1.00 0.00 ? 61 TYR A HD1  6  
ATOM 10788 H HD2  . TYR A 1 61 ? -15.459 18.704  26.285  1.00 0.00 ? 61 TYR A HD2  6  
ATOM 10789 H HE1  . TYR A 1 61 ? -15.645 13.872  25.382  1.00 0.00 ? 61 TYR A HE1  6  
ATOM 10790 H HE2  . TYR A 1 61 ? -14.747 17.107  28.014  1.00 0.00 ? 61 TYR A HE2  6  
ATOM 10791 H HH   . TYR A 1 61 ? -13.842 14.671  28.010  1.00 0.00 ? 61 TYR A HH   6  
ATOM 10792 N N    . MET B 1 1  ? 0.203   13.157  5.339   1.00 0.00 ? 1  MET B N    6  
ATOM 10793 C CA   . MET B 1 1  ? -0.203  11.765  5.014   1.00 0.00 ? 1  MET B CA   6  
ATOM 10794 C C    . MET B 1 1  ? -1.383  11.320  5.872   1.00 0.00 ? 1  MET B C    6  
ATOM 10795 O O    . MET B 1 1  ? -1.855  12.065  6.731   1.00 0.00 ? 1  MET B O    6  
ATOM 10796 C CB   . MET B 1 1  ? 0.994   10.841  5.245   1.00 0.00 ? 1  MET B CB   6  
ATOM 10797 C CG   . MET B 1 1  ? 1.485   10.829  6.683   1.00 0.00 ? 1  MET B CG   6  
ATOM 10798 S SD   . MET B 1 1  ? 2.909   11.906  6.940   1.00 0.00 ? 1  MET B SD   6  
ATOM 10799 C CE   . MET B 1 1  ? 3.872   10.925  8.087   1.00 0.00 ? 1  MET B CE   6  
ATOM 10800 H H1   . MET B 1 1  ? 0.520   13.172  6.329   1.00 0.00 ? 1  MET B H1   6  
ATOM 10801 H H2   . MET B 1 1  ? -0.627  13.769  5.200   1.00 0.00 ? 1  MET B H2   6  
ATOM 10802 H H3   . MET B 1 1  ? 0.976   13.420  4.696   1.00 0.00 ? 1  MET B H3   6  
ATOM 10803 H HA   . MET B 1 1  ? -0.489  11.724  3.974   1.00 0.00 ? 1  MET B HA   6  
ATOM 10804 H HB2  . MET B 1 1  ? 0.715   9.834   4.974   1.00 0.00 ? 1  MET B HB2  6  
ATOM 10805 H HB3  . MET B 1 1  ? 1.808   11.163  4.612   1.00 0.00 ? 1  MET B HB3  6  
ATOM 10806 H HG2  . MET B 1 1  ? 0.683   11.159  7.326   1.00 0.00 ? 1  MET B HG2  6  
ATOM 10807 H HG3  . MET B 1 1  ? 1.763   9.819   6.945   1.00 0.00 ? 1  MET B HG3  6  
ATOM 10808 H HE1  . MET B 1 1  ? 4.772   10.581  7.600   1.00 0.00 ? 1  MET B HE1  6  
ATOM 10809 H HE2  . MET B 1 1  ? 3.290   10.074  8.410   1.00 0.00 ? 1  MET B HE2  6  
ATOM 10810 H HE3  . MET B 1 1  ? 4.134   11.527  8.944   1.00 0.00 ? 1  MET B HE3  6  
ATOM 10811 N N    . LEU B 1 2  ? -1.856  10.101  5.632   1.00 0.00 ? 2  LEU B N    6  
ATOM 10812 C CA   . LEU B 1 2  ? -2.982  9.557   6.382   1.00 0.00 ? 2  LEU B CA   6  
ATOM 10813 C C    . LEU B 1 2  ? -2.559  8.331   7.186   1.00 0.00 ? 2  LEU B C    6  
ATOM 10814 O O    . LEU B 1 2  ? -2.404  7.241   6.634   1.00 0.00 ? 2  LEU B O    6  
ATOM 10815 C CB   . LEU B 1 2  ? -4.120  9.187   5.427   1.00 0.00 ? 2  LEU B CB   6  
ATOM 10816 C CG   . LEU B 1 2  ? -5.448  8.839   6.103   1.00 0.00 ? 2  LEU B CG   6  
ATOM 10817 C CD1  . LEU B 1 2  ? -6.616  9.395   5.303   1.00 0.00 ? 2  LEU B CD1  6  
ATOM 10818 C CD2  . LEU B 1 2  ? -5.583  7.332   6.267   1.00 0.00 ? 2  LEU B CD2  6  
ATOM 10819 H H    . LEU B 1 2  ? -1.438  9.554   4.933   1.00 0.00 ? 2  LEU B H    6  
ATOM 10820 H HA   . LEU B 1 2  ? -3.329  10.320  7.063   1.00 0.00 ? 2  LEU B HA   6  
ATOM 10821 H HB2  . LEU B 1 2  ? -4.285  10.021  4.761   1.00 0.00 ? 2  LEU B HB2  6  
ATOM 10822 H HB3  . LEU B 1 2  ? -3.806  8.337   4.841   1.00 0.00 ? 2  LEU B HB3  6  
ATOM 10823 H HG   . LEU B 1 2  ? -5.473  9.287   7.085   1.00 0.00 ? 2  LEU B HG   6  
ATOM 10824 H HD11 . LEU B 1 2  ? -6.838  10.397  5.639   1.00 0.00 ? 2  LEU B HD11 6  
ATOM 10825 H HD12 . LEU B 1 2  ? -7.483  8.767   5.447   1.00 0.00 ? 2  LEU B HD12 6  
ATOM 10826 H HD13 . LEU B 1 2  ? -6.357  9.416   4.255   1.00 0.00 ? 2  LEU B HD13 6  
ATOM 10827 H HD21 . LEU B 1 2  ? -4.604  6.894   6.386   1.00 0.00 ? 2  LEU B HD21 6  
ATOM 10828 H HD22 . LEU B 1 2  ? -6.060  6.916   5.392   1.00 0.00 ? 2  LEU B HD22 6  
ATOM 10829 H HD23 . LEU B 1 2  ? -6.183  7.118   7.139   1.00 0.00 ? 2  LEU B HD23 6  
ATOM 10830 N N    . ILE B 1 3  ? -2.377  8.510   8.493   1.00 0.00 ? 3  ILE B N    6  
ATOM 10831 C CA   . ILE B 1 3  ? -1.978  7.407   9.359   1.00 0.00 ? 3  ILE B CA   6  
ATOM 10832 C C    . ILE B 1 3  ? -3.190  6.811   10.069  1.00 0.00 ? 3  ILE B C    6  
ATOM 10833 O O    . ILE B 1 3  ? -3.729  7.393   11.010  1.00 0.00 ? 3  ILE B O    6  
ATOM 10834 C CB   . ILE B 1 3  ? -0.919  7.852   10.394  1.00 0.00 ? 3  ILE B CB   6  
ATOM 10835 C CG1  . ILE B 1 3  ? -0.342  6.638   11.127  1.00 0.00 ? 3  ILE B CG1  6  
ATOM 10836 C CG2  . ILE B 1 3  ? -1.507  8.846   11.385  1.00 0.00 ? 3  ILE B CG2  6  
ATOM 10837 C CD1  . ILE B 1 3  ? 1.129   6.783   11.469  1.00 0.00 ? 3  ILE B CD1  6  
ATOM 10838 H H    . ILE B 1 3  ? -2.520  9.399   8.881   1.00 0.00 ? 3  ILE B H    6  
ATOM 10839 H HA   . ILE B 1 3  ? -1.539  6.645   8.736   1.00 0.00 ? 3  ILE B HA   6  
ATOM 10840 H HB   . ILE B 1 3  ? -0.122  8.349   9.862   1.00 0.00 ? 3  ILE B HB   6  
ATOM 10841 H HG12 . ILE B 1 3  ? -0.884  6.492   12.050  1.00 0.00 ? 3  ILE B HG12 6  
ATOM 10842 H HG13 . ILE B 1 3  ? -0.455  5.762   10.505  1.00 0.00 ? 3  ILE B HG13 6  
ATOM 10843 H HG21 . ILE B 1 3  ? -2.177  9.517   10.867  1.00 0.00 ? 3  ILE B HG21 6  
ATOM 10844 H HG22 . ILE B 1 3  ? -0.708  9.415   11.839  1.00 0.00 ? 3  ILE B HG22 6  
ATOM 10845 H HG23 . ILE B 1 3  ? -2.049  8.313   12.151  1.00 0.00 ? 3  ILE B HG23 6  
ATOM 10846 H HD11 . ILE B 1 3  ? 1.354   7.824   11.652  1.00 0.00 ? 3  ILE B HD11 6  
ATOM 10847 H HD12 . ILE B 1 3  ? 1.730   6.424   10.645  1.00 0.00 ? 3  ILE B HD12 6  
ATOM 10848 H HD13 . ILE B 1 3  ? 1.354   6.206   12.354  1.00 0.00 ? 3  ILE B HD13 6  
ATOM 10849 N N    . LEU B 1 4  ? -3.605  5.634   9.611   1.00 0.00 ? 4  LEU B N    6  
ATOM 10850 C CA   . LEU B 1 4  ? -4.743  4.935   10.195  1.00 0.00 ? 4  LEU B CA   6  
ATOM 10851 C C    . LEU B 1 4  ? -4.354  3.520   10.614  1.00 0.00 ? 4  LEU B C    6  
ATOM 10852 O O    . LEU B 1 4  ? -3.917  2.723   9.782   1.00 0.00 ? 4  LEU B O    6  
ATOM 10853 C CB   . LEU B 1 4  ? -5.904  4.884   9.200   1.00 0.00 ? 4  LEU B CB   6  
ATOM 10854 C CG   . LEU B 1 4  ? -7.297  4.830   9.830   1.00 0.00 ? 4  LEU B CG   6  
ATOM 10855 C CD1  . LEU B 1 4  ? -7.524  6.036   10.728  1.00 0.00 ? 4  LEU B CD1  6  
ATOM 10856 C CD2  . LEU B 1 4  ? -8.367  4.757   8.751   1.00 0.00 ? 4  LEU B CD2  6  
ATOM 10857 H H    . LEU B 1 4  ? -3.115  5.211   8.875   1.00 0.00 ? 4  LEU B H    6  
ATOM 10858 H HA   . LEU B 1 4  ? -5.055  5.484   11.071  1.00 0.00 ? 4  LEU B HA   6  
ATOM 10859 H HB2  . LEU B 1 4  ? -5.849  5.761   8.571   1.00 0.00 ? 4  LEU B HB2  6  
ATOM 10860 H HB3  . LEU B 1 4  ? -5.780  4.009   8.580   1.00 0.00 ? 4  LEU B HB3  6  
ATOM 10861 H HG   . LEU B 1 4  ? -7.374  3.941   10.440  1.00 0.00 ? 4  LEU B HG   6  
ATOM 10862 H HD11 . LEU B 1 4  ? -7.139  6.922   10.244  1.00 0.00 ? 4  LEU B HD11 6  
ATOM 10863 H HD12 . LEU B 1 4  ? -7.012  5.888   11.667  1.00 0.00 ? 4  LEU B HD12 6  
ATOM 10864 H HD13 . LEU B 1 4  ? -8.582  6.156   10.909  1.00 0.00 ? 4  LEU B HD13 6  
ATOM 10865 H HD21 . LEU B 1 4  ? -8.751  5.748   8.557   1.00 0.00 ? 4  LEU B HD21 6  
ATOM 10866 H HD22 . LEU B 1 4  ? -9.171  4.118   9.085   1.00 0.00 ? 4  LEU B HD22 6  
ATOM 10867 H HD23 . LEU B 1 4  ? -7.938  4.353   7.846   1.00 0.00 ? 4  LEU B HD23 6  
ATOM 10868 N N    . THR B 1 5  ? -4.513  3.197   11.894  1.00 0.00 ? 5  THR B N    6  
ATOM 10869 C CA   . THR B 1 5  ? -4.175  1.861   12.374  1.00 0.00 ? 5  THR B CA   6  
ATOM 10870 C C    . THR B 1 5  ? -4.951  0.808   11.600  1.00 0.00 ? 5  THR B C    6  
ATOM 10871 O O    . THR B 1 5  ? -6.068  1.056   11.147  1.00 0.00 ? 5  THR B O    6  
ATOM 10872 C CB   . THR B 1 5  ? -4.468  1.719   13.867  1.00 0.00 ? 5  THR B CB   6  
ATOM 10873 O OG1  . THR B 1 5  ? -4.723  2.983   14.456  1.00 0.00 ? 5  THR B OG1  6  
ATOM 10874 C CG2  . THR B 1 5  ? -3.334  1.073   14.631  1.00 0.00 ? 5  THR B CG2  6  
ATOM 10875 H H    . THR B 1 5  ? -4.861  3.862   12.526  1.00 0.00 ? 5  THR B H    6  
ATOM 10876 H HA   . THR B 1 5  ? -3.122  1.706   12.206  1.00 0.00 ? 5  THR B HA   6  
ATOM 10877 H HB   . THR B 1 5  ? -5.345  1.098   13.993  1.00 0.00 ? 5  THR B HB   6  
ATOM 10878 H HG1  . THR B 1 5  ? -5.661  3.064   14.646  1.00 0.00 ? 5  THR B HG1  6  
ATOM 10879 H HG21 . THR B 1 5  ? -2.773  0.431   13.966  1.00 0.00 ? 5  THR B HG21 6  
ATOM 10880 H HG22 . THR B 1 5  ? -3.736  0.486   15.444  1.00 0.00 ? 5  THR B HG22 6  
ATOM 10881 H HG23 . THR B 1 5  ? -2.683  1.838   15.027  1.00 0.00 ? 5  THR B HG23 6  
ATOM 10882 N N    . ARG B 1 6  ? -4.355  -0.366  11.446  1.00 0.00 ? 6  ARG B N    6  
ATOM 10883 C CA   . ARG B 1 6  ? -5.003  -1.446  10.720  1.00 0.00 ? 6  ARG B CA   6  
ATOM 10884 C C    . ARG B 1 6  ? -4.132  -2.694  10.686  1.00 0.00 ? 6  ARG B C    6  
ATOM 10885 O O    . ARG B 1 6  ? -2.908  -2.616  10.577  1.00 0.00 ? 6  ARG B O    6  
ATOM 10886 C CB   . ARG B 1 6  ? -5.329  -1.002  9.293   1.00 0.00 ? 6  ARG B CB   6  
ATOM 10887 C CG   . ARG B 1 6  ? -6.719  -1.404  8.833   1.00 0.00 ? 6  ARG B CG   6  
ATOM 10888 C CD   . ARG B 1 6  ? -7.800  -0.689  9.627   1.00 0.00 ? 6  ARG B CD   6  
ATOM 10889 N NE   . ARG B 1 6  ? -9.081  -1.388  9.559   1.00 0.00 ? 6  ARG B NE   6  
ATOM 10890 C CZ   . ARG B 1 6  ? -10.246 -0.834  9.885   1.00 0.00 ? 6  ARG B CZ   6  
ATOM 10891 N NH1  . ARG B 1 6  ? -10.296 0.424   10.304  1.00 0.00 ? 6  ARG B NH1  6  
ATOM 10892 N NH2  . ARG B 1 6  ? -11.364 -1.540  9.792   1.00 0.00 ? 6  ARG B NH2  6  
ATOM 10893 H H    . ARG B 1 6  ? -3.464  -0.508  11.827  1.00 0.00 ? 6  ARG B H    6  
ATOM 10894 H HA   . ARG B 1 6  ? -5.924  -1.680  11.231  1.00 0.00 ? 6  ARG B HA   6  
ATOM 10895 H HB2  . ARG B 1 6  ? -5.253  0.074   9.237   1.00 0.00 ? 6  ARG B HB2  6  
ATOM 10896 H HB3  . ARG B 1 6  ? -4.609  -1.440  8.617   1.00 0.00 ? 6  ARG B HB3  6  
ATOM 10897 H HG2  . ARG B 1 6  ? -6.827  -1.151  7.791   1.00 0.00 ? 6  ARG B HG2  6  
ATOM 10898 H HG3  . ARG B 1 6  ? -6.836  -2.470  8.961   1.00 0.00 ? 6  ARG B HG3  6  
ATOM 10899 H HD2  . ARG B 1 6  ? -7.489  -0.626  10.659  1.00 0.00 ? 6  ARG B HD2  6  
ATOM 10900 H HD3  . ARG B 1 6  ? -7.922  0.307   9.227   1.00 0.00 ? 6  ARG B HD3  6  
ATOM 10901 H HE   . ARG B 1 6  ? -9.072  -2.319  9.253   1.00 0.00 ? 6  ARG B HE   6  
ATOM 10902 H HH11 . ARG B 1 6  ? -9.456  0.962   10.377  1.00 0.00 ? 6  ARG B HH11 6  
ATOM 10903 H HH12 . ARG B 1 6  ? -11.174 0.835   10.547  1.00 0.00 ? 6  ARG B HH12 6  
ATOM 10904 H HH21 . ARG B 1 6  ? -11.332 -2.488  9.477   1.00 0.00 ? 6  ARG B HH21 6  
ATOM 10905 H HH22 . ARG B 1 6  ? -12.240 -1.123  10.037  1.00 0.00 ? 6  ARG B HH22 6  
ATOM 10906 N N    . ARG B 1 7  ? -4.783  -3.844  10.777  1.00 0.00 ? 7  ARG B N    6  
ATOM 10907 C CA   . ARG B 1 7  ? -4.090  -5.126  10.749  1.00 0.00 ? 7  ARG B CA   6  
ATOM 10908 C C    . ARG B 1 7  ? -5.079  -6.283  10.627  1.00 0.00 ? 7  ARG B C    6  
ATOM 10909 O O    . ARG B 1 7  ? -4.778  -7.413  11.012  1.00 0.00 ? 7  ARG B O    6  
ATOM 10910 C CB   . ARG B 1 7  ? -3.238  -5.296  12.007  1.00 0.00 ? 7  ARG B CB   6  
ATOM 10911 C CG   . ARG B 1 7  ? -2.179  -6.379  11.884  1.00 0.00 ? 7  ARG B CG   6  
ATOM 10912 C CD   . ARG B 1 7  ? -1.571  -6.711  13.237  1.00 0.00 ? 7  ARG B CD   6  
ATOM 10913 N NE   . ARG B 1 7  ? -0.376  -7.542  13.113  1.00 0.00 ? 7  ARG B NE   6  
ATOM 10914 C CZ   . ARG B 1 7  ? 0.521   -7.699  14.083  1.00 0.00 ? 7  ARG B CZ   6  
ATOM 10915 N NH1  . ARG B 1 7  ? 0.365   -7.081  15.247  1.00 0.00 ? 7  ARG B NH1  6  
ATOM 10916 N NH2  . ARG B 1 7  ? 1.578   -8.476  13.890  1.00 0.00 ? 7  ARG B NH2  6  
ATOM 10917 H H    . ARG B 1 7  ? -5.758  -3.828  10.865  1.00 0.00 ? 7  ARG B H    6  
ATOM 10918 H HA   . ARG B 1 7  ? -3.442  -5.131  9.885   1.00 0.00 ? 7  ARG B HA   6  
ATOM 10919 H HB2  . ARG B 1 7  ? -2.742  -4.360  12.219  1.00 0.00 ? 7  ARG B HB2  6  
ATOM 10920 H HB3  . ARG B 1 7  ? -3.885  -5.547  12.834  1.00 0.00 ? 7  ARG B HB3  6  
ATOM 10921 H HG2  . ARG B 1 7  ? -2.632  -7.272  11.471  1.00 0.00 ? 7  ARG B HG2  6  
ATOM 10922 H HG3  . ARG B 1 7  ? -1.398  -6.032  11.223  1.00 0.00 ? 7  ARG B HG3  6  
ATOM 10923 H HD2  . ARG B 1 7  ? -1.305  -5.789  13.732  1.00 0.00 ? 7  ARG B HD2  6  
ATOM 10924 H HD3  . ARG B 1 7  ? -2.305  -7.237  13.828  1.00 0.00 ? 7  ARG B HD3  6  
ATOM 10925 H HE   . ARG B 1 7  ? -0.236  -8.009  12.262  1.00 0.00 ? 7  ARG B HE   6  
ATOM 10926 H HH11 . ARG B 1 7  ? -0.429  -6.493  15.399  1.00 0.00 ? 7  ARG B HH11 6  
ATOM 10927 H HH12 . ARG B 1 7  ? 1.041   -7.204  15.973  1.00 0.00 ? 7  ARG B HH12 6  
ATOM 10928 H HH21 . ARG B 1 7  ? 1.702   -8.943  13.014  1.00 0.00 ? 7  ARG B HH21 6  
ATOM 10929 H HH22 . ARG B 1 7  ? 2.252   -8.594  14.619  1.00 0.00 ? 7  ARG B HH22 6  
ATOM 10930 N N    . VAL B 1 8  ? -6.265  -5.996  10.094  1.00 0.00 ? 8  VAL B N    6  
ATOM 10931 C CA   . VAL B 1 8  ? -7.294  -7.015  9.930   1.00 0.00 ? 8  VAL B CA   6  
ATOM 10932 C C    . VAL B 1 8  ? -7.802  -7.058  8.493   1.00 0.00 ? 8  VAL B C    6  
ATOM 10933 O O    . VAL B 1 8  ? -7.809  -8.113  7.859   1.00 0.00 ? 8  VAL B O    6  
ATOM 10934 C CB   . VAL B 1 8  ? -8.485  -6.768  10.877  1.00 0.00 ? 8  VAL B CB   6  
ATOM 10935 C CG1  . VAL B 1 8  ? -9.349  -8.015  10.984  1.00 0.00 ? 8  VAL B CG1  6  
ATOM 10936 C CG2  . VAL B 1 8  ? -7.998  -6.330  12.252  1.00 0.00 ? 8  VAL B CG2  6  
ATOM 10937 H H    . VAL B 1 8  ? -6.455  -5.079  9.811   1.00 0.00 ? 8  VAL B H    6  
ATOM 10938 H HA   . VAL B 1 8  ? -6.858  -7.972  10.176  1.00 0.00 ? 8  VAL B HA   6  
ATOM 10939 H HB   . VAL B 1 8  ? -9.089  -5.974  10.463  1.00 0.00 ? 8  VAL B HB   6  
ATOM 10940 H HG11 . VAL B 1 8  ? -9.076  -8.567  11.871  1.00 0.00 ? 8  VAL B HG11 6  
ATOM 10941 H HG12 . VAL B 1 8  ? -9.196  -8.635  10.113  1.00 0.00 ? 8  VAL B HG12 6  
ATOM 10942 H HG13 . VAL B 1 8  ? -10.388 -7.729  11.043  1.00 0.00 ? 8  VAL B HG13 6  
ATOM 10943 H HG21 . VAL B 1 8  ? -7.696  -5.293  12.213  1.00 0.00 ? 8  VAL B HG21 6  
ATOM 10944 H HG22 . VAL B 1 8  ? -7.156  -6.939  12.546  1.00 0.00 ? 8  VAL B HG22 6  
ATOM 10945 H HG23 . VAL B 1 8  ? -8.796  -6.447  12.970  1.00 0.00 ? 8  VAL B HG23 6  
ATOM 10946 N N    . GLY B 1 9  ? -8.227  -5.906  7.983   1.00 0.00 ? 9  GLY B N    6  
ATOM 10947 C CA   . GLY B 1 9  ? -8.730  -5.839  6.623   1.00 0.00 ? 9  GLY B CA   6  
ATOM 10948 C C    . GLY B 1 9  ? -9.274  -4.469  6.267   1.00 0.00 ? 9  GLY B C    6  
ATOM 10949 O O    . GLY B 1 9  ? -10.361 -4.092  6.706   1.00 0.00 ? 9  GLY B O    6  
ATOM 10950 H H    . GLY B 1 9  ? -8.198  -5.095  8.534   1.00 0.00 ? 9  GLY B H    6  
ATOM 10951 H HA2  . GLY B 1 9  ? -7.928  -6.083  5.942   1.00 0.00 ? 9  GLY B HA2  6  
ATOM 10952 H HA3  . GLY B 1 9  ? -9.519  -6.568  6.508   1.00 0.00 ? 9  GLY B HA3  6  
ATOM 10953 N N    . GLU B 1 10 ? -8.518  -3.723  5.467   1.00 0.00 ? 10 GLU B N    6  
ATOM 10954 C CA   . GLU B 1 10 ? -8.929  -2.387  5.049   1.00 0.00 ? 10 GLU B CA   6  
ATOM 10955 C C    . GLU B 1 10 ? -9.212  -2.350  3.552   1.00 0.00 ? 10 GLU B C    6  
ATOM 10956 O O    . GLU B 1 10 ? -10.314 -2.007  3.126   1.00 0.00 ? 10 GLU B O    6  
ATOM 10957 C CB   . GLU B 1 10 ? -7.848  -1.364  5.400   1.00 0.00 ? 10 GLU B CB   6  
ATOM 10958 C CG   . GLU B 1 10 ? -8.391  -0.113  6.072   1.00 0.00 ? 10 GLU B CG   6  
ATOM 10959 C CD   . GLU B 1 10 ? -7.500  1.095   5.862   1.00 0.00 ? 10 GLU B CD   6  
ATOM 10960 O OE1  . GLU B 1 10 ? -6.497  1.228   6.595   1.00 0.00 ? 10 GLU B OE1  6  
ATOM 10961 O OE2  . GLU B 1 10 ? -7.804  1.908   4.963   1.00 0.00 ? 10 GLU B OE2  6  
ATOM 10962 H H    . GLU B 1 10 ? -7.662  -4.081  5.149   1.00 0.00 ? 10 GLU B H    6  
ATOM 10963 H HA   . GLU B 1 10 ? -9.835  -2.137  5.581   1.00 0.00 ? 10 GLU B HA   6  
ATOM 10964 H HB2  . GLU B 1 10 ? -7.135  -1.826  6.065   1.00 0.00 ? 10 GLU B HB2  6  
ATOM 10965 H HB3  . GLU B 1 10 ? -7.340  -1.068  4.494   1.00 0.00 ? 10 GLU B HB3  6  
ATOM 10966 H HG2  . GLU B 1 10 ? -9.367  0.104   5.664   1.00 0.00 ? 10 GLU B HG2  6  
ATOM 10967 H HG3  . GLU B 1 10 ? -8.478  -0.299  7.132   1.00 0.00 ? 10 GLU B HG3  6  
ATOM 10968 N N    . THR B 1 11 ? -8.203  -2.702  2.760   1.00 0.00 ? 11 THR B N    6  
ATOM 10969 C CA   . THR B 1 11 ? -8.328  -2.711  1.306   1.00 0.00 ? 11 THR B CA   6  
ATOM 10970 C C    . THR B 1 11 ? -8.537  -1.300  0.762   1.00 0.00 ? 11 THR B C    6  
ATOM 10971 O O    . THR B 1 11 ? -9.657  -0.790  0.736   1.00 0.00 ? 11 THR B O    6  
ATOM 10972 C CB   . THR B 1 11 ? -9.477  -3.626  0.863   1.00 0.00 ? 11 THR B CB   6  
ATOM 10973 O OG1  . THR B 1 11 ? -10.720 -2.951  0.933   1.00 0.00 ? 11 THR B OG1  6  
ATOM 10974 C CG2  . THR B 1 11 ? -9.595  -4.888  1.691   1.00 0.00 ? 11 THR B CG2  6  
ATOM 10975 H H    . THR B 1 11 ? -7.349  -2.961  3.164   1.00 0.00 ? 11 THR B H    6  
ATOM 10976 H HA   . THR B 1 11 ? -7.403  -3.098  0.904   1.00 0.00 ? 11 THR B HA   6  
ATOM 10977 H HB   . THR B 1 11 ? -9.311  -3.920  -0.163  1.00 0.00 ? 11 THR B HB   6  
ATOM 10978 H HG1  . THR B 1 11 ? -10.775 -2.306  0.224   1.00 0.00 ? 11 THR B HG1  6  
ATOM 10979 H HG21 . THR B 1 11 ? -10.508 -4.858  2.266   1.00 0.00 ? 11 THR B HG21 6  
ATOM 10980 H HG22 . THR B 1 11 ? -8.750  -4.961  2.360   1.00 0.00 ? 11 THR B HG22 6  
ATOM 10981 H HG23 . THR B 1 11 ? -9.610  -5.748  1.036   1.00 0.00 ? 11 THR B HG23 6  
ATOM 10982 N N    . LEU B 1 12 ? -7.448  -0.677  0.320   1.00 0.00 ? 12 LEU B N    6  
ATOM 10983 C CA   . LEU B 1 12 ? -7.507  0.671   -0.238  1.00 0.00 ? 12 LEU B CA   6  
ATOM 10984 C C    . LEU B 1 12 ? -7.138  0.643   -1.717  1.00 0.00 ? 12 LEU B C    6  
ATOM 10985 O O    . LEU B 1 12 ? -6.424  -0.255  -2.164  1.00 0.00 ? 12 LEU B O    6  
ATOM 10986 C CB   . LEU B 1 12 ? -6.580  1.623   0.534   1.00 0.00 ? 12 LEU B CB   6  
ATOM 10987 C CG   . LEU B 1 12 ? -5.099  1.577   0.140   1.00 0.00 ? 12 LEU B CG   6  
ATOM 10988 C CD1  . LEU B 1 12 ? -4.407  2.883   0.501   1.00 0.00 ? 12 LEU B CD1  6  
ATOM 10989 C CD2  . LEU B 1 12 ? -4.409  0.402   0.812   1.00 0.00 ? 12 LEU B CD2  6  
ATOM 10990 H H    . LEU B 1 12 ? -6.586  -1.140  0.360   1.00 0.00 ? 12 LEU B H    6  
ATOM 10991 H HA   . LEU B 1 12 ? -8.525  1.021   -0.144  1.00 0.00 ? 12 LEU B HA   6  
ATOM 10992 H HB2  . LEU B 1 12 ? -6.937  2.632   0.386   1.00 0.00 ? 12 LEU B HB2  6  
ATOM 10993 H HB3  . LEU B 1 12 ? -6.655  1.387   1.585   1.00 0.00 ? 12 LEU B HB3  6  
ATOM 10994 H HG   . LEU B 1 12 ? -5.020  1.445   -0.929  1.00 0.00 ? 12 LEU B HG   6  
ATOM 10995 H HD11 . LEU B 1 12 ? -5.148  3.632   0.738   1.00 0.00 ? 12 LEU B HD11 6  
ATOM 10996 H HD12 . LEU B 1 12 ? -3.813  3.219   -0.337  1.00 0.00 ? 12 LEU B HD12 6  
ATOM 10997 H HD13 . LEU B 1 12 ? -3.766  2.728   1.357   1.00 0.00 ? 12 LEU B HD13 6  
ATOM 10998 H HD21 . LEU B 1 12 ? -3.340  0.496   0.693   1.00 0.00 ? 12 LEU B HD21 6  
ATOM 10999 H HD22 . LEU B 1 12 ? -4.742  -0.518  0.355   1.00 0.00 ? 12 LEU B HD22 6  
ATOM 11000 H HD23 . LEU B 1 12 ? -4.656  0.392   1.863   1.00 0.00 ? 12 LEU B HD23 6  
ATOM 11001 N N    . MET B 1 13 ? -7.619  1.622   -2.476  1.00 0.00 ? 13 MET B N    6  
ATOM 11002 C CA   . MET B 1 13 ? -7.320  1.680   -3.899  1.00 0.00 ? 13 MET B CA   6  
ATOM 11003 C C    . MET B 1 13 ? -6.798  3.055   -4.292  1.00 0.00 ? 13 MET B C    6  
ATOM 11004 O O    . MET B 1 13 ? -7.568  3.997   -4.474  1.00 0.00 ? 13 MET B O    6  
ATOM 11005 C CB   . MET B 1 13 ? -8.570  1.345   -4.714  1.00 0.00 ? 13 MET B CB   6  
ATOM 11006 C CG   . MET B 1 13 ? -8.330  1.323   -6.214  1.00 0.00 ? 13 MET B CG   6  
ATOM 11007 S SD   . MET B 1 13 ? -9.854  1.498   -7.163  1.00 0.00 ? 13 MET B SD   6  
ATOM 11008 C CE   . MET B 1 13 ? -10.722 0.006   -6.688  1.00 0.00 ? 13 MET B CE   6  
ATOM 11009 H H    . MET B 1 13 ? -8.175  2.321   -2.074  1.00 0.00 ? 13 MET B H    6  
ATOM 11010 H HA   . MET B 1 13 ? -6.558  0.945   -4.109  1.00 0.00 ? 13 MET B HA   6  
ATOM 11011 H HB2  . MET B 1 13 ? -8.929  0.371   -4.414  1.00 0.00 ? 13 MET B HB2  6  
ATOM 11012 H HB3  . MET B 1 13 ? -9.331  2.081   -4.503  1.00 0.00 ? 13 MET B HB3  6  
ATOM 11013 H HG2  . MET B 1 13 ? -7.668  2.136   -6.471  1.00 0.00 ? 13 MET B HG2  6  
ATOM 11014 H HG3  . MET B 1 13 ? -7.865  0.385   -6.477  1.00 0.00 ? 13 MET B HG3  6  
ATOM 11015 H HE1  . MET B 1 13 ? -10.103 -0.574  -6.020  1.00 0.00 ? 13 MET B HE1  6  
ATOM 11016 H HE2  . MET B 1 13 ? -10.945 -0.577  -7.570  1.00 0.00 ? 13 MET B HE2  6  
ATOM 11017 H HE3  . MET B 1 13 ? -11.643 0.269   -6.188  1.00 0.00 ? 13 MET B HE3  6  
ATOM 11018 N N    . ILE B 1 14 ? -5.482  3.157   -4.420  1.00 0.00 ? 14 ILE B N    6  
ATOM 11019 C CA   . ILE B 1 14 ? -4.844  4.407   -4.791  1.00 0.00 ? 14 ILE B CA   6  
ATOM 11020 C C    . ILE B 1 14 ? -4.100  4.265   -6.117  1.00 0.00 ? 14 ILE B C    6  
ATOM 11021 O O    . ILE B 1 14 ? -3.012  3.692   -6.168  1.00 0.00 ? 14 ILE B O    6  
ATOM 11022 C CB   . ILE B 1 14 ? -3.859  4.874   -3.697  1.00 0.00 ? 14 ILE B CB   6  
ATOM 11023 C CG1  . ILE B 1 14 ? -3.188  6.189   -4.101  1.00 0.00 ? 14 ILE B CG1  6  
ATOM 11024 C CG2  . ILE B 1 14 ? -2.815  3.798   -3.425  1.00 0.00 ? 14 ILE B CG2  6  
ATOM 11025 C CD1  . ILE B 1 14 ? -4.174  7.295   -4.397  1.00 0.00 ? 14 ILE B CD1  6  
ATOM 11026 H H    . ILE B 1 14 ? -4.926  2.371   -4.252  1.00 0.00 ? 14 ILE B H    6  
ATOM 11027 H HA   . ILE B 1 14 ? -5.617  5.153   -4.896  1.00 0.00 ? 14 ILE B HA   6  
ATOM 11028 H HB   . ILE B 1 14 ? -4.419  5.031   -2.788  1.00 0.00 ? 14 ILE B HB   6  
ATOM 11029 H HG12 . ILE B 1 14 ? -2.548  6.521   -3.299  1.00 0.00 ? 14 ILE B HG12 6  
ATOM 11030 H HG13 . ILE B 1 14 ? -2.594  6.026   -4.988  1.00 0.00 ? 14 ILE B HG13 6  
ATOM 11031 H HG21 . ILE B 1 14 ? -2.867  3.502   -2.386  1.00 0.00 ? 14 ILE B HG21 6  
ATOM 11032 H HG22 . ILE B 1 14 ? -1.830  4.187   -3.638  1.00 0.00 ? 14 ILE B HG22 6  
ATOM 11033 H HG23 . ILE B 1 14 ? -3.007  2.941   -4.053  1.00 0.00 ? 14 ILE B HG23 6  
ATOM 11034 H HD11 . ILE B 1 14 ? -5.178  6.904   -4.328  1.00 0.00 ? 14 ILE B HD11 6  
ATOM 11035 H HD12 . ILE B 1 14 ? -4.002  7.674   -5.394  1.00 0.00 ? 14 ILE B HD12 6  
ATOM 11036 H HD13 . ILE B 1 14 ? -4.048  8.092   -3.680  1.00 0.00 ? 14 ILE B HD13 6  
ATOM 11037 N N    . GLY B 1 15 ? -4.695  4.783   -7.188  1.00 0.00 ? 15 GLY B N    6  
ATOM 11038 C CA   . GLY B 1 15 ? -4.076  4.698   -8.500  1.00 0.00 ? 15 GLY B CA   6  
ATOM 11039 C C    . GLY B 1 15 ? -5.096  4.827   -9.616  1.00 0.00 ? 15 GLY B C    6  
ATOM 11040 O O    . GLY B 1 15 ? -5.621  5.913   -9.863  1.00 0.00 ? 15 GLY B O    6  
ATOM 11041 H H    . GLY B 1 15 ? -5.564  5.225   -7.097  1.00 0.00 ? 15 GLY B H    6  
ATOM 11042 H HA2  . GLY B 1 15 ? -3.349  5.491   -8.596  1.00 0.00 ? 15 GLY B HA2  6  
ATOM 11043 H HA3  . GLY B 1 15 ? -3.573  3.746   -8.594  1.00 0.00 ? 15 GLY B HA3  6  
ATOM 11044 N N    . ASP B 1 16 ? -5.379  3.715   -10.285 1.00 0.00 ? 16 ASP B N    6  
ATOM 11045 C CA   . ASP B 1 16 ? -6.349  3.704   -11.378 1.00 0.00 ? 16 ASP B CA   6  
ATOM 11046 C C    . ASP B 1 16 ? -7.146  2.395   -11.411 1.00 0.00 ? 16 ASP B C    6  
ATOM 11047 O O    . ASP B 1 16 ? -8.061  2.241   -12.221 1.00 0.00 ? 16 ASP B O    6  
ATOM 11048 C CB   . ASP B 1 16 ? -5.640  3.914   -12.717 1.00 0.00 ? 16 ASP B CB   6  
ATOM 11049 C CG   . ASP B 1 16 ? -5.632  5.369   -13.144 1.00 0.00 ? 16 ASP B CG   6  
ATOM 11050 O OD1  . ASP B 1 16 ? -4.771  6.127   -12.652 1.00 0.00 ? 16 ASP B OD1  6  
ATOM 11051 O OD2  . ASP B 1 16 ? -6.487  5.749   -13.972 1.00 0.00 ? 16 ASP B OD2  6  
ATOM 11052 H H    . ASP B 1 16 ? -4.928  2.883   -10.036 1.00 0.00 ? 16 ASP B H    6  
ATOM 11053 H HA   . ASP B 1 16 ? -7.036  4.521   -11.216 1.00 0.00 ? 16 ASP B HA   6  
ATOM 11054 H HB2  . ASP B 1 16 ? -4.617  3.578   -12.632 1.00 0.00 ? 16 ASP B HB2  6  
ATOM 11055 H HB3  . ASP B 1 16 ? -6.142  3.336   -13.479 1.00 0.00 ? 16 ASP B HB3  6  
ATOM 11056 N N    . GLU B 1 17 ? -6.795  1.457   -10.528 1.00 0.00 ? 17 GLU B N    6  
ATOM 11057 C CA   . GLU B 1 17 ? -7.468  0.161   -10.448 1.00 0.00 ? 17 GLU B CA   6  
ATOM 11058 C C    . GLU B 1 17 ? -6.624  -0.806  -9.624  1.00 0.00 ? 17 GLU B C    6  
ATOM 11059 O O    . GLU B 1 17 ? -6.222  -1.867  -10.103 1.00 0.00 ? 17 GLU B O    6  
ATOM 11060 C CB   . GLU B 1 17 ? -7.715  -0.414  -11.851 1.00 0.00 ? 17 GLU B CB   6  
ATOM 11061 C CG   . GLU B 1 17 ? -9.186  -0.484  -12.229 1.00 0.00 ? 17 GLU B CG   6  
ATOM 11062 C CD   . GLU B 1 17 ? -9.528  -1.738  -13.010 1.00 0.00 ? 17 GLU B CD   6  
ATOM 11063 O OE1  . GLU B 1 17 ? -9.409  -2.843  -12.440 1.00 0.00 ? 17 GLU B OE1  6  
ATOM 11064 O OE2  . GLU B 1 17 ? -9.914  -1.614  -14.191 1.00 0.00 ? 17 GLU B OE2  6  
ATOM 11065 H H    . GLU B 1 17 ? -6.062  1.639   -9.907  1.00 0.00 ? 17 GLU B H    6  
ATOM 11066 H HA   . GLU B 1 17 ? -8.416  0.309   -9.952  1.00 0.00 ? 17 GLU B HA   6  
ATOM 11067 H HB2  . GLU B 1 17 ? -7.210  0.206   -12.576 1.00 0.00 ? 17 GLU B HB2  6  
ATOM 11068 H HB3  . GLU B 1 17 ? -7.307  -1.412  -11.899 1.00 0.00 ? 17 GLU B HB3  6  
ATOM 11069 H HG2  . GLU B 1 17 ? -9.778  -0.468  -11.326 1.00 0.00 ? 17 GLU B HG2  6  
ATOM 11070 H HG3  . GLU B 1 17 ? -9.431  0.378   -12.833 1.00 0.00 ? 17 GLU B HG3  6  
ATOM 11071 N N    . VAL B 1 18 ? -6.342  -0.423  -8.382  1.00 0.00 ? 18 VAL B N    6  
ATOM 11072 C CA   . VAL B 1 18 ? -5.533  -1.235  -7.497  1.00 0.00 ? 18 VAL B CA   6  
ATOM 11073 C C    . VAL B 1 18 ? -6.351  -1.788  -6.326  1.00 0.00 ? 18 VAL B C    6  
ATOM 11074 O O    . VAL B 1 18 ? -7.580  -1.829  -6.375  1.00 0.00 ? 18 VAL B O    6  
ATOM 11075 C CB   . VAL B 1 18 ? -4.348  -0.409  -6.960  1.00 0.00 ? 18 VAL B CB   6  
ATOM 11076 C CG1  . VAL B 1 18 ? -3.573  0.221   -8.108  1.00 0.00 ? 18 VAL B CG1  6  
ATOM 11077 C CG2  . VAL B 1 18 ? -4.828  0.655   -5.982  1.00 0.00 ? 18 VAL B CG2  6  
ATOM 11078 H H    . VAL B 1 18 ? -6.677  0.433   -8.056  1.00 0.00 ? 18 VAL B H    6  
ATOM 11079 H HA   . VAL B 1 18 ? -5.137  -2.060  -8.069  1.00 0.00 ? 18 VAL B HA   6  
ATOM 11080 H HB   . VAL B 1 18 ? -3.688  -1.073  -6.438  1.00 0.00 ? 18 VAL B HB   6  
ATOM 11081 H HG11 . VAL B 1 18 ? -3.836  1.265   -8.190  1.00 0.00 ? 18 VAL B HG11 6  
ATOM 11082 H HG12 . VAL B 1 18 ? -3.818  -0.285  -9.029  1.00 0.00 ? 18 VAL B HG12 6  
ATOM 11083 H HG13 . VAL B 1 18 ? -2.513  0.131   -7.918  1.00 0.00 ? 18 VAL B HG13 6  
ATOM 11084 H HG21 . VAL B 1 18 ? -4.431  1.617   -6.271  1.00 0.00 ? 18 VAL B HG21 6  
ATOM 11085 H HG22 . VAL B 1 18 ? -4.487  0.410   -4.986  1.00 0.00 ? 18 VAL B HG22 6  
ATOM 11086 H HG23 . VAL B 1 18 ? -5.907  0.694   -5.992  1.00 0.00 ? 18 VAL B HG23 6  
ATOM 11087 N N    . THR B 1 19 ? -5.650  -2.212  -5.277  1.00 0.00 ? 19 THR B N    6  
ATOM 11088 C CA   . THR B 1 19 ? -6.277  -2.768  -4.083  1.00 0.00 ? 19 THR B CA   6  
ATOM 11089 C C    . THR B 1 19 ? -5.207  -3.377  -3.185  1.00 0.00 ? 19 THR B C    6  
ATOM 11090 O O    . THR B 1 19 ? -4.700  -4.462  -3.461  1.00 0.00 ? 19 THR B O    6  
ATOM 11091 C CB   . THR B 1 19 ? -7.317  -3.829  -4.456  1.00 0.00 ? 19 THR B CB   6  
ATOM 11092 O OG1  . THR B 1 19 ? -7.636  -4.635  -3.335  1.00 0.00 ? 19 THR B OG1  6  
ATOM 11093 C CG2  . THR B 1 19 ? -6.863  -4.750  -5.568  1.00 0.00 ? 19 THR B CG2  6  
ATOM 11094 H H    . THR B 1 19 ? -4.674  -2.151  -5.304  1.00 0.00 ? 19 THR B H    6  
ATOM 11095 H HA   . THR B 1 19 ? -6.764  -1.962  -3.554  1.00 0.00 ? 19 THR B HA   6  
ATOM 11096 H HB   . THR B 1 19 ? -8.220  -3.334  -4.785  1.00 0.00 ? 19 THR B HB   6  
ATOM 11097 H HG1  . THR B 1 19 ? -8.278  -4.180  -2.786  1.00 0.00 ? 19 THR B HG1  6  
ATOM 11098 H HG21 . THR B 1 19 ? -7.538  -4.662  -6.407  1.00 0.00 ? 19 THR B HG21 6  
ATOM 11099 H HG22 . THR B 1 19 ? -6.861  -5.770  -5.213  1.00 0.00 ? 19 THR B HG22 6  
ATOM 11100 H HG23 . THR B 1 19 ? -5.866  -4.475  -5.879  1.00 0.00 ? 19 THR B HG23 6  
ATOM 11101 N N    . VAL B 1 20 ? -4.851  -2.669  -2.119  1.00 0.00 ? 20 VAL B N    6  
ATOM 11102 C CA   . VAL B 1 20 ? -3.822  -3.148  -1.203  1.00 0.00 ? 20 VAL B CA   6  
ATOM 11103 C C    . VAL B 1 20 ? -4.401  -3.528  0.157   1.00 0.00 ? 20 VAL B C    6  
ATOM 11104 O O    . VAL B 1 20 ? -4.831  -2.665  0.926   1.00 0.00 ? 20 VAL B O    6  
ATOM 11105 C CB   . VAL B 1 20 ? -2.721  -2.089  -0.996  1.00 0.00 ? 20 VAL B CB   6  
ATOM 11106 C CG1  . VAL B 1 20 ? -1.557  -2.669  -0.206  1.00 0.00 ? 20 VAL B CG1  6  
ATOM 11107 C CG2  . VAL B 1 20 ? -2.246  -1.541  -2.333  1.00 0.00 ? 20 VAL B CG2  6  
ATOM 11108 H H    . VAL B 1 20 ? -5.281  -1.804  -1.948  1.00 0.00 ? 20 VAL B H    6  
ATOM 11109 H HA   . VAL B 1 20 ? -3.366  -4.023  -1.647  1.00 0.00 ? 20 VAL B HA   6  
ATOM 11110 H HB   . VAL B 1 20 ? -3.138  -1.274  -0.427  1.00 0.00 ? 20 VAL B HB   6  
ATOM 11111 H HG11 . VAL B 1 20 ? -1.261  -1.970  0.562   1.00 0.00 ? 20 VAL B HG11 6  
ATOM 11112 H HG12 . VAL B 1 20 ? -0.724  -2.847  -0.870  1.00 0.00 ? 20 VAL B HG12 6  
ATOM 11113 H HG13 . VAL B 1 20 ? -1.859  -3.599  0.251   1.00 0.00 ? 20 VAL B HG13 6  
ATOM 11114 H HG21 . VAL B 1 20 ? -3.086  -1.129  -2.872  1.00 0.00 ? 20 VAL B HG21 6  
ATOM 11115 H HG22 . VAL B 1 20 ? -1.803  -2.338  -2.912  1.00 0.00 ? 20 VAL B HG22 6  
ATOM 11116 H HG23 . VAL B 1 20 ? -1.511  -0.767  -2.164  1.00 0.00 ? 20 VAL B HG23 6  
ATOM 11117 N N    . THR B 1 21 ? -4.410  -4.827  0.443   1.00 0.00 ? 21 THR B N    6  
ATOM 11118 C CA   . THR B 1 21 ? -4.930  -5.333  1.709   1.00 0.00 ? 21 THR B CA   6  
ATOM 11119 C C    . THR B 1 21 ? -3.794  -5.597  2.695   1.00 0.00 ? 21 THR B C    6  
ATOM 11120 O O    . THR B 1 21 ? -2.984  -6.504  2.498   1.00 0.00 ? 21 THR B O    6  
ATOM 11121 C CB   . THR B 1 21 ? -5.730  -6.616  1.479   1.00 0.00 ? 21 THR B CB   6  
ATOM 11122 O OG1  . THR B 1 21 ? -6.586  -6.479  0.359   1.00 0.00 ? 21 THR B OG1  6  
ATOM 11123 C CG2  . THR B 1 21 ? -6.584  -7.010  2.665   1.00 0.00 ? 21 THR B CG2  6  
ATOM 11124 H H    . THR B 1 21 ? -4.063  -5.460  -0.219  1.00 0.00 ? 21 THR B H    6  
ATOM 11125 H HA   . THR B 1 21 ? -5.584  -4.580  2.123   1.00 0.00 ? 21 THR B HA   6  
ATOM 11126 H HB   . THR B 1 21 ? -5.042  -7.426  1.284   1.00 0.00 ? 21 THR B HB   6  
ATOM 11127 H HG1  . THR B 1 21 ? -6.064  -6.493  -0.446  1.00 0.00 ? 21 THR B HG1  6  
ATOM 11128 H HG21 . THR B 1 21 ? -7.554  -6.542  2.581   1.00 0.00 ? 21 THR B HG21 6  
ATOM 11129 H HG22 . THR B 1 21 ? -6.105  -6.685  3.577   1.00 0.00 ? 21 THR B HG22 6  
ATOM 11130 H HG23 . THR B 1 21 ? -6.702  -8.083  2.683   1.00 0.00 ? 21 THR B HG23 6  
ATOM 11131 N N    . VAL B 1 22 ? -3.738  -4.794  3.753   1.00 0.00 ? 22 VAL B N    6  
ATOM 11132 C CA   . VAL B 1 22 ? -2.699  -4.935  4.769   1.00 0.00 ? 22 VAL B CA   6  
ATOM 11133 C C    . VAL B 1 22 ? -2.989  -6.110  5.700   1.00 0.00 ? 22 VAL B C    6  
ATOM 11134 O O    . VAL B 1 22 ? -3.287  -5.923  6.880   1.00 0.00 ? 22 VAL B O    6  
ATOM 11135 C CB   . VAL B 1 22 ? -2.559  -3.651  5.609   1.00 0.00 ? 22 VAL B CB   6  
ATOM 11136 C CG1  . VAL B 1 22 ? -1.992  -2.519  4.767   1.00 0.00 ? 22 VAL B CG1  6  
ATOM 11137 C CG2  . VAL B 1 22 ? -3.901  -3.260  6.208   1.00 0.00 ? 22 VAL B CG2  6  
ATOM 11138 H H    . VAL B 1 22 ? -4.408  -4.086  3.850   1.00 0.00 ? 22 VAL B H    6  
ATOM 11139 H HA   . VAL B 1 22 ? -1.761  -5.113  4.263   1.00 0.00 ? 22 VAL B HA   6  
ATOM 11140 H HB   . VAL B 1 22 ? -1.871  -3.848  6.418   1.00 0.00 ? 22 VAL B HB   6  
ATOM 11141 H HG11 . VAL B 1 22 ? -2.427  -1.583  5.083   1.00 0.00 ? 22 VAL B HG11 6  
ATOM 11142 H HG12 . VAL B 1 22 ? -2.226  -2.692  3.727   1.00 0.00 ? 22 VAL B HG12 6  
ATOM 11143 H HG13 . VAL B 1 22 ? -0.920  -2.479  4.893   1.00 0.00 ? 22 VAL B HG13 6  
ATOM 11144 H HG21 . VAL B 1 22 ? -4.358  -2.495  5.597   1.00 0.00 ? 22 VAL B HG21 6  
ATOM 11145 H HG22 . VAL B 1 22 ? -3.752  -2.880  7.208   1.00 0.00 ? 22 VAL B HG22 6  
ATOM 11146 H HG23 . VAL B 1 22 ? -4.546  -4.125  6.243   1.00 0.00 ? 22 VAL B HG23 6  
ATOM 11147 N N    . LEU B 1 23 ? -2.901  -7.322  5.162   1.00 0.00 ? 23 LEU B N    6  
ATOM 11148 C CA   . LEU B 1 23 ? -3.157  -8.525  5.945   1.00 0.00 ? 23 LEU B CA   6  
ATOM 11149 C C    . LEU B 1 23 ? -1.845  -9.111  6.486   1.00 0.00 ? 23 LEU B C    6  
ATOM 11150 O O    . LEU B 1 23 ? -0.947  -8.365  6.875   1.00 0.00 ? 23 LEU B O    6  
ATOM 11151 C CB   . LEU B 1 23 ? -3.911  -9.553  5.090   1.00 0.00 ? 23 LEU B CB   6  
ATOM 11152 C CG   . LEU B 1 23 ? -4.730  -10.608 5.858   1.00 0.00 ? 23 LEU B CG   6  
ATOM 11153 C CD1  . LEU B 1 23 ? -4.741  -10.330 7.359   1.00 0.00 ? 23 LEU B CD1  6  
ATOM 11154 C CD2  . LEU B 1 23 ? -6.153  -10.670 5.320   1.00 0.00 ? 23 LEU B CD2  6  
ATOM 11155 H H    . LEU B 1 23 ? -2.664  -7.407  4.215   1.00 0.00 ? 23 LEU B H    6  
ATOM 11156 H HA   . LEU B 1 23 ? -3.777  -8.241  6.781   1.00 0.00 ? 23 LEU B HA   6  
ATOM 11157 H HB2  . LEU B 1 23 ? -4.583  -9.015  4.437   1.00 0.00 ? 23 LEU B HB2  6  
ATOM 11158 H HB3  . LEU B 1 23 ? -3.189  -10.073 4.478   1.00 0.00 ? 23 LEU B HB3  6  
ATOM 11159 H HG   . LEU B 1 23 ? -4.276  -11.577 5.704   1.00 0.00 ? 23 LEU B HG   6  
ATOM 11160 H HD11 . LEU B 1 23 ? -5.292  -9.422  7.554   1.00 0.00 ? 23 LEU B HD11 6  
ATOM 11161 H HD12 . LEU B 1 23 ? -3.727  -10.217 7.714   1.00 0.00 ? 23 LEU B HD12 6  
ATOM 11162 H HD13 . LEU B 1 23 ? -5.213  -11.154 7.874   1.00 0.00 ? 23 LEU B HD13 6  
ATOM 11163 H HD21 . LEU B 1 23 ? -6.520  -11.683 5.391   1.00 0.00 ? 23 LEU B HD21 6  
ATOM 11164 H HD22 . LEU B 1 23 ? -6.161  -10.355 4.287   1.00 0.00 ? 23 LEU B HD22 6  
ATOM 11165 H HD23 . LEU B 1 23 ? -6.786  -10.015 5.901   1.00 0.00 ? 23 LEU B HD23 6  
ATOM 11166 N N    . GLY B 1 24 ? -1.736  -10.443 6.518   1.00 0.00 ? 24 GLY B N    6  
ATOM 11167 C CA   . GLY B 1 24 ? -0.531  -11.078 7.019   1.00 0.00 ? 24 GLY B CA   6  
ATOM 11168 C C    . GLY B 1 24 ? -0.157  -10.601 8.408   1.00 0.00 ? 24 GLY B C    6  
ATOM 11169 O O    . GLY B 1 24 ? 0.824   -9.877  8.578   1.00 0.00 ? 24 GLY B O    6  
ATOM 11170 H H    . GLY B 1 24 ? -2.475  -10.996 6.204   1.00 0.00 ? 24 GLY B H    6  
ATOM 11171 H HA2  . GLY B 1 24 ? -0.686  -12.146 7.047   1.00 0.00 ? 24 GLY B HA2  6  
ATOM 11172 H HA3  . GLY B 1 24 ? 0.282   -10.860 6.345   1.00 0.00 ? 24 GLY B HA3  6  
ATOM 11173 N N    . VAL B 1 25 ? -0.942  -10.999 9.403   1.00 0.00 ? 25 VAL B N    6  
ATOM 11174 C CA   . VAL B 1 25 ? -0.686  -10.598 10.774  1.00 0.00 ? 25 VAL B CA   6  
ATOM 11175 C C    . VAL B 1 25 ? 0.306   -11.538 11.454  1.00 0.00 ? 25 VAL B C    6  
ATOM 11176 O O    . VAL B 1 25 ? -0.023  -12.679 11.775  1.00 0.00 ? 25 VAL B O    6  
ATOM 11177 C CB   . VAL B 1 25 ? -1.990  -10.564 11.596  1.00 0.00 ? 25 VAL B CB   6  
ATOM 11178 C CG1  . VAL B 1 25 ? -1.733  -10.030 12.998  1.00 0.00 ? 25 VAL B CG1  6  
ATOM 11179 C CG2  . VAL B 1 25 ? -3.046  -9.732  10.883  1.00 0.00 ? 25 VAL B CG2  6  
ATOM 11180 H H    . VAL B 1 25 ? -1.710  -11.567 9.210   1.00 0.00 ? 25 VAL B H    6  
ATOM 11181 H HA   . VAL B 1 25 ? -0.273  -9.605  10.753  1.00 0.00 ? 25 VAL B HA   6  
ATOM 11182 H HB   . VAL B 1 25 ? -2.360  -11.575 11.684  1.00 0.00 ? 25 VAL B HB   6  
ATOM 11183 H HG11 . VAL B 1 25 ? -2.259  -9.096  13.131  1.00 0.00 ? 25 VAL B HG11 6  
ATOM 11184 H HG12 . VAL B 1 25 ? -0.674  -9.869  13.136  1.00 0.00 ? 25 VAL B HG12 6  
ATOM 11185 H HG13 . VAL B 1 25 ? -2.085  -10.747 13.726  1.00 0.00 ? 25 VAL B HG13 6  
ATOM 11186 H HG21 . VAL B 1 25 ? -3.578  -10.353 10.177  1.00 0.00 ? 25 VAL B HG21 6  
ATOM 11187 H HG22 . VAL B 1 25 ? -2.569  -8.918  10.357  1.00 0.00 ? 25 VAL B HG22 6  
ATOM 11188 H HG23 . VAL B 1 25 ? -3.741  -9.334  11.607  1.00 0.00 ? 25 VAL B HG23 6  
ATOM 11189 N N    . LYS B 1 26 ? 1.522   -11.046 11.664  1.00 0.00 ? 26 LYS B N    6  
ATOM 11190 C CA   . LYS B 1 26 ? 2.568   -11.839 12.301  1.00 0.00 ? 26 LYS B CA   6  
ATOM 11191 C C    . LYS B 1 26 ? 3.446   -10.970 13.194  1.00 0.00 ? 26 LYS B C    6  
ATOM 11192 O O    . LYS B 1 26 ? 3.610   -9.775  12.948  1.00 0.00 ? 26 LYS B O    6  
ATOM 11193 C CB   . LYS B 1 26 ? 3.428   -12.530 11.241  1.00 0.00 ? 26 LYS B CB   6  
ATOM 11194 C CG   . LYS B 1 26 ? 4.153   -13.764 11.755  1.00 0.00 ? 26 LYS B CG   6  
ATOM 11195 C CD   . LYS B 1 26 ? 3.480   -15.043 11.286  1.00 0.00 ? 26 LYS B CD   6  
ATOM 11196 C CE   . LYS B 1 26 ? 4.458   -16.207 11.249  1.00 0.00 ? 26 LYS B CE   6  
ATOM 11197 N NZ   . LYS B 1 26 ? 5.157   -16.387 12.552  1.00 0.00 ? 26 LYS B NZ   6  
ATOM 11198 H H    . LYS B 1 26 ? 1.722   -10.134 11.366  1.00 0.00 ? 26 LYS B H    6  
ATOM 11199 H HA   . LYS B 1 26 ? 2.090   -12.591 12.909  1.00 0.00 ? 26 LYS B HA   6  
ATOM 11200 H HB2  . LYS B 1 26 ? 2.795   -12.827 10.418  1.00 0.00 ? 26 LYS B HB2  6  
ATOM 11201 H HB3  . LYS B 1 26 ? 4.166   -11.830 10.880  1.00 0.00 ? 26 LYS B HB3  6  
ATOM 11202 H HG2  . LYS B 1 26 ? 5.170   -13.750 11.391  1.00 0.00 ? 26 LYS B HG2  6  
ATOM 11203 H HG3  . LYS B 1 26 ? 4.156   -13.744 12.835  1.00 0.00 ? 26 LYS B HG3  6  
ATOM 11204 H HD2  . LYS B 1 26 ? 2.675   -15.284 11.964  1.00 0.00 ? 26 LYS B HD2  6  
ATOM 11205 H HD3  . LYS B 1 26 ? 3.083   -14.886 10.294  1.00 0.00 ? 26 LYS B HD3  6  
ATOM 11206 H HE2  . LYS B 1 26 ? 3.914   -17.110 11.016  1.00 0.00 ? 26 LYS B HE2  6  
ATOM 11207 H HE3  . LYS B 1 26 ? 5.191   -16.020 10.479  1.00 0.00 ? 26 LYS B HE3  6  
ATOM 11208 H HZ1  . LYS B 1 26 ? 5.904   -17.105 12.460  1.00 0.00 ? 26 LYS B HZ1  6  
ATOM 11209 H HZ2  . LYS B 1 26 ? 4.482   -16.697 13.280  1.00 0.00 ? 26 LYS B HZ2  6  
ATOM 11210 H HZ3  . LYS B 1 26 ? 5.587   -15.490 12.854  1.00 0.00 ? 26 LYS B HZ3  6  
ATOM 11211 N N    . GLY B 1 27 ? 4.011   -11.580 14.230  1.00 0.00 ? 27 GLY B N    6  
ATOM 11212 C CA   . GLY B 1 27 ? 4.868   -10.849 15.143  1.00 0.00 ? 27 GLY B CA   6  
ATOM 11213 C C    . GLY B 1 27 ? 6.103   -10.296 14.461  1.00 0.00 ? 27 GLY B C    6  
ATOM 11214 O O    . GLY B 1 27 ? 6.590   -10.868 13.486  1.00 0.00 ? 27 GLY B O    6  
ATOM 11215 H H    . GLY B 1 27 ? 3.846   -12.535 14.374  1.00 0.00 ? 27 GLY B H    6  
ATOM 11216 H HA2  . GLY B 1 27 ? 4.307   -10.030 15.568  1.00 0.00 ? 27 GLY B HA2  6  
ATOM 11217 H HA3  . GLY B 1 27 ? 5.176   -11.512 15.939  1.00 0.00 ? 27 GLY B HA3  6  
ATOM 11218 N N    . ASN B 1 28 ? 6.606   -9.176  14.973  1.00 0.00 ? 28 ASN B N    6  
ATOM 11219 C CA   . ASN B 1 28 ? 7.791   -8.532  14.412  1.00 0.00 ? 28 ASN B CA   6  
ATOM 11220 C C    . ASN B 1 28 ? 7.471   -7.862  13.078  1.00 0.00 ? 28 ASN B C    6  
ATOM 11221 O O    . ASN B 1 28 ? 7.357   -6.639  13.003  1.00 0.00 ? 28 ASN B O    6  
ATOM 11222 C CB   . ASN B 1 28 ? 8.930   -9.543  14.237  1.00 0.00 ? 28 ASN B CB   6  
ATOM 11223 C CG   . ASN B 1 28 ? 9.169   -10.366 15.488  1.00 0.00 ? 28 ASN B CG   6  
ATOM 11224 O OD1  . ASN B 1 28 ? 9.766   -9.890  16.454  1.00 0.00 ? 28 ASN B OD1  6  
ATOM 11225 N ND2  . ASN B 1 28 ? 8.703   -11.610 15.476  1.00 0.00 ? 28 ASN B ND2  6  
ATOM 11226 H H    . ASN B 1 28 ? 6.166   -8.769  15.747  1.00 0.00 ? 28 ASN B H    6  
ATOM 11227 H HA   . ASN B 1 28 ? 8.108   -7.771  15.110  1.00 0.00 ? 28 ASN B HA   6  
ATOM 11228 H HB2  . ASN B 1 28 ? 8.689   -10.216 13.429  1.00 0.00 ? 28 ASN B HB2  6  
ATOM 11229 H HB3  . ASN B 1 28 ? 9.840   -9.012  13.999  1.00 0.00 ? 28 ASN B HB3  6  
ATOM 11230 H HD21 . ASN B 1 28 ? 8.238   -11.923 14.672  1.00 0.00 ? 28 ASN B HD21 6  
ATOM 11231 H HD22 . ASN B 1 28 ? 8.843   -12.164 16.272  1.00 0.00 ? 28 ASN B HD22 6  
ATOM 11232 N N    . GLN B 1 29 ? 7.328   -8.664  12.026  1.00 0.00 ? 29 GLN B N    6  
ATOM 11233 C CA   . GLN B 1 29 ? 7.024   -8.134  10.701  1.00 0.00 ? 29 GLN B CA   6  
ATOM 11234 C C    . GLN B 1 29 ? 5.718   -8.712  10.165  1.00 0.00 ? 29 GLN B C    6  
ATOM 11235 O O    . GLN B 1 29 ? 5.517   -9.926  10.163  1.00 0.00 ? 29 GLN B O    6  
ATOM 11236 C CB   . GLN B 1 29 ? 8.166   -8.441  9.731   1.00 0.00 ? 29 GLN B CB   6  
ATOM 11237 C CG   . GLN B 1 29 ? 9.255   -7.380  9.716   1.00 0.00 ? 29 GLN B CG   6  
ATOM 11238 C CD   . GLN B 1 29 ? 9.792   -7.074  11.101  1.00 0.00 ? 29 GLN B CD   6  
ATOM 11239 O OE1  . GLN B 1 29 ? 10.113  -7.981  11.869  1.00 0.00 ? 29 GLN B OE1  6  
ATOM 11240 N NE2  . GLN B 1 29 ? 9.891   -5.791  11.427  1.00 0.00 ? 29 GLN B NE2  6  
ATOM 11241 H H    . GLN B 1 29 ? 7.432   -9.631  12.138  1.00 0.00 ? 29 GLN B H    6  
ATOM 11242 H HA   . GLN B 1 29 ? 6.919   -7.063  10.790  1.00 0.00 ? 29 GLN B HA   6  
ATOM 11243 H HB2  . GLN B 1 29 ? 8.615   -9.383  10.008  1.00 0.00 ? 29 GLN B HB2  6  
ATOM 11244 H HB3  . GLN B 1 29 ? 7.762   -8.524  8.733   1.00 0.00 ? 29 GLN B HB3  6  
ATOM 11245 H HG2  . GLN B 1 29 ? 10.070  -7.728  9.100   1.00 0.00 ? 29 GLN B HG2  6  
ATOM 11246 H HG3  . GLN B 1 29 ? 8.849   -6.472  9.295   1.00 0.00 ? 29 GLN B HG3  6  
ATOM 11247 H HE21 . GLN B 1 29 ? 9.616   -5.123  10.765  1.00 0.00 ? 29 GLN B HE21 6  
ATOM 11248 H HE22 . GLN B 1 29 ? 10.235  -5.565  12.316  1.00 0.00 ? 29 GLN B HE22 6  
ATOM 11249 N N    . VAL B 1 30 ? 4.829   -7.829  9.723   1.00 0.00 ? 30 VAL B N    6  
ATOM 11250 C CA   . VAL B 1 30 ? 3.533   -8.239  9.195   1.00 0.00 ? 30 VAL B CA   6  
ATOM 11251 C C    . VAL B 1 30 ? 3.581   -8.407  7.681   1.00 0.00 ? 30 VAL B C    6  
ATOM 11252 O O    . VAL B 1 30 ? 4.157   -7.580  6.974   1.00 0.00 ? 30 VAL B O    6  
ATOM 11253 C CB   . VAL B 1 30 ? 2.433   -7.223  9.553   1.00 0.00 ? 30 VAL B CB   6  
ATOM 11254 C CG1  . VAL B 1 30 ? 2.092   -7.305  11.032  1.00 0.00 ? 30 VAL B CG1  6  
ATOM 11255 C CG2  . VAL B 1 30 ? 2.863   -5.814  9.173   1.00 0.00 ? 30 VAL B CG2  6  
ATOM 11256 H H    . VAL B 1 30 ? 5.044   -6.872  9.768   1.00 0.00 ? 30 VAL B H    6  
ATOM 11257 H HA   . VAL B 1 30 ? 3.276   -9.188  9.644   1.00 0.00 ? 30 VAL B HA   6  
ATOM 11258 H HB   . VAL B 1 30 ? 1.545   -7.470  8.988   1.00 0.00 ? 30 VAL B HB   6  
ATOM 11259 H HG11 . VAL B 1 30 ? 1.605   -6.391  11.340  1.00 0.00 ? 30 VAL B HG11 6  
ATOM 11260 H HG12 . VAL B 1 30 ? 2.999   -7.440  11.604  1.00 0.00 ? 30 VAL B HG12 6  
ATOM 11261 H HG13 . VAL B 1 30 ? 1.431   -8.141  11.203  1.00 0.00 ? 30 VAL B HG13 6  
ATOM 11262 H HG21 . VAL B 1 30 ? 1.990   -5.220  8.945   1.00 0.00 ? 30 VAL B HG21 6  
ATOM 11263 H HG22 . VAL B 1 30 ? 3.507   -5.855  8.307   1.00 0.00 ? 30 VAL B HG22 6  
ATOM 11264 H HG23 . VAL B 1 30 ? 3.397   -5.366  9.998   1.00 0.00 ? 30 VAL B HG23 6  
ATOM 11265 N N    . ARG B 1 31 ? 2.963   -9.477  7.186   1.00 0.00 ? 31 ARG B N    6  
ATOM 11266 C CA   . ARG B 1 31 ? 2.926   -9.745  5.763   1.00 0.00 ? 31 ARG B CA   6  
ATOM 11267 C C    . ARG B 1 31 ? 1.925   -8.824  5.078   1.00 0.00 ? 31 ARG B C    6  
ATOM 11268 O O    . ARG B 1 31 ? 0.715   -9.014  5.190   1.00 0.00 ? 31 ARG B O    6  
ATOM 11269 C CB   . ARG B 1 31 ? 2.562   -11.209 5.504   1.00 0.00 ? 31 ARG B CB   6  
ATOM 11270 C CG   . ARG B 1 31 ? 3.756   -12.077 5.140   1.00 0.00 ? 31 ARG B CG   6  
ATOM 11271 C CD   . ARG B 1 31 ? 4.128   -13.019 6.274   1.00 0.00 ? 31 ARG B CD   6  
ATOM 11272 N NE   . ARG B 1 31 ? 5.452   -13.605 6.086   1.00 0.00 ? 31 ARG B NE   6  
ATOM 11273 C CZ   . ARG B 1 31 ? 5.702   -14.624 5.266   1.00 0.00 ? 31 ARG B CZ   6  
ATOM 11274 N NH1  . ARG B 1 31 ? 4.721   -15.171 4.559   1.00 0.00 ? 31 ARG B NH1  6  
ATOM 11275 N NH2  . ARG B 1 31 ? 6.936   -15.096 5.152   1.00 0.00 ? 31 ARG B NH2  6  
ATOM 11276 H H    . ARG B 1 31 ? 2.506   -10.089 7.785   1.00 0.00 ? 31 ARG B H    6  
ATOM 11277 H HA   . ARG B 1 31 ? 3.904   -9.553  5.374   1.00 0.00 ? 31 ARG B HA   6  
ATOM 11278 H HB2  . ARG B 1 31 ? 2.105   -11.616 6.394   1.00 0.00 ? 31 ARG B HB2  6  
ATOM 11279 H HB3  . ARG B 1 31 ? 1.851   -11.254 4.692   1.00 0.00 ? 31 ARG B HB3  6  
ATOM 11280 H HG2  . ARG B 1 31 ? 3.511   -12.662 4.267   1.00 0.00 ? 31 ARG B HG2  6  
ATOM 11281 H HG3  . ARG B 1 31 ? 4.600   -11.438 4.923   1.00 0.00 ? 31 ARG B HG3  6  
ATOM 11282 H HD2  . ARG B 1 31 ? 4.118   -12.466 7.202   1.00 0.00 ? 31 ARG B HD2  6  
ATOM 11283 H HD3  . ARG B 1 31 ? 3.396   -13.812 6.321   1.00 0.00 ? 31 ARG B HD3  6  
ATOM 11284 H HE   . ARG B 1 31 ? 6.195   -13.220 6.596   1.00 0.00 ? 31 ARG B HE   6  
ATOM 11285 H HH11 . ARG B 1 31 ? 3.788   -14.819 4.639   1.00 0.00 ? 31 ARG B HH11 6  
ATOM 11286 H HH12 . ARG B 1 31 ? 4.915   -15.936 3.945   1.00 0.00 ? 31 ARG B HH12 6  
ATOM 11287 H HH21 . ARG B 1 31 ? 7.678   -14.687 5.683   1.00 0.00 ? 31 ARG B HH21 6  
ATOM 11288 H HH22 . ARG B 1 31 ? 7.123   -15.861 4.537   1.00 0.00 ? 31 ARG B HH22 6  
ATOM 11289 N N    . ILE B 1 32 ? 2.434   -7.816  4.381   1.00 0.00 ? 32 ILE B N    6  
ATOM 11290 C CA   . ILE B 1 32 ? 1.577   -6.858  3.697   1.00 0.00 ? 32 ILE B CA   6  
ATOM 11291 C C    . ILE B 1 32 ? 1.220   -7.340  2.296   1.00 0.00 ? 32 ILE B C    6  
ATOM 11292 O O    . ILE B 1 32 ? 2.094   -7.727  1.521   1.00 0.00 ? 32 ILE B O    6  
ATOM 11293 C CB   . ILE B 1 32 ? 2.250   -5.475  3.603   1.00 0.00 ? 32 ILE B CB   6  
ATOM 11294 C CG1  . ILE B 1 32 ? 2.935   -5.125  4.929   1.00 0.00 ? 32 ILE B CG1  6  
ATOM 11295 C CG2  . ILE B 1 32 ? 1.228   -4.412  3.228   1.00 0.00 ? 32 ILE B CG2  6  
ATOM 11296 C CD1  . ILE B 1 32 ? 1.965   -4.895  6.069   1.00 0.00 ? 32 ILE B CD1  6  
ATOM 11297 H H    . ILE B 1 32 ? 3.409   -7.706  4.336   1.00 0.00 ? 32 ILE B H    6  
ATOM 11298 H HA   . ILE B 1 32 ? 0.669   -6.755  4.273   1.00 0.00 ? 32 ILE B HA   6  
ATOM 11299 H HB   . ILE B 1 32 ? 2.995   -5.514  2.822   1.00 0.00 ? 32 ILE B HB   6  
ATOM 11300 H HG12 . ILE B 1 32 ? 3.592   -5.935  5.213   1.00 0.00 ? 32 ILE B HG12 6  
ATOM 11301 H HG13 . ILE B 1 32 ? 3.517   -4.224  4.801   1.00 0.00 ? 32 ILE B HG13 6  
ATOM 11302 H HG21 . ILE B 1 32 ? 0.251   -4.714  3.573   1.00 0.00 ? 32 ILE B HG21 6  
ATOM 11303 H HG22 . ILE B 1 32 ? 1.210   -4.293  2.154   1.00 0.00 ? 32 ILE B HG22 6  
ATOM 11304 H HG23 . ILE B 1 32 ? 1.499   -3.473  3.689   1.00 0.00 ? 32 ILE B HG23 6  
ATOM 11305 H HD11 . ILE B 1 32 ? 1.501   -5.831  6.341   1.00 0.00 ? 32 ILE B HD11 6  
ATOM 11306 H HD12 . ILE B 1 32 ? 1.206   -4.193  5.760   1.00 0.00 ? 32 ILE B HD12 6  
ATOM 11307 H HD13 . ILE B 1 32 ? 2.498   -4.498  6.920   1.00 0.00 ? 32 ILE B HD13 6  
ATOM 11308 N N    . GLY B 1 33 ? -0.072  -7.309  1.977   1.00 0.00 ? 33 GLY B N    6  
ATOM 11309 C CA   . GLY B 1 33 ? -0.527  -7.742  0.669   1.00 0.00 ? 33 GLY B CA   6  
ATOM 11310 C C    . GLY B 1 33 ? -0.874  -6.576  -0.229  1.00 0.00 ? 33 GLY B C    6  
ATOM 11311 O O    . GLY B 1 33 ? -1.879  -5.899  -0.015  1.00 0.00 ? 33 GLY B O    6  
ATOM 11312 H H    . GLY B 1 33 ? -0.724  -6.984  2.633   1.00 0.00 ? 33 GLY B H    6  
ATOM 11313 H HA2  . GLY B 1 33 ? 0.251   -8.324  0.202   1.00 0.00 ? 33 GLY B HA2  6  
ATOM 11314 H HA3  . GLY B 1 33 ? -1.403  -8.362  0.791   1.00 0.00 ? 33 GLY B HA3  6  
ATOM 11315 N N    . VAL B 1 34 ? -0.041  -6.332  -1.234  1.00 0.00 ? 34 VAL B N    6  
ATOM 11316 C CA   . VAL B 1 34 ? -0.274  -5.229  -2.156  1.00 0.00 ? 34 VAL B CA   6  
ATOM 11317 C C    . VAL B 1 34 ? -0.738  -5.727  -3.520  1.00 0.00 ? 34 VAL B C    6  
ATOM 11318 O O    . VAL B 1 34 ? 0.062   -6.211  -4.323  1.00 0.00 ? 34 VAL B O    6  
ATOM 11319 C CB   . VAL B 1 34 ? 0.996   -4.378  -2.342  1.00 0.00 ? 34 VAL B CB   6  
ATOM 11320 C CG1  . VAL B 1 34 ? 0.672   -3.085  -3.075  1.00 0.00 ? 34 VAL B CG1  6  
ATOM 11321 C CG2  . VAL B 1 34 ? 1.650   -4.089  -0.999  1.00 0.00 ? 34 VAL B CG2  6  
ATOM 11322 H H    . VAL B 1 34 ? 0.748   -6.901  -1.355  1.00 0.00 ? 34 VAL B H    6  
ATOM 11323 H HA   . VAL B 1 34 ? -1.043  -4.600  -1.734  1.00 0.00 ? 34 VAL B HA   6  
ATOM 11324 H HB   . VAL B 1 34 ? 1.695   -4.939  -2.945  1.00 0.00 ? 34 VAL B HB   6  
ATOM 11325 H HG11 . VAL B 1 34 ? 1.510   -2.803  -3.695  1.00 0.00 ? 34 VAL B HG11 6  
ATOM 11326 H HG12 . VAL B 1 34 ? 0.477   -2.303  -2.356  1.00 0.00 ? 34 VAL B HG12 6  
ATOM 11327 H HG13 . VAL B 1 34 ? -0.201  -3.231  -3.694  1.00 0.00 ? 34 VAL B HG13 6  
ATOM 11328 H HG21 . VAL B 1 34 ? 2.179   -4.968  -0.661  1.00 0.00 ? 34 VAL B HG21 6  
ATOM 11329 H HG22 . VAL B 1 34 ? 0.891   -3.826  -0.278  1.00 0.00 ? 34 VAL B HG22 6  
ATOM 11330 H HG23 . VAL B 1 34 ? 2.346   -3.270  -1.106  1.00 0.00 ? 34 VAL B HG23 6  
ATOM 11331 N N    . ASN B 1 35 ? -2.035  -5.598  -3.775  1.00 0.00 ? 35 ASN B N    6  
ATOM 11332 C CA   . ASN B 1 35 ? -2.604  -6.026  -5.046  1.00 0.00 ? 35 ASN B CA   6  
ATOM 11333 C C    . ASN B 1 35 ? -2.715  -4.845  -6.003  1.00 0.00 ? 35 ASN B C    6  
ATOM 11334 O O    . ASN B 1 35 ? -3.558  -3.966  -5.830  1.00 0.00 ? 35 ASN B O    6  
ATOM 11335 C CB   . ASN B 1 35 ? -3.977  -6.667  -4.834  1.00 0.00 ? 35 ASN B CB   6  
ATOM 11336 C CG   . ASN B 1 35 ? -4.161  -7.926  -5.657  1.00 0.00 ? 35 ASN B CG   6  
ATOM 11337 O OD1  . ASN B 1 35 ? -3.575  -8.071  -6.731  1.00 0.00 ? 35 ASN B OD1  6  
ATOM 11338 N ND2  . ASN B 1 35 ? -4.977  -8.847  -5.157  1.00 0.00 ? 35 ASN B ND2  6  
ATOM 11339 H H    . ASN B 1 35 ? -2.615  -5.211  -3.087  1.00 0.00 ? 35 ASN B H    6  
ATOM 11340 H HA   . ASN B 1 35 ? -1.937  -6.759  -5.476  1.00 0.00 ? 35 ASN B HA   6  
ATOM 11341 H HB2  . ASN B 1 35 ? -4.092  -6.921  -3.791  1.00 0.00 ? 35 ASN B HB2  6  
ATOM 11342 H HB3  . ASN B 1 35 ? -4.745  -5.960  -5.114  1.00 0.00 ? 35 ASN B HB3  6  
ATOM 11343 H HD21 . ASN B 1 35 ? -5.409  -8.664  -4.297  1.00 0.00 ? 35 ASN B HD21 6  
ATOM 11344 H HD22 . ASN B 1 35 ? -5.114  -9.671  -5.669  1.00 0.00 ? 35 ASN B HD22 6  
ATOM 11345 N N    . ALA B 1 36 ? -1.847  -4.832  -7.004  1.00 0.00 ? 36 ALA B N    6  
ATOM 11346 C CA   . ALA B 1 36 ? -1.831  -3.756  -7.988  1.00 0.00 ? 36 ALA B CA   6  
ATOM 11347 C C    . ALA B 1 36 ? -1.688  -4.292  -9.410  1.00 0.00 ? 36 ALA B C    6  
ATOM 11348 O O    . ALA B 1 36 ? -1.026  -5.304  -9.640  1.00 0.00 ? 36 ALA B O    6  
ATOM 11349 C CB   . ALA B 1 36 ? -0.708  -2.778  -7.679  1.00 0.00 ? 36 ALA B CB   6  
ATOM 11350 H H    . ALA B 1 36 ? -1.197  -5.561  -7.067  1.00 0.00 ? 36 ALA B H    6  
ATOM 11351 H HA   . ALA B 1 36 ? -2.768  -3.224  -7.909  1.00 0.00 ? 36 ALA B HA   6  
ATOM 11352 H HB1  . ALA B 1 36 ? 0.176   -3.059  -8.232  1.00 0.00 ? 36 ALA B HB1  6  
ATOM 11353 H HB2  . ALA B 1 36 ? -0.492  -2.801  -6.621  1.00 0.00 ? 36 ALA B HB2  6  
ATOM 11354 H HB3  . ALA B 1 36 ? -1.010  -1.781  -7.964  1.00 0.00 ? 36 ALA B HB3  6  
ATOM 11355 N N    . PRO B 1 37 ? -2.309  -3.609  -10.389 1.00 0.00 ? 37 PRO B N    6  
ATOM 11356 C CA   . PRO B 1 37 ? -2.251  -4.005  -11.796 1.00 0.00 ? 37 PRO B CA   6  
ATOM 11357 C C    . PRO B 1 37 ? -0.958  -3.556  -12.465 1.00 0.00 ? 37 PRO B C    6  
ATOM 11358 O O    . PRO B 1 37 ? -0.316  -2.606  -12.019 1.00 0.00 ? 37 PRO B O    6  
ATOM 11359 C CB   . PRO B 1 37 ? -3.446  -3.275  -12.402 1.00 0.00 ? 37 PRO B CB   6  
ATOM 11360 C CG   . PRO B 1 37 ? -3.559  -2.028  -11.597 1.00 0.00 ? 37 PRO B CG   6  
ATOM 11361 C CD   . PRO B 1 37 ? -3.118  -2.386  -10.200 1.00 0.00 ? 37 PRO B CD   6  
ATOM 11362 H HA   . PRO B 1 37 ? -2.373  -5.072  -11.917 1.00 0.00 ? 37 PRO B HA   6  
ATOM 11363 H HB2  . PRO B 1 37 ? -3.252  -3.062  -13.443 1.00 0.00 ? 37 PRO B HB2  6  
ATOM 11364 H HB3  . PRO B 1 37 ? -4.331  -3.886  -12.310 1.00 0.00 ? 37 PRO B HB3  6  
ATOM 11365 H HG2  . PRO B 1 37 ? -2.913  -1.266  -12.009 1.00 0.00 ? 37 PRO B HG2  6  
ATOM 11366 H HG3  . PRO B 1 37 ? -4.583  -1.687  -11.590 1.00 0.00 ? 37 PRO B HG3  6  
ATOM 11367 H HD2  . PRO B 1 37 ? -2.519  -1.592  -9.778  1.00 0.00 ? 37 PRO B HD2  6  
ATOM 11368 H HD3  . PRO B 1 37 ? -3.975  -2.586  -9.575  1.00 0.00 ? 37 PRO B HD3  6  
ATOM 11369 N N    . LYS B 1 38 ? -0.579  -4.243  -13.537 1.00 0.00 ? 38 LYS B N    6  
ATOM 11370 C CA   . LYS B 1 38 ? 0.639   -3.908  -14.264 1.00 0.00 ? 38 LYS B CA   6  
ATOM 11371 C C    . LYS B 1 38 ? 0.351   -2.940  -15.408 1.00 0.00 ? 38 LYS B C    6  
ATOM 11372 O O    . LYS B 1 38 ? 1.005   -2.987  -16.450 1.00 0.00 ? 38 LYS B O    6  
ATOM 11373 C CB   . LYS B 1 38 ? 1.296   -5.178  -14.810 1.00 0.00 ? 38 LYS B CB   6  
ATOM 11374 C CG   . LYS B 1 38 ? 2.159   -5.904  -13.790 1.00 0.00 ? 38 LYS B CG   6  
ATOM 11375 C CD   . LYS B 1 38 ? 1.469   -7.151  -13.261 1.00 0.00 ? 38 LYS B CD   6  
ATOM 11376 C CE   . LYS B 1 38 ? 2.465   -8.120  -12.644 1.00 0.00 ? 38 LYS B CE   6  
ATOM 11377 N NZ   . LYS B 1 38 ? 1.831   -8.992  -11.618 1.00 0.00 ? 38 LYS B NZ   6  
ATOM 11378 H H    . LYS B 1 38 ? -1.132  -4.990  -13.847 1.00 0.00 ? 38 LYS B H    6  
ATOM 11379 H HA   . LYS B 1 38 ? 1.318   -3.434  -13.571 1.00 0.00 ? 38 LYS B HA   6  
ATOM 11380 H HB2  . LYS B 1 38 ? 0.522   -5.854  -15.143 1.00 0.00 ? 38 LYS B HB2  6  
ATOM 11381 H HB3  . LYS B 1 38 ? 1.917   -4.914  -15.652 1.00 0.00 ? 38 LYS B HB3  6  
ATOM 11382 H HG2  . LYS B 1 38 ? 3.088   -6.190  -14.258 1.00 0.00 ? 38 LYS B HG2  6  
ATOM 11383 H HG3  . LYS B 1 38 ? 2.360   -5.237  -12.964 1.00 0.00 ? 38 LYS B HG3  6  
ATOM 11384 H HD2  . LYS B 1 38 ? 0.750   -6.863  -12.509 1.00 0.00 ? 38 LYS B HD2  6  
ATOM 11385 H HD3  . LYS B 1 38 ? 0.960   -7.643  -14.078 1.00 0.00 ? 38 LYS B HD3  6  
ATOM 11386 H HE2  . LYS B 1 38 ? 2.876   -8.741  -13.427 1.00 0.00 ? 38 LYS B HE2  6  
ATOM 11387 H HE3  . LYS B 1 38 ? 3.260   -7.553  -12.182 1.00 0.00 ? 38 LYS B HE3  6  
ATOM 11388 H HZ1  . LYS B 1 38 ? 2.495   -9.166  -10.836 1.00 0.00 ? 38 LYS B HZ1  6  
ATOM 11389 H HZ2  . LYS B 1 38 ? 1.563   -9.904  -12.039 1.00 0.00 ? 38 LYS B HZ2  6  
ATOM 11390 H HZ3  . LYS B 1 38 ? 0.978   -8.534  -11.238 1.00 0.00 ? 38 LYS B HZ3  6  
ATOM 11391 N N    . GLU B 1 39 ? -0.631  -2.062  -15.212 1.00 0.00 ? 39 GLU B N    6  
ATOM 11392 C CA   . GLU B 1 39 ? -0.998  -1.087  -16.233 1.00 0.00 ? 39 GLU B CA   6  
ATOM 11393 C C    . GLU B 1 39 ? -0.723  0.335   -15.754 1.00 0.00 ? 39 GLU B C    6  
ATOM 11394 O O    . GLU B 1 39 ? -0.234  1.172   -16.513 1.00 0.00 ? 39 GLU B O    6  
ATOM 11395 C CB   . GLU B 1 39 ? -2.475  -1.236  -16.601 1.00 0.00 ? 39 GLU B CB   6  
ATOM 11396 C CG   . GLU B 1 39 ? -2.899  -2.675  -16.849 1.00 0.00 ? 39 GLU B CG   6  
ATOM 11397 C CD   . GLU B 1 39 ? -3.332  -2.919  -18.282 1.00 0.00 ? 39 GLU B CD   6  
ATOM 11398 O OE1  . GLU B 1 39 ? -2.579  -2.536  -19.202 1.00 0.00 ? 39 GLU B OE1  6  
ATOM 11399 O OE2  . GLU B 1 39 ? -4.424  -3.491  -18.483 1.00 0.00 ? 39 GLU B OE2  6  
ATOM 11400 H H    . GLU B 1 39 ? -1.122  -2.067  -14.366 1.00 0.00 ? 39 GLU B H    6  
ATOM 11401 H HA   . GLU B 1 39 ? -0.397  -1.282  -17.109 1.00 0.00 ? 39 GLU B HA   6  
ATOM 11402 H HB2  . GLU B 1 39 ? -3.076  -0.840  -15.796 1.00 0.00 ? 39 GLU B HB2  6  
ATOM 11403 H HB3  . GLU B 1 39 ? -2.670  -0.666  -17.498 1.00 0.00 ? 39 GLU B HB3  6  
ATOM 11404 H HG2  . GLU B 1 39 ? -2.067  -3.326  -16.625 1.00 0.00 ? 39 GLU B HG2  6  
ATOM 11405 H HG3  . GLU B 1 39 ? -3.725  -2.911  -16.194 1.00 0.00 ? 39 GLU B HG3  6  
ATOM 11406 N N    . VAL B 1 40 ? -1.038  0.605   -14.489 1.00 0.00 ? 40 VAL B N    6  
ATOM 11407 C CA   . VAL B 1 40 ? -0.820  1.928   -13.914 1.00 0.00 ? 40 VAL B CA   6  
ATOM 11408 C C    . VAL B 1 40 ? 0.650   2.129   -13.560 1.00 0.00 ? 40 VAL B C    6  
ATOM 11409 O O    . VAL B 1 40 ? 1.402   1.163   -13.431 1.00 0.00 ? 40 VAL B O    6  
ATOM 11410 C CB   . VAL B 1 40 ? -1.683  2.149   -12.655 1.00 0.00 ? 40 VAL B CB   6  
ATOM 11411 C CG1  . VAL B 1 40 ? -1.712  3.622   -12.280 1.00 0.00 ? 40 VAL B CG1  6  
ATOM 11412 C CG2  . VAL B 1 40 ? -3.094  1.622   -12.872 1.00 0.00 ? 40 VAL B CG2  6  
ATOM 11413 H H    . VAL B 1 40 ? -1.422  -0.102  -13.930 1.00 0.00 ? 40 VAL B H    6  
ATOM 11414 H HA   . VAL B 1 40 ? -1.105  2.662   -14.654 1.00 0.00 ? 40 VAL B HA   6  
ATOM 11415 H HB   . VAL B 1 40 ? -1.240  1.603   -11.835 1.00 0.00 ? 40 VAL B HB   6  
ATOM 11416 H HG11 . VAL B 1 40 ? -0.745  3.915   -11.900 1.00 0.00 ? 40 VAL B HG11 6  
ATOM 11417 H HG12 . VAL B 1 40 ? -2.461  3.786   -11.520 1.00 0.00 ? 40 VAL B HG12 6  
ATOM 11418 H HG13 . VAL B 1 40 ? -1.949  4.211   -13.153 1.00 0.00 ? 40 VAL B HG13 6  
ATOM 11419 H HG21 . VAL B 1 40 ? -3.063  0.549   -12.987 1.00 0.00 ? 40 VAL B HG21 6  
ATOM 11420 H HG22 . VAL B 1 40 ? -3.512  2.068   -13.762 1.00 0.00 ? 40 VAL B HG22 6  
ATOM 11421 H HG23 . VAL B 1 40 ? -3.708  1.875   -12.020 1.00 0.00 ? 40 VAL B HG23 6  
ATOM 11422 N N    . SER B 1 41 ? 1.057   3.385   -13.406 1.00 0.00 ? 41 SER B N    6  
ATOM 11423 C CA   . SER B 1 41 ? 2.441   3.700   -13.071 1.00 0.00 ? 41 SER B CA   6  
ATOM 11424 C C    . SER B 1 41 ? 2.785   3.209   -11.669 1.00 0.00 ? 41 SER B C    6  
ATOM 11425 O O    . SER B 1 41 ? 2.348   3.786   -10.674 1.00 0.00 ? 41 SER B O    6  
ATOM 11426 C CB   . SER B 1 41 ? 2.687   5.208   -13.178 1.00 0.00 ? 41 SER B CB   6  
ATOM 11427 O OG   . SER B 1 41 ? 3.823   5.597   -12.426 1.00 0.00 ? 41 SER B OG   6  
ATOM 11428 H H    . SER B 1 41 ? 0.413   4.116   -13.522 1.00 0.00 ? 41 SER B H    6  
ATOM 11429 H HA   . SER B 1 41 ? 3.076   3.191   -13.782 1.00 0.00 ? 41 SER B HA   6  
ATOM 11430 H HB2  . SER B 1 41 ? 2.850   5.470   -14.212 1.00 0.00 ? 41 SER B HB2  6  
ATOM 11431 H HB3  . SER B 1 41 ? 1.824   5.738   -12.805 1.00 0.00 ? 41 SER B HB3  6  
ATOM 11432 H HG   . SER B 1 41 ? 4.275   6.314   -12.876 1.00 0.00 ? 41 SER B HG   6  
ATOM 11433 N N    . VAL B 1 42 ? 3.569   2.138   -11.600 1.00 0.00 ? 42 VAL B N    6  
ATOM 11434 C CA   . VAL B 1 42 ? 3.971   1.566   -10.321 1.00 0.00 ? 42 VAL B CA   6  
ATOM 11435 C C    . VAL B 1 42 ? 5.492   1.533   -10.186 1.00 0.00 ? 42 VAL B C    6  
ATOM 11436 O O    . VAL B 1 42 ? 6.187   0.984   -11.042 1.00 0.00 ? 42 VAL B O    6  
ATOM 11437 C CB   . VAL B 1 42 ? 3.418   0.137   -10.150 1.00 0.00 ? 42 VAL B CB   6  
ATOM 11438 C CG1  . VAL B 1 42 ? 3.981   -0.790  -11.217 1.00 0.00 ? 42 VAL B CG1  6  
ATOM 11439 C CG2  . VAL B 1 42 ? 3.724   -0.394  -8.757  1.00 0.00 ? 42 VAL B CG2  6  
ATOM 11440 H H    . VAL B 1 42 ? 3.886   1.720   -12.428 1.00 0.00 ? 42 VAL B H    6  
ATOM 11441 H HA   . VAL B 1 42 ? 3.560   2.184   -9.536  1.00 0.00 ? 42 VAL B HA   6  
ATOM 11442 H HB   . VAL B 1 42 ? 2.346   0.173   -10.270 1.00 0.00 ? 42 VAL B HB   6  
ATOM 11443 H HG11 . VAL B 1 42 ? 3.458   -1.734  -11.186 1.00 0.00 ? 42 VAL B HG11 6  
ATOM 11444 H HG12 . VAL B 1 42 ? 5.032   -0.956  -11.032 1.00 0.00 ? 42 VAL B HG12 6  
ATOM 11445 H HG13 . VAL B 1 42 ? 3.853   -0.339  -12.190 1.00 0.00 ? 42 VAL B HG13 6  
ATOM 11446 H HG21 . VAL B 1 42 ? 4.585   -1.044  -8.800  1.00 0.00 ? 42 VAL B HG21 6  
ATOM 11447 H HG22 . VAL B 1 42 ? 2.873   -0.946  -8.388  1.00 0.00 ? 42 VAL B HG22 6  
ATOM 11448 H HG23 . VAL B 1 42 ? 3.931   0.434   -8.094  1.00 0.00 ? 42 VAL B HG23 6  
ATOM 11449 N N    . HIS B 1 43 ? 6.004   2.107   -9.101  1.00 0.00 ? 43 HIS B N    6  
ATOM 11450 C CA   . HIS B 1 43 ? 7.440   2.127   -8.848  1.00 0.00 ? 43 HIS B CA   6  
ATOM 11451 C C    . HIS B 1 43 ? 7.733   1.618   -7.441  1.00 0.00 ? 43 HIS B C    6  
ATOM 11452 O O    . HIS B 1 43 ? 7.203   2.146   -6.463  1.00 0.00 ? 43 HIS B O    6  
ATOM 11453 C CB   . HIS B 1 43 ? 7.992   3.544   -9.019  1.00 0.00 ? 43 HIS B CB   6  
ATOM 11454 C CG   . HIS B 1 43 ? 9.435   3.579   -9.419  1.00 0.00 ? 43 HIS B CG   6  
ATOM 11455 N ND1  . HIS B 1 43 ? 9.862   3.979   -10.667 1.00 0.00 ? 43 HIS B ND1  6  
ATOM 11456 C CD2  . HIS B 1 43 ? 10.555  3.260   -8.727  1.00 0.00 ? 43 HIS B CD2  6  
ATOM 11457 C CE1  . HIS B 1 43 ? 11.179  3.905   -10.728 1.00 0.00 ? 43 HIS B CE1  6  
ATOM 11458 N NE2  . HIS B 1 43 ? 11.625  3.472   -9.563  1.00 0.00 ? 43 HIS B NE2  6  
ATOM 11459 H H    . HIS B 1 43 ? 5.405   2.512   -8.440  1.00 0.00 ? 43 HIS B H    6  
ATOM 11460 H HA   . HIS B 1 43 ? 7.914   1.473   -9.564  1.00 0.00 ? 43 HIS B HA   6  
ATOM 11461 H HB2  . HIS B 1 43 ? 7.425   4.054   -9.783  1.00 0.00 ? 43 HIS B HB2  6  
ATOM 11462 H HB3  . HIS B 1 43 ? 7.892   4.077   -8.085  1.00 0.00 ? 43 HIS B HB3  6  
ATOM 11463 H HD2  . HIS B 1 43 ? 10.599  2.906   -7.706  1.00 0.00 ? 43 HIS B HD2  6  
ATOM 11464 H HE1  . HIS B 1 43 ? 11.787  4.158   -11.583 1.00 0.00 ? 43 HIS B HE1  6  
ATOM 11465 H HE2  . HIS B 1 43 ? 12.552  3.216   -9.374  1.00 0.00 ? 43 HIS B HE2  6  
ATOM 11466 N N    . ARG B 1 44 ? 8.574   0.593   -7.334  1.00 0.00 ? 44 ARG B N    6  
ATOM 11467 C CA   . ARG B 1 44 ? 8.923   0.027   -6.036  1.00 0.00 ? 44 ARG B CA   6  
ATOM 11468 C C    . ARG B 1 44 ? 10.264  -0.695  -6.113  1.00 0.00 ? 44 ARG B C    6  
ATOM 11469 O O    . ARG B 1 44 ? 11.244  -0.280  -5.495  1.00 0.00 ? 44 ARG B O    6  
ATOM 11470 C CB   . ARG B 1 44 ? 7.839   -0.947  -5.565  1.00 0.00 ? 44 ARG B CB   6  
ATOM 11471 C CG   . ARG B 1 44 ? 6.430   -0.378  -5.632  1.00 0.00 ? 44 ARG B CG   6  
ATOM 11472 C CD   . ARG B 1 44 ? 5.398   -1.383  -5.142  1.00 0.00 ? 44 ARG B CD   6  
ATOM 11473 N NE   . ARG B 1 44 ? 5.818   -2.046  -3.909  1.00 0.00 ? 44 ARG B NE   6  
ATOM 11474 C CZ   . ARG B 1 44 ? 5.323   -3.207  -3.486  1.00 0.00 ? 44 ARG B CZ   6  
ATOM 11475 N NH1  . ARG B 1 44 ? 4.384   -3.832  -4.186  1.00 0.00 ? 44 ARG B NH1  6  
ATOM 11476 N NH2  . ARG B 1 44 ? 5.766   -3.745  -2.358  1.00 0.00 ? 44 ARG B NH2  6  
ATOM 11477 H H    . ARG B 1 44 ? 8.977   0.203   -8.138  1.00 0.00 ? 44 ARG B H    6  
ATOM 11478 H HA   . ARG B 1 44 ? 9.002   0.839   -5.328  1.00 0.00 ? 44 ARG B HA   6  
ATOM 11479 H HB2  . ARG B 1 44 ? 7.875   -1.832  -6.183  1.00 0.00 ? 44 ARG B HB2  6  
ATOM 11480 H HB3  . ARG B 1 44 ? 8.043   -1.225  -4.542  1.00 0.00 ? 44 ARG B HB3  6  
ATOM 11481 H HG2  . ARG B 1 44 ? 6.378   0.506   -5.015  1.00 0.00 ? 44 ARG B HG2  6  
ATOM 11482 H HG3  . ARG B 1 44 ? 6.205   -0.119  -6.657  1.00 0.00 ? 44 ARG B HG3  6  
ATOM 11483 H HD2  . ARG B 1 44 ? 4.468   -0.865  -4.961  1.00 0.00 ? 44 ARG B HD2  6  
ATOM 11484 H HD3  . ARG B 1 44 ? 5.250   -2.129  -5.908  1.00 0.00 ? 44 ARG B HD3  6  
ATOM 11485 H HE   . ARG B 1 44 ? 6.506   -1.605  -3.369  1.00 0.00 ? 44 ARG B HE   6  
ATOM 11486 H HH11 . ARG B 1 44 ? 4.044   -3.431  -5.037  1.00 0.00 ? 44 ARG B HH11 6  
ATOM 11487 H HH12 . ARG B 1 44 ? 4.017   -4.704  -3.863  1.00 0.00 ? 44 ARG B HH12 6  
ATOM 11488 H HH21 . ARG B 1 44 ? 6.473   -3.279  -1.825  1.00 0.00 ? 44 ARG B HH21 6  
ATOM 11489 H HH22 . ARG B 1 44 ? 5.395   -4.618  -2.040  1.00 0.00 ? 44 ARG B HH22 6  
ATOM 11490 N N    . GLU B 1 45 ? 10.296  -1.779  -6.882  1.00 0.00 ? 45 GLU B N    6  
ATOM 11491 C CA   . GLU B 1 45 ? 11.511  -2.566  -7.053  1.00 0.00 ? 45 GLU B CA   6  
ATOM 11492 C C    . GLU B 1 45 ? 11.318  -3.622  -8.137  1.00 0.00 ? 45 GLU B C    6  
ATOM 11493 O O    . GLU B 1 45 ? 10.334  -4.363  -8.129  1.00 0.00 ? 45 GLU B O    6  
ATOM 11494 C CB   . GLU B 1 45 ? 11.907  -3.233  -5.734  1.00 0.00 ? 45 GLU B CB   6  
ATOM 11495 C CG   . GLU B 1 45 ? 13.410  -3.312  -5.518  1.00 0.00 ? 45 GLU B CG   6  
ATOM 11496 C CD   . GLU B 1 45 ? 14.087  -1.960  -5.629  1.00 0.00 ? 45 GLU B CD   6  
ATOM 11497 O OE1  . GLU B 1 45 ? 13.583  -0.992  -5.022  1.00 0.00 ? 45 GLU B OE1  6  
ATOM 11498 O OE2  . GLU B 1 45 ? 15.121  -1.869  -6.323  1.00 0.00 ? 45 GLU B OE2  6  
ATOM 11499 H H    . GLU B 1 45 ? 9.480   -2.055  -7.350  1.00 0.00 ? 45 GLU B H    6  
ATOM 11500 H HA   . GLU B 1 45 ? 12.300  -1.895  -7.358  1.00 0.00 ? 45 GLU B HA   6  
ATOM 11501 H HB2  . GLU B 1 45 ? 11.477  -2.673  -4.917  1.00 0.00 ? 45 GLU B HB2  6  
ATOM 11502 H HB3  . GLU B 1 45 ? 11.511  -4.237  -5.718  1.00 0.00 ? 45 GLU B HB3  6  
ATOM 11503 H HG2  . GLU B 1 45 ? 13.599  -3.712  -4.533  1.00 0.00 ? 45 GLU B HG2  6  
ATOM 11504 H HG3  . GLU B 1 45 ? 13.833  -3.972  -6.261  1.00 0.00 ? 45 GLU B HG3  6  
ATOM 11505 N N    . GLU B 1 46 ? 12.263  -3.685  -9.069  1.00 0.00 ? 46 GLU B N    6  
ATOM 11506 C CA   . GLU B 1 46 ? 12.196  -4.648  -10.162 1.00 0.00 ? 46 GLU B CA   6  
ATOM 11507 C C    . GLU B 1 46 ? 12.146  -6.076  -9.631  1.00 0.00 ? 46 GLU B C    6  
ATOM 11508 O O    . GLU B 1 46 ? 11.437  -6.924  -10.170 1.00 0.00 ? 46 GLU B O    6  
ATOM 11509 C CB   . GLU B 1 46 ? 13.400  -4.479  -11.092 1.00 0.00 ? 46 GLU B CB   6  
ATOM 11510 C CG   . GLU B 1 46 ? 14.721  -4.321  -10.355 1.00 0.00 ? 46 GLU B CG   6  
ATOM 11511 C CD   . GLU B 1 46 ? 15.420  -3.015  -10.680 1.00 0.00 ? 46 GLU B CD   6  
ATOM 11512 O OE1  . GLU B 1 46 ? 14.717  -2.015  -10.940 1.00 0.00 ? 46 GLU B OE1  6  
ATOM 11513 O OE2  . GLU B 1 46 ? 16.668  -2.992  -10.675 1.00 0.00 ? 46 GLU B OE2  6  
ATOM 11514 H H    . GLU B 1 46 ? 13.024  -3.069  -9.022  1.00 0.00 ? 46 GLU B H    6  
ATOM 11515 H HA   . GLU B 1 46 ? 11.293  -4.452  -10.720 1.00 0.00 ? 46 GLU B HA   6  
ATOM 11516 H HB2  . GLU B 1 46 ? 13.471  -5.347  -11.731 1.00 0.00 ? 46 GLU B HB2  6  
ATOM 11517 H HB3  . GLU B 1 46 ? 13.247  -3.603  -11.704 1.00 0.00 ? 46 GLU B HB3  6  
ATOM 11518 H HG2  . GLU B 1 46 ? 14.533  -4.355  -9.293  1.00 0.00 ? 46 GLU B HG2  6  
ATOM 11519 H HG3  . GLU B 1 46 ? 15.372  -5.139  -10.631 1.00 0.00 ? 46 GLU B HG3  6  
ATOM 11520 N N    . ILE B 1 47 ? 12.906  -6.335  -8.572  1.00 0.00 ? 47 ILE B N    6  
ATOM 11521 C CA   . ILE B 1 47 ? 12.952  -7.661  -7.968  1.00 0.00 ? 47 ILE B CA   6  
ATOM 11522 C C    . ILE B 1 47 ? 11.669  -7.965  -7.199  1.00 0.00 ? 47 ILE B C    6  
ATOM 11523 O O    . ILE B 1 47 ? 11.127  -9.066  -7.286  1.00 0.00 ? 47 ILE B O    6  
ATOM 11524 C CB   . ILE B 1 47 ? 14.153  -7.797  -7.012  1.00 0.00 ? 47 ILE B CB   6  
ATOM 11525 C CG1  . ILE B 1 47 ? 15.442  -7.354  -7.707  1.00 0.00 ? 47 ILE B CG1  6  
ATOM 11526 C CG2  . ILE B 1 47 ? 14.280  -9.229  -6.515  1.00 0.00 ? 47 ILE B CG2  6  
ATOM 11527 C CD1  . ILE B 1 47 ? 16.520  -6.898  -6.748  1.00 0.00 ? 47 ILE B CD1  6  
ATOM 11528 H H    . ILE B 1 47 ? 13.451  -5.618  -8.187  1.00 0.00 ? 47 ILE B H    6  
ATOM 11529 H HA   . ILE B 1 47 ? 13.065  -8.386  -8.761  1.00 0.00 ? 47 ILE B HA   6  
ATOM 11530 H HB   . ILE B 1 47 ? 13.978  -7.161  -6.157  1.00 0.00 ? 47 ILE B HB   6  
ATOM 11531 H HG12 . ILE B 1 47 ? 15.837  -8.180  -8.280  1.00 0.00 ? 47 ILE B HG12 6  
ATOM 11532 H HG13 . ILE B 1 47 ? 15.221  -6.533  -8.373  1.00 0.00 ? 47 ILE B HG13 6  
ATOM 11533 H HG21 . ILE B 1 47 ? 14.976  -9.263  -5.689  1.00 0.00 ? 47 ILE B HG21 6  
ATOM 11534 H HG22 . ILE B 1 47 ? 14.640  -9.858  -7.315  1.00 0.00 ? 47 ILE B HG22 6  
ATOM 11535 H HG23 . ILE B 1 47 ? 13.314  -9.583  -6.186  1.00 0.00 ? 47 ILE B HG23 6  
ATOM 11536 H HD11 . ILE B 1 47 ? 16.093  -6.222  -6.022  1.00 0.00 ? 47 ILE B HD11 6  
ATOM 11537 H HD12 . ILE B 1 47 ? 17.300  -6.392  -7.297  1.00 0.00 ? 47 ILE B HD12 6  
ATOM 11538 H HD13 . ILE B 1 47 ? 16.935  -7.756  -6.239  1.00 0.00 ? 47 ILE B HD13 6  
ATOM 11539 N N    . TYR B 1 48 ? 11.194  -6.983  -6.439  1.00 0.00 ? 48 TYR B N    6  
ATOM 11540 C CA   . TYR B 1 48 ? 9.981   -7.145  -5.642  1.00 0.00 ? 48 TYR B CA   6  
ATOM 11541 C C    . TYR B 1 48 ? 8.826   -7.691  -6.479  1.00 0.00 ? 48 TYR B C    6  
ATOM 11542 O O    . TYR B 1 48 ? 8.123   -8.606  -6.056  1.00 0.00 ? 48 TYR B O    6  
ATOM 11543 C CB   . TYR B 1 48 ? 9.575   -5.809  -5.015  1.00 0.00 ? 48 TYR B CB   6  
ATOM 11544 C CG   . TYR B 1 48 ? 10.347  -5.465  -3.760  1.00 0.00 ? 48 TYR B CG   6  
ATOM 11545 C CD1  . TYR B 1 48 ? 11.711  -5.715  -3.666  1.00 0.00 ? 48 TYR B CD1  6  
ATOM 11546 C CD2  . TYR B 1 48 ? 9.710   -4.888  -2.668  1.00 0.00 ? 48 TYR B CD2  6  
ATOM 11547 C CE1  . TYR B 1 48 ? 12.417  -5.401  -2.520  1.00 0.00 ? 48 TYR B CE1  6  
ATOM 11548 C CE2  . TYR B 1 48 ? 10.410  -4.571  -1.519  1.00 0.00 ? 48 TYR B CE2  6  
ATOM 11549 C CZ   . TYR B 1 48 ? 11.762  -4.829  -1.451  1.00 0.00 ? 48 TYR B CZ   6  
ATOM 11550 O OH   . TYR B 1 48 ? 12.462  -4.515  -0.308  1.00 0.00 ? 48 TYR B OH   6  
ATOM 11551 H H    . TYR B 1 48 ? 11.676  -6.131  -6.404  1.00 0.00 ? 48 TYR B H    6  
ATOM 11552 H HA   . TYR B 1 48 ? 10.198  -7.848  -4.852  1.00 0.00 ? 48 TYR B HA   6  
ATOM 11553 H HB2  . TYR B 1 48 ? 9.738   -5.018  -5.731  1.00 0.00 ? 48 TYR B HB2  6  
ATOM 11554 H HB3  . TYR B 1 48 ? 8.526   -5.844  -4.759  1.00 0.00 ? 48 TYR B HB3  6  
ATOM 11555 H HD1  . TYR B 1 48 ? 12.222  -6.163  -4.505  1.00 0.00 ? 48 TYR B HD1  6  
ATOM 11556 H HD2  . TYR B 1 48 ? 8.651   -4.688  -2.724  1.00 0.00 ? 48 TYR B HD2  6  
ATOM 11557 H HE1  . TYR B 1 48 ? 13.477  -5.603  -2.467  1.00 0.00 ? 48 TYR B HE1  6  
ATOM 11558 H HE2  . TYR B 1 48 ? 9.896   -4.123  -0.681  1.00 0.00 ? 48 TYR B HE2  6  
ATOM 11559 H HH   . TYR B 1 48 ? 12.843  -5.313  0.064   1.00 0.00 ? 48 TYR B HH   6  
ATOM 11560 N N    . GLN B 1 49 ? 8.626   -7.117  -7.660  1.00 0.00 ? 49 GLN B N    6  
ATOM 11561 C CA   . GLN B 1 49 ? 7.541   -7.543  -8.540  1.00 0.00 ? 49 GLN B CA   6  
ATOM 11562 C C    . GLN B 1 49 ? 7.930   -8.764  -9.372  1.00 0.00 ? 49 GLN B C    6  
ATOM 11563 O O    . GLN B 1 49 ? 7.262   -9.795  -9.321  1.00 0.00 ? 49 GLN B O    6  
ATOM 11564 C CB   . GLN B 1 49 ? 7.132   -6.396  -9.465  1.00 0.00 ? 49 GLN B CB   6  
ATOM 11565 C CG   . GLN B 1 49 ? 5.648   -6.378  -9.792  1.00 0.00 ? 49 GLN B CG   6  
ATOM 11566 C CD   . GLN B 1 49 ? 5.375   -6.040  -11.244 1.00 0.00 ? 49 GLN B CD   6  
ATOM 11567 O OE1  . GLN B 1 49 ? 5.009   -4.912  -11.573 1.00 0.00 ? 49 GLN B OE1  6  
ATOM 11568 N NE2  . GLN B 1 49 ? 5.551   -7.020  -12.123 1.00 0.00 ? 49 GLN B NE2  6  
ATOM 11569 H H    . GLN B 1 49 ? 9.212   -6.382  -7.943  1.00 0.00 ? 49 GLN B H    6  
ATOM 11570 H HA   . GLN B 1 49 ? 6.698   -7.804  -7.918  1.00 0.00 ? 49 GLN B HA   6  
ATOM 11571 H HB2  . GLN B 1 49 ? 7.385   -5.459  -8.991  1.00 0.00 ? 49 GLN B HB2  6  
ATOM 11572 H HB3  . GLN B 1 49 ? 7.682   -6.481  -10.391 1.00 0.00 ? 49 GLN B HB3  6  
ATOM 11573 H HG2  . GLN B 1 49 ? 5.235   -7.354  -9.582  1.00 0.00 ? 49 GLN B HG2  6  
ATOM 11574 H HG3  . GLN B 1 49 ? 5.163   -5.641  -9.168  1.00 0.00 ? 49 GLN B HG3  6  
ATOM 11575 H HE21 . GLN B 1 49 ? 5.843   -7.894  -11.790 1.00 0.00 ? 49 GLN B HE21 6  
ATOM 11576 H HE22 . GLN B 1 49 ? 5.381   -6.829  -13.069 1.00 0.00 ? 49 GLN B HE22 6  
ATOM 11577 N N    . ARG B 1 50 ? 9.000   -8.633  -10.151 1.00 0.00 ? 50 ARG B N    6  
ATOM 11578 C CA   . ARG B 1 50 ? 9.469   -9.715  -11.019 1.00 0.00 ? 50 ARG B CA   6  
ATOM 11579 C C    . ARG B 1 50 ? 9.729   -11.023 -10.262 1.00 0.00 ? 50 ARG B C    6  
ATOM 11580 O O    . ARG B 1 50 ? 9.962   -12.060 -10.883 1.00 0.00 ? 50 ARG B O    6  
ATOM 11581 C CB   . ARG B 1 50 ? 10.745  -9.286  -11.746 1.00 0.00 ? 50 ARG B CB   6  
ATOM 11582 C CG   . ARG B 1 50 ? 10.531  -8.147  -12.731 1.00 0.00 ? 50 ARG B CG   6  
ATOM 11583 C CD   . ARG B 1 50 ? 11.734  -7.965  -13.644 1.00 0.00 ? 50 ARG B CD   6  
ATOM 11584 N NE   . ARG B 1 50 ? 11.423  -8.298  -15.033 1.00 0.00 ? 50 ARG B NE   6  
ATOM 11585 C CZ   . ARG B 1 50 ? 10.799  -7.473  -15.872 1.00 0.00 ? 50 ARG B CZ   6  
ATOM 11586 N NH1  . ARG B 1 50 ? 10.414  -6.269  -15.467 1.00 0.00 ? 50 ARG B NH1  6  
ATOM 11587 N NH2  . ARG B 1 50 ? 10.558  -7.855  -17.119 1.00 0.00 ? 50 ARG B NH2  6  
ATOM 11588 H H    . ARG B 1 50 ? 9.479   -7.778  -10.160 1.00 0.00 ? 50 ARG B H    6  
ATOM 11589 H HA   . ARG B 1 50 ? 8.702   -9.894  -11.755 1.00 0.00 ? 50 ARG B HA   6  
ATOM 11590 H HB2  . ARG B 1 50 ? 11.474  -8.971  -11.015 1.00 0.00 ? 50 ARG B HB2  6  
ATOM 11591 H HB3  . ARG B 1 50 ? 11.137  -10.133 -12.290 1.00 0.00 ? 50 ARG B HB3  6  
ATOM 11592 H HG2  . ARG B 1 50 ? 9.663   -8.365  -13.335 1.00 0.00 ? 50 ARG B HG2  6  
ATOM 11593 H HG3  . ARG B 1 50 ? 10.368  -7.233  -12.178 1.00 0.00 ? 50 ARG B HG3  6  
ATOM 11594 H HD2  . ARG B 1 50 ? 12.054  -6.934  -13.595 1.00 0.00 ? 50 ARG B HD2  6  
ATOM 11595 H HD3  . ARG B 1 50 ? 12.533  -8.605  -13.300 1.00 0.00 ? 50 ARG B HD3  6  
ATOM 11596 H HE   . ARG B 1 50 ? 11.694  -9.182  -15.357 1.00 0.00 ? 50 ARG B HE   6  
ATOM 11597 H HH11 . ARG B 1 50 ? 10.592  -5.975  -14.528 1.00 0.00 ? 50 ARG B HH11 6  
ATOM 11598 H HH12 . ARG B 1 50 ? 9.947   -5.655  -16.103 1.00 0.00 ? 50 ARG B HH12 6  
ATOM 11599 H HH21 . ARG B 1 50 ? 10.845  -8.761  -17.429 1.00 0.00 ? 50 ARG B HH21 6  
ATOM 11600 H HH22 . ARG B 1 50 ? 10.089  -7.236  -17.749 1.00 0.00 ? 50 ARG B HH22 6  
ATOM 11601 N N    . ILE B 1 51 ? 9.701   -10.982 -8.933  1.00 0.00 ? 51 ILE B N    6  
ATOM 11602 C CA   . ILE B 1 51 ? 9.947   -12.179 -8.134  1.00 0.00 ? 51 ILE B CA   6  
ATOM 11603 C C    . ILE B 1 51 ? 8.695   -12.624 -7.382  1.00 0.00 ? 51 ILE B C    6  
ATOM 11604 O O    . ILE B 1 51 ? 8.259   -13.767 -7.514  1.00 0.00 ? 51 ILE B O    6  
ATOM 11605 C CB   . ILE B 1 51 ? 11.094  -11.954 -7.126  1.00 0.00 ? 51 ILE B CB   6  
ATOM 11606 C CG1  . ILE B 1 51 ? 12.369  -11.538 -7.861  1.00 0.00 ? 51 ILE B CG1  6  
ATOM 11607 C CG2  . ILE B 1 51 ? 11.341  -13.212 -6.299  1.00 0.00 ? 51 ILE B CG2  6  
ATOM 11608 C CD1  . ILE B 1 51 ? 12.891  -12.594 -8.811  1.00 0.00 ? 51 ILE B CD1  6  
ATOM 11609 H H    . ILE B 1 51 ? 9.519   -10.138 -8.481  1.00 0.00 ? 51 ILE B H    6  
ATOM 11610 H HA   . ILE B 1 51 ? 10.245  -12.970 -8.809  1.00 0.00 ? 51 ILE B HA   6  
ATOM 11611 H HB   . ILE B 1 51 ? 10.801  -11.163 -6.453  1.00 0.00 ? 51 ILE B HB   6  
ATOM 11612 H HG12 . ILE B 1 51 ? 12.173  -10.645 -8.435  1.00 0.00 ? 51 ILE B HG12 6  
ATOM 11613 H HG13 . ILE B 1 51 ? 13.143  -11.332 -7.136  1.00 0.00 ? 51 ILE B HG13 6  
ATOM 11614 H HG21 . ILE B 1 51 ? 10.609  -13.963 -6.557  1.00 0.00 ? 51 ILE B HG21 6  
ATOM 11615 H HG22 . ILE B 1 51 ? 11.257  -12.974 -5.249  1.00 0.00 ? 51 ILE B HG22 6  
ATOM 11616 H HG23 . ILE B 1 51 ? 12.332  -13.590 -6.504  1.00 0.00 ? 51 ILE B HG23 6  
ATOM 11617 H HD11 . ILE B 1 51 ? 13.179  -13.471 -8.251  1.00 0.00 ? 51 ILE B HD11 6  
ATOM 11618 H HD12 . ILE B 1 51 ? 13.748  -12.209 -9.343  1.00 0.00 ? 51 ILE B HD12 6  
ATOM 11619 H HD13 . ILE B 1 51 ? 12.117  -12.857 -9.517  1.00 0.00 ? 51 ILE B HD13 6  
ATOM 11620 N N    . GLN B 1 52 ? 8.122   -11.722 -6.592  1.00 0.00 ? 52 GLN B N    6  
ATOM 11621 C CA   . GLN B 1 52 ? 6.924   -12.042 -5.823  1.00 0.00 ? 52 GLN B CA   6  
ATOM 11622 C C    . GLN B 1 52 ? 5.691   -12.062 -6.719  1.00 0.00 ? 52 GLN B C    6  
ATOM 11623 O O    . GLN B 1 52 ? 4.956   -13.050 -6.755  1.00 0.00 ? 52 GLN B O    6  
ATOM 11624 C CB   . GLN B 1 52 ? 6.729   -11.039 -4.685  1.00 0.00 ? 52 GLN B CB   6  
ATOM 11625 C CG   . GLN B 1 52 ? 7.707   -11.227 -3.537  1.00 0.00 ? 52 GLN B CG   6  
ATOM 11626 C CD   . GLN B 1 52 ? 8.881   -10.270 -3.608  1.00 0.00 ? 52 GLN B CD   6  
ATOM 11627 O OE1  . GLN B 1 52 ? 8.703   -9.054  -3.676  1.00 0.00 ? 52 GLN B OE1  6  
ATOM 11628 N NE2  . GLN B 1 52 ? 10.092  -10.816 -3.591  1.00 0.00 ? 52 GLN B NE2  6  
ATOM 11629 H H    . GLN B 1 52 ? 8.513   -10.826 -6.524  1.00 0.00 ? 52 GLN B H    6  
ATOM 11630 H HA   . GLN B 1 52 ? 7.059   -13.026 -5.401  1.00 0.00 ? 52 GLN B HA   6  
ATOM 11631 H HB2  . GLN B 1 52 ? 6.848   -10.040 -5.074  1.00 0.00 ? 52 GLN B HB2  6  
ATOM 11632 H HB3  . GLN B 1 52 ? 5.727   -11.146 -4.295  1.00 0.00 ? 52 GLN B HB3  6  
ATOM 11633 H HG2  . GLN B 1 52 ? 7.186   -11.064 -2.606  1.00 0.00 ? 52 GLN B HG2  6  
ATOM 11634 H HG3  . GLN B 1 52 ? 8.084   -12.239 -3.565  1.00 0.00 ? 52 GLN B HG3  6  
ATOM 11635 H HE21 . GLN B 1 52 ? 10.159  -11.793 -3.535  1.00 0.00 ? 52 GLN B HE21 6  
ATOM 11636 H HE22 . GLN B 1 52 ? 10.869  -10.221 -3.636  1.00 0.00 ? 52 GLN B HE22 6  
ATOM 11637 N N    . ALA B 1 53 ? 5.467   -10.970 -7.442  1.00 0.00 ? 53 ALA B N    6  
ATOM 11638 C CA   . ALA B 1 53 ? 4.323   -10.872 -8.334  1.00 0.00 ? 53 ALA B CA   6  
ATOM 11639 C C    . ALA B 1 53 ? 4.544   -11.697 -9.596  1.00 0.00 ? 53 ALA B C    6  
ATOM 11640 O O    . ALA B 1 53 ? 3.612   -12.302 -10.126 1.00 0.00 ? 53 ALA B O    6  
ATOM 11641 C CB   . ALA B 1 53 ? 4.056   -9.417  -8.690  1.00 0.00 ? 53 ALA B CB   6  
ATOM 11642 H H    . ALA B 1 53 ? 6.082   -10.214 -7.377  1.00 0.00 ? 53 ALA B H    6  
ATOM 11643 H HA   . ALA B 1 53 ? 3.463   -11.254 -7.810  1.00 0.00 ? 53 ALA B HA   6  
ATOM 11644 H HB1  . ALA B 1 53 ? 2.990   -9.241  -8.709  1.00 0.00 ? 53 ALA B HB1  6  
ATOM 11645 H HB2  . ALA B 1 53 ? 4.474   -9.202  -9.662  1.00 0.00 ? 53 ALA B HB2  6  
ATOM 11646 H HB3  . ALA B 1 53 ? 4.513   -8.776  -7.951  1.00 0.00 ? 53 ALA B HB3  6  
ATOM 11647 N N    . GLU B 1 54 ? 5.784   -11.715 -10.073 1.00 0.00 ? 54 GLU B N    6  
ATOM 11648 C CA   . GLU B 1 54 ? 6.132   -12.464 -11.273 1.00 0.00 ? 54 GLU B CA   6  
ATOM 11649 C C    . GLU B 1 54 ? 6.866   -13.752 -10.922 1.00 0.00 ? 54 GLU B C    6  
ATOM 11650 O O    . GLU B 1 54 ? 7.893   -13.732 -10.243 1.00 0.00 ? 54 GLU B O    6  
ATOM 11651 C CB   . GLU B 1 54 ? 6.995   -11.610 -12.203 1.00 0.00 ? 54 GLU B CB   6  
ATOM 11652 C CG   . GLU B 1 54 ? 6.744   -11.875 -13.679 1.00 0.00 ? 54 GLU B CG   6  
ATOM 11653 C CD   . GLU B 1 54 ? 5.362   -11.439 -14.123 1.00 0.00 ? 54 GLU B CD   6  
ATOM 11654 O OE1  . GLU B 1 54 ? 5.136   -10.217 -14.248 1.00 0.00 ? 54 GLU B OE1  6  
ATOM 11655 O OE2  . GLU B 1 54 ? 4.504   -12.320 -14.344 1.00 0.00 ? 54 GLU B OE2  6  
ATOM 11656 H H    . GLU B 1 54 ? 6.483   -11.212 -9.606  1.00 0.00 ? 54 GLU B H    6  
ATOM 11657 H HA   . GLU B 1 54 ? 5.213   -12.716 -11.782 1.00 0.00 ? 54 GLU B HA   6  
ATOM 11658 H HB2  . GLU B 1 54 ? 6.794   -10.568 -12.007 1.00 0.00 ? 54 GLU B HB2  6  
ATOM 11659 H HB3  . GLU B 1 54 ? 8.035   -11.813 -11.996 1.00 0.00 ? 54 GLU B HB3  6  
ATOM 11660 H HG2  . GLU B 1 54 ? 7.478   -11.334 -14.258 1.00 0.00 ? 54 GLU B HG2  6  
ATOM 11661 H HG3  . GLU B 1 54 ? 6.850   -12.934 -13.865 1.00 0.00 ? 54 GLU B HG3  6  
ATOM 11662 N N    . LYS B 1 55 ? 6.324   -14.869 -11.391 1.00 0.00 ? 55 LYS B N    6  
ATOM 11663 C CA   . LYS B 1 55 ? 6.906   -16.184 -11.142 1.00 0.00 ? 55 LYS B CA   6  
ATOM 11664 C C    . LYS B 1 55 ? 6.793   -16.564 -9.666  1.00 0.00 ? 55 LYS B C    6  
ATOM 11665 O O    . LYS B 1 55 ? 5.824   -17.206 -9.259  1.00 0.00 ? 55 LYS B O    6  
ATOM 11666 C CB   . LYS B 1 55 ? 8.369   -16.222 -11.597 1.00 0.00 ? 55 LYS B CB   6  
ATOM 11667 C CG   . LYS B 1 55 ? 8.556   -16.809 -12.988 1.00 0.00 ? 55 LYS B CG   6  
ATOM 11668 C CD   . LYS B 1 55 ? 9.707   -17.803 -13.030 1.00 0.00 ? 55 LYS B CD   6  
ATOM 11669 C CE   . LYS B 1 55 ? 10.921  -17.222 -13.737 1.00 0.00 ? 55 LYS B CE   6  
ATOM 11670 N NZ   . LYS B 1 55 ? 11.655  -16.254 -12.876 1.00 0.00 ? 55 LYS B NZ   6  
ATOM 11671 H H    . LYS B 1 55 ? 5.504   -14.806 -11.919 1.00 0.00 ? 55 LYS B H    6  
ATOM 11672 H HA   . LYS B 1 55 ? 6.345   -16.901 -11.722 1.00 0.00 ? 55 LYS B HA   6  
ATOM 11673 H HB2  . LYS B 1 55 ? 8.761   -15.216 -11.599 1.00 0.00 ? 55 LYS B HB2  6  
ATOM 11674 H HB3  . LYS B 1 55 ? 8.936   -16.819 -10.898 1.00 0.00 ? 55 LYS B HB3  6  
ATOM 11675 H HG2  . LYS B 1 55 ? 7.648   -17.314 -13.279 1.00 0.00 ? 55 LYS B HG2  6  
ATOM 11676 H HG3  . LYS B 1 55 ? 8.760   -16.005 -13.681 1.00 0.00 ? 55 LYS B HG3  6  
ATOM 11677 H HD2  . LYS B 1 55 ? 9.983   -18.064 -12.019 1.00 0.00 ? 55 LYS B HD2  6  
ATOM 11678 H HD3  . LYS B 1 55 ? 9.384   -18.689 -13.557 1.00 0.00 ? 55 LYS B HD3  6  
ATOM 11679 H HE2  . LYS B 1 55 ? 11.587  -18.029 -14.003 1.00 0.00 ? 55 LYS B HE2  6  
ATOM 11680 H HE3  . LYS B 1 55 ? 10.592  -16.717 -14.633 1.00 0.00 ? 55 LYS B HE3  6  
ATOM 11681 H HZ1  . LYS B 1 55 ? 10.983  -15.618 -12.400 1.00 0.00 ? 55 LYS B HZ1  6  
ATOM 11682 H HZ2  . LYS B 1 55 ? 12.305  -15.683 -13.453 1.00 0.00 ? 55 LYS B HZ2  6  
ATOM 11683 H HZ3  . LYS B 1 55 ? 12.205  -16.762 -12.155 1.00 0.00 ? 55 LYS B HZ3  6  
ATOM 11684 N N    . SER B 1 56 ? 7.782   -16.171 -8.867  1.00 0.00 ? 56 SER B N    6  
ATOM 11685 C CA   . SER B 1 56 ? 7.779   -16.483 -7.441  1.00 0.00 ? 56 SER B CA   6  
ATOM 11686 C C    . SER B 1 56 ? 7.821   -17.991 -7.218  1.00 0.00 ? 56 SER B C    6  
ATOM 11687 O O    . SER B 1 56 ? 7.279   -18.761 -8.011  1.00 0.00 ? 56 SER B O    6  
ATOM 11688 C CB   . SER B 1 56 ? 6.539   -15.892 -6.768  1.00 0.00 ? 56 SER B CB   6  
ATOM 11689 O OG   . SER B 1 56 ? 6.698   -15.841 -5.360  1.00 0.00 ? 56 SER B OG   6  
ATOM 11690 H H    . SER B 1 56 ? 8.532   -15.665 -9.242  1.00 0.00 ? 56 SER B H    6  
ATOM 11691 H HA   . SER B 1 56 ? 8.662   -16.041 -7.003  1.00 0.00 ? 56 SER B HA   6  
ATOM 11692 H HB2  . SER B 1 56 ? 6.374   -14.890 -7.135  1.00 0.00 ? 56 SER B HB2  6  
ATOM 11693 H HB3  . SER B 1 56 ? 5.680   -16.505 -6.998  1.00 0.00 ? 56 SER B HB3  6  
ATOM 11694 H HG   . SER B 1 56 ? 7.579   -15.524 -5.148  1.00 0.00 ? 56 SER B HG   6  
ATOM 11695 N N    . GLN B 1 57 ? 8.468   -18.409 -6.135  1.00 0.00 ? 57 GLN B N    6  
ATOM 11696 C CA   . GLN B 1 57 ? 8.578   -19.827 -5.812  1.00 0.00 ? 57 GLN B CA   6  
ATOM 11697 C C    . GLN B 1 57 ? 8.196   -20.084 -4.358  1.00 0.00 ? 57 GLN B C    6  
ATOM 11698 O O    . GLN B 1 57 ? 7.373   -20.951 -4.066  1.00 0.00 ? 57 GLN B O    6  
ATOM 11699 C CB   . GLN B 1 57 ? 10.000  -20.324 -6.074  1.00 0.00 ? 57 GLN B CB   6  
ATOM 11700 C CG   . GLN B 1 57 ? 11.076  -19.432 -5.477  1.00 0.00 ? 57 GLN B CG   6  
ATOM 11701 C CD   . GLN B 1 57 ? 12.421  -19.608 -6.156  1.00 0.00 ? 57 GLN B CD   6  
ATOM 11702 O OE1  . GLN B 1 57 ? 12.643  -20.581 -6.875  1.00 0.00 ? 57 GLN B OE1  6  
ATOM 11703 N NE2  . GLN B 1 57 ? 13.326  -18.663 -5.929  1.00 0.00 ? 57 GLN B NE2  6  
ATOM 11704 H H    . GLN B 1 57 ? 8.882   -17.751 -5.538  1.00 0.00 ? 57 GLN B H    6  
ATOM 11705 H HA   . GLN B 1 57 ? 7.894   -20.366 -6.451  1.00 0.00 ? 57 GLN B HA   6  
ATOM 11706 H HB2  . GLN B 1 57 ? 10.108  -21.312 -5.652  1.00 0.00 ? 57 GLN B HB2  6  
ATOM 11707 H HB3  . GLN B 1 57 ? 10.159  -20.378 -7.141  1.00 0.00 ? 57 GLN B HB3  6  
ATOM 11708 H HG2  . GLN B 1 57 ? 10.771  -18.402 -5.580  1.00 0.00 ? 57 GLN B HG2  6  
ATOM 11709 H HG3  . GLN B 1 57 ? 11.184  -19.672 -4.429  1.00 0.00 ? 57 GLN B HG3  6  
ATOM 11710 H HE21 . GLN B 1 57 ? 13.079  -17.916 -5.345  1.00 0.00 ? 57 GLN B HE21 6  
ATOM 11711 H HE22 . GLN B 1 57 ? 14.204  -18.751 -6.356  1.00 0.00 ? 57 GLN B HE22 6  
ATOM 11712 N N    . GLN B 1 58 ? 8.799   -19.323 -3.451  1.00 0.00 ? 58 GLN B N    6  
ATOM 11713 C CA   . GLN B 1 58 ? 8.521   -19.468 -2.027  1.00 0.00 ? 58 GLN B CA   6  
ATOM 11714 C C    . GLN B 1 58 ? 8.631   -18.127 -1.310  1.00 0.00 ? 58 GLN B C    6  
ATOM 11715 O O    . GLN B 1 58 ? 9.448   -17.281 -1.675  1.00 0.00 ? 58 GLN B O    6  
ATOM 11716 C CB   . GLN B 1 58 ? 9.484   -20.475 -1.397  1.00 0.00 ? 58 GLN B CB   6  
ATOM 11717 C CG   . GLN B 1 58 ? 9.112   -20.864 0.024   1.00 0.00 ? 58 GLN B CG   6  
ATOM 11718 C CD   . GLN B 1 58 ? 7.985   -21.877 0.075   1.00 0.00 ? 58 GLN B CD   6  
ATOM 11719 O OE1  . GLN B 1 58 ? 8.171   -23.048 -0.257  1.00 0.00 ? 58 GLN B OE1  6  
ATOM 11720 N NE2  . GLN B 1 58 ? 6.805   -21.430 0.491   1.00 0.00 ? 58 GLN B NE2  6  
ATOM 11721 H H    . GLN B 1 58 ? 9.446   -18.648 -3.745  1.00 0.00 ? 58 GLN B H    6  
ATOM 11722 H HA   . GLN B 1 58 ? 7.511   -19.837 -1.923  1.00 0.00 ? 58 GLN B HA   6  
ATOM 11723 H HB2  . GLN B 1 58 ? 9.497   -21.371 -2.001  1.00 0.00 ? 58 GLN B HB2  6  
ATOM 11724 H HB3  . GLN B 1 58 ? 10.476  -20.047 -1.382  1.00 0.00 ? 58 GLN B HB3  6  
ATOM 11725 H HG2  . GLN B 1 58 ? 9.979   -21.290 0.507   1.00 0.00 ? 58 GLN B HG2  6  
ATOM 11726 H HG3  . GLN B 1 58 ? 8.804   -19.977 0.557   1.00 0.00 ? 58 GLN B HG3  6  
ATOM 11727 H HE21 . GLN B 1 58 ? 6.730   -20.484 0.738   1.00 0.00 ? 58 GLN B HE21 6  
ATOM 11728 H HE22 . GLN B 1 58 ? 6.059   -22.063 0.533   1.00 0.00 ? 58 GLN B HE22 6  
ATOM 11729 N N    . SER B 1 59 ? 7.802   -17.939 -0.288  1.00 0.00 ? 59 SER B N    6  
ATOM 11730 C CA   . SER B 1 59 ? 7.806   -16.701 0.481   1.00 0.00 ? 59 SER B CA   6  
ATOM 11731 C C    . SER B 1 59 ? 9.160   -16.478 1.147   1.00 0.00 ? 59 SER B C    6  
ATOM 11732 O O    . SER B 1 59 ? 9.780   -15.428 0.980   1.00 0.00 ? 59 SER B O    6  
ATOM 11733 C CB   . SER B 1 59 ? 6.703   -16.732 1.541   1.00 0.00 ? 59 SER B CB   6  
ATOM 11734 O OG   . SER B 1 59 ? 5.491   -17.230 1.002   1.00 0.00 ? 59 SER B OG   6  
ATOM 11735 H H    . SER B 1 59 ? 7.174   -18.651 -0.045  1.00 0.00 ? 59 SER B H    6  
ATOM 11736 H HA   . SER B 1 59 ? 7.614   -15.886 -0.201  1.00 0.00 ? 59 SER B HA   6  
ATOM 11737 H HB2  . SER B 1 59 ? 7.008   -17.372 2.356   1.00 0.00 ? 59 SER B HB2  6  
ATOM 11738 H HB3  . SER B 1 59 ? 6.534   -15.732 1.912   1.00 0.00 ? 59 SER B HB3  6  
ATOM 11739 H HG   . SER B 1 59 ? 4.769   -17.036 1.604   1.00 0.00 ? 59 SER B HG   6  
ATOM 11740 N N    . SER B 1 60 ? 9.613   -17.474 1.902   1.00 0.00 ? 60 SER B N    6  
ATOM 11741 C CA   . SER B 1 60 ? 10.894  -17.388 2.594   1.00 0.00 ? 60 SER B CA   6  
ATOM 11742 C C    . SER B 1 60 ? 11.818  -18.526 2.171   1.00 0.00 ? 60 SER B C    6  
ATOM 11743 O O    . SER B 1 60 ? 11.462  -19.699 2.276   1.00 0.00 ? 60 SER B O    6  
ATOM 11744 C CB   . SER B 1 60 ? 10.682  -17.425 4.108   1.00 0.00 ? 60 SER B CB   6  
ATOM 11745 O OG   . SER B 1 60 ? 9.658   -18.341 4.458   1.00 0.00 ? 60 SER B OG   6  
ATOM 11746 H H    . SER B 1 60 ? 9.073   -18.286 1.996   1.00 0.00 ? 60 SER B H    6  
ATOM 11747 H HA   . SER B 1 60 ? 11.353  -16.448 2.326   1.00 0.00 ? 60 SER B HA   6  
ATOM 11748 H HB2  . SER B 1 60 ? 11.599  -17.729 4.591   1.00 0.00 ? 60 SER B HB2  6  
ATOM 11749 H HB3  . SER B 1 60 ? 10.402  -16.441 4.455   1.00 0.00 ? 60 SER B HB3  6  
ATOM 11750 H HG   . SER B 1 60 ? 9.825   -18.687 5.338   1.00 0.00 ? 60 SER B HG   6  
ATOM 11751 N N    . TYR B 1 61 ? 13.007  -18.169 1.694   1.00 0.00 ? 61 TYR B N    6  
ATOM 11752 C CA   . TYR B 1 61 ? 13.983  -19.160 1.256   1.00 0.00 ? 61 TYR B CA   6  
ATOM 11753 C C    . TYR B 1 61 ? 13.428  -20.001 0.112   1.00 0.00 ? 61 TYR B C    6  
ATOM 11754 O O    . TYR B 1 61 ? 12.497  -19.528 -0.572  1.00 0.00 ? 61 TYR B O    6  
ATOM 11755 C CB   . TYR B 1 61 ? 14.382  -20.065 2.423   1.00 0.00 ? 61 TYR B CB   6  
ATOM 11756 C CG   . TYR B 1 61 ? 15.727  -20.732 2.241   1.00 0.00 ? 61 TYR B CG   6  
ATOM 11757 C CD1  . TYR B 1 61 ? 16.904  -19.999 2.321   1.00 0.00 ? 61 TYR B CD1  6  
ATOM 11758 C CD2  . TYR B 1 61 ? 15.818  -22.095 1.989   1.00 0.00 ? 61 TYR B CD2  6  
ATOM 11759 C CE1  . TYR B 1 61 ? 18.135  -20.606 2.154   1.00 0.00 ? 61 TYR B CE1  6  
ATOM 11760 C CE2  . TYR B 1 61 ? 17.045  -22.709 1.821   1.00 0.00 ? 61 TYR B CE2  6  
ATOM 11761 C CZ   . TYR B 1 61 ? 18.200  -21.960 1.905   1.00 0.00 ? 61 TYR B CZ   6  
ATOM 11762 O OH   . TYR B 1 61 ? 19.423  -22.568 1.739   1.00 0.00 ? 61 TYR B OH   6  
ATOM 11763 O OXT  . TYR B 1 61 ? 13.930  -21.127 -0.091  1.00 0.00 ? 61 TYR B OXT  6  
ATOM 11764 H H    . TYR B 1 61 ? 13.232  -17.218 1.636   1.00 0.00 ? 61 TYR B H    6  
ATOM 11765 H HA   . TYR B 1 61 ? 14.857  -18.631 0.907   1.00 0.00 ? 61 TYR B HA   6  
ATOM 11766 H HB2  . TYR B 1 61 ? 14.425  -19.476 3.328   1.00 0.00 ? 61 TYR B HB2  6  
ATOM 11767 H HB3  . TYR B 1 61 ? 13.639  -20.840 2.539   1.00 0.00 ? 61 TYR B HB3  6  
ATOM 11768 H HD1  . TYR B 1 61 ? 16.850  -18.939 2.516   1.00 0.00 ? 61 TYR B HD1  6  
ATOM 11769 H HD2  . TYR B 1 61 ? 14.912  -22.679 1.923   1.00 0.00 ? 61 TYR B HD2  6  
ATOM 11770 H HE1  . TYR B 1 61 ? 19.039  -20.019 2.220   1.00 0.00 ? 61 TYR B HE1  6  
ATOM 11771 H HE2  . TYR B 1 61 ? 17.095  -23.770 1.626   1.00 0.00 ? 61 TYR B HE2  6  
ATOM 11772 H HH   . TYR B 1 61 ? 19.363  -23.223 1.039   1.00 0.00 ? 61 TYR B HH   6  
ATOM 11773 N N    . MET A 1 1  ? -3.029  -11.964 -4.242  1.00 0.00 ? 1  MET A N    7  
ATOM 11774 C CA   . MET A 1 1  ? -2.687  -11.315 -2.949  1.00 0.00 ? 1  MET A CA   7  
ATOM 11775 C C    . MET A 1 1  ? -1.199  -11.447 -2.642  1.00 0.00 ? 1  MET A C    7  
ATOM 11776 O O    . MET A 1 1  ? -0.604  -12.507 -2.841  1.00 0.00 ? 1  MET A O    7  
ATOM 11777 C CB   . MET A 1 1  ? -3.512  -11.973 -1.840  1.00 0.00 ? 1  MET A CB   7  
ATOM 11778 C CG   . MET A 1 1  ? -4.847  -11.293 -1.584  1.00 0.00 ? 1  MET A CG   7  
ATOM 11779 S SD   . MET A 1 1  ? -4.682  -9.783  -0.611  1.00 0.00 ? 1  MET A SD   7  
ATOM 11780 C CE   . MET A 1 1  ? -5.349  -10.320 0.962   1.00 0.00 ? 1  MET A CE   7  
ATOM 11781 H H1   . MET A 1 1  ? -2.939  -12.991 -4.115  1.00 0.00 ? 1  MET A H1   7  
ATOM 11782 H H2   . MET A 1 1  ? -2.361  -11.613 -4.959  1.00 0.00 ? 1  MET A H2   7  
ATOM 11783 H H3   . MET A 1 1  ? -4.007  -11.701 -4.479  1.00 0.00 ? 1  MET A H3   7  
ATOM 11784 H HA   . MET A 1 1  ? -2.942  -10.266 -3.011  1.00 0.00 ? 1  MET A HA   7  
ATOM 11785 H HB2  . MET A 1 1  ? -3.702  -13.000 -2.111  1.00 0.00 ? 1  MET A HB2  7  
ATOM 11786 H HB3  . MET A 1 1  ? -2.941  -11.952 -0.923  1.00 0.00 ? 1  MET A HB3  7  
ATOM 11787 H HG2  . MET A 1 1  ? -5.298  -11.045 -2.534  1.00 0.00 ? 1  MET A HG2  7  
ATOM 11788 H HG3  . MET A 1 1  ? -5.489  -11.980 -1.052  1.00 0.00 ? 1  MET A HG3  7  
ATOM 11789 H HE1  . MET A 1 1  ? -5.795  -11.297 0.850   1.00 0.00 ? 1  MET A HE1  7  
ATOM 11790 H HE2  . MET A 1 1  ? -6.099  -9.617  1.294   1.00 0.00 ? 1  MET A HE2  7  
ATOM 11791 H HE3  . MET A 1 1  ? -4.554  -10.369 1.692   1.00 0.00 ? 1  MET A HE3  7  
ATOM 11792 N N    . LEU A 1 2  ? -0.603  -10.363 -2.159  1.00 0.00 ? 2  LEU A N    7  
ATOM 11793 C CA   . LEU A 1 2  ? 0.816   -10.350 -1.824  1.00 0.00 ? 2  LEU A CA   7  
ATOM 11794 C C    . LEU A 1 2  ? 1.015   -10.109 -0.330  1.00 0.00 ? 2  LEU A C    7  
ATOM 11795 O O    . LEU A 1 2  ? 0.866   -8.985  0.148   1.00 0.00 ? 2  LEU A O    7  
ATOM 11796 C CB   . LEU A 1 2  ? 1.537   -9.265  -2.627  1.00 0.00 ? 2  LEU A CB   7  
ATOM 11797 C CG   . LEU A 1 2  ? 1.603   -9.509  -4.138  1.00 0.00 ? 2  LEU A CG   7  
ATOM 11798 C CD1  . LEU A 1 2  ? 0.204   -9.584  -4.730  1.00 0.00 ? 2  LEU A CD1  7  
ATOM 11799 C CD2  . LEU A 1 2  ? 2.415   -8.415  -4.818  1.00 0.00 ? 2  LEU A CD2  7  
ATOM 11800 H H    . LEU A 1 2  ? -1.131  -9.548  -2.025  1.00 0.00 ? 2  LEU A H    7  
ATOM 11801 H HA   . LEU A 1 2  ? 1.231   -11.313 -2.083  1.00 0.00 ? 2  LEU A HA   7  
ATOM 11802 H HB2  . LEU A 1 2  ? 1.032   -8.326  -2.456  1.00 0.00 ? 2  LEU A HB2  7  
ATOM 11803 H HB3  . LEU A 1 2  ? 2.547   -9.183  -2.255  1.00 0.00 ? 2  LEU A HB3  7  
ATOM 11804 H HG   . LEU A 1 2  ? 2.093   -10.454 -4.322  1.00 0.00 ? 2  LEU A HG   7  
ATOM 11805 H HD11 . LEU A 1 2  ? -0.102  -10.617 -4.802  1.00 0.00 ? 2  LEU A HD11 7  
ATOM 11806 H HD12 . LEU A 1 2  ? 0.205   -9.140  -5.715  1.00 0.00 ? 2  LEU A HD12 7  
ATOM 11807 H HD13 . LEU A 1 2  ? -0.486  -9.048  -4.095  1.00 0.00 ? 2  LEU A HD13 7  
ATOM 11808 H HD21 . LEU A 1 2  ? 1.926   -8.121  -5.735  1.00 0.00 ? 2  LEU A HD21 7  
ATOM 11809 H HD22 . LEU A 1 2  ? 3.403   -8.787  -5.042  1.00 0.00 ? 2  LEU A HD22 7  
ATOM 11810 H HD23 . LEU A 1 2  ? 2.492   -7.561  -4.161  1.00 0.00 ? 2  LEU A HD23 7  
ATOM 11811 N N    . ILE A 1 3  ? 1.359   -11.165 0.404   1.00 0.00 ? 3  ILE A N    7  
ATOM 11812 C CA   . ILE A 1 3  ? 1.581   -11.050 1.841   1.00 0.00 ? 3  ILE A CA   7  
ATOM 11813 C C    . ILE A 1 3  ? 3.067   -10.890 2.147   1.00 0.00 ? 3  ILE A C    7  
ATOM 11814 O O    . ILE A 1 3  ? 3.834   -11.850 2.081   1.00 0.00 ? 3  ILE A O    7  
ATOM 11815 C CB   . ILE A 1 3  ? 1.031   -12.278 2.598   1.00 0.00 ? 3  ILE A CB   7  
ATOM 11816 C CG1  . ILE A 1 3  ? -0.472  -12.434 2.342   1.00 0.00 ? 3  ILE A CG1  7  
ATOM 11817 C CG2  . ILE A 1 3  ? 1.312   -12.160 4.092   1.00 0.00 ? 3  ILE A CG2  7  
ATOM 11818 C CD1  . ILE A 1 3  ? -1.326  -11.407 3.061   1.00 0.00 ? 3  ILE A CD1  7  
ATOM 11819 H H    . ILE A 1 3  ? 1.472   -12.036 -0.031  1.00 0.00 ? 3  ILE A H    7  
ATOM 11820 H HA   . ILE A 1 3  ? 1.056   -10.173 2.190   1.00 0.00 ? 3  ILE A HA   7  
ATOM 11821 H HB   . ILE A 1 3  ? 1.543   -13.155 2.232   1.00 0.00 ? 3  ILE A HB   7  
ATOM 11822 H HG12 . ILE A 1 3  ? -0.660  -12.338 1.282   1.00 0.00 ? 3  ILE A HG12 7  
ATOM 11823 H HG13 . ILE A 1 3  ? -0.784  -13.416 2.669   1.00 0.00 ? 3  ILE A HG13 7  
ATOM 11824 H HG21 . ILE A 1 3  ? 2.329   -12.465 4.293