data_1Y02
# 
_entry.id   1Y02 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1Y02         
RCSB  RCSB030945   
WWPDB D_1000030945 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1Y02 
_pdbx_database_status.recvd_initial_deposition_date   2004-11-14 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tibbetts, M.D.' 1 
'Gu, L.'         2 
'Shiozaki, E.N.' 3 
'Shi, Y.'        4 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of a FYVE-type zinc finger domain from the caspase regulator CARP2.' 
_citation.journal_abbrev            STRUCTURE 
_citation.journal_volume            12 
_citation.page_first                2257 
_citation.page_last                 2263 
_citation.year                      2004 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15576038 
_citation.pdbx_database_id_DOI      10.1016/j.str.2004.10.007 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tibbetts, M.D.' 1 
primary 'Shiozaki, E.N.' 2 
primary 'Gu, L.'         3 
primary 'McDonald, E.R.' 4 
primary 'El-Deiry, W.S.' 5 
primary 'Shi, Y.'        6 
# 
_cell.entry_id           1Y02 
_cell.length_a           51.196 
_cell.length_b           51.196 
_cell.length_c           38.564 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              3 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1Y02 
_symmetry.space_group_name_H-M             'P 31' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                144 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'FYVE-RING finger protein SAKURA' 13593.707 1   ? ? 'CARP2 fragment (residues 26-145)' ? 
2 non-polymer syn 'ZINC ION'                        65.409    2   ? ? ?                                  ? 
3 water       nat water                             18.015    153 ? ? ?                                  ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        CARP2 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MQAYSNPGYSSFPSPTGLEPSCKSCGAHFANTARKQTCLDCKKNFCMTCSSQVGNGPRLCLLCQRFRATAFQREELMKMK
VKDLRDYLSLHDISTEMCREKEELVLLVLGQQPVISQEDR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MQAYSNPGYSSFPSPTGLEPSCKSCGAHFANTARKQTCLDCKKNFCMTCSSQVGNGPRLCLLCQRFRATAFQREELMKMK
VKDLRDYLSLHDISTEMCREKEELVLLVLGQQPVISQEDR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLN n 
1 3   ALA n 
1 4   TYR n 
1 5   SER n 
1 6   ASN n 
1 7   PRO n 
1 8   GLY n 
1 9   TYR n 
1 10  SER n 
1 11  SER n 
1 12  PHE n 
1 13  PRO n 
1 14  SER n 
1 15  PRO n 
1 16  THR n 
1 17  GLY n 
1 18  LEU n 
1 19  GLU n 
1 20  PRO n 
1 21  SER n 
1 22  CYS n 
1 23  LYS n 
1 24  SER n 
1 25  CYS n 
1 26  GLY n 
1 27  ALA n 
1 28  HIS n 
1 29  PHE n 
1 30  ALA n 
1 31  ASN n 
1 32  THR n 
1 33  ALA n 
1 34  ARG n 
1 35  LYS n 
1 36  GLN n 
1 37  THR n 
1 38  CYS n 
1 39  LEU n 
1 40  ASP n 
1 41  CYS n 
1 42  LYS n 
1 43  LYS n 
1 44  ASN n 
1 45  PHE n 
1 46  CYS n 
1 47  MET n 
1 48  THR n 
1 49  CYS n 
1 50  SER n 
1 51  SER n 
1 52  GLN n 
1 53  VAL n 
1 54  GLY n 
1 55  ASN n 
1 56  GLY n 
1 57  PRO n 
1 58  ARG n 
1 59  LEU n 
1 60  CYS n 
1 61  LEU n 
1 62  LEU n 
1 63  CYS n 
1 64  GLN n 
1 65  ARG n 
1 66  PHE n 
1 67  ARG n 
1 68  ALA n 
1 69  THR n 
1 70  ALA n 
1 71  PHE n 
1 72  GLN n 
1 73  ARG n 
1 74  GLU n 
1 75  GLU n 
1 76  LEU n 
1 77  MET n 
1 78  LYS n 
1 79  MET n 
1 80  LYS n 
1 81  VAL n 
1 82  LYS n 
1 83  ASP n 
1 84  LEU n 
1 85  ARG n 
1 86  ASP n 
1 87  TYR n 
1 88  LEU n 
1 89  SER n 
1 90  LEU n 
1 91  HIS n 
1 92  ASP n 
1 93  ILE n 
1 94  SER n 
1 95  THR n 
1 96  GLU n 
1 97  MET n 
1 98  CYS n 
1 99  ARG n 
1 100 GLU n 
1 101 LYS n 
1 102 GLU n 
1 103 GLU n 
1 104 LEU n 
1 105 VAL n 
1 106 LEU n 
1 107 LEU n 
1 108 VAL n 
1 109 LEU n 
1 110 GLY n 
1 111 GLN n 
1 112 GLN n 
1 113 PRO n 
1 114 VAL n 
1 115 ILE n 
1 116 SER n 
1 117 GLN n 
1 118 GLU n 
1 119 ASP n 
1 120 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RFFL_HUMAN 
_struct_ref.pdbx_db_accession          Q8WZ73 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MQAYSNPGYSSFPSPTGLEPSCKSCGAHFANTARKQTCLDCKKNFCMTCSSQVGNGPRLCLLCQRFRATAFQREELMKMK
VKDLRDYLSLHDISTEMCREKEELVLLVLGQQPVISQEDR
;
_struct_ref.pdbx_align_begin           26 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1Y02 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 120 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8WZ73 
_struct_ref_seq.db_align_beg                  26 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  145 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       120 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          1Y02 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.4 
_exptl_crystal.density_percent_sol   50 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    'HEPES, Na, K, Tartrate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2004-02-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Ni MIRROR + Ni FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.28 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.28 
# 
_reflns.entry_id                     1Y02 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            1.7 
_reflns.d_resolution_low             99 
_reflns.number_all                   12581 
_reflns.number_obs                   12241 
_reflns.percent_possible_obs         97.3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.071 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.7 
_reflns_shell.d_res_low              1.76 
_reflns_shell.percent_possible_all   85.2 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.446 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1Y02 
_refine.ls_d_res_high                            1.8 
_refine.ls_d_res_low                             20 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     10491 
_refine.ls_number_reflns_obs                     10239 
_refine.ls_number_reflns_R_free                  519 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          0.21 
_refine.ls_R_factor_obs                          0.21 
_refine.ls_R_factor_R_work                       0.206 
_refine.ls_R_factor_R_free                       0.2338 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        724 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             153 
_refine_hist.number_atoms_total               879 
_refine_hist.d_res_high                       1.8 
_refine_hist.d_res_low                        20 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.37  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1Y02 
_struct.title                     'Crystal Structure of a FYVE-type domain from caspase regulator CARP2' 
_struct.pdbx_descriptor           'FYVE-RING finger protein SAKURA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1Y02 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            
'CARP2, FYVE, zinc-binding module, phosphoinositide binding, caspase regulation, METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN A 31  ? LYS A 35  ? ASN A 31  LYS A 35  5 ? 5  
HELX_P HELX_P2 2 CYS A 46  ? THR A 48  ? CYS A 46  THR A 48  5 ? 3  
HELX_P HELX_P3 3 LEU A 61  ? THR A 69  ? LEU A 61  THR A 69  1 ? 9  
HELX_P HELX_P4 4 GLN A 72  ? LYS A 78  ? GLN A 72  LYS A 78  1 ? 7  
HELX_P HELX_P5 5 LYS A 80  ? HIS A 91  ? LYS A 80  HIS A 91  1 ? 12 
HELX_P HELX_P6 6 GLU A 100 ? GLN A 111 ? GLU A 100 GLN A 111 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 38 SG ? ? A ZN 161 A CYS 38 1_555 ? ? ? ? ? ? ? 2.413 ? 
metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 41 SG ? ? A ZN 161 A CYS 41 1_555 ? ? ? ? ? ? ? 2.359 ? 
metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 60 SG ? ? A ZN 161 A CYS 60 1_555 ? ? ? ? ? ? ? 2.392 ? 
metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 63 SG ? ? A ZN 161 A CYS 63 1_555 ? ? ? ? ? ? ? 2.362 ? 
metalc5 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 22 SG ? ? A ZN 162 A CYS 22 1_555 ? ? ? ? ? ? ? 2.359 ? 
metalc6 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 49 SG ? ? A ZN 162 A CYS 49 1_555 ? ? ? ? ? ? ? 2.348 ? 
metalc7 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 46 SG ? ? A ZN 162 A CYS 46 1_555 ? ? ? ? ? ? ? 2.336 ? 
metalc8 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 25 SG ? ? A ZN 162 A CYS 25 1_555 ? ? ? ? ? ? ? 2.368 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 36 ? THR A 37 ? GLN A 36 THR A 37 
A 2 ASN A 44 ? PHE A 45 ? ASN A 44 PHE A 45 
B 1 SER A 50 ? SER A 51 ? SER A 50 SER A 51 
B 2 LEU A 59 ? CYS A 60 ? LEU A 59 CYS A 60 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLN A 36 ? N GLN A 36 O PHE A 45 ? O PHE A 45 
B 1 2 N SER A 51 ? N SER A 51 O LEU A 59 ? O LEU A 59 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 161' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN A 162' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 38 ? CYS A 38 . ? 1_555 ? 
2 AC1 4 CYS A 41 ? CYS A 41 . ? 1_555 ? 
3 AC1 4 CYS A 60 ? CYS A 60 . ? 1_555 ? 
4 AC1 4 CYS A 63 ? CYS A 63 . ? 1_555 ? 
5 AC2 5 CYS A 22 ? CYS A 22 . ? 1_555 ? 
6 AC2 5 LYS A 23 ? LYS A 23 . ? 2_655 ? 
7 AC2 5 CYS A 25 ? CYS A 25 . ? 1_555 ? 
8 AC2 5 CYS A 46 ? CYS A 46 . ? 1_555 ? 
9 AC2 5 CYS A 49 ? CYS A 49 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1Y02 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1Y02 
_atom_sites.fract_transf_matrix[1][1]   0.019533 
_atom_sites.fract_transf_matrix[1][2]   0.011277 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.022555 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.025931 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N   . PRO A 1 20  ? 21.162 18.541  14.905 1.00 50.75 ? 20  PRO A N   1 
ATOM   2   C  CA  . PRO A 1 20  ? 22.510 18.698  15.497 1.00 49.26 ? 20  PRO A CA  1 
ATOM   3   C  C   . PRO A 1 20  ? 22.474 18.527  17.011 1.00 43.97 ? 20  PRO A C   1 
ATOM   4   O  O   . PRO A 1 20  ? 21.674 19.160  17.697 1.00 44.50 ? 20  PRO A O   1 
ATOM   5   C  CB  . PRO A 1 20  ? 22.996 20.089  15.122 1.00 52.21 ? 20  PRO A CB  1 
ATOM   6   C  CG  . PRO A 1 20  ? 21.674 20.829  14.946 1.00 54.11 ? 20  PRO A CG  1 
ATOM   7   C  CD  . PRO A 1 20  ? 20.746 19.806  14.276 1.00 53.69 ? 20  PRO A CD  1 
ATOM   8   N  N   . SER A 1 21  ? 23.346 17.668  17.527 1.00 41.34 ? 21  SER A N   1 
ATOM   9   C  CA  . SER A 1 21  ? 23.414 17.411  18.961 1.00 37.05 ? 21  SER A CA  1 
ATOM   10  C  C   . SER A 1 21  ? 24.850 17.122  19.379 1.00 33.63 ? 21  SER A C   1 
ATOM   11  O  O   . SER A 1 21  ? 25.717 16.901  18.535 1.00 30.93 ? 21  SER A O   1 
ATOM   12  C  CB  . SER A 1 21  ? 22.522 16.222  19.324 1.00 38.84 ? 21  SER A CB  1 
ATOM   13  O  OG  . SER A 1 21  ? 22.935 15.050  18.640 1.00 43.48 ? 21  SER A OG  1 
ATOM   14  N  N   . CYS A 1 22  ? 25.103 17.126  20.684 1.00 29.15 ? 22  CYS A N   1 
ATOM   15  C  CA  . CYS A 1 22  ? 26.442 16.857  21.185 1.00 27.41 ? 22  CYS A CA  1 
ATOM   16  C  C   . CYS A 1 22  ? 26.796 15.386  21.030 1.00 28.62 ? 22  CYS A C   1 
ATOM   17  O  O   . CYS A 1 22  ? 26.047 14.504  21.451 1.00 24.93 ? 22  CYS A O   1 
ATOM   18  C  CB  . CYS A 1 22  ? 26.559 17.244  22.658 1.00 25.29 ? 22  CYS A CB  1 
ATOM   19  S  SG  . CYS A 1 22  ? 28.181 16.922  23.350 1.00 24.21 ? 22  CYS A SG  1 
ATOM   20  N  N   . LYS A 1 23  ? 27.956 15.135  20.434 1.00 26.23 ? 23  LYS A N   1 
ATOM   21  C  CA  . LYS A 1 23  ? 28.432 13.781  20.210 1.00 26.84 ? 23  LYS A CA  1 
ATOM   22  C  C   . LYS A 1 23  ? 28.734 13.043  21.515 1.00 26.31 ? 23  LYS A C   1 
ATOM   23  O  O   . LYS A 1 23  ? 28.667 11.815  21.573 1.00 29.34 ? 23  LYS A O   1 
ATOM   24  C  CB  . LYS A 1 23  ? 29.684 13.827  19.321 1.00 25.90 ? 23  LYS A CB  1 
ATOM   25  C  CG  . LYS A 1 23  ? 30.290 12.473  18.977 1.00 26.83 ? 23  LYS A CG  1 
ATOM   26  C  CD  . LYS A 1 23  ? 29.349 11.590  18.164 1.00 25.71 ? 23  LYS A CD  1 
ATOM   27  C  CE  . LYS A 1 23  ? 29.096 12.158  16.779 1.00 24.62 ? 23  LYS A CE  1 
ATOM   28  N  NZ  . LYS A 1 23  ? 28.142 11.305  16.013 1.00 26.41 ? 23  LYS A NZ  1 
ATOM   29  N  N   . SER A 1 24  ? 29.051 13.790  22.568 1.00 27.06 ? 24  SER A N   1 
ATOM   30  C  CA  . SER A 1 24  ? 29.374 13.178  23.851 1.00 28.52 ? 24  SER A CA  1 
ATOM   31  C  C   . SER A 1 24  ? 28.160 12.882  24.733 1.00 31.16 ? 24  SER A C   1 
ATOM   32  O  O   . SER A 1 24  ? 27.879 11.721  25.043 1.00 32.76 ? 24  SER A O   1 
ATOM   33  C  CB  . SER A 1 24  ? 30.358 14.064  24.623 1.00 29.14 ? 24  SER A CB  1 
ATOM   34  O  OG  . SER A 1 24  ? 30.741 13.453  25.846 1.00 33.13 ? 24  SER A OG  1 
ATOM   35  N  N   . CYS A 1 25  ? 27.434 13.924  25.125 1.00 29.22 ? 25  CYS A N   1 
ATOM   36  C  CA  . CYS A 1 25  ? 26.281 13.755  26.005 1.00 30.20 ? 25  CYS A CA  1 
ATOM   37  C  C   . CYS A 1 25  ? 24.931 13.616  25.304 1.00 31.39 ? 25  CYS A C   1 
ATOM   38  O  O   . CYS A 1 25  ? 23.929 13.284  25.943 1.00 30.43 ? 25  CYS A O   1 
ATOM   39  C  CB  . CYS A 1 25  ? 26.221 14.915  27.006 1.00 30.95 ? 25  CYS A CB  1 
ATOM   40  S  SG  . CYS A 1 25  ? 25.732 16.489  26.296 1.00 29.90 ? 25  CYS A SG  1 
ATOM   41  N  N   . GLY A 1 26  ? 24.902 13.879  24.001 1.00 30.56 ? 26  GLY A N   1 
ATOM   42  C  CA  . GLY A 1 26  ? 23.666 13.760  23.246 1.00 29.74 ? 26  GLY A CA  1 
ATOM   43  C  C   . GLY A 1 26  ? 22.687 14.915  23.361 1.00 29.91 ? 26  GLY A C   1 
ATOM   44  O  O   . GLY A 1 26  ? 21.657 14.924  22.692 1.00 29.71 ? 26  GLY A O   1 
ATOM   45  N  N   . ALA A 1 27  ? 22.997 15.898  24.198 1.00 30.28 ? 27  ALA A N   1 
ATOM   46  C  CA  . ALA A 1 27  ? 22.106 17.037  24.370 1.00 32.88 ? 27  ALA A CA  1 
ATOM   47  C  C   . ALA A 1 27  ? 22.087 17.948  23.146 1.00 33.59 ? 27  ALA A C   1 
ATOM   48  O  O   . ALA A 1 27  ? 22.966 17.877  22.284 1.00 30.67 ? 27  ALA A O   1 
ATOM   49  C  CB  . ALA A 1 27  ? 22.516 17.837  25.607 1.00 34.87 ? 27  ALA A CB  1 
ATOM   50  N  N   . HIS A 1 28  ? 21.068 18.797  23.077 1.00 34.72 ? 28  HIS A N   1 
ATOM   51  C  CA  . HIS A 1 28  ? 20.930 19.746  21.987 1.00 37.89 ? 28  HIS A CA  1 
ATOM   52  C  C   . HIS A 1 28  ? 21.521 21.082  22.416 1.00 36.01 ? 28  HIS A C   1 
ATOM   53  O  O   . HIS A 1 28  ? 21.967 21.235  23.552 1.00 33.12 ? 28  HIS A O   1 
ATOM   54  C  CB  . HIS A 1 28  ? 19.457 19.917  21.610 1.00 45.57 ? 28  HIS A CB  1 
ATOM   55  C  CG  . HIS A 1 28  ? 18.902 18.768  20.826 1.00 53.35 ? 28  HIS A CG  1 
ATOM   56  N  ND1 . HIS A 1 28  ? 18.919 17.472  21.291 1.00 57.08 ? 28  HIS A ND1 1 
ATOM   57  C  CD2 . HIS A 1 28  ? 18.327 18.723  19.601 1.00 56.42 ? 28  HIS A CD2 1 
ATOM   58  C  CE1 . HIS A 1 28  ? 18.379 16.675  20.385 1.00 57.28 ? 28  HIS A CE1 1 
ATOM   59  N  NE2 . HIS A 1 28  ? 18.012 17.408  19.351 1.00 58.00 ? 28  HIS A NE2 1 
ATOM   60  N  N   . PHE A 1 29  ? 21.519 22.045  21.501 1.00 34.86 ? 29  PHE A N   1 
ATOM   61  C  CA  . PHE A 1 29  ? 22.072 23.366  21.769 1.00 34.74 ? 29  PHE A CA  1 
ATOM   62  C  C   . PHE A 1 29  ? 20.969 24.420  21.776 1.00 34.62 ? 29  PHE A C   1 
ATOM   63  O  O   . PHE A 1 29  ? 20.084 24.397  20.923 1.00 34.37 ? 29  PHE A O   1 
ATOM   64  C  CB  . PHE A 1 29  ? 23.104 23.713  20.692 1.00 33.81 ? 29  PHE A CB  1 
ATOM   65  C  CG  . PHE A 1 29  ? 24.169 22.665  20.512 1.00 33.26 ? 29  PHE A CG  1 
ATOM   66  C  CD1 . PHE A 1 29  ? 25.217 22.557  21.417 1.00 34.02 ? 29  PHE A CD1 1 
ATOM   67  C  CD2 . PHE A 1 29  ? 24.108 21.769  19.450 1.00 33.12 ? 29  PHE A CD2 1 
ATOM   68  C  CE1 . PHE A 1 29  ? 26.193 21.567  21.267 1.00 32.76 ? 29  PHE A CE1 1 
ATOM   69  C  CE2 . PHE A 1 29  ? 25.075 20.778  19.291 1.00 35.21 ? 29  PHE A CE2 1 
ATOM   70  C  CZ  . PHE A 1 29  ? 26.119 20.678  20.203 1.00 32.89 ? 29  PHE A CZ  1 
ATOM   71  N  N   . ALA A 1 30  ? 21.023 25.340  22.737 1.00 35.22 ? 30  ALA A N   1 
ATOM   72  C  CA  . ALA A 1 30  ? 20.026 26.405  22.820 1.00 36.93 ? 30  ALA A CA  1 
ATOM   73  C  C   . ALA A 1 30  ? 20.152 27.254  21.559 1.00 39.01 ? 30  ALA A C   1 
ATOM   74  O  O   . ALA A 1 30  ? 19.185 27.867  21.100 1.00 40.63 ? 30  ALA A O   1 
ATOM   75  C  CB  . ALA A 1 30  ? 20.267 27.263  24.058 1.00 36.40 ? 30  ALA A CB  1 
ATOM   76  N  N   . ASN A 1 31  ? 21.361 27.277  21.010 1.00 37.59 ? 31  ASN A N   1 
ATOM   77  C  CA  . ASN A 1 31  ? 21.665 28.023  19.794 1.00 38.64 ? 31  ASN A CA  1 
ATOM   78  C  C   . ASN A 1 31  ? 22.665 27.171  19.013 1.00 37.50 ? 31  ASN A C   1 
ATOM   79  O  O   . ASN A 1 31  ? 23.837 27.091  19.380 1.00 36.02 ? 31  ASN A O   1 
ATOM   80  C  CB  . ASN A 1 31  ? 22.287 29.375  20.151 1.00 41.06 ? 31  ASN A CB  1 
ATOM   81  C  CG  . ASN A 1 31  ? 22.408 30.298  18.955 1.00 42.87 ? 31  ASN A CG  1 
ATOM   82  O  OD1 . ASN A 1 31  ? 22.866 29.891  17.889 1.00 44.40 ? 31  ASN A OD1 1 
ATOM   83  N  ND2 . ASN A 1 31  ? 22.013 31.553  19.133 1.00 42.77 ? 31  ASN A ND2 1 
ATOM   84  N  N   . THR A 1 32  ? 22.199 26.531  17.944 1.00 37.69 ? 32  THR A N   1 
ATOM   85  C  CA  . THR A 1 32  ? 23.059 25.662  17.142 1.00 42.13 ? 32  THR A CA  1 
ATOM   86  C  C   . THR A 1 32  ? 24.335 26.327  16.639 1.00 39.30 ? 32  THR A C   1 
ATOM   87  O  O   . THR A 1 32  ? 25.313 25.646  16.332 1.00 38.62 ? 32  THR A O   1 
ATOM   88  C  CB  . THR A 1 32  ? 22.293 25.078  15.931 1.00 46.73 ? 32  THR A CB  1 
ATOM   89  O  OG1 . THR A 1 32  ? 21.755 26.144  15.139 1.00 50.41 ? 32  THR A OG1 1 
ATOM   90  C  CG2 . THR A 1 32  ? 21.161 24.176  16.402 1.00 50.94 ? 32  THR A CG2 1 
ATOM   91  N  N   . ALA A 1 33  ? 24.326 27.653  16.558 1.00 38.54 ? 33  ALA A N   1 
ATOM   92  C  CA  . ALA A 1 33  ? 25.494 28.394  16.092 1.00 38.43 ? 33  ALA A CA  1 
ATOM   93  C  C   . ALA A 1 33  ? 26.596 28.360  17.143 1.00 37.67 ? 33  ALA A C   1 
ATOM   94  O  O   . ALA A 1 33  ? 27.753 28.673  16.857 1.00 36.61 ? 33  ALA A O   1 
ATOM   95  C  CB  . ALA A 1 33  ? 25.110 29.839  15.787 1.00 41.49 ? 33  ALA A CB  1 
ATOM   96  N  N   . ARG A 1 34  ? 26.229 27.969  18.359 1.00 33.59 ? 34  ARG A N   1 
ATOM   97  C  CA  . ARG A 1 34  ? 27.175 27.905  19.464 1.00 33.25 ? 34  ARG A CA  1 
ATOM   98  C  C   . ARG A 1 34  ? 27.774 26.525  19.686 1.00 31.42 ? 34  ARG A C   1 
ATOM   99  O  O   . ARG A 1 34  ? 28.572 26.335  20.604 1.00 30.38 ? 34  ARG A O   1 
ATOM   100 C  CB  . ARG A 1 34  ? 26.499 28.378  20.748 1.00 36.63 ? 34  ARG A CB  1 
ATOM   101 C  CG  . ARG A 1 34  ? 26.118 29.839  20.715 1.00 40.84 ? 34  ARG A CG  1 
ATOM   102 C  CD  . ARG A 1 34  ? 25.155 30.178  21.830 1.00 46.85 ? 34  ARG A CD  1 
ATOM   103 N  NE  . ARG A 1 34  ? 24.781 31.586  21.793 1.00 52.28 ? 34  ARG A NE  1 
ATOM   104 C  CZ  . ARG A 1 34  ? 23.774 32.109  22.483 1.00 52.88 ? 34  ARG A CZ  1 
ATOM   105 N  NH1 . ARG A 1 34  ? 23.034 31.336  23.266 1.00 55.16 ? 34  ARG A NH1 1 
ATOM   106 N  NH2 . ARG A 1 34  ? 23.515 33.404  22.393 1.00 56.05 ? 34  ARG A NH2 1 
ATOM   107 N  N   . LYS A 1 35  ? 27.390 25.556  18.865 1.00 31.24 ? 35  LYS A N   1 
ATOM   108 C  CA  . LYS A 1 35  ? 27.948 24.221  19.020 1.00 31.11 ? 35  LYS A CA  1 
ATOM   109 C  C   . LYS A 1 35  ? 29.450 24.320  18.764 1.00 30.99 ? 35  LYS A C   1 
ATOM   110 O  O   . LYS A 1 35  ? 29.897 25.135  17.949 1.00 31.71 ? 35  LYS A O   1 
ATOM   111 C  CB  . LYS A 1 35  ? 27.291 23.241  18.043 1.00 34.97 ? 35  LYS A CB  1 
ATOM   112 C  CG  . LYS A 1 35  ? 27.514 23.556  16.580 1.00 36.05 ? 35  LYS A CG  1 
ATOM   113 C  CD  . LYS A 1 35  ? 26.764 22.571  15.695 1.00 39.81 ? 35  LYS A CD  1 
ATOM   114 C  CE  . LYS A 1 35  ? 27.094 22.795  14.231 1.00 41.78 ? 35  LYS A CE  1 
ATOM   115 N  NZ  . LYS A 1 35  ? 26.824 24.201  13.825 1.00 44.71 ? 35  LYS A NZ  1 
ATOM   116 N  N   . GLN A 1 36  ? 30.227 23.509  19.476 1.00 28.36 ? 36  GLN A N   1 
ATOM   117 C  CA  . GLN A 1 36  ? 31.679 23.515  19.340 1.00 29.05 ? 36  GLN A CA  1 
ATOM   118 C  C   . GLN A 1 36  ? 32.144 22.335  18.503 1.00 30.06 ? 36  GLN A C   1 
ATOM   119 O  O   . GLN A 1 36  ? 31.830 21.191  18.816 1.00 32.10 ? 36  GLN A O   1 
ATOM   120 C  CB  . GLN A 1 36  ? 32.343 23.433  20.717 1.00 30.48 ? 36  GLN A CB  1 
ATOM   121 C  CG  . GLN A 1 36  ? 31.911 24.521  21.685 1.00 30.98 ? 36  GLN A CG  1 
ATOM   122 C  CD  . GLN A 1 36  ? 32.203 25.906  21.155 1.00 32.83 ? 36  GLN A CD  1 
ATOM   123 O  OE1 . GLN A 1 36  ? 31.292 26.707  20.939 1.00 36.69 ? 36  GLN A OE1 1 
ATOM   124 N  NE2 . GLN A 1 36  ? 33.477 26.196  20.935 1.00 29.04 ? 36  GLN A NE2 1 
ATOM   125 N  N   . THR A 1 37  ? 32.896 22.616  17.445 1.00 28.75 ? 37  THR A N   1 
ATOM   126 C  CA  . THR A 1 37  ? 33.406 21.556  16.580 1.00 27.29 ? 37  THR A CA  1 
ATOM   127 C  C   . THR A 1 37  ? 34.834 21.226  16.994 1.00 28.36 ? 37  THR A C   1 
ATOM   128 O  O   . THR A 1 37  ? 35.682 22.114  17.072 1.00 29.09 ? 37  THR A O   1 
ATOM   129 C  CB  . THR A 1 37  ? 33.410 21.990  15.098 1.00 30.35 ? 37  THR A CB  1 
ATOM   130 O  OG1 . THR A 1 37  ? 32.085 22.370  14.703 1.00 28.63 ? 37  THR A OG1 1 
ATOM   131 C  CG2 . THR A 1 37  ? 33.887 20.849  14.212 1.00 29.96 ? 37  THR A CG2 1 
ATOM   132 N  N   . CYS A 1 38  ? 35.096 19.952  17.265 1.00 21.89 ? 38  CYS A N   1 
ATOM   133 C  CA  . CYS A 1 38  ? 36.429 19.522  17.672 1.00 25.44 ? 38  CYS A CA  1 
ATOM   134 C  C   . CYS A 1 38  ? 37.360 19.539  16.465 1.00 25.70 ? 38  CYS A C   1 
ATOM   135 O  O   . CYS A 1 38  ? 37.057 18.943  15.435 1.00 24.27 ? 38  CYS A O   1 
ATOM   136 C  CB  . CYS A 1 38  ? 36.373 18.111  18.263 1.00 23.57 ? 38  CYS A CB  1 
ATOM   137 S  SG  . CYS A 1 38  ? 37.985 17.466  18.781 1.00 24.36 ? 38  CYS A SG  1 
ATOM   138 N  N   . LEU A 1 39  ? 38.494 20.220  16.596 1.00 27.05 ? 39  LEU A N   1 
ATOM   139 C  CA  . LEU A 1 39  ? 39.454 20.313  15.499 1.00 29.86 ? 39  LEU A CA  1 
ATOM   140 C  C   . LEU A 1 39  ? 40.047 18.959  15.109 1.00 30.76 ? 39  LEU A C   1 
ATOM   141 O  O   . LEU A 1 39  ? 40.494 18.771  13.973 1.00 28.67 ? 39  LEU A O   1 
ATOM   142 C  CB  . LEU A 1 39  ? 40.583 21.276  15.877 1.00 35.69 ? 39  LEU A CB  1 
ATOM   143 C  CG  . LEU A 1 39  ? 41.568 21.645  14.765 1.00 41.14 ? 39  LEU A CG  1 
ATOM   144 C  CD1 . LEU A 1 39  ? 40.828 22.387  13.659 1.00 43.95 ? 39  LEU A CD1 1 
ATOM   145 C  CD2 . LEU A 1 39  ? 42.682 22.508  15.332 1.00 44.12 ? 39  LEU A CD2 1 
ATOM   146 N  N   . ASP A 1 40  ? 40.044 18.017  16.046 1.00 28.53 ? 40  ASP A N   1 
ATOM   147 C  CA  . ASP A 1 40  ? 40.596 16.690  15.798 1.00 29.11 ? 40  ASP A CA  1 
ATOM   148 C  C   . ASP A 1 40  ? 39.631 15.671  15.203 1.00 27.43 ? 40  ASP A C   1 
ATOM   149 O  O   . ASP A 1 40  ? 39.896 15.130  14.134 1.00 25.11 ? 40  ASP A O   1 
ATOM   150 C  CB  . ASP A 1 40  ? 41.205 16.118  17.079 1.00 29.70 ? 40  ASP A CB  1 
ATOM   151 C  CG  . ASP A 1 40  ? 42.606 16.630  17.334 1.00 36.48 ? 40  ASP A CG  1 
ATOM   152 O  OD1 . ASP A 1 40  ? 43.277 16.098  18.241 1.00 34.83 ? 40  ASP A OD1 1 
ATOM   153 O  OD2 . ASP A 1 40  ? 43.037 17.564  16.623 1.00 36.78 ? 40  ASP A OD2 1 
ATOM   154 N  N   . CYS A 1 41  ? 38.524 15.388  15.886 1.00 25.79 ? 41  CYS A N   1 
ATOM   155 C  CA  . CYS A 1 41  ? 37.567 14.418  15.353 1.00 21.27 ? 41  CYS A CA  1 
ATOM   156 C  C   . CYS A 1 41  ? 36.512 15.077  14.467 1.00 25.51 ? 41  CYS A C   1 
ATOM   157 O  O   . CYS A 1 41  ? 35.795 14.396  13.729 1.00 22.90 ? 41  CYS A O   1 
ATOM   158 C  CB  . CYS A 1 41  ? 36.888 13.633  16.486 1.00 21.56 ? 41  CYS A CB  1 
ATOM   159 S  SG  . CYS A 1 41  ? 35.842 14.599  17.592 1.00 22.35 ? 41  CYS A SG  1 
ATOM   160 N  N   . LYS A 1 42  ? 36.423 16.400  14.554 1.00 23.65 ? 42  LYS A N   1 
ATOM   161 C  CA  . LYS A 1 42  ? 35.489 17.193  13.760 1.00 26.32 ? 42  LYS A CA  1 
ATOM   162 C  C   . LYS A 1 42  ? 34.015 16.991  14.083 1.00 23.92 ? 42  LYS A C   1 
ATOM   163 O  O   . LYS A 1 42  ? 33.147 17.392  13.308 1.00 25.54 ? 42  LYS A O   1 
ATOM   164 C  CB  . LYS A 1 42  ? 35.734 16.955  12.264 1.00 33.18 ? 42  LYS A CB  1 
ATOM   165 C  CG  . LYS A 1 42  ? 37.177 17.228  11.851 1.00 39.93 ? 42  LYS A CG  1 
ATOM   166 C  CD  . LYS A 1 42  ? 37.342 17.313  10.347 1.00 46.69 ? 42  LYS A CD  1 
ATOM   167 C  CE  . LYS A 1 42  ? 38.803 17.540  9.985  1.00 48.99 ? 42  LYS A CE  1 
ATOM   168 N  NZ  . LYS A 1 42  ? 39.392 18.696  10.728 1.00 50.84 ? 42  LYS A NZ  1 
ATOM   169 N  N   . LYS A 1 43  ? 33.725 16.374  15.223 1.00 21.72 ? 43  LYS A N   1 
ATOM   170 C  CA  . LYS A 1 43  ? 32.335 16.173  15.619 1.00 20.22 ? 43  LYS A CA  1 
ATOM   171 C  C   . LYS A 1 43  ? 31.898 17.390  16.442 1.00 22.74 ? 43  LYS A C   1 
ATOM   172 O  O   . LYS A 1 43  ? 32.739 18.195  16.846 1.00 19.05 ? 43  LYS A O   1 
ATOM   173 C  CB  . LYS A 1 43  ? 32.187 14.881  16.432 1.00 19.67 ? 43  LYS A CB  1 
ATOM   174 C  CG  . LYS A 1 43  ? 32.728 13.632  15.731 1.00 20.79 ? 43  LYS A CG  1 
ATOM   175 C  CD  . LYS A 1 43  ? 32.219 13.498  14.297 1.00 21.66 ? 43  LYS A CD  1 
ATOM   176 C  CE  . LYS A 1 43  ? 32.826 12.276  13.611 1.00 24.27 ? 43  LYS A CE  1 
ATOM   177 N  NZ  . LYS A 1 43  ? 32.423 12.164  12.171 1.00 28.14 ? 43  LYS A NZ  1 
ATOM   178 N  N   . ASN A 1 44  ? 30.594 17.538  16.677 1.00 21.28 ? 44  ASN A N   1 
ATOM   179 C  CA  . ASN A 1 44  ? 30.076 18.683  17.438 1.00 23.82 ? 44  ASN A CA  1 
ATOM   180 C  C   . ASN A 1 44  ? 29.862 18.360  18.915 1.00 23.84 ? 44  ASN A C   1 
ATOM   181 O  O   . ASN A 1 44  ? 29.395 17.277  19.249 1.00 21.63 ? 44  ASN A O   1 
ATOM   182 C  CB  . ASN A 1 44  ? 28.762 19.177  16.822 1.00 24.67 ? 44  ASN A CB  1 
ATOM   183 C  CG  . ASN A 1 44  ? 28.909 19.546  15.357 1.00 27.79 ? 44  ASN A CG  1 
ATOM   184 O  OD1 . ASN A 1 44  ? 29.860 20.223  14.970 1.00 30.67 ? 44  ASN A OD1 1 
ATOM   185 N  ND2 . ASN A 1 44  ? 27.960 19.109  14.537 1.00 31.09 ? 44  ASN A ND2 1 
ATOM   186 N  N   . PHE A 1 45  ? 30.187 19.316  19.790 1.00 20.58 ? 45  PHE A N   1 
ATOM   187 C  CA  . PHE A 1 45  ? 30.073 19.121  21.237 1.00 24.27 ? 45  PHE A CA  1 
ATOM   188 C  C   . PHE A 1 45  ? 29.608 20.350  22.002 1.00 23.49 ? 45  PHE A C   1 
ATOM   189 O  O   . PHE A 1 45  ? 29.672 21.468  21.499 1.00 24.81 ? 45  PHE A O   1 
ATOM   190 C  CB  . PHE A 1 45  ? 31.424 18.743  21.839 1.00 21.97 ? 45  PHE A CB  1 
ATOM   191 C  CG  . PHE A 1 45  ? 32.052 17.536  21.224 1.00 20.02 ? 45  PHE A CG  1 
ATOM   192 C  CD1 . PHE A 1 45  ? 32.770 17.637  20.036 1.00 21.18 ? 45  PHE A CD1 1 
ATOM   193 C  CD2 . PHE A 1 45  ? 31.935 16.297  21.836 1.00 19.87 ? 45  PHE A CD2 1 
ATOM   194 C  CE1 . PHE A 1 45  ? 33.366 16.518  19.472 1.00 19.41 ? 45  PHE A CE1 1 
ATOM   195 C  CE2 . PHE A 1 45  ? 32.526 15.174  21.278 1.00 19.77 ? 45  PHE A CE2 1 
ATOM   196 C  CZ  . PHE A 1 45  ? 33.242 15.285  20.093 1.00 22.67 ? 45  PHE A CZ  1 
ATOM   197 N  N   . CYS A 1 46  ? 29.178 20.118  23.242 1.00 26.49 ? 46  CYS A N   1 
ATOM   198 C  CA  . CYS A 1 46  ? 28.754 21.196  24.136 1.00 26.13 ? 46  CYS A CA  1 
ATOM   199 C  C   . CYS A 1 46  ? 30.007 21.943  24.529 1.00 26.50 ? 46  CYS A C   1 
ATOM   200 O  O   . CYS A 1 46  ? 31.112 21.424  24.403 1.00 25.98 ? 46  CYS A O   1 
ATOM   201 C  CB  . CYS A 1 46  ? 28.163 20.650  25.438 1.00 24.56 ? 46  CYS A CB  1 
ATOM   202 S  SG  . CYS A 1 46  ? 26.680 19.718  25.305 1.00 29.12 ? 46  CYS A SG  1 
ATOM   203 N  N   . MET A 1 47  ? 29.834 23.161  25.026 1.00 24.21 ? 47  MET A N   1 
ATOM   204 C  CA  . MET A 1 47  ? 30.963 23.935  25.496 1.00 24.87 ? 47  MET A CA  1 
ATOM   205 C  C   . MET A 1 47  ? 31.476 23.176  26.723 1.00 22.54 ? 47  MET A C   1 
ATOM   206 O  O   . MET A 1 47  ? 32.672 23.144  26.993 1.00 25.76 ? 47  MET A O   1 
ATOM   207 C  CB  . MET A 1 47  ? 30.504 25.333  25.905 1.00 25.60 ? 47  MET A CB  1 
ATOM   208 C  CG  . MET A 1 47  ? 31.611 26.240  26.389 1.00 29.20 ? 47  MET A CG  1 
ATOM   209 S  SD  . MET A 1 47  ? 32.762 26.682  25.072 1.00 33.90 ? 47  MET A SD  1 
ATOM   210 C  CE  . MET A 1 47  ? 31.801 27.899  24.182 1.00 31.99 ? 47  MET A CE  1 
ATOM   211 N  N   . THR A 1 48  ? 30.552 22.554  27.453 1.00 25.03 ? 48  THR A N   1 
ATOM   212 C  CA  . THR A 1 48  ? 30.903 21.793  28.653 1.00 25.30 ? 48  THR A CA  1 
ATOM   213 C  C   . THR A 1 48  ? 31.434 20.399  28.338 1.00 26.85 ? 48  THR A C   1 
ATOM   214 O  O   . THR A 1 48  ? 31.785 19.637  29.240 1.00 23.66 ? 48  THR A O   1 
ATOM   215 C  CB  . THR A 1 48  ? 29.699 21.670  29.615 1.00 26.73 ? 48  THR A CB  1 
ATOM   216 O  OG1 . THR A 1 48  ? 28.547 21.218  28.897 1.00 27.55 ? 48  THR A OG1 1 
ATOM   217 C  CG2 . THR A 1 48  ? 29.409 23.008  30.270 1.00 28.00 ? 48  THR A CG2 1 
ATOM   218 N  N   . CYS A 1 49  ? 31.485 20.066  27.054 1.00 24.28 ? 49  CYS A N   1 
ATOM   219 C  CA  . CYS A 1 49  ? 31.999 18.768  26.631 1.00 24.55 ? 49  CYS A CA  1 
ATOM   220 C  C   . CYS A 1 49  ? 33.237 18.953  25.758 1.00 26.37 ? 49  CYS A C   1 
ATOM   221 O  O   . CYS A 1 49  ? 33.609 18.066  24.993 1.00 24.20 ? 49  CYS A O   1 
ATOM   222 C  CB  . CYS A 1 49  ? 30.928 17.985  25.868 1.00 21.25 ? 49  CYS A CB  1 
ATOM   223 S  SG  . CYS A 1 49  ? 29.568 17.408  26.918 1.00 25.44 ? 49  CYS A SG  1 
ATOM   224 N  N   . SER A 1 50  ? 33.863 20.120  25.881 1.00 26.37 ? 50  SER A N   1 
ATOM   225 C  CA  . SER A 1 50  ? 35.073 20.442  25.128 1.00 28.48 ? 50  SER A CA  1 
ATOM   226 C  C   . SER A 1 50  ? 35.932 21.363  25.987 1.00 31.95 ? 50  SER A C   1 
ATOM   227 O  O   . SER A 1 50  ? 35.487 21.814  27.043 1.00 31.30 ? 50  SER A O   1 
ATOM   228 C  CB  . SER A 1 50  ? 34.714 21.110  23.796 1.00 27.96 ? 50  SER A CB  1 
ATOM   229 O  OG  . SER A 1 50  ? 33.912 22.261  23.981 1.00 29.01 ? 50  SER A OG  1 
ATOM   230 N  N   . SER A 1 51  ? 37.156 21.647  25.555 1.00 34.91 ? 51  SER A N   1 
ATOM   231 C  CA  . SER A 1 51  ? 38.022 22.498  26.362 1.00 41.20 ? 51  SER A CA  1 
ATOM   232 C  C   . SER A 1 51  ? 39.071 23.309  25.615 1.00 49.15 ? 51  SER A C   1 
ATOM   233 O  O   . SER A 1 51  ? 39.247 23.177  24.403 1.00 45.07 ? 51  SER A O   1 
ATOM   234 C  CB  . SER A 1 51  ? 38.729 21.652  27.421 1.00 41.16 ? 51  SER A CB  1 
ATOM   235 O  OG  . SER A 1 51  ? 39.618 20.732  26.809 1.00 42.54 ? 51  SER A OG  1 
ATOM   236 N  N   . GLN A 1 52  ? 39.791 24.220  26.579 1.00 55.97 ? 52  GLN A N   1 
ATOM   237 C  CA  . GLN A 1 52  ? 40.821 25.213  26.284 1.00 64.91 ? 52  GLN A CA  1 
ATOM   238 C  C   . GLN A 1 52  ? 40.515 26.325  25.290 1.00 68.75 ? 52  GLN A C   1 
ATOM   239 O  O   . GLN A 1 52  ? 40.260 27.471  25.655 1.00 70.63 ? 52  GLN A O   1 
ATOM   240 C  CB  . GLN A 1 52  ? 42.121 24.512  25.875 1.00 66.71 ? 52  GLN A CB  1 
ATOM   241 C  CG  . GLN A 1 52  ? 43.378 25.263  26.284 1.00 68.32 ? 52  GLN A CG  1 
ATOM   242 C  CD  . GLN A 1 52  ? 44.631 24.415  26.183 1.00 69.42 ? 52  GLN A CD  1 
ATOM   243 O  OE1 . GLN A 1 52  ? 45.574 24.763  25.471 1.00 69.91 ? 52  GLN A OE1 1 
ATOM   244 N  NE2 . GLN A 1 52  ? 44.650 23.297  26.901 1.00 70.05 ? 52  GLN A NE2 1 
ATOM   245 N  N   . PRO A 1 57  ? 42.594 26.207  19.533 1.00 49.51 ? 57  PRO A N   1 
ATOM   246 C  CA  . PRO A 1 57  ? 42.520 24.747  19.429 1.00 46.64 ? 57  PRO A CA  1 
ATOM   247 C  C   . PRO A 1 57  ? 41.393 24.149  20.271 1.00 43.36 ? 57  PRO A C   1 
ATOM   248 O  O   . PRO A 1 57  ? 41.639 23.545  21.316 1.00 43.35 ? 57  PRO A O   1 
ATOM   249 C  CB  . PRO A 1 57  ? 43.899 24.304  19.906 1.00 48.09 ? 57  PRO A CB  1 
ATOM   250 C  CG  . PRO A 1 57  ? 44.217 25.329  20.950 1.00 48.60 ? 57  PRO A CG  1 
ATOM   251 C  CD  . PRO A 1 57  ? 43.797 26.618  20.279 1.00 49.50 ? 57  PRO A CD  1 
ATOM   252 N  N   . ARG A 1 58  ? 40.159 24.329  19.811 1.00 39.14 ? 58  ARG A N   1 
ATOM   253 C  CA  . ARG A 1 58  ? 38.992 23.798  20.507 1.00 35.97 ? 58  ARG A CA  1 
ATOM   254 C  C   . ARG A 1 58  ? 38.938 22.290  20.283 1.00 33.19 ? 58  ARG A C   1 
ATOM   255 O  O   . ARG A 1 58  ? 38.844 21.832  19.145 1.00 32.18 ? 58  ARG A O   1 
ATOM   256 C  CB  . ARG A 1 58  ? 37.719 24.457  19.968 1.00 37.95 ? 58  ARG A CB  1 
ATOM   257 C  CG  . ARG A 1 58  ? 36.420 23.833  20.452 1.00 40.21 ? 58  ARG A CG  1 
ATOM   258 C  CD  . ARG A 1 58  ? 36.318 23.819  21.970 1.00 42.25 ? 58  ARG A CD  1 
ATOM   259 N  NE  . ARG A 1 58  ? 36.448 25.150  22.557 1.00 41.99 ? 58  ARG A NE  1 
ATOM   260 C  CZ  . ARG A 1 58  ? 36.125 25.442  23.813 1.00 43.77 ? 58  ARG A CZ  1 
ATOM   261 N  NH1 . ARG A 1 58  ? 36.276 26.677  24.274 1.00 44.86 ? 58  ARG A NH1 1 
ATOM   262 N  NH2 . ARG A 1 58  ? 35.633 24.502  24.606 1.00 41.64 ? 58  ARG A NH2 1 
ATOM   263 N  N   . LEU A 1 59  ? 39.002 21.525  21.370 1.00 30.26 ? 59  LEU A N   1 
ATOM   264 C  CA  . LEU A 1 59  ? 38.978 20.066  21.289 1.00 28.06 ? 59  LEU A CA  1 
ATOM   265 C  C   . LEU A 1 59  ? 37.948 19.461  22.241 1.00 25.92 ? 59  LEU A C   1 
ATOM   266 O  O   . LEU A 1 59  ? 37.625 20.051  23.272 1.00 25.95 ? 59  LEU A O   1 
ATOM   267 C  CB  . LEU A 1 59  ? 40.360 19.503  21.643 1.00 25.17 ? 59  LEU A CB  1 
ATOM   268 C  CG  . LEU A 1 59  ? 41.567 19.964  20.821 1.00 26.95 ? 59  LEU A CG  1 
ATOM   269 C  CD1 . LEU A 1 59  ? 42.843 19.416  21.451 1.00 27.68 ? 59  LEU A CD1 1 
ATOM   270 C  CD2 . LEU A 1 59  ? 41.435 19.484  19.384 1.00 26.78 ? 59  LEU A CD2 1 
ATOM   271 N  N   . CYS A 1 60  ? 37.417 18.290  21.898 1.00 26.02 ? 60  CYS A N   1 
ATOM   272 C  CA  . CYS A 1 60  ? 36.471 17.654  22.800 1.00 24.35 ? 60  CYS A CA  1 
ATOM   273 C  C   . CYS A 1 60  ? 37.337 17.089  23.926 1.00 25.46 ? 60  CYS A C   1 
ATOM   274 O  O   . CYS A 1 60  ? 38.560 17.016  23.791 1.00 24.53 ? 60  CYS A O   1 
ATOM   275 C  CB  . CYS A 1 60  ? 35.668 16.555  22.095 1.00 25.46 ? 60  CYS A CB  1 
ATOM   276 S  SG  . CYS A 1 60  ? 36.584 15.092  21.611 1.00 24.71 ? 60  CYS A SG  1 
ATOM   277 N  N   . LEU A 1 61  ? 36.723 16.713  25.040 1.00 25.02 ? 61  LEU A N   1 
ATOM   278 C  CA  . LEU A 1 61  ? 37.484 16.212  26.177 1.00 27.35 ? 61  LEU A CA  1 
ATOM   279 C  C   . LEU A 1 61  ? 38.322 14.963  25.917 1.00 28.51 ? 61  LEU A C   1 
ATOM   280 O  O   . LEU A 1 61  ? 39.410 14.818  26.476 1.00 28.67 ? 61  LEU A O   1 
ATOM   281 C  CB  . LEU A 1 61  ? 36.544 15.984  27.364 1.00 29.68 ? 61  LEU A CB  1 
ATOM   282 C  CG  . LEU A 1 61  ? 35.771 17.241  27.780 1.00 31.99 ? 61  LEU A CG  1 
ATOM   283 C  CD1 . LEU A 1 61  ? 34.935 16.945  29.017 1.00 32.19 ? 61  LEU A CD1 1 
ATOM   284 C  CD2 . LEU A 1 61  ? 36.743 18.383  28.052 1.00 31.60 ? 61  LEU A CD2 1 
ATOM   285 N  N   . LEU A 1 62  ? 37.837 14.063  25.067 1.00 25.14 ? 62  LEU A N   1 
ATOM   286 C  CA  . LEU A 1 62  ? 38.595 12.852  24.781 1.00 24.64 ? 62  LEU A CA  1 
ATOM   287 C  C   . LEU A 1 62  ? 39.793 13.148  23.874 1.00 24.95 ? 62  LEU A C   1 
ATOM   288 O  O   . LEU A 1 62  ? 40.908 12.687  24.131 1.00 25.50 ? 62  LEU A O   1 
ATOM   289 C  CB  . LEU A 1 62  ? 37.682 11.800  24.144 1.00 28.62 ? 62  LEU A CB  1 
ATOM   290 C  CG  . LEU A 1 62  ? 38.163 10.348  24.200 1.00 33.09 ? 62  LEU A CG  1 
ATOM   291 C  CD1 . LEU A 1 62  ? 38.411 9.938   25.650 1.00 30.97 ? 62  LEU A CD1 1 
ATOM   292 C  CD2 . LEU A 1 62  ? 37.120 9.442   23.560 1.00 34.15 ? 62  LEU A CD2 1 
ATOM   293 N  N   . CYS A 1 63  ? 39.580 13.928  22.822 1.00 23.27 ? 63  CYS A N   1 
ATOM   294 C  CA  . CYS A 1 63  ? 40.679 14.254  21.924 1.00 24.02 ? 63  CYS A CA  1 
ATOM   295 C  C   . CYS A 1 63  ? 41.733 15.075  22.660 1.00 26.51 ? 63  CYS A C   1 
ATOM   296 O  O   . CYS A 1 63  ? 42.921 14.971  22.371 1.00 25.62 ? 63  CYS A O   1 
ATOM   297 C  CB  . CYS A 1 63  ? 40.169 15.013  20.700 1.00 23.85 ? 63  CYS A CB  1 
ATOM   298 S  SG  . CYS A 1 63  ? 39.288 13.947  19.536 1.00 23.31 ? 63  CYS A SG  1 
ATOM   299 N  N   . GLN A 1 64  ? 41.293 15.883  23.619 1.00 26.16 ? 64  GLN A N   1 
ATOM   300 C  CA  . GLN A 1 64  ? 42.215 16.698  24.408 1.00 29.35 ? 64  GLN A CA  1 
ATOM   301 C  C   . GLN A 1 64  ? 43.061 15.757  25.263 1.00 29.61 ? 64  GLN A C   1 
ATOM   302 O  O   . GLN A 1 64  ? 44.276 15.920  25.373 1.00 28.09 ? 64  GLN A O   1 
ATOM   303 C  CB  . GLN A 1 64  ? 41.432 17.643  25.320 1.00 32.78 ? 64  GLN A CB  1 
ATOM   304 C  CG  . GLN A 1 64  ? 42.279 18.643  26.096 1.00 36.60 ? 64  GLN A CG  1 
ATOM   305 C  CD  . GLN A 1 64  ? 42.848 19.739  25.217 1.00 40.97 ? 64  GLN A CD  1 
ATOM   306 O  OE1 . GLN A 1 64  ? 43.876 19.561  24.562 1.00 42.66 ? 64  GLN A OE1 1 
ATOM   307 N  NE2 . GLN A 1 64  ? 42.170 20.882  25.188 1.00 41.92 ? 64  GLN A NE2 1 
ATOM   308 N  N   . ARG A 1 65  ? 42.400 14.769  25.857 1.00 27.88 ? 65  ARG A N   1 
ATOM   309 C  CA  . ARG A 1 65  ? 43.060 13.786  26.708 1.00 31.99 ? 65  ARG A CA  1 
ATOM   310 C  C   . ARG A 1 65  ? 44.100 12.981  25.938 1.00 30.07 ? 65  ARG A C   1 
ATOM   311 O  O   . ARG A 1 65  ? 45.179 12.690  26.456 1.00 27.86 ? 65  ARG A O   1 
ATOM   312 C  CB  . ARG A 1 65  ? 42.021 12.843  27.314 1.00 37.21 ? 65  ARG A CB  1 
ATOM   313 C  CG  . ARG A 1 65  ? 42.596 11.792  28.243 1.00 46.15 ? 65  ARG A CG  1 
ATOM   314 C  CD  . ARG A 1 65  ? 41.500 10.887  28.769 1.00 52.22 ? 65  ARG A CD  1 
ATOM   315 N  NE  . ARG A 1 65  ? 40.495 11.629  29.524 1.00 57.19 ? 65  ARG A NE  1 
ATOM   316 C  CZ  . ARG A 1 65  ? 39.369 11.096  29.986 1.00 60.16 ? 65  ARG A CZ  1 
ATOM   317 N  NH1 . ARG A 1 65  ? 39.104 9.815   29.769 1.00 61.07 ? 65  ARG A NH1 1 
ATOM   318 N  NH2 . ARG A 1 65  ? 38.509 11.842  30.667 1.00 61.61 ? 65  ARG A NH2 1 
ATOM   319 N  N   . PHE A 1 66  ? 43.781 12.613  24.701 1.00 25.48 ? 66  PHE A N   1 
ATOM   320 C  CA  . PHE A 1 66  ? 44.731 11.853  23.904 1.00 26.26 ? 66  PHE A CA  1 
ATOM   321 C  C   . PHE A 1 66  ? 45.907 12.702  23.439 1.00 25.86 ? 66  PHE A C   1 
ATOM   322 O  O   . PHE A 1 66  ? 47.023 12.204  23.336 1.00 27.46 ? 66  PHE A O   1 
ATOM   323 C  CB  . PHE A 1 66  ? 44.036 11.196  22.706 1.00 23.61 ? 66  PHE A CB  1 
ATOM   324 C  CG  . PHE A 1 66  ? 43.390 9.883   23.038 1.00 23.79 ? 66  PHE A CG  1 
ATOM   325 C  CD1 . PHE A 1 66  ? 42.253 9.835   23.837 1.00 25.98 ? 66  PHE A CD1 1 
ATOM   326 C  CD2 . PHE A 1 66  ? 43.946 8.690   22.592 1.00 25.17 ? 66  PHE A CD2 1 
ATOM   327 C  CE1 . PHE A 1 66  ? 41.681 8.617   24.191 1.00 26.72 ? 66  PHE A CE1 1 
ATOM   328 C  CE2 . PHE A 1 66  ? 43.383 7.463   22.939 1.00 28.44 ? 66  PHE A CE2 1 
ATOM   329 C  CZ  . PHE A 1 66  ? 42.247 7.425   23.743 1.00 29.15 ? 66  PHE A CZ  1 
ATOM   330 N  N   . ARG A 1 67  ? 45.674 13.979  23.152 1.00 26.02 ? 67  ARG A N   1 
ATOM   331 C  CA  . ARG A 1 67  ? 46.784 14.826  22.732 1.00 28.96 ? 67  ARG A CA  1 
ATOM   332 C  C   . ARG A 1 67  ? 47.780 14.949  23.879 1.00 32.33 ? 67  ARG A C   1 
ATOM   333 O  O   . ARG A 1 67  ? 48.991 15.043  23.657 1.00 32.91 ? 67  ARG A O   1 
ATOM   334 C  CB  . ARG A 1 67  ? 46.303 16.225  22.336 1.00 30.14 ? 67  ARG A CB  1 
ATOM   335 C  CG  . ARG A 1 67  ? 45.745 16.330  20.929 1.00 31.02 ? 67  ARG A CG  1 
ATOM   336 C  CD  . ARG A 1 67  ? 45.731 17.780  20.485 1.00 34.21 ? 67  ARG A CD  1 
ATOM   337 N  NE  . ARG A 1 67  ? 45.238 17.951  19.122 1.00 38.00 ? 67  ARG A NE  1 
ATOM   338 C  CZ  . ARG A 1 67  ? 45.318 19.091  18.444 1.00 39.81 ? 67  ARG A CZ  1 
ATOM   339 N  NH1 . ARG A 1 67  ? 45.877 20.156  19.004 1.00 42.69 ? 67  ARG A NH1 1 
ATOM   340 N  NH2 . ARG A 1 67  ? 44.840 19.170  17.211 1.00 40.02 ? 67  ARG A NH2 1 
ATOM   341 N  N   . ALA A 1 68  ? 47.261 14.942  25.103 1.00 32.03 ? 68  ALA A N   1 
ATOM   342 C  CA  . ALA A 1 68  ? 48.090 15.062  26.297 1.00 36.77 ? 68  ALA A CA  1 
ATOM   343 C  C   . ALA A 1 68  ? 49.049 13.886  26.462 1.00 36.98 ? 68  ALA A C   1 
ATOM   344 O  O   . ALA A 1 68  ? 50.077 14.006  27.127 1.00 38.33 ? 68  ALA A O   1 
ATOM   345 C  CB  . ALA A 1 68  ? 47.208 15.190  27.531 1.00 37.69 ? 68  ALA A CB  1 
ATOM   346 N  N   . THR A 1 69  ? 48.715 12.751  25.858 1.00 35.17 ? 69  THR A N   1 
ATOM   347 C  CA  . THR A 1 69  ? 49.568 11.570  25.952 1.00 34.02 ? 69  THR A CA  1 
ATOM   348 C  C   . THR A 1 69  ? 50.774 11.684  25.024 1.00 33.90 ? 69  THR A C   1 
ATOM   349 O  O   . THR A 1 69  ? 51.719 10.899  25.125 1.00 33.72 ? 69  THR A O   1 
ATOM   350 C  CB  . THR A 1 69  ? 48.817 10.285  25.550 1.00 33.86 ? 69  THR A CB  1 
ATOM   351 O  OG1 . THR A 1 69  ? 48.548 10.315  24.141 1.00 33.47 ? 69  THR A OG1 1 
ATOM   352 C  CG2 . THR A 1 69  ? 47.509 10.160  26.316 1.00 34.22 ? 69  THR A CG2 1 
ATOM   353 N  N   . ALA A 1 70  ? 50.740 12.658  24.120 1.00 32.29 ? 70  ALA A N   1 
ATOM   354 C  CA  . ALA A 1 70  ? 51.821 12.846  23.156 1.00 33.53 ? 70  ALA A CA  1 
ATOM   355 C  C   . ALA A 1 70  ? 51.905 11.594  22.293 1.00 33.08 ? 70  ALA A C   1 
ATOM   356 O  O   . ALA A 1 70  ? 52.921 11.334  21.647 1.00 31.46 ? 70  ALA A O   1 
ATOM   357 C  CB  . ALA A 1 70  ? 53.147 13.081  23.876 1.00 36.81 ? 70  ALA A CB  1 
ATOM   358 N  N   . PHE A 1 71  ? 50.825 10.818  22.296 1.00 29.72 ? 71  PHE A N   1 
ATOM   359 C  CA  . PHE A 1 71  ? 50.753 9.588   21.519 1.00 30.74 ? 71  PHE A CA  1 
ATOM   360 C  C   . PHE A 1 71  ? 51.898 8.634   21.827 1.00 31.67 ? 71  PHE A C   1 
ATOM   361 O  O   . PHE A 1 71  ? 52.398 7.932   20.949 1.00 31.93 ? 71  PHE A O   1 
ATOM   362 C  CB  . PHE A 1 71  ? 50.708 9.923   20.029 1.00 31.36 ? 71  PHE A CB  1 
ATOM   363 C  CG  . PHE A 1 71  ? 49.414 10.551  19.603 1.00 32.93 ? 71  PHE A CG  1 
ATOM   364 C  CD1 . PHE A 1 71  ? 48.292 9.764   19.356 1.00 32.86 ? 71  PHE A CD1 1 
ATOM   365 C  CD2 . PHE A 1 71  ? 49.297 11.932  19.512 1.00 30.33 ? 71  PHE A CD2 1 
ATOM   366 C  CE1 . PHE A 1 71  ? 47.070 10.348  19.028 1.00 32.29 ? 71  PHE A CE1 1 
ATOM   367 C  CE2 . PHE A 1 71  ? 48.079 12.526  19.185 1.00 32.12 ? 71  PHE A CE2 1 
ATOM   368 C  CZ  . PHE A 1 71  ? 46.965 11.731  18.944 1.00 31.88 ? 71  PHE A CZ  1 
ATOM   369 N  N   . GLN A 1 72  ? 52.306 8.621   23.090 1.00 33.46 ? 72  GLN A N   1 
ATOM   370 C  CA  . GLN A 1 72  ? 53.370 7.738   23.552 1.00 37.73 ? 72  GLN A CA  1 
ATOM   371 C  C   . GLN A 1 72  ? 52.699 6.403   23.846 1.00 36.16 ? 72  GLN A C   1 
ATOM   372 O  O   . GLN A 1 72  ? 51.755 6.345   24.636 1.00 31.64 ? 72  GLN A O   1 
ATOM   373 C  CB  . GLN A 1 72  ? 53.999 8.294   24.827 1.00 43.01 ? 72  GLN A CB  1 
ATOM   374 C  CG  . GLN A 1 72  ? 54.674 9.640   24.643 1.00 51.25 ? 72  GLN A CG  1 
ATOM   375 C  CD  . GLN A 1 72  ? 55.135 10.236  25.955 1.00 54.48 ? 72  GLN A CD  1 
ATOM   376 O  OE1 . GLN A 1 72  ? 55.915 9.628   26.688 1.00 57.58 ? 72  GLN A OE1 1 
ATOM   377 N  NE2 . GLN A 1 72  ? 54.653 11.434  26.260 1.00 57.38 ? 72  GLN A NE2 1 
ATOM   378 N  N   . ARG A 1 73  ? 53.187 5.340   23.212 1.00 36.88 ? 73  ARG A N   1 
ATOM   379 C  CA  . ARG A 1 73  ? 52.613 4.006   23.381 1.00 39.98 ? 73  ARG A CA  1 
ATOM   380 C  C   . ARG A 1 73  ? 52.343 3.613   24.828 1.00 36.48 ? 73  ARG A C   1 
ATOM   381 O  O   . ARG A 1 73  ? 51.281 3.074   25.140 1.00 32.45 ? 73  ARG A O   1 
ATOM   382 C  CB  . ARG A 1 73  ? 53.516 2.949   22.736 1.00 50.32 ? 73  ARG A CB  1 
ATOM   383 C  CG  . ARG A 1 73  ? 54.903 2.845   23.348 1.00 61.39 ? 73  ARG A CG  1 
ATOM   384 C  CD  . ARG A 1 73  ? 55.697 1.657   22.804 1.00 68.25 ? 73  ARG A CD  1 
ATOM   385 N  NE  . ARG A 1 73  ? 55.231 0.372   23.328 1.00 73.20 ? 73  ARG A NE  1 
ATOM   386 C  CZ  . ARG A 1 73  ? 54.164 -0.286  22.884 1.00 75.66 ? 73  ARG A CZ  1 
ATOM   387 N  NH1 . ARG A 1 73  ? 53.825 -1.446  23.431 1.00 77.14 ? 73  ARG A NH1 1 
ATOM   388 N  NH2 . ARG A 1 73  ? 53.439 0.204   21.887 1.00 77.15 ? 73  ARG A NH2 1 
ATOM   389 N  N   . GLU A 1 74  ? 53.304 3.875   25.709 1.00 36.13 ? 74  GLU A N   1 
ATOM   390 C  CA  . GLU A 1 74  ? 53.163 3.531   27.119 1.00 37.98 ? 74  GLU A CA  1 
ATOM   391 C  C   . GLU A 1 74  ? 51.997 4.250   27.785 1.00 34.78 ? 74  GLU A C   1 
ATOM   392 O  O   . GLU A 1 74  ? 51.286 3.668   28.603 1.00 33.49 ? 74  GLU A O   1 
ATOM   393 C  CB  . GLU A 1 74  ? 54.462 3.848   27.862 1.00 48.72 ? 74  GLU A CB  1 
ATOM   394 C  CG  . GLU A 1 74  ? 55.656 3.048   27.371 1.00 58.59 ? 74  GLU A CG  1 
ATOM   395 C  CD  . GLU A 1 74  ? 56.975 3.615   27.855 1.00 64.16 ? 74  GLU A CD  1 
ATOM   396 O  OE1 . GLU A 1 74  ? 58.032 3.048   27.504 1.00 68.12 ? 74  GLU A OE1 1 
ATOM   397 O  OE2 . GLU A 1 74  ? 56.957 4.631   28.581 1.00 68.10 ? 74  GLU A OE2 1 
ATOM   398 N  N   . GLU A 1 75  ? 51.800 5.517   27.438 1.00 32.79 ? 75  GLU A N   1 
ATOM   399 C  CA  . GLU A 1 75  ? 50.712 6.293   28.018 1.00 32.07 ? 75  GLU A CA  1 
ATOM   400 C  C   . GLU A 1 75  ? 49.368 5.835   27.466 1.00 28.13 ? 75  GLU A C   1 
ATOM   401 O  O   . GLU A 1 75  ? 48.379 5.769   28.194 1.00 27.98 ? 75  GLU A O   1 
ATOM   402 C  CB  . GLU A 1 75  ? 50.924 7.782   27.739 1.00 35.94 ? 75  GLU A CB  1 
ATOM   403 C  CG  . GLU A 1 75  ? 52.183 8.326   28.391 1.00 39.27 ? 75  GLU A CG  1 
ATOM   404 C  CD  . GLU A 1 75  ? 52.125 8.265   29.908 1.00 44.58 ? 75  GLU A CD  1 
ATOM   405 O  OE1 . GLU A 1 75  ? 53.199 8.289   30.546 1.00 48.14 ? 75  GLU A OE1 1 
ATOM   406 O  OE2 . GLU A 1 75  ? 51.008 8.208   30.465 1.00 44.92 ? 75  GLU A OE2 1 
ATOM   407 N  N   . LEU A 1 76  ? 49.338 5.520   26.176 1.00 27.23 ? 76  LEU A N   1 
ATOM   408 C  CA  . LEU A 1 76  ? 48.114 5.048   25.546 1.00 27.01 ? 76  LEU A CA  1 
ATOM   409 C  C   . LEU A 1 76  ? 47.711 3.699   26.128 1.00 27.14 ? 76  LEU A C   1 
ATOM   410 O  O   . LEU A 1 76  ? 46.525 3.418   26.307 1.00 25.29 ? 76  LEU A O   1 
ATOM   411 C  CB  . LEU A 1 76  ? 48.312 4.908   24.038 1.00 24.74 ? 76  LEU A CB  1 
ATOM   412 C  CG  . LEU A 1 76  ? 48.569 6.204   23.269 1.00 23.86 ? 76  LEU A CG  1 
ATOM   413 C  CD1 . LEU A 1 76  ? 48.940 5.867   21.839 1.00 23.72 ? 76  LEU A CD1 1 
ATOM   414 C  CD2 . LEU A 1 76  ? 47.330 7.097   23.311 1.00 25.10 ? 76  LEU A CD2 1 
ATOM   415 N  N   . MET A 1 77  ? 48.702 2.863   26.420 1.00 26.09 ? 77  MET A N   1 
ATOM   416 C  CA  . MET A 1 77  ? 48.425 1.539   26.970 1.00 26.62 ? 77  MET A CA  1 
ATOM   417 C  C   . MET A 1 77  ? 47.795 1.622   28.352 1.00 28.45 ? 77  MET A C   1 
ATOM   418 O  O   . MET A 1 77  ? 47.131 0.689   28.794 1.00 26.92 ? 77  MET A O   1 
ATOM   419 C  CB  . MET A 1 77  ? 49.707 0.713   27.056 1.00 27.04 ? 77  MET A CB  1 
ATOM   420 C  CG  . MET A 1 77  ? 49.461 -0.749  27.388 1.00 28.47 ? 77  MET A CG  1 
ATOM   421 S  SD  . MET A 1 77  ? 48.479 -1.538  26.094 1.00 36.31 ? 77  MET A SD  1 
ATOM   422 C  CE  . MET A 1 77  ? 49.640 -1.520  24.776 1.00 30.74 ? 77  MET A CE  1 
ATOM   423 N  N   . LYS A 1 78  ? 48.007 2.742   29.038 1.00 28.00 ? 78  LYS A N   1 
ATOM   424 C  CA  . LYS A 1 78  ? 47.458 2.928   30.374 1.00 30.63 ? 78  LYS A CA  1 
ATOM   425 C  C   . LYS A 1 78  ? 46.018 3.435   30.352 1.00 31.88 ? 78  LYS A C   1 
ATOM   426 O  O   . LYS A 1 78  ? 45.361 3.500   31.390 1.00 31.30 ? 78  LYS A O   1 
ATOM   427 C  CB  . LYS A 1 78  ? 48.333 3.906   31.167 1.00 36.82 ? 78  LYS A CB  1 
ATOM   428 C  CG  . LYS A 1 78  ? 49.759 3.422   31.378 1.00 41.19 ? 78  LYS A CG  1 
ATOM   429 C  CD  . LYS A 1 78  ? 50.596 4.470   32.096 1.00 47.35 ? 78  LYS A CD  1 
ATOM   430 C  CE  . LYS A 1 78  ? 51.998 3.959   32.389 1.00 50.74 ? 78  LYS A CE  1 
ATOM   431 N  NZ  . LYS A 1 78  ? 52.740 3.592   31.151 1.00 53.31 ? 78  LYS A NZ  1 
ATOM   432 N  N   . MET A 1 79  ? 45.531 3.784   29.165 1.00 30.92 ? 79  MET A N   1 
ATOM   433 C  CA  . MET A 1 79  ? 44.174 4.295   29.005 1.00 33.59 ? 79  MET A CA  1 
ATOM   434 C  C   . MET A 1 79  ? 43.129 3.196   29.124 1.00 32.79 ? 79  MET A C   1 
ATOM   435 O  O   . MET A 1 79  ? 43.395 2.036   28.823 1.00 30.93 ? 79  MET A O   1 
ATOM   436 C  CB  . MET A 1 79  ? 44.024 4.977   27.641 1.00 37.06 ? 79  MET A CB  1 
ATOM   437 C  CG  . MET A 1 79  ? 44.950 6.160   27.428 1.00 42.10 ? 79  MET A CG  1 
ATOM   438 S  SD  . MET A 1 79  ? 44.551 7.542   28.510 1.00 49.09 ? 79  MET A SD  1 
ATOM   439 C  CE  . MET A 1 79  ? 43.242 8.313   27.566 1.00 48.02 ? 79  MET A CE  1 
ATOM   440 N  N   . LYS A 1 80  ? 41.933 3.578   29.557 1.00 32.70 ? 80  LYS A N   1 
ATOM   441 C  CA  . LYS A 1 80  ? 40.832 2.639   29.704 1.00 35.49 ? 80  LYS A CA  1 
ATOM   442 C  C   . LYS A 1 80  ? 40.404 2.165   28.317 1.00 33.48 ? 80  LYS A C   1 
ATOM   443 O  O   . LYS A 1 80  ? 40.402 2.944   27.363 1.00 29.96 ? 80  LYS A O   1 
ATOM   444 C  CB  . LYS A 1 80  ? 39.656 3.326   30.402 1.00 42.96 ? 80  LYS A CB  1 
ATOM   445 C  CG  . LYS A 1 80  ? 40.042 4.079   31.667 1.00 50.27 ? 80  LYS A CG  1 
ATOM   446 C  CD  . LYS A 1 80  ? 38.866 4.849   32.242 1.00 54.61 ? 80  LYS A CD  1 
ATOM   447 C  CE  . LYS A 1 80  ? 39.293 5.728   33.405 1.00 56.49 ? 80  LYS A CE  1 
ATOM   448 N  NZ  . LYS A 1 80  ? 40.284 6.760   32.985 1.00 55.61 ? 80  LYS A NZ  1 
ATOM   449 N  N   . VAL A 1 81  ? 40.048 0.889   28.208 1.00 31.50 ? 81  VAL A N   1 
ATOM   450 C  CA  . VAL A 1 81  ? 39.621 0.320   26.936 1.00 31.48 ? 81  VAL A CA  1 
ATOM   451 C  C   . VAL A 1 81  ? 38.488 1.125   26.305 1.00 31.55 ? 81  VAL A C   1 
ATOM   452 O  O   . VAL A 1 81  ? 38.489 1.363   25.096 1.00 29.19 ? 81  VAL A O   1 
ATOM   453 C  CB  . VAL A 1 81  ? 39.158 -1.145  27.113 1.00 32.90 ? 81  VAL A CB  1 
ATOM   454 C  CG1 . VAL A 1 81  ? 38.546 -1.665  25.821 1.00 33.47 ? 81  VAL A CG1 1 
ATOM   455 C  CG2 . VAL A 1 81  ? 40.340 -2.010  27.518 1.00 34.46 ? 81  VAL A CG2 1 
ATOM   456 N  N   . LYS A 1 82  ? 37.526 1.545   27.122 1.00 31.06 ? 82  LYS A N   1 
ATOM   457 C  CA  . LYS A 1 82  ? 36.395 2.318   26.618 1.00 34.04 ? 82  LYS A CA  1 
ATOM   458 C  C   . LYS A 1 82  ? 36.827 3.648   26.010 1.00 31.54 ? 82  LYS A C   1 
ATOM   459 O  O   . LYS A 1 82  ? 36.247 4.096   25.022 1.00 29.93 ? 82  LYS A O   1 
ATOM   460 C  CB  . LYS A 1 82  ? 35.373 2.579   27.729 1.00 40.05 ? 82  LYS A CB  1 
ATOM   461 C  CG  . LYS A 1 82  ? 34.124 3.294   27.234 1.00 46.46 ? 82  LYS A CG  1 
ATOM   462 C  CD  . LYS A 1 82  ? 33.057 3.393   28.308 1.00 51.23 ? 82  LYS A CD  1 
ATOM   463 C  CE  . LYS A 1 82  ? 31.759 3.952   27.739 1.00 52.79 ? 82  LYS A CE  1 
ATOM   464 N  NZ  . LYS A 1 82  ? 31.918 5.328   27.188 1.00 55.14 ? 82  LYS A NZ  1 
ATOM   465 N  N   . ASP A 1 83  ? 37.834 4.287   26.600 1.00 30.16 ? 83  ASP A N   1 
ATOM   466 C  CA  . ASP A 1 83  ? 38.313 5.559   26.072 1.00 29.01 ? 83  ASP A CA  1 
ATOM   467 C  C   . ASP A 1 83  ? 39.029 5.363   24.743 1.00 27.62 ? 83  ASP A C   1 
ATOM   468 O  O   . ASP A 1 83  ? 38.901 6.183   23.837 1.00 24.19 ? 83  ASP A O   1 
ATOM   469 C  CB  . ASP A 1 83  ? 39.255 6.252   27.061 1.00 32.11 ? 83  ASP A CB  1 
ATOM   470 C  CG  . ASP A 1 83  ? 38.533 6.776   28.285 1.00 35.77 ? 83  ASP A CG  1 
ATOM   471 O  OD1 . ASP A 1 83  ? 37.315 7.026   28.194 1.00 37.17 ? 83  ASP A OD1 1 
ATOM   472 O  OD2 . ASP A 1 83  ? 39.185 6.955   29.334 1.00 37.77 ? 83  ASP A OD2 1 
ATOM   473 N  N   . LEU A 1 84  ? 39.785 4.276   24.628 1.00 24.37 ? 84  LEU A N   1 
ATOM   474 C  CA  . LEU A 1 84  ? 40.501 3.997   23.389 1.00 24.04 ? 84  LEU A CA  1 
ATOM   475 C  C   . LEU A 1 84  ? 39.474 3.714   22.300 1.00 23.71 ? 84  LEU A C   1 
ATOM   476 O  O   . LEU A 1 84  ? 39.570 4.227   21.184 1.00 24.07 ? 84  LEU A O   1 
ATOM   477 C  CB  . LEU A 1 84  ? 41.429 2.790   23.571 1.00 24.66 ? 84  LEU A CB  1 
ATOM   478 C  CG  . LEU A 1 84  ? 42.691 3.046   24.402 1.00 22.63 ? 84  LEU A CG  1 
ATOM   479 C  CD1 . LEU A 1 84  ? 43.301 1.730   24.857 1.00 23.67 ? 84  LEU A CD1 1 
ATOM   480 C  CD2 . LEU A 1 84  ? 43.693 3.846   23.572 1.00 24.12 ? 84  LEU A CD2 1 
ATOM   481 N  N   . ARG A 1 85  ? 38.479 2.902   22.640 1.00 27.13 ? 85  ARG A N   1 
ATOM   482 C  CA  . ARG A 1 85  ? 37.429 2.548   21.694 1.00 30.19 ? 85  ARG A CA  1 
ATOM   483 C  C   . ARG A 1 85  ? 36.631 3.785   21.281 1.00 26.21 ? 85  ARG A C   1 
ATOM   484 O  O   . ARG A 1 85  ? 36.392 4.012   20.095 1.00 25.61 ? 85  ARG A O   1 
ATOM   485 C  CB  . ARG A 1 85  ? 36.498 1.510   22.323 1.00 38.44 ? 85  ARG A CB  1 
ATOM   486 C  CG  . ARG A 1 85  ? 35.637 0.751   21.331 1.00 51.27 ? 85  ARG A CG  1 
ATOM   487 C  CD  . ARG A 1 85  ? 35.008 -0.469  21.991 1.00 58.20 ? 85  ARG A CD  1 
ATOM   488 N  NE  . ARG A 1 85  ? 34.331 -1.332  21.027 1.00 64.73 ? 85  ARG A NE  1 
ATOM   489 C  CZ  . ARG A 1 85  ? 33.263 -0.977  20.321 1.00 67.20 ? 85  ARG A CZ  1 
ATOM   490 N  NH1 . ARG A 1 85  ? 32.739 0.233   20.468 1.00 69.02 ? 85  ARG A NH1 1 
ATOM   491 N  NH2 . ARG A 1 85  ? 32.721 -1.832  19.465 1.00 67.78 ? 85  ARG A NH2 1 
ATOM   492 N  N   . ASP A 1 86  ? 36.222 4.588   22.259 1.00 24.21 ? 86  ASP A N   1 
ATOM   493 C  CA  . ASP A 1 86  ? 35.440 5.786   21.965 1.00 24.81 ? 86  ASP A CA  1 
ATOM   494 C  C   . ASP A 1 86  ? 36.215 6.800   21.132 1.00 22.40 ? 86  ASP A C   1 
ATOM   495 O  O   . ASP A 1 86  ? 35.656 7.438   20.243 1.00 22.30 ? 86  ASP A O   1 
ATOM   496 C  CB  . ASP A 1 86  ? 34.958 6.447   23.262 1.00 25.85 ? 86  ASP A CB  1 
ATOM   497 C  CG  . ASP A 1 86  ? 33.864 5.652   23.950 1.00 30.69 ? 86  ASP A CG  1 
ATOM   498 O  OD1 . ASP A 1 86  ? 33.314 4.722   23.323 1.00 30.95 ? 86  ASP A OD1 1 
ATOM   499 O  OD2 . ASP A 1 86  ? 33.546 5.967   25.116 1.00 31.89 ? 86  ASP A OD2 1 
ATOM   500 N  N   . TYR A 1 87  ? 37.500 6.954   21.428 1.00 22.37 ? 87  TYR A N   1 
ATOM   501 C  CA  . TYR A 1 87  ? 38.337 7.893   20.692 1.00 20.59 ? 87  TYR A CA  1 
ATOM   502 C  C   . TYR A 1 87  ? 38.403 7.467   19.229 1.00 21.20 ? 87  TYR A C   1 
ATOM   503 O  O   . TYR A 1 87  ? 38.225 8.280   18.324 1.00 21.98 ? 87  TYR A O   1 
ATOM   504 C  CB  . TYR A 1 87  ? 39.747 7.929   21.294 1.00 22.44 ? 87  TYR A CB  1 
ATOM   505 C  CG  . TYR A 1 87  ? 40.721 8.814   20.552 1.00 21.47 ? 87  TYR A CG  1 
ATOM   506 C  CD1 . TYR A 1 87  ? 40.707 10.202  20.716 1.00 24.70 ? 87  TYR A CD1 1 
ATOM   507 C  CD2 . TYR A 1 87  ? 41.664 8.265   19.691 1.00 22.84 ? 87  TYR A CD2 1 
ATOM   508 C  CE1 . TYR A 1 87  ? 41.620 11.018  20.041 1.00 23.79 ? 87  TYR A CE1 1 
ATOM   509 C  CE2 . TYR A 1 87  ? 42.575 9.065   19.011 1.00 23.07 ? 87  TYR A CE2 1 
ATOM   510 C  CZ  . TYR A 1 87  ? 42.551 10.437  19.190 1.00 26.10 ? 87  TYR A CZ  1 
ATOM   511 O  OH  . TYR A 1 87  ? 43.484 11.213  18.539 1.00 25.28 ? 87  TYR A OH  1 
ATOM   512 N  N   . LEU A 1 88  ? 38.648 6.183   18.995 1.00 22.54 ? 88  LEU A N   1 
ATOM   513 C  CA  . LEU A 1 88  ? 38.722 5.686   17.629 1.00 21.12 ? 88  LEU A CA  1 
ATOM   514 C  C   . LEU A 1 88  ? 37.372 5.842   16.928 1.00 21.98 ? 88  LEU A C   1 
ATOM   515 O  O   . LEU A 1 88  ? 37.318 6.176   15.751 1.00 22.65 ? 88  LEU A O   1 
ATOM   516 C  CB  . LEU A 1 88  ? 39.184 4.228   17.632 1.00 23.13 ? 88  LEU A CB  1 
ATOM   517 C  CG  . LEU A 1 88  ? 40.667 4.082   18.000 1.00 24.13 ? 88  LEU A CG  1 
ATOM   518 C  CD1 . LEU A 1 88  ? 41.016 2.621   18.245 1.00 23.67 ? 88  LEU A CD1 1 
ATOM   519 C  CD2 . LEU A 1 88  ? 41.527 4.666   16.883 1.00 24.28 ? 88  LEU A CD2 1 
ATOM   520 N  N   . SER A 1 89  ? 36.281 5.623   17.656 1.00 22.83 ? 89  SER A N   1 
ATOM   521 C  CA  . SER A 1 89  ? 34.949 5.775   17.067 1.00 22.37 ? 89  SER A CA  1 
ATOM   522 C  C   . SER A 1 89  ? 34.713 7.218   16.621 1.00 23.40 ? 89  SER A C   1 
ATOM   523 O  O   . SER A 1 89  ? 34.134 7.463   15.560 1.00 23.35 ? 89  SER A O   1 
ATOM   524 C  CB  . SER A 1 89  ? 33.868 5.368   18.076 1.00 24.20 ? 89  SER A CB  1 
ATOM   525 O  OG  . SER A 1 89  ? 33.953 3.989   18.389 1.00 29.47 ? 89  SER A OG  1 
ATOM   526 N  N   . LEU A 1 90  ? 35.151 8.175   17.435 1.00 19.53 ? 90  LEU A N   1 
ATOM   527 C  CA  . LEU A 1 90  ? 34.983 9.589   17.108 1.00 21.37 ? 90  LEU A CA  1 
ATOM   528 C  C   . LEU A 1 90  ? 35.721 9.940   15.826 1.00 21.91 ? 90  LEU A C   1 
ATOM   529 O  O   . LEU A 1 90  ? 35.326 10.849  15.097 1.00 20.41 ? 90  LEU A O   1 
ATOM   530 C  CB  . LEU A 1 90  ? 35.509 10.471  18.240 1.00 22.92 ? 90  LEU A CB  1 
ATOM   531 C  CG  . LEU A 1 90  ? 34.663 10.520  19.510 1.00 25.38 ? 90  LEU A CG  1 
ATOM   532 C  CD1 . LEU A 1 90  ? 35.362 11.386  20.555 1.00 25.62 ? 90  LEU A CD1 1 
ATOM   533 C  CD2 . LEU A 1 90  ? 33.292 11.089  19.172 1.00 27.76 ? 90  LEU A CD2 1 
ATOM   534 N  N   . HIS A 1 91  ? 36.804 9.215   15.571 1.00 20.72 ? 91  HIS A N   1 
ATOM   535 C  CA  . HIS A 1 91  ? 37.613 9.436   14.383 1.00 19.79 ? 91  HIS A CA  1 
ATOM   536 C  C   . HIS A 1 91  ? 37.182 8.530   13.233 1.00 22.91 ? 91  HIS A C   1 
ATOM   537 O  O   . HIS A 1 91  ? 37.882 8.396   12.229 1.00 22.50 ? 91  HIS A O   1 
ATOM   538 C  CB  . HIS A 1 91  ? 39.086 9.236   14.737 1.00 22.48 ? 91  HIS A CB  1 
ATOM   539 C  CG  . HIS A 1 91  ? 39.643 10.340  15.582 1.00 20.84 ? 91  HIS A CG  1 
ATOM   540 N  ND1 . HIS A 1 91  ? 40.293 11.431  15.047 1.00 26.00 ? 91  HIS A ND1 1 
ATOM   541 C  CD2 . HIS A 1 91  ? 39.583 10.557  16.919 1.00 23.03 ? 91  HIS A CD2 1 
ATOM   542 C  CE1 . HIS A 1 91  ? 40.609 12.273  16.018 1.00 25.46 ? 91  HIS A CE1 1 
ATOM   543 N  NE2 . HIS A 1 91  ? 40.189 11.767  17.160 1.00 24.97 ? 91  HIS A NE2 1 
ATOM   544 N  N   . ASP A 1 92  ? 36.008 7.928   13.397 1.00 23.63 ? 92  ASP A N   1 
ATOM   545 C  CA  . ASP A 1 92  ? 35.401 7.051   12.400 1.00 24.90 ? 92  ASP A CA  1 
ATOM   546 C  C   . ASP A 1 92  ? 36.238 5.847   12.013 1.00 29.09 ? 92  ASP A C   1 
ATOM   547 O  O   . ASP A 1 92  ? 36.300 5.469   10.840 1.00 29.96 ? 92  ASP A O   1 
ATOM   548 C  CB  . ASP A 1 92  ? 35.044 7.857   11.152 1.00 28.78 ? 92  ASP A CB  1 
ATOM   549 C  CG  . ASP A 1 92  ? 34.076 8.981   11.450 1.00 25.78 ? 92  ASP A CG  1 
ATOM   550 O  OD1 . ASP A 1 92  ? 32.991 8.696   12.003 1.00 26.38 ? 92  ASP A OD1 1 
ATOM   551 O  OD2 . ASP A 1 92  ? 34.399 10.144  11.130 1.00 26.76 ? 92  ASP A OD2 1 
ATOM   552 N  N   . ILE A 1 93  ? 36.875 5.247   13.010 1.00 28.32 ? 93  ILE A N   1 
ATOM   553 C  CA  . ILE A 1 93  ? 37.699 4.064   12.806 1.00 32.83 ? 93  ILE A CA  1 
ATOM   554 C  C   . ILE A 1 93  ? 37.040 2.924   13.569 1.00 33.32 ? 93  ILE A C   1 
ATOM   555 O  O   . ILE A 1 93  ? 36.731 3.055   14.752 1.00 34.02 ? 93  ILE A O   1 
ATOM   556 C  CB  . ILE A 1 93  ? 39.133 4.290   13.329 1.00 30.91 ? 93  ILE A CB  1 
ATOM   557 C  CG1 . ILE A 1 93  ? 39.808 5.387   12.503 1.00 32.84 ? 93  ILE A CG1 1 
ATOM   558 C  CG2 . ILE A 1 93  ? 39.928 2.990   13.268 1.00 33.50 ? 93  ILE A CG2 1 
ATOM   559 C  CD1 . ILE A 1 93  ? 41.140 5.851   13.047 1.00 33.80 ? 93  ILE A CD1 1 
ATOM   560 N  N   . SER A 1 94  ? 36.812 1.811   12.880 1.00 37.64 ? 94  SER A N   1 
ATOM   561 C  CA  . SER A 1 94  ? 36.170 0.655   13.491 1.00 42.00 ? 94  SER A CA  1 
ATOM   562 C  C   . SER A 1 94  ? 37.152 -0.187  14.294 1.00 40.30 ? 94  SER A C   1 
ATOM   563 O  O   . SER A 1 94  ? 38.306 -0.355  13.902 1.00 39.85 ? 94  SER A O   1 
ATOM   564 C  CB  . SER A 1 94  ? 35.521 -0.216  12.412 1.00 48.27 ? 94  SER A CB  1 
ATOM   565 O  OG  . SER A 1 94  ? 36.483 -0.674  11.479 1.00 53.35 ? 94  SER A OG  1 
ATOM   566 N  N   . THR A 1 95  ? 36.680 -0.706  15.422 1.00 41.49 ? 95  THR A N   1 
ATOM   567 C  CA  . THR A 1 95  ? 37.492 -1.545  16.298 1.00 44.93 ? 95  THR A CA  1 
ATOM   568 C  C   . THR A 1 95  ? 36.772 -2.870  16.511 1.00 47.46 ? 95  THR A C   1 
ATOM   569 O  O   . THR A 1 95  ? 36.967 -3.548  17.520 1.00 47.12 ? 95  THR A O   1 
ATOM   570 C  CB  . THR A 1 95  ? 37.715 -0.874  17.668 1.00 44.68 ? 95  THR A CB  1 
ATOM   571 O  OG1 . THR A 1 95  ? 36.455 -0.683  18.324 1.00 46.22 ? 95  THR A OG1 1 
ATOM   572 C  CG2 . THR A 1 95  ? 38.397 0.472   17.492 1.00 44.21 ? 95  THR A CG2 1 
ATOM   573 N  N   . GLU A 1 96  ? 35.937 -3.228  15.542 1.00 51.66 ? 96  GLU A N   1 
ATOM   574 C  CA  . GLU A 1 96  ? 35.162 -4.461  15.594 1.00 57.54 ? 96  GLU A CA  1 
ATOM   575 C  C   . GLU A 1 96  ? 36.009 -5.713  15.384 1.00 58.04 ? 96  GLU A C   1 
ATOM   576 O  O   . GLU A 1 96  ? 35.631 -6.802  15.818 1.00 57.78 ? 96  GLU A O   1 
ATOM   577 C  CB  . GLU A 1 96  ? 34.052 -4.411  14.540 1.00 63.24 ? 96  GLU A CB  1 
ATOM   578 C  CG  . GLU A 1 96  ? 34.559 -4.117  13.137 1.00 68.95 ? 96  GLU A CG  1 
ATOM   579 C  CD  . GLU A 1 96  ? 33.448 -4.041  12.105 1.00 71.93 ? 96  GLU A CD  1 
ATOM   580 O  OE1 . GLU A 1 96  ? 33.757 -3.777  10.924 1.00 72.85 ? 96  GLU A OE1 1 
ATOM   581 O  OE2 . GLU A 1 96  ? 32.269 -4.243  12.471 1.00 73.47 ? 96  GLU A OE2 1 
ATOM   582 N  N   . MET A 1 97  ? 37.153 -5.559  14.724 1.00 58.81 ? 97  MET A N   1 
ATOM   583 C  CA  . MET A 1 97  ? 38.035 -6.691  14.454 1.00 59.28 ? 97  MET A CA  1 
ATOM   584 C  C   . MET A 1 97  ? 39.190 -6.803  15.446 1.00 55.67 ? 97  MET A C   1 
ATOM   585 O  O   . MET A 1 97  ? 40.093 -7.626  15.268 1.00 57.33 ? 97  MET A O   1 
ATOM   586 C  CB  . MET A 1 97  ? 38.597 -6.590  13.034 1.00 65.17 ? 97  MET A CB  1 
ATOM   587 C  CG  . MET A 1 97  ? 37.536 -6.585  11.947 1.00 68.68 ? 97  MET A CG  1 
ATOM   588 S  SD  . MET A 1 97  ? 36.442 -8.013  12.053 1.00 72.49 ? 97  MET A SD  1 
ATOM   589 C  CE  . MET A 1 97  ? 37.420 -9.257  11.201 1.00 70.44 ? 97  MET A CE  1 
ATOM   590 N  N   . CYS A 1 98  ? 39.160 -5.978  16.489 1.00 49.44 ? 98  CYS A N   1 
ATOM   591 C  CA  . CYS A 1 98  ? 40.212 -5.987  17.502 1.00 43.24 ? 98  CYS A CA  1 
ATOM   592 C  C   . CYS A 1 98  ? 39.912 -6.982  18.613 1.00 40.52 ? 98  CYS A C   1 
ATOM   593 O  O   . CYS A 1 98  ? 38.797 -7.030  19.130 1.00 38.49 ? 98  CYS A O   1 
ATOM   594 C  CB  . CYS A 1 98  ? 40.371 -4.592  18.113 1.00 40.13 ? 98  CYS A CB  1 
ATOM   595 S  SG  . CYS A 1 98  ? 40.813 -3.299  16.941 1.00 40.90 ? 98  CYS A SG  1 
ATOM   596 N  N   . ARG A 1 99  ? 40.911 -7.777  18.984 1.00 43.61 ? 99  ARG A N   1 
ATOM   597 C  CA  . ARG A 1 99  ? 40.731 -8.751  20.050 1.00 46.65 ? 99  ARG A CA  1 
ATOM   598 C  C   . ARG A 1 99  ? 41.566 -8.434  21.285 1.00 40.75 ? 99  ARG A C   1 
ATOM   599 O  O   . ARG A 1 99  ? 41.218 -8.845  22.389 1.00 38.85 ? 99  ARG A O   1 
ATOM   600 C  CB  . ARG A 1 99  ? 41.052 -10.164 19.554 1.00 59.89 ? 99  ARG A CB  1 
ATOM   601 C  CG  . ARG A 1 99  ? 39.818 -10.986 19.192 1.00 69.38 ? 99  ARG A CG  1 
ATOM   602 C  CD  . ARG A 1 99  ? 38.930 -11.227 20.410 1.00 75.02 ? 99  ARG A CD  1 
ATOM   603 N  NE  . ARG A 1 99  ? 37.798 -12.098 20.103 1.00 77.27 ? 99  ARG A NE  1 
ATOM   604 C  CZ  . ARG A 1 99  ? 36.893 -12.495 20.993 1.00 78.13 ? 99  ARG A CZ  1 
ATOM   605 N  NH1 . ARG A 1 99  ? 35.898 -13.289 20.620 1.00 78.87 ? 99  ARG A NH1 1 
ATOM   606 N  NH2 . ARG A 1 99  ? 36.982 -12.100 22.257 1.00 78.44 ? 99  ARG A NH2 1 
ATOM   607 N  N   . GLU A 1 100 ? 42.664 -7.703  21.106 1.00 36.07 ? 100 GLU A N   1 
ATOM   608 C  CA  . GLU A 1 100 ? 43.520 -7.338  22.235 1.00 34.62 ? 100 GLU A CA  1 
ATOM   609 C  C   . GLU A 1 100 ? 43.659 -5.824  22.347 1.00 31.10 ? 100 GLU A C   1 
ATOM   610 O  O   . GLU A 1 100 ? 43.622 -5.118  21.343 1.00 30.12 ? 100 GLU A O   1 
ATOM   611 C  CB  . GLU A 1 100 ? 44.914 -7.949  22.082 1.00 37.16 ? 100 GLU A CB  1 
ATOM   612 C  CG  . GLU A 1 100 ? 44.943 -9.452  21.943 1.00 43.24 ? 100 GLU A CG  1 
ATOM   613 C  CD  . GLU A 1 100 ? 46.335 -10.012 22.139 1.00 46.12 ? 100 GLU A CD  1 
ATOM   614 O  OE1 . GLU A 1 100 ? 47.298 -9.391  21.643 1.00 47.73 ? 100 GLU A OE1 1 
ATOM   615 O  OE2 . GLU A 1 100 ? 46.466 -11.070 22.790 1.00 49.95 ? 100 GLU A OE2 1 
ATOM   616 N  N   . LYS A 1 101 ? 43.831 -5.336  23.573 1.00 27.04 ? 101 LYS A N   1 
ATOM   617 C  CA  . LYS A 1 101 ? 43.977 -3.900  23.810 1.00 25.84 ? 101 LYS A CA  1 
ATOM   618 C  C   . LYS A 1 101 ? 45.102 -3.282  22.979 1.00 26.39 ? 101 LYS A C   1 
ATOM   619 O  O   . LYS A 1 101 ? 44.981 -2.147  22.513 1.00 23.35 ? 101 LYS A O   1 
ATOM   620 C  CB  . LYS A 1 101 ? 44.220 -3.632  25.301 1.00 26.41 ? 101 LYS A CB  1 
ATOM   621 C  CG  . LYS A 1 101 ? 44.255 -2.153  25.677 1.00 29.60 ? 101 LYS A CG  1 
ATOM   622 C  CD  . LYS A 1 101 ? 44.549 -1.965  27.162 1.00 27.80 ? 101 LYS A CD  1 
ATOM   623 C  CE  . LYS A 1 101 ? 44.456 -0.501  27.565 1.00 31.78 ? 101 LYS A CE  1 
ATOM   624 N  NZ  . LYS A 1 101 ? 44.661 -0.308  29.032 1.00 28.08 ? 101 LYS A NZ  1 
ATOM   625 N  N   . GLU A 1 102 ? 46.198 -4.011  22.791 1.00 25.62 ? 102 GLU A N   1 
ATOM   626 C  CA  . GLU A 1 102 ? 47.302 -3.467  22.006 1.00 28.86 ? 102 GLU A CA  1 
ATOM   627 C  C   . GLU A 1 102 ? 46.864 -3.091  20.594 1.00 27.08 ? 102 GLU A C   1 
ATOM   628 O  O   . GLU A 1 102 ? 47.404 -2.157  20.002 1.00 26.62 ? 102 GLU A O   1 
ATOM   629 C  CB  . GLU A 1 102 ? 48.469 -4.454  21.935 1.00 38.20 ? 102 GLU A CB  1 
ATOM   630 C  CG  . GLU A 1 102 ? 49.634 -3.923  21.107 1.00 48.58 ? 102 GLU A CG  1 
ATOM   631 C  CD  . GLU A 1 102 ? 50.931 -4.657  21.369 1.00 54.02 ? 102 GLU A CD  1 
ATOM   632 O  OE1 . GLU A 1 102 ? 50.953 -5.898  21.235 1.00 57.70 ? 102 GLU A OE1 1 
ATOM   633 O  OE2 . GLU A 1 102 ? 51.929 -3.988  21.713 1.00 57.58 ? 102 GLU A OE2 1 
ATOM   634 N  N   . GLU A 1 103 ? 45.893 -3.818  20.046 1.00 25.85 ? 103 GLU A N   1 
ATOM   635 C  CA  . GLU A 1 103 ? 45.408 -3.509  18.704 1.00 27.87 ? 103 GLU A CA  1 
ATOM   636 C  C   . GLU A 1 103 ? 44.766 -2.126  18.677 1.00 26.57 ? 103 GLU A C   1 
ATOM   637 O  O   . GLU A 1 103 ? 44.887 -1.402  17.689 1.00 24.72 ? 103 GLU A O   1 
ATOM   638 C  CB  . GLU A 1 103 ? 44.386 -4.547  18.236 1.00 33.35 ? 103 GLU A CB  1 
ATOM   639 C  CG  . GLU A 1 103 ? 44.962 -5.928  18.006 1.00 38.74 ? 103 GLU A CG  1 
ATOM   640 C  CD  . GLU A 1 103 ? 43.915 -6.919  17.535 1.00 42.67 ? 103 GLU A CD  1 
ATOM   641 O  OE1 . GLU A 1 103 ? 43.362 -6.729  16.431 1.00 44.73 ? 103 GLU A OE1 1 
ATOM   642 O  OE2 . GLU A 1 103 ? 43.642 -7.887  18.271 1.00 45.26 ? 103 GLU A OE2 1 
ATOM   643 N  N   . LEU A 1 104 ? 44.073 -1.768  19.756 1.00 23.22 ? 104 LEU A N   1 
ATOM   644 C  CA  . LEU A 1 104 ? 43.429 -0.458  19.832 1.00 24.87 ? 104 LEU A CA  1 
ATOM   645 C  C   . LEU A 1 104 ? 44.508 0.620   19.866 1.00 24.37 ? 104 LEU A C   1 
ATOM   646 O  O   . LEU A 1 104 ? 44.398 1.647   19.195 1.00 23.35 ? 104 LEU A O   1 
ATOM   647 C  CB  . LEU A 1 104 ? 42.562 -0.350  21.089 1.00 24.19 ? 104 LEU A CB  1 
ATOM   648 C  CG  . LEU A 1 104 ? 41.389 -1.326  21.224 1.00 26.69 ? 104 LEU A CG  1 
ATOM   649 C  CD1 . LEU A 1 104 ? 40.743 -1.167  22.594 1.00 26.95 ? 104 LEU A CD1 1 
ATOM   650 C  CD2 . LEU A 1 104 ? 40.380 -1.072  20.119 1.00 27.56 ? 104 LEU A CD2 1 
ATOM   651 N  N   . VAL A 1 105 ? 45.553 0.378   20.653 1.00 21.58 ? 105 VAL A N   1 
ATOM   652 C  CA  . VAL A 1 105 ? 46.653 1.333   20.767 1.00 21.14 ? 105 VAL A CA  1 
ATOM   653 C  C   . VAL A 1 105 ? 47.320 1.530   19.409 1.00 22.49 ? 105 VAL A C   1 
ATOM   654 O  O   . VAL A 1 105 ? 47.661 2.651   19.034 1.00 22.27 ? 105 VAL A O   1 
ATOM   655 C  CB  . VAL A 1 105 ? 47.704 0.849   21.805 1.00 22.30 ? 105 VAL A CB  1 
ATOM   656 C  CG1 . VAL A 1 105 ? 48.950 1.730   21.761 1.00 22.80 ? 105 VAL A CG1 1 
ATOM   657 C  CG2 . VAL A 1 105 ? 47.094 0.883   23.197 1.00 20.94 ? 105 VAL A CG2 1 
ATOM   658 N  N   . LEU A 1 106 ? 47.495 0.441   18.665 1.00 22.22 ? 106 LEU A N   1 
ATOM   659 C  CA  . LEU A 1 106 ? 48.116 0.528   17.348 1.00 25.43 ? 106 LEU A CA  1 
ATOM   660 C  C   . LEU A 1 106 ? 47.278 1.386   16.407 1.00 25.09 ? 106 LEU A C   1 
ATOM   661 O  O   . LEU A 1 106 ? 47.816 2.142   15.598 1.00 23.89 ? 106 LEU A O   1 
ATOM   662 C  CB  . LEU A 1 106 ? 48.303 -0.872  16.752 1.00 27.79 ? 106 LEU A CB  1 
ATOM   663 C  CG  . LEU A 1 106 ? 49.441 -1.693  17.367 1.00 32.23 ? 106 LEU A CG  1 
ATOM   664 C  CD1 . LEU A 1 106 ? 49.359 -3.141  16.900 1.00 33.47 ? 106 LEU A CD1 1 
ATOM   665 C  CD2 . LEU A 1 106 ? 50.776 -1.080  16.975 1.00 34.22 ? 106 LEU A CD2 1 
ATOM   666 N  N   . LEU A 1 107 ? 45.958 1.274   16.516 1.00 24.55 ? 107 LEU A N   1 
ATOM   667 C  CA  . LEU A 1 107 ? 45.078 2.057   15.659 1.00 22.90 ? 107 LEU A CA  1 
ATOM   668 C  C   . LEU A 1 107 ? 45.161 3.530   16.019 1.00 23.12 ? 107 LEU A C   1 
ATOM   669 O  O   . LEU A 1 107 ? 45.115 4.391   15.146 1.00 23.61 ? 107 LEU A O   1 
ATOM   670 C  CB  . LEU A 1 107 ? 43.637 1.562   15.776 1.00 24.74 ? 107 LEU A CB  1 
ATOM   671 C  CG  . LEU A 1 107 ? 43.359 0.238   15.061 1.00 27.49 ? 107 LEU A CG  1 
ATOM   672 C  CD1 . LEU A 1 107 ? 41.945 -0.235  15.364 1.00 26.33 ? 107 LEU A CD1 1 
ATOM   673 C  CD2 . LEU A 1 107 ? 43.560 0.430   13.557 1.00 27.97 ? 107 LEU A CD2 1 
ATOM   674 N  N   . VAL A 1 108 ? 45.280 3.820   17.308 1.00 21.62 ? 108 VAL A N   1 
ATOM   675 C  CA  . VAL A 1 108 ? 45.387 5.202   17.743 1.00 20.78 ? 108 VAL A CA  1 
ATOM   676 C  C   . VAL A 1 108 ? 46.688 5.770   17.180 1.00 23.56 ? 108 VAL A C   1 
ATOM   677 O  O   . VAL A 1 108 ? 46.710 6.868   16.631 1.00 23.09 ? 108 VAL A O   1 
ATOM   678 C  CB  . VAL A 1 108 ? 45.381 5.304   19.284 1.00 21.31 ? 108 VAL A CB  1 
ATOM   679 C  CG1 . VAL A 1 108 ? 45.701 6.734   19.720 1.00 24.38 ? 108 VAL A CG1 1 
ATOM   680 C  CG2 . VAL A 1 108 ? 44.009 4.894   19.819 1.00 20.55 ? 108 VAL A CG2 1 
ATOM   681 N  N   . LEU A 1 109 ? 47.770 5.006   17.295 1.00 24.50 ? 109 LEU A N   1 
ATOM   682 C  CA  . LEU A 1 109 ? 49.058 5.459   16.778 1.00 25.80 ? 109 LEU A CA  1 
ATOM   683 C  C   . LEU A 1 109 ? 49.001 5.671   15.264 1.00 26.75 ? 109 LEU A C   1 
ATOM   684 O  O   . LEU A 1 109 ? 49.568 6.632   14.738 1.00 28.24 ? 109 LEU A O   1 
ATOM   685 C  CB  . LEU A 1 109 ? 50.152 4.439   17.120 1.00 27.66 ? 109 LEU A CB  1 
ATOM   686 C  CG  . LEU A 1 109 ? 50.504 4.283   18.603 1.00 28.95 ? 109 LEU A CG  1 
ATOM   687 C  CD1 . LEU A 1 109 ? 51.465 3.120   18.804 1.00 28.60 ? 109 LEU A CD1 1 
ATOM   688 C  CD2 . LEU A 1 109 ? 51.119 5.581   19.108 1.00 31.20 ? 109 LEU A CD2 1 
ATOM   689 N  N   . GLY A 1 110 ? 48.304 4.777   14.572 1.00 25.55 ? 110 GLY A N   1 
ATOM   690 C  CA  . GLY A 1 110 ? 48.196 4.865   13.125 1.00 29.45 ? 110 GLY A CA  1 
ATOM   691 C  C   . GLY A 1 110 ? 47.529 6.112   12.573 1.00 30.77 ? 110 GLY A C   1 
ATOM   692 O  O   . GLY A 1 110 ? 47.962 6.651   11.552 1.00 28.85 ? 110 GLY A O   1 
ATOM   693 N  N   . GLN A 1 111 ? 46.478 6.578   13.239 1.00 30.06 ? 111 GLN A N   1 
ATOM   694 C  CA  . GLN A 1 111 ? 45.764 7.763   12.773 1.00 30.41 ? 111 GLN A CA  1 
ATOM   695 C  C   . GLN A 1 111 ? 46.343 9.070   13.311 1.00 30.68 ? 111 GLN A C   1 
ATOM   696 O  O   . GLN A 1 111 ? 45.805 10.146  13.044 1.00 32.10 ? 111 GLN A O   1 
ATOM   697 C  CB  . GLN A 1 111 ? 44.279 7.658   13.144 1.00 29.09 ? 111 GLN A CB  1 
ATOM   698 C  CG  . GLN A 1 111 ? 43.995 7.625   14.642 1.00 29.50 ? 111 GLN A CG  1 
ATOM   699 C  CD  . GLN A 1 111 ? 44.028 9.000   15.287 1.00 33.03 ? 111 GLN A CD  1 
ATOM   700 O  OE1 . GLN A 1 111 ? 43.275 9.897   14.903 1.00 30.67 ? 111 GLN A OE1 1 
ATOM   701 N  NE2 . GLN A 1 111 ? 44.898 9.172   16.276 1.00 30.34 ? 111 GLN A NE2 1 
ATOM   702 N  N   . GLN A 1 112 ? 47.436 8.987   14.062 1.00 32.92 ? 112 GLN A N   1 
ATOM   703 C  CA  . GLN A 1 112 ? 48.054 10.190  14.613 1.00 34.30 ? 112 GLN A CA  1 
ATOM   704 C  C   . GLN A 1 112 ? 48.474 11.146  13.502 1.00 37.39 ? 112 GLN A C   1 
ATOM   705 O  O   . GLN A 1 112 ? 49.126 10.744  12.541 1.00 33.30 ? 112 GLN A O   1 
ATOM   706 C  CB  . GLN A 1 112 ? 49.291 9.843   15.446 1.00 36.87 ? 112 GLN A CB  1 
ATOM   707 C  CG  . GLN A 1 112 ? 49.981 11.081  16.019 1.00 38.82 ? 112 GLN A CG  1 
ATOM   708 C  CD  . GLN A 1 112 ? 51.351 10.795  16.610 1.00 39.64 ? 112 GLN A CD  1 
ATOM   709 O  OE1 . GLN A 1 112 ? 52.002 11.690  17.152 1.00 40.65 ? 112 GLN A OE1 1 
ATOM   710 N  NE2 . GLN A 1 112 ? 51.798 9.550   16.505 1.00 38.14 ? 112 GLN A NE2 1 
ATOM   711 N  N   . PRO A 1 113 ? 48.107 12.430  13.623 1.00 39.94 ? 113 PRO A N   1 
ATOM   712 C  CA  . PRO A 1 113 ? 48.469 13.420  12.605 1.00 41.53 ? 113 PRO A CA  1 
ATOM   713 C  C   . PRO A 1 113 ? 49.976 13.672  12.563 1.00 42.04 ? 113 PRO A C   1 
ATOM   714 O  O   . PRO A 1 113 ? 50.645 13.663  13.595 1.00 38.50 ? 113 PRO A O   1 
ATOM   715 C  CB  . PRO A 1 113 ? 47.682 14.655  13.035 1.00 44.10 ? 113 PRO A CB  1 
ATOM   716 C  CG  . PRO A 1 113 ? 47.649 14.519  14.530 1.00 46.46 ? 113 PRO A CG  1 
ATOM   717 C  CD  . PRO A 1 113 ? 47.331 13.053  14.710 1.00 43.56 ? 113 PRO A CD  1 
ATOM   718 N  N   . VAL A 1 114 ? 50.504 13.891  11.365 1.00 44.67 ? 114 VAL A N   1 
ATOM   719 C  CA  . VAL A 1 114 ? 51.927 14.152  11.195 1.00 51.49 ? 114 VAL A CA  1 
ATOM   720 C  C   . VAL A 1 114 ? 52.159 15.237  10.148 1.00 53.88 ? 114 VAL A C   1 
ATOM   721 O  O   . VAL A 1 114 ? 52.831 14.956  9.132  1.00 55.15 ? 114 VAL A O   1 
ATOM   722 C  CB  . VAL A 1 114 ? 52.687 12.868  10.782 1.00 54.00 ? 114 VAL A CB  1 
ATOM   723 C  CG1 . VAL A 1 114 ? 52.699 11.882  11.938 1.00 55.87 ? 114 VAL A CG1 1 
ATOM   724 C  CG2 . VAL A 1 114 ? 52.032 12.238  9.561  1.00 55.47 ? 114 VAL A CG2 1 
HETATM 725 ZN ZN  . ZN  B 2 .   ? 37.307 15.217  19.334 1.00 29.96 ? 161 ZN  A ZN  1 
HETATM 726 ZN ZN  . ZN  C 2 .   ? 27.674 17.618  25.546 1.00 32.00 ? 162 ZN  A ZN  1 
HETATM 727 O  O   . HOH D 3 .   ? 27.497 23.314  27.521 1.00 20.73 ? 163 HOH A O   1 
HETATM 728 O  O   . HOH D 3 .   ? 35.006 13.550  23.861 1.00 23.84 ? 164 HOH A O   1 
HETATM 729 O  O   . HOH D 3 .   ? 33.502 15.450  25.316 1.00 26.24 ? 165 HOH A O   1 
HETATM 730 O  O   . HOH D 3 .   ? 41.841 10.788  12.467 1.00 33.51 ? 166 HOH A O   1 
HETATM 731 O  O   . HOH D 3 .   ? 37.058 0.456   29.715 1.00 37.13 ? 167 HOH A O   1 
HETATM 732 O  O   . HOH D 3 .   ? 28.506 15.694  15.767 1.00 28.50 ? 168 HOH A O   1 
HETATM 733 O  O   . HOH D 3 .   ? 31.471 29.425  19.839 1.00 45.33 ? 169 HOH A O   1 
HETATM 734 O  O   . HOH D 3 .   ? 20.611 21.397  18.908 1.00 38.17 ? 170 HOH A O   1 
HETATM 735 O  O   . HOH D 3 .   ? 23.768 26.680  22.445 1.00 39.16 ? 171 HOH A O   1 
HETATM 736 O  O   . HOH D 3 .   ? 40.202 16.132  28.740 1.00 41.28 ? 172 HOH A O   1 
HETATM 737 O  O   . HOH D 3 .   ? 44.720 3.839   12.523 1.00 32.79 ? 173 HOH A O   1 
HETATM 738 O  O   . HOH D 3 .   ? 23.037 13.445  28.530 1.00 31.27 ? 174 HOH A O   1 
HETATM 739 O  O   . HOH D 3 .   ? 35.070 7.529   26.796 1.00 38.38 ? 175 HOH A O   1 
HETATM 740 O  O   . HOH D 3 .   ? 22.636 25.545  25.209 1.00 29.39 ? 176 HOH A O   1 
HETATM 741 O  O   . HOH D 3 .   ? 45.842 11.905  29.153 1.00 48.95 ? 177 HOH A O   1 
HETATM 742 O  O   . HOH D 3 .   ? 25.694 11.702  17.123 1.00 44.82 ? 178 HOH A O   1 
HETATM 743 O  O   . HOH D 3 .   ? 33.609 25.387  17.214 1.00 43.60 ? 179 HOH A O   1 
HETATM 744 O  O   . HOH D 3 .   ? 43.461 13.791  19.778 1.00 33.42 ? 180 HOH A O   1 
HETATM 745 O  O   . HOH D 3 .   ? 53.736 8.121   17.755 1.00 37.27 ? 181 HOH A O   1 
HETATM 746 O  O   . HOH D 3 .   ? 40.434 19.253  28.928 1.00 51.46 ? 182 HOH A O   1 
HETATM 747 O  O   . HOH D 3 .   ? 26.308 14.636  17.498 1.00 37.44 ? 183 HOH A O   1 
HETATM 748 O  O   . HOH D 3 .   ? 32.177 19.160  11.488 1.00 46.18 ? 184 HOH A O   1 
HETATM 749 O  O   . HOH D 3 .   ? 45.295 -2.564  15.111 1.00 44.57 ? 185 HOH A O   1 
HETATM 750 O  O   . HOH D 3 .   ? 55.809 5.884   22.028 1.00 46.66 ? 186 HOH A O   1 
HETATM 751 O  O   . HOH D 3 .   ? 43.822 12.653  15.156 1.00 46.10 ? 187 HOH A O   1 
HETATM 752 O  O   . HOH D 3 .   ? 55.834 5.123   25.279 1.00 47.86 ? 188 HOH A O   1 
HETATM 753 O  O   . HOH D 3 .   ? 19.766 13.692  24.634 1.00 42.61 ? 189 HOH A O   1 
HETATM 754 O  O   . HOH D 3 .   ? 44.398 17.192  14.058 1.00 52.00 ? 190 HOH A O   1 
HETATM 755 O  O   . HOH D 3 .   ? 47.812 7.821   30.073 1.00 47.10 ? 191 HOH A O   1 
HETATM 756 O  O   . HOH D 3 .   ? 31.919 15.146  27.985 1.00 54.82 ? 192 HOH A O   1 
HETATM 757 O  O   . HOH D 3 .   ? 34.597 2.082   15.921 1.00 49.26 ? 193 HOH A O   1 
HETATM 758 O  O   . HOH D 3 .   ? 21.331 30.345  14.930 1.00 66.06 ? 194 HOH A O   1 
HETATM 759 O  O   . HOH D 3 .   ? 35.567 6.622   30.661 1.00 62.93 ? 195 HOH A O   1 
HETATM 760 O  O   . HOH D 3 .   ? 45.531 14.606  16.943 1.00 42.58 ? 196 HOH A O   1 
HETATM 761 O  O   . HOH D 3 .   ? 48.324 -7.240  19.899 1.00 56.44 ? 197 HOH A O   1 
HETATM 762 O  O   . HOH D 3 .   ? 33.901 20.794  30.830 1.00 54.93 ? 198 HOH A O   1 
HETATM 763 O  O   . HOH D 3 .   ? 42.163 15.364  12.508 1.00 54.96 ? 199 HOH A O   1 
HETATM 764 O  O   . HOH D 3 .   ? 39.945 -0.607  30.724 1.00 55.04 ? 200 HOH A O   1 
HETATM 765 O  O   . HOH D 3 .   ? 24.833 12.428  20.111 1.00 54.87 ? 201 HOH A O   1 
HETATM 766 O  O   . HOH D 3 .   ? 32.663 11.602  24.278 1.00 51.85 ? 202 HOH A O   1 
HETATM 767 O  O   . HOH D 3 .   ? 45.354 -10.136 18.026 1.00 65.06 ? 203 HOH A O   1 
HETATM 768 O  O   . HOH D 3 .   ? 45.710 18.356  26.161 1.00 58.29 ? 204 HOH A O   1 
HETATM 769 O  O   . HOH D 3 .   ? 16.476 27.710  21.637 1.00 60.32 ? 205 HOH A O   1 
HETATM 770 O  O   . HOH D 3 .   ? 30.259 27.723  17.286 1.00 55.65 ? 206 HOH A O   1 
HETATM 771 O  O   . HOH D 3 .   ? 23.704 23.285  12.556 1.00 65.57 ? 207 HOH A O   1 
HETATM 772 O  O   . HOH D 3 .   ? 43.323 23.114  23.529 1.00 57.53 ? 208 HOH A O   1 
HETATM 773 O  O   . HOH D 3 .   ? 34.944 25.427  27.123 1.00 65.94 ? 209 HOH A O   1 
HETATM 774 O  O   . HOH D 3 .   ? 19.146 26.984  17.392 1.00 53.54 ? 210 HOH A O   1 
HETATM 775 O  O   . HOH D 3 .   ? 32.908 3.334   20.893 1.00 57.57 ? 211 HOH A O   1 
HETATM 776 O  O   . HOH D 3 .   ? 44.957 -1.606  10.128 1.00 68.66 ? 212 HOH A O   1 
HETATM 777 O  O   . HOH D 3 .   ? 36.835 3.339   9.404  1.00 50.97 ? 213 HOH A O   1 
HETATM 778 O  O   . HOH D 3 .   ? 38.015 25.438  28.065 1.00 55.31 ? 214 HOH A O   1 
HETATM 779 O  O   . HOH D 3 .   ? 45.854 21.233  22.670 1.00 63.88 ? 215 HOH A O   1 
HETATM 780 O  O   . HOH D 3 .   ? 26.542 8.283   24.314 1.00 64.33 ? 216 HOH A O   1 
HETATM 781 O  O   . HOH D 3 .   ? 23.653 26.576  13.068 1.00 66.27 ? 217 HOH A O   1 
HETATM 782 O  O   . HOH D 3 .   ? 33.830 -0.828  14.994 1.00 50.83 ? 218 HOH A O   1 
HETATM 783 O  O   . HOH D 3 .   ? 46.163 21.507  15.839 1.00 56.23 ? 219 HOH A O   1 
HETATM 784 O  O   . HOH D 3 .   ? 36.709 24.509  16.132 1.00 59.84 ? 220 HOH A O   1 
HETATM 785 O  O   . HOH D 3 .   ? 54.939 12.690  20.624 1.00 59.75 ? 221 HOH A O   1 
HETATM 786 O  O   . HOH D 3 .   ? 32.965 24.883  29.703 1.00 54.73 ? 222 HOH A O   1 
HETATM 787 O  O   . HOH D 3 .   ? 32.040 9.404   22.148 1.00 53.63 ? 223 HOH A O   1 
HETATM 788 O  O   . HOH D 3 .   ? 30.678 5.056   24.383 1.00 53.94 ? 224 HOH A O   1 
HETATM 789 O  O   . HOH D 3 .   ? 29.605 8.060   23.601 1.00 58.52 ? 225 HOH A O   1 
HETATM 790 O  O   . HOH D 3 .   ? 42.679 2.371   10.676 1.00 56.47 ? 226 HOH A O   1 
HETATM 791 O  O   . HOH D 3 .   ? 34.169 -9.020  13.896 1.00 70.63 ? 227 HOH A O   1 
HETATM 792 O  O   . HOH D 3 .   ? 47.492 18.027  13.971 1.00 59.58 ? 228 HOH A O   1 
HETATM 793 O  O   . HOH D 3 .   ? 48.254 16.326  17.245 1.00 57.93 ? 229 HOH A O   1 
HETATM 794 O  O   . HOH D 3 .   ? 34.347 10.528  26.754 1.00 52.20 ? 230 HOH A O   1 
HETATM 795 O  O   . HOH D 3 .   ? 26.605 27.714  12.218 1.00 62.04 ? 231 HOH A O   1 
HETATM 796 O  O   . HOH D 3 .   ? 40.234 0.478   33.785 1.00 73.69 ? 232 HOH A O   1 
HETATM 797 O  O   . HOH D 3 .   ? 35.293 -1.949  28.656 1.00 60.43 ? 233 HOH A O   1 
HETATM 798 O  O   . HOH D 3 .   ? 52.226 14.523  20.275 1.00 62.95 ? 234 HOH A O   1 
HETATM 799 O  O   . HOH D 3 .   ? 34.908 20.737  10.642 1.00 53.73 ? 235 HOH A O   1 
HETATM 800 O  O   . HOH D 3 .   ? 39.277 19.959  7.561  1.00 71.09 ? 236 HOH A O   1 
HETATM 801 O  O   . HOH D 3 .   ? 30.467 -1.456  23.006 1.00 75.60 ? 237 HOH A O   1 
HETATM 802 O  O   . HOH D 3 .   ? 58.185 -5.326  25.373 1.00 72.91 ? 238 HOH A O   1 
HETATM 803 O  O   . HOH D 3 .   ? 49.040 11.326  29.597 1.00 64.75 ? 239 HOH A O   1 
HETATM 804 O  O   . HOH D 3 .   ? 31.046 -0.014  17.542 1.00 74.20 ? 240 HOH A O   1 
HETATM 805 O  O   . HOH D 3 .   ? 47.317 2.452   11.473 1.00 60.81 ? 241 HOH A O   1 
HETATM 806 O  O   . HOH D 3 .   ? 41.077 -10.988 16.391 1.00 65.65 ? 242 HOH A O   1 
HETATM 807 O  O   . HOH D 3 .   ? 31.667 -3.014  16.231 1.00 76.05 ? 243 HOH A O   1 
HETATM 808 O  O   . HOH D 3 .   ? 58.595 4.945   23.525 1.00 90.84 ? 244 HOH A O   1 
HETATM 809 O  O   . HOH D 3 .   ? 35.991 12.810  28.278 1.00 63.54 ? 245 HOH A O   1 
HETATM 810 O  O   . HOH D 3 .   ? 47.330 23.418  18.121 1.00 60.91 ? 246 HOH A O   1 
HETATM 811 O  O   . HOH D 3 .   ? 28.488 26.613  14.662 1.00 70.27 ? 247 HOH A O   1 
HETATM 812 O  O   . HOH D 3 .   ? 57.064 15.053  19.855 1.00 66.93 ? 248 HOH A O   1 
HETATM 813 O  O   . HOH D 3 .   ? 52.206 12.280  29.296 1.00 67.95 ? 249 HOH A O   1 
HETATM 814 O  O   . HOH D 3 .   ? 33.776 24.505  12.685 1.00 69.24 ? 250 HOH A O   1 
HETATM 815 O  O   . HOH D 3 .   ? 14.007 28.505  23.571 1.00 71.62 ? 251 HOH A O   1 
HETATM 816 O  O   . HOH D 3 .   ? 50.623 17.616  24.759 1.00 71.65 ? 252 HOH A O   1 
HETATM 817 O  O   . HOH D 3 .   ? 47.322 -5.005  14.266 1.00 63.72 ? 253 HOH A O   1 
HETATM 818 O  O   . HOH D 3 .   ? 29.861 4.428   19.914 1.00 69.70 ? 254 HOH A O   1 
HETATM 819 O  O   . HOH D 3 .   ? 24.131 6.121   24.228 1.00 63.47 ? 255 HOH A O   1 
HETATM 820 O  O   . HOH D 3 .   ? 48.581 -7.039  16.553 1.00 65.00 ? 256 HOH A O   1 
HETATM 821 O  O   . HOH D 3 .   ? 34.674 3.445   31.196 1.00 67.70 ? 257 HOH A O   1 
HETATM 822 O  O   . HOH D 3 .   ? 55.079 5.432   18.959 1.00 62.82 ? 258 HOH A O   1 
HETATM 823 O  O   . HOH D 3 .   ? 36.798 -4.832  28.126 1.00 76.81 ? 259 HOH A O   1 
HETATM 824 O  O   . HOH D 3 .   ? 52.168 20.584  24.650 1.00 66.77 ? 260 HOH A O   1 
HETATM 825 O  O   . HOH D 3 .   ? 20.731 13.763  17.097 1.00 88.02 ? 261 HOH A O   1 
HETATM 826 O  O   . HOH D 3 .   ? 41.281 -13.761 19.050 1.00 65.84 ? 262 HOH A O   1 
HETATM 827 O  O   . HOH D 3 .   ? 49.234 13.983  31.495 1.00 58.13 ? 263 HOH A O   1 
HETATM 828 O  O   . HOH D 3 .   ? 47.655 0.065   13.478 1.00 53.16 ? 264 HOH A O   1 
HETATM 829 O  O   . HOH D 3 .   ? 52.862 16.579  17.797 1.00 77.00 ? 265 HOH A O   1 
HETATM 830 O  O   . HOH D 3 .   ? 52.920 17.418  22.344 1.00 77.84 ? 266 HOH A O   1 
HETATM 831 O  O   . HOH D 3 .   ? 24.871 3.013   25.369 1.00 77.85 ? 267 HOH A O   1 
HETATM 832 O  O   . HOH D 3 .   ? 39.847 2.582   9.318  1.00 62.06 ? 268 HOH A O   1 
HETATM 833 O  O   . HOH D 3 .   ? 29.203 5.720   28.421 1.00 71.36 ? 269 HOH A O   1 
HETATM 834 O  O   . HOH D 3 .   ? 32.009 26.796  14.317 1.00 77.37 ? 270 HOH A O   1 
HETATM 835 O  O   . HOH D 3 .   ? 32.770 -2.630  30.508 1.00 79.00 ? 271 HOH A O   1 
HETATM 836 O  O   . HOH D 3 .   ? 33.021 -5.667  19.763 1.00 74.77 ? 272 HOH A O   1 
HETATM 837 O  O   . HOH D 3 .   ? 33.206 10.003  29.754 1.00 66.86 ? 273 HOH A O   1 
HETATM 838 O  O   . HOH D 3 .   ? 59.751 13.729  21.131 1.00 79.64 ? 274 HOH A O   1 
HETATM 839 O  O   . HOH D 3 .   ? 34.852 18.097  32.569 1.00 87.90 ? 275 HOH A O   1 
HETATM 840 O  O   . HOH D 3 .   ? 59.320 -2.275  24.211 1.00 79.21 ? 276 HOH A O   1 
HETATM 841 O  O   . HOH D 3 .   ? 18.705 12.191  21.347 1.00 84.61 ? 277 HOH A O   1 
HETATM 842 O  O   . HOH D 3 .   ? 41.766 6.521   29.911 1.00 43.14 ? 278 HOH A O   1 
HETATM 843 O  O   . HOH D 3 .   ? 56.117 7.244   28.197 1.00 53.38 ? 279 HOH A O   1 
HETATM 844 O  O   . HOH D 3 .   ? 25.273 10.254  22.971 1.00 54.00 ? 280 HOH A O   1 
HETATM 845 O  O   . HOH D 3 .   ? 49.811 -7.788  23.095 1.00 53.48 ? 281 HOH A O   1 
HETATM 846 O  O   . HOH D 3 .   ? 21.033 13.219  20.759 1.00 52.62 ? 282 HOH A O   1 
HETATM 847 O  O   . HOH D 3 .   ? 18.072 18.115  14.963 1.00 68.91 ? 283 HOH A O   1 
HETATM 848 O  O   . HOH D 3 .   ? 35.923 1.976   18.518 1.00 51.63 ? 284 HOH A O   1 
HETATM 849 O  O   . HOH D 3 .   ? 34.787 -0.583  25.787 1.00 53.93 ? 285 HOH A O   1 
HETATM 850 O  O   . HOH D 3 .   ? 40.817 0.451   10.821 1.00 58.81 ? 286 HOH A O   1 
HETATM 851 O  O   . HOH D 3 .   ? 30.619 24.623  15.268 1.00 46.68 ? 287 HOH A O   1 
HETATM 852 O  O   . HOH D 3 .   ? 37.955 1.183   10.350 1.00 83.06 ? 288 HOH A O   1 
HETATM 853 O  O   . HOH D 3 .   ? 30.961 2.359   24.896 1.00 63.96 ? 289 HOH A O   1 
HETATM 854 O  O   . HOH D 3 .   ? 22.435 15.461  15.711 1.00 51.74 ? 290 HOH A O   1 
HETATM 855 O  O   . HOH D 3 .   ? 60.727 -4.414  22.545 1.00 61.77 ? 291 HOH A O   1 
HETATM 856 O  O   . HOH D 3 .   ? 35.544 -4.101  25.413 1.00 64.04 ? 292 HOH A O   1 
HETATM 857 O  O   . HOH D 3 .   ? 44.117 0.865   8.967  1.00 65.83 ? 293 HOH A O   1 
HETATM 858 O  O   . HOH D 3 .   ? 43.580 16.353  29.138 1.00 67.88 ? 294 HOH A O   1 
HETATM 859 O  O   . HOH D 3 .   ? 38.905 14.912  30.784 1.00 62.56 ? 295 HOH A O   1 
HETATM 860 O  O   . HOH D 3 .   ? 43.276 19.007  29.797 1.00 60.31 ? 296 HOH A O   1 
HETATM 861 O  O   . HOH D 3 .   ? 55.296 4.311   31.803 1.00 70.62 ? 297 HOH A O   1 
HETATM 862 O  O   . HOH D 3 .   ? 33.917 -0.599  9.173  1.00 63.27 ? 298 HOH A O   1 
HETATM 863 O  O   . HOH D 3 .   ? 43.313 13.035  12.443 1.00 65.73 ? 299 HOH A O   1 
HETATM 864 O  O   . HOH D 3 .   ? 38.658 23.356  15.025 1.00 62.90 ? 300 HOH A O   1 
HETATM 865 O  O   . HOH D 3 .   ? 24.233 21.715  10.603 1.00 70.88 ? 301 HOH A O   1 
HETATM 866 O  O   . HOH D 3 .   ? 38.898 -10.469 14.747 1.00 58.14 ? 302 HOH A O   1 
HETATM 867 O  O   . HOH D 3 .   ? 42.763 7.856   32.025 1.00 66.33 ? 303 HOH A O   1 
HETATM 868 O  O   . HOH D 3 .   ? 39.046 -3.427  13.457 1.00 67.28 ? 304 HOH A O   1 
HETATM 869 O  O   . HOH D 3 .   ? 50.113 16.366  29.725 1.00 58.95 ? 305 HOH A O   1 
HETATM 870 O  O   . HOH D 3 .   ? 22.192 2.845   23.595 1.00 60.94 ? 306 HOH A O   1 
HETATM 871 O  O   . HOH D 3 .   ? 45.237 14.649  30.769 1.00 56.17 ? 307 HOH A O   1 
HETATM 872 O  O   . HOH D 3 .   ? 31.211 3.405   31.426 1.00 60.80 ? 308 HOH A O   1 
HETATM 873 O  O   . HOH D 3 .   ? 31.498 18.134  32.906 1.00 72.96 ? 309 HOH A O   1 
HETATM 874 O  O   . HOH D 3 .   ? 35.114 21.411  33.501 1.00 64.82 ? 310 HOH A O   1 
HETATM 875 O  O   . HOH D 3 .   ? 33.097 12.725  31.283 1.00 60.18 ? 311 HOH A O   1 
HETATM 876 O  O   . HOH D 3 .   ? 56.540 12.155  23.940 1.00 69.40 ? 312 HOH A O   1 
HETATM 877 O  O   . HOH D 3 .   ? 36.677 -9.352  19.602 1.00 74.69 ? 313 HOH A O   1 
HETATM 878 O  O   . HOH D 3 .   ? 58.933 -4.672  27.834 1.00 57.26 ? 314 HOH A O   1 
HETATM 879 O  O   . HOH D 3 .   ? 39.618 25.740  17.296 1.00 61.57 ? 315 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   GLN 2   2   ?   ?   ?   A . n 
A 1 3   ALA 3   3   ?   ?   ?   A . n 
A 1 4   TYR 4   4   ?   ?   ?   A . n 
A 1 5   SER 5   5   ?   ?   ?   A . n 
A 1 6   ASN 6   6   ?   ?   ?   A . n 
A 1 7   PRO 7   7   ?   ?   ?   A . n 
A 1 8   GLY 8   8   ?   ?   ?   A . n 
A 1 9   TYR 9   9   ?   ?   ?   A . n 
A 1 10  SER 10  10  ?   ?   ?   A . n 
A 1 11  SER 11  11  ?   ?   ?   A . n 
A 1 12  PHE 12  12  ?   ?   ?   A . n 
A 1 13  PRO 13  13  ?   ?   ?   A . n 
A 1 14  SER 14  14  ?   ?   ?   A . n 
A 1 15  PRO 15  15  ?   ?   ?   A . n 
A 1 16  THR 16  16  ?   ?   ?   A . n 
A 1 17  GLY 17  17  ?   ?   ?   A . n 
A 1 18  LEU 18  18  ?   ?   ?   A . n 
A 1 19  GLU 19  19  ?   ?   ?   A . n 
A 1 20  PRO 20  20  20  PRO PRO A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  CYS 22  22  22  CYS CYS A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  CYS 25  25  25  CYS CYS A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  HIS 28  28  28  HIS HIS A . n 
A 1 29  PHE 29  29  29  PHE PHE A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  ASN 31  31  31  ASN ASN A . n 
A 1 32  THR 32  32  32  THR THR A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  ARG 34  34  34  ARG ARG A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  GLN 36  36  36  GLN GLN A . n 
A 1 37  THR 37  37  37  THR THR A . n 
A 1 38  CYS 38  38  38  CYS CYS A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  CYS 41  41  41  CYS CYS A . n 
A 1 42  LYS 42  42  42  LYS LYS A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  ASN 44  44  44  ASN ASN A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  CYS 46  46  46  CYS CYS A . n 
A 1 47  MET 47  47  47  MET MET A . n 
A 1 48  THR 48  48  48  THR THR A . n 
A 1 49  CYS 49  49  49  CYS CYS A . n 
A 1 50  SER 50  50  50  SER SER A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  GLN 52  52  52  GLN GLN A . n 
A 1 53  VAL 53  53  ?   ?   ?   A . n 
A 1 54  GLY 54  54  ?   ?   ?   A . n 
A 1 55  ASN 55  55  ?   ?   ?   A . n 
A 1 56  GLY 56  56  ?   ?   ?   A . n 
A 1 57  PRO 57  57  57  PRO PRO A . n 
A 1 58  ARG 58  58  58  ARG ARG A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  CYS 60  60  60  CYS CYS A . n 
A 1 61  LEU 61  61  61  LEU LEU A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  CYS 63  63  63  CYS CYS A . n 
A 1 64  GLN 64  64  64  GLN GLN A . n 
A 1 65  ARG 65  65  65  ARG ARG A . n 
A 1 66  PHE 66  66  66  PHE PHE A . n 
A 1 67  ARG 67  67  67  ARG ARG A . n 
A 1 68  ALA 68  68  68  ALA ALA A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  PHE 71  71  71  PHE PHE A . n 
A 1 72  GLN 72  72  72  GLN GLN A . n 
A 1 73  ARG 73  73  73  ARG ARG A . n 
A 1 74  GLU 74  74  74  GLU GLU A . n 
A 1 75  GLU 75  75  75  GLU GLU A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  MET 77  77  77  MET MET A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  MET 79  79  79  MET MET A . n 
A 1 80  LYS 80  80  80  LYS LYS A . n 
A 1 81  VAL 81  81  81  VAL VAL A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  ASP 83  83  83  ASP ASP A . n 
A 1 84  LEU 84  84  84  LEU LEU A . n 
A 1 85  ARG 85  85  85  ARG ARG A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  TYR 87  87  87  TYR TYR A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  HIS 91  91  91  HIS HIS A . n 
A 1 92  ASP 92  92  92  ASP ASP A . n 
A 1 93  ILE 93  93  93  ILE ILE A . n 
A 1 94  SER 94  94  94  SER SER A . n 
A 1 95  THR 95  95  95  THR THR A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  MET 97  97  97  MET MET A . n 
A 1 98  CYS 98  98  98  CYS CYS A . n 
A 1 99  ARG 99  99  99  ARG ARG A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 GLU 102 102 102 GLU GLU A . n 
A 1 103 GLU 103 103 103 GLU GLU A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 VAL 105 105 105 VAL VAL A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 GLN 111 111 111 GLN GLN A . n 
A 1 112 GLN 112 112 112 GLN GLN A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 ILE 115 115 ?   ?   ?   A . n 
A 1 116 SER 116 116 ?   ?   ?   A . n 
A 1 117 GLN 117 117 ?   ?   ?   A . n 
A 1 118 GLU 118 118 ?   ?   ?   A . n 
A 1 119 ASP 119 119 ?   ?   ?   A . n 
A 1 120 ARG 120 120 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG ? A CYS 38 ? A CYS 38 ? 1_555 ZN ? B ZN . ? A ZN 161 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 104.4 ? 
2  SG ? A CYS 38 ? A CYS 38 ? 1_555 ZN ? B ZN . ? A ZN 161 ? 1_555 SG ? A CYS 60 ? A CYS 60 ? 1_555 110.6 ? 
3  SG ? A CYS 41 ? A CYS 41 ? 1_555 ZN ? B ZN . ? A ZN 161 ? 1_555 SG ? A CYS 60 ? A CYS 60 ? 1_555 120.1 ? 
4  SG ? A CYS 38 ? A CYS 38 ? 1_555 ZN ? B ZN . ? A ZN 161 ? 1_555 SG ? A CYS 63 ? A CYS 63 ? 1_555 106.6 ? 
5  SG ? A CYS 41 ? A CYS 41 ? 1_555 ZN ? B ZN . ? A ZN 161 ? 1_555 SG ? A CYS 63 ? A CYS 63 ? 1_555 116.3 ? 
6  SG ? A CYS 60 ? A CYS 60 ? 1_555 ZN ? B ZN . ? A ZN 161 ? 1_555 SG ? A CYS 63 ? A CYS 63 ? 1_555 98.3  ? 
7  SG ? A CYS 22 ? A CYS 22 ? 1_555 ZN ? C ZN . ? A ZN 162 ? 1_555 SG ? A CYS 49 ? A CYS 49 ? 1_555 110.1 ? 
8  SG ? A CYS 22 ? A CYS 22 ? 1_555 ZN ? C ZN . ? A ZN 162 ? 1_555 SG ? A CYS 46 ? A CYS 46 ? 1_555 105.1 ? 
9  SG ? A CYS 49 ? A CYS 49 ? 1_555 ZN ? C ZN . ? A ZN 162 ? 1_555 SG ? A CYS 46 ? A CYS 46 ? 1_555 118.9 ? 
10 SG ? A CYS 22 ? A CYS 22 ? 1_555 ZN ? C ZN . ? A ZN 162 ? 1_555 SG ? A CYS 25 ? A CYS 25 ? 1_555 109.3 ? 
11 SG ? A CYS 49 ? A CYS 49 ? 1_555 ZN ? C ZN . ? A ZN 162 ? 1_555 SG ? A CYS 25 ? A CYS 25 ? 1_555 115.7 ? 
12 SG ? A CYS 46 ? A CYS 46 ? 1_555 ZN ? C ZN . ? A ZN 162 ? 1_555 SG ? A CYS 25 ? A CYS 25 ? 1_555 96.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-12-28 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' . ? 1 
SCALEPACK 'data scaling'    . ? 2 
SOLVE     phasing           . ? 3 
CNS       refinement        . ? 4 
HKL-2000  'data reduction'  . ? 5 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            C 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            SER 
_pdbx_validate_rmsd_bond.auth_seq_id_1             51 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            N 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            GLN 
_pdbx_validate_rmsd_bond.auth_seq_id_2             52 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.509 
_pdbx_validate_rmsd_bond.bond_target_value         1.336 
_pdbx_validate_rmsd_bond.bond_deviation            0.173 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.023 
_pdbx_validate_rmsd_bond.linker_flag               Y 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A GLN 2   ? A GLN 2   
3  1 Y 1 A ALA 3   ? A ALA 3   
4  1 Y 1 A TYR 4   ? A TYR 4   
5  1 Y 1 A SER 5   ? A SER 5   
6  1 Y 1 A ASN 6   ? A ASN 6   
7  1 Y 1 A PRO 7   ? A PRO 7   
8  1 Y 1 A GLY 8   ? A GLY 8   
9  1 Y 1 A TYR 9   ? A TYR 9   
10 1 Y 1 A SER 10  ? A SER 10  
11 1 Y 1 A SER 11  ? A SER 11  
12 1 Y 1 A PHE 12  ? A PHE 12  
13 1 Y 1 A PRO 13  ? A PRO 13  
14 1 Y 1 A SER 14  ? A SER 14  
15 1 Y 1 A PRO 15  ? A PRO 15  
16 1 Y 1 A THR 16  ? A THR 16  
17 1 Y 1 A GLY 17  ? A GLY 17  
18 1 Y 1 A LEU 18  ? A LEU 18  
19 1 Y 1 A GLU 19  ? A GLU 19  
20 1 Y 1 A VAL 53  ? A VAL 53  
21 1 Y 1 A GLY 54  ? A GLY 54  
22 1 Y 1 A ASN 55  ? A ASN 55  
23 1 Y 1 A GLY 56  ? A GLY 56  
24 1 Y 1 A ILE 115 ? A ILE 115 
25 1 Y 1 A SER 116 ? A SER 116 
26 1 Y 1 A GLN 117 ? A GLN 117 
27 1 Y 1 A GLU 118 ? A GLU 118 
28 1 Y 1 A ASP 119 ? A ASP 119 
29 1 Y 1 A ARG 120 ? A ARG 120 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION' ZN  
3 water      HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN  1   161 1   ZN  ZN  A . 
C 2 ZN  1   162 2   ZN  ZN  A . 
D 3 HOH 1   163 1   HOH TIP A . 
D 3 HOH 2   164 2   HOH TIP A . 
D 3 HOH 3   165 3   HOH TIP A . 
D 3 HOH 4   166 4   HOH TIP A . 
D 3 HOH 5   167 5   HOH TIP A . 
D 3 HOH 6   168 6   HOH TIP A . 
D 3 HOH 7   169 7   HOH TIP A . 
D 3 HOH 8   170 8   HOH TIP A . 
D 3 HOH 9   171 9   HOH TIP A . 
D 3 HOH 10  172 10  HOH TIP A . 
D 3 HOH 11  173 11  HOH TIP A . 
D 3 HOH 12  174 12  HOH TIP A . 
D 3 HOH 13  175 13  HOH TIP A . 
D 3 HOH 14  176 14  HOH TIP A . 
D 3 HOH 15  177 15  HOH TIP A . 
D 3 HOH 16  178 16  HOH TIP A . 
D 3 HOH 17  179 17  HOH TIP A . 
D 3 HOH 18  180 18  HOH TIP A . 
D 3 HOH 19  181 19  HOH TIP A . 
D 3 HOH 20  182 20  HOH TIP A . 
D 3 HOH 21  183 21  HOH TIP A . 
D 3 HOH 22  184 22  HOH TIP A . 
D 3 HOH 23  185 23  HOH TIP A . 
D 3 HOH 24  186 24  HOH TIP A . 
D 3 HOH 25  187 25  HOH TIP A . 
D 3 HOH 26  188 26  HOH TIP A . 
D 3 HOH 27  189 27  HOH TIP A . 
D 3 HOH 28  190 28  HOH TIP A . 
D 3 HOH 29  191 29  HOH TIP A . 
D 3 HOH 30  192 30  HOH TIP A . 
D 3 HOH 31  193 31  HOH TIP A . 
D 3 HOH 32  194 32  HOH TIP A . 
D 3 HOH 33  195 33  HOH TIP A . 
D 3 HOH 34  196 34  HOH TIP A . 
D 3 HOH 35  197 35  HOH TIP A . 
D 3 HOH 36  198 36  HOH TIP A . 
D 3 HOH 37  199 37  HOH TIP A . 
D 3 HOH 38  200 38  HOH TIP A . 
D 3 HOH 39  201 39  HOH TIP A . 
D 3 HOH 40  202 40  HOH TIP A . 
D 3 HOH 41  203 41  HOH TIP A . 
D 3 HOH 42  204 42  HOH TIP A . 
D 3 HOH 43  205 43  HOH TIP A . 
D 3 HOH 44  206 44  HOH TIP A . 
D 3 HOH 45  207 45  HOH TIP A . 
D 3 HOH 46  208 46  HOH TIP A . 
D 3 HOH 47  209 47  HOH TIP A . 
D 3 HOH 48  210 48  HOH TIP A . 
D 3 HOH 49  211 49  HOH TIP A . 
D 3 HOH 50  212 50  HOH TIP A . 
D 3 HOH 51  213 51  HOH TIP A . 
D 3 HOH 52  214 52  HOH TIP A . 
D 3 HOH 53  215 53  HOH TIP A . 
D 3 HOH 54  216 54  HOH TIP A . 
D 3 HOH 55  217 55  HOH TIP A . 
D 3 HOH 56  218 56  HOH TIP A . 
D 3 HOH 57  219 57  HOH TIP A . 
D 3 HOH 58  220 58  HOH TIP A . 
D 3 HOH 59  221 59  HOH TIP A . 
D 3 HOH 60  222 60  HOH TIP A . 
D 3 HOH 61  223 61  HOH TIP A . 
D 3 HOH 62  224 62  HOH TIP A . 
D 3 HOH 63  225 63  HOH TIP A . 
D 3 HOH 64  226 64  HOH TIP A . 
D 3 HOH 65  227 65  HOH TIP A . 
D 3 HOH 66  228 66  HOH TIP A . 
D 3 HOH 67  229 67  HOH TIP A . 
D 3 HOH 68  230 68  HOH TIP A . 
D 3 HOH 69  231 69  HOH TIP A . 
D 3 HOH 70  232 70  HOH TIP A . 
D 3 HOH 71  233 71  HOH TIP A . 
D 3 HOH 72  234 72  HOH TIP A . 
D 3 HOH 73  235 73  HOH TIP A . 
D 3 HOH 74  236 74  HOH TIP A . 
D 3 HOH 75  237 75  HOH TIP A . 
D 3 HOH 76  238 76  HOH TIP A . 
D 3 HOH 77  239 77  HOH TIP A . 
D 3 HOH 78  240 78  HOH TIP A . 
D 3 HOH 79  241 79  HOH TIP A . 
D 3 HOH 80  242 80  HOH TIP A . 
D 3 HOH 81  243 81  HOH TIP A . 
D 3 HOH 82  244 82  HOH TIP A . 
D 3 HOH 83  245 83  HOH TIP A . 
D 3 HOH 84  246 84  HOH TIP A . 
D 3 HOH 85  247 85  HOH TIP A . 
D 3 HOH 86  248 86  HOH TIP A . 
D 3 HOH 87  249 87  HOH TIP A . 
D 3 HOH 88  250 88  HOH TIP A . 
D 3 HOH 89  251 89  HOH TIP A . 
D 3 HOH 90  252 90  HOH TIP A . 
D 3 HOH 91  253 91  HOH TIP A . 
D 3 HOH 92  254 92  HOH TIP A . 
D 3 HOH 93  255 93  HOH TIP A . 
D 3 HOH 94  256 94  HOH TIP A . 
D 3 HOH 95  257 95  HOH TIP A . 
D 3 HOH 96  258 96  HOH TIP A . 
D 3 HOH 97  259 97  HOH TIP A . 
D 3 HOH 98  260 98  HOH TIP A . 
D 3 HOH 99  261 99  HOH TIP A . 
D 3 HOH 100 262 100 HOH TIP A . 
D 3 HOH 101 263 101 HOH TIP A . 
D 3 HOH 102 264 102 HOH TIP A . 
D 3 HOH 103 265 103 HOH TIP A . 
D 3 HOH 104 266 104 HOH TIP A . 
D 3 HOH 105 267 105 HOH TIP A . 
D 3 HOH 106 268 106 HOH TIP A . 
D 3 HOH 107 269 107 HOH TIP A . 
D 3 HOH 108 270 108 HOH TIP A . 
D 3 HOH 109 271 109 HOH TIP A . 
D 3 HOH 110 272 110 HOH TIP A . 
D 3 HOH 111 273 111 HOH TIP A . 
D 3 HOH 112 274 112 HOH TIP A . 
D 3 HOH 113 275 113 HOH TIP A . 
D 3 HOH 114 276 114 HOH TIP A . 
D 3 HOH 115 277 115 HOH TIP A . 
D 3 HOH 116 278 116 HOH TIP A . 
D 3 HOH 117 279 117 HOH TIP A . 
D 3 HOH 118 280 118 HOH TIP A . 
D 3 HOH 119 281 119 HOH TIP A . 
D 3 HOH 120 282 120 HOH TIP A . 
D 3 HOH 121 283 121 HOH TIP A . 
D 3 HOH 122 284 122 HOH TIP A . 
D 3 HOH 123 285 123 HOH TIP A . 
D 3 HOH 124 286 124 HOH TIP A . 
D 3 HOH 125 287 125 HOH TIP A . 
D 3 HOH 126 288 126 HOH TIP A . 
D 3 HOH 127 289 127 HOH TIP A . 
D 3 HOH 128 290 128 HOH TIP A . 
D 3 HOH 129 291 129 HOH TIP A . 
D 3 HOH 130 292 130 HOH TIP A . 
D 3 HOH 131 293 131 HOH TIP A . 
D 3 HOH 132 294 132 HOH TIP A . 
D 3 HOH 133 295 133 HOH TIP A . 
D 3 HOH 134 296 134 HOH TIP A . 
D 3 HOH 135 297 135 HOH TIP A . 
D 3 HOH 136 298 136 HOH TIP A . 
D 3 HOH 137 299 137 HOH TIP A . 
D 3 HOH 138 300 138 HOH TIP A . 
D 3 HOH 139 301 139 HOH TIP A . 
D 3 HOH 140 302 140 HOH TIP A . 
D 3 HOH 141 303 141 HOH TIP A . 
D 3 HOH 142 304 142 HOH TIP A . 
D 3 HOH 143 305 143 HOH TIP A . 
D 3 HOH 144 306 144 HOH TIP A . 
D 3 HOH 145 307 145 HOH TIP A . 
D 3 HOH 146 308 146 HOH TIP A . 
D 3 HOH 147 309 147 HOH TIP A . 
D 3 HOH 148 310 148 HOH TIP A . 
D 3 HOH 149 311 149 HOH TIP A . 
D 3 HOH 150 312 150 HOH TIP A . 
D 3 HOH 151 313 151 HOH TIP A . 
D 3 HOH 152 314 152 HOH TIP A . 
D 3 HOH 153 315 153 HOH TIP A . 
#