data_1Y0S
# 
_entry.id   1Y0S 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1Y0S         
RCSB  RCSB030971   
WWPDB D_1000030971 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1Y0S 
_pdbx_database_status.recvd_initial_deposition_date   2004-11-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Takada, I.'    1 
'Yu, R.T.'      2 
'Xu, H.E.'      3 
'Xu, R.X.'      4 
'Lambert, M.H.' 5 
'Montana, V.G.' 6 
'Kliewer, S.A.' 7 
'Evans, R.M.'   8 
'Umesono, K.'   9 
# 
_citation.id                        primary 
_citation.title                     
'Alteration of a Single Amino Acid in Peroxisome Proliferator-Activated Receptor-alpha (PPARalpha) Generates a PPAR delta Phenotype' 
_citation.journal_abbrev            MOL.ENDOCRINOL. 
_citation.journal_volume            14 
_citation.page_first                733 
_citation.page_last                 740 
_citation.year                      2000 
_citation.journal_id_ASTM           MOENEN 
_citation.country                   US 
_citation.journal_id_ISSN           0888-8809 
_citation.journal_id_CSD            2068 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10809235 
_citation.pdbx_database_id_DOI      10.1210/me.14.5.733 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Takada, I.'    1 
primary 'Yu, R.T.'      2 
primary 'Xu, H.E.'      3 
primary 'Lambert, M.H.' 4 
primary 'Montana, V.G.' 5 
primary 'Kliewer, S.A.' 6 
primary 'Evans, R.M.'   7 
primary 'Umesono, K.'   8 
# 
_cell.entry_id           1Y0S 
_cell.length_a           39.356 
_cell.length_b           94.523 
_cell.length_c           96.492 
_cell.angle_alpha        90.00 
_cell.angle_beta         97.92 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1Y0S 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Peroxisome proliferator activated receptor delta'                                        31114.178 2   ? ? 
'LBD domain (residues 170-441)' ? 
2 non-polymer syn 'IODIDE ION'                                                                              126.904   11  ? ? ? ? 
3 non-polymer syn '(2S)-2-(4-[2-(3-[2,4-DIFLUOROPHENYL]-1-HEPTYLUREIDO)ETHYL]PHENOXY)-2-METHYLBUTYRIC ACID' 490.583   2   ? ? ? ? 
4 non-polymer syn HEPTYL-BETA-D-GLUCOPYRANOSIDE                                                             278.342   2   ? ? ? ? 
5 water       nat water                                                                                     18.015    162 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PPAR-delta, PPAR-beta, Nuclear hormone receptor 1, NUC1, NUCI' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRC
QCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIE
PKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQL
VTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRC
QCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIE
PKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQL
VTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   GLN n 
1 3   VAL n 
1 4   ALA n 
1 5   ASP n 
1 6   LEU n 
1 7   LYS n 
1 8   ALA n 
1 9   PHE n 
1 10  SER n 
1 11  LYS n 
1 12  HIS n 
1 13  ILE n 
1 14  TYR n 
1 15  ASN n 
1 16  ALA n 
1 17  TYR n 
1 18  LEU n 
1 19  LYS n 
1 20  ASN n 
1 21  PHE n 
1 22  ASN n 
1 23  MET n 
1 24  THR n 
1 25  LYS n 
1 26  LYS n 
1 27  LYS n 
1 28  ALA n 
1 29  ARG n 
1 30  SER n 
1 31  ILE n 
1 32  LEU n 
1 33  THR n 
1 34  GLY n 
1 35  LYS n 
1 36  ALA n 
1 37  SER n 
1 38  HIS n 
1 39  THR n 
1 40  ALA n 
1 41  PRO n 
1 42  PHE n 
1 43  VAL n 
1 44  ILE n 
1 45  HIS n 
1 46  ASP n 
1 47  ILE n 
1 48  GLU n 
1 49  THR n 
1 50  LEU n 
1 51  TRP n 
1 52  GLN n 
1 53  ALA n 
1 54  GLU n 
1 55  LYS n 
1 56  GLY n 
1 57  LEU n 
1 58  VAL n 
1 59  TRP n 
1 60  LYS n 
1 61  GLN n 
1 62  LEU n 
1 63  VAL n 
1 64  ASN n 
1 65  GLY n 
1 66  LEU n 
1 67  PRO n 
1 68  PRO n 
1 69  TYR n 
1 70  LYS n 
1 71  GLU n 
1 72  ILE n 
1 73  SER n 
1 74  VAL n 
1 75  HIS n 
1 76  VAL n 
1 77  PHE n 
1 78  TYR n 
1 79  ARG n 
1 80  CYS n 
1 81  GLN n 
1 82  CYS n 
1 83  THR n 
1 84  THR n 
1 85  VAL n 
1 86  GLU n 
1 87  THR n 
1 88  VAL n 
1 89  ARG n 
1 90  GLU n 
1 91  LEU n 
1 92  THR n 
1 93  GLU n 
1 94  PHE n 
1 95  ALA n 
1 96  LYS n 
1 97  SER n 
1 98  ILE n 
1 99  PRO n 
1 100 SER n 
1 101 PHE n 
1 102 SER n 
1 103 SER n 
1 104 LEU n 
1 105 PHE n 
1 106 LEU n 
1 107 ASN n 
1 108 ASP n 
1 109 GLN n 
1 110 VAL n 
1 111 THR n 
1 112 LEU n 
1 113 LEU n 
1 114 LYS n 
1 115 TYR n 
1 116 GLY n 
1 117 VAL n 
1 118 HIS n 
1 119 GLU n 
1 120 ALA n 
1 121 ILE n 
1 122 PHE n 
1 123 ALA n 
1 124 MET n 
1 125 LEU n 
1 126 ALA n 
1 127 SER n 
1 128 ILE n 
1 129 VAL n 
1 130 ASN n 
1 131 LYS n 
1 132 ASP n 
1 133 GLY n 
1 134 LEU n 
1 135 LEU n 
1 136 VAL n 
1 137 ALA n 
1 138 ASN n 
1 139 GLY n 
1 140 SER n 
1 141 GLY n 
1 142 PHE n 
1 143 VAL n 
1 144 THR n 
1 145 ARG n 
1 146 GLU n 
1 147 PHE n 
1 148 LEU n 
1 149 ARG n 
1 150 SER n 
1 151 LEU n 
1 152 ARG n 
1 153 LYS n 
1 154 PRO n 
1 155 PHE n 
1 156 SER n 
1 157 ASP n 
1 158 ILE n 
1 159 ILE n 
1 160 GLU n 
1 161 PRO n 
1 162 LYS n 
1 163 PHE n 
1 164 GLU n 
1 165 PHE n 
1 166 ALA n 
1 167 VAL n 
1 168 LYS n 
1 169 PHE n 
1 170 ASN n 
1 171 ALA n 
1 172 LEU n 
1 173 GLU n 
1 174 LEU n 
1 175 ASP n 
1 176 ASP n 
1 177 SER n 
1 178 ASP n 
1 179 LEU n 
1 180 ALA n 
1 181 LEU n 
1 182 PHE n 
1 183 ILE n 
1 184 ALA n 
1 185 ALA n 
1 186 ILE n 
1 187 ILE n 
1 188 LEU n 
1 189 CYS n 
1 190 GLY n 
1 191 ASP n 
1 192 ARG n 
1 193 PRO n 
1 194 GLY n 
1 195 LEU n 
1 196 MET n 
1 197 ASN n 
1 198 VAL n 
1 199 PRO n 
1 200 ARG n 
1 201 VAL n 
1 202 GLU n 
1 203 ALA n 
1 204 ILE n 
1 205 GLN n 
1 206 ASP n 
1 207 THR n 
1 208 ILE n 
1 209 LEU n 
1 210 ARG n 
1 211 ALA n 
1 212 LEU n 
1 213 GLU n 
1 214 PHE n 
1 215 HIS n 
1 216 LEU n 
1 217 GLN n 
1 218 ALA n 
1 219 ASN n 
1 220 HIS n 
1 221 PRO n 
1 222 ASP n 
1 223 ALA n 
1 224 GLN n 
1 225 TYR n 
1 226 LEU n 
1 227 PHE n 
1 228 PRO n 
1 229 LYS n 
1 230 LEU n 
1 231 LEU n 
1 232 GLN n 
1 233 LYS n 
1 234 MET n 
1 235 ALA n 
1 236 ASP n 
1 237 LEU n 
1 238 ARG n 
1 239 GLN n 
1 240 LEU n 
1 241 VAL n 
1 242 THR n 
1 243 GLU n 
1 244 HIS n 
1 245 ALA n 
1 246 GLN n 
1 247 MET n 
1 248 MET n 
1 249 GLN n 
1 250 ARG n 
1 251 ILE n 
1 252 LYS n 
1 253 LYS n 
1 254 THR n 
1 255 GLU n 
1 256 THR n 
1 257 GLU n 
1 258 THR n 
1 259 SER n 
1 260 LEU n 
1 261 HIS n 
1 262 PRO n 
1 263 LEU n 
1 264 LEU n 
1 265 GLN n 
1 266 GLU n 
1 267 ILE n 
1 268 TYR n 
1 269 LYS n 
1 270 ASP n 
1 271 MET n 
1 272 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               B21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PPAS_HUMAN 
_struct_ref.pdbx_db_accession          Q03181 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRC
QCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIE
PKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQL
VTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
;
_struct_ref.pdbx_align_begin           170 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1Y0S A 1 ? 272 ? Q03181 170 ? 441 ? 206 477 
2 1 1Y0S B 1 ? 272 ? Q03181 170 ? 441 ? 206 477 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
331 non-polymer         . '(2S)-2-(4-[2-(3-[2,4-DIFLUOROPHENYL]-1-HEPTYLUREIDO)ETHYL]PHENOXY)-2-METHYLBUTYRIC ACID' GW2331 
'C27 H36 F2 N2 O4' 490.583 
ALA 'L-peptide linking' y ALANINE                                                                                   ?      
'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                                                                  ?      
'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                ?      
'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                           ?      
'C4 H7 N O4'       133.103 
B7G non-polymer         . HEPTYL-BETA-D-GLUCOPYRANOSIDE                                                             ?      
'C13 H26 O6'       278.342 
CYS 'L-peptide linking' y CYSTEINE                                                                                  ?      
'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                                 ?      
'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                           ?      
'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                                                                   ?      
'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                 ?      
'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                                                                     ?      'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                ?      
'C6 H13 N O2'      131.173 
IOD non-polymer         . 'IODIDE ION'                                                                              ?      'I -1' 
126.904 
LEU 'L-peptide linking' y LEUCINE                                                                                   ?      
'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                                                                    ?      
'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                                                                ?      
'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                             ?      
'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                                                                   ?      
'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                                                                    ?      
'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                                                                 ?      
'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                ?      
'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                  ?      
'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                                                                    ?      
'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1Y0S 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.5 
_exptl_crystal.density_percent_sol   55 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              9.0 
_exptl_crystal_grow.pdbx_details    'PEG 35K, KI, pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           180 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS II' 
_diffrn_detector.pdbx_collection_date   1997-11-07 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 channel' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54 
# 
_reflns.entry_id                     1Y0S 
_reflns.observed_criterion_sigma_F   2.6 
_reflns.observed_criterion_sigma_I   2.6 
_reflns.d_resolution_high            2.65 
_reflns.d_resolution_low             50 
_reflns.number_all                   20426 
_reflns.number_obs                   19351 
_reflns.percent_possible_obs         94.7 
_reflns.pdbx_Rmerge_I_obs            0.089 
_reflns.pdbx_Rsym_value              0.089 
_reflns.pdbx_netI_over_sigmaI        16 
_reflns.B_iso_Wilson_estimate        37.6 
_reflns.pdbx_redundancy              4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.65 
_reflns_shell.d_res_low              2.74 
_reflns_shell.percent_possible_all   97.2 
_reflns_shell.Rmerge_I_obs           0.413 
_reflns_shell.pdbx_Rsym_value        0.413 
_reflns_shell.meanI_over_sigI_obs    2.6 
_reflns_shell.pdbx_redundancy        4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1963 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1Y0S 
_refine.ls_d_res_high                            2.65 
_refine.ls_d_res_low                             50 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_number_reflns_all                     20462 
_refine.ls_number_reflns_obs                     19351 
_refine.ls_number_reflns_R_free                  1135 
_refine.ls_percent_reflns_obs                    94.7 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.21 
_refine.ls_R_factor_R_work                       0.21 
_refine.ls_R_factor_R_free                       0.261 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'pdb entry 2GWX' 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4101 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         189 
_refine_hist.number_atoms_solvent             162 
_refine_hist.number_atoms_total               4452 
_refine_hist.d_res_high                       2.65 
_refine_hist.d_res_low                        50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.013 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.464 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1Y0S 
_struct.title                     'Crystal structure of PPAR delta complexed with GW2331' 
_struct.pdbx_descriptor           'Peroxisome proliferator activated receptor delta' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1Y0S 
_struct_keywords.pdbx_keywords   'HORMONE/GROWTH FACTOR RECEPTOR' 
_struct_keywords.text            'PPAR, HORMONE-GROWTH FACTOR RECEPTOR COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 3 ? 
K N N 4 ? 
L N N 2 ? 
M N N 2 ? 
N N N 2 ? 
O N N 2 ? 
P N N 3 ? 
Q N N 4 ? 
R N N 5 ? 
S N N 5 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 1   ? PHE A 21  ? PRO A 206 PHE A 226 1 ? 21 
HELX_P HELX_P2  2  THR A 24  ? GLY A 34  ? THR A 229 GLY A 239 1 ? 11 
HELX_P HELX_P3  3  ASP A 46  ? GLY A 56  ? ASP A 251 GLY A 261 1 ? 11 
HELX_P HELX_P4  4  GLU A 71  ? SER A 97  ? GLU A 276 SER A 302 1 ? 27 
HELX_P HELX_P5  5  ILE A 98  ? LEU A 104 ? ILE A 303 LEU A 309 1 ? 7  
HELX_P HELX_P6  6  PHE A 105 ? ALA A 126 ? PHE A 310 ALA A 331 1 ? 22 
HELX_P HELX_P7  7  ARG A 145 ? SER A 150 ? ARG A 350 SER A 355 1 ? 6  
HELX_P HELX_P8  8  PRO A 154 ? ILE A 159 ? PRO A 359 ILE A 364 1 ? 6  
HELX_P HELX_P9  9  ILE A 159 ? ALA A 171 ? ILE A 364 ALA A 376 1 ? 13 
HELX_P HELX_P10 10 ASP A 175 ? LEU A 188 ? ASP A 380 LEU A 393 1 ? 14 
HELX_P HELX_P11 11 ASN A 197 ? HIS A 220 ? ASN A 402 HIS A 425 1 ? 24 
HELX_P HELX_P12 12 TYR A 225 ? GLU A 255 ? TYR A 430 GLU A 460 1 ? 31 
HELX_P HELX_P13 13 HIS A 261 ? ASP A 270 ? HIS A 466 ASP A 475 1 ? 10 
HELX_P HELX_P14 14 ASP B 5   ? PHE B 21  ? ASP B 210 PHE B 226 1 ? 17 
HELX_P HELX_P15 15 THR B 24  ? GLY B 34  ? THR B 229 GLY B 239 1 ? 11 
HELX_P HELX_P16 16 ASP B 46  ? GLY B 56  ? ASP B 251 GLY B 261 1 ? 11 
HELX_P HELX_P17 17 GLU B 71  ? SER B 97  ? GLU B 276 SER B 302 1 ? 27 
HELX_P HELX_P18 18 ILE B 98  ? SER B 103 ? ILE B 303 SER B 308 1 ? 6  
HELX_P HELX_P19 19 PHE B 105 ? ALA B 126 ? PHE B 310 ALA B 331 1 ? 22 
HELX_P HELX_P20 20 ALA B 137 ? GLY B 139 ? ALA B 342 GLY B 344 5 ? 3  
HELX_P HELX_P21 21 ARG B 145 ? SER B 150 ? ARG B 350 SER B 355 1 ? 6  
HELX_P HELX_P22 22 PHE B 155 ? ALA B 171 ? PHE B 360 ALA B 376 1 ? 17 
HELX_P HELX_P23 23 ASP B 175 ? LEU B 188 ? ASP B 380 LEU B 393 1 ? 14 
HELX_P HELX_P24 24 ASN B 197 ? HIS B 220 ? ASN B 402 HIS B 425 1 ? 24 
HELX_P HELX_P25 25 TYR B 225 ? GLU B 255 ? TYR B 430 GLU B 460 1 ? 31 
HELX_P HELX_P26 26 HIS B 261 ? LYS B 269 ? HIS B 466 LYS B 474 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 153 A . ? LYS 358 A PRO 154 A ? PRO 359 A 1 1.23 
2 LYS 153 B . ? LYS 358 B PRO 154 B ? PRO 359 B 1 0.94 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 42  ? ILE A 44  ? PHE A 247 ILE A 249 
A 2 GLY A 141 ? THR A 144 ? GLY A 346 THR A 349 
A 3 GLY A 133 ? VAL A 136 ? GLY A 338 VAL A 341 
A 4 VAL A 129 ? ASN A 130 ? VAL A 334 ASN A 335 
B 1 PHE B 42  ? ILE B 44  ? PHE B 247 ILE B 249 
B 2 GLY B 141 ? THR B 144 ? GLY B 346 THR B 349 
B 3 GLY B 133 ? VAL B 136 ? GLY B 338 VAL B 341 
B 4 VAL B 129 ? ASN B 130 ? VAL B 334 ASN B 335 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 44  ? N ILE A 249 O PHE A 142 ? O PHE A 347 
A 2 3 O VAL A 143 ? O VAL A 348 N LEU A 134 ? N LEU A 339 
A 3 4 O GLY A 133 ? O GLY A 338 N ASN A 130 ? N ASN A 335 
B 1 2 N ILE B 44  ? N ILE B 249 O THR B 144 ? O THR B 349 
B 2 3 O GLY B 141 ? O GLY B 346 N VAL B 136 ? N VAL B 341 
B 3 4 O GLY B 133 ? O GLY B 338 N ASN B 130 ? N ASN B 335 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE IOD A 203' 
AC2 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE IOD A 478' 
AC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE IOD A 479' 
AC4 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE IOD B 478' 
AC5 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE 331 A 482' 
AC6 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE 331 B 479' 
AC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE B7G A 483' 
AC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE B7G B 480' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 1  HOH R .   ? HOH A 71  . ? 1_555 ? 
2  AC2 1  THR A 83  ? THR A 288 . ? 1_555 ? 
3  AC3 1  ARG A 192 ? ARG A 397 . ? 1_555 ? 
4  AC4 1  ARG B 192 ? ARG B 397 . ? 1_555 ? 
5  AC5 17 HOH R .   ? HOH A 139 . ? 1_555 ? 
6  AC5 17 CYS A 80  ? CYS A 285 . ? 1_555 ? 
7  AC5 17 GLN A 81  ? GLN A 286 . ? 1_555 ? 
8  AC5 17 THR A 83  ? THR A 288 . ? 1_555 ? 
9  AC5 17 THR A 84  ? THR A 289 . ? 1_555 ? 
10 AC5 17 HIS A 118 ? HIS A 323 . ? 1_555 ? 
11 AC5 17 ILE A 121 ? ILE A 326 . ? 1_555 ? 
12 AC5 17 PHE A 122 ? PHE A 327 . ? 1_555 ? 
13 AC5 17 MET A 124 ? MET A 329 . ? 1_555 ? 
14 AC5 17 LEU A 125 ? LEU A 330 . ? 1_555 ? 
15 AC5 17 ILE A 128 ? ILE A 333 . ? 1_555 ? 
16 AC5 17 LEU A 134 ? LEU A 339 . ? 1_555 ? 
17 AC5 17 ILE A 158 ? ILE A 363 . ? 1_555 ? 
18 AC5 17 HIS A 244 ? HIS A 449 . ? 1_555 ? 
19 AC5 17 MET A 248 ? MET A 453 . ? 1_555 ? 
20 AC5 17 LEU A 264 ? LEU A 469 . ? 1_555 ? 
21 AC5 17 TYR A 268 ? TYR A 473 . ? 1_555 ? 
22 AC6 19 HOH S .   ? HOH B 105 . ? 1_555 ? 
23 AC6 19 TRP B 59  ? TRP B 264 . ? 1_555 ? 
24 AC6 19 CYS B 80  ? CYS B 285 . ? 1_555 ? 
25 AC6 19 GLN B 81  ? GLN B 286 . ? 1_555 ? 
26 AC6 19 THR B 83  ? THR B 288 . ? 1_555 ? 
27 AC6 19 THR B 84  ? THR B 289 . ? 1_555 ? 
28 AC6 19 HIS B 118 ? HIS B 323 . ? 1_555 ? 
29 AC6 19 ILE B 121 ? ILE B 326 . ? 1_555 ? 
30 AC6 19 PHE B 122 ? PHE B 327 . ? 1_555 ? 
31 AC6 19 MET B 124 ? MET B 329 . ? 1_555 ? 
32 AC6 19 LEU B 125 ? LEU B 330 . ? 1_555 ? 
33 AC6 19 ILE B 128 ? ILE B 333 . ? 1_555 ? 
34 AC6 19 LEU B 134 ? LEU B 339 . ? 1_555 ? 
35 AC6 19 VAL B 143 ? VAL B 348 . ? 1_555 ? 
36 AC6 19 ILE B 158 ? ILE B 363 . ? 1_555 ? 
37 AC6 19 HIS B 244 ? HIS B 449 . ? 1_555 ? 
38 AC6 19 MET B 248 ? MET B 453 . ? 1_555 ? 
39 AC6 19 LEU B 264 ? LEU B 469 . ? 1_555 ? 
40 AC6 19 TYR B 268 ? TYR B 473 . ? 1_555 ? 
41 AC7 5  HOH R .   ? HOH A 115 . ? 1_555 ? 
42 AC7 5  HOH R .   ? HOH A 120 . ? 1_555 ? 
43 AC7 5  LEU A 113 ? LEU A 318 . ? 1_555 ? 
44 AC7 5  GLU A 266 ? GLU A 471 . ? 1_555 ? 
45 AC7 5  LYS A 269 ? LYS A 474 . ? 1_555 ? 
46 AC8 5  HOH S .   ? HOH B 129 . ? 1_555 ? 
47 AC8 5  THR B 92  ? THR B 297 . ? 1_555 ? 
48 AC8 5  LYS B 114 ? LYS B 319 . ? 1_555 ? 
49 AC8 5  GLU B 266 ? GLU B 471 . ? 1_555 ? 
50 AC8 5  LYS B 269 ? LYS B 474 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1Y0S 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1Y0S 
_atom_sites.fract_transf_matrix[1][1]   0.025409 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003535 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010579 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010463 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
F 
H 
I 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 1   ? 6.736   8.075   91.883  1.00 88.06  ? 206 PRO A N   1 
ATOM   2    C CA  . PRO A 1 1   ? 7.511   9.174   92.509  1.00 88.38  ? 206 PRO A CA  1 
ATOM   3    C C   . PRO A 1 1   ? 8.691   9.449   91.618  1.00 88.63  ? 206 PRO A C   1 
ATOM   4    O O   . PRO A 1 1   ? 8.614   10.249  90.681  1.00 88.15  ? 206 PRO A O   1 
ATOM   5    C CB  . PRO A 1 1   ? 7.983   8.679   93.873  1.00 87.70  ? 206 PRO A CB  1 
ATOM   6    C CG  . PRO A 1 1   ? 7.113   7.430   94.086  1.00 87.82  ? 206 PRO A CG  1 
ATOM   7    C CD  . PRO A 1 1   ? 6.870   6.854   92.692  1.00 87.54  ? 206 PRO A CD  1 
ATOM   8    N N   . GLN A 1 2   ? 9.797   8.777   91.916  1.00 89.35  ? 207 GLN A N   1 
ATOM   9    C CA  . GLN A 1 2   ? 11.013  8.900   91.123  1.00 89.99  ? 207 GLN A CA  1 
ATOM   10   C C   . GLN A 1 2   ? 10.731  8.145   89.794  1.00 90.38  ? 207 GLN A C   1 
ATOM   11   O O   . GLN A 1 2   ? 10.749  8.738   88.715  1.00 90.80  ? 207 GLN A O   1 
ATOM   12   C CB  . GLN A 1 2   ? 12.198  8.264   91.872  1.00 89.31  ? 207 GLN A CB  1 
ATOM   13   C CG  . GLN A 1 2   ? 13.586  8.414   91.175  1.00 88.43  ? 207 GLN A CG  1 
ATOM   14   C CD  . GLN A 1 2   ? 14.735  7.894   92.028  1.00 87.29  ? 207 GLN A CD  1 
ATOM   15   O OE1 . GLN A 1 2   ? 14.988  8.398   93.120  1.00 86.81  ? 207 GLN A OE1 1 
ATOM   16   N NE2 . GLN A 1 2   ? 15.435  6.882   91.531  1.00 85.87  ? 207 GLN A NE2 1 
ATOM   17   N N   . VAL A 1 3   ? 10.434  6.850   89.910  1.00 90.68  ? 208 VAL A N   1 
ATOM   18   C CA  . VAL A 1 3   ? 10.138  5.984   88.764  1.00 90.24  ? 208 VAL A CA  1 
ATOM   19   C C   . VAL A 1 3   ? 8.949   6.484   87.865  1.00 89.71  ? 208 VAL A C   1 
ATOM   20   O O   . VAL A 1 3   ? 8.782   6.033   86.726  1.00 89.76  ? 208 VAL A O   1 
ATOM   21   C CB  . VAL A 1 3   ? 9.818   4.541   89.241  1.00 90.07  ? 208 VAL A CB  1 
ATOM   22   C CG1 . VAL A 1 3   ? 9.469   3.655   88.053  1.00 90.45  ? 208 VAL A CG1 1 
ATOM   23   C CG2 . VAL A 1 3   ? 11.011  3.968   89.993  1.00 90.00  ? 208 VAL A CG2 1 
ATOM   24   N N   . ALA A 1 4   ? 8.148   7.404   88.393  1.00 88.25  ? 209 ALA A N   1 
ATOM   25   C CA  . ALA A 1 4   ? 7.016   7.939   87.651  1.00 86.09  ? 209 ALA A CA  1 
ATOM   26   C C   . ALA A 1 4   ? 7.402   9.221   86.909  1.00 84.24  ? 209 ALA A C   1 
ATOM   27   O O   . ALA A 1 4   ? 7.161   9.356   85.707  1.00 83.94  ? 209 ALA A O   1 
ATOM   28   C CB  . ALA A 1 4   ? 5.856   8.208   88.604  1.00 86.55  ? 209 ALA A CB  1 
ATOM   29   N N   . ASP A 1 5   ? 8.006   10.158  87.631  1.00 81.81  ? 210 ASP A N   1 
ATOM   30   C CA  . ASP A 1 5   ? 8.414   11.424  87.039  1.00 79.41  ? 210 ASP A CA  1 
ATOM   31   C C   . ASP A 1 5   ? 9.430   11.255  85.882  1.00 77.16  ? 210 ASP A C   1 
ATOM   32   O O   . ASP A 1 5   ? 9.423   12.031  84.925  1.00 75.88  ? 210 ASP A O   1 
ATOM   33   C CB  . ASP A 1 5   ? 9.014   12.326  88.113  1.00 80.63  ? 210 ASP A CB  1 
ATOM   34   C CG  . ASP A 1 5   ? 9.517   13.630  87.547  1.00 82.76  ? 210 ASP A CG  1 
ATOM   35   O OD1 . ASP A 1 5   ? 8.680   14.444  87.097  1.00 83.86  ? 210 ASP A OD1 1 
ATOM   36   O OD2 . ASP A 1 5   ? 10.751  13.835  87.540  1.00 83.61  ? 210 ASP A OD2 1 
ATOM   37   N N   . LEU A 1 6   ? 10.292  10.245  85.993  1.00 74.46  ? 211 LEU A N   1 
ATOM   38   C CA  . LEU A 1 6   ? 11.312  9.964   84.986  1.00 71.24  ? 211 LEU A CA  1 
ATOM   39   C C   . LEU A 1 6   ? 10.745  9.398   83.691  1.00 69.86  ? 211 LEU A C   1 
ATOM   40   O O   . LEU A 1 6   ? 11.340  9.560   82.628  1.00 69.67  ? 211 LEU A O   1 
ATOM   41   C CB  . LEU A 1 6   ? 12.355  9.003   85.554  1.00 70.35  ? 211 LEU A CB  1 
ATOM   42   C CG  . LEU A 1 6   ? 13.236  9.570   86.666  1.00 69.70  ? 211 LEU A CG  1 
ATOM   43   C CD1 . LEU A 1 6   ? 14.123  8.482   87.214  1.00 70.20  ? 211 LEU A CD1 1 
ATOM   44   C CD2 . LEU A 1 6   ? 14.072  10.715  86.127  1.00 70.80  ? 211 LEU A CD2 1 
ATOM   45   N N   . LYS A 1 7   ? 9.607   8.718   83.773  1.00 67.18  ? 212 LYS A N   1 
ATOM   46   C CA  . LYS A 1 7   ? 8.988   8.175   82.575  1.00 64.21  ? 212 LYS A CA  1 
ATOM   47   C C   . LYS A 1 7   ? 8.807   9.335   81.661  1.00 62.26  ? 212 LYS A C   1 
ATOM   48   O O   . LYS A 1 7   ? 9.213   9.298   80.504  1.00 61.99  ? 212 LYS A O   1 
ATOM   49   C CB  . LYS A 1 7   ? 7.641   7.546   82.908  1.00 63.63  ? 212 LYS A CB  1 
ATOM   50   N N   . ALA A 1 8   ? 8.195   10.390  82.185  1.00 59.97  ? 213 ALA A N   1 
ATOM   51   C CA  . ALA A 1 8   ? 7.961   11.601  81.418  1.00 58.62  ? 213 ALA A CA  1 
ATOM   52   C C   . ALA A 1 8   ? 9.243   12.043  80.762  1.00 57.83  ? 213 ALA A C   1 
ATOM   53   O O   . ALA A 1 8   ? 9.325   12.152  79.534  1.00 56.22  ? 213 ALA A O   1 
ATOM   54   C CB  . ALA A 1 8   ? 7.444   12.696  82.332  1.00 58.00  ? 213 ALA A CB  1 
ATOM   55   N N   . PHE A 1 9   ? 10.250  12.293  81.597  1.00 56.78  ? 214 PHE A N   1 
ATOM   56   C CA  . PHE A 1 9   ? 11.572  12.733  81.161  1.00 55.10  ? 214 PHE A CA  1 
ATOM   57   C C   . PHE A 1 9   ? 12.130  11.885  80.026  1.00 54.40  ? 214 PHE A C   1 
ATOM   58   O O   . PHE A 1 9   ? 12.739  12.407  79.094  1.00 54.71  ? 214 PHE A O   1 
ATOM   59   C CB  . PHE A 1 9   ? 12.529  12.709  82.357  1.00 54.68  ? 214 PHE A CB  1 
ATOM   60   C CG  . PHE A 1 9   ? 13.908  13.205  82.046  1.00 55.96  ? 214 PHE A CG  1 
ATOM   61   C CD1 . PHE A 1 9   ? 14.878  12.347  81.565  1.00 55.12  ? 214 PHE A CD1 1 
ATOM   62   C CD2 . PHE A 1 9   ? 14.233  14.539  82.226  1.00 57.16  ? 214 PHE A CD2 1 
ATOM   63   C CE1 . PHE A 1 9   ? 16.144  12.809  81.271  1.00 56.02  ? 214 PHE A CE1 1 
ATOM   64   C CE2 . PHE A 1 9   ? 15.502  15.006  81.931  1.00 57.14  ? 214 PHE A CE2 1 
ATOM   65   C CZ  . PHE A 1 9   ? 16.456  14.141  81.454  1.00 55.59  ? 214 PHE A CZ  1 
ATOM   66   N N   . SER A 1 10  ? 11.913  10.578  80.108  1.00 52.84  ? 215 SER A N   1 
ATOM   67   C CA  . SER A 1 10  ? 12.390  9.647   79.101  1.00 52.02  ? 215 SER A CA  1 
ATOM   68   C C   . SER A 1 10  ? 11.645  9.764   77.802  1.00 51.37  ? 215 SER A C   1 
ATOM   69   O O   . SER A 1 10  ? 12.249  9.792   76.734  1.00 52.45  ? 215 SER A O   1 
ATOM   70   C CB  . SER A 1 10  ? 12.284  8.218   79.629  1.00 53.12  ? 215 SER A CB  1 
ATOM   71   O OG  . SER A 1 10  ? 12.428  7.285   78.574  1.00 57.33  ? 215 SER A OG  1 
ATOM   72   N N   . LYS A 1 11  ? 10.322  9.817   77.871  1.00 51.11  ? 216 LYS A N   1 
ATOM   73   C CA  . LYS A 1 11  ? 9.523   9.940   76.661  1.00 49.45  ? 216 LYS A CA  1 
ATOM   74   C C   . LYS A 1 11  ? 9.899   11.230  75.939  1.00 48.43  ? 216 LYS A C   1 
ATOM   75   O O   . LYS A 1 11  ? 10.009  11.254  74.720  1.00 49.30  ? 216 LYS A O   1 
ATOM   76   C CB  . LYS A 1 11  ? 8.030   9.928   77.005  1.00 50.09  ? 216 LYS A CB  1 
ATOM   77   N N   . HIS A 1 12  ? 10.112  12.302  76.694  1.00 47.11  ? 217 HIS A N   1 
ATOM   78   C CA  . HIS A 1 12  ? 10.485  13.576  76.103  1.00 46.40  ? 217 HIS A CA  1 
ATOM   79   C C   . HIS A 1 12  ? 11.782  13.470  75.283  1.00 44.65  ? 217 HIS A C   1 
ATOM   80   O O   . HIS A 1 12  ? 11.888  14.054  74.207  1.00 44.32  ? 217 HIS A O   1 
ATOM   81   C CB  . HIS A 1 12  ? 10.654  14.629  77.194  1.00 50.74  ? 217 HIS A CB  1 
ATOM   82   C CG  . HIS A 1 12  ? 10.813  16.017  76.663  1.00 55.09  ? 217 HIS A CG  1 
ATOM   83   N ND1 . HIS A 1 12  ? 11.894  16.403  75.900  1.00 58.11  ? 217 HIS A ND1 1 
ATOM   84   C CD2 . HIS A 1 12  ? 9.993   17.094  76.727  1.00 58.04  ? 217 HIS A CD2 1 
ATOM   85   C CE1 . HIS A 1 12  ? 11.730  17.655  75.509  1.00 60.67  ? 217 HIS A CE1 1 
ATOM   86   N NE2 . HIS A 1 12  ? 10.584  18.098  75.997  1.00 61.02  ? 217 HIS A NE2 1 
ATOM   87   N N   . ILE A 1 13  ? 12.767  12.740  75.803  1.00 42.37  ? 218 ILE A N   1 
ATOM   88   C CA  . ILE A 1 13  ? 14.032  12.556  75.098  1.00 40.37  ? 218 ILE A CA  1 
ATOM   89   C C   . ILE A 1 13  ? 13.824  11.706  73.870  1.00 38.86  ? 218 ILE A C   1 
ATOM   90   O O   . ILE A 1 13  ? 14.420  11.956  72.823  1.00 35.55  ? 218 ILE A O   1 
ATOM   91   C CB  . ILE A 1 13  ? 15.087  11.878  75.990  1.00 40.33  ? 218 ILE A CB  1 
ATOM   92   C CG1 . ILE A 1 13  ? 15.415  12.784  77.174  1.00 40.61  ? 218 ILE A CG1 1 
ATOM   93   C CG2 . ILE A 1 13  ? 16.347  11.601  75.192  1.00 38.45  ? 218 ILE A CG2 1 
ATOM   94   C CD1 . ILE A 1 13  ? 16.505  12.228  78.083  1.00 41.57  ? 218 ILE A CD1 1 
ATOM   95   N N   . TYR A 1 14  ? 12.971  10.693  73.993  1.00 38.22  ? 219 TYR A N   1 
ATOM   96   C CA  . TYR A 1 14  ? 12.670  9.821   72.866  1.00 39.05  ? 219 TYR A CA  1 
ATOM   97   C C   . TYR A 1 14  ? 12.018  10.623  71.721  1.00 38.75  ? 219 TYR A C   1 
ATOM   98   O O   . TYR A 1 14  ? 12.258  10.345  70.538  1.00 37.09  ? 219 TYR A O   1 
ATOM   99   C CB  . TYR A 1 14  ? 11.739  8.687   73.296  1.00 38.47  ? 219 TYR A CB  1 
ATOM   100  C CG  . TYR A 1 14  ? 11.516  7.643   72.211  1.00 40.75  ? 219 TYR A CG  1 
ATOM   101  C CD1 . TYR A 1 14  ? 12.555  7.246   71.380  1.00 40.15  ? 219 TYR A CD1 1 
ATOM   102  C CD2 . TYR A 1 14  ? 10.276  7.035   72.039  1.00 40.56  ? 219 TYR A CD2 1 
ATOM   103  C CE1 . TYR A 1 14  ? 12.370  6.286   70.418  1.00 39.07  ? 219 TYR A CE1 1 
ATOM   104  C CE2 . TYR A 1 14  ? 10.086  6.068   71.075  1.00 40.14  ? 219 TYR A CE2 1 
ATOM   105  C CZ  . TYR A 1 14  ? 11.139  5.699   70.265  1.00 40.86  ? 219 TYR A CZ  1 
ATOM   106  O OH  . TYR A 1 14  ? 10.955  4.755   69.277  1.00 43.12  ? 219 TYR A OH  1 
ATOM   107  N N   . ASN A 1 15  ? 11.199  11.610  72.083  1.00 37.82  ? 220 ASN A N   1 
ATOM   108  C CA  . ASN A 1 15  ? 10.538  12.432  71.086  1.00 36.94  ? 220 ASN A CA  1 
ATOM   109  C C   . ASN A 1 15  ? 11.550  13.286  70.393  1.00 34.36  ? 220 ASN A C   1 
ATOM   110  O O   . ASN A 1 15  ? 11.475  13.466  69.181  1.00 34.12  ? 220 ASN A O   1 
ATOM   111  C CB  . ASN A 1 15  ? 9.426   13.299  71.713  1.00 40.84  ? 220 ASN A CB  1 
ATOM   112  C CG  . ASN A 1 15  ? 8.287   12.463  72.334  1.00 45.82  ? 220 ASN A CG  1 
ATOM   113  O OD1 . ASN A 1 15  ? 7.888   11.419  71.798  1.00 47.96  ? 220 ASN A OD1 1 
ATOM   114  N ND2 . ASN A 1 15  ? 7.750   12.937  73.460  1.00 46.84  ? 220 ASN A ND2 1 
ATOM   115  N N   . ALA A 1 16  ? 12.509  13.826  71.143  1.00 33.52  ? 221 ALA A N   1 
ATOM   116  C CA  . ALA A 1 16  ? 13.561  14.658  70.548  1.00 33.24  ? 221 ALA A CA  1 
ATOM   117  C C   . ALA A 1 16  ? 14.306  13.805  69.503  1.00 34.78  ? 221 ALA A C   1 
ATOM   118  O O   . ALA A 1 16  ? 14.577  14.250  68.383  1.00 34.20  ? 221 ALA A O   1 
ATOM   119  C CB  . ALA A 1 16  ? 14.526  15.126  71.622  1.00 33.79  ? 221 ALA A CB  1 
ATOM   120  N N   . TYR A 1 17  ? 14.610  12.572  69.899  1.00 33.82  ? 222 TYR A N   1 
ATOM   121  C CA  . TYR A 1 17  ? 15.288  11.592  69.069  1.00 34.37  ? 222 TYR A CA  1 
ATOM   122  C C   . TYR A 1 17  ? 14.503  11.261  67.749  1.00 36.08  ? 222 TYR A C   1 
ATOM   123  O O   . TYR A 1 17  ? 15.077  11.270  66.658  1.00 35.67  ? 222 TYR A O   1 
ATOM   124  C CB  . TYR A 1 17  ? 15.498  10.328  69.907  1.00 35.93  ? 222 TYR A CB  1 
ATOM   125  C CG  . TYR A 1 17  ? 16.146  9.158   69.207  1.00 35.73  ? 222 TYR A CG  1 
ATOM   126  C CD1 . TYR A 1 17  ? 15.401  8.303   68.399  1.00 35.44  ? 222 TYR A CD1 1 
ATOM   127  C CD2 . TYR A 1 17  ? 17.494  8.865   69.410  1.00 35.89  ? 222 TYR A CD2 1 
ATOM   128  C CE1 . TYR A 1 17  ? 15.975  7.177   67.822  1.00 36.14  ? 222 TYR A CE1 1 
ATOM   129  C CE2 . TYR A 1 17  ? 18.080  7.745   68.836  1.00 35.52  ? 222 TYR A CE2 1 
ATOM   130  C CZ  . TYR A 1 17  ? 17.312  6.901   68.051  1.00 36.54  ? 222 TYR A CZ  1 
ATOM   131  O OH  . TYR A 1 17  ? 17.863  5.748   67.545  1.00 37.49  ? 222 TYR A OH  1 
ATOM   132  N N   . LEU A 1 18  ? 13.211  10.962  67.877  1.00 36.85  ? 223 LEU A N   1 
ATOM   133  C CA  . LEU A 1 18  ? 12.365  10.645  66.725  1.00 35.37  ? 223 LEU A CA  1 
ATOM   134  C C   . LEU A 1 18  ? 12.235  11.872  65.838  1.00 36.21  ? 223 LEU A C   1 
ATOM   135  O O   . LEU A 1 18  ? 12.235  11.789  64.610  1.00 35.38  ? 223 LEU A O   1 
ATOM   136  C CB  . LEU A 1 18  ? 10.978  10.210  67.204  1.00 36.46  ? 223 LEU A CB  1 
ATOM   137  C CG  . LEU A 1 18  ? 10.598  8.735   67.451  1.00 37.29  ? 223 LEU A CG  1 
ATOM   138  C CD1 . LEU A 1 18  ? 11.827  7.841   67.556  1.00 37.15  ? 223 LEU A CD1 1 
ATOM   139  C CD2 . LEU A 1 18  ? 9.739   8.655   68.711  1.00 33.77  ? 223 LEU A CD2 1 
ATOM   140  N N   . LYS A 1 19  ? 12.134  13.024  66.477  1.00 36.17  ? 224 LYS A N   1 
ATOM   141  C CA  . LYS A 1 19  ? 12.006  14.284  65.780  1.00 37.74  ? 224 LYS A CA  1 
ATOM   142  C C   . LYS A 1 19  ? 13.263  14.737  65.030  1.00 39.38  ? 224 LYS A C   1 
ATOM   143  O O   . LYS A 1 19  ? 13.166  15.436  64.023  1.00 41.13  ? 224 LYS A O   1 
ATOM   144  C CB  . LYS A 1 19  ? 11.604  15.365  66.789  1.00 38.49  ? 224 LYS A CB  1 
ATOM   145  C CG  . LYS A 1 19  ? 11.718  16.788  66.269  1.00 41.75  ? 224 LYS A CG  1 
ATOM   146  C CD  . LYS A 1 19  ? 11.150  17.812  67.281  1.00 44.50  ? 224 LYS A CD  1 
ATOM   147  C CE  . LYS A 1 19  ? 11.100  19.249  66.658  1.00 45.70  ? 224 LYS A CE  1 
ATOM   148  N NZ  . LYS A 1 19  ? 10.710  20.319  67.631  1.00 46.67  ? 224 LYS A NZ  1 
ATOM   149  N N   . ASN A 1 20  ? 14.439  14.322  65.492  1.00 40.36  ? 225 ASN A N   1 
ATOM   150  C CA  . ASN A 1 20  ? 15.681  14.796  64.885  1.00 40.51  ? 225 ASN A CA  1 
ATOM   151  C C   . ASN A 1 20  ? 16.578  13.892  64.089  1.00 41.19  ? 225 ASN A C   1 
ATOM   152  O O   . ASN A 1 20  ? 17.292  14.357  63.198  1.00 42.65  ? 225 ASN A O   1 
ATOM   153  C CB  . ASN A 1 20  ? 16.535  15.463  65.970  1.00 39.57  ? 225 ASN A CB  1 
ATOM   154  C CG  . ASN A 1 20  ? 15.945  16.764  66.459  1.00 37.91  ? 225 ASN A CG  1 
ATOM   155  O OD1 . ASN A 1 20  ? 15.890  17.740  65.719  1.00 38.27  ? 225 ASN A OD1 1 
ATOM   156  N ND2 . ASN A 1 20  ? 15.496  16.786  67.711  1.00 36.26  ? 225 ASN A ND2 1 
ATOM   157  N N   . PHE A 1 21  ? 16.593  12.605  64.381  1.00 40.92  ? 226 PHE A N   1 
ATOM   158  C CA  . PHE A 1 21  ? 17.501  11.752  63.636  1.00 42.10  ? 226 PHE A CA  1 
ATOM   159  C C   . PHE A 1 21  ? 17.017  11.245  62.386  1.00 43.62  ? 226 PHE A C   1 
ATOM   160  O O   . PHE A 1 21  ? 15.896  10.765  62.276  1.00 43.22  ? 226 PHE A O   1 
ATOM   161  C CB  . PHE A 1 21  ? 18.008  10.634  64.531  1.00 40.46  ? 226 PHE A CB  1 
ATOM   162  C CG  . PHE A 1 21  ? 18.893  11.128  65.619  1.00 39.01  ? 226 PHE A CG  1 
ATOM   163  C CD1 . PHE A 1 21  ? 20.001  11.897  65.311  1.00 38.12  ? 226 PHE A CD1 1 
ATOM   164  C CD2 . PHE A 1 21  ? 18.596  10.880  66.942  1.00 38.88  ? 226 PHE A CD2 1 
ATOM   165  C CE1 . PHE A 1 21  ? 20.792  12.411  66.303  1.00 39.61  ? 226 PHE A CE1 1 
ATOM   166  C CE2 . PHE A 1 21  ? 19.382  11.392  67.943  1.00 39.96  ? 226 PHE A CE2 1 
ATOM   167  C CZ  . PHE A 1 21  ? 20.483  12.160  67.625  1.00 40.04  ? 226 PHE A CZ  1 
ATOM   168  N N   . ASN A 1 22  ? 17.876  11.350  61.384  1.00 46.61  ? 227 ASN A N   1 
ATOM   169  C CA  . ASN A 1 22  ? 17.561  10.925  60.036  1.00 48.75  ? 227 ASN A CA  1 
ATOM   170  C C   . ASN A 1 22  ? 17.205  9.520   59.902  1.00 48.87  ? 227 ASN A C   1 
ATOM   171  O O   . ASN A 1 22  ? 16.305  9.178   59.146  1.00 49.30  ? 227 ASN A O   1 
ATOM   172  C CB  . ASN A 1 22  ? 18.731  11.221  59.117  1.00 52.89  ? 227 ASN A CB  1 
ATOM   173  C CG  . ASN A 1 22  ? 18.430  10.869  57.687  1.00 58.93  ? 227 ASN A CG  1 
ATOM   174  O OD1 . ASN A 1 22  ? 17.446  11.359  57.119  1.00 61.83  ? 227 ASN A OD1 1 
ATOM   175  N ND2 . ASN A 1 22  ? 19.264  10.011  57.088  1.00 60.02  ? 227 ASN A ND2 1 
ATOM   176  N N   . MET A 1 23  ? 17.892  8.652   60.629  1.00 48.78  ? 228 MET A N   1 
ATOM   177  C CA  . MET A 1 23  ? 17.618  7.230   60.521  1.00 47.82  ? 228 MET A CA  1 
ATOM   178  C C   . MET A 1 23  ? 17.515  6.541   61.865  1.00 47.08  ? 228 MET A C   1 
ATOM   179  O O   . MET A 1 23  ? 18.434  6.605   62.682  1.00 46.55  ? 228 MET A O   1 
ATOM   180  C CB  . MET A 1 23  ? 18.721  6.577   59.683  1.00 48.69  ? 228 MET A CB  1 
ATOM   181  C CG  . MET A 1 23  ? 18.710  5.065   59.649  1.00 49.10  ? 228 MET A CG  1 
ATOM   182  S SD  . MET A 1 23  ? 17.973  4.404   58.152  1.00 52.14  ? 228 MET A SD  1 
ATOM   183  C CE  . MET A 1 23  ? 19.235  4.774   56.970  1.00 50.66  ? 228 MET A CE  1 
ATOM   184  N N   . THR A 1 24  ? 16.388  5.873   62.089  1.00 45.18  ? 229 THR A N   1 
ATOM   185  C CA  . THR A 1 24  ? 16.162  5.137   63.323  1.00 43.83  ? 229 THR A CA  1 
ATOM   186  C C   . THR A 1 24  ? 16.648  3.742   63.142  1.00 40.33  ? 229 THR A C   1 
ATOM   187  O O   . THR A 1 24  ? 16.685  3.233   62.031  1.00 37.28  ? 229 THR A O   1 
ATOM   188  C CB  . THR A 1 24  ? 14.662  5.048   63.676  1.00 46.02  ? 229 THR A CB  1 
ATOM   189  O OG1 . THR A 1 24  ? 13.986  4.272   62.678  1.00 47.20  ? 229 THR A OG1 1 
ATOM   190  C CG2 . THR A 1 24  ? 14.042  6.434   63.752  1.00 46.80  ? 229 THR A CG2 1 
ATOM   191  N N   . LYS A 1 25  ? 17.025  3.101   64.237  1.00 39.51  ? 230 LYS A N   1 
ATOM   192  C CA  . LYS A 1 25  ? 17.481  1.724   64.173  1.00 39.42  ? 230 LYS A CA  1 
ATOM   193  C C   . LYS A 1 25  ? 16.323  0.822   63.652  1.00 42.08  ? 230 LYS A C   1 
ATOM   194  O O   . LYS A 1 25  ? 16.561  -0.181  62.983  1.00 43.80  ? 230 LYS A O   1 
ATOM   195  C CB  . LYS A 1 25  ? 17.927  1.231   65.554  1.00 32.54  ? 230 LYS A CB  1 
ATOM   196  C CG  . LYS A 1 25  ? 18.522  -0.162  65.509  1.00 30.17  ? 230 LYS A CG  1 
ATOM   197  C CD  . LYS A 1 25  ? 19.001  -0.636  66.846  1.00 28.59  ? 230 LYS A CD  1 
ATOM   198  C CE  . LYS A 1 25  ? 19.692  -1.967  66.697  1.00 28.72  ? 230 LYS A CE  1 
ATOM   199  N NZ  . LYS A 1 25  ? 20.162  -2.520  67.997  1.00 30.57  ? 230 LYS A NZ  1 
ATOM   200  N N   . LYS A 1 26  ? 15.084  1.173   63.982  1.00 43.87  ? 231 LYS A N   1 
ATOM   201  C CA  . LYS A 1 26  ? 13.944  0.394   63.515  1.00 46.28  ? 231 LYS A CA  1 
ATOM   202  C C   . LYS A 1 26  ? 14.053  0.420   61.957  1.00 47.06  ? 231 LYS A C   1 
ATOM   203  O O   . LYS A 1 26  ? 14.228  -0.621  61.307  1.00 44.63  ? 231 LYS A O   1 
ATOM   204  C CB  . LYS A 1 26  ? 12.646  1.056   63.983  1.00 47.72  ? 231 LYS A CB  1 
ATOM   205  C CG  . LYS A 1 26  ? 11.355  0.254   63.761  1.00 49.81  ? 231 LYS A CG  1 
ATOM   206  C CD  . LYS A 1 26  ? 10.106  1.182   64.014  1.00 53.81  ? 231 LYS A CD  1 
ATOM   207  C CE  . LYS A 1 26  ? 8.750   0.470   63.749  1.00 55.49  ? 231 LYS A CE  1 
ATOM   208  N NZ  . LYS A 1 26  ? 7.588   1.417   63.827  1.00 56.40  ? 231 LYS A NZ  1 
ATOM   209  N N   . LYS A 1 27  ? 13.981  1.625   61.393  1.00 46.13  ? 232 LYS A N   1 
ATOM   210  C CA  . LYS A 1 27  ? 14.097  1.794   59.953  1.00 48.50  ? 232 LYS A CA  1 
ATOM   211  C C   . LYS A 1 27  ? 15.389  1.086   59.407  1.00 49.56  ? 232 LYS A C   1 
ATOM   212  O O   . LYS A 1 27  ? 15.371  0.502   58.330  1.00 50.38  ? 232 LYS A O   1 
ATOM   213  C CB  . LYS A 1 27  ? 14.129  3.288   59.611  1.00 49.68  ? 232 LYS A CB  1 
ATOM   214  C CG  . LYS A 1 27  ? 14.109  3.603   58.098  1.00 50.73  ? 232 LYS A CG  1 
ATOM   215  C CD  . LYS A 1 27  ? 14.180  5.143   57.835  1.00 51.78  ? 232 LYS A CD  1 
ATOM   216  C CE  . LYS A 1 27  ? 14.365  5.453   56.310  1.00 51.63  ? 232 LYS A CE  1 
ATOM   217  N NZ  . LYS A 1 27  ? 14.507  6.914   56.026  1.00 51.42  ? 232 LYS A NZ  1 
ATOM   218  N N   . ALA A 1 28  ? 16.479  1.149   60.169  1.00 49.83  ? 233 ALA A N   1 
ATOM   219  C CA  . ALA A 1 28  ? 17.740  0.540   59.772  1.00 48.87  ? 233 ALA A CA  1 
ATOM   220  C C   . ALA A 1 28  ? 17.679  -0.981  59.708  1.00 48.85  ? 233 ALA A C   1 
ATOM   221  O O   . ALA A 1 28  ? 17.908  -1.559  58.652  1.00 48.88  ? 233 ALA A O   1 
ATOM   222  C CB  . ALA A 1 28  ? 18.857  0.983   60.717  1.00 47.01  ? 233 ALA A CB  1 
ATOM   223  N N   . ARG A 1 29  ? 17.386  -1.632  60.831  1.00 50.26  ? 234 ARG A N   1 
ATOM   224  C CA  . ARG A 1 29  ? 17.309  -3.096  60.867  1.00 52.41  ? 234 ARG A CA  1 
ATOM   225  C C   . ARG A 1 29  ? 16.373  -3.627  59.798  1.00 53.37  ? 234 ARG A C   1 
ATOM   226  O O   . ARG A 1 29  ? 16.631  -4.663  59.186  1.00 52.64  ? 234 ARG A O   1 
ATOM   227  C CB  . ARG A 1 29  ? 16.829  -3.584  62.232  1.00 53.13  ? 234 ARG A CB  1 
ATOM   228  C CG  . ARG A 1 29  ? 17.845  -3.466  63.355  1.00 54.46  ? 234 ARG A CG  1 
ATOM   229  C CD  . ARG A 1 29  ? 19.105  -4.259  63.063  1.00 55.03  ? 234 ARG A CD  1 
ATOM   230  N NE  . ARG A 1 29  ? 20.167  -3.386  62.585  1.00 56.39  ? 234 ARG A NE  1 
ATOM   231  C CZ  . ARG A 1 29  ? 21.420  -3.767  62.346  1.00 58.44  ? 234 ARG A CZ  1 
ATOM   232  N NH1 . ARG A 1 29  ? 21.803  -5.026  62.535  1.00 58.59  ? 234 ARG A NH1 1 
ATOM   233  N NH2 . ARG A 1 29  ? 22.298  -2.875  61.917  1.00 59.18  ? 234 ARG A NH2 1 
ATOM   234  N N   . SER A 1 30  ? 15.271  -2.919  59.589  1.00 54.05  ? 235 SER A N   1 
ATOM   235  C CA  . SER A 1 30  ? 14.305  -3.296  58.574  1.00 54.52  ? 235 SER A CA  1 
ATOM   236  C C   . SER A 1 30  ? 15.055  -3.527  57.276  1.00 55.56  ? 235 SER A C   1 
ATOM   237  O O   . SER A 1 30  ? 15.216  -4.663  56.823  1.00 57.19  ? 235 SER A O   1 
ATOM   238  C CB  . SER A 1 30  ? 13.284  -2.167  58.401  1.00 53.95  ? 235 SER A CB  1 
ATOM   239  O OG  . SER A 1 30  ? 12.505  -2.332  57.234  1.00 53.30  ? 235 SER A OG  1 
ATOM   240  N N   . ILE A 1 31  ? 15.534  -2.437  56.690  1.00 54.45  ? 236 ILE A N   1 
ATOM   241  C CA  . ILE A 1 31  ? 16.271  -2.483  55.440  1.00 54.32  ? 236 ILE A CA  1 
ATOM   242  C C   . ILE A 1 31  ? 17.392  -3.538  55.425  1.00 56.20  ? 236 ILE A C   1 
ATOM   243  O O   . ILE A 1 31  ? 17.614  -4.208  54.423  1.00 56.06  ? 236 ILE A O   1 
ATOM   244  C CB  . ILE A 1 31  ? 16.852  -1.101  55.136  1.00 51.87  ? 236 ILE A CB  1 
ATOM   245  C CG1 . ILE A 1 31  ? 15.710  -0.087  55.039  1.00 49.03  ? 236 ILE A CG1 1 
ATOM   246  C CG2 . ILE A 1 31  ? 17.657  -1.140  53.856  1.00 52.53  ? 236 ILE A CG2 1 
ATOM   247  C CD1 . ILE A 1 31  ? 16.164  1.353   54.834  1.00 46.76  ? 236 ILE A CD1 1 
ATOM   248  N N   . LEU A 1 32  ? 18.081  -3.691  56.545  1.00 59.45  ? 237 LEU A N   1 
ATOM   249  C CA  . LEU A 1 32  ? 19.165  -4.659  56.644  1.00 62.33  ? 237 LEU A CA  1 
ATOM   250  C C   . LEU A 1 32  ? 18.693  -6.152  56.764  1.00 64.08  ? 237 LEU A C   1 
ATOM   251  O O   . LEU A 1 32  ? 19.490  -7.079  56.577  1.00 64.08  ? 237 LEU A O   1 
ATOM   252  C CB  . LEU A 1 32  ? 20.058  -4.292  57.830  1.00 62.24  ? 237 LEU A CB  1 
ATOM   253  C CG  . LEU A 1 32  ? 20.857  -3.010  57.610  1.00 61.93  ? 237 LEU A CG  1 
ATOM   254  C CD1 . LEU A 1 32  ? 21.479  -2.563  58.912  1.00 62.45  ? 237 LEU A CD1 1 
ATOM   255  C CD2 . LEU A 1 32  ? 21.924  -3.257  56.554  1.00 61.79  ? 237 LEU A CD2 1 
ATOM   256  N N   . THR A 1 33  ? 17.416  -6.356  57.081  1.00 65.49  ? 238 THR A N   1 
ATOM   257  C CA  . THR A 1 33  ? 16.862  -7.705  57.202  1.00 66.53  ? 238 THR A CA  1 
ATOM   258  C C   . THR A 1 33  ? 16.247  -8.138  55.871  1.00 67.64  ? 238 THR A C   1 
ATOM   259  O O   . THR A 1 33  ? 16.469  -9.261  55.406  1.00 67.68  ? 238 THR A O   1 
ATOM   260  C CB  . THR A 1 33  ? 15.785  -7.783  58.310  1.00 65.77  ? 238 THR A CB  1 
ATOM   261  O OG1 . THR A 1 33  ? 14.929  -6.638  58.230  1.00 64.20  ? 238 THR A OG1 1 
ATOM   262  C CG2 . THR A 1 33  ? 16.436  -7.855  59.687  1.00 64.89  ? 238 THR A CG2 1 
ATOM   263  N N   . GLY A 1 34  ? 15.479  -7.239  55.260  1.00 67.89  ? 239 GLY A N   1 
ATOM   264  C CA  . GLY A 1 34  ? 14.870  -7.543  53.981  1.00 67.56  ? 239 GLY A CA  1 
ATOM   265  C C   . GLY A 1 34  ? 15.930  -7.727  52.906  1.00 67.72  ? 239 GLY A C   1 
ATOM   266  O O   . GLY A 1 34  ? 16.609  -6.778  52.498  1.00 67.06  ? 239 GLY A O   1 
ATOM   267  N N   . ALA A 1 40  ? 15.644  -2.930  47.496  1.00 57.67  ? 245 ALA A N   1 
ATOM   268  C CA  . ALA A 1 40  ? 16.822  -3.174  48.329  1.00 58.51  ? 245 ALA A CA  1 
ATOM   269  C C   . ALA A 1 40  ? 17.918  -2.162  48.035  1.00 57.48  ? 245 ALA A C   1 
ATOM   270  O O   . ALA A 1 40  ? 17.931  -1.533  46.976  1.00 56.74  ? 245 ALA A O   1 
ATOM   271  C CB  . ALA A 1 40  ? 17.355  -4.601  48.104  1.00 57.93  ? 245 ALA A CB  1 
ATOM   272  N N   . PRO A 1 41  ? 18.860  -1.988  48.977  1.00 56.55  ? 246 PRO A N   1 
ATOM   273  C CA  . PRO A 1 41  ? 19.949  -1.035  48.772  1.00 54.54  ? 246 PRO A CA  1 
ATOM   274  C C   . PRO A 1 41  ? 20.938  -1.554  47.786  1.00 53.44  ? 246 PRO A C   1 
ATOM   275  O O   . PRO A 1 41  ? 21.205  -2.758  47.730  1.00 51.06  ? 246 PRO A O   1 
ATOM   276  C CB  . PRO A 1 41  ? 20.546  -0.899  50.163  1.00 54.91  ? 246 PRO A CB  1 
ATOM   277  C CG  . PRO A 1 41  ? 20.410  -2.289  50.695  1.00 56.06  ? 246 PRO A CG  1 
ATOM   278  C CD  . PRO A 1 41  ? 18.993  -2.660  50.284  1.00 55.58  ? 246 PRO A CD  1 
ATOM   279  N N   . PHE A 1 42  ? 21.483  -0.644  46.989  1.00 52.77  ? 247 PHE A N   1 
ATOM   280  C CA  . PHE A 1 42  ? 22.483  -0.996  45.996  1.00 52.50  ? 247 PHE A CA  1 
ATOM   281  C C   . PHE A 1 42  ? 23.776  -1.323  46.745  1.00 50.73  ? 247 PHE A C   1 
ATOM   282  O O   . PHE A 1 42  ? 24.269  -0.515  47.533  1.00 51.29  ? 247 PHE A O   1 
ATOM   283  C CB  . PHE A 1 42  ? 22.698  0.188   45.051  1.00 55.40  ? 247 PHE A CB  1 
ATOM   284  C CG  . PHE A 1 42  ? 23.698  -0.076  43.964  1.00 57.66  ? 247 PHE A CG  1 
ATOM   285  C CD1 . PHE A 1 42  ? 23.556  -1.164  43.125  1.00 57.59  ? 247 PHE A CD1 1 
ATOM   286  C CD2 . PHE A 1 42  ? 24.763  0.788   43.761  1.00 58.84  ? 247 PHE A CD2 1 
ATOM   287  C CE1 . PHE A 1 42  ? 24.455  -1.383  42.102  1.00 60.03  ? 247 PHE A CE1 1 
ATOM   288  C CE2 . PHE A 1 42  ? 25.665  0.572   42.739  1.00 59.44  ? 247 PHE A CE2 1 
ATOM   289  C CZ  . PHE A 1 42  ? 25.512  -0.512  41.909  1.00 59.81  ? 247 PHE A CZ  1 
ATOM   290  N N   . VAL A 1 43  ? 24.325  -2.504  46.503  1.00 47.82  ? 248 VAL A N   1 
ATOM   291  C CA  . VAL A 1 43  ? 25.542  -2.904  47.186  1.00 47.06  ? 248 VAL A CA  1 
ATOM   292  C C   . VAL A 1 43  ? 26.831  -2.373  46.592  1.00 46.97  ? 248 VAL A C   1 
ATOM   293  O O   . VAL A 1 43  ? 27.099  -2.567  45.412  1.00 49.91  ? 248 VAL A O   1 
ATOM   294  C CB  . VAL A 1 43  ? 25.651  -4.438  47.267  1.00 45.57  ? 248 VAL A CB  1 
ATOM   295  C CG1 . VAL A 1 43  ? 26.998  -4.833  47.867  1.00 43.71  ? 248 VAL A CG1 1 
ATOM   296  C CG2 . VAL A 1 43  ? 24.514  -4.990  48.115  1.00 44.72  ? 248 VAL A CG2 1 
ATOM   297  N N   . ILE A 1 44  ? 27.627  -1.692  47.414  1.00 45.52  ? 249 ILE A N   1 
ATOM   298  C CA  . ILE A 1 44  ? 28.916  -1.169  46.974  1.00 43.03  ? 249 ILE A CA  1 
ATOM   299  C C   . ILE A 1 44  ? 29.977  -2.060  47.545  1.00 43.77  ? 249 ILE A C   1 
ATOM   300  O O   . ILE A 1 44  ? 30.192  -2.107  48.762  1.00 42.61  ? 249 ILE A O   1 
ATOM   301  C CB  . ILE A 1 44  ? 29.156  0.261   47.452  1.00 40.19  ? 249 ILE A CB  1 
ATOM   302  C CG1 . ILE A 1 44  ? 28.110  1.191   46.839  1.00 38.99  ? 249 ILE A CG1 1 
ATOM   303  C CG2 . ILE A 1 44  ? 30.555  0.691   47.067  1.00 36.75  ? 249 ILE A CG2 1 
ATOM   304  C CD1 . ILE A 1 44  ? 28.171  2.637   47.358  1.00 39.09  ? 249 ILE A CD1 1 
ATOM   305  N N   . HIS A 1 45  ? 30.642  -2.791  46.661  1.00 42.98  ? 250 HIS A N   1 
ATOM   306  C CA  . HIS A 1 45  ? 31.673  -3.730  47.068  1.00 41.44  ? 250 HIS A CA  1 
ATOM   307  C C   . HIS A 1 45  ? 32.944  -3.543  46.302  1.00 40.92  ? 250 HIS A C   1 
ATOM   308  O O   . HIS A 1 45  ? 33.889  -4.305  46.476  1.00 40.23  ? 250 HIS A O   1 
ATOM   309  C CB  . HIS A 1 45  ? 31.159  -5.155  46.873  1.00 40.84  ? 250 HIS A CB  1 
ATOM   310  C CG  . HIS A 1 45  ? 30.926  -5.514  45.440  1.00 39.53  ? 250 HIS A CG  1 
ATOM   311  N ND1 . HIS A 1 45  ? 31.725  -6.408  44.759  1.00 38.08  ? 250 HIS A ND1 1 
ATOM   312  C CD2 . HIS A 1 45  ? 30.021  -5.056  44.542  1.00 38.01  ? 250 HIS A CD2 1 
ATOM   313  C CE1 . HIS A 1 45  ? 31.324  -6.480  43.503  1.00 38.31  ? 250 HIS A CE1 1 
ATOM   314  N NE2 . HIS A 1 45  ? 30.293  -5.668  43.345  1.00 37.55  ? 250 HIS A NE2 1 
ATOM   315  N N   . ASP A 1 46  ? 32.969  -2.546  45.425  1.00 41.51  ? 251 ASP A N   1 
ATOM   316  C CA  . ASP A 1 46  ? 34.159  -2.231  44.638  1.00 42.93  ? 251 ASP A CA  1 
ATOM   317  C C   . ASP A 1 46  ? 34.024  -0.908  43.865  1.00 43.73  ? 251 ASP A C   1 
ATOM   318  O O   . ASP A 1 46  ? 33.001  -0.222  43.931  1.00 44.92  ? 251 ASP A O   1 
ATOM   319  C CB  . ASP A 1 46  ? 34.506  -3.365  43.661  1.00 42.92  ? 251 ASP A CB  1 
ATOM   320  C CG  . ASP A 1 46  ? 33.361  -3.715  42.721  1.00 43.26  ? 251 ASP A CG  1 
ATOM   321  O OD1 . ASP A 1 46  ? 32.622  -2.808  42.279  1.00 39.98  ? 251 ASP A OD1 1 
ATOM   322  O OD2 . ASP A 1 46  ? 33.220  -4.913  42.406  1.00 45.22  ? 251 ASP A OD2 1 
ATOM   323  N N   . ILE A 1 47  ? 35.067  -0.568  43.125  1.00 43.40  ? 252 ILE A N   1 
ATOM   324  C CA  . ILE A 1 47  ? 35.090  0.664   42.361  1.00 43.49  ? 252 ILE A CA  1 
ATOM   325  C C   . ILE A 1 47  ? 33.974  0.767   41.372  1.00 45.66  ? 252 ILE A C   1 
ATOM   326  O O   . ILE A 1 47  ? 33.369  1.827   41.231  1.00 46.61  ? 252 ILE A O   1 
ATOM   327  C CB  . ILE A 1 47  ? 36.421  0.797   41.627  1.00 43.01  ? 252 ILE A CB  1 
ATOM   328  C CG1 . ILE A 1 47  ? 37.561  0.830   42.641  1.00 41.11  ? 252 ILE A CG1 1 
ATOM   329  C CG2 . ILE A 1 47  ? 36.420  2.036   40.784  1.00 42.64  ? 252 ILE A CG2 1 
ATOM   330  C CD1 . ILE A 1 47  ? 38.901  0.706   42.027  1.00 41.44  ? 252 ILE A CD1 1 
ATOM   331  N N   . GLU A 1 48  ? 33.700  -0.333  40.669  1.00 46.89  ? 253 GLU A N   1 
ATOM   332  C CA  . GLU A 1 48  ? 32.642  -0.396  39.662  1.00 46.58  ? 253 GLU A CA  1 
ATOM   333  C C   . GLU A 1 48  ? 31.320  0.066   40.242  1.00 46.08  ? 253 GLU A C   1 
ATOM   334  O O   . GLU A 1 48  ? 30.692  0.990   39.723  1.00 44.77  ? 253 GLU A O   1 
ATOM   335  C CB  . GLU A 1 48  ? 32.529  -1.840  39.135  1.00 49.97  ? 253 GLU A CB  1 
ATOM   336  C CG  . GLU A 1 48  ? 31.120  -2.268  38.519  1.00 52.85  ? 253 GLU A CG  1 
ATOM   337  C CD  . GLU A 1 48  ? 30.875  -1.756  37.101  1.00 54.93  ? 253 GLU A CD  1 
ATOM   338  O OE1 . GLU A 1 48  ? 31.624  -2.154  36.181  1.00 55.76  ? 253 GLU A OE1 1 
ATOM   339  O OE2 . GLU A 1 48  ? 29.925  -0.963  36.904  1.00 55.40  ? 253 GLU A OE2 1 
ATOM   340  N N   . THR A 1 49  ? 30.908  -0.575  41.334  1.00 46.57  ? 254 THR A N   1 
ATOM   341  C CA  . THR A 1 49  ? 29.650  -0.254  42.003  1.00 47.31  ? 254 THR A CA  1 
ATOM   342  C C   . THR A 1 49  ? 29.695  1.057   42.736  1.00 48.38  ? 254 THR A C   1 
ATOM   343  O O   . THR A 1 49  ? 28.658  1.669   42.972  1.00 48.62  ? 254 THR A O   1 
ATOM   344  C CB  . THR A 1 49  ? 29.263  -1.347  43.002  1.00 47.81  ? 254 THR A CB  1 
ATOM   345  O OG1 . THR A 1 49  ? 30.351  -1.560  43.910  1.00 49.52  ? 254 THR A OG1 1 
ATOM   346  C CG2 . THR A 1 49  ? 28.948  -2.645  42.281  1.00 46.52  ? 254 THR A CG2 1 
ATOM   347  N N   . LEU A 1 50  ? 30.891  1.492   43.128  1.00 48.86  ? 255 LEU A N   1 
ATOM   348  C CA  . LEU A 1 50  ? 31.038  2.770   43.815  1.00 48.31  ? 255 LEU A CA  1 
ATOM   349  C C   . LEU A 1 50  ? 30.767  3.866   42.778  1.00 49.63  ? 255 LEU A C   1 
ATOM   350  O O   . LEU A 1 50  ? 30.010  4.801   43.026  1.00 48.40  ? 255 LEU A O   1 
ATOM   351  C CB  . LEU A 1 50  ? 32.458  2.928   44.371  1.00 46.65  ? 255 LEU A CB  1 
ATOM   352  C CG  . LEU A 1 50  ? 32.688  3.941   45.506  1.00 44.88  ? 255 LEU A CG  1 
ATOM   353  C CD1 . LEU A 1 50  ? 34.116  4.430   45.424  1.00 42.82  ? 255 LEU A CD1 1 
ATOM   354  C CD2 . LEU A 1 50  ? 31.744  5.126   45.408  1.00 42.19  ? 255 LEU A CD2 1 
ATOM   355  N N   . TRP A 1 51  ? 31.397  3.749   41.613  1.00 51.20  ? 256 TRP A N   1 
ATOM   356  C CA  . TRP A 1 51  ? 31.190  4.724   40.553  1.00 52.94  ? 256 TRP A CA  1 
ATOM   357  C C   . TRP A 1 51  ? 29.752  4.687   40.164  1.00 52.45  ? 256 TRP A C   1 
ATOM   358  O O   . TRP A 1 51  ? 29.142  5.713   39.863  1.00 51.02  ? 256 TRP A O   1 
ATOM   359  C CB  . TRP A 1 51  ? 32.055  4.389   39.341  1.00 55.80  ? 256 TRP A CB  1 
ATOM   360  C CG  . TRP A 1 51  ? 31.776  5.266   38.157  1.00 59.36  ? 256 TRP A CG  1 
ATOM   361  C CD1 . TRP A 1 51  ? 32.102  6.588   38.011  1.00 59.68  ? 256 TRP A CD1 1 
ATOM   362  C CD2 . TRP A 1 51  ? 31.077  4.889   36.962  1.00 60.79  ? 256 TRP A CD2 1 
ATOM   363  N NE1 . TRP A 1 51  ? 31.648  7.055   36.797  1.00 61.48  ? 256 TRP A NE1 1 
ATOM   364  C CE2 . TRP A 1 51  ? 31.018  6.033   36.137  1.00 62.12  ? 256 TRP A CE2 1 
ATOM   365  C CE3 . TRP A 1 51  ? 30.498  3.699   36.513  1.00 60.94  ? 256 TRP A CE3 1 
ATOM   366  C CZ2 . TRP A 1 51  ? 30.397  6.016   34.886  1.00 63.72  ? 256 TRP A CZ2 1 
ATOM   367  C CZ3 . TRP A 1 51  ? 29.881  3.685   35.274  1.00 62.68  ? 256 TRP A CZ3 1 
ATOM   368  C CH2 . TRP A 1 51  ? 29.835  4.835   34.474  1.00 64.11  ? 256 TRP A CH2 1 
ATOM   369  N N   . GLN A 1 52  ? 29.200  3.481   40.168  1.00 53.02  ? 257 GLN A N   1 
ATOM   370  C CA  . GLN A 1 52  ? 27.806  3.255   39.828  1.00 53.62  ? 257 GLN A CA  1 
ATOM   371  C C   . GLN A 1 52  ? 26.920  4.011   40.837  1.00 53.25  ? 257 GLN A C   1 
ATOM   372  O O   . GLN A 1 52  ? 26.136  4.885   40.462  1.00 53.43  ? 257 GLN A O   1 
ATOM   373  C CB  . GLN A 1 52  ? 27.519  1.758   39.894  1.00 54.29  ? 257 GLN A CB  1 
ATOM   374  C CG  . GLN A 1 52  ? 26.509  1.266   38.917  1.00 54.56  ? 257 GLN A CG  1 
ATOM   375  C CD  . GLN A 1 52  ? 27.092  0.229   37.989  1.00 55.67  ? 257 GLN A CD  1 
ATOM   376  O OE1 . GLN A 1 52  ? 27.761  0.563   37.011  1.00 55.26  ? 257 GLN A OE1 1 
ATOM   377  N NE2 . GLN A 1 52  ? 26.855  -1.045  38.300  1.00 56.50  ? 257 GLN A NE2 1 
ATOM   378  N N   . ALA A 1 53  ? 27.066  3.663   42.113  1.00 52.46  ? 258 ALA A N   1 
ATOM   379  C CA  . ALA A 1 53  ? 26.309  4.291   43.185  1.00 52.51  ? 258 ALA A CA  1 
ATOM   380  C C   . ALA A 1 53  ? 26.441  5.763   43.088  1.00 54.16  ? 258 ALA A C   1 
ATOM   381  O O   . ALA A 1 53  ? 25.452  6.497   43.132  1.00 54.12  ? 258 ALA A O   1 
ATOM   382  C CB  . ALA A 1 53  ? 26.820  3.812   44.530  1.00 50.67  ? 258 ALA A CB  1 
ATOM   383  N N   . GLU A 1 54  ? 27.679  6.217   42.952  1.00 56.51  ? 259 GLU A N   1 
ATOM   384  C CA  . GLU A 1 54  ? 27.980  7.632   42.844  1.00 59.69  ? 259 GLU A CA  1 
ATOM   385  C C   . GLU A 1 54  ? 27.074  8.358   41.905  1.00 62.17  ? 259 GLU A C   1 
ATOM   386  O O   . GLU A 1 54  ? 26.186  9.085   42.346  1.00 63.28  ? 259 GLU A O   1 
ATOM   387  C CB  . GLU A 1 54  ? 29.433  7.824   42.406  1.00 60.93  ? 259 GLU A CB  1 
ATOM   388  C CG  . GLU A 1 54  ? 30.430  7.743   43.541  1.00 59.66  ? 259 GLU A CG  1 
ATOM   389  C CD  . GLU A 1 54  ? 30.179  8.807   44.586  1.00 58.82  ? 259 GLU A CD  1 
ATOM   390  O OE1 . GLU A 1 54  ? 30.154  9.998   44.212  1.00 58.85  ? 259 GLU A OE1 1 
ATOM   391  O OE2 . GLU A 1 54  ? 30.008  8.459   45.774  1.00 56.69  ? 259 GLU A OE2 1 
ATOM   392  N N   . LYS A 1 55  ? 27.285  8.163   40.604  1.00 64.55  ? 260 LYS A N   1 
ATOM   393  C CA  . LYS A 1 55  ? 26.490  8.830   39.570  1.00 67.40  ? 260 LYS A CA  1 
ATOM   394  C C   . LYS A 1 55  ? 25.031  9.037   39.928  1.00 68.86  ? 260 LYS A C   1 
ATOM   395  O O   . LYS A 1 55  ? 24.644  10.099  40.435  1.00 69.89  ? 260 LYS A O   1 
ATOM   396  C CB  . LYS A 1 55  ? 26.585  8.067   38.246  1.00 67.07  ? 260 LYS A CB  1 
ATOM   397  C CG  . LYS A 1 55  ? 27.960  8.126   37.604  1.00 67.98  ? 260 LYS A CG  1 
ATOM   398  C CD  . LYS A 1 55  ? 27.961  7.452   36.246  1.00 69.10  ? 260 LYS A CD  1 
ATOM   399  C CE  . LYS A 1 55  ? 27.198  8.277   35.190  1.00 70.40  ? 260 LYS A CE  1 
ATOM   400  N NZ  . LYS A 1 55  ? 27.158  7.590   33.859  1.00 70.97  ? 260 LYS A NZ  1 
ATOM   401  N N   . GLY A 1 56  ? 24.211  8.029   39.662  1.00 68.46  ? 261 GLY A N   1 
ATOM   402  C CA  . GLY A 1 56  ? 22.803  8.158   39.973  1.00 68.95  ? 261 GLY A CA  1 
ATOM   403  C C   . GLY A 1 56  ? 22.247  7.009   40.784  1.00 69.33  ? 261 GLY A C   1 
ATOM   404  O O   . GLY A 1 56  ? 21.284  7.187   41.530  1.00 69.24  ? 261 GLY A O   1 
ATOM   405  N N   . LEU A 1 57  ? 22.860  5.835   40.643  1.00 69.64  ? 262 LEU A N   1 
ATOM   406  C CA  . LEU A 1 57  ? 22.421  4.632   41.344  1.00 70.46  ? 262 LEU A CA  1 
ATOM   407  C C   . LEU A 1 57  ? 21.897  4.906   42.754  1.00 71.18  ? 262 LEU A C   1 
ATOM   408  O O   . LEU A 1 57  ? 20.856  4.375   43.148  1.00 72.19  ? 262 LEU A O   1 
ATOM   409  C CB  . LEU A 1 57  ? 23.558  3.616   41.394  1.00 70.17  ? 262 LEU A CB  1 
ATOM   410  N N   . VAL A 1 58  ? 22.618  5.732   43.509  1.00 70.43  ? 263 VAL A N   1 
ATOM   411  C CA  . VAL A 1 58  ? 22.219  6.065   44.868  1.00 69.31  ? 263 VAL A CA  1 
ATOM   412  C C   . VAL A 1 58  ? 22.271  7.588   45.120  1.00 68.89  ? 263 VAL A C   1 
ATOM   413  O O   . VAL A 1 58  ? 21.261  8.207   45.450  1.00 69.03  ? 263 VAL A O   1 
ATOM   414  C CB  . VAL A 1 58  ? 23.125  5.344   45.885  1.00 68.65  ? 263 VAL A CB  1 
ATOM   415  C CG1 . VAL A 1 58  ? 22.714  5.708   47.286  1.00 68.90  ? 263 VAL A CG1 1 
ATOM   416  C CG2 . VAL A 1 58  ? 23.045  3.837   45.681  1.00 67.34  ? 263 VAL A CG2 1 
ATOM   417  N N   . TRP A 1 59  ? 23.449  8.177   44.951  1.00 67.94  ? 264 TRP A N   1 
ATOM   418  C CA  . TRP A 1 59  ? 23.624  9.607   45.167  1.00 67.17  ? 264 TRP A CA  1 
ATOM   419  C C   . TRP A 1 59  ? 23.092  10.444  44.024  1.00 67.42  ? 264 TRP A C   1 
ATOM   420  O O   . TRP A 1 59  ? 23.654  10.455  42.930  1.00 68.40  ? 264 TRP A O   1 
ATOM   421  C CB  . TRP A 1 59  ? 25.106  9.913   45.410  1.00 64.83  ? 264 TRP A CB  1 
ATOM   422  C CG  . TRP A 1 59  ? 25.559  9.516   46.789  1.00 62.17  ? 264 TRP A CG  1 
ATOM   423  C CD1 . TRP A 1 59  ? 25.201  10.109  47.962  1.00 61.40  ? 264 TRP A CD1 1 
ATOM   424  C CD2 . TRP A 1 59  ? 26.414  8.415   47.142  1.00 60.46  ? 264 TRP A CD2 1 
ATOM   425  N NE1 . TRP A 1 59  ? 25.772  9.448   49.022  1.00 61.17  ? 264 TRP A NE1 1 
ATOM   426  C CE2 . TRP A 1 59  ? 26.519  8.402   48.547  1.00 59.73  ? 264 TRP A CE2 1 
ATOM   427  C CE3 . TRP A 1 59  ? 27.092  7.436   46.409  1.00 59.09  ? 264 TRP A CE3 1 
ATOM   428  C CZ2 . TRP A 1 59  ? 27.280  7.457   49.234  1.00 57.43  ? 264 TRP A CZ2 1 
ATOM   429  C CZ3 . TRP A 1 59  ? 27.848  6.496   47.095  1.00 58.16  ? 264 TRP A CZ3 1 
ATOM   430  C CH2 . TRP A 1 59  ? 27.931  6.514   48.494  1.00 56.33  ? 264 TRP A CH2 1 
ATOM   431  N N   . GLY A 1 65  ? 29.210  17.536  45.709  1.00 70.01  ? 270 GLY A N   1 
ATOM   432  C CA  . GLY A 1 65  ? 29.567  18.628  46.598  1.00 70.42  ? 270 GLY A CA  1 
ATOM   433  C C   . GLY A 1 65  ? 30.669  18.271  47.582  1.00 70.65  ? 270 GLY A C   1 
ATOM   434  O O   . GLY A 1 65  ? 30.711  18.793  48.689  1.00 70.65  ? 270 GLY A O   1 
ATOM   435  N N   . LEU A 1 66  ? 31.567  17.384  47.170  1.00 71.17  ? 271 LEU A N   1 
ATOM   436  C CA  . LEU A 1 66  ? 32.679  16.931  48.006  1.00 71.30  ? 271 LEU A CA  1 
ATOM   437  C C   . LEU A 1 66  ? 33.955  17.626  47.530  1.00 71.14  ? 271 LEU A C   1 
ATOM   438  O O   . LEU A 1 66  ? 33.940  18.325  46.519  1.00 72.76  ? 271 LEU A O   1 
ATOM   439  C CB  . LEU A 1 66  ? 32.848  15.411  47.855  1.00 71.65  ? 271 LEU A CB  1 
ATOM   440  C CG  . LEU A 1 66  ? 31.875  14.385  48.458  1.00 72.10  ? 271 LEU A CG  1 
ATOM   441  C CD1 . LEU A 1 66  ? 32.323  14.031  49.857  1.00 72.76  ? 271 LEU A CD1 1 
ATOM   442  C CD2 . LEU A 1 66  ? 30.452  14.910  48.460  1.00 72.53  ? 271 LEU A CD2 1 
ATOM   443  N N   . PRO A 1 67  ? 35.074  17.461  48.258  1.00 70.05  ? 272 PRO A N   1 
ATOM   444  C CA  . PRO A 1 67  ? 36.304  18.114  47.799  1.00 68.58  ? 272 PRO A CA  1 
ATOM   445  C C   . PRO A 1 67  ? 36.653  17.536  46.437  1.00 67.18  ? 272 PRO A C   1 
ATOM   446  O O   . PRO A 1 67  ? 36.208  16.438  46.092  1.00 66.93  ? 272 PRO A O   1 
ATOM   447  C CB  . PRO A 1 67  ? 37.324  17.723  48.866  1.00 68.78  ? 272 PRO A CB  1 
ATOM   448  C CG  . PRO A 1 67  ? 36.494  17.597  50.097  1.00 68.91  ? 272 PRO A CG  1 
ATOM   449  C CD  . PRO A 1 67  ? 35.266  16.864  49.592  1.00 70.26  ? 272 PRO A CD  1 
ATOM   450  N N   . PRO A 1 68  ? 37.457  18.257  45.641  1.00 66.24  ? 273 PRO A N   1 
ATOM   451  C CA  . PRO A 1 68  ? 37.814  17.732  44.319  1.00 65.19  ? 273 PRO A CA  1 
ATOM   452  C C   . PRO A 1 68  ? 38.300  16.310  44.416  1.00 64.09  ? 273 PRO A C   1 
ATOM   453  O O   . PRO A 1 68  ? 38.990  15.950  45.374  1.00 63.92  ? 273 PRO A O   1 
ATOM   454  C CB  . PRO A 1 68  ? 38.905  18.691  43.851  1.00 65.01  ? 273 PRO A CB  1 
ATOM   455  C CG  . PRO A 1 68  ? 39.549  19.111  45.137  1.00 65.23  ? 273 PRO A CG  1 
ATOM   456  C CD  . PRO A 1 68  ? 38.343  19.371  46.012  1.00 66.06  ? 273 PRO A CD  1 
ATOM   457  N N   . TYR A 1 69  ? 37.941  15.485  43.438  1.00 62.02  ? 274 TYR A N   1 
ATOM   458  C CA  . TYR A 1 69  ? 38.375  14.097  43.468  1.00 61.41  ? 274 TYR A CA  1 
ATOM   459  C C   . TYR A 1 69  ? 39.868  14.051  43.702  1.00 61.08  ? 274 TYR A C   1 
ATOM   460  O O   . TYR A 1 69  ? 40.580  15.011  43.400  1.00 61.82  ? 274 TYR A O   1 
ATOM   461  C CB  . TYR A 1 69  ? 38.055  13.381  42.155  1.00 59.24  ? 274 TYR A CB  1 
ATOM   462  C CG  . TYR A 1 69  ? 38.214  11.881  42.258  1.00 57.59  ? 274 TYR A CG  1 
ATOM   463  C CD1 . TYR A 1 69  ? 37.247  11.107  42.888  1.00 56.22  ? 274 TYR A CD1 1 
ATOM   464  C CD2 . TYR A 1 69  ? 39.346  11.246  41.766  1.00 56.53  ? 274 TYR A CD2 1 
ATOM   465  C CE1 . TYR A 1 69  ? 37.399  9.742   43.025  1.00 55.32  ? 274 TYR A CE1 1 
ATOM   466  C CE2 . TYR A 1 69  ? 39.511  9.875   41.902  1.00 56.61  ? 274 TYR A CE2 1 
ATOM   467  C CZ  . TYR A 1 69  ? 38.532  9.127   42.533  1.00 55.79  ? 274 TYR A CZ  1 
ATOM   468  O OH  . TYR A 1 69  ? 38.682  7.763   42.673  1.00 53.12  ? 274 TYR A OH  1 
ATOM   469  N N   . LYS A 1 70  ? 40.344  12.935  44.247  1.00 59.71  ? 275 LYS A N   1 
ATOM   470  C CA  . LYS A 1 70  ? 41.758  12.763  44.520  1.00 56.74  ? 275 LYS A CA  1 
ATOM   471  C C   . LYS A 1 70  ? 42.157  11.336  44.435  1.00 55.33  ? 275 LYS A C   1 
ATOM   472  O O   . LYS A 1 70  ? 43.197  11.010  43.871  1.00 56.05  ? 275 LYS A O   1 
ATOM   473  C CB  . LYS A 1 70  ? 42.094  13.319  45.904  1.00 56.13  ? 275 LYS A CB  1 
ATOM   474  N N   . GLU A 1 71  ? 41.324  10.450  44.967  1.00 53.68  ? 276 GLU A N   1 
ATOM   475  C CA  . GLU A 1 71  ? 41.655  9.030   44.983  1.00 50.47  ? 276 GLU A CA  1 
ATOM   476  C C   . GLU A 1 71  ? 40.463  8.281   45.561  1.00 48.52  ? 276 GLU A C   1 
ATOM   477  O O   . GLU A 1 71  ? 39.611  8.879   46.214  1.00 48.22  ? 276 GLU A O   1 
ATOM   478  C CB  . GLU A 1 71  ? 42.912  8.866   45.846  1.00 49.57  ? 276 GLU A CB  1 
ATOM   479  C CG  . GLU A 1 71  ? 43.322  7.493   46.237  1.00 50.00  ? 276 GLU A CG  1 
ATOM   480  C CD  . GLU A 1 71  ? 44.475  7.542   47.222  1.00 48.57  ? 276 GLU A CD  1 
ATOM   481  O OE1 . GLU A 1 71  ? 44.927  6.481   47.699  1.00 49.45  ? 276 GLU A OE1 1 
ATOM   482  O OE2 . GLU A 1 71  ? 44.929  8.662   47.519  1.00 46.23  ? 276 GLU A OE2 1 
ATOM   483  N N   . ILE A 1 72  ? 40.393  6.980   45.319  1.00 46.23  ? 277 ILE A N   1 
ATOM   484  C CA  . ILE A 1 72  ? 39.278  6.175   45.802  1.00 46.51  ? 277 ILE A CA  1 
ATOM   485  C C   . ILE A 1 72  ? 39.121  6.201   47.294  1.00 45.51  ? 277 ILE A C   1 
ATOM   486  O O   . ILE A 1 72  ? 38.093  6.638   47.812  1.00 44.69  ? 277 ILE A O   1 
ATOM   487  C CB  . ILE A 1 72  ? 39.418  4.709   45.333  1.00 47.77  ? 277 ILE A CB  1 
ATOM   488  C CG1 . ILE A 1 72  ? 39.287  4.643   43.803  1.00 48.35  ? 277 ILE A CG1 1 
ATOM   489  C CG2 . ILE A 1 72  ? 38.344  3.852   45.987  1.00 48.45  ? 277 ILE A CG2 1 
ATOM   490  C CD1 . ILE A 1 72  ? 40.075  3.515   43.141  1.00 45.66  ? 277 ILE A CD1 1 
ATOM   491  N N   . SER A 1 73  ? 40.144  5.728   47.997  1.00 44.96  ? 278 SER A N   1 
ATOM   492  C CA  . SER A 1 73  ? 40.127  5.693   49.452  1.00 42.17  ? 278 SER A CA  1 
ATOM   493  C C   . SER A 1 73  ? 39.790  7.052   50.057  1.00 40.04  ? 278 SER A C   1 
ATOM   494  O O   . SER A 1 73  ? 39.014  7.133   51.005  1.00 39.59  ? 278 SER A O   1 
ATOM   495  C CB  . SER A 1 73  ? 41.482  5.209   49.978  1.00 41.68  ? 278 SER A CB  1 
ATOM   496  O OG  . SER A 1 73  ? 41.764  3.894   49.526  1.00 41.17  ? 278 SER A OG  1 
ATOM   497  N N   . VAL A 1 74  ? 40.364  8.116   49.507  1.00 38.24  ? 279 VAL A N   1 
ATOM   498  C CA  . VAL A 1 74  ? 40.110  9.460   50.020  1.00 36.88  ? 279 VAL A CA  1 
ATOM   499  C C   . VAL A 1 74  ? 38.691  9.916   49.763  1.00 35.90  ? 279 VAL A C   1 
ATOM   500  O O   . VAL A 1 74  ? 38.079  10.567  50.608  1.00 35.65  ? 279 VAL A O   1 
ATOM   501  C CB  . VAL A 1 74  ? 41.093  10.492  49.417  1.00 36.56  ? 279 VAL A CB  1 
ATOM   502  C CG1 . VAL A 1 74  ? 40.748  11.897  49.910  1.00 33.99  ? 279 VAL A CG1 1 
ATOM   503  C CG2 . VAL A 1 74  ? 42.515  10.134  49.807  1.00 34.08  ? 279 VAL A CG2 1 
ATOM   504  N N   . HIS A 1 75  ? 38.165  9.582   48.593  1.00 35.37  ? 280 HIS A N   1 
ATOM   505  C CA  . HIS A 1 75  ? 36.796  9.939   48.245  1.00 34.66  ? 280 HIS A CA  1 
ATOM   506  C C   . HIS A 1 75  ? 35.866  9.388   49.318  1.00 33.25  ? 280 HIS A C   1 
ATOM   507  O O   . HIS A 1 75  ? 34.975  10.078  49.801  1.00 34.42  ? 280 HIS A O   1 
ATOM   508  C CB  . HIS A 1 75  ? 36.424  9.345   46.883  1.00 36.15  ? 280 HIS A CB  1 
ATOM   509  C CG  . HIS A 1 75  ? 35.000  9.582   46.494  1.00 38.74  ? 280 HIS A CG  1 
ATOM   510  N ND1 . HIS A 1 75  ? 34.520  10.828  46.149  1.00 40.73  ? 280 HIS A ND1 1 
ATOM   511  C CD2 . HIS A 1 75  ? 33.937  8.743   46.448  1.00 37.00  ? 280 HIS A CD2 1 
ATOM   512  C CE1 . HIS A 1 75  ? 33.222  10.747  45.911  1.00 38.16  ? 280 HIS A CE1 1 
ATOM   513  N NE2 . HIS A 1 75  ? 32.845  9.494   46.086  1.00 38.07  ? 280 HIS A NE2 1 
ATOM   514  N N   . VAL A 1 76  ? 36.069  8.131   49.682  1.00 31.74  ? 281 VAL A N   1 
ATOM   515  C CA  . VAL A 1 76  ? 35.263  7.501   50.714  1.00 31.93  ? 281 VAL A CA  1 
ATOM   516  C C   . VAL A 1 76  ? 35.420  8.274   52.049  1.00 33.22  ? 281 VAL A C   1 
ATOM   517  O O   . VAL A 1 76  ? 34.450  8.499   52.784  1.00 32.66  ? 281 VAL A O   1 
ATOM   518  C CB  . VAL A 1 76  ? 35.710  6.041   50.911  1.00 31.68  ? 281 VAL A CB  1 
ATOM   519  C CG1 . VAL A 1 76  ? 34.945  5.400   52.055  1.00 28.64  ? 281 VAL A CG1 1 
ATOM   520  C CG2 . VAL A 1 76  ? 35.499  5.267   49.612  1.00 30.82  ? 281 VAL A CG2 1 
ATOM   521  N N   . PHE A 1 77  ? 36.660  8.655   52.345  1.00 33.75  ? 282 PHE A N   1 
ATOM   522  C CA  . PHE A 1 77  ? 36.979  9.410   53.543  1.00 33.97  ? 282 PHE A CA  1 
ATOM   523  C C   . PHE A 1 77  ? 36.160  10.669  53.571  1.00 34.92  ? 282 PHE A C   1 
ATOM   524  O O   . PHE A 1 77  ? 35.611  11.040  54.608  1.00 33.68  ? 282 PHE A O   1 
ATOM   525  C CB  . PHE A 1 77  ? 38.461  9.770   53.557  1.00 34.96  ? 282 PHE A CB  1 
ATOM   526  C CG  . PHE A 1 77  ? 38.909  10.416  54.834  1.00 36.03  ? 282 PHE A CG  1 
ATOM   527  C CD1 . PHE A 1 77  ? 38.776  9.750   56.043  1.00 36.89  ? 282 PHE A CD1 1 
ATOM   528  C CD2 . PHE A 1 77  ? 39.477  11.677  54.825  1.00 35.04  ? 282 PHE A CD2 1 
ATOM   529  C CE1 . PHE A 1 77  ? 39.201  10.327  57.218  1.00 38.07  ? 282 PHE A CE1 1 
ATOM   530  C CE2 . PHE A 1 77  ? 39.905  12.262  55.993  1.00 37.02  ? 282 PHE A CE2 1 
ATOM   531  C CZ  . PHE A 1 77  ? 39.770  11.588  57.192  1.00 38.76  ? 282 PHE A CZ  1 
ATOM   532  N N   . TYR A 1 78  ? 36.089  11.343  52.425  1.00 34.68  ? 283 TYR A N   1 
ATOM   533  C CA  . TYR A 1 78  ? 35.305  12.556  52.301  1.00 36.45  ? 283 TYR A CA  1 
ATOM   534  C C   . TYR A 1 78  ? 33.811  12.268  52.552  1.00 36.00  ? 283 TYR A C   1 
ATOM   535  O O   . TYR A 1 78  ? 33.131  13.038  53.225  1.00 35.85  ? 283 TYR A O   1 
ATOM   536  C CB  . TYR A 1 78  ? 35.498  13.174  50.917  1.00 39.91  ? 283 TYR A CB  1 
ATOM   537  C CG  . TYR A 1 78  ? 36.872  13.771  50.701  1.00 43.82  ? 283 TYR A CG  1 
ATOM   538  C CD1 . TYR A 1 78  ? 37.661  14.160  51.780  1.00 45.06  ? 283 TYR A CD1 1 
ATOM   539  C CD2 . TYR A 1 78  ? 37.365  13.993  49.420  1.00 45.26  ? 283 TYR A CD2 1 
ATOM   540  C CE1 . TYR A 1 78  ? 38.901  14.754  51.591  1.00 44.86  ? 283 TYR A CE1 1 
ATOM   541  C CE2 . TYR A 1 78  ? 38.603  14.590  49.224  1.00 46.39  ? 283 TYR A CE2 1 
ATOM   542  C CZ  . TYR A 1 78  ? 39.362  14.967  50.314  1.00 45.82  ? 283 TYR A CZ  1 
ATOM   543  O OH  . TYR A 1 78  ? 40.580  15.570  50.126  1.00 47.40  ? 283 TYR A OH  1 
ATOM   544  N N   . ARG A 1 79  ? 33.307  11.166  52.008  1.00 36.42  ? 284 ARG A N   1 
ATOM   545  C CA  . ARG A 1 79  ? 31.911  10.790  52.231  1.00 38.07  ? 284 ARG A CA  1 
ATOM   546  C C   . ARG A 1 79  ? 31.706  10.634  53.737  1.00 37.33  ? 284 ARG A C   1 
ATOM   547  O O   . ARG A 1 79  ? 30.711  11.112  54.289  1.00 37.43  ? 284 ARG A O   1 
ATOM   548  C CB  . ARG A 1 79  ? 31.579  9.468   51.533  1.00 40.11  ? 284 ARG A CB  1 
ATOM   549  C CG  . ARG A 1 79  ? 31.432  9.555   49.995  1.00 43.60  ? 284 ARG A CG  1 
ATOM   550  C CD  . ARG A 1 79  ? 30.180  10.339  49.617  1.00 48.14  ? 284 ARG A CD  1 
ATOM   551  N NE  . ARG A 1 79  ? 29.843  10.251  48.197  1.00 50.26  ? 284 ARG A NE  1 
ATOM   552  C CZ  . ARG A 1 79  ? 28.908  10.999  47.618  1.00 52.37  ? 284 ARG A CZ  1 
ATOM   553  N NH1 . ARG A 1 79  ? 28.651  10.871  46.326  1.00 51.99  ? 284 ARG A NH1 1 
ATOM   554  N NH2 . ARG A 1 79  ? 28.228  11.885  48.336  1.00 52.42  ? 284 ARG A NH2 1 
ATOM   555  N N   . CYS A 1 80  ? 32.648  9.957   54.396  1.00 35.39  ? 285 CYS A N   1 
ATOM   556  C CA  . CYS A 1 80  ? 32.586  9.767   55.844  1.00 34.83  ? 285 CYS A CA  1 
ATOM   557  C C   . CYS A 1 80  ? 32.451  11.082  56.529  1.00 32.80  ? 285 CYS A C   1 
ATOM   558  O O   . CYS A 1 80  ? 31.705  11.207  57.488  1.00 31.31  ? 285 CYS A O   1 
ATOM   559  C CB  . CYS A 1 80  ? 33.849  9.072   56.362  1.00 36.94  ? 285 CYS A CB  1 
ATOM   560  S SG  . CYS A 1 80  ? 33.996  7.310   55.979  1.00 36.02  ? 285 CYS A SG  1 
ATOM   561  N N   . GLN A 1 81  ? 33.186  12.079  56.045  1.00 33.20  ? 286 GLN A N   1 
ATOM   562  C CA  . GLN A 1 81  ? 33.139  13.419  56.616  1.00 33.63  ? 286 GLN A CA  1 
ATOM   563  C C   . GLN A 1 81  ? 31.832  14.027  56.422  1.00 34.64  ? 286 GLN A C   1 
ATOM   564  O O   . GLN A 1 81  ? 31.251  14.563  57.361  1.00 36.69  ? 286 GLN A O   1 
ATOM   565  C CB  . GLN A 1 81  ? 34.215  14.319  56.010  1.00 33.74  ? 286 GLN A CB  1 
ATOM   566  C CG  . GLN A 1 81  ? 35.656  14.043  56.524  1.00 33.63  ? 286 GLN A CG  1 
ATOM   567  C CD  . GLN A 1 81  ? 36.653  15.104  56.080  1.00 33.91  ? 286 GLN A CD  1 
ATOM   568  O OE1 . GLN A 1 81  ? 36.438  16.293  56.288  1.00 34.96  ? 286 GLN A OE1 1 
ATOM   569  N NE2 . GLN A 1 81  ? 37.748  14.676  55.471  1.00 32.68  ? 286 GLN A NE2 1 
ATOM   570  N N   . CYS A 1 82  ? 31.315  13.974  55.203  1.00 34.36  ? 287 CYS A N   1 
ATOM   571  C CA  . CYS A 1 82  ? 30.000  14.545  54.950  1.00 37.00  ? 287 CYS A CA  1 
ATOM   572  C C   . CYS A 1 82  ? 28.956  13.901  55.862  1.00 35.95  ? 287 CYS A C   1 
ATOM   573  O O   . CYS A 1 82  ? 28.107  14.584  56.428  1.00 36.66  ? 287 CYS A O   1 
ATOM   574  C CB  . CYS A 1 82  ? 29.599  14.349  53.484  1.00 39.94  ? 287 CYS A CB  1 
ATOM   575  S SG  . CYS A 1 82  ? 30.644  15.254  52.308  1.00 50.04  ? 287 CYS A SG  1 
ATOM   576  N N   . THR A 1 83  ? 29.021  12.584  56.008  1.00 34.47  ? 288 THR A N   1 
ATOM   577  C CA  . THR A 1 83  ? 28.070  11.883  56.856  1.00 34.00  ? 288 THR A CA  1 
ATOM   578  C C   . THR A 1 83  ? 28.204  12.310  58.316  1.00 33.59  ? 288 THR A C   1 
ATOM   579  O O   . THR A 1 83  ? 27.210  12.550  59.004  1.00 32.42  ? 288 THR A O   1 
ATOM   580  C CB  . THR A 1 83  ? 28.266  10.369  56.751  1.00 32.87  ? 288 THR A CB  1 
ATOM   581  O OG1 . THR A 1 83  ? 27.915  9.945   55.438  1.00 34.44  ? 288 THR A OG1 1 
ATOM   582  C CG2 . THR A 1 83  ? 27.398  9.653   57.724  1.00 31.47  ? 288 THR A CG2 1 
ATOM   583  N N   . THR A 1 84  ? 29.439  12.409  58.783  1.00 32.19  ? 289 THR A N   1 
ATOM   584  C CA  . THR A 1 84  ? 29.690  12.803  60.157  1.00 31.71  ? 289 THR A CA  1 
ATOM   585  C C   . THR A 1 84  ? 29.226  14.214  60.457  1.00 32.11  ? 289 THR A C   1 
ATOM   586  O O   . THR A 1 84  ? 28.655  14.466  61.518  1.00 31.66  ? 289 THR A O   1 
ATOM   587  C CB  . THR A 1 84  ? 31.171  12.668  60.475  1.00 30.19  ? 289 THR A CB  1 
ATOM   588  O OG1 . THR A 1 84  ? 31.512  11.278  60.477  1.00 30.47  ? 289 THR A OG1 1 
ATOM   589  C CG2 . THR A 1 84  ? 31.506  13.299  61.809  1.00 25.41  ? 289 THR A CG2 1 
ATOM   590  N N   . VAL A 1 85  ? 29.469  15.133  59.526  1.00 31.27  ? 290 VAL A N   1 
ATOM   591  C CA  . VAL A 1 85  ? 29.058  16.519  59.701  1.00 31.85  ? 290 VAL A CA  1 
ATOM   592  C C   . VAL A 1 85  ? 27.564  16.592  59.838  1.00 32.62  ? 290 VAL A C   1 
ATOM   593  O O   . VAL A 1 85  ? 27.044  17.322  60.684  1.00 32.41  ? 290 VAL A O   1 
ATOM   594  C CB  . VAL A 1 85  ? 29.499  17.392  58.505  1.00 33.27  ? 290 VAL A CB  1 
ATOM   595  C CG1 . VAL A 1 85  ? 28.733  18.702  58.515  1.00 32.22  ? 290 VAL A CG1 1 
ATOM   596  C CG2 . VAL A 1 85  ? 31.001  17.660  58.581  1.00 31.01  ? 290 VAL A CG2 1 
ATOM   597  N N   . GLU A 1 86  ? 26.864  15.827  59.002  1.00 32.19  ? 291 GLU A N   1 
ATOM   598  C CA  . GLU A 1 86  ? 25.414  15.781  59.029  1.00 32.60  ? 291 GLU A CA  1 
ATOM   599  C C   . GLU A 1 86  ? 24.890  15.173  60.373  1.00 32.03  ? 291 GLU A C   1 
ATOM   600  O O   . GLU A 1 86  ? 23.922  15.671  60.946  1.00 32.90  ? 291 GLU A O   1 
ATOM   601  C CB  . GLU A 1 86  ? 24.906  14.964  57.838  1.00 36.03  ? 291 GLU A CB  1 
ATOM   602  C CG  . GLU A 1 86  ? 23.375  14.959  57.700  1.00 42.62  ? 291 GLU A CG  1 
ATOM   603  C CD  . GLU A 1 86  ? 22.773  16.361  57.758  1.00 46.03  ? 291 GLU A CD  1 
ATOM   604  O OE1 . GLU A 1 86  ? 23.202  17.233  56.961  1.00 46.60  ? 291 GLU A OE1 1 
ATOM   605  O OE2 . GLU A 1 86  ? 21.870  16.585  58.600  1.00 47.02  ? 291 GLU A OE2 1 
ATOM   606  N N   . THR A 1 87  ? 25.538  14.114  60.857  1.00 29.89  ? 292 THR A N   1 
ATOM   607  C CA  . THR A 1 87  ? 25.138  13.495  62.110  1.00 27.39  ? 292 THR A CA  1 
ATOM   608  C C   . THR A 1 87  ? 25.448  14.403  63.273  1.00 28.53  ? 292 THR A C   1 
ATOM   609  O O   . THR A 1 87  ? 24.793  14.328  64.307  1.00 29.34  ? 292 THR A O   1 
ATOM   610  C CB  . THR A 1 87  ? 25.839  12.153  62.329  1.00 28.06  ? 292 THR A CB  1 
ATOM   611  O OG1 . THR A 1 87  ? 25.658  11.322  61.171  1.00 29.47  ? 292 THR A OG1 1 
ATOM   612  C CG2 . THR A 1 87  ? 25.247  11.444  63.531  1.00 22.53  ? 292 THR A CG2 1 
ATOM   613  N N   . VAL A 1 88  ? 26.457  15.259  63.130  1.00 28.68  ? 293 VAL A N   1 
ATOM   614  C CA  . VAL A 1 88  ? 26.788  16.211  64.188  1.00 29.04  ? 293 VAL A CA  1 
ATOM   615  C C   . VAL A 1 88  ? 25.631  17.281  64.257  1.00 29.82  ? 293 VAL A C   1 
ATOM   616  O O   . VAL A 1 88  ? 25.232  17.701  65.343  1.00 27.39  ? 293 VAL A O   1 
ATOM   617  C CB  . VAL A 1 88  ? 28.158  16.932  63.931  1.00 29.18  ? 293 VAL A CB  1 
ATOM   618  C CG1 . VAL A 1 88  ? 28.372  18.036  64.971  1.00 26.75  ? 293 VAL A CG1 1 
ATOM   619  C CG2 . VAL A 1 88  ? 29.309  15.926  64.010  1.00 23.88  ? 293 VAL A CG2 1 
ATOM   620  N N   . ARG A 1 89  ? 25.112  17.686  63.097  1.00 32.08  ? 294 ARG A N   1 
ATOM   621  C CA  . ARG A 1 89  ? 24.016  18.650  63.047  1.00 35.31  ? 294 ARG A CA  1 
ATOM   622  C C   . ARG A 1 89  ? 22.770  18.079  63.767  1.00 36.56  ? 294 ARG A C   1 
ATOM   623  O O   . ARG A 1 89  ? 22.067  18.786  64.497  1.00 36.46  ? 294 ARG A O   1 
ATOM   624  C CB  . ARG A 1 89  ? 23.632  18.973  61.601  1.00 38.55  ? 294 ARG A CB  1 
ATOM   625  C CG  . ARG A 1 89  ? 24.663  19.781  60.789  1.00 43.71  ? 294 ARG A CG  1 
ATOM   626  C CD  . ARG A 1 89  ? 23.974  20.410  59.506  1.00 48.03  ? 294 ARG A CD  1 
ATOM   627  N NE  . ARG A 1 89  ? 24.911  21.140  58.647  1.00 51.33  ? 294 ARG A NE  1 
ATOM   628  C CZ  . ARG A 1 89  ? 25.513  20.623  57.575  1.00 54.10  ? 294 ARG A CZ  1 
ATOM   629  N NH1 . ARG A 1 89  ? 25.279  19.360  57.214  1.00 52.33  ? 294 ARG A NH1 1 
ATOM   630  N NH2 . ARG A 1 89  ? 26.353  21.371  56.858  1.00 53.82  ? 294 ARG A NH2 1 
ATOM   631  N N   . GLU A 1 90  ? 22.503  16.799  63.547  1.00 36.15  ? 295 GLU A N   1 
ATOM   632  C CA  . GLU A 1 90  ? 21.358  16.179  64.182  1.00 38.64  ? 295 GLU A CA  1 
ATOM   633  C C   . GLU A 1 90  ? 21.572  16.100  65.662  1.00 38.42  ? 295 GLU A C   1 
ATOM   634  O O   . GLU A 1 90  ? 20.698  16.463  66.440  1.00 40.24  ? 295 GLU A O   1 
ATOM   635  C CB  . GLU A 1 90  ? 21.123  14.790  63.600  1.00 40.05  ? 295 GLU A CB  1 
ATOM   636  C CG  . GLU A 1 90  ? 21.109  14.794  62.090  1.00 45.50  ? 295 GLU A CG  1 
ATOM   637  C CD  . GLU A 1 90  ? 20.429  13.579  61.497  1.00 49.66  ? 295 GLU A CD  1 
ATOM   638  O OE1 . GLU A 1 90  ? 20.832  12.438  61.829  1.00 50.59  ? 295 GLU A OE1 1 
ATOM   639  O OE2 . GLU A 1 90  ? 19.490  13.774  60.689  1.00 53.12  ? 295 GLU A OE2 1 
ATOM   640  N N   . LEU A 1 91  ? 22.747  15.630  66.064  1.00 37.46  ? 296 LEU A N   1 
ATOM   641  C CA  . LEU A 1 91  ? 23.090  15.505  67.473  1.00 34.38  ? 296 LEU A CA  1 
ATOM   642  C C   . LEU A 1 91  ? 22.935  16.775  68.154  1.00 33.22  ? 296 LEU A C   1 
ATOM   643  O O   . LEU A 1 91  ? 22.538  16.813  69.308  1.00 31.61  ? 296 LEU A O   1 
ATOM   644  C CB  . LEU A 1 91  ? 24.522  14.984  67.623  1.00 35.82  ? 296 LEU A CB  1 
ATOM   645  C CG  . LEU A 1 91  ? 24.677  13.497  67.271  1.00 34.94  ? 296 LEU A CG  1 
ATOM   646  C CD1 . LEU A 1 91  ? 26.147  13.084  67.272  1.00 35.29  ? 296 LEU A CD1 1 
ATOM   647  C CD2 . LEU A 1 91  ? 23.879  12.683  68.273  1.00 30.44  ? 296 LEU A CD2 1 
ATOM   648  N N   . THR A 1 92  ? 23.237  17.867  67.459  1.00 33.76  ? 297 THR A N   1 
ATOM   649  C CA  . THR A 1 92  ? 23.093  19.192  68.044  1.00 33.31  ? 297 THR A CA  1 
ATOM   650  C C   . THR A 1 92  ? 21.646  19.484  68.238  1.00 34.19  ? 297 THR A C   1 
ATOM   651  O O   . THR A 1 92  ? 21.228  19.830  69.343  1.00 33.95  ? 297 THR A O   1 
ATOM   652  C CB  . THR A 1 92  ? 23.714  20.284  67.154  1.00 34.54  ? 297 THR A CB  1 
ATOM   653  O OG1 . THR A 1 92  ? 25.123  20.053  67.019  1.00 32.38  ? 297 THR A OG1 1 
ATOM   654  C CG2 . THR A 1 92  ? 23.480  21.666  67.770  1.00 33.32  ? 297 THR A CG2 1 
ATOM   655  N N   . GLU A 1 93  ? 20.847  19.348  67.180  1.00 34.68  ? 298 GLU A N   1 
ATOM   656  C CA  . GLU A 1 93  ? 19.413  19.596  67.316  1.00 35.08  ? 298 GLU A CA  1 
ATOM   657  C C   . GLU A 1 93  ? 18.814  18.694  68.411  1.00 34.01  ? 298 GLU A C   1 
ATOM   658  O O   . GLU A 1 93  ? 18.015  19.140  69.231  1.00 34.34  ? 298 GLU A O   1 
ATOM   659  C CB  . GLU A 1 93  ? 18.688  19.364  65.991  1.00 37.19  ? 298 GLU A CB  1 
ATOM   660  C CG  . GLU A 1 93  ? 18.915  20.470  64.967  1.00 42.32  ? 298 GLU A CG  1 
ATOM   661  C CD  . GLU A 1 93  ? 18.847  21.851  65.591  1.00 46.55  ? 298 GLU A CD  1 
ATOM   662  O OE1 . GLU A 1 93  ? 17.903  22.100  66.370  1.00 50.24  ? 298 GLU A OE1 1 
ATOM   663  O OE2 . GLU A 1 93  ? 19.732  22.689  65.306  1.00 48.27  ? 298 GLU A OE2 1 
ATOM   664  N N   . PHE A 1 94  ? 19.202  17.428  68.423  1.00 31.40  ? 299 PHE A N   1 
ATOM   665  C CA  . PHE A 1 94  ? 18.709  16.516  69.439  1.00 31.96  ? 299 PHE A CA  1 
ATOM   666  C C   . PHE A 1 94  ? 19.036  17.071  70.824  1.00 32.44  ? 299 PHE A C   1 
ATOM   667  O O   . PHE A 1 94  ? 18.172  17.127  71.694  1.00 33.94  ? 299 PHE A O   1 
ATOM   668  C CB  . PHE A 1 94  ? 19.351  15.134  69.266  1.00 31.76  ? 299 PHE A CB  1 
ATOM   669  C CG  . PHE A 1 94  ? 19.094  14.192  70.408  1.00 29.49  ? 299 PHE A CG  1 
ATOM   670  C CD1 . PHE A 1 94  ? 17.800  13.861  70.779  1.00 28.88  ? 299 PHE A CD1 1 
ATOM   671  C CD2 . PHE A 1 94  ? 20.147  13.616  71.096  1.00 28.71  ? 299 PHE A CD2 1 
ATOM   672  C CE1 . PHE A 1 94  ? 17.566  12.977  71.806  1.00 26.02  ? 299 PHE A CE1 1 
ATOM   673  C CE2 . PHE A 1 94  ? 19.912  12.728  72.127  1.00 26.43  ? 299 PHE A CE2 1 
ATOM   674  C CZ  . PHE A 1 94  ? 18.621  12.409  72.478  1.00 25.02  ? 299 PHE A CZ  1 
ATOM   675  N N   . ALA A 1 95  ? 20.283  17.488  71.025  1.00 32.54  ? 300 ALA A N   1 
ATOM   676  C CA  . ALA A 1 95  ? 20.712  18.024  72.316  1.00 33.39  ? 300 ALA A CA  1 
ATOM   677  C C   . ALA A 1 95  ? 19.914  19.205  72.736  1.00 35.09  ? 300 ALA A C   1 
ATOM   678  O O   . ALA A 1 95  ? 19.537  19.324  73.899  1.00 35.60  ? 300 ALA A O   1 
ATOM   679  C CB  . ALA A 1 95  ? 22.193  18.377  72.277  1.00 30.01  ? 300 ALA A CB  1 
ATOM   680  N N   . LYS A 1 96  ? 19.647  20.102  71.794  1.00 38.87  ? 301 LYS A N   1 
ATOM   681  C CA  . LYS A 1 96  ? 18.862  21.301  72.070  1.00 41.93  ? 301 LYS A CA  1 
ATOM   682  C C   . LYS A 1 96  ? 17.352  20.950  72.334  1.00 44.86  ? 301 LYS A C   1 
ATOM   683  O O   . LYS A 1 96  ? 16.631  21.714  72.983  1.00 47.14  ? 301 LYS A O   1 
ATOM   684  C CB  . LYS A 1 96  ? 18.998  22.280  70.900  1.00 40.15  ? 301 LYS A CB  1 
ATOM   685  C CG  . LYS A 1 96  ? 20.407  22.862  70.769  1.00 42.89  ? 301 LYS A CG  1 
ATOM   686  C CD  . LYS A 1 96  ? 20.711  23.351  69.357  1.00 47.24  ? 301 LYS A CD  1 
ATOM   687  C CE  . LYS A 1 96  ? 19.827  24.526  68.949  1.00 51.95  ? 301 LYS A CE  1 
ATOM   688  N NZ  . LYS A 1 96  ? 20.037  24.898  67.518  1.00 54.54  ? 301 LYS A NZ  1 
ATOM   689  N N   . SER A 1 97  ? 16.901  19.802  71.831  1.00 45.70  ? 302 SER A N   1 
ATOM   690  C CA  . SER A 1 97  ? 15.524  19.378  72.045  1.00 46.12  ? 302 SER A CA  1 
ATOM   691  C C   . SER A 1 97  ? 15.339  18.821  73.467  1.00 47.41  ? 302 SER A C   1 
ATOM   692  O O   . SER A 1 97  ? 14.250  18.380  73.824  1.00 47.58  ? 302 SER A O   1 
ATOM   693  C CB  . SER A 1 97  ? 15.119  18.316  71.016  1.00 46.82  ? 302 SER A CB  1 
ATOM   694  O OG  . SER A 1 97  ? 14.982  18.863  69.710  1.00 48.21  ? 302 SER A OG  1 
ATOM   695  N N   . ILE A 1 98  ? 16.411  18.823  74.258  1.00 47.77  ? 303 ILE A N   1 
ATOM   696  C CA  . ILE A 1 98  ? 16.361  18.352  75.638  1.00 49.72  ? 303 ILE A CA  1 
ATOM   697  C C   . ILE A 1 98  ? 16.434  19.623  76.532  1.00 52.79  ? 303 ILE A C   1 
ATOM   698  O O   . ILE A 1 98  ? 17.495  20.233  76.689  1.00 52.34  ? 303 ILE A O   1 
ATOM   699  C CB  . ILE A 1 98  ? 17.553  17.445  75.968  1.00 49.57  ? 303 ILE A CB  1 
ATOM   700  C CG1 . ILE A 1 98  ? 17.613  16.281  74.987  1.00 49.84  ? 303 ILE A CG1 1 
ATOM   701  C CG2 . ILE A 1 98  ? 17.430  16.918  77.382  1.00 50.01  ? 303 ILE A CG2 1 
ATOM   702  C CD1 . ILE A 1 98  ? 18.844  15.386  75.182  1.00 48.93  ? 303 ILE A CD1 1 
ATOM   703  N N   . PRO A 1 99  ? 15.293  20.026  77.109  1.00 55.02  ? 304 PRO A N   1 
ATOM   704  C CA  . PRO A 1 99  ? 15.201  21.207  77.969  1.00 55.44  ? 304 PRO A CA  1 
ATOM   705  C C   . PRO A 1 99  ? 16.421  21.500  78.854  1.00 54.80  ? 304 PRO A C   1 
ATOM   706  O O   . PRO A 1 99  ? 17.036  22.558  78.723  1.00 55.43  ? 304 PRO A O   1 
ATOM   707  C CB  . PRO A 1 99  ? 13.929  20.940  78.767  1.00 55.93  ? 304 PRO A CB  1 
ATOM   708  C CG  . PRO A 1 99  ? 13.052  20.295  77.723  1.00 54.97  ? 304 PRO A CG  1 
ATOM   709  C CD  . PRO A 1 99  ? 14.004  19.306  77.075  1.00 55.10  ? 304 PRO A CD  1 
ATOM   710  N N   . SER A 1 100 ? 16.772  20.574  79.742  1.00 53.24  ? 305 SER A N   1 
ATOM   711  C CA  . SER A 1 100 ? 17.911  20.786  80.635  1.00 51.84  ? 305 SER A CA  1 
ATOM   712  C C   . SER A 1 100 ? 19.229  21.118  79.897  1.00 50.48  ? 305 SER A C   1 
ATOM   713  O O   . SER A 1 100 ? 20.064  21.853  80.417  1.00 50.00  ? 305 SER A O   1 
ATOM   714  C CB  . SER A 1 100 ? 18.094  19.569  81.547  1.00 51.78  ? 305 SER A CB  1 
ATOM   715  O OG  . SER A 1 100 ? 17.921  18.364  80.825  1.00 52.67  ? 305 SER A OG  1 
ATOM   716  N N   . PHE A 1 101 ? 19.405  20.581  78.694  1.00 49.18  ? 306 PHE A N   1 
ATOM   717  C CA  . PHE A 1 101 ? 20.605  20.859  77.913  1.00 48.45  ? 306 PHE A CA  1 
ATOM   718  C C   . PHE A 1 101 ? 20.680  22.344  77.459  1.00 48.64  ? 306 PHE A C   1 
ATOM   719  O O   . PHE A 1 101 ? 21.751  22.943  77.455  1.00 48.62  ? 306 PHE A O   1 
ATOM   720  C CB  . PHE A 1 101 ? 20.659  19.949  76.685  1.00 48.18  ? 306 PHE A CB  1 
ATOM   721  C CG  . PHE A 1 101 ? 21.845  20.206  75.794  1.00 47.45  ? 306 PHE A CG  1 
ATOM   722  C CD1 . PHE A 1 101 ? 21.732  21.027  74.685  1.00 45.94  ? 306 PHE A CD1 1 
ATOM   723  C CD2 . PHE A 1 101 ? 23.078  19.638  76.080  1.00 46.59  ? 306 PHE A CD2 1 
ATOM   724  C CE1 . PHE A 1 101 ? 22.823  21.278  73.876  1.00 45.26  ? 306 PHE A CE1 1 
ATOM   725  C CE2 . PHE A 1 101 ? 24.177  19.885  75.274  1.00 45.68  ? 306 PHE A CE2 1 
ATOM   726  C CZ  . PHE A 1 101 ? 24.048  20.706  74.171  1.00 45.45  ? 306 PHE A CZ  1 
ATOM   727  N N   . SER A 1 102 ? 19.538  22.908  77.070  1.00 49.00  ? 307 SER A N   1 
ATOM   728  C CA  . SER A 1 102 ? 19.469  24.296  76.629  1.00 49.36  ? 307 SER A CA  1 
ATOM   729  C C   . SER A 1 102 ? 19.599  25.270  77.777  1.00 49.84  ? 307 SER A C   1 
ATOM   730  O O   . SER A 1 102 ? 20.002  26.423  77.580  1.00 50.77  ? 307 SER A O   1 
ATOM   731  C CB  . SER A 1 102 ? 18.163  24.545  75.879  1.00 50.63  ? 307 SER A CB  1 
ATOM   732  O OG  . SER A 1 102 ? 18.162  23.835  74.652  1.00 53.19  ? 307 SER A OG  1 
ATOM   733  N N   . SER A 1 103 ? 19.258  24.820  78.983  1.00 49.18  ? 308 SER A N   1 
ATOM   734  C CA  . SER A 1 103 ? 19.380  25.662  80.168  1.00 48.78  ? 308 SER A CA  1 
ATOM   735  C C   . SER A 1 103 ? 20.839  26.090  80.303  1.00 47.66  ? 308 SER A C   1 
ATOM   736  O O   . SER A 1 103 ? 21.123  27.203  80.729  1.00 50.09  ? 308 SER A O   1 
ATOM   737  C CB  . SER A 1 103 ? 18.961  24.893  81.432  1.00 51.80  ? 308 SER A CB  1 
ATOM   738  O OG  . SER A 1 103 ? 20.029  24.122  81.980  1.00 51.25  ? 308 SER A OG  1 
ATOM   739  N N   . LEU A 1 104 ? 21.751  25.191  79.934  1.00 45.21  ? 309 LEU A N   1 
ATOM   740  C CA  . LEU A 1 104 ? 23.188  25.423  79.993  1.00 42.89  ? 309 LEU A CA  1 
ATOM   741  C C   . LEU A 1 104 ? 23.632  26.566  79.109  1.00 43.13  ? 309 LEU A C   1 
ATOM   742  O O   . LEU A 1 104 ? 23.009  26.864  78.096  1.00 41.98  ? 309 LEU A O   1 
ATOM   743  C CB  . LEU A 1 104 ? 23.930  24.155  79.568  1.00 41.49  ? 309 LEU A CB  1 
ATOM   744  C CG  . LEU A 1 104 ? 23.691  22.891  80.392  1.00 40.42  ? 309 LEU A CG  1 
ATOM   745  C CD1 . LEU A 1 104 ? 24.348  21.698  79.725  1.00 39.19  ? 309 LEU A CD1 1 
ATOM   746  C CD2 . LEU A 1 104 ? 24.234  23.093  81.783  1.00 40.41  ? 309 LEU A CD2 1 
ATOM   747  N N   . PHE A 1 105 ? 24.730  27.210  79.483  1.00 44.16  ? 310 PHE A N   1 
ATOM   748  C CA  . PHE A 1 105 ? 25.237  28.312  78.687  1.00 43.83  ? 310 PHE A CA  1 
ATOM   749  C C   . PHE A 1 105 ? 25.717  27.834  77.415  1.00 43.46  ? 310 PHE A C   1 
ATOM   750  O O   . PHE A 1 105 ? 26.308  26.753  77.325  1.00 43.73  ? 310 PHE A O   1 
ATOM   751  C CB  . PHE A 1 105 ? 26.325  29.058  79.448  1.00 44.28  ? 310 PHE A CB  1 
ATOM   752  C CG  . PHE A 1 105 ? 25.779  30.115  80.361  1.00 47.97  ? 310 PHE A CG  1 
ATOM   753  C CD1 . PHE A 1 105 ? 25.189  31.256  79.834  1.00 47.37  ? 310 PHE A CD1 1 
ATOM   754  C CD2 . PHE A 1 105 ? 25.794  29.945  81.742  1.00 48.42  ? 310 PHE A CD2 1 
ATOM   755  C CE1 . PHE A 1 105 ? 24.624  32.204  80.663  1.00 48.65  ? 310 PHE A CE1 1 
ATOM   756  C CE2 . PHE A 1 105 ? 25.227  30.895  82.579  1.00 47.89  ? 310 PHE A CE2 1 
ATOM   757  C CZ  . PHE A 1 105 ? 24.642  32.023  82.039  1.00 49.04  ? 310 PHE A CZ  1 
ATOM   758  N N   . LEU A 1 106 ? 25.468  28.627  76.380  1.00 42.30  ? 311 LEU A N   1 
ATOM   759  C CA  . LEU A 1 106 ? 25.845  28.269  75.020  1.00 41.54  ? 311 LEU A CA  1 
ATOM   760  C C   . LEU A 1 106 ? 27.245  27.651  74.913  1.00 41.10  ? 311 LEU A C   1 
ATOM   761  O O   . LEU A 1 106 ? 27.448  26.654  74.210  1.00 40.26  ? 311 LEU A O   1 
ATOM   762  C CB  . LEU A 1 106 ? 25.736  29.496  74.110  1.00 41.89  ? 311 LEU A CB  1 
ATOM   763  C CG  . LEU A 1 106 ? 25.394  29.129  72.661  1.00 42.83  ? 311 LEU A CG  1 
ATOM   764  C CD1 . LEU A 1 106 ? 24.094  28.326  72.660  1.00 42.37  ? 311 LEU A CD1 1 
ATOM   765  C CD2 . LEU A 1 106 ? 25.265  30.374  71.802  1.00 39.40  ? 311 LEU A CD2 1 
ATOM   766  N N   . ASN A 1 107 ? 28.203  28.245  75.615  1.00 39.30  ? 312 ASN A N   1 
ATOM   767  C CA  . ASN A 1 107 ? 29.573  27.758  75.596  1.00 37.63  ? 312 ASN A CA  1 
ATOM   768  C C   . ASN A 1 107 ? 29.695  26.289  76.151  1.00 36.27  ? 312 ASN A C   1 
ATOM   769  O O   . ASN A 1 107 ? 30.421  25.471  75.589  1.00 34.72  ? 312 ASN A O   1 
ATOM   770  C CB  . ASN A 1 107 ? 30.480  28.729  76.373  1.00 37.27  ? 312 ASN A CB  1 
ATOM   771  C CG  . ASN A 1 107 ? 30.010  28.963  77.805  1.00 37.06  ? 312 ASN A CG  1 
ATOM   772  O OD1 . ASN A 1 107 ? 28.837  29.211  78.058  1.00 37.52  ? 312 ASN A OD1 1 
ATOM   773  N ND2 . ASN A 1 107 ? 30.939  28.899  78.744  1.00 38.41  ? 312 ASN A ND2 1 
ATOM   774  N N   . ASP A 1 108 ? 28.996  25.971  77.233  1.00 34.22  ? 313 ASP A N   1 
ATOM   775  C CA  . ASP A 1 108 ? 29.068  24.610  77.739  1.00 35.80  ? 313 ASP A CA  1 
ATOM   776  C C   . ASP A 1 108 ? 28.387  23.625  76.762  1.00 36.57  ? 313 ASP A C   1 
ATOM   777  O O   . ASP A 1 108 ? 28.842  22.489  76.599  1.00 36.58  ? 313 ASP A O   1 
ATOM   778  C CB  . ASP A 1 108 ? 28.447  24.498  79.130  1.00 34.54  ? 313 ASP A CB  1 
ATOM   779  C CG  . ASP A 1 108 ? 29.431  24.867  80.227  1.00 36.10  ? 313 ASP A CG  1 
ATOM   780  O OD1 . ASP A 1 108 ? 30.640  24.924  79.927  1.00 35.24  ? 313 ASP A OD1 1 
ATOM   781  O OD2 . ASP A 1 108 ? 29.011  25.092  81.382  1.00 36.64  ? 313 ASP A OD2 1 
ATOM   782  N N   . GLN A 1 109 ? 27.307  24.065  76.120  1.00 35.08  ? 314 GLN A N   1 
ATOM   783  C CA  . GLN A 1 109 ? 26.625  23.224  75.154  1.00 34.58  ? 314 GLN A CA  1 
ATOM   784  C C   . GLN A 1 109 ? 27.646  22.795  74.083  1.00 33.45  ? 314 GLN A C   1 
ATOM   785  O O   . GLN A 1 109 ? 27.766  21.622  73.739  1.00 33.27  ? 314 GLN A O   1 
ATOM   786  C CB  . GLN A 1 109 ? 25.476  23.999  74.510  1.00 35.38  ? 314 GLN A CB  1 
ATOM   787  C CG  . GLN A 1 109 ? 24.281  24.177  75.435  1.00 39.15  ? 314 GLN A CG  1 
ATOM   788  C CD  . GLN A 1 109 ? 23.167  24.981  74.794  1.00 40.22  ? 314 GLN A CD  1 
ATOM   789  O OE1 . GLN A 1 109 ? 22.912  24.855  73.598  1.00 43.54  ? 314 GLN A OE1 1 
ATOM   790  N NE2 . GLN A 1 109 ? 22.488  25.802  75.589  1.00 38.62  ? 314 GLN A NE2 1 
ATOM   791  N N   . VAL A 1 110 ? 28.392  23.762  73.575  1.00 32.00  ? 315 VAL A N   1 
ATOM   792  C CA  . VAL A 1 110 ? 29.397  23.487  72.565  1.00 30.72  ? 315 VAL A CA  1 
ATOM   793  C C   . VAL A 1 110 ? 30.498  22.570  73.109  1.00 29.92  ? 315 VAL A C   1 
ATOM   794  O O   . VAL A 1 110 ? 31.049  21.765  72.367  1.00 31.75  ? 315 VAL A O   1 
ATOM   795  C CB  . VAL A 1 110 ? 29.994  24.825  72.026  1.00 29.81  ? 315 VAL A CB  1 
ATOM   796  C CG1 . VAL A 1 110 ? 31.160  24.566  71.117  1.00 29.20  ? 315 VAL A CG1 1 
ATOM   797  C CG2 . VAL A 1 110 ? 28.905  25.603  71.269  1.00 29.54  ? 315 VAL A CG2 1 
ATOM   798  N N   . THR A 1 111 ? 30.813  22.685  74.396  1.00 29.36  ? 316 THR A N   1 
ATOM   799  C CA  . THR A 1 111 ? 31.843  21.852  75.004  1.00 29.39  ? 316 THR A CA  1 
ATOM   800  C C   . THR A 1 111 ? 31.373  20.376  75.076  1.00 30.40  ? 316 THR A C   1 
ATOM   801  O O   . THR A 1 111 ? 32.140  19.454  74.793  1.00 29.06  ? 316 THR A O   1 
ATOM   802  C CB  . THR A 1 111 ? 32.207  22.354  76.434  1.00 31.13  ? 316 THR A CB  1 
ATOM   803  O OG1 . THR A 1 111 ? 32.920  23.595  76.342  1.00 30.34  ? 316 THR A OG1 1 
ATOM   804  C CG2 . THR A 1 111 ? 33.076  21.326  77.167  1.00 30.47  ? 316 THR A CG2 1 
ATOM   805  N N   . LEU A 1 112 ? 30.115  20.170  75.451  1.00 29.95  ? 317 LEU A N   1 
ATOM   806  C CA  . LEU A 1 112 ? 29.569  18.824  75.525  1.00 30.10  ? 317 LEU A CA  1 
ATOM   807  C C   . LEU A 1 112 ? 29.507  18.182  74.141  1.00 30.89  ? 317 LEU A C   1 
ATOM   808  O O   . LEU A 1 112 ? 29.847  17.013  73.986  1.00 33.36  ? 317 LEU A O   1 
ATOM   809  C CB  . LEU A 1 112 ? 28.184  18.852  76.164  1.00 29.06  ? 317 LEU A CB  1 
ATOM   810  C CG  . LEU A 1 112 ? 28.225  19.206  77.651  1.00 29.90  ? 317 LEU A CG  1 
ATOM   811  C CD1 . LEU A 1 112 ? 26.814  19.312  78.182  1.00 28.25  ? 317 LEU A CD1 1 
ATOM   812  C CD2 . LEU A 1 112 ? 29.028  18.143  78.419  1.00 26.35  ? 317 LEU A CD2 1 
ATOM   813  N N   . LEU A 1 113 ? 29.075  18.940  73.136  1.00 29.51  ? 318 LEU A N   1 
ATOM   814  C CA  . LEU A 1 113 ? 29.001  18.425  71.767  1.00 28.61  ? 318 LEU A CA  1 
ATOM   815  C C   . LEU A 1 113 ? 30.395  18.159  71.200  1.00 30.06  ? 318 LEU A C   1 
ATOM   816  O O   . LEU A 1 113 ? 30.637  17.116  70.581  1.00 29.66  ? 318 LEU A O   1 
ATOM   817  C CB  . LEU A 1 113 ? 28.275  19.419  70.862  1.00 26.44  ? 318 LEU A CB  1 
ATOM   818  C CG  . LEU A 1 113 ? 26.781  19.563  71.115  1.00 25.68  ? 318 LEU A CG  1 
ATOM   819  C CD1 . LEU A 1 113 ? 26.217  20.683  70.272  1.00 25.16  ? 318 LEU A CD1 1 
ATOM   820  C CD2 . LEU A 1 113 ? 26.094  18.253  70.803  1.00 24.72  ? 318 LEU A CD2 1 
ATOM   821  N N   . LYS A 1 114 ? 31.302  19.113  71.410  1.00 30.24  ? 319 LYS A N   1 
ATOM   822  C CA  . LYS A 1 114 ? 32.682  19.002  70.944  1.00 30.23  ? 319 LYS A CA  1 
ATOM   823  C C   . LYS A 1 114 ? 33.358  17.704  71.400  1.00 29.25  ? 319 LYS A C   1 
ATOM   824  O O   . LYS A 1 114 ? 34.049  17.048  70.638  1.00 29.96  ? 319 LYS A O   1 
ATOM   825  C CB  . LYS A 1 114 ? 33.499  20.198  71.438  1.00 28.51  ? 319 LYS A CB  1 
ATOM   826  C CG  . LYS A 1 114 ? 35.002  20.096  71.135  1.00 29.27  ? 319 LYS A CG  1 
ATOM   827  C CD  . LYS A 1 114 ? 35.774  21.338  71.665  1.00 31.44  ? 319 LYS A CD  1 
ATOM   828  C CE  . LYS A 1 114 ? 37.273  21.032  71.980  1.00 29.72  ? 319 LYS A CE  1 
ATOM   829  N NZ  . LYS A 1 114 ? 38.062  20.618  70.790  1.00 32.31  ? 319 LYS A NZ  1 
ATOM   830  N N   . TYR A 1 115 ? 33.133  17.324  72.639  1.00 29.53  ? 320 TYR A N   1 
ATOM   831  C CA  . TYR A 1 115 ? 33.748  16.127  73.163  1.00 31.12  ? 320 TYR A CA  1 
ATOM   832  C C   . TYR A 1 115 ? 32.894  14.897  73.200  1.00 30.65  ? 320 TYR A C   1 
ATOM   833  O O   . TYR A 1 115 ? 33.395  13.804  73.462  1.00 29.18  ? 320 TYR A O   1 
ATOM   834  C CB  . TYR A 1 115 ? 34.272  16.428  74.567  1.00 35.50  ? 320 TYR A CB  1 
ATOM   835  C CG  . TYR A 1 115 ? 35.475  17.336  74.556  1.00 39.17  ? 320 TYR A CG  1 
ATOM   836  C CD1 . TYR A 1 115 ? 36.702  16.877  74.094  1.00 40.37  ? 320 TYR A CD1 1 
ATOM   837  C CD2 . TYR A 1 115 ? 35.385  18.653  74.989  1.00 39.85  ? 320 TYR A CD2 1 
ATOM   838  C CE1 . TYR A 1 115 ? 37.800  17.698  74.068  1.00 42.03  ? 320 TYR A CE1 1 
ATOM   839  C CE2 . TYR A 1 115 ? 36.481  19.482  74.963  1.00 41.15  ? 320 TYR A CE2 1 
ATOM   840  C CZ  . TYR A 1 115 ? 37.686  18.997  74.504  1.00 41.30  ? 320 TYR A CZ  1 
ATOM   841  O OH  . TYR A 1 115 ? 38.796  19.799  74.495  1.00 45.02  ? 320 TYR A OH  1 
ATOM   842  N N   . GLY A 1 116 ? 31.602  15.037  72.928  1.00 31.28  ? 321 GLY A N   1 
ATOM   843  C CA  . GLY A 1 116 ? 30.740  13.873  72.997  1.00 30.22  ? 321 GLY A CA  1 
ATOM   844  C C   . GLY A 1 116 ? 30.159  13.323  71.711  1.00 30.80  ? 321 GLY A C   1 
ATOM   845  O O   . GLY A 1 116 ? 29.733  12.168  71.679  1.00 28.90  ? 321 GLY A O   1 
ATOM   846  N N   . VAL A 1 117 ? 30.159  14.109  70.641  1.00 30.29  ? 322 VAL A N   1 
ATOM   847  C CA  . VAL A 1 117 ? 29.541  13.633  69.410  1.00 30.78  ? 322 VAL A CA  1 
ATOM   848  C C   . VAL A 1 117 ? 30.119  12.444  68.767  1.00 31.26  ? 322 VAL A C   1 
ATOM   849  O O   . VAL A 1 117 ? 29.387  11.647  68.216  1.00 32.84  ? 322 VAL A O   1 
ATOM   850  C CB  . VAL A 1 117 ? 29.415  14.761  68.340  1.00 30.25  ? 322 VAL A CB  1 
ATOM   851  C CG1 . VAL A 1 117 ? 28.368  15.783  68.794  1.00 26.90  ? 322 VAL A CG1 1 
ATOM   852  C CG2 . VAL A 1 117 ? 30.770  15.412  68.083  1.00 24.20  ? 322 VAL A CG2 1 
ATOM   853  N N   . HIS A 1 118 ? 31.432  12.274  68.791  1.00 30.75  ? 323 HIS A N   1 
ATOM   854  C CA  . HIS A 1 118 ? 31.964  11.096  68.143  1.00 29.72  ? 323 HIS A CA  1 
ATOM   855  C C   . HIS A 1 118 ? 31.589  9.888   68.857  1.00 29.90  ? 323 HIS A C   1 
ATOM   856  O O   . HIS A 1 118 ? 31.319  8.862   68.242  1.00 28.49  ? 323 HIS A O   1 
ATOM   857  C CB  . HIS A 1 118 ? 33.469  11.207  67.969  1.00 30.66  ? 323 HIS A CB  1 
ATOM   858  C CG  . HIS A 1 118 ? 33.857  12.083  66.823  1.00 30.94  ? 323 HIS A CG  1 
ATOM   859  N ND1 . HIS A 1 118 ? 33.920  13.454  66.926  1.00 31.21  ? 323 HIS A ND1 1 
ATOM   860  C CD2 . HIS A 1 118 ? 34.097  11.792  65.523  1.00 31.87  ? 323 HIS A CD2 1 
ATOM   861  C CE1 . HIS A 1 118 ? 34.178  13.971  65.739  1.00 31.84  ? 323 HIS A CE1 1 
ATOM   862  N NE2 . HIS A 1 118 ? 34.288  12.984  64.870  1.00 31.41  ? 323 HIS A NE2 1 
ATOM   863  N N   . GLU A 1 119 ? 31.545  9.973   70.179  1.00 29.32  ? 324 GLU A N   1 
ATOM   864  C CA  . GLU A 1 119 ? 31.124  8.841   70.984  1.00 30.25  ? 324 GLU A CA  1 
ATOM   865  C C   . GLU A 1 119 ? 29.695  8.508   70.610  1.00 30.12  ? 324 GLU A C   1 
ATOM   866  O O   . GLU A 1 119 ? 29.352  7.349   70.429  1.00 31.68  ? 324 GLU A O   1 
ATOM   867  C CB  . GLU A 1 119 ? 31.216  9.180   72.474  1.00 30.57  ? 324 GLU A CB  1 
ATOM   868  C CG  . GLU A 1 119 ? 32.558  8.824   73.117  1.00 31.11  ? 324 GLU A CG  1 
ATOM   869  C CD  . GLU A 1 119 ? 32.789  9.543   74.436  1.00 34.74  ? 324 GLU A CD  1 
ATOM   870  O OE1 . GLU A 1 119 ? 31.833  9.653   75.236  1.00 35.37  ? 324 GLU A OE1 1 
ATOM   871  O OE2 . GLU A 1 119 ? 33.932  9.989   74.677  1.00 36.59  ? 324 GLU A OE2 1 
ATOM   872  N N   . ALA A 1 120 ? 28.859  9.531   70.481  1.00 30.40  ? 325 ALA A N   1 
ATOM   873  C CA  . ALA A 1 120 ? 27.458  9.343   70.117  1.00 30.71  ? 325 ALA A CA  1 
ATOM   874  C C   . ALA A 1 120 ? 27.320  8.798   68.729  1.00 31.08  ? 325 ALA A C   1 
ATOM   875  O O   . ALA A 1 120 ? 26.489  7.928   68.472  1.00 33.42  ? 325 ALA A O   1 
ATOM   876  C CB  . ALA A 1 120 ? 26.714  10.651  70.219  1.00 29.31  ? 325 ALA A CB  1 
ATOM   877  N N   . ILE A 1 121 ? 28.134  9.313   67.821  1.00 28.73  ? 326 ILE A N   1 
ATOM   878  C CA  . ILE A 1 121 ? 28.121  8.890   66.435  1.00 27.77  ? 326 ILE A CA  1 
ATOM   879  C C   . ILE A 1 121 ? 28.483  7.424   66.301  1.00 29.59  ? 326 ILE A C   1 
ATOM   880  O O   . ILE A 1 121 ? 27.865  6.696   65.535  1.00 29.25  ? 326 ILE A O   1 
ATOM   881  C CB  . ILE A 1 121 ? 29.114  9.727   65.614  1.00 26.42  ? 326 ILE A CB  1 
ATOM   882  C CG1 . ILE A 1 121 ? 28.615  11.166  65.507  1.00 26.31  ? 326 ILE A CG1 1 
ATOM   883  C CG2 . ILE A 1 121 ? 29.308  9.121   64.248  1.00 23.09  ? 326 ILE A CG2 1 
ATOM   884  C CD1 . ILE A 1 121 ? 29.552  12.069  64.732  1.00 29.30  ? 326 ILE A CD1 1 
ATOM   885  N N   . PHE A 1 122 ? 29.481  6.973   67.052  1.00 29.74  ? 327 PHE A N   1 
ATOM   886  C CA  . PHE A 1 122 ? 29.879  5.584   66.945  1.00 28.89  ? 327 PHE A CA  1 
ATOM   887  C C   . PHE A 1 122 ? 28.968  4.736   67.579  1.00 29.89  ? 327 PHE A C   1 
ATOM   888  O O   . PHE A 1 122 ? 28.893  3.567   67.256  1.00 30.95  ? 327 PHE A O   1 
ATOM   889  C CB  . PHE A 1 122 ? 31.302  5.378   67.461  1.00 27.15  ? 327 PHE A CB  1 
ATOM   890  C CG  . PHE A 1 122 ? 32.333  6.078   66.623  1.00 27.49  ? 327 PHE A CG  1 
ATOM   891  C CD1 . PHE A 1 122 ? 32.141  6.213   65.258  1.00 29.48  ? 327 PHE A CD1 1 
ATOM   892  C CD2 . PHE A 1 122 ? 33.458  6.634   67.190  1.00 25.68  ? 327 PHE A CD2 1 
ATOM   893  C CE1 . PHE A 1 122 ? 33.053  6.899   64.483  1.00 32.37  ? 327 PHE A CE1 1 
ATOM   894  C CE2 . PHE A 1 122 ? 34.372  7.319   66.428  1.00 26.62  ? 327 PHE A CE2 1 
ATOM   895  C CZ  . PHE A 1 122 ? 34.176  7.457   65.074  1.00 31.67  ? 327 PHE A CZ  1 
ATOM   896  N N   . ALA A 1 123 ? 28.205  5.275   68.519  1.00 32.18  ? 328 ALA A N   1 
ATOM   897  C CA  . ALA A 1 123 ? 27.185  4.488   69.198  1.00 33.00  ? 328 ALA A CA  1 
ATOM   898  C C   . ALA A 1 123 ? 26.077  4.204   68.175  1.00 33.08  ? 328 ALA A C   1 
ATOM   899  O O   . ALA A 1 123 ? 25.729  3.055   67.931  1.00 33.74  ? 328 ALA A O   1 
ATOM   900  C CB  . ALA A 1 123 ? 26.623  5.261   70.376  1.00 33.37  ? 328 ALA A CB  1 
ATOM   901  N N   . MET A 1 124 ? 25.548  5.263   67.573  1.00 32.47  ? 329 MET A N   1 
ATOM   902  C CA  . MET A 1 124 ? 24.492  5.147   66.574  1.00 33.58  ? 329 MET A CA  1 
ATOM   903  C C   . MET A 1 124 ? 24.944  4.432   65.292  1.00 32.81  ? 329 MET A C   1 
ATOM   904  O O   . MET A 1 124 ? 24.124  3.901   64.550  1.00 32.84  ? 329 MET A O   1 
ATOM   905  C CB  . MET A 1 124 ? 23.977  6.530   66.183  1.00 34.87  ? 329 MET A CB  1 
ATOM   906  C CG  . MET A 1 124 ? 23.571  7.392   67.331  1.00 35.71  ? 329 MET A CG  1 
ATOM   907  S SD  . MET A 1 124 ? 23.221  9.048   66.745  1.00 39.62  ? 329 MET A SD  1 
ATOM   908  C CE  . MET A 1 124 ? 21.445  8.993   66.707  1.00 37.92  ? 329 MET A CE  1 
ATOM   909  N N   . LEU A 1 125 ? 26.239  4.438   65.013  1.00 32.43  ? 330 LEU A N   1 
ATOM   910  C CA  . LEU A 1 125 ? 26.721  3.771   63.811  1.00 32.47  ? 330 LEU A CA  1 
ATOM   911  C C   . LEU A 1 125 ? 26.250  2.327   63.838  1.00 33.88  ? 330 LEU A C   1 
ATOM   912  O O   . LEU A 1 125 ? 25.871  1.765   62.807  1.00 33.63  ? 330 LEU A O   1 
ATOM   913  C CB  . LEU A 1 125 ? 28.243  3.810   63.748  1.00 28.64  ? 330 LEU A CB  1 
ATOM   914  C CG  . LEU A 1 125 ? 28.826  3.053   62.564  1.00 26.18  ? 330 LEU A CG  1 
ATOM   915  C CD1 . LEU A 1 125 ? 28.377  3.710   61.279  1.00 26.09  ? 330 LEU A CD1 1 
ATOM   916  C CD2 . LEU A 1 125 ? 30.331  3.036   62.644  1.00 25.73  ? 330 LEU A CD2 1 
ATOM   917  N N   . ALA A 1 126 ? 26.275  1.737   65.032  1.00 35.37  ? 331 ALA A N   1 
ATOM   918  C CA  . ALA A 1 126 ? 25.856  0.355   65.243  1.00 37.22  ? 331 ALA A CA  1 
ATOM   919  C C   . ALA A 1 126 ? 24.489  0.088   64.682  1.00 38.11  ? 331 ALA A C   1 
ATOM   920  O O   . ALA A 1 126 ? 24.238  -0.976  64.130  1.00 40.40  ? 331 ALA A O   1 
ATOM   921  C CB  . ALA A 1 126 ? 25.888  0.024   66.730  1.00 36.43  ? 331 ALA A CB  1 
ATOM   922  N N   . SER A 1 127 ? 23.589  1.053   64.810  1.00 39.13  ? 332 SER A N   1 
ATOM   923  C CA  . SER A 1 127 ? 22.231  0.905   64.299  1.00 37.92  ? 332 SER A CA  1 
ATOM   924  C C   . SER A 1 127 ? 22.138  0.562   62.768  1.00 37.96  ? 332 SER A C   1 
ATOM   925  O O   . SER A 1 127 ? 21.287  -0.228  62.367  1.00 40.17  ? 332 SER A O   1 
ATOM   926  C CB  . SER A 1 127 ? 21.439  2.176   64.586  1.00 37.29  ? 332 SER A CB  1 
ATOM   927  O OG  . SER A 1 127 ? 21.346  2.394   65.979  1.00 37.52  ? 332 SER A OG  1 
ATOM   928  N N   . ILE A 1 128 ? 23.000  1.152   61.946  1.00 35.59  ? 333 ILE A N   1 
ATOM   929  C CA  . ILE A 1 128 ? 22.973  0.893   60.503  1.00 35.50  ? 333 ILE A CA  1 
ATOM   930  C C   . ILE A 1 128 ? 24.053  -0.085  60.058  1.00 36.52  ? 333 ILE A C   1 
ATOM   931  O O   . ILE A 1 128 ? 24.388  -0.153  58.875  1.00 35.58  ? 333 ILE A O   1 
ATOM   932  C CB  . ILE A 1 128 ? 23.194  2.182   59.704  1.00 32.64  ? 333 ILE A CB  1 
ATOM   933  C CG1 . ILE A 1 128 ? 24.673  2.587   59.783  1.00 33.31  ? 333 ILE A CG1 1 
ATOM   934  C CG2 . ILE A 1 128 ? 22.332  3.279   60.264  1.00 33.26  ? 333 ILE A CG2 1 
ATOM   935  C CD1 . ILE A 1 128 ? 25.019  3.905   59.089  1.00 31.65  ? 333 ILE A CD1 1 
ATOM   936  N N   . VAL A 1 129 ? 24.583  -0.858  60.994  1.00 37.27  ? 334 VAL A N   1 
ATOM   937  C CA  . VAL A 1 129 ? 25.663  -1.779  60.677  1.00 40.63  ? 334 VAL A CA  1 
ATOM   938  C C   . VAL A 1 129 ? 25.383  -3.202  60.986  1.00 42.27  ? 334 VAL A C   1 
ATOM   939  O O   . VAL A 1 129 ? 24.874  -3.506  62.059  1.00 42.94  ? 334 VAL A O   1 
ATOM   940  C CB  . VAL A 1 129 ? 26.962  -1.355  61.460  1.00 41.94  ? 334 VAL A CB  1 
ATOM   941  C CG1 . VAL A 1 129 ? 27.883  -2.538  61.663  1.00 40.80  ? 334 VAL A CG1 1 
ATOM   942  C CG2 . VAL A 1 129 ? 27.698  -0.254  60.714  1.00 42.61  ? 334 VAL A CG2 1 
ATOM   943  N N   . ASN A 1 130 ? 25.682  -4.106  60.055  1.00 44.36  ? 335 ASN A N   1 
ATOM   944  C CA  . ASN A 1 130 ? 25.530  -5.532  60.357  1.00 47.86  ? 335 ASN A CA  1 
ATOM   945  C C   . ASN A 1 130 ? 26.921  -6.171  60.130  1.00 48.02  ? 335 ASN A C   1 
ATOM   946  O O   . ASN A 1 130 ? 27.818  -5.518  59.610  1.00 48.72  ? 335 ASN A O   1 
ATOM   947  C CB  . ASN A 1 130 ? 24.425  -6.210  59.513  1.00 48.79  ? 335 ASN A CB  1 
ATOM   948  C CG  . ASN A 1 130 ? 24.846  -6.509  58.092  1.00 49.98  ? 335 ASN A CG  1 
ATOM   949  O OD1 . ASN A 1 130 ? 25.858  -7.166  57.857  1.00 50.58  ? 335 ASN A OD1 1 
ATOM   950  N ND2 . ASN A 1 130 ? 24.052  -6.046  57.130  1.00 49.36  ? 335 ASN A ND2 1 
ATOM   951  N N   . LYS A 1 131 ? 27.099  -7.419  60.547  1.00 49.78  ? 336 LYS A N   1 
ATOM   952  C CA  . LYS A 1 131 ? 28.384  -8.110  60.406  1.00 51.10  ? 336 LYS A CA  1 
ATOM   953  C C   . LYS A 1 131 ? 29.142  -7.859  59.075  1.00 49.92  ? 336 LYS A C   1 
ATOM   954  O O   . LYS A 1 131 ? 30.371  -7.770  59.068  1.00 48.80  ? 336 LYS A O   1 
ATOM   955  C CB  . LYS A 1 131 ? 28.183  -9.621  60.604  1.00 54.60  ? 336 LYS A CB  1 
ATOM   956  C CG  . LYS A 1 131 ? 27.056  -10.222 59.703  1.00 62.30  ? 336 LYS A CG  1 
ATOM   957  C CD  . LYS A 1 131 ? 26.721  -11.704 60.038  1.00 64.42  ? 336 LYS A CD  1 
ATOM   958  C CE  . LYS A 1 131 ? 25.320  -12.123 59.452  1.00 65.51  ? 336 LYS A CE  1 
ATOM   959  N NZ  . LYS A 1 131 ? 25.231  -12.052 57.960  1.00 67.25  ? 336 LYS A NZ  1 
ATOM   960  N N   . ASP A 1 132 ? 28.401  -7.726  57.978  1.00 48.71  ? 337 ASP A N   1 
ATOM   961  C CA  . ASP A 1 132 ? 28.991  -7.522  56.659  1.00 49.13  ? 337 ASP A CA  1 
ATOM   962  C C   . ASP A 1 132 ? 29.125  -6.132  56.096  1.00 47.77  ? 337 ASP A C   1 
ATOM   963  O O   . ASP A 1 132 ? 29.888  -5.934  55.152  1.00 46.60  ? 337 ASP A O   1 
ATOM   964  C CB  . ASP A 1 132 ? 28.251  -8.373  55.635  1.00 51.24  ? 337 ASP A CB  1 
ATOM   965  C CG  . ASP A 1 132 ? 28.502  -9.836  55.829  1.00 54.26  ? 337 ASP A CG  1 
ATOM   966  O OD1 . ASP A 1 132 ? 29.693  -10.226 55.840  1.00 55.26  ? 337 ASP A OD1 1 
ATOM   967  O OD2 . ASP A 1 132 ? 27.516  -10.589 55.974  1.00 56.58  ? 337 ASP A OD2 1 
ATOM   968  N N   . GLY A 1 133 ? 28.394  -5.162  56.630  1.00 45.43  ? 338 GLY A N   1 
ATOM   969  C CA  . GLY A 1 133 ? 28.512  -3.821  56.085  1.00 42.96  ? 338 GLY A CA  1 
ATOM   970  C C   . GLY A 1 133 ? 27.636  -2.780  56.743  1.00 40.66  ? 338 GLY A C   1 
ATOM   971  O O   . GLY A 1 133 ? 27.183  -2.964  57.870  1.00 41.57  ? 338 GLY A O   1 
ATOM   972  N N   . LEU A 1 134 ? 27.384  -1.687  56.033  1.00 37.15  ? 339 LEU A N   1 
ATOM   973  C CA  . LEU A 1 134 ? 26.578  -0.619  56.588  1.00 35.59  ? 339 LEU A CA  1 
ATOM   974  C C   . LEU A 1 134 ? 25.830  0.173   55.572  1.00 36.17  ? 339 LEU A C   1 
ATOM   975  O O   . LEU A 1 134 ? 26.268  0.326   54.438  1.00 36.95  ? 339 LEU A O   1 
ATOM   976  C CB  . LEU A 1 134 ? 27.470  0.312   57.415  1.00 34.89  ? 339 LEU A CB  1 
ATOM   977  C CG  . LEU A 1 134 ? 28.611  1.031   56.702  1.00 32.00  ? 339 LEU A CG  1 
ATOM   978  C CD1 . LEU A 1 134 ? 28.217  2.466   56.418  1.00 30.12  ? 339 LEU A CD1 1 
ATOM   979  C CD2 . LEU A 1 134 ? 29.846  0.991   57.581  1.00 32.20  ? 339 LEU A CD2 1 
ATOM   980  N N   . LEU A 1 135 ? 24.684  0.697   55.979  1.00 36.21  ? 340 LEU A N   1 
ATOM   981  C CA  . LEU A 1 135 ? 23.856  1.501   55.099  1.00 39.63  ? 340 LEU A CA  1 
ATOM   982  C C   . LEU A 1 135 ? 24.453  2.884   54.861  1.00 41.16  ? 340 LEU A C   1 
ATOM   983  O O   . LEU A 1 135 ? 25.155  3.435   55.710  1.00 41.90  ? 340 LEU A O   1 
ATOM   984  C CB  . LEU A 1 135 ? 22.452  1.665   55.698  1.00 39.83  ? 340 LEU A CB  1 
ATOM   985  C CG  . LEU A 1 135 ? 21.631  0.398   55.949  1.00 39.56  ? 340 LEU A CG  1 
ATOM   986  C CD1 . LEU A 1 135 ? 20.364  0.730   56.717  1.00 36.39  ? 340 LEU A CD1 1 
ATOM   987  C CD2 . LEU A 1 135 ? 21.310  -0.252  54.617  1.00 40.39  ? 340 LEU A CD2 1 
ATOM   988  N N   . VAL A 1 136 ? 24.158  3.441   53.692  1.00 42.23  ? 341 VAL A N   1 
ATOM   989  C CA  . VAL A 1 136 ? 24.621  4.771   53.328  1.00 42.04  ? 341 VAL A CA  1 
ATOM   990  C C   . VAL A 1 136 ? 23.554  5.420   52.498  1.00 42.71  ? 341 VAL A C   1 
ATOM   991  O O   . VAL A 1 136 ? 22.707  4.745   51.909  1.00 41.05  ? 341 VAL A O   1 
ATOM   992  C CB  . VAL A 1 136 ? 25.942  4.730   52.506  1.00 41.41  ? 341 VAL A CB  1 
ATOM   993  C CG1 . VAL A 1 136 ? 27.003  3.932   53.259  1.00 40.21  ? 341 VAL A CG1 1 
ATOM   994  C CG2 . VAL A 1 136 ? 25.690  4.127   51.120  1.00 40.28  ? 341 VAL A CG2 1 
ATOM   995  N N   . ALA A 1 137 ? 23.579  6.742   52.453  1.00 43.96  ? 342 ALA A N   1 
ATOM   996  C CA  . ALA A 1 137 ? 22.613  7.476   51.668  1.00 45.48  ? 342 ALA A CA  1 
ATOM   997  C C   . ALA A 1 137 ? 21.240  7.192   52.090  1.00 48.59  ? 342 ALA A C   1 
ATOM   998  O O   . ALA A 1 137 ? 20.438  6.675   51.318  1.00 48.82  ? 342 ALA A O   1 
ATOM   999  C CB  . ALA A 1 137 ? 22.780  7.138   50.216  1.00 45.13  ? 342 ALA A CB  1 
ATOM   1000 N N   . ASN A 1 138 ? 20.937  7.506   53.341  1.00 51.88  ? 343 ASN A N   1 
ATOM   1001 C CA  . ASN A 1 138 ? 19.595  7.311   53.862  1.00 53.76  ? 343 ASN A CA  1 
ATOM   1002 C C   . ASN A 1 138 ? 18.943  5.880   53.522  1.00 53.34  ? 343 ASN A C   1 
ATOM   1003 O O   . ASN A 1 138 ? 17.753  5.794   53.227  1.00 54.23  ? 343 ASN A O   1 
ATOM   1004 C CB  . ASN A 1 138 ? 18.713  8.439   53.318  1.00 54.61  ? 343 ASN A CB  1 
ATOM   1005 C CG  . ASN A 1 138 ? 17.388  8.534   54.025  1.00 57.31  ? 343 ASN A CG  1 
ATOM   1006 O OD1 . ASN A 1 138 ? 17.331  8.727   55.242  1.00 59.21  ? 343 ASN A OD1 1 
ATOM   1007 N ND2 . ASN A 1 138 ? 16.305  8.399   53.268  1.00 57.74  ? 343 ASN A ND2 1 
ATOM   1008 N N   . GLY A 1 139 ? 19.738  4.814   53.582  1.00 52.63  ? 344 GLY A N   1 
ATOM   1009 C CA  . GLY A 1 139 ? 19.222  3.480   53.292  1.00 52.30  ? 344 GLY A CA  1 
ATOM   1010 C C   . GLY A 1 139 ? 19.268  3.076   51.819  1.00 53.09  ? 344 GLY A C   1 
ATOM   1011 O O   . GLY A 1 139 ? 19.158  1.896   51.466  1.00 52.35  ? 344 GLY A O   1 
ATOM   1012 N N   . SER A 1 140 ? 19.439  4.068   50.955  1.00 51.96  ? 345 SER A N   1 
ATOM   1013 C CA  . SER A 1 140 ? 19.497  3.860   49.519  1.00 51.86  ? 345 SER A CA  1 
ATOM   1014 C C   . SER A 1 140 ? 20.619  2.811   49.073  1.00 51.42  ? 345 SER A C   1 
ATOM   1015 O O   . SER A 1 140 ? 20.450  2.086   48.084  1.00 50.65  ? 345 SER A O   1 
ATOM   1016 C CB  . SER A 1 140 ? 19.727  5.217   48.846  1.00 50.93  ? 345 SER A CB  1 
ATOM   1017 O OG  . SER A 1 140 ? 19.530  5.147   47.449  1.00 54.62  ? 345 SER A OG  1 
ATOM   1018 N N   . GLY A 1 141 ? 21.724  2.764   49.818  1.00 50.52  ? 346 GLY A N   1 
ATOM   1019 C CA  . GLY A 1 141 ? 22.807  1.851   49.486  1.00 46.68  ? 346 GLY A CA  1 
ATOM   1020 C C   . GLY A 1 141 ? 23.381  1.096   50.672  1.00 44.71  ? 346 GLY A C   1 
ATOM   1021 O O   . GLY A 1 141 ? 23.037  1.353   51.830  1.00 44.00  ? 346 GLY A O   1 
ATOM   1022 N N   . PHE A 1 142 ? 24.273  0.162   50.373  1.00 42.79  ? 347 PHE A N   1 
ATOM   1023 C CA  . PHE A 1 142 ? 24.907  -0.668  51.385  1.00 40.42  ? 347 PHE A CA  1 
ATOM   1024 C C   . PHE A 1 142 ? 26.330  -0.885  50.984  1.00 40.79  ? 347 PHE A C   1 
ATOM   1025 O O   . PHE A 1 142 ? 26.596  -1.487  49.948  1.00 40.24  ? 347 PHE A O   1 
ATOM   1026 C CB  . PHE A 1 142 ? 24.195  -2.021  51.468  1.00 39.27  ? 347 PHE A CB  1 
ATOM   1027 C CG  . PHE A 1 142 ? 24.752  -2.941  52.522  1.00 36.25  ? 347 PHE A CG  1 
ATOM   1028 C CD1 . PHE A 1 142 ? 24.355  -2.825  53.846  1.00 35.24  ? 347 PHE A CD1 1 
ATOM   1029 C CD2 . PHE A 1 142 ? 25.676  -3.910  52.192  1.00 32.79  ? 347 PHE A CD2 1 
ATOM   1030 C CE1 . PHE A 1 142 ? 24.871  -3.663  54.818  1.00 33.97  ? 347 PHE A CE1 1 
ATOM   1031 C CE2 . PHE A 1 142 ? 26.188  -4.741  53.157  1.00 33.51  ? 347 PHE A CE2 1 
ATOM   1032 C CZ  . PHE A 1 142 ? 25.785  -4.619  54.472  1.00 33.66  ? 347 PHE A CZ  1 
ATOM   1033 N N   . VAL A 1 143 ? 27.262  -0.403  51.802  1.00 40.35  ? 348 VAL A N   1 
ATOM   1034 C CA  . VAL A 1 143 ? 28.683  -0.546  51.511  1.00 40.67  ? 348 VAL A CA  1 
ATOM   1035 C C   . VAL A 1 143 ? 29.234  -1.763  52.270  1.00 40.62  ? 348 VAL A C   1 
ATOM   1036 O O   . VAL A 1 143 ? 28.993  -1.922  53.465  1.00 40.34  ? 348 VAL A O   1 
ATOM   1037 C CB  . VAL A 1 143 ? 29.445  0.731   51.924  1.00 40.87  ? 348 VAL A CB  1 
ATOM   1038 C CG1 . VAL A 1 143 ? 29.409  0.880   53.433  1.00 41.90  ? 348 VAL A CG1 1 
ATOM   1039 C CG2 . VAL A 1 143 ? 30.867  0.698   51.405  1.00 38.84  ? 348 VAL A CG2 1 
ATOM   1040 N N   . THR A 1 144 ? 29.969  -2.627  51.578  1.00 40.78  ? 349 THR A N   1 
ATOM   1041 C CA  . THR A 1 144 ? 30.485  -3.812  52.241  1.00 40.00  ? 349 THR A CA  1 
ATOM   1042 C C   . THR A 1 144 ? 31.620  -3.512  53.074  1.00 40.05  ? 349 THR A C   1 
ATOM   1043 O O   . THR A 1 144 ? 32.384  -2.587  52.807  1.00 39.14  ? 349 THR A O   1 
ATOM   1044 C CB  . THR A 1 144 ? 30.869  -4.944  51.243  1.00 39.13  ? 349 THR A CB  1 
ATOM   1045 O OG1 . THR A 1 144 ? 32.213  -4.766  50.774  1.00 40.19  ? 349 THR A OG1 1 
ATOM   1046 C CG2 . THR A 1 144 ? 29.921  -4.946  50.070  1.00 38.40  ? 349 THR A CG2 1 
ATOM   1047 N N   . ARG A 1 145 ? 31.748  -4.301  54.130  1.00 40.08  ? 350 ARG A N   1 
ATOM   1048 C CA  . ARG A 1 145 ? 32.813  -4.174  55.091  1.00 40.48  ? 350 ARG A CA  1 
ATOM   1049 C C   . ARG A 1 145 ? 34.102  -4.566  54.453  1.00 42.06  ? 350 ARG A C   1 
ATOM   1050 O O   . ARG A 1 145 ? 35.149  -4.003  54.761  1.00 42.03  ? 350 ARG A O   1 
ATOM   1051 C CB  . ARG A 1 145 ? 32.488  -5.061  56.292  1.00 41.41  ? 350 ARG A CB  1 
ATOM   1052 C CG  . ARG A 1 145 ? 33.556  -5.152  57.383  1.00 42.80  ? 350 ARG A CG  1 
ATOM   1053 C CD  . ARG A 1 145 ? 33.005  -5.982  58.549  1.00 43.35  ? 350 ARG A CD  1 
ATOM   1054 N NE  . ARG A 1 145 ? 33.990  -6.266  59.586  1.00 44.01  ? 350 ARG A NE  1 
ATOM   1055 C CZ  . ARG A 1 145 ? 33.674  -6.793  60.765  1.00 46.90  ? 350 ARG A CZ  1 
ATOM   1056 N NH1 . ARG A 1 145 ? 32.408  -7.081  61.037  1.00 48.78  ? 350 ARG A NH1 1 
ATOM   1057 N NH2 . ARG A 1 145 ? 34.609  -7.029  61.673  1.00 46.26  ? 350 ARG A NH2 1 
ATOM   1058 N N   . GLU A 1 146 ? 34.049  -5.529  53.538  1.00 45.03  ? 351 GLU A N   1 
ATOM   1059 C CA  . GLU A 1 146 ? 35.255  -5.988  52.850  1.00 47.66  ? 351 GLU A CA  1 
ATOM   1060 C C   . GLU A 1 146 ? 35.802  -4.883  51.919  1.00 46.16  ? 351 GLU A C   1 
ATOM   1061 O O   . GLU A 1 146 ? 37.011  -4.740  51.749  1.00 45.22  ? 351 GLU A O   1 
ATOM   1062 C CB  . GLU A 1 146 ? 34.959  -7.257  52.041  1.00 52.11  ? 351 GLU A CB  1 
ATOM   1063 C CG  . GLU A 1 146 ? 36.218  -7.940  51.467  1.00 57.53  ? 351 GLU A CG  1 
ATOM   1064 C CD  . GLU A 1 146 ? 35.887  -9.040  50.476  1.00 61.07  ? 351 GLU A CD  1 
ATOM   1065 O OE1 . GLU A 1 146 ? 35.145  -8.762  49.508  1.00 63.08  ? 351 GLU A OE1 1 
ATOM   1066 O OE2 . GLU A 1 146 ? 36.375  -10.177 50.657  1.00 63.17  ? 351 GLU A OE2 1 
ATOM   1067 N N   . PHE A 1 147 ? 34.902  -4.114  51.318  1.00 45.20  ? 352 PHE A N   1 
ATOM   1068 C CA  . PHE A 1 147 ? 35.311  -3.021  50.450  1.00 45.17  ? 352 PHE A CA  1 
ATOM   1069 C C   . PHE A 1 147 ? 36.075  -1.938  51.269  1.00 45.96  ? 352 PHE A C   1 
ATOM   1070 O O   . PHE A 1 147 ? 37.078  -1.386  50.806  1.00 47.70  ? 352 PHE A O   1 
ATOM   1071 C CB  . PHE A 1 147 ? 34.099  -2.377  49.777  1.00 43.88  ? 352 PHE A CB  1 
ATOM   1072 C CG  . PHE A 1 147 ? 34.441  -1.144  48.998  1.00 45.31  ? 352 PHE A CG  1 
ATOM   1073 C CD1 . PHE A 1 147 ? 35.461  -1.165  48.059  1.00 45.95  ? 352 PHE A CD1 1 
ATOM   1074 C CD2 . PHE A 1 147 ? 33.764  0.045   49.217  1.00 47.13  ? 352 PHE A CD2 1 
ATOM   1075 C CE1 . PHE A 1 147 ? 35.803  -0.026  47.353  1.00 46.47  ? 352 PHE A CE1 1 
ATOM   1076 C CE2 . PHE A 1 147 ? 34.102  1.196   48.510  1.00 46.65  ? 352 PHE A CE2 1 
ATOM   1077 C CZ  . PHE A 1 147 ? 35.123  1.157   47.578  1.00 45.94  ? 352 PHE A CZ  1 
ATOM   1078 N N   . LEU A 1 148 ? 35.577  -1.634  52.464  1.00 44.26  ? 353 LEU A N   1 
ATOM   1079 C CA  . LEU A 1 148 ? 36.223  -0.657  53.323  1.00 42.49  ? 353 LEU A CA  1 
ATOM   1080 C C   . LEU A 1 148 ? 37.603  -1.164  53.710  1.00 43.38  ? 353 LEU A C   1 
ATOM   1081 O O   . LEU A 1 148 ? 38.580  -0.424  53.659  1.00 45.13  ? 353 LEU A O   1 
ATOM   1082 C CB  . LEU A 1 148 ? 35.380  -0.410  54.575  1.00 39.45  ? 353 LEU A CB  1 
ATOM   1083 C CG  . LEU A 1 148 ? 34.356  0.729   54.569  1.00 34.60  ? 353 LEU A CG  1 
ATOM   1084 C CD1 . LEU A 1 148 ? 34.320  1.385   53.205  1.00 32.21  ? 353 LEU A CD1 1 
ATOM   1085 C CD2 . LEU A 1 148 ? 33.000  0.198   54.995  1.00 27.83  ? 353 LEU A CD2 1 
ATOM   1086 N N   . ARG A 1 149 ? 37.689  -2.433  54.088  1.00 44.17  ? 354 ARG A N   1 
ATOM   1087 C CA  . ARG A 1 149 ? 38.966  -3.038  54.465  1.00 44.48  ? 354 ARG A CA  1 
ATOM   1088 C C   . ARG A 1 149 ? 40.013  -2.976  53.354  1.00 44.40  ? 354 ARG A C   1 
ATOM   1089 O O   . ARG A 1 149 ? 41.208  -2.938  53.630  1.00 43.99  ? 354 ARG A O   1 
ATOM   1090 C CB  . ARG A 1 149 ? 38.760  -4.502  54.836  1.00 46.29  ? 354 ARG A CB  1 
ATOM   1091 C CG  . ARG A 1 149 ? 38.271  -4.762  56.235  1.00 48.97  ? 354 ARG A CG  1 
ATOM   1092 C CD  . ARG A 1 149 ? 37.673  -6.147  56.294  1.00 50.97  ? 354 ARG A CD  1 
ATOM   1093 N NE  . ARG A 1 149 ? 37.542  -6.665  57.648  1.00 53.03  ? 354 ARG A NE  1 
ATOM   1094 C CZ  . ARG A 1 149 ? 36.798  -7.720  57.960  1.00 55.81  ? 354 ARG A CZ  1 
ATOM   1095 N NH1 . ARG A 1 149 ? 36.115  -8.354  57.010  1.00 56.60  ? 354 ARG A NH1 1 
ATOM   1096 N NH2 . ARG A 1 149 ? 36.755  -8.156  59.213  1.00 56.62  ? 354 ARG A NH2 1 
ATOM   1097 N N   . SER A 1 150 ? 39.560  -2.984  52.102  1.00 44.27  ? 355 SER A N   1 
ATOM   1098 C CA  . SER A 1 150 ? 40.454  -2.955  50.946  1.00 44.69  ? 355 SER A CA  1 
ATOM   1099 C C   . SER A 1 150 ? 41.042  -1.589  50.639  1.00 45.15  ? 355 SER A C   1 
ATOM   1100 O O   . SER A 1 150 ? 41.971  -1.471  49.834  1.00 46.41  ? 355 SER A O   1 
ATOM   1101 C CB  . SER A 1 150 ? 39.715  -3.450  49.709  1.00 44.34  ? 355 SER A CB  1 
ATOM   1102 O OG  . SER A 1 150 ? 38.773  -2.482  49.283  1.00 44.29  ? 355 SER A OG  1 
ATOM   1103 N N   . LEU A 1 151 ? 40.501  -0.552  51.265  1.00 44.41  ? 356 LEU A N   1 
ATOM   1104 C CA  . LEU A 1 151 ? 40.986  0.791   51.025  1.00 43.61  ? 356 LEU A CA  1 
ATOM   1105 C C   . LEU A 1 151 ? 42.398  0.913   51.417  1.00 43.84  ? 356 LEU A C   1 
ATOM   1106 O O   . LEU A 1 151 ? 42.850  0.297   52.373  1.00 42.91  ? 356 LEU A O   1 
ATOM   1107 C CB  . LEU A 1 151 ? 40.143  1.806   51.790  1.00 42.68  ? 356 LEU A CB  1 
ATOM   1108 C CG  . LEU A 1 151 ? 38.651  1.791   51.466  1.00 42.22  ? 356 LEU A CG  1 
ATOM   1109 C CD1 . LEU A 1 151 ? 37.950  2.899   52.224  1.00 41.38  ? 356 LEU A CD1 1 
ATOM   1110 C CD2 . LEU A 1 151 ? 38.454  1.962   49.968  1.00 43.86  ? 356 LEU A CD2 1 
ATOM   1111 N N   . ARG A 1 152 ? 43.134  1.706   50.656  1.00 44.67  ? 357 ARG A N   1 
ATOM   1112 C CA  . ARG A 1 152 ? 44.540  1.948   50.925  1.00 45.47  ? 357 ARG A CA  1 
ATOM   1113 C C   . ARG A 1 152 ? 44.659  2.417   52.414  1.00 45.50  ? 357 ARG A C   1 
ATOM   1114 O O   . ARG A 1 152 ? 43.798  3.157   52.900  1.00 46.21  ? 357 ARG A O   1 
ATOM   1115 C CB  . ARG A 1 152 ? 45.020  3.042   49.960  1.00 46.24  ? 357 ARG A CB  1 
ATOM   1116 C CG  . ARG A 1 152 ? 46.504  3.260   49.906  1.00 48.01  ? 357 ARG A CG  1 
ATOM   1117 C CD  . ARG A 1 152 ? 46.897  4.522   50.626  1.00 48.31  ? 357 ARG A CD  1 
ATOM   1118 N NE  . ARG A 1 152 ? 46.501  5.740   49.920  1.00 47.13  ? 357 ARG A NE  1 
ATOM   1119 C CZ  . ARG A 1 152 ? 46.599  6.958   50.450  1.00 47.13  ? 357 ARG A CZ  1 
ATOM   1120 N NH1 . ARG A 1 152 ? 47.070  7.106   51.682  1.00 46.36  ? 357 ARG A NH1 1 
ATOM   1121 N NH2 . ARG A 1 152 ? 46.246  8.028   49.756  1.00 45.03  ? 357 ARG A NH2 1 
ATOM   1122 N N   . LYS A 1 153 ? 45.684  1.967   53.133  1.00 44.65  ? 358 LYS A N   1 
ATOM   1123 C CA  . LYS A 1 153 ? 45.845  2.421   54.519  1.00 43.70  ? 358 LYS A CA  1 
ATOM   1124 C C   . LYS A 1 153 ? 46.224  3.887   54.466  1.00 43.16  ? 358 LYS A C   1 
ATOM   1125 O O   . LYS A 1 153 ? 46.794  4.356   53.481  1.00 42.24  ? 358 LYS A O   1 
ATOM   1126 C CB  . LYS A 1 153 ? 46.942  1.647   55.247  1.00 43.11  ? 358 LYS A CB  1 
ATOM   1127 C CG  . LYS A 1 153 ? 46.586  0.202   55.604  1.00 47.45  ? 358 LYS A CG  1 
ATOM   1128 C CD  . LYS A 1 153 ? 47.681  -0.425  56.503  1.00 48.01  ? 358 LYS A CD  1 
ATOM   1129 C CE  . LYS A 1 153 ? 47.467  -1.928  56.711  1.00 50.89  ? 358 LYS A CE  1 
ATOM   1130 N NZ  . LYS A 1 153 ? 46.176  -2.258  57.384  1.00 54.76  ? 358 LYS A NZ  1 
ATOM   1131 N N   . PRO A 1 154 ? 45.947  4.640   55.536  1.00 42.90  ? 359 PRO A N   1 
ATOM   1132 C CA  . PRO A 1 154 ? 45.335  4.279   56.818  1.00 42.84  ? 359 PRO A CA  1 
ATOM   1133 C C   . PRO A 1 154 ? 43.808  4.328   56.809  1.00 42.78  ? 359 PRO A C   1 
ATOM   1134 O O   . PRO A 1 154 ? 43.164  4.088   57.828  1.00 41.37  ? 359 PRO A O   1 
ATOM   1135 C CB  . PRO A 1 154 ? 45.904  5.330   57.746  1.00 42.56  ? 359 PRO A CB  1 
ATOM   1136 C CG  . PRO A 1 154 ? 45.765  6.565   56.873  1.00 42.50  ? 359 PRO A CG  1 
ATOM   1137 C CD  . PRO A 1 154 ? 46.254  6.082   55.503  1.00 42.30  ? 359 PRO A CD  1 
ATOM   1138 N N   . PHE A 1 155 ? 43.232  4.656   55.662  1.00 42.81  ? 360 PHE A N   1 
ATOM   1139 C CA  . PHE A 1 155 ? 41.787  4.752   55.544  1.00 41.96  ? 360 PHE A CA  1 
ATOM   1140 C C   . PHE A 1 155 ? 41.070  3.400   55.805  1.00 41.60  ? 360 PHE A C   1 
ATOM   1141 O O   . PHE A 1 155 ? 39.947  3.365   56.295  1.00 41.39  ? 360 PHE A O   1 
ATOM   1142 C CB  . PHE A 1 155 ? 41.464  5.312   54.165  1.00 39.96  ? 360 PHE A CB  1 
ATOM   1143 C CG  . PHE A 1 155 ? 42.105  6.647   53.904  1.00 36.11  ? 360 PHE A CG  1 
ATOM   1144 C CD1 . PHE A 1 155 ? 41.655  7.783   54.559  1.00 33.31  ? 360 PHE A CD1 1 
ATOM   1145 C CD2 . PHE A 1 155 ? 43.171  6.762   53.029  1.00 37.88  ? 360 PHE A CD2 1 
ATOM   1146 C CE1 . PHE A 1 155 ? 42.250  9.011   54.353  1.00 31.59  ? 360 PHE A CE1 1 
ATOM   1147 C CE2 . PHE A 1 155 ? 43.778  7.996   52.814  1.00 38.25  ? 360 PHE A CE2 1 
ATOM   1148 C CZ  . PHE A 1 155 ? 43.310  9.124   53.484  1.00 34.67  ? 360 PHE A CZ  1 
ATOM   1149 N N   . SER A 1 156 ? 41.746  2.302   55.498  1.00 42.59  ? 361 SER A N   1 
ATOM   1150 C CA  . SER A 1 156 ? 41.189  0.972   55.710  1.00 43.57  ? 361 SER A CA  1 
ATOM   1151 C C   . SER A 1 156 ? 41.178  0.526   57.180  1.00 44.22  ? 361 SER A C   1 
ATOM   1152 O O   . SER A 1 156 ? 40.582  -0.491  57.513  1.00 45.67  ? 361 SER A O   1 
ATOM   1153 C CB  . SER A 1 156 ? 41.983  -0.051  54.901  1.00 44.06  ? 361 SER A CB  1 
ATOM   1154 O OG  . SER A 1 156 ? 43.361  -0.018  55.247  1.00 45.57  ? 361 SER A OG  1 
ATOM   1155 N N   . ASP A 1 157 ? 41.836  1.279   58.052  1.00 45.03  ? 362 ASP A N   1 
ATOM   1156 C CA  . ASP A 1 157 ? 41.910  0.920   59.469  1.00 45.76  ? 362 ASP A CA  1 
ATOM   1157 C C   . ASP A 1 157 ? 40.977  1.625   60.300  1.00 44.91  ? 362 ASP A C   1 
ATOM   1158 O O   . ASP A 1 157 ? 40.510  1.105   61.308  1.00 45.28  ? 362 ASP A O   1 
ATOM   1159 C CB  . ASP A 1 157 ? 43.309  1.195   60.026  1.00 47.70  ? 362 ASP A CB  1 
ATOM   1160 C CG  . ASP A 1 157 ? 44.375  0.374   59.359  1.00 51.57  ? 362 ASP A CG  1 
ATOM   1161 O OD1 . ASP A 1 157 ? 44.643  0.592   58.155  1.00 54.09  ? 362 ASP A OD1 1 
ATOM   1162 O OD2 . ASP A 1 157 ? 44.945  -0.494  60.048  1.00 55.56  ? 362 ASP A OD2 1 
ATOM   1163 N N   . ILE A 1 158 ? 40.691  2.858   59.919  1.00 44.45  ? 363 ILE A N   1 
ATOM   1164 C CA  . ILE A 1 158 ? 39.807  3.705   60.688  1.00 44.91  ? 363 ILE A CA  1 
ATOM   1165 C C   . ILE A 1 158 ? 38.416  3.146   60.953  1.00 44.16  ? 363 ILE A C   1 
ATOM   1166 O O   . ILE A 1 158 ? 38.007  2.973   62.102  1.00 42.77  ? 363 ILE A O   1 
ATOM   1167 C CB  . ILE A 1 158 ? 39.715  5.088   60.025  1.00 44.92  ? 363 ILE A CB  1 
ATOM   1168 C CG1 . ILE A 1 158 ? 38.421  5.777   60.408  1.00 44.79  ? 363 ILE A CG1 1 
ATOM   1169 C CG2 . ILE A 1 158 ? 39.832  4.960   58.535  1.00 44.92  ? 363 ILE A CG2 1 
ATOM   1170 C CD1 . ILE A 1 158 ? 38.362  7.146   59.841  1.00 50.82  ? 363 ILE A CD1 1 
ATOM   1171 N N   . ILE A 1 159 ? 37.699  2.814   59.898  1.00 43.65  ? 364 ILE A N   1 
ATOM   1172 C CA  . ILE A 1 159 ? 36.355  2.321   60.067  1.00 42.76  ? 364 ILE A CA  1 
ATOM   1173 C C   . ILE A 1 159 ? 36.191  0.833   60.548  1.00 42.54  ? 364 ILE A C   1 
ATOM   1174 O O   . ILE A 1 159 ? 35.135  0.470   61.055  1.00 44.70  ? 364 ILE A O   1 
ATOM   1175 C CB  . ILE A 1 159 ? 35.582  2.597   58.774  1.00 44.17  ? 364 ILE A CB  1 
ATOM   1176 C CG1 . ILE A 1 159 ? 34.201  1.969   58.838  1.00 46.09  ? 364 ILE A CG1 1 
ATOM   1177 C CG2 . ILE A 1 159 ? 36.420  2.162   57.573  1.00 44.21  ? 364 ILE A CG2 1 
ATOM   1178 C CD1 . ILE A 1 159 ? 33.275  2.522   57.761  1.00 51.66  ? 364 ILE A CD1 1 
ATOM   1179 N N   . GLU A 1 160 ? 37.224  0.003   60.423  1.00 41.02  ? 365 GLU A N   1 
ATOM   1180 C CA  . GLU A 1 160 ? 37.123  -1.397  60.865  1.00 40.30  ? 365 GLU A CA  1 
ATOM   1181 C C   . GLU A 1 160 ? 36.861  -1.587  62.391  1.00 39.49  ? 365 GLU A C   1 
ATOM   1182 O O   . GLU A 1 160 ? 36.009  -2.380  62.783  1.00 40.55  ? 365 GLU A O   1 
ATOM   1183 C CB  . GLU A 1 160 ? 38.379  -2.181  60.469  1.00 42.10  ? 365 GLU A CB  1 
ATOM   1184 C CG  . GLU A 1 160 ? 38.456  -3.664  60.992  1.00 43.02  ? 365 GLU A CG  1 
ATOM   1185 C CD  . GLU A 1 160 ? 37.339  -4.566  60.466  1.00 46.62  ? 365 GLU A CD  1 
ATOM   1186 O OE1 . GLU A 1 160 ? 36.668  -4.182  59.481  1.00 46.52  ? 365 GLU A OE1 1 
ATOM   1187 O OE2 . GLU A 1 160 ? 37.144  -5.668  61.037  1.00 45.29  ? 365 GLU A OE2 1 
ATOM   1188 N N   . PRO A 1 161 ? 37.605  -0.882  63.258  1.00 38.82  ? 366 PRO A N   1 
ATOM   1189 C CA  . PRO A 1 161 ? 37.332  -1.077  64.684  1.00 37.36  ? 366 PRO A CA  1 
ATOM   1190 C C   . PRO A 1 161 ? 35.866  -0.774  65.072  1.00 38.40  ? 366 PRO A C   1 
ATOM   1191 O O   . PRO A 1 161 ? 35.325  -1.360  66.008  1.00 36.58  ? 366 PRO A O   1 
ATOM   1192 C CB  . PRO A 1 161 ? 38.329  -0.132  65.356  1.00 35.02  ? 366 PRO A CB  1 
ATOM   1193 C CG  . PRO A 1 161 ? 38.581  0.898   64.328  1.00 35.31  ? 366 PRO A CG  1 
ATOM   1194 C CD  . PRO A 1 161 ? 38.693  0.091   63.074  1.00 36.52  ? 366 PRO A CD  1 
ATOM   1195 N N   . LYS A 1 162 ? 35.238  0.138   64.338  1.00 40.34  ? 367 LYS A N   1 
ATOM   1196 C CA  . LYS A 1 162 ? 33.853  0.504   64.601  1.00 42.09  ? 367 LYS A CA  1 
ATOM   1197 C C   . LYS A 1 162 ? 32.918  -0.691  64.405  1.00 43.36  ? 367 LYS A C   1 
ATOM   1198 O O   . LYS A 1 162 ? 31.998  -0.895  65.193  1.00 44.30  ? 367 LYS A O   1 
ATOM   1199 C CB  . LYS A 1 162 ? 33.452  1.645   63.687  1.00 42.82  ? 367 LYS A CB  1 
ATOM   1200 C CG  . LYS A 1 162 ? 34.482  2.757   63.666  1.00 43.76  ? 367 LYS A CG  1 
ATOM   1201 C CD  . LYS A 1 162 ? 34.814  3.208   65.051  1.00 44.14  ? 367 LYS A CD  1 
ATOM   1202 C CE  . LYS A 1 162 ? 35.669  4.451   65.002  1.00 47.04  ? 367 LYS A CE  1 
ATOM   1203 N NZ  . LYS A 1 162 ? 36.882  4.260   64.173  1.00 46.83  ? 367 LYS A NZ  1 
ATOM   1204 N N   . PHE A 1 163 ? 33.147  -1.470  63.349  1.00 42.76  ? 368 PHE A N   1 
ATOM   1205 C CA  . PHE A 1 163 ? 32.346  -2.659  63.099  1.00 40.00  ? 368 PHE A CA  1 
ATOM   1206 C C   . PHE A 1 163 ? 32.477  -3.568  64.317  1.00 41.46  ? 368 PHE A C   1 
ATOM   1207 O O   . PHE A 1 163 ? 31.479  -3.995  64.902  1.00 41.17  ? 368 PHE A O   1 
ATOM   1208 C CB  . PHE A 1 163 ? 32.850  -3.388  61.853  1.00 36.89  ? 368 PHE A CB  1 
ATOM   1209 C CG  . PHE A 1 163 ? 32.144  -2.985  60.590  1.00 38.81  ? 368 PHE A CG  1 
ATOM   1210 C CD1 . PHE A 1 163 ? 30.827  -3.373  60.359  1.00 38.21  ? 368 PHE A CD1 1 
ATOM   1211 C CD2 . PHE A 1 163 ? 32.784  -2.201  59.635  1.00 37.49  ? 368 PHE A CD2 1 
ATOM   1212 C CE1 . PHE A 1 163 ? 30.159  -2.983  59.202  1.00 36.70  ? 368 PHE A CE1 1 
ATOM   1213 C CE2 . PHE A 1 163 ? 32.127  -1.814  58.485  1.00 36.14  ? 368 PHE A CE2 1 
ATOM   1214 C CZ  . PHE A 1 163 ? 30.808  -2.205  58.268  1.00 36.89  ? 368 PHE A CZ  1 
ATOM   1215 N N   . GLU A 1 164 ? 33.715  -3.861  64.705  1.00 40.96  ? 369 GLU A N   1 
ATOM   1216 C CA  . GLU A 1 164 ? 33.942  -4.712  65.859  1.00 43.00  ? 369 GLU A CA  1 
ATOM   1217 C C   . GLU A 1 164 ? 33.111  -4.208  67.023  1.00 42.02  ? 369 GLU A C   1 
ATOM   1218 O O   . GLU A 1 164 ? 32.423  -4.991  67.687  1.00 42.54  ? 369 GLU A O   1 
ATOM   1219 C CB  . GLU A 1 164 ? 35.434  -4.740  66.226  1.00 46.63  ? 369 GLU A CB  1 
ATOM   1220 C CG  . GLU A 1 164 ? 36.328  -5.503  65.175  1.00 53.84  ? 369 GLU A CG  1 
ATOM   1221 C CD  . GLU A 1 164 ? 37.843  -5.309  65.381  1.00 58.28  ? 369 GLU A CD  1 
ATOM   1222 O OE1 . GLU A 1 164 ? 38.332  -4.155  65.278  1.00 58.51  ? 369 GLU A OE1 1 
ATOM   1223 O OE2 . GLU A 1 164 ? 38.548  -6.320  65.632  1.00 59.70  ? 369 GLU A OE2 1 
ATOM   1224 N N   . PHE A 1 165 ? 33.151  -2.897  67.265  1.00 38.74  ? 370 PHE A N   1 
ATOM   1225 C CA  . PHE A 1 165 ? 32.381  -2.320  68.355  1.00 35.56  ? 370 PHE A CA  1 
ATOM   1226 C C   . PHE A 1 165 ? 30.904  -2.532  68.169  1.00 36.20  ? 370 PHE A C   1 
ATOM   1227 O O   . PHE A 1 165 ? 30.201  -2.995  69.072  1.00 34.64  ? 370 PHE A O   1 
ATOM   1228 C CB  . PHE A 1 165 ? 32.645  -0.818  68.478  1.00 32.90  ? 370 PHE A CB  1 
ATOM   1229 C CG  . PHE A 1 165 ? 31.817  -0.154  69.548  1.00 31.34  ? 370 PHE A CG  1 
ATOM   1230 C CD1 . PHE A 1 165 ? 30.553  0.347   69.261  1.00 31.10  ? 370 PHE A CD1 1 
ATOM   1231 C CD2 . PHE A 1 165 ? 32.260  -0.121  70.862  1.00 27.93  ? 370 PHE A CD2 1 
ATOM   1232 C CE1 . PHE A 1 165 ? 29.751  0.856   70.264  1.00 27.84  ? 370 PHE A CE1 1 
ATOM   1233 C CE2 . PHE A 1 165 ? 31.468  0.385   71.861  1.00 26.57  ? 370 PHE A CE2 1 
ATOM   1234 C CZ  . PHE A 1 165 ? 30.209  0.873   71.565  1.00 26.58  ? 370 PHE A CZ  1 
ATOM   1235 N N   . ALA A 1 166 ? 30.434  -2.181  66.979  1.00 36.99  ? 371 ALA A N   1 
ATOM   1236 C CA  . ALA A 1 166 ? 29.033  -2.276  66.627  1.00 38.66  ? 371 ALA A CA  1 
ATOM   1237 C C   . ALA A 1 166 ? 28.408  -3.665  66.772  1.00 40.17  ? 371 ALA A C   1 
ATOM   1238 O O   . ALA A 1 166 ? 27.288  -3.780  67.268  1.00 41.50  ? 371 ALA A O   1 
ATOM   1239 C CB  . ALA A 1 166 ? 28.828  -1.749  65.211  1.00 36.10  ? 371 ALA A CB  1 
ATOM   1240 N N   . VAL A 1 167 ? 29.106  -4.718  66.356  1.00 39.63  ? 372 VAL A N   1 
ATOM   1241 C CA  . VAL A 1 167 ? 28.521  -6.049  66.464  1.00 40.59  ? 372 VAL A CA  1 
ATOM   1242 C C   . VAL A 1 167 ? 28.236  -6.422  67.940  1.00 42.76  ? 372 VAL A C   1 
ATOM   1243 O O   . VAL A 1 167 ? 27.167  -6.956  68.252  1.00 43.73  ? 372 VAL A O   1 
ATOM   1244 C CB  . VAL A 1 167 ? 29.420  -7.139  65.789  1.00 40.58  ? 372 VAL A CB  1 
ATOM   1245 C CG1 . VAL A 1 167 ? 28.880  -8.527  66.102  1.00 38.66  ? 372 VAL A CG1 1 
ATOM   1246 C CG2 . VAL A 1 167 ? 29.450  -6.938  64.267  1.00 36.75  ? 372 VAL A CG2 1 
ATOM   1247 N N   . LYS A 1 168 ? 29.179  -6.133  68.834  1.00 43.57  ? 373 LYS A N   1 
ATOM   1248 C CA  . LYS A 1 168 ? 28.981  -6.428  70.252  1.00 44.45  ? 373 LYS A CA  1 
ATOM   1249 C C   . LYS A 1 168 ? 27.878  -5.622  70.755  1.00 43.46  ? 373 LYS A C   1 
ATOM   1250 O O   . LYS A 1 168 ? 26.998  -6.118  71.447  1.00 43.30  ? 373 LYS A O   1 
ATOM   1251 C CB  . LYS A 1 168 ? 30.232  -6.107  71.065  1.00 47.83  ? 373 LYS A CB  1 
ATOM   1252 C CG  . LYS A 1 168 ? 31.410  -7.014  70.771  1.00 53.13  ? 373 LYS A CG  1 
ATOM   1253 C CD  . LYS A 1 168 ? 32.665  -6.563  71.515  1.00 55.85  ? 373 LYS A CD  1 
ATOM   1254 C CE  . LYS A 1 168 ? 33.869  -7.363  71.041  1.00 57.02  ? 373 LYS A CE  1 
ATOM   1255 N NZ  . LYS A 1 168 ? 34.007  -7.260  69.561  1.00 59.49  ? 373 LYS A NZ  1 
ATOM   1256 N N   . PHE A 1 169 ? 27.900  -4.340  70.416  1.00 41.28  ? 374 PHE A N   1 
ATOM   1257 C CA  . PHE A 1 169 ? 26.867  -3.428  70.859  1.00 38.37  ? 374 PHE A CA  1 
ATOM   1258 C C   . PHE A 1 169 ? 25.462  -3.928  70.405  1.00 38.20  ? 374 PHE A C   1 
ATOM   1259 O O   . PHE A 1 169 ? 24.539  -4.041  71.213  1.00 36.62  ? 374 PHE A O   1 
ATOM   1260 C CB  . PHE A 1 169 ? 27.148  -2.037  70.302  1.00 36.48  ? 374 PHE A CB  1 
ATOM   1261 C CG  . PHE A 1 169 ? 26.337  -0.960  70.946  1.00 35.71  ? 374 PHE A CG  1 
ATOM   1262 C CD1 . PHE A 1 169 ? 26.551  -0.617  72.271  1.00 36.74  ? 374 PHE A CD1 1 
ATOM   1263 C CD2 . PHE A 1 169 ? 25.344  -0.301  70.235  1.00 33.86  ? 374 PHE A CD2 1 
ATOM   1264 C CE1 . PHE A 1 169 ? 25.786  0.367   72.872  1.00 37.49  ? 374 PHE A CE1 1 
ATOM   1265 C CE2 . PHE A 1 169 ? 24.581  0.676   70.824  1.00 32.84  ? 374 PHE A CE2 1 
ATOM   1266 C CZ  . PHE A 1 169 ? 24.798  1.013   72.142  1.00 35.74  ? 374 PHE A CZ  1 
ATOM   1267 N N   . ASN A 1 170 ? 25.317  -4.223  69.120  1.00 37.49  ? 375 ASN A N   1 
ATOM   1268 C CA  . ASN A 1 170 ? 24.045  -4.710  68.604  1.00 38.96  ? 375 ASN A CA  1 
ATOM   1269 C C   . ASN A 1 170 ? 23.553  -6.019  69.272  1.00 40.18  ? 375 ASN A C   1 
ATOM   1270 O O   . ASN A 1 170 ? 22.385  -6.379  69.149  1.00 39.08  ? 375 ASN A O   1 
ATOM   1271 C CB  . ASN A 1 170 ? 24.129  -4.912  67.099  1.00 38.07  ? 375 ASN A CB  1 
ATOM   1272 C CG  . ASN A 1 170 ? 24.165  -3.609  66.351  1.00 38.73  ? 375 ASN A CG  1 
ATOM   1273 O OD1 . ASN A 1 170 ? 23.766  -2.568  66.877  1.00 40.30  ? 375 ASN A OD1 1 
ATOM   1274 N ND2 . ASN A 1 170 ? 24.626  -3.654  65.108  1.00 36.73  ? 375 ASN A ND2 1 
ATOM   1275 N N   . ALA A 1 171 ? 24.450  -6.718  69.960  1.00 40.40  ? 376 ALA A N   1 
ATOM   1276 C CA  . ALA A 1 171 ? 24.087  -7.940  70.656  1.00 40.70  ? 376 ALA A CA  1 
ATOM   1277 C C   . ALA A 1 171 ? 23.173  -7.620  71.886  1.00 42.56  ? 376 ALA A C   1 
ATOM   1278 O O   . ALA A 1 171 ? 22.472  -8.497  72.397  1.00 43.64  ? 376 ALA A O   1 
ATOM   1279 C CB  . ALA A 1 171 ? 25.338  -8.662  71.114  1.00 39.23  ? 376 ALA A CB  1 
ATOM   1280 N N   . LEU A 1 172 ? 23.197  -6.370  72.342  1.00 43.43  ? 377 LEU A N   1 
ATOM   1281 C CA  . LEU A 1 172 ? 22.373  -5.951  73.472  1.00 44.94  ? 377 LEU A CA  1 
ATOM   1282 C C   . LEU A 1 172 ? 20.897  -5.782  73.030  1.00 46.16  ? 377 LEU A C   1 
ATOM   1283 O O   . LEU A 1 172 ? 19.997  -5.700  73.865  1.00 46.31  ? 377 LEU A O   1 
ATOM   1284 C CB  . LEU A 1 172 ? 22.901  -4.636  74.044  1.00 44.74  ? 377 LEU A CB  1 
ATOM   1285 C CG  . LEU A 1 172 ? 24.374  -4.696  74.445  1.00 43.05  ? 377 LEU A CG  1 
ATOM   1286 C CD1 . LEU A 1 172 ? 24.832  -3.358  75.012  1.00 39.58  ? 377 LEU A CD1 1 
ATOM   1287 C CD2 . LEU A 1 172 ? 24.546  -5.821  75.454  1.00 42.83  ? 377 LEU A CD2 1 
ATOM   1288 N N   . GLU A 1 173 ? 20.677  -5.727  71.717  1.00 47.09  ? 378 GLU A N   1 
ATOM   1289 C CA  . GLU A 1 173 ? 19.342  -5.602  71.152  1.00 48.30  ? 378 GLU A CA  1 
ATOM   1290 C C   . GLU A 1 173 ? 18.584  -4.389  71.656  1.00 47.64  ? 378 GLU A C   1 
ATOM   1291 O O   . GLU A 1 173 ? 17.449  -4.501  72.117  1.00 47.40  ? 378 GLU A O   1 
ATOM   1292 C CB  . GLU A 1 173 ? 18.553  -6.877  71.442  1.00 50.78  ? 378 GLU A CB  1 
ATOM   1293 C CG  . GLU A 1 173 ? 19.194  -8.137  70.831  1.00 57.32  ? 378 GLU A CG  1 
ATOM   1294 C CD  . GLU A 1 173 ? 18.553  -9.437  71.312  1.00 62.34  ? 378 GLU A CD  1 
ATOM   1295 O OE1 . GLU A 1 173 ? 19.065  -10.519 70.941  1.00 63.70  ? 378 GLU A OE1 1 
ATOM   1296 O OE2 . GLU A 1 173 ? 17.544  -9.385  72.056  1.00 64.03  ? 378 GLU A OE2 1 
ATOM   1297 N N   . LEU A 1 174 ? 19.219  -3.224  71.553  1.00 46.04  ? 379 LEU A N   1 
ATOM   1298 C CA  . LEU A 1 174 ? 18.625  -1.968  71.991  1.00 45.07  ? 379 LEU A CA  1 
ATOM   1299 C C   . LEU A 1 174 ? 17.748  -1.368  70.930  1.00 44.82  ? 379 LEU A C   1 
ATOM   1300 O O   . LEU A 1 174 ? 18.103  -1.368  69.750  1.00 44.37  ? 379 LEU A O   1 
ATOM   1301 C CB  . LEU A 1 174 ? 19.722  -0.957  72.343  1.00 44.22  ? 379 LEU A CB  1 
ATOM   1302 C CG  . LEU A 1 174 ? 20.230  -0.816  73.780  1.00 43.73  ? 379 LEU A CG  1 
ATOM   1303 C CD1 . LEU A 1 174 ? 20.736  -2.145  74.318  1.00 41.99  ? 379 LEU A CD1 1 
ATOM   1304 C CD2 . LEU A 1 174 ? 21.335  0.232   73.789  1.00 41.30  ? 379 LEU A CD2 1 
ATOM   1305 N N   . ASP A 1 175 ? 16.595  -0.845  71.336  1.00 43.58  ? 380 ASP A N   1 
ATOM   1306 C CA  . ASP A 1 175 ? 15.703  -0.203  70.383  1.00 43.60  ? 380 ASP A CA  1 
ATOM   1307 C C   . ASP A 1 175 ? 15.923  1.277   70.474  1.00 43.24  ? 380 ASP A C   1 
ATOM   1308 O O   . ASP A 1 175 ? 16.642  1.752   71.356  1.00 44.36  ? 380 ASP A O   1 
ATOM   1309 C CB  . ASP A 1 175 ? 14.227  -0.543  70.663  1.00 45.37  ? 380 ASP A CB  1 
ATOM   1310 C CG  . ASP A 1 175 ? 13.773  -0.153  72.067  1.00 48.56  ? 380 ASP A CG  1 
ATOM   1311 O OD1 . ASP A 1 175 ? 14.102  0.963   72.530  1.00 48.16  ? 380 ASP A OD1 1 
ATOM   1312 O OD2 . ASP A 1 175 ? 13.065  -0.968  72.705  1.00 50.21  ? 380 ASP A OD2 1 
ATOM   1313 N N   . ASP A 1 176 ? 15.301  2.019   69.566  1.00 41.54  ? 381 ASP A N   1 
ATOM   1314 C CA  . ASP A 1 176 ? 15.431  3.473   69.520  1.00 39.46  ? 381 ASP A CA  1 
ATOM   1315 C C   . ASP A 1 176 ? 15.145  4.208   70.796  1.00 38.93  ? 381 ASP A C   1 
ATOM   1316 O O   . ASP A 1 176 ? 15.732  5.257   71.040  1.00 39.22  ? 381 ASP A O   1 
ATOM   1317 C CB  . ASP A 1 176 ? 14.538  4.033   68.422  1.00 37.07  ? 381 ASP A CB  1 
ATOM   1318 C CG  . ASP A 1 176 ? 14.977  3.601   67.054  1.00 37.83  ? 381 ASP A CG  1 
ATOM   1319 O OD1 . ASP A 1 176 ? 16.035  4.074   66.603  1.00 38.37  ? 381 ASP A OD1 1 
ATOM   1320 O OD2 . ASP A 1 176 ? 14.275  2.783   66.432  1.00 40.06  ? 381 ASP A OD2 1 
ATOM   1321 N N   . SER A 1 177 ? 14.230  3.690   71.610  1.00 38.22  ? 382 SER A N   1 
ATOM   1322 C CA  . SER A 1 177 ? 13.884  4.344   72.868  1.00 36.65  ? 382 SER A CA  1 
ATOM   1323 C C   . SER A 1 177 ? 15.034  4.215   73.836  1.00 37.40  ? 382 SER A C   1 
ATOM   1324 O O   . SER A 1 177 ? 15.274  5.110   74.639  1.00 38.03  ? 382 SER A O   1 
ATOM   1325 C CB  . SER A 1 177 ? 12.624  3.725   73.478  1.00 34.25  ? 382 SER A CB  1 
ATOM   1326 O OG  . SER A 1 177 ? 12.901  2.454   74.046  1.00 31.86  ? 382 SER A OG  1 
ATOM   1327 N N   . ASP A 1 178 ? 15.746  3.094   73.787  1.00 38.11  ? 383 ASP A N   1 
ATOM   1328 C CA  . ASP A 1 178 ? 16.891  2.922   74.673  1.00 38.22  ? 383 ASP A CA  1 
ATOM   1329 C C   . ASP A 1 178 ? 17.980  3.897   74.204  1.00 37.33  ? 383 ASP A C   1 
ATOM   1330 O O   . ASP A 1 178 ? 18.585  4.611   75.007  1.00 35.90  ? 383 ASP A O   1 
ATOM   1331 C CB  . ASP A 1 178 ? 17.442  1.492   74.614  1.00 39.10  ? 383 ASP A CB  1 
ATOM   1332 C CG  . ASP A 1 178 ? 16.384  0.439   74.880  1.00 42.71  ? 383 ASP A CG  1 
ATOM   1333 O OD1 . ASP A 1 178 ? 15.489  0.676   75.713  1.00 42.76  ? 383 ASP A OD1 1 
ATOM   1334 O OD2 . ASP A 1 178 ? 16.459  -0.642  74.258  1.00 45.40  ? 383 ASP A OD2 1 
ATOM   1335 N N   . LEU A 1 179 ? 18.208  3.920   72.892  1.00 35.45  ? 384 LEU A N   1 
ATOM   1336 C CA  . LEU A 1 179 ? 19.216  4.777   72.307  1.00 33.50  ? 384 LEU A CA  1 
ATOM   1337 C C   . LEU A 1 179 ? 19.045  6.237   72.661  1.00 33.29  ? 384 LEU A C   1 
ATOM   1338 O O   . LEU A 1 179 ? 20.009  6.887   73.074  1.00 34.72  ? 384 LEU A O   1 
ATOM   1339 C CB  . LEU A 1 179 ? 19.238  4.591   70.791  1.00 32.54  ? 384 LEU A CB  1 
ATOM   1340 C CG  . LEU A 1 179 ? 19.666  3.190   70.348  1.00 33.00  ? 384 LEU A CG  1 
ATOM   1341 C CD1 . LEU A 1 179 ? 19.421  3.000   68.864  1.00 32.14  ? 384 LEU A CD1 1 
ATOM   1342 C CD2 . LEU A 1 179 ? 21.128  2.990   70.666  1.00 31.77  ? 384 LEU A CD2 1 
ATOM   1343 N N   . ALA A 1 180 ? 17.836  6.769   72.526  1.00 30.43  ? 385 ALA A N   1 
ATOM   1344 C CA  . ALA A 1 180 ? 17.629  8.179   72.835  1.00 31.16  ? 385 ALA A CA  1 
ATOM   1345 C C   . ALA A 1 180 ? 18.243  8.525   74.199  1.00 31.34  ? 385 ALA A C   1 
ATOM   1346 O O   . ALA A 1 180 ? 18.936  9.529   74.324  1.00 31.89  ? 385 ALA A O   1 
ATOM   1347 C CB  . ALA A 1 180 ? 16.125  8.538   72.799  1.00 30.44  ? 385 ALA A CB  1 
ATOM   1348 N N   . LEU A 1 181 ? 18.002  7.685   75.202  1.00 30.73  ? 386 LEU A N   1 
ATOM   1349 C CA  . LEU A 1 181 ? 18.543  7.900   76.544  1.00 30.79  ? 386 LEU A CA  1 
ATOM   1350 C C   . LEU A 1 181 ? 20.065  7.682   76.623  1.00 30.41  ? 386 LEU A C   1 
ATOM   1351 O O   . LEU A 1 181 ? 20.780  8.445   77.269  1.00 29.13  ? 386 LEU A O   1 
ATOM   1352 C CB  . LEU A 1 181 ? 17.847  6.970   77.545  1.00 30.67  ? 386 LEU A CB  1 
ATOM   1353 C CG  . LEU A 1 181 ? 16.370  7.276   77.811  1.00 31.82  ? 386 LEU A CG  1 
ATOM   1354 C CD1 . LEU A 1 181 ? 15.798  6.249   78.774  1.00 29.44  ? 386 LEU A CD1 1 
ATOM   1355 C CD2 . LEU A 1 181 ? 16.237  8.693   78.384  1.00 31.14  ? 386 LEU A CD2 1 
ATOM   1356 N N   . PHE A 1 182 ? 20.537  6.627   75.963  1.00 32.26  ? 387 PHE A N   1 
ATOM   1357 C CA  . PHE A 1 182 ? 21.956  6.271   75.927  1.00 31.87  ? 387 PHE A CA  1 
ATOM   1358 C C   . PHE A 1 182 ? 22.764  7.411   75.331  1.00 31.74  ? 387 PHE A C   1 
ATOM   1359 O O   . PHE A 1 182 ? 23.833  7.765   75.825  1.00 28.65  ? 387 PHE A O   1 
ATOM   1360 C CB  . PHE A 1 182 ? 22.148  5.019   75.075  1.00 30.39  ? 387 PHE A CB  1 
ATOM   1361 C CG  . PHE A 1 182 ? 23.544  4.472   75.104  1.00 30.96  ? 387 PHE A CG  1 
ATOM   1362 C CD1 . PHE A 1 182 ? 23.974  3.692   76.157  1.00 30.31  ? 387 PHE A CD1 1 
ATOM   1363 C CD2 . PHE A 1 182 ? 24.426  4.730   74.070  1.00 31.95  ? 387 PHE A CD2 1 
ATOM   1364 C CE1 . PHE A 1 182 ? 25.254  3.179   76.175  1.00 29.77  ? 387 PHE A CE1 1 
ATOM   1365 C CE2 . PHE A 1 182 ? 25.709  4.217   74.090  1.00 30.84  ? 387 PHE A CE2 1 
ATOM   1366 C CZ  . PHE A 1 182 ? 26.119  3.442   75.143  1.00 29.29  ? 387 PHE A CZ  1 
ATOM   1367 N N   . ILE A 1 183 ? 22.242  7.977   74.248  1.00 32.46  ? 388 ILE A N   1 
ATOM   1368 C CA  . ILE A 1 183 ? 22.895  9.089   73.581  1.00 32.74  ? 388 ILE A CA  1 
ATOM   1369 C C   . ILE A 1 183 ? 22.868  10.303  74.461  1.00 31.30  ? 388 ILE A C   1 
ATOM   1370 O O   . ILE A 1 183 ? 23.880  10.983  74.636  1.00 31.05  ? 388 ILE A O   1 
ATOM   1371 C CB  . ILE A 1 183 ? 22.209  9.397   72.262  1.00 33.87  ? 388 ILE A CB  1 
ATOM   1372 C CG1 . ILE A 1 183 ? 22.360  8.203   71.333  1.00 34.45  ? 388 ILE A CG1 1 
ATOM   1373 C CG2 . ILE A 1 183 ? 22.830  10.617  71.616  1.00 34.92  ? 388 ILE A CG2 1 
ATOM   1374 C CD1 . ILE A 1 183 ? 21.727  8.441   69.983  1.00 41.51  ? 388 ILE A CD1 1 
ATOM   1375 N N   . ALA A 1 184 ? 21.710  10.584  75.036  1.00 28.84  ? 389 ALA A N   1 
ATOM   1376 C CA  . ALA A 1 184 ? 21.593  11.728  75.919  1.00 30.21  ? 389 ALA A CA  1 
ATOM   1377 C C   . ALA A 1 184 ? 22.648  11.636  77.006  1.00 30.46  ? 389 ALA A C   1 
ATOM   1378 O O   . ALA A 1 184 ? 23.306  12.629  77.317  1.00 31.24  ? 389 ALA A O   1 
ATOM   1379 C CB  . ALA A 1 184 ? 20.195  11.776  76.542  1.00 30.72  ? 389 ALA A CB  1 
ATOM   1380 N N   . ALA A 1 185 ? 22.811  10.441  77.580  1.00 29.68  ? 390 ALA A N   1 
ATOM   1381 C CA  . ALA A 1 185 ? 23.787  10.215  78.644  1.00 29.33  ? 390 ALA A CA  1 
ATOM   1382 C C   . ALA A 1 185 ? 25.211  10.529  78.181  1.00 30.76  ? 390 ALA A C   1 
ATOM   1383 O O   . ALA A 1 185 ? 26.001  11.120  78.920  1.00 32.59  ? 390 ALA A O   1 
ATOM   1384 C CB  . ALA A 1 185 ? 23.705  8.781   79.132  1.00 28.89  ? 390 ALA A CB  1 
ATOM   1385 N N   . ILE A 1 186 ? 25.533  10.130  76.959  1.00 29.27  ? 391 ILE A N   1 
ATOM   1386 C CA  . ILE A 1 186 ? 26.845  10.388  76.401  1.00 29.00  ? 391 ILE A CA  1 
ATOM   1387 C C   . ILE A 1 186 ? 27.134  11.894  76.278  1.00 29.89  ? 391 ILE A C   1 
ATOM   1388 O O   . ILE A 1 186 ? 28.205  12.353  76.657  1.00 30.44  ? 391 ILE A O   1 
ATOM   1389 C CB  . ILE A 1 186 ? 26.988  9.738   75.001  1.00 28.51  ? 391 ILE A CB  1 
ATOM   1390 C CG1 . ILE A 1 186 ? 26.942  8.215   75.132  1.00 27.77  ? 391 ILE A CG1 1 
ATOM   1391 C CG2 . ILE A 1 186 ? 28.297  10.174  74.344  1.00 28.29  ? 391 ILE A CG2 1 
ATOM   1392 C CD1 . ILE A 1 186 ? 26.914  7.482   73.793  1.00 26.20  ? 391 ILE A CD1 1 
ATOM   1393 N N   . ILE A 1 187 ? 26.182  12.656  75.749  1.00 32.05  ? 392 ILE A N   1 
ATOM   1394 C CA  . ILE A 1 187 ? 26.373  14.095  75.574  1.00 32.14  ? 392 ILE A CA  1 
ATOM   1395 C C   . ILE A 1 187 ? 26.429  14.840  76.872  1.00 33.87  ? 392 ILE A C   1 
ATOM   1396 O O   . ILE A 1 187 ? 27.248  15.741  77.039  1.00 34.74  ? 392 ILE A O   1 
ATOM   1397 C CB  . ILE A 1 187 ? 25.262  14.738  74.706  1.00 30.72  ? 392 ILE A CB  1 
ATOM   1398 C CG1 . ILE A 1 187 ? 25.355  14.246  73.264  1.00 30.80  ? 392 ILE A CG1 1 
ATOM   1399 C CG2 . ILE A 1 187 ? 25.415  16.244  74.711  1.00 29.15  ? 392 ILE A CG2 1 
ATOM   1400 C CD1 . ILE A 1 187 ? 24.656  12.969  73.018  1.00 32.28  ? 392 ILE A CD1 1 
ATOM   1401 N N   . LEU A 1 188 ? 25.553  14.487  77.805  1.00 33.99  ? 393 LEU A N   1 
ATOM   1402 C CA  . LEU A 1 188 ? 25.547  15.158  79.093  1.00 36.59  ? 393 LEU A CA  1 
ATOM   1403 C C   . LEU A 1 188 ? 26.483  14.501  80.050  1.00 36.15  ? 393 LEU A C   1 
ATOM   1404 O O   . LEU A 1 188 ? 26.073  13.865  81.009  1.00 37.10  ? 393 LEU A O   1 
ATOM   1405 C CB  . LEU A 1 188 ? 24.124  15.205  79.637  1.00 36.05  ? 393 LEU A CB  1 
ATOM   1406 C CG  . LEU A 1 188 ? 23.432  16.305  78.829  1.00 38.98  ? 393 LEU A CG  1 
ATOM   1407 C CD1 . LEU A 1 188 ? 22.169  15.790  78.203  1.00 37.53  ? 393 LEU A CD1 1 
ATOM   1408 C CD2 . LEU A 1 188 ? 23.183  17.502  79.726  1.00 37.06  ? 393 LEU A CD2 1 
ATOM   1409 N N   . CYS A 1 189 ? 27.770  14.669  79.786  1.00 35.12  ? 394 CYS A N   1 
ATOM   1410 C CA  . CYS A 1 189 ? 28.816  14.076  80.593  1.00 36.79  ? 394 CYS A CA  1 
ATOM   1411 C C   . CYS A 1 189 ? 29.712  15.146  81.270  1.00 37.10  ? 394 CYS A C   1 
ATOM   1412 O O   . CYS A 1 189 ? 30.463  15.863  80.608  1.00 37.64  ? 394 CYS A O   1 
ATOM   1413 C CB  . CYS A 1 189 ? 29.645  13.154  79.698  1.00 37.86  ? 394 CYS A CB  1 
ATOM   1414 S SG  . CYS A 1 189 ? 31.286  12.811  80.287  1.00 42.79  ? 394 CYS A SG  1 
ATOM   1415 N N   . GLY A 1 190 ? 29.631  15.228  82.592  1.00 37.64  ? 395 GLY A N   1 
ATOM   1416 C CA  . GLY A 1 190 ? 30.410  16.214  83.322  1.00 37.53  ? 395 GLY A CA  1 
ATOM   1417 C C   . GLY A 1 190 ? 31.918  16.090  83.296  1.00 38.22  ? 395 GLY A C   1 
ATOM   1418 O O   . GLY A 1 190 ? 32.607  16.966  83.802  1.00 38.53  ? 395 GLY A O   1 
ATOM   1419 N N   . ASP A 1 191 ? 32.431  15.019  82.702  1.00 40.28  ? 396 ASP A N   1 
ATOM   1420 C CA  . ASP A 1 191 ? 33.871  14.765  82.622  1.00 42.93  ? 396 ASP A CA  1 
ATOM   1421 C C   . ASP A 1 191 ? 34.566  15.533  81.505  1.00 41.06  ? 396 ASP A C   1 
ATOM   1422 O O   . ASP A 1 191 ? 35.781  15.461  81.382  1.00 41.09  ? 396 ASP A O   1 
ATOM   1423 C CB  . ASP A 1 191 ? 34.150  13.275  82.364  1.00 49.19  ? 396 ASP A CB  1 
ATOM   1424 C CG  . ASP A 1 191 ? 33.380  12.341  83.296  1.00 57.24  ? 396 ASP A CG  1 
ATOM   1425 O OD1 . ASP A 1 191 ? 32.137  12.477  83.440  1.00 60.75  ? 396 ASP A OD1 1 
ATOM   1426 O OD2 . ASP A 1 191 ? 34.026  11.436  83.871  1.00 61.29  ? 396 ASP A OD2 1 
ATOM   1427 N N   . ARG A 1 192 ? 33.818  16.255  80.680  1.00 39.57  ? 397 ARG A N   1 
ATOM   1428 C CA  . ARG A 1 192 ? 34.435  16.960  79.559  1.00 38.81  ? 397 ARG A CA  1 
ATOM   1429 C C   . ARG A 1 192 ? 35.332  18.137  79.931  1.00 39.86  ? 397 ARG A C   1 
ATOM   1430 O O   . ARG A 1 192 ? 34.997  18.964  80.779  1.00 41.65  ? 397 ARG A O   1 
ATOM   1431 C CB  . ARG A 1 192 ? 33.364  17.438  78.572  1.00 36.27  ? 397 ARG A CB  1 
ATOM   1432 C CG  . ARG A 1 192 ? 32.336  16.386  78.154  1.00 35.08  ? 397 ARG A CG  1 
ATOM   1433 C CD  . ARG A 1 192 ? 32.945  15.147  77.473  1.00 35.02  ? 397 ARG A CD  1 
ATOM   1434 N NE  . ARG A 1 192 ? 31.895  14.181  77.154  1.00 37.35  ? 397 ARG A NE  1 
ATOM   1435 C CZ  . ARG A 1 192 ? 32.091  12.961  76.661  1.00 36.37  ? 397 ARG A CZ  1 
ATOM   1436 N NH1 . ARG A 1 192 ? 33.308  12.525  76.420  1.00 34.88  ? 397 ARG A NH1 1 
ATOM   1437 N NH2 . ARG A 1 192 ? 31.058  12.174  76.401  1.00 37.27  ? 397 ARG A NH2 1 
ATOM   1438 N N   . PRO A 1 193 ? 36.496  18.221  79.283  1.00 40.20  ? 398 PRO A N   1 
ATOM   1439 C CA  . PRO A 1 193 ? 37.512  19.257  79.463  1.00 40.54  ? 398 PRO A CA  1 
ATOM   1440 C C   . PRO A 1 193 ? 36.942  20.646  79.250  1.00 41.31  ? 398 PRO A C   1 
ATOM   1441 O O   . PRO A 1 193 ? 36.238  20.899  78.266  1.00 41.38  ? 398 PRO A O   1 
ATOM   1442 C CB  . PRO A 1 193 ? 38.540  18.914  78.392  1.00 39.87  ? 398 PRO A CB  1 
ATOM   1443 C CG  . PRO A 1 193 ? 38.443  17.437  78.309  1.00 40.99  ? 398 PRO A CG  1 
ATOM   1444 C CD  . PRO A 1 193 ? 36.960  17.203  78.328  1.00 41.67  ? 398 PRO A CD  1 
ATOM   1445 N N   . GLY A 1 194 ? 37.256  21.552  80.169  1.00 40.76  ? 399 GLY A N   1 
ATOM   1446 C CA  . GLY A 1 194 ? 36.782  22.916  80.049  1.00 39.73  ? 399 GLY A CA  1 
ATOM   1447 C C   . GLY A 1 194 ? 35.314  23.118  80.351  1.00 38.96  ? 399 GLY A C   1 
ATOM   1448 O O   . GLY A 1 194 ? 34.808  24.232  80.235  1.00 38.33  ? 399 GLY A O   1 
ATOM   1449 N N   . LEU A 1 195 ? 34.617  22.050  80.718  1.00 38.84  ? 400 LEU A N   1 
ATOM   1450 C CA  . LEU A 1 195 ? 33.204  22.179  81.034  1.00 40.21  ? 400 LEU A CA  1 
ATOM   1451 C C   . LEU A 1 195 ? 33.154  23.193  82.149  1.00 40.84  ? 400 LEU A C   1 
ATOM   1452 O O   . LEU A 1 195 ? 33.984  23.167  83.058  1.00 41.87  ? 400 LEU A O   1 
ATOM   1453 C CB  . LEU A 1 195 ? 32.630  20.831  81.471  1.00 37.85  ? 400 LEU A CB  1 
ATOM   1454 C CG  . LEU A 1 195 ? 31.108  20.713  81.481  1.00 37.64  ? 400 LEU A CG  1 
ATOM   1455 C CD1 . LEU A 1 195 ? 30.521  21.118  80.128  1.00 33.74  ? 400 LEU A CD1 1 
ATOM   1456 C CD2 . LEU A 1 195 ? 30.741  19.286  81.828  1.00 36.86  ? 400 LEU A CD2 1 
ATOM   1457 N N   . MET A 1 196 ? 32.189  24.102  82.071  1.00 42.04  ? 401 MET A N   1 
ATOM   1458 C CA  . MET A 1 196 ? 32.053  25.181  83.040  1.00 42.08  ? 401 MET A CA  1 
ATOM   1459 C C   . MET A 1 196 ? 31.216  24.899  84.257  1.00 41.73  ? 401 MET A C   1 
ATOM   1460 O O   . MET A 1 196 ? 31.693  25.029  85.379  1.00 42.13  ? 401 MET A O   1 
ATOM   1461 C CB  . MET A 1 196 ? 31.518  26.416  82.321  1.00 44.28  ? 401 MET A CB  1 
ATOM   1462 C CG  . MET A 1 196 ? 31.478  27.671  83.154  1.00 46.37  ? 401 MET A CG  1 
ATOM   1463 S SD  . MET A 1 196 ? 31.086  29.080  82.128  1.00 47.75  ? 401 MET A SD  1 
ATOM   1464 C CE  . MET A 1 196 ? 29.292  28.964  82.109  1.00 47.34  ? 401 MET A CE  1 
ATOM   1465 N N   . ASN A 1 197 ? 29.958  24.530  84.050  1.00 42.27  ? 402 ASN A N   1 
ATOM   1466 C CA  . ASN A 1 197 ? 29.049  24.232  85.157  1.00 42.39  ? 402 ASN A CA  1 
ATOM   1467 C C   . ASN A 1 197 ? 29.005  22.699  85.383  1.00 42.02  ? 402 ASN A C   1 
ATOM   1468 O O   . ASN A 1 197 ? 27.975  22.051  85.175  1.00 41.54  ? 402 ASN A O   1 
ATOM   1469 C CB  . ASN A 1 197 ? 27.642  24.748  84.832  1.00 43.94  ? 402 ASN A CB  1 
ATOM   1470 C CG  . ASN A 1 197 ? 26.724  24.771  86.040  1.00 46.39  ? 402 ASN A CG  1 
ATOM   1471 O OD1 . ASN A 1 197 ? 26.861  23.964  86.966  1.00 47.77  ? 402 ASN A OD1 1 
ATOM   1472 N ND2 . ASN A 1 197 ? 25.762  25.691  86.026  1.00 46.52  ? 402 ASN A ND2 1 
ATOM   1473 N N   . VAL A 1 198 ? 30.135  22.145  85.806  1.00 41.47  ? 403 VAL A N   1 
ATOM   1474 C CA  . VAL A 1 198 ? 30.259  20.716  86.066  1.00 41.00  ? 403 VAL A CA  1 
ATOM   1475 C C   . VAL A 1 198 ? 29.143  20.120  86.953  1.00 40.81  ? 403 VAL A C   1 
ATOM   1476 O O   . VAL A 1 198 ? 28.589  19.081  86.629  1.00 39.59  ? 403 VAL A O   1 
ATOM   1477 C CB  . VAL A 1 198 ? 31.623  20.401  86.704  1.00 41.18  ? 403 VAL A CB  1 
ATOM   1478 C CG1 . VAL A 1 198 ? 31.740  18.917  86.978  1.00 41.60  ? 403 VAL A CG1 1 
ATOM   1479 C CG2 . VAL A 1 198 ? 32.738  20.861  85.784  1.00 40.16  ? 403 VAL A CG2 1 
ATOM   1480 N N   . PRO A 1 199 ? 28.813  20.764  88.082  1.00 42.27  ? 404 PRO A N   1 
ATOM   1481 C CA  . PRO A 1 199 ? 27.750  20.186  88.912  1.00 43.32  ? 404 PRO A CA  1 
ATOM   1482 C C   . PRO A 1 199 ? 26.433  20.069  88.178  1.00 44.44  ? 404 PRO A C   1 
ATOM   1483 O O   . PRO A 1 199 ? 25.730  19.068  88.299  1.00 44.81  ? 404 PRO A O   1 
ATOM   1484 C CB  . PRO A 1 199 ? 27.666  21.154  90.093  1.00 41.73  ? 404 PRO A CB  1 
ATOM   1485 C CG  . PRO A 1 199 ? 29.065  21.616  90.232  1.00 42.24  ? 404 PRO A CG  1 
ATOM   1486 C CD  . PRO A 1 199 ? 29.466  21.881  88.787  1.00 42.49  ? 404 PRO A CD  1 
ATOM   1487 N N   . ARG A 1 200 ? 26.088  21.100  87.417  1.00 45.79  ? 405 ARG A N   1 
ATOM   1488 C CA  . ARG A 1 200 ? 24.838  21.096  86.667  1.00 47.00  ? 405 ARG A CA  1 
ATOM   1489 C C   . ARG A 1 200 ? 24.793  19.947  85.659  1.00 45.15  ? 405 ARG A C   1 
ATOM   1490 O O   . ARG A 1 200 ? 23.800  19.219  85.584  1.00 44.47  ? 405 ARG A O   1 
ATOM   1491 C CB  . ARG A 1 200 ? 24.658  22.427  85.934  1.00 49.37  ? 405 ARG A CB  1 
ATOM   1492 C CG  . ARG A 1 200 ? 23.338  22.547  85.121  1.00 54.81  ? 405 ARG A CG  1 
ATOM   1493 C CD  . ARG A 1 200 ? 22.089  22.602  86.017  1.00 59.61  ? 405 ARG A CD  1 
ATOM   1494 N NE  . ARG A 1 200 ? 20.898  23.017  85.273  1.00 64.96  ? 405 ARG A NE  1 
ATOM   1495 C CZ  . ARG A 1 200 ? 19.660  23.000  85.765  1.00 68.65  ? 405 ARG A CZ  1 
ATOM   1496 N NH1 . ARG A 1 200 ? 18.638  23.399  85.010  1.00 69.71  ? 405 ARG A NH1 1 
ATOM   1497 N NH2 . ARG A 1 200 ? 19.438  22.581  87.010  1.00 69.28  ? 405 ARG A NH2 1 
ATOM   1498 N N   . VAL A 1 201 ? 25.864  19.797  84.883  1.00 41.91  ? 406 VAL A N   1 
ATOM   1499 C CA  . VAL A 1 201 ? 25.925  18.743  83.885  1.00 39.98  ? 406 VAL A CA  1 
ATOM   1500 C C   . VAL A 1 201 ? 25.840  17.411  84.563  1.00 41.06  ? 406 VAL A C   1 
ATOM   1501 O O   . VAL A 1 201 ? 25.044  16.554  84.171  1.00 40.67  ? 406 VAL A O   1 
ATOM   1502 C CB  . VAL A 1 201 ? 27.225  18.819  83.061  1.00 37.55  ? 406 VAL A CB  1 
ATOM   1503 C CG1 . VAL A 1 201 ? 27.278  17.682  82.068  1.00 35.86  ? 406 VAL A CG1 1 
ATOM   1504 C CG2 . VAL A 1 201 ? 27.282  20.127  82.321  1.00 39.41  ? 406 VAL A CG2 1 
ATOM   1505 N N   . GLU A 1 202 ? 26.650  17.224  85.600  1.00 40.16  ? 407 GLU A N   1 
ATOM   1506 C CA  . GLU A 1 202 ? 26.649  15.976  86.337  1.00 38.40  ? 407 GLU A CA  1 
ATOM   1507 C C   . GLU A 1 202 ? 25.282  15.639  86.842  1.00 37.01  ? 407 GLU A C   1 
ATOM   1508 O O   . GLU A 1 202 ? 24.868  14.477  86.803  1.00 38.41  ? 407 GLU A O   1 
ATOM   1509 C CB  . GLU A 1 202 ? 27.621  16.043  87.509  1.00 39.80  ? 407 GLU A CB  1 
ATOM   1510 C CG  . GLU A 1 202 ? 29.068  16.111  87.117  1.00 43.49  ? 407 GLU A CG  1 
ATOM   1511 C CD  . GLU A 1 202 ? 29.997  15.971  88.311  1.00 47.50  ? 407 GLU A CD  1 
ATOM   1512 O OE1 . GLU A 1 202 ? 29.682  16.520  89.392  1.00 48.66  ? 407 GLU A OE1 1 
ATOM   1513 O OE2 . GLU A 1 202 ? 31.052  15.319  88.167  1.00 51.42  ? 407 GLU A OE2 1 
ATOM   1514 N N   . ALA A 1 203 ? 24.565  16.644  87.331  1.00 34.84  ? 408 ALA A N   1 
ATOM   1515 C CA  . ALA A 1 203 ? 23.224  16.426  87.851  1.00 35.59  ? 408 ALA A CA  1 
ATOM   1516 C C   . ALA A 1 203 ? 22.292  15.957  86.755  1.00 36.51  ? 408 ALA A C   1 
ATOM   1517 O O   . ALA A 1 203 ? 21.504  15.032  86.955  1.00 37.82  ? 408 ALA A O   1 
ATOM   1518 C CB  . ALA A 1 203 ? 22.695  17.691  88.482  1.00 31.94  ? 408 ALA A CB  1 
ATOM   1519 N N   . ILE A 1 204 ? 22.366  16.587  85.590  1.00 37.30  ? 409 ILE A N   1 
ATOM   1520 C CA  . ILE A 1 204 ? 21.509  16.178  84.485  1.00 38.60  ? 409 ILE A CA  1 
ATOM   1521 C C   . ILE A 1 204 ? 21.872  14.784  84.058  1.00 37.45  ? 409 ILE A C   1 
ATOM   1522 O O   . ILE A 1 204 ? 20.996  13.969  83.788  1.00 39.12  ? 409 ILE A O   1 
ATOM   1523 C CB  . ILE A 1 204 ? 21.630  17.119  83.255  1.00 39.10  ? 409 ILE A CB  1 
ATOM   1524 C CG1 . ILE A 1 204 ? 21.192  18.540  83.626  1.00 39.19  ? 409 ILE A CG1 1 
ATOM   1525 C CG2 . ILE A 1 204 ? 20.762  16.587  82.111  1.00 37.25  ? 409 ILE A CG2 1 
ATOM   1526 C CD1 . ILE A 1 204 ? 21.501  19.584  82.534  1.00 40.00  ? 409 ILE A CD1 1 
ATOM   1527 N N   . GLN A 1 205 ? 23.163  14.485  83.996  1.00 36.26  ? 410 GLN A N   1 
ATOM   1528 C CA  . GLN A 1 205 ? 23.568  13.153  83.589  1.00 35.94  ? 410 GLN A CA  1 
ATOM   1529 C C   . GLN A 1 205 ? 22.971  12.130  84.489  1.00 35.39  ? 410 GLN A C   1 
ATOM   1530 O O   . GLN A 1 205 ? 22.475  11.105  84.027  1.00 35.78  ? 410 GLN A O   1 
ATOM   1531 C CB  . GLN A 1 205 ? 25.092  12.998  83.579  1.00 35.99  ? 410 GLN A CB  1 
ATOM   1532 C CG  . GLN A 1 205 ? 25.515  11.587  83.088  1.00 38.18  ? 410 GLN A CG  1 
ATOM   1533 C CD  . GLN A 1 205 ? 27.006  11.335  83.151  1.00 39.18  ? 410 GLN A CD  1 
ATOM   1534 O OE1 . GLN A 1 205 ? 27.627  11.502  84.194  1.00 36.39  ? 410 GLN A OE1 1 
ATOM   1535 N NE2 . GLN A 1 205 ? 27.587  10.910  82.023  1.00 43.56  ? 410 GLN A NE2 1 
ATOM   1536 N N   . ASP A 1 206 ? 22.996  12.390  85.788  1.00 35.18  ? 411 ASP A N   1 
ATOM   1537 C CA  . ASP A 1 206 ? 22.438  11.443  86.729  1.00 36.96  ? 411 ASP A CA  1 
ATOM   1538 C C   . ASP A 1 206 ? 20.981  11.199  86.468  1.00 37.53  ? 411 ASP A C   1 
ATOM   1539 O O   . ASP A 1 206 ? 20.539  10.054  86.406  1.00 37.87  ? 411 ASP A O   1 
ATOM   1540 C CB  . ASP A 1 206 ? 22.623  11.931  88.154  1.00 38.06  ? 411 ASP A CB  1 
ATOM   1541 C CG  . ASP A 1 206 ? 22.624  10.795  89.146  1.00 38.74  ? 411 ASP A CG  1 
ATOM   1542 O OD1 . ASP A 1 206 ? 23.562  9.965   89.078  1.00 38.75  ? 411 ASP A OD1 1 
ATOM   1543 O OD2 . ASP A 1 206 ? 21.692  10.729  89.979  1.00 36.58  ? 411 ASP A OD2 1 
ATOM   1544 N N   . THR A 1 207 ? 20.211  12.268  86.320  1.00 38.39  ? 412 THR A N   1 
ATOM   1545 C CA  . THR A 1 207 ? 18.783  12.130  86.037  1.00 40.53  ? 412 THR A CA  1 
ATOM   1546 C C   . THR A 1 207 ? 18.567  11.195  84.825  1.00 41.38  ? 412 THR A C   1 
ATOM   1547 O O   . THR A 1 207 ? 17.657  10.357  84.817  1.00 40.57  ? 412 THR A O   1 
ATOM   1548 C CB  . THR A 1 207 ? 18.145  13.497  85.711  1.00 40.68  ? 412 THR A CB  1 
ATOM   1549 O OG1 . THR A 1 207 ? 18.177  14.330  86.873  1.00 42.40  ? 412 THR A OG1 1 
ATOM   1550 C CG2 . THR A 1 207 ? 16.703  13.322  85.260  1.00 42.00  ? 412 THR A CG2 1 
ATOM   1551 N N   . ILE A 1 208 ? 19.417  11.369  83.815  1.00 41.55  ? 413 ILE A N   1 
ATOM   1552 C CA  . ILE A 1 208 ? 19.367  10.576  82.593  1.00 42.36  ? 413 ILE A CA  1 
ATOM   1553 C C   . ILE A 1 208 ? 19.693  9.134   82.839  1.00 41.53  ? 413 ILE A C   1 
ATOM   1554 O O   . ILE A 1 208 ? 19.011  8.247   82.333  1.00 41.54  ? 413 ILE A O   1 
ATOM   1555 C CB  . ILE A 1 208 ? 20.339  11.138  81.521  1.00 41.47  ? 413 ILE A CB  1 
ATOM   1556 C CG1 . ILE A 1 208 ? 19.784  12.451  80.962  1.00 39.21  ? 413 ILE A CG1 1 
ATOM   1557 C CG2 . ILE A 1 208 ? 20.545  10.116  80.403  1.00 40.20  ? 413 ILE A CG2 1 
ATOM   1558 C CD1 . ILE A 1 208 ? 20.772  13.228  80.112  1.00 37.53  ? 413 ILE A CD1 1 
ATOM   1559 N N   . LEU A 1 209 ? 20.740  8.880   83.610  1.00 40.75  ? 414 LEU A N   1 
ATOM   1560 C CA  . LEU A 1 209 ? 21.117  7.508   83.904  1.00 41.42  ? 414 LEU A CA  1 
ATOM   1561 C C   . LEU A 1 209 ? 20.036  6.782   84.701  1.00 43.00  ? 414 LEU A C   1 
ATOM   1562 O O   . LEU A 1 209 ? 19.759  5.612   84.449  1.00 44.60  ? 414 LEU A O   1 
ATOM   1563 C CB  . LEU A 1 209 ? 22.445  7.477   84.655  1.00 38.25  ? 414 LEU A CB  1 
ATOM   1564 C CG  . LEU A 1 209 ? 23.638  7.632   83.712  1.00 37.67  ? 414 LEU A CG  1 
ATOM   1565 C CD1 . LEU A 1 209 ? 24.944  7.744   84.494  1.00 36.12  ? 414 LEU A CD1 1 
ATOM   1566 C CD2 . LEU A 1 209 ? 23.661  6.438   82.772  1.00 35.24  ? 414 LEU A CD2 1 
ATOM   1567 N N   . ARG A 1 210 ? 19.422  7.467   85.658  1.00 43.56  ? 415 ARG A N   1 
ATOM   1568 C CA  . ARG A 1 210 ? 18.363  6.852   86.449  1.00 44.98  ? 415 ARG A CA  1 
ATOM   1569 C C   . ARG A 1 210 ? 17.186  6.581   85.561  1.00 45.07  ? 415 ARG A C   1 
ATOM   1570 O O   . ARG A 1 210 ? 16.557  5.527   85.643  1.00 46.94  ? 415 ARG A O   1 
ATOM   1571 C CB  . ARG A 1 210 ? 17.964  7.767   87.604  1.00 47.15  ? 415 ARG A CB  1 
ATOM   1572 C CG  . ARG A 1 210 ? 19.123  8.088   88.511  1.00 49.87  ? 415 ARG A CG  1 
ATOM   1573 C CD  . ARG A 1 210 ? 18.674  8.701   89.792  1.00 55.43  ? 415 ARG A CD  1 
ATOM   1574 N NE  . ARG A 1 210 ? 19.779  8.789   90.744  1.00 60.66  ? 415 ARG A NE  1 
ATOM   1575 C CZ  . ARG A 1 210 ? 19.633  9.008   92.048  1.00 62.81  ? 415 ARG A CZ  1 
ATOM   1576 N NH1 . ARG A 1 210 ? 18.416  9.162   92.563  1.00 62.48  ? 415 ARG A NH1 1 
ATOM   1577 N NH2 . ARG A 1 210 ? 20.705  9.069   92.835  1.00 63.33  ? 415 ARG A NH2 1 
ATOM   1578 N N   . ALA A 1 211 ? 16.874  7.535   84.695  1.00 44.21  ? 416 ALA A N   1 
ATOM   1579 C CA  . ALA A 1 211 ? 15.782  7.363   83.756  1.00 43.10  ? 416 ALA A CA  1 
ATOM   1580 C C   . ALA A 1 211 ? 16.088  6.162   82.875  1.00 42.77  ? 416 ALA A C   1 
ATOM   1581 O O   . ALA A 1 211 ? 15.221  5.347   82.587  1.00 43.31  ? 416 ALA A O   1 
ATOM   1582 C CB  . ALA A 1 211 ? 15.636  8.605   82.903  1.00 41.49  ? 416 ALA A CB  1 
ATOM   1583 N N   . LEU A 1 212 ? 17.336  6.055   82.445  1.00 43.38  ? 417 LEU A N   1 
ATOM   1584 C CA  . LEU A 1 212 ? 17.742  4.965   81.586  1.00 45.22  ? 417 LEU A CA  1 
ATOM   1585 C C   . LEU A 1 212 ? 17.539  3.655   82.200  1.00 47.78  ? 417 LEU A C   1 
ATOM   1586 O O   . LEU A 1 212 ? 17.001  2.753   81.565  1.00 48.15  ? 417 LEU A O   1 
ATOM   1587 C CB  . LEU A 1 212 ? 19.205  5.116   81.191  1.00 43.46  ? 417 LEU A CB  1 
ATOM   1588 C CG  . LEU A 1 212 ? 19.789  3.934   80.410  1.00 42.03  ? 417 LEU A CG  1 
ATOM   1589 C CD1 . LEU A 1 212 ? 19.133  3.788   79.045  1.00 39.07  ? 417 LEU A CD1 1 
ATOM   1590 C CD2 . LEU A 1 212 ? 21.275  4.152   80.260  1.00 41.62  ? 417 LEU A CD2 1 
ATOM   1591 N N   . GLU A 1 213 ? 17.964  3.511   83.452  1.00 50.58  ? 418 GLU A N   1 
ATOM   1592 C CA  . GLU A 1 213 ? 17.830  2.244   84.170  1.00 52.82  ? 418 GLU A CA  1 
ATOM   1593 C C   . GLU A 1 213 ? 16.390  1.815   84.370  1.00 52.48  ? 418 GLU A C   1 
ATOM   1594 O O   . GLU A 1 213 ? 16.039  0.661   84.141  1.00 52.29  ? 418 GLU A O   1 
ATOM   1595 C CB  . GLU A 1 213 ? 18.505  2.328   85.531  1.00 55.01  ? 418 GLU A CB  1 
ATOM   1596 C CG  . GLU A 1 213 ? 18.472  1.014   86.274  1.00 59.11  ? 418 GLU A CG  1 
ATOM   1597 C CD  . GLU A 1 213 ? 18.995  1.144   87.680  1.00 61.51  ? 418 GLU A CD  1 
ATOM   1598 O OE1 . GLU A 1 213 ? 18.358  1.853   88.489  1.00 62.80  ? 418 GLU A OE1 1 
ATOM   1599 O OE2 . GLU A 1 213 ? 20.047  0.539   87.972  1.00 63.47  ? 418 GLU A OE2 1 
ATOM   1600 N N   . PHE A 1 214 ? 15.552  2.737   84.820  1.00 52.12  ? 419 PHE A N   1 
ATOM   1601 C CA  . PHE A 1 214 ? 14.153  2.415   85.016  1.00 52.40  ? 419 PHE A CA  1 
ATOM   1602 C C   . PHE A 1 214 ? 13.561  2.031   83.704  1.00 51.14  ? 419 PHE A C   1 
ATOM   1603 O O   . PHE A 1 214 ? 12.818  1.050   83.616  1.00 52.89  ? 419 PHE A O   1 
ATOM   1604 C CB  . PHE A 1 214 ? 13.431  3.606   85.642  1.00 54.96  ? 419 PHE A CB  1 
ATOM   1605 C CG  . PHE A 1 214 ? 13.817  3.841   87.080  1.00 59.39  ? 419 PHE A CG  1 
ATOM   1606 C CD1 . PHE A 1 214 ? 14.112  5.113   87.542  1.00 61.06  ? 419 PHE A CD1 1 
ATOM   1607 C CD2 . PHE A 1 214 ? 13.904  2.775   87.968  1.00 60.39  ? 419 PHE A CD2 1 
ATOM   1608 C CE1 . PHE A 1 214 ? 14.491  5.316   88.867  1.00 62.40  ? 419 PHE A CE1 1 
ATOM   1609 C CE2 . PHE A 1 214 ? 14.281  2.970   89.291  1.00 61.76  ? 419 PHE A CE2 1 
ATOM   1610 C CZ  . PHE A 1 214 ? 14.575  4.241   89.740  1.00 62.21  ? 419 PHE A CZ  1 
ATOM   1611 N N   . HIS A 1 215 ? 13.911  2.778   82.659  1.00 48.56  ? 420 HIS A N   1 
ATOM   1612 C CA  . HIS A 1 215 ? 13.427  2.505   81.307  1.00 45.80  ? 420 HIS A CA  1 
ATOM   1613 C C   . HIS A 1 215 ? 13.861  1.121   80.824  1.00 44.47  ? 420 HIS A C   1 
ATOM   1614 O O   . HIS A 1 215 ? 13.155  0.486   80.051  1.00 42.30  ? 420 HIS A O   1 
ATOM   1615 C CB  . HIS A 1 215 ? 13.954  3.563   80.333  1.00 45.47  ? 420 HIS A CB  1 
ATOM   1616 C CG  . HIS A 1 215 ? 13.550  3.327   78.909  1.00 45.80  ? 420 HIS A CG  1 
ATOM   1617 N ND1 . HIS A 1 215 ? 12.302  3.655   78.424  1.00 45.55  ? 420 HIS A ND1 1 
ATOM   1618 C CD2 . HIS A 1 215 ? 14.217  2.757   77.876  1.00 44.99  ? 420 HIS A CD2 1 
ATOM   1619 C CE1 . HIS A 1 215 ? 12.217  3.293   77.154  1.00 44.08  ? 420 HIS A CE1 1 
ATOM   1620 N NE2 . HIS A 1 215 ? 13.365  2.746   76.798  1.00 42.08  ? 420 HIS A NE2 1 
ATOM   1621 N N   . LEU A 1 216 ? 15.028  0.668   81.280  1.00 44.89  ? 421 LEU A N   1 
ATOM   1622 C CA  . LEU A 1 216 ? 15.570  -0.630  80.892  1.00 45.39  ? 421 LEU A CA  1 
ATOM   1623 C C   . LEU A 1 216 ? 14.946  -1.775  81.565  1.00 46.84  ? 421 LEU A C   1 
ATOM   1624 O O   . LEU A 1 216 ? 14.791  -2.833  80.964  1.00 46.15  ? 421 LEU A O   1 
ATOM   1625 C CB  . LEU A 1 216 ? 17.075  -0.693  81.137  1.00 44.85  ? 421 LEU A CB  1 
ATOM   1626 C CG  . LEU A 1 216 ? 18.009  0.081   80.208  1.00 45.43  ? 421 LEU A CG  1 
ATOM   1627 C CD1 . LEU A 1 216 ? 19.447  -0.266  80.561  1.00 46.15  ? 421 LEU A CD1 1 
ATOM   1628 C CD2 . LEU A 1 216 ? 17.731  -0.273  78.759  1.00 45.75  ? 421 LEU A CD2 1 
ATOM   1629 N N   . GLN A 1 217 ? 14.591  -1.633  82.834  1.00 49.20  ? 422 GLN A N   1 
ATOM   1630 C CA  . GLN A 1 217 ? 13.957  -2.762  83.493  1.00 53.13  ? 422 GLN A CA  1 
ATOM   1631 C C   . GLN A 1 217 ? 12.528  -2.911  82.974  1.00 55.30  ? 422 GLN A C   1 
ATOM   1632 O O   . GLN A 1 217 ? 11.931  -3.987  83.056  1.00 56.06  ? 422 GLN A O   1 
ATOM   1633 C CB  . GLN A 1 217 ? 14.001  -2.611  85.015  1.00 52.32  ? 422 GLN A CB  1 
ATOM   1634 C CG  . GLN A 1 217 ? 13.719  -1.242  85.539  1.00 55.41  ? 422 GLN A CG  1 
ATOM   1635 C CD  . GLN A 1 217 ? 14.161  -1.103  86.985  1.00 57.69  ? 422 GLN A CD  1 
ATOM   1636 O OE1 . GLN A 1 217 ? 13.884  -0.098  87.646  1.00 59.12  ? 422 GLN A OE1 1 
ATOM   1637 N NE2 . GLN A 1 217 ? 14.861  -2.115  87.483  1.00 56.95  ? 422 GLN A NE2 1 
ATOM   1638 N N   . ALA A 1 218 ? 11.991  -1.834  82.412  1.00 55.78  ? 423 ALA A N   1 
ATOM   1639 C CA  . ALA A 1 218 ? 10.654  -1.877  81.842  1.00 57.34  ? 423 ALA A CA  1 
ATOM   1640 C C   . ALA A 1 218 ? 10.735  -2.524  80.421  1.00 58.67  ? 423 ALA A C   1 
ATOM   1641 O O   . ALA A 1 218 ? 10.215  -3.616  80.200  1.00 59.60  ? 423 ALA A O   1 
ATOM   1642 C CB  . ALA A 1 218 ? 10.072  -0.463  81.750  1.00 55.38  ? 423 ALA A CB  1 
ATOM   1643 N N   . ASN A 1 219 ? 11.416  -1.839  79.500  1.00 59.69  ? 424 ASN A N   1 
ATOM   1644 C CA  . ASN A 1 219 ? 11.580  -2.277  78.109  1.00 59.78  ? 424 ASN A CA  1 
ATOM   1645 C C   . ASN A 1 219 ? 12.379  -3.615  77.925  1.00 59.38  ? 424 ASN A C   1 
ATOM   1646 O O   . ASN A 1 219 ? 12.327  -4.228  76.865  1.00 59.98  ? 424 ASN A O   1 
ATOM   1647 C CB  . ASN A 1 219 ? 12.254  -1.151  77.304  1.00 60.97  ? 424 ASN A CB  1 
ATOM   1648 C CG  . ASN A 1 219 ? 12.074  -1.301  75.795  1.00 61.80  ? 424 ASN A CG  1 
ATOM   1649 O OD1 . ASN A 1 219 ? 12.570  -2.243  75.186  1.00 63.83  ? 424 ASN A OD1 1 
ATOM   1650 N ND2 . ASN A 1 219 ? 11.361  -0.362  75.191  1.00 63.78  ? 424 ASN A ND2 1 
ATOM   1651 N N   . HIS A 1 220 ? 13.104  -4.044  78.950  1.00 59.44  ? 425 HIS A N   1 
ATOM   1652 C CA  . HIS A 1 220 ? 13.880  -5.279  78.865  1.00 60.42  ? 425 HIS A CA  1 
ATOM   1653 C C   . HIS A 1 220 ? 13.775  -6.014  80.167  1.00 61.64  ? 425 HIS A C   1 
ATOM   1654 O O   . HIS A 1 220 ? 14.772  -6.243  80.845  1.00 61.52  ? 425 HIS A O   1 
ATOM   1655 C CB  . HIS A 1 220 ? 15.343  -4.949  78.578  1.00 60.88  ? 425 HIS A CB  1 
ATOM   1656 C CG  . HIS A 1 220 ? 15.557  -4.231  77.284  1.00 60.77  ? 425 HIS A CG  1 
ATOM   1657 N ND1 . HIS A 1 220 ? 15.944  -4.876  76.129  1.00 61.32  ? 425 HIS A ND1 1 
ATOM   1658 C CD2 . HIS A 1 220 ? 15.397  -2.928  76.951  1.00 60.33  ? 425 HIS A CD2 1 
ATOM   1659 C CE1 . HIS A 1 220 ? 16.012  -4.002  75.141  1.00 61.06  ? 425 HIS A CE1 1 
ATOM   1660 N NE2 . HIS A 1 220 ? 15.684  -2.813  75.614  1.00 60.74  ? 425 HIS A NE2 1 
ATOM   1661 N N   . PRO A 1 221 ? 12.561  -6.435  80.527  1.00 63.36  ? 426 PRO A N   1 
ATOM   1662 C CA  . PRO A 1 221 ? 12.275  -7.153  81.770  1.00 64.11  ? 426 PRO A CA  1 
ATOM   1663 C C   . PRO A 1 221 ? 13.253  -8.212  82.164  1.00 64.94  ? 426 PRO A C   1 
ATOM   1664 O O   . PRO A 1 221 ? 13.856  -8.154  83.236  1.00 65.14  ? 426 PRO A O   1 
ATOM   1665 C CB  . PRO A 1 221 ? 10.884  -7.733  81.521  1.00 64.06  ? 426 PRO A CB  1 
ATOM   1666 C CG  . PRO A 1 221 ? 10.271  -6.755  80.583  1.00 64.75  ? 426 PRO A CG  1 
ATOM   1667 C CD  . PRO A 1 221 ? 11.402  -6.504  79.621  1.00 64.24  ? 426 PRO A CD  1 
ATOM   1668 N N   . ASP A 1 222 ? 13.426  -9.192  81.290  1.00 65.67  ? 427 ASP A N   1 
ATOM   1669 C CA  . ASP A 1 222 ? 14.301  -10.312 81.578  1.00 66.90  ? 427 ASP A CA  1 
ATOM   1670 C C   . ASP A 1 222 ? 15.759  -10.108 81.222  1.00 67.61  ? 427 ASP A C   1 
ATOM   1671 O O   . ASP A 1 222 ? 16.573  -11.021 81.361  1.00 67.89  ? 427 ASP A O   1 
ATOM   1672 C CB  . ASP A 1 222 ? 13.734  -11.561 80.892  1.00 66.95  ? 427 ASP A CB  1 
ATOM   1673 C CG  . ASP A 1 222 ? 12.236  -11.735 81.150  1.00 66.16  ? 427 ASP A CG  1 
ATOM   1674 O OD1 . ASP A 1 222 ? 11.828  -11.812 82.333  1.00 63.65  ? 427 ASP A OD1 1 
ATOM   1675 O OD2 . ASP A 1 222 ? 11.470  -11.779 80.164  1.00 65.77  ? 427 ASP A OD2 1 
ATOM   1676 N N   . ALA A 1 223 ? 16.102  -8.904  80.779  1.00 68.75  ? 428 ALA A N   1 
ATOM   1677 C CA  . ALA A 1 223 ? 17.486  -8.592  80.420  1.00 69.20  ? 428 ALA A CA  1 
ATOM   1678 C C   . ALA A 1 223 ? 18.332  -8.482  81.718  1.00 69.17  ? 428 ALA A C   1 
ATOM   1679 O O   . ALA A 1 223 ? 18.185  -7.542  82.505  1.00 69.60  ? 428 ALA A O   1 
ATOM   1680 C CB  . ALA A 1 223 ? 17.536  -7.291  79.634  1.00 69.57  ? 428 ALA A CB  1 
ATOM   1681 N N   . GLN A 1 224 ? 19.214  -9.451  81.916  1.00 68.77  ? 429 GLN A N   1 
ATOM   1682 C CA  . GLN A 1 224 ? 20.041  -9.502  83.112  1.00 67.58  ? 429 GLN A CA  1 
ATOM   1683 C C   . GLN A 1 224 ? 20.745  -8.196  83.480  1.00 66.56  ? 429 GLN A C   1 
ATOM   1684 O O   . GLN A 1 224 ? 20.117  -7.269  83.994  1.00 67.55  ? 429 GLN A O   1 
ATOM   1685 C CB  . GLN A 1 224 ? 21.058  -10.639 82.990  1.00 67.82  ? 429 GLN A CB  1 
ATOM   1686 N N   . TYR A 1 225 ? 22.044  -8.127  83.208  1.00 64.01  ? 430 TYR A N   1 
ATOM   1687 C CA  . TYR A 1 225 ? 22.859  -6.960  83.546  1.00 61.09  ? 430 TYR A CA  1 
ATOM   1688 C C   . TYR A 1 225 ? 22.883  -5.849  82.534  1.00 57.93  ? 430 TYR A C   1 
ATOM   1689 O O   . TYR A 1 225 ? 23.911  -5.188  82.386  1.00 56.85  ? 430 TYR A O   1 
ATOM   1690 C CB  . TYR A 1 225 ? 24.306  -7.400  83.776  1.00 63.57  ? 430 TYR A CB  1 
ATOM   1691 C CG  . TYR A 1 225 ? 24.577  -8.077  85.094  1.00 65.23  ? 430 TYR A CG  1 
ATOM   1692 C CD1 . TYR A 1 225 ? 23.943  -9.267  85.445  1.00 66.77  ? 430 TYR A CD1 1 
ATOM   1693 C CD2 . TYR A 1 225 ? 25.468  -7.514  85.999  1.00 66.20  ? 430 TYR A CD2 1 
ATOM   1694 C CE1 . TYR A 1 225 ? 24.191  -9.879  86.677  1.00 68.64  ? 430 TYR A CE1 1 
ATOM   1695 C CE2 . TYR A 1 225 ? 25.725  -8.109  87.222  1.00 68.42  ? 430 TYR A CE2 1 
ATOM   1696 C CZ  . TYR A 1 225 ? 25.086  -9.289  87.566  1.00 69.40  ? 430 TYR A CZ  1 
ATOM   1697 O OH  . TYR A 1 225 ? 25.339  -9.845  88.808  1.00 67.56  ? 430 TYR A OH  1 
ATOM   1698 N N   . LEU A 1 226 ? 21.773  -5.603  81.852  1.00 54.08  ? 431 LEU A N   1 
ATOM   1699 C CA  . LEU A 1 226 ? 21.748  -4.569  80.825  1.00 51.38  ? 431 LEU A CA  1 
ATOM   1700 C C   . LEU A 1 226 ? 22.373  -3.199  81.199  1.00 50.09  ? 431 LEU A C   1 
ATOM   1701 O O   . LEU A 1 226 ? 23.281  -2.728  80.524  1.00 50.05  ? 431 LEU A O   1 
ATOM   1702 C CB  . LEU A 1 226 ? 20.318  -4.349  80.326  1.00 49.05  ? 431 LEU A CB  1 
ATOM   1703 C CG  . LEU A 1 226 ? 20.367  -3.809  78.903  1.00 47.03  ? 431 LEU A CG  1 
ATOM   1704 C CD1 . LEU A 1 226 ? 21.128  -4.823  78.099  1.00 46.27  ? 431 LEU A CD1 1 
ATOM   1705 C CD2 . LEU A 1 226 ? 18.989  -3.570  78.312  1.00 47.84  ? 431 LEU A CD2 1 
ATOM   1706 N N   . PHE A 1 227 ? 21.885  -2.582  82.270  1.00 48.84  ? 432 PHE A N   1 
ATOM   1707 C CA  . PHE A 1 227 ? 22.376  -1.271  82.694  1.00 46.96  ? 432 PHE A CA  1 
ATOM   1708 C C   . PHE A 1 227 ? 23.870  -1.158  82.895  1.00 46.52  ? 432 PHE A C   1 
ATOM   1709 O O   . PHE A 1 227 ? 24.535  -0.397  82.207  1.00 47.27  ? 432 PHE A O   1 
ATOM   1710 C CB  . PHE A 1 227 ? 21.673  -0.835  83.967  1.00 46.30  ? 432 PHE A CB  1 
ATOM   1711 C CG  . PHE A 1 227 ? 21.846  0.606   84.270  1.00 44.92  ? 432 PHE A CG  1 
ATOM   1712 C CD1 . PHE A 1 227 ? 21.169  1.562   83.541  1.00 45.78  ? 432 PHE A CD1 1 
ATOM   1713 C CD2 . PHE A 1 227 ? 22.685  1.013   85.287  1.00 44.27  ? 432 PHE A CD2 1 
ATOM   1714 C CE1 . PHE A 1 227 ? 21.325  2.908   83.824  1.00 45.06  ? 432 PHE A CE1 1 
ATOM   1715 C CE2 . PHE A 1 227 ? 22.844  2.354   85.574  1.00 43.90  ? 432 PHE A CE2 1 
ATOM   1716 C CZ  . PHE A 1 227 ? 22.163  3.303   84.841  1.00 43.53  ? 432 PHE A CZ  1 
ATOM   1717 N N   . PRO A 1 228 ? 24.434  -1.892  83.863  1.00 46.88  ? 433 PRO A N   1 
ATOM   1718 C CA  . PRO A 1 228 ? 25.888  -1.755  84.017  1.00 45.04  ? 433 PRO A CA  1 
ATOM   1719 C C   . PRO A 1 228 ? 26.662  -2.077  82.733  1.00 44.32  ? 433 PRO A C   1 
ATOM   1720 O O   . PRO A 1 228 ? 27.772  -1.592  82.533  1.00 45.60  ? 433 PRO A O   1 
ATOM   1721 C CB  . PRO A 1 228 ? 26.211  -2.719  85.165  1.00 44.21  ? 433 PRO A CB  1 
ATOM   1722 C CG  . PRO A 1 228 ? 25.080  -3.702  85.143  1.00 45.36  ? 433 PRO A CG  1 
ATOM   1723 C CD  . PRO A 1 228 ? 23.883  -2.828  84.859  1.00 45.31  ? 433 PRO A CD  1 
ATOM   1724 N N   . LYS A 1 229 ? 26.080  -2.902  81.870  1.00 44.13  ? 434 LYS A N   1 
ATOM   1725 C CA  . LYS A 1 229 ? 26.724  -3.243  80.610  1.00 44.40  ? 434 LYS A CA  1 
ATOM   1726 C C   . LYS A 1 229 ? 26.791  -2.005  79.732  1.00 43.90  ? 434 LYS A C   1 
ATOM   1727 O O   . LYS A 1 229 ? 27.790  -1.761  79.055  1.00 45.21  ? 434 LYS A O   1 
ATOM   1728 C CB  . LYS A 1 229 ? 25.950  -4.352  79.897  1.00 45.34  ? 434 LYS A CB  1 
ATOM   1729 C CG  . LYS A 1 229 ? 26.256  -5.766  80.425  1.00 47.38  ? 434 LYS A CG  1 
ATOM   1730 C CD  . LYS A 1 229 ? 25.455  -6.830  79.653  1.00 49.97  ? 434 LYS A CD  1 
ATOM   1731 C CE  . LYS A 1 229 ? 25.648  -8.229  80.245  1.00 51.29  ? 434 LYS A CE  1 
ATOM   1732 N NZ  . LYS A 1 229 ? 24.701  -9.202  79.636  1.00 52.55  ? 434 LYS A NZ  1 
ATOM   1733 N N   . LEU A 1 230 ? 25.723  -1.216  79.755  1.00 41.82  ? 435 LEU A N   1 
ATOM   1734 C CA  . LEU A 1 230 ? 25.659  0.006   78.977  1.00 40.16  ? 435 LEU A CA  1 
ATOM   1735 C C   . LEU A 1 230 ? 26.674  1.021   79.485  1.00 39.08  ? 435 LEU A C   1 
ATOM   1736 O O   . LEU A 1 230 ? 27.264  1.758   78.702  1.00 38.87  ? 435 LEU A O   1 
ATOM   1737 C CB  . LEU A 1 230 ? 24.241  0.574   79.024  1.00 39.68  ? 435 LEU A CB  1 
ATOM   1738 C CG  . LEU A 1 230 ? 23.195  -0.274  78.291  1.00 39.69  ? 435 LEU A CG  1 
ATOM   1739 C CD1 . LEU A 1 230 ? 21.855  0.435   78.279  1.00 42.37  ? 435 LEU A CD1 1 
ATOM   1740 C CD2 . LEU A 1 230 ? 23.651  -0.506  76.871  1.00 37.74  ? 435 LEU A CD2 1 
ATOM   1741 N N   . LEU A 1 231 ? 26.872  1.066   80.795  1.00 38.13  ? 436 LEU A N   1 
ATOM   1742 C CA  . LEU A 1 231 ? 27.852  1.967   81.386  1.00 39.16  ? 436 LEU A CA  1 
ATOM   1743 C C   . LEU A 1 231 ? 29.241  1.589   80.888  1.00 39.57  ? 436 LEU A C   1 
ATOM   1744 O O   . LEU A 1 231 ? 30.077  2.460   80.620  1.00 39.84  ? 436 LEU A O   1 
ATOM   1745 C CB  . LEU A 1 231 ? 27.806  1.873   82.909  1.00 39.15  ? 436 LEU A CB  1 
ATOM   1746 C CG  . LEU A 1 231 ? 26.497  2.400   83.511  1.00 39.66  ? 436 LEU A CG  1 
ATOM   1747 C CD1 . LEU A 1 231 ? 26.430  2.072   84.995  1.00 39.18  ? 436 LEU A CD1 1 
ATOM   1748 C CD2 . LEU A 1 231 ? 26.405  3.903   83.284  1.00 39.48  ? 436 LEU A CD2 1 
ATOM   1749 N N   . GLN A 1 232 ? 29.493  0.289   80.764  1.00 38.37  ? 437 GLN A N   1 
ATOM   1750 C CA  . GLN A 1 232 ? 30.781  -0.155  80.264  1.00 37.73  ? 437 GLN A CA  1 
ATOM   1751 C C   . GLN A 1 232 ? 30.930  0.268   78.781  1.00 37.27  ? 437 GLN A C   1 
ATOM   1752 O O   . GLN A 1 232 ? 32.000  0.699   78.360  1.00 38.94  ? 437 GLN A O   1 
ATOM   1753 C CB  . GLN A 1 232 ? 30.918  -1.670  80.384  1.00 37.14  ? 437 GLN A CB  1 
ATOM   1754 C CG  . GLN A 1 232 ? 32.329  -2.196  79.996  1.00 38.10  ? 437 GLN A CG  1 
ATOM   1755 C CD  . GLN A 1 232 ? 33.439  -1.539  80.799  1.00 38.53  ? 437 GLN A CD  1 
ATOM   1756 O OE1 . GLN A 1 232 ? 33.463  -1.626  82.020  1.00 43.61  ? 437 GLN A OE1 1 
ATOM   1757 N NE2 . GLN A 1 232 ? 34.361  -0.879  80.115  1.00 38.17  ? 437 GLN A NE2 1 
ATOM   1758 N N   . LYS A 1 233 ? 29.858  0.139   78.002  1.00 35.84  ? 438 LYS A N   1 
ATOM   1759 C CA  . LYS A 1 233 ? 29.896  0.528   76.590  1.00 34.10  ? 438 LYS A CA  1 
ATOM   1760 C C   . LYS A 1 233 ? 30.271  2.008   76.449  1.00 32.39  ? 438 LYS A C   1 
ATOM   1761 O O   . LYS A 1 233 ? 30.979  2.393   75.511  1.00 30.07  ? 438 LYS A O   1 
ATOM   1762 C CB  . LYS A 1 233 ? 28.540  0.268   75.922  1.00 34.92  ? 438 LYS A CB  1 
ATOM   1763 C CG  . LYS A 1 233 ? 28.181  -1.203  75.840  1.00 34.04  ? 438 LYS A CG  1 
ATOM   1764 C CD  . LYS A 1 233 ? 29.274  -1.970  75.140  1.00 35.87  ? 438 LYS A CD  1 
ATOM   1765 C CE  . LYS A 1 233 ? 29.082  -3.474  75.286  1.00 36.69  ? 438 LYS A CE  1 
ATOM   1766 N NZ  . LYS A 1 233 ? 30.319  -4.215  74.910  1.00 38.71  ? 438 LYS A NZ  1 
ATOM   1767 N N   . MET A 1 234 ? 29.792  2.829   77.381  1.00 29.79  ? 439 MET A N   1 
ATOM   1768 C CA  . MET A 1 234 ? 30.107  4.248   77.363  1.00 30.80  ? 439 MET A CA  1 
ATOM   1769 C C   . MET A 1 234 ? 31.534  4.384   77.563  1.00 32.03  ? 439 MET A C   1 
ATOM   1770 O O   . MET A 1 234 ? 32.206  5.168   76.885  1.00 32.76  ? 439 MET A O   1 
ATOM   1771 C CB  . MET A 1 234 ? 29.343  4.978   78.453  1.00 28.82  ? 439 MET A CB  1 
ATOM   1772 C CG  . MET A 1 234 ? 27.923  5.155   78.107  1.00 30.76  ? 439 MET A CG  1 
ATOM   1773 S SD  . MET A 1 234 ? 26.976  5.706   79.478  1.00 34.39  ? 439 MET A SD  1 
ATOM   1774 C CE  . MET A 1 234 ? 27.426  7.479   79.440  1.00 37.13  ? 439 MET A CE  1 
ATOM   1775 N N   . ALA A 1 235 ? 32.046  3.605   78.507  1.00 32.09  ? 440 ALA A N   1 
ATOM   1776 C CA  . ALA A 1 235 ? 33.459  3.602   78.805  1.00 30.33  ? 440 ALA A CA  1 
ATOM   1777 C C   . ALA A 1 235 ? 34.202  3.214   77.520  1.00 30.70  ? 440 ALA A C   1 
ATOM   1778 O O   . ALA A 1 235 ? 35.140  3.886   77.119  1.00 31.62  ? 440 ALA A O   1 
ATOM   1779 C CB  . ALA A 1 235 ? 33.742  2.611   79.924  1.00 27.45  ? 440 ALA A CB  1 
ATOM   1780 N N   . ASP A 1 236 ? 33.764  2.141   76.865  1.00 31.79  ? 441 ASP A N   1 
ATOM   1781 C CA  . ASP A 1 236 ? 34.399  1.689   75.630  1.00 31.76  ? 441 ASP A CA  1 
ATOM   1782 C C   . ASP A 1 236 ? 34.388  2.732   74.543  1.00 31.21  ? 441 ASP A C   1 
ATOM   1783 O O   . ASP A 1 236 ? 35.372  2.915   73.835  1.00 30.33  ? 441 ASP A O   1 
ATOM   1784 C CB  . ASP A 1 236 ? 33.715  0.429   75.100  1.00 34.67  ? 441 ASP A CB  1 
ATOM   1785 C CG  . ASP A 1 236 ? 33.737  -0.701  76.085  1.00 35.91  ? 441 ASP A CG  1 
ATOM   1786 O OD1 . ASP A 1 236 ? 34.674  -0.763  76.900  1.00 35.03  ? 441 ASP A OD1 1 
ATOM   1787 O OD2 . ASP A 1 236 ? 32.818  -1.540  76.031  1.00 40.76  ? 441 ASP A OD2 1 
ATOM   1788 N N   . LEU A 1 237 ? 33.258  3.404   74.374  1.00 30.57  ? 442 LEU A N   1 
ATOM   1789 C CA  . LEU A 1 237 ? 33.172  4.431   73.357  1.00 30.48  ? 442 LEU A CA  1 
ATOM   1790 C C   . LEU A 1 237 ? 34.198  5.499   73.620  1.00 30.94  ? 442 LEU A C   1 
ATOM   1791 O O   . LEU A 1 237 ? 34.761  6.057   72.689  1.00 31.31  ? 442 LEU A O   1 
ATOM   1792 C CB  . LEU A 1 237 ? 31.751  5.004   73.313  1.00 30.80  ? 442 LEU A CB  1 
ATOM   1793 C CG  . LEU A 1 237 ? 30.743  4.065   72.619  1.00 28.92  ? 442 LEU A CG  1 
ATOM   1794 C CD1 . LEU A 1 237 ? 29.342  4.332   73.109  1.00 27.68  ? 442 LEU A CD1 1 
ATOM   1795 C CD2 . LEU A 1 237 ? 30.842  4.228   71.105  1.00 23.96  ? 442 LEU A CD2 1 
ATOM   1796 N N   . ARG A 1 238 ? 34.469  5.778   74.892  1.00 31.91  ? 443 ARG A N   1 
ATOM   1797 C CA  . ARG A 1 238 ? 35.469  6.775   75.271  1.00 33.42  ? 443 ARG A CA  1 
ATOM   1798 C C   . ARG A 1 238 ? 36.863  6.362   74.691  1.00 33.78  ? 443 ARG A C   1 
ATOM   1799 O O   . ARG A 1 238 ? 37.615  7.204   74.194  1.00 35.23  ? 443 ARG A O   1 
ATOM   1800 C CB  . ARG A 1 238 ? 35.541  6.859   76.789  1.00 36.41  ? 443 ARG A CB  1 
ATOM   1801 C CG  . ARG A 1 238 ? 36.053  8.149   77.331  1.00 41.60  ? 443 ARG A CG  1 
ATOM   1802 C CD  . ARG A 1 238 ? 35.018  8.738   78.280  1.00 47.07  ? 443 ARG A CD  1 
ATOM   1803 N NE  . ARG A 1 238 ? 35.631  9.379   79.439  1.00 51.73  ? 443 ARG A NE  1 
ATOM   1804 C CZ  . ARG A 1 238 ? 34.948  9.976   80.412  1.00 54.73  ? 443 ARG A CZ  1 
ATOM   1805 N NH1 . ARG A 1 238 ? 33.619  10.024  80.371  1.00 55.13  ? 443 ARG A NH1 1 
ATOM   1806 N NH2 . ARG A 1 238 ? 35.597  10.504  81.441  1.00 56.86  ? 443 ARG A NH2 1 
ATOM   1807 N N   . GLN A 1 239 ? 37.164  5.065   74.773  1.00 32.06  ? 444 GLN A N   1 
ATOM   1808 C CA  . GLN A 1 239 ? 38.402  4.471   74.265  1.00 28.89  ? 444 GLN A CA  1 
ATOM   1809 C C   . GLN A 1 239 ? 38.383  4.421   72.757  1.00 28.86  ? 444 GLN A C   1 
ATOM   1810 O O   . GLN A 1 239 ? 39.368  4.735   72.097  1.00 28.59  ? 444 GLN A O   1 
ATOM   1811 C CB  . GLN A 1 239 ? 38.539  3.051   74.805  1.00 29.95  ? 444 GLN A CB  1 
ATOM   1812 C CG  . GLN A 1 239 ? 39.759  2.283   74.319  1.00 35.12  ? 444 GLN A CG  1 
ATOM   1813 C CD  . GLN A 1 239 ? 41.065  2.910   74.780  1.00 38.11  ? 444 GLN A CD  1 
ATOM   1814 O OE1 . GLN A 1 239 ? 41.120  3.551   75.835  1.00 39.27  ? 444 GLN A OE1 1 
ATOM   1815 N NE2 . GLN A 1 239 ? 42.127  2.719   73.999  1.00 37.70  ? 444 GLN A NE2 1 
ATOM   1816 N N   . LEU A 1 240 ? 37.252  4.010   72.199  1.00 28.44  ? 445 LEU A N   1 
ATOM   1817 C CA  . LEU A 1 240 ? 37.118  3.927   70.757  1.00 28.81  ? 445 LEU A CA  1 
ATOM   1818 C C   . LEU A 1 240 ? 37.412  5.268   70.144  1.00 29.22  ? 445 LEU A C   1 
ATOM   1819 O O   . LEU A 1 240 ? 38.166  5.371   69.174  1.00 28.99  ? 445 LEU A O   1 
ATOM   1820 C CB  . LEU A 1 240 ? 35.705  3.467   70.384  1.00 27.66  ? 445 LEU A CB  1 
ATOM   1821 C CG  . LEU A 1 240 ? 35.474  3.134   68.908  1.00 27.59  ? 445 LEU A CG  1 
ATOM   1822 C CD1 . LEU A 1 240 ? 36.430  2.036   68.464  1.00 25.12  ? 445 LEU A CD1 1 
ATOM   1823 C CD2 . LEU A 1 240 ? 34.032  2.708   68.698  1.00 26.77  ? 445 LEU A CD2 1 
ATOM   1824 N N   . VAL A 1 241 ? 36.824  6.319   70.705  1.00 31.09  ? 446 VAL A N   1 
ATOM   1825 C CA  . VAL A 1 241 ? 37.061  7.660   70.180  1.00 32.30  ? 446 VAL A CA  1 
ATOM   1826 C C   . VAL A 1 241 ? 38.497  8.026   70.320  1.00 32.37  ? 446 VAL A C   1 
ATOM   1827 O O   . VAL A 1 241 ? 39.081  8.579   69.405  1.00 34.15  ? 446 VAL A O   1 
ATOM   1828 C CB  . VAL A 1 241 ? 36.178  8.717   70.886  1.00 33.42  ? 446 VAL A CB  1 
ATOM   1829 C CG1 . VAL A 1 241 ? 36.669  10.116  70.553  1.00 29.51  ? 446 VAL A CG1 1 
ATOM   1830 C CG2 . VAL A 1 241 ? 34.719  8.549   70.440  1.00 31.99  ? 446 VAL A CG2 1 
ATOM   1831 N N   . THR A 1 242 ? 39.099  7.702   71.457  1.00 32.41  ? 447 THR A N   1 
ATOM   1832 C CA  . THR A 1 242 ? 40.504  8.008   71.671  1.00 32.79  ? 447 THR A CA  1 
ATOM   1833 C C   . THR A 1 242 ? 41.421  7.386   70.625  1.00 33.18  ? 447 THR A C   1 
ATOM   1834 O O   . THR A 1 242 ? 42.307  8.057   70.094  1.00 32.92  ? 447 THR A O   1 
ATOM   1835 C CB  . THR A 1 242 ? 40.951  7.564   73.067  1.00 34.76  ? 447 THR A CB  1 
ATOM   1836 O OG1 . THR A 1 242 ? 40.293  8.380   74.049  1.00 36.05  ? 447 THR A OG1 1 
ATOM   1837 C CG2 . THR A 1 242 ? 42.466  7.694   73.214  1.00 33.14  ? 447 THR A CG2 1 
ATOM   1838 N N   . GLU A 1 243 ? 41.223  6.105   70.331  1.00 34.14  ? 448 GLU A N   1 
ATOM   1839 C CA  . GLU A 1 243 ? 42.040  5.433   69.324  1.00 36.27  ? 448 GLU A CA  1 
ATOM   1840 C C   . GLU A 1 243 ? 41.723  6.035   67.953  1.00 36.16  ? 448 GLU A C   1 
ATOM   1841 O O   . GLU A 1 243 ? 42.587  6.100   67.085  1.00 38.07  ? 448 GLU A O   1 
ATOM   1842 C CB  . GLU A 1 243 ? 41.766  3.921   69.339  1.00 38.01  ? 448 GLU A CB  1 
ATOM   1843 C CG  . GLU A 1 243 ? 41.999  3.293   70.722  1.00 43.49  ? 448 GLU A CG  1 
ATOM   1844 C CD  . GLU A 1 243 ? 41.319  1.941   70.911  1.00 48.54  ? 448 GLU A CD  1 
ATOM   1845 O OE1 . GLU A 1 243 ? 40.188  1.749   70.404  1.00 53.63  ? 448 GLU A OE1 1 
ATOM   1846 O OE2 . GLU A 1 243 ? 41.903  1.074   71.595  1.00 48.24  ? 448 GLU A OE2 1 
ATOM   1847 N N   . HIS A 1 244 ? 40.480  6.481   67.768  1.00 35.62  ? 449 HIS A N   1 
ATOM   1848 C CA  . HIS A 1 244 ? 40.061  7.109   66.518  1.00 33.69  ? 449 HIS A CA  1 
ATOM   1849 C C   . HIS A 1 244 ? 40.832  8.434   66.317  1.00 31.81  ? 449 HIS A C   1 
ATOM   1850 O O   . HIS A 1 244 ? 41.326  8.726   65.231  1.00 30.23  ? 449 HIS A O   1 
ATOM   1851 C CB  . HIS A 1 244 ? 38.559  7.408   66.547  1.00 33.97  ? 449 HIS A CB  1 
ATOM   1852 C CG  . HIS A 1 244 ? 38.036  7.974   65.260  1.00 33.61  ? 449 HIS A CG  1 
ATOM   1853 N ND1 . HIS A 1 244 ? 37.889  7.216   64.118  1.00 33.81  ? 449 HIS A ND1 1 
ATOM   1854 C CD2 . HIS A 1 244 ? 37.649  9.229   64.929  1.00 32.09  ? 449 HIS A CD2 1 
ATOM   1855 C CE1 . HIS A 1 244 ? 37.432  7.978   63.140  1.00 33.44  ? 449 HIS A CE1 1 
ATOM   1856 N NE2 . HIS A 1 244 ? 37.279  9.203   63.606  1.00 32.56  ? 449 HIS A NE2 1 
ATOM   1857 N N   . ALA A 1 245 ? 40.900  9.227   67.381  1.00 31.30  ? 450 ALA A N   1 
ATOM   1858 C CA  . ALA A 1 245 ? 41.600  10.502  67.372  1.00 32.36  ? 450 ALA A CA  1 
ATOM   1859 C C   . ALA A 1 245 ? 43.072  10.284  67.045  1.00 34.51  ? 450 ALA A C   1 
ATOM   1860 O O   . ALA A 1 245 ? 43.694  11.091  66.350  1.00 35.74  ? 450 ALA A O   1 
ATOM   1861 C CB  . ALA A 1 245 ? 41.460  11.172  68.724  1.00 29.38  ? 450 ALA A CB  1 
ATOM   1862 N N   . GLN A 1 246 ? 43.637  9.195   67.548  1.00 35.50  ? 451 GLN A N   1 
ATOM   1863 C CA  . GLN A 1 246 ? 45.032  8.901   67.279  1.00 36.80  ? 451 GLN A CA  1 
ATOM   1864 C C   . GLN A 1 246 ? 45.226  8.664   65.815  1.00 37.92  ? 451 GLN A C   1 
ATOM   1865 O O   . GLN A 1 246 ? 46.081  9.295   65.197  1.00 39.01  ? 451 GLN A O   1 
ATOM   1866 C CB  . GLN A 1 246 ? 45.491  7.697   68.110  1.00 36.65  ? 451 GLN A CB  1 
ATOM   1867 C CG  . GLN A 1 246 ? 45.634  8.031   69.617  1.00 32.95  ? 451 GLN A CG  1 
ATOM   1868 C CD  . GLN A 1 246 ? 45.716  6.797   70.488  1.00 35.82  ? 451 GLN A CD  1 
ATOM   1869 O OE1 . GLN A 1 246 ? 45.716  5.661   69.991  1.00 36.48  ? 451 GLN A OE1 1 
ATOM   1870 N NE2 . GLN A 1 246 ? 45.781  7.007   71.800  1.00 32.79  ? 451 GLN A NE2 1 
ATOM   1871 N N   . MET A 1 247 ? 44.433  7.771   65.230  1.00 38.04  ? 452 MET A N   1 
ATOM   1872 C CA  . MET A 1 247 ? 44.552  7.514   63.799  1.00 38.04  ? 452 MET A CA  1 
ATOM   1873 C C   . MET A 1 247 ? 44.335  8.802   63.032  1.00 37.69  ? 452 MET A C   1 
ATOM   1874 O O   . MET A 1 247 ? 44.934  9.013   61.983  1.00 37.74  ? 452 MET A O   1 
ATOM   1875 C CB  . MET A 1 247 ? 43.524  6.488   63.334  1.00 40.33  ? 452 MET A CB  1 
ATOM   1876 C CG  . MET A 1 247 ? 43.624  5.129   63.993  1.00 45.57  ? 452 MET A CG  1 
ATOM   1877 S SD  . MET A 1 247 ? 42.550  3.930   63.169  1.00 51.56  ? 452 MET A SD  1 
ATOM   1878 C CE  . MET A 1 247 ? 41.046  4.139   64.061  1.00 49.75  ? 452 MET A CE  1 
ATOM   1879 N N   . MET A 1 248 ? 43.469  9.669   63.544  1.00 37.26  ? 453 MET A N   1 
ATOM   1880 C CA  . MET A 1 248 ? 43.209  10.932  62.874  1.00 39.06  ? 453 MET A CA  1 
ATOM   1881 C C   . MET A 1 248 ? 44.445  11.803  62.848  1.00 38.88  ? 453 MET A C   1 
ATOM   1882 O O   . MET A 1 248 ? 44.722  12.450  61.848  1.00 37.08  ? 453 MET A O   1 
ATOM   1883 C CB  . MET A 1 248 ? 42.043  11.669  63.544  1.00 41.43  ? 453 MET A CB  1 
ATOM   1884 C CG  . MET A 1 248 ? 40.686  10.979  63.349  1.00 44.31  ? 453 MET A CG  1 
ATOM   1885 S SD  . MET A 1 248 ? 40.299  10.618  61.596  1.00 52.12  ? 453 MET A SD  1 
ATOM   1886 C CE  . MET A 1 248 ? 40.720  8.831   61.474  1.00 47.30  ? 453 MET A CE  1 
ATOM   1887 N N   . GLN A 1 249 ? 45.195  11.835  63.947  1.00 40.78  ? 454 GLN A N   1 
ATOM   1888 C CA  . GLN A 1 249 ? 46.425  12.618  63.981  1.00 42.53  ? 454 GLN A CA  1 
ATOM   1889 C C   . GLN A 1 249 ? 47.439  12.031  62.932  1.00 41.67  ? 454 GLN A C   1 
ATOM   1890 O O   . GLN A 1 249 ? 48.222  12.769  62.324  1.00 41.44  ? 454 GLN A O   1 
ATOM   1891 C CB  . GLN A 1 249 ? 47.052  12.599  65.383  1.00 45.18  ? 454 GLN A CB  1 
ATOM   1892 C CG  . GLN A 1 249 ? 46.526  13.694  66.318  1.00 51.02  ? 454 GLN A CG  1 
ATOM   1893 C CD  . GLN A 1 249 ? 46.629  15.087  65.702  1.00 56.24  ? 454 GLN A CD  1 
ATOM   1894 O OE1 . GLN A 1 249 ? 47.702  15.504  65.252  1.00 59.10  ? 454 GLN A OE1 1 
ATOM   1895 N NE2 . GLN A 1 249 ? 45.510  15.815  65.679  1.00 57.17  ? 454 GLN A NE2 1 
ATOM   1896 N N   . ARG A 1 250 ? 47.404  10.716  62.739  1.00 37.76  ? 455 ARG A N   1 
ATOM   1897 C CA  . ARG A 1 250 ? 48.289  10.102  61.778  1.00 36.77  ? 455 ARG A CA  1 
ATOM   1898 C C   . ARG A 1 250 ? 47.886  10.500  60.388  1.00 38.26  ? 455 ARG A C   1 
ATOM   1899 O O   . ARG A 1 250 ? 48.732  10.686  59.512  1.00 38.66  ? 455 ARG A O   1 
ATOM   1900 C CB  . ARG A 1 250 ? 48.263  8.593   61.938  1.00 37.57  ? 455 ARG A CB  1 
ATOM   1901 C CG  . ARG A 1 250 ? 48.809  8.127   63.305  1.00 41.08  ? 455 ARG A CG  1 
ATOM   1902 C CD  . ARG A 1 250 ? 50.229  8.651   63.521  1.00 40.58  ? 455 ARG A CD  1 
ATOM   1903 N NE  . ARG A 1 250 ? 51.077  8.312   62.384  1.00 42.63  ? 455 ARG A NE  1 
ATOM   1904 C CZ  . ARG A 1 250 ? 52.209  8.935   62.075  1.00 42.98  ? 455 ARG A CZ  1 
ATOM   1905 N NH1 . ARG A 1 250 ? 52.645  9.939   62.820  1.00 42.53  ? 455 ARG A NH1 1 
ATOM   1906 N NH2 . ARG A 1 250 ? 52.897  8.560   61.004  1.00 41.85  ? 455 ARG A NH2 1 
ATOM   1907 N N   . ILE A 1 251 ? 46.586  10.637  60.155  1.00 38.52  ? 456 ILE A N   1 
ATOM   1908 C CA  . ILE A 1 251 ? 46.126  11.056  58.845  1.00 37.23  ? 456 ILE A CA  1 
ATOM   1909 C C   . ILE A 1 251 ? 46.509  12.518  58.613  1.00 37.64  ? 456 ILE A C   1 
ATOM   1910 O O   . ILE A 1 251 ? 46.960  12.875  57.530  1.00 37.86  ? 456 ILE A O   1 
ATOM   1911 C CB  . ILE A 1 251 ? 44.605  10.886  58.707  1.00 37.26  ? 456 ILE A CB  1 
ATOM   1912 C CG1 . ILE A 1 251 ? 44.266  9.400   58.595  1.00 37.80  ? 456 ILE A CG1 1 
ATOM   1913 C CG2 . ILE A 1 251 ? 44.098  11.625  57.488  1.00 35.51  ? 456 ILE A CG2 1 
ATOM   1914 C CD1 . ILE A 1 251 ? 42.796  9.136   58.442  1.00 36.61  ? 456 ILE A CD1 1 
ATOM   1915 N N   . LYS A 1 252 ? 46.350  13.372  59.620  1.00 36.42  ? 457 LYS A N   1 
ATOM   1916 C CA  . LYS A 1 252 ? 46.717  14.769  59.426  1.00 37.92  ? 457 LYS A CA  1 
ATOM   1917 C C   . LYS A 1 252 ? 48.233  14.923  59.162  1.00 38.14  ? 457 LYS A C   1 
ATOM   1918 O O   . LYS A 1 252 ? 48.658  15.789  58.407  1.00 38.12  ? 457 LYS A O   1 
ATOM   1919 C CB  . LYS A 1 252 ? 46.327  15.632  60.626  1.00 38.92  ? 457 LYS A CB  1 
ATOM   1920 C CG  . LYS A 1 252 ? 46.787  17.093  60.430  1.00 43.80  ? 457 LYS A CG  1 
ATOM   1921 C CD  . LYS A 1 252 ? 46.410  18.024  61.562  1.00 46.43  ? 457 LYS A CD  1 
ATOM   1922 C CE  . LYS A 1 252 ? 46.976  19.442  61.282  1.00 49.25  ? 457 LYS A CE  1 
ATOM   1923 N NZ  . LYS A 1 252 ? 46.606  20.438  62.334  1.00 52.88  ? 457 LYS A NZ  1 
ATOM   1924 N N   . LYS A 1 253 ? 49.035  14.076  59.792  1.00 38.89  ? 458 LYS A N   1 
ATOM   1925 C CA  . LYS A 1 253 ? 50.474  14.124  59.613  1.00 39.62  ? 458 LYS A CA  1 
ATOM   1926 C C   . LYS A 1 253 ? 50.930  13.570  58.249  1.00 41.53  ? 458 LYS A C   1 
ATOM   1927 O O   . LYS A 1 253 ? 51.582  14.268  57.478  1.00 43.52  ? 458 LYS A O   1 
ATOM   1928 C CB  . LYS A 1 253 ? 51.156  13.345  60.732  1.00 38.65  ? 458 LYS A CB  1 
ATOM   1929 C CG  . LYS A 1 253 ? 52.670  13.160  60.537  1.00 40.89  ? 458 LYS A CG  1 
ATOM   1930 C CD  . LYS A 1 253 ? 53.405  14.498  60.544  1.00 40.70  ? 458 LYS A CD  1 
ATOM   1931 C CE  . LYS A 1 253 ? 54.862  14.319  60.241  1.00 41.10  ? 458 LYS A CE  1 
ATOM   1932 N NZ  . LYS A 1 253 ? 55.569  15.623  60.259  1.00 44.09  ? 458 LYS A NZ  1 
ATOM   1933 N N   . THR A 1 254 ? 50.566  12.324  57.958  1.00 43.07  ? 459 THR A N   1 
ATOM   1934 C CA  . THR A 1 254 ? 50.963  11.669  56.717  1.00 43.86  ? 459 THR A CA  1 
ATOM   1935 C C   . THR A 1 254 ? 50.058  11.929  55.482  1.00 44.29  ? 459 THR A C   1 
ATOM   1936 O O   . THR A 1 254 ? 50.536  11.888  54.358  1.00 45.35  ? 459 THR A O   1 
ATOM   1937 C CB  . THR A 1 254 ? 51.098  10.129  56.937  1.00 44.61  ? 459 THR A CB  1 
ATOM   1938 O OG1 . THR A 1 254 ? 49.804  9.519   56.988  1.00 45.61  ? 459 THR A OG1 1 
ATOM   1939 C CG2 . THR A 1 254 ? 51.801  9.847   58.250  1.00 42.84  ? 459 THR A CG2 1 
ATOM   1940 N N   . GLU A 1 255 ? 48.773  12.194  55.694  1.00 46.55  ? 460 GLU A N   1 
ATOM   1941 C CA  . GLU A 1 255 ? 47.843  12.447  54.585  1.00 47.87  ? 460 GLU A CA  1 
ATOM   1942 C C   . GLU A 1 255 ? 47.734  13.895  54.257  1.00 48.56  ? 460 GLU A C   1 
ATOM   1943 O O   . GLU A 1 255 ? 46.655  14.482  54.278  1.00 46.26  ? 460 GLU A O   1 
ATOM   1944 C CB  . GLU A 1 255 ? 46.451  11.909  54.913  1.00 48.79  ? 460 GLU A CB  1 
ATOM   1945 C CG  . GLU A 1 255 ? 46.400  10.440  55.051  1.00 48.04  ? 460 GLU A CG  1 
ATOM   1946 C CD  . GLU A 1 255 ? 47.100  9.764   53.909  1.00 49.61  ? 460 GLU A CD  1 
ATOM   1947 O OE1 . GLU A 1 255 ? 46.931  10.229  52.759  1.00 49.78  ? 460 GLU A OE1 1 
ATOM   1948 O OE2 . GLU A 1 255 ? 47.814  8.770   54.159  1.00 50.39  ? 460 GLU A OE2 1 
ATOM   1949 N N   . THR A 1 256 ? 48.872  14.481  53.931  1.00 51.31  ? 461 THR A N   1 
ATOM   1950 C CA  . THR A 1 256 ? 48.960  15.888  53.597  1.00 53.60  ? 461 THR A CA  1 
ATOM   1951 C C   . THR A 1 256 ? 47.982  16.402  52.494  1.00 52.66  ? 461 THR A C   1 
ATOM   1952 O O   . THR A 1 256 ? 47.469  17.514  52.602  1.00 52.53  ? 461 THR A O   1 
ATOM   1953 C CB  . THR A 1 256 ? 50.413  16.239  53.195  1.00 55.85  ? 461 THR A CB  1 
ATOM   1954 O OG1 . THR A 1 256 ? 50.454  17.577  52.686  1.00 59.42  ? 461 THR A OG1 1 
ATOM   1955 C CG2 . THR A 1 256 ? 50.944  15.248  52.140  1.00 54.68  ? 461 THR A CG2 1 
ATOM   1956 N N   . GLU A 1 257 ? 47.734  15.607  51.457  1.00 51.52  ? 462 GLU A N   1 
ATOM   1957 C CA  . GLU A 1 257 ? 46.837  16.050  50.382  1.00 52.49  ? 462 GLU A CA  1 
ATOM   1958 C C   . GLU A 1 257 ? 45.335  16.035  50.767  1.00 52.39  ? 462 GLU A C   1 
ATOM   1959 O O   . GLU A 1 257 ? 44.548  16.821  50.245  1.00 54.07  ? 462 GLU A O   1 
ATOM   1960 C CB  . GLU A 1 257 ? 47.057  15.202  49.129  1.00 51.70  ? 462 GLU A CB  1 
ATOM   1961 N N   . THR A 1 258 ? 44.970  15.139  51.679  1.00 51.33  ? 463 THR A N   1 
ATOM   1962 C CA  . THR A 1 258 ? 43.597  14.970  52.149  1.00 48.27  ? 463 THR A CA  1 
ATOM   1963 C C   . THR A 1 258 ? 43.122  16.133  53.036  1.00 48.43  ? 463 THR A C   1 
ATOM   1964 O O   . THR A 1 258 ? 43.669  16.369  54.107  1.00 49.62  ? 463 THR A O   1 
ATOM   1965 C CB  . THR A 1 258 ? 43.487  13.659  52.934  1.00 46.99  ? 463 THR A CB  1 
ATOM   1966 O OG1 . THR A 1 258 ? 43.798  12.560  52.063  1.00 47.45  ? 463 THR A OG1 1 
ATOM   1967 C CG2 . THR A 1 258 ? 42.106  13.490  53.506  1.00 46.66  ? 463 THR A CG2 1 
ATOM   1968 N N   . SER A 1 259 ? 42.091  16.847  52.599  1.00 46.77  ? 464 SER A N   1 
ATOM   1969 C CA  . SER A 1 259 ? 41.603  17.979  53.375  1.00 45.25  ? 464 SER A CA  1 
ATOM   1970 C C   . SER A 1 259 ? 40.588  17.589  54.431  1.00 44.20  ? 464 SER A C   1 
ATOM   1971 O O   . SER A 1 259 ? 39.885  16.595  54.295  1.00 43.85  ? 464 SER A O   1 
ATOM   1972 C CB  . SER A 1 259 ? 41.012  19.039  52.444  1.00 43.78  ? 464 SER A CB  1 
ATOM   1973 O OG  . SER A 1 259 ? 39.855  18.560  51.806  1.00 41.76  ? 464 SER A OG  1 
ATOM   1974 N N   . LEU A 1 260 ? 40.514  18.385  55.493  1.00 42.87  ? 465 LEU A N   1 
ATOM   1975 C CA  . LEU A 1 260 ? 39.598  18.110  56.584  1.00 40.79  ? 465 LEU A CA  1 
ATOM   1976 C C   . LEU A 1 260 ? 38.600  19.214  56.747  1.00 40.31  ? 465 LEU A C   1 
ATOM   1977 O O   . LEU A 1 260 ? 38.943  20.392  56.704  1.00 41.47  ? 465 LEU A O   1 
ATOM   1978 C CB  . LEU A 1 260 ? 40.381  17.911  57.879  1.00 40.96  ? 465 LEU A CB  1 
ATOM   1979 C CG  . LEU A 1 260 ? 39.518  17.548  59.084  1.00 43.57  ? 465 LEU A CG  1 
ATOM   1980 C CD1 . LEU A 1 260 ? 38.730  16.283  58.760  1.00 44.12  ? 465 LEU A CD1 1 
ATOM   1981 C CD2 . LEU A 1 260 ? 40.387  17.361  60.330  1.00 43.34  ? 465 LEU A CD2 1 
ATOM   1982 N N   . HIS A 1 261 ? 37.343  18.832  56.927  1.00 38.42  ? 466 HIS A N   1 
ATOM   1983 C CA  . HIS A 1 261 ? 36.264  19.780  57.089  1.00 38.60  ? 466 HIS A CA  1 
ATOM   1984 C C   . HIS A 1 261 ? 36.488  20.607  58.311  1.00 39.17  ? 466 HIS A C   1 
ATOM   1985 O O   . HIS A 1 261 ? 36.728  20.082  59.400  1.00 38.35  ? 466 HIS A O   1 
ATOM   1986 C CB  . HIS A 1 261 ? 34.936  19.027  57.181  1.00 40.17  ? 466 HIS A CB  1 
ATOM   1987 C CG  . HIS A 1 261 ? 33.738  19.910  57.344  1.00 41.23  ? 466 HIS A CG  1 
ATOM   1988 N ND1 . HIS A 1 261 ? 32.667  19.875  56.478  1.00 44.52  ? 466 HIS A ND1 1 
ATOM   1989 C CD2 . HIS A 1 261 ? 33.419  20.815  58.297  1.00 41.55  ? 466 HIS A CD2 1 
ATOM   1990 C CE1 . HIS A 1 261 ? 31.737  20.718  56.892  1.00 43.07  ? 466 HIS A CE1 1 
ATOM   1991 N NE2 . HIS A 1 261 ? 32.170  21.301  57.995  1.00 44.03  ? 466 HIS A NE2 1 
ATOM   1992 N N   . PRO A 1 262 ? 36.401  21.938  58.158  1.00 40.40  ? 467 PRO A N   1 
ATOM   1993 C CA  . PRO A 1 262 ? 36.584  22.944  59.215  1.00 38.91  ? 467 PRO A CA  1 
ATOM   1994 C C   . PRO A 1 262 ? 36.002  22.588  60.554  1.00 37.38  ? 467 PRO A C   1 
ATOM   1995 O O   . PRO A 1 262 ? 36.710  22.622  61.555  1.00 37.83  ? 467 PRO A O   1 
ATOM   1996 C CB  . PRO A 1 262 ? 35.951  24.204  58.615  1.00 38.71  ? 467 PRO A CB  1 
ATOM   1997 C CG  . PRO A 1 262 ? 35.056  23.675  57.515  1.00 40.29  ? 467 PRO A CG  1 
ATOM   1998 C CD  . PRO A 1 262 ? 35.867  22.565  56.939  1.00 38.41  ? 467 PRO A CD  1 
ATOM   1999 N N   . LEU A 1 263 ? 34.712  22.255  60.584  1.00 36.26  ? 468 LEU A N   1 
ATOM   2000 C CA  . LEU A 1 263 ? 34.030  21.881  61.821  1.00 34.57  ? 468 LEU A CA  1 
ATOM   2001 C C   . LEU A 1 263 ? 34.692  20.678  62.488  1.00 35.71  ? 468 LEU A C   1 
ATOM   2002 O O   . LEU A 1 263 ? 34.708  20.570  63.714  1.00 35.38  ? 468 LEU A O   1 
ATOM   2003 C CB  . LEU A 1 263 ? 32.558  21.562  61.551  1.00 33.65  ? 468 LEU A CB  1 
ATOM   2004 C CG  . LEU A 1 263 ? 31.731  21.149  62.784  1.00 34.81  ? 468 LEU A CG  1 
ATOM   2005 C CD1 . LEU A 1 263 ? 31.721  22.265  63.825  1.00 33.13  ? 468 LEU A CD1 1 
ATOM   2006 C CD2 . LEU A 1 263 ? 30.317  20.828  62.362  1.00 31.98  ? 468 LEU A CD2 1 
ATOM   2007 N N   . LEU A 1 264 ? 35.238  19.773  61.680  1.00 35.40  ? 469 LEU A N   1 
ATOM   2008 C CA  . LEU A 1 264 ? 35.894  18.591  62.216  1.00 36.03  ? 469 LEU A CA  1 
ATOM   2009 C C   . LEU A 1 264 ? 37.248  18.915  62.782  1.00 36.45  ? 469 LEU A C   1 
ATOM   2010 O O   . LEU A 1 264 ? 37.691  18.288  63.739  1.00 37.25  ? 469 LEU A O   1 
ATOM   2011 C CB  . LEU A 1 264 ? 35.996  17.503  61.142  1.00 33.34  ? 469 LEU A CB  1 
ATOM   2012 C CG  . LEU A 1 264 ? 34.655  16.948  60.654  1.00 27.67  ? 469 LEU A CG  1 
ATOM   2013 C CD1 . LEU A 1 264 ? 34.899  15.707  59.818  1.00 25.76  ? 469 LEU A CD1 1 
ATOM   2014 C CD2 . LEU A 1 264 ? 33.768  16.616  61.841  1.00 26.59  ? 469 LEU A CD2 1 
ATOM   2015 N N   . GLN A 1 265 ? 37.922  19.892  62.193  1.00 37.23  ? 470 GLN A N   1 
ATOM   2016 C CA  . GLN A 1 265 ? 39.221  20.316  62.697  1.00 40.83  ? 470 GLN A CA  1 
ATOM   2017 C C   . GLN A 1 265 ? 39.038  20.983  64.092  1.00 41.01  ? 470 GLN A C   1 
ATOM   2018 O O   . GLN A 1 265 ? 39.885  20.853  64.962  1.00 42.35  ? 470 GLN A O   1 
ATOM   2019 C CB  . GLN A 1 265 ? 39.846  21.342  61.766  1.00 45.21  ? 470 GLN A CB  1 
ATOM   2020 C CG  . GLN A 1 265 ? 40.100  20.892  60.377  1.00 51.66  ? 470 GLN A CG  1 
ATOM   2021 C CD  . GLN A 1 265 ? 40.626  22.035  59.542  1.00 57.41  ? 470 GLN A CD  1 
ATOM   2022 O OE1 . GLN A 1 265 ? 41.560  22.733  59.961  1.00 60.31  ? 470 GLN A OE1 1 
ATOM   2023 N NE2 . GLN A 1 265 ? 40.032  22.248  58.361  1.00 55.19  ? 470 GLN A NE2 1 
ATOM   2024 N N   . GLU A 1 266 ? 37.941  21.712  64.265  1.00 41.66  ? 471 GLU A N   1 
ATOM   2025 C CA  . GLU A 1 266 ? 37.637  22.371  65.526  1.00 42.95  ? 471 GLU A CA  1 
ATOM   2026 C C   . GLU A 1 266 ? 37.492  21.376  66.626  1.00 43.02  ? 471 GLU A C   1 
ATOM   2027 O O   . GLU A 1 266 ? 37.901  21.633  67.757  1.00 42.48  ? 471 GLU A O   1 
ATOM   2028 C CB  . GLU A 1 266 ? 36.347  23.194  65.412  1.00 46.05  ? 471 GLU A CB  1 
ATOM   2029 C CG  . GLU A 1 266 ? 36.502  24.558  64.684  1.00 50.83  ? 471 GLU A CG  1 
ATOM   2030 C CD  . GLU A 1 266 ? 37.599  25.432  65.297  1.00 54.44  ? 471 GLU A CD  1 
ATOM   2031 O OE1 . GLU A 1 266 ? 38.769  25.326  64.862  1.00 56.65  ? 471 GLU A OE1 1 
ATOM   2032 O OE2 . GLU A 1 266 ? 37.296  26.218  66.223  1.00 54.98  ? 471 GLU A OE2 1 
ATOM   2033 N N   . ILE A 1 267 ? 36.894  20.227  66.323  1.00 44.08  ? 472 ILE A N   1 
ATOM   2034 C CA  . ILE A 1 267 ? 36.721  19.190  67.331  1.00 46.90  ? 472 ILE A CA  1 
ATOM   2035 C C   . ILE A 1 267 ? 38.093  18.569  67.671  1.00 49.59  ? 472 ILE A C   1 
ATOM   2036 O O   . ILE A 1 267 ? 38.461  18.420  68.838  1.00 49.29  ? 472 ILE A O   1 
ATOM   2037 C CB  . ILE A 1 267 ? 35.777  18.070  66.833  1.00 45.79  ? 472 ILE A CB  1 
ATOM   2038 C CG1 . ILE A 1 267 ? 34.383  18.628  66.584  1.00 45.40  ? 472 ILE A CG1 1 
ATOM   2039 C CG2 . ILE A 1 267 ? 35.675  16.966  67.865  1.00 45.53  ? 472 ILE A CG2 1 
ATOM   2040 C CD1 . ILE A 1 267 ? 33.373  17.551  66.188  1.00 44.08  ? 472 ILE A CD1 1 
ATOM   2041 N N   . TYR A 1 268 ? 38.850  18.242  66.633  1.00 51.72  ? 473 TYR A N   1 
ATOM   2042 C CA  . TYR A 1 268 ? 40.147  17.618  66.809  1.00 55.72  ? 473 TYR A CA  1 
ATOM   2043 C C   . TYR A 1 268 ? 41.332  18.517  67.094  1.00 59.91  ? 473 TYR A C   1 
ATOM   2044 O O   . TYR A 1 268 ? 42.470  18.039  67.122  1.00 61.92  ? 473 TYR A O   1 
ATOM   2045 C CB  . TYR A 1 268 ? 40.453  16.748  65.588  1.00 51.78  ? 473 TYR A CB  1 
ATOM   2046 C CG  . TYR A 1 268 ? 39.576  15.525  65.516  1.00 48.71  ? 473 TYR A CG  1 
ATOM   2047 C CD1 . TYR A 1 268 ? 39.620  14.561  66.518  1.00 45.87  ? 473 TYR A CD1 1 
ATOM   2048 C CD2 . TYR A 1 268 ? 38.672  15.351  64.473  1.00 46.81  ? 473 TYR A CD2 1 
ATOM   2049 C CE1 . TYR A 1 268 ? 38.788  13.466  66.482  1.00 43.61  ? 473 TYR A CE1 1 
ATOM   2050 C CE2 . TYR A 1 268 ? 37.835  14.255  64.430  1.00 42.92  ? 473 TYR A CE2 1 
ATOM   2051 C CZ  . TYR A 1 268 ? 37.900  13.322  65.435  1.00 43.00  ? 473 TYR A CZ  1 
ATOM   2052 O OH  . TYR A 1 268 ? 37.080  12.235  65.397  1.00 42.50  ? 473 TYR A OH  1 
ATOM   2053 N N   . LYS A 1 269 ? 41.114  19.806  67.320  1.00 62.84  ? 474 LYS A N   1 
ATOM   2054 C CA  . LYS A 1 269 ? 42.268  20.645  67.580  1.00 66.47  ? 474 LYS A CA  1 
ATOM   2055 C C   . LYS A 1 269 ? 42.751  20.551  69.013  1.00 68.75  ? 474 LYS A C   1 
ATOM   2056 O O   . LYS A 1 269 ? 43.955  20.529  69.256  1.00 70.31  ? 474 LYS A O   1 
ATOM   2057 C CB  . LYS A 1 269 ? 42.001  22.102  67.186  1.00 66.07  ? 474 LYS A CB  1 
ATOM   2058 C CG  . LYS A 1 269 ? 40.975  22.835  67.999  1.00 67.71  ? 474 LYS A CG  1 
ATOM   2059 C CD  . LYS A 1 269 ? 41.534  24.205  68.399  1.00 69.68  ? 474 LYS A CD  1 
ATOM   2060 C CE  . LYS A 1 269 ? 40.455  25.149  68.890  1.00 70.43  ? 474 LYS A CE  1 
ATOM   2061 N NZ  . LYS A 1 269 ? 39.613  25.640  67.764  1.00 69.50  ? 474 LYS A NZ  1 
ATOM   2062 N N   . ASP A 1 270 ? 41.836  20.467  69.972  1.00 71.14  ? 475 ASP A N   1 
ATOM   2063 C CA  . ASP A 1 270 ? 42.252  20.371  71.367  1.00 74.40  ? 475 ASP A CA  1 
ATOM   2064 C C   . ASP A 1 270 ? 41.361  19.517  72.231  1.00 75.74  ? 475 ASP A C   1 
ATOM   2065 O O   . ASP A 1 270 ? 40.870  20.048  73.251  1.00 75.77  ? 475 ASP A O   1 
ATOM   2066 C CB  . ASP A 1 270 ? 42.368  21.768  71.982  1.00 75.40  ? 475 ASP A CB  1 
ATOM   2067 C CG  . ASP A 1 270 ? 43.635  22.486  71.556  1.00 77.58  ? 475 ASP A CG  1 
ATOM   2068 O OD1 . ASP A 1 270 ? 44.738  21.944  71.800  1.00 77.10  ? 475 ASP A OD1 1 
ATOM   2069 O OD2 . ASP A 1 270 ? 43.531  23.593  70.980  1.00 78.74  ? 475 ASP A OD2 1 
ATOM   2070 N N   . ALA B 1 4   ? 11.054  -9.428  44.501  1.00 83.42  ? 209 ALA B N   1 
ATOM   2071 C CA  . ALA B 1 4   ? 11.974  -8.477  43.810  1.00 84.05  ? 209 ALA B CA  1 
ATOM   2072 C C   . ALA B 1 4   ? 11.446  -7.040  43.926  1.00 84.07  ? 209 ALA B C   1 
ATOM   2073 O O   . ALA B 1 4   ? 10.234  -6.806  43.903  1.00 84.21  ? 209 ALA B O   1 
ATOM   2074 C CB  . ALA B 1 4   ? 12.128  -8.870  42.334  1.00 83.83  ? 209 ALA B CB  1 
ATOM   2075 N N   . ASP B 1 5   ? 12.363  -6.086  44.063  1.00 83.27  ? 210 ASP B N   1 
ATOM   2076 C CA  . ASP B 1 5   ? 11.990  -4.683  44.177  1.00 81.67  ? 210 ASP B CA  1 
ATOM   2077 C C   . ASP B 1 5   ? 11.758  -4.172  42.800  1.00 79.13  ? 210 ASP B C   1 
ATOM   2078 O O   . ASP B 1 5   ? 12.405  -4.609  41.848  1.00 78.67  ? 210 ASP B O   1 
ATOM   2079 C CB  . ASP B 1 5   ? 13.104  -3.884  44.863  1.00 84.31  ? 210 ASP B CB  1 
ATOM   2080 C CG  . ASP B 1 5   ? 12.646  -2.502  45.319  1.00 86.01  ? 210 ASP B CG  1 
ATOM   2081 O OD1 . ASP B 1 5   ? 11.656  -2.420  46.086  1.00 85.99  ? 210 ASP B OD1 1 
ATOM   2082 O OD2 . ASP B 1 5   ? 13.285  -1.502  44.917  1.00 86.08  ? 210 ASP B OD2 1 
ATOM   2083 N N   . LEU B 1 6   ? 10.824  -3.239  42.679  1.00 76.22  ? 211 LEU B N   1 
ATOM   2084 C CA  . LEU B 1 6   ? 10.466  -2.656  41.393  1.00 74.05  ? 211 LEU B CA  1 
ATOM   2085 C C   . LEU B 1 6   ? 11.643  -2.238  40.546  1.00 72.40  ? 211 LEU B C   1 
ATOM   2086 O O   . LEU B 1 6   ? 11.602  -2.368  39.324  1.00 72.70  ? 211 LEU B O   1 
ATOM   2087 C CB  . LEU B 1 6   ? 9.536   -1.468  41.613  1.00 73.44  ? 211 LEU B CB  1 
ATOM   2088 C CG  . LEU B 1 6   ? 8.306   -1.850  42.432  1.00 72.71  ? 211 LEU B CG  1 
ATOM   2089 C CD1 . LEU B 1 6   ? 7.413   -0.638  42.596  1.00 73.91  ? 211 LEU B CD1 1 
ATOM   2090 C CD2 . LEU B 1 6   ? 7.565   -2.992  41.748  1.00 72.30  ? 211 LEU B CD2 1 
ATOM   2091 N N   . LYS B 1 7   ? 12.693  -1.729  41.181  1.00 69.52  ? 212 LYS B N   1 
ATOM   2092 C CA  . LYS B 1 7   ? 13.884  -1.313  40.455  1.00 66.35  ? 212 LYS B CA  1 
ATOM   2093 C C   . LYS B 1 7   ? 14.245  -2.372  39.425  1.00 63.43  ? 212 LYS B C   1 
ATOM   2094 O O   . LYS B 1 7   ? 14.279  -2.098  38.228  1.00 61.72  ? 212 LYS B O   1 
ATOM   2095 C CB  . LYS B 1 7   ? 15.041  -1.112  41.429  1.00 67.80  ? 212 LYS B CB  1 
ATOM   2096 N N   . ALA B 1 8   ? 14.504  -3.585  39.901  1.00 61.53  ? 213 ALA B N   1 
ATOM   2097 C CA  . ALA B 1 8   ? 14.863  -4.704  39.033  1.00 61.23  ? 213 ALA B CA  1 
ATOM   2098 C C   . ALA B 1 8   ? 13.743  -5.067  38.063  1.00 60.55  ? 213 ALA B C   1 
ATOM   2099 O O   . ALA B 1 8   ? 13.963  -5.198  36.858  1.00 59.53  ? 213 ALA B O   1 
ATOM   2100 C CB  . ALA B 1 8   ? 15.218  -5.914  39.877  1.00 61.11  ? 213 ALA B CB  1 
ATOM   2101 N N   . PHE B 1 9   ? 12.542  -5.237  38.605  1.00 59.88  ? 214 PHE B N   1 
ATOM   2102 C CA  . PHE B 1 9   ? 11.370  -5.594  37.815  1.00 57.44  ? 214 PHE B CA  1 
ATOM   2103 C C   . PHE B 1 9   ? 11.212  -4.740  36.559  1.00 56.46  ? 214 PHE B C   1 
ATOM   2104 O O   . PHE B 1 9   ? 10.913  -5.265  35.486  1.00 56.29  ? 214 PHE B O   1 
ATOM   2105 C CB  . PHE B 1 9   ? 10.122  -5.494  38.694  1.00 56.63  ? 214 PHE B CB  1 
ATOM   2106 C CG  . PHE B 1 9   ? 8.852   -5.896  38.002  1.00 56.31  ? 214 PHE B CG  1 
ATOM   2107 C CD1 . PHE B 1 9   ? 8.084   -4.959  37.330  1.00 55.37  ? 214 PHE B CD1 1 
ATOM   2108 C CD2 . PHE B 1 9   ? 8.417   -7.214  38.035  1.00 56.57  ? 214 PHE B CD2 1 
ATOM   2109 C CE1 . PHE B 1 9   ? 6.912   -5.328  36.710  1.00 54.90  ? 214 PHE B CE1 1 
ATOM   2110 C CE2 . PHE B 1 9   ? 7.243   -7.589  37.414  1.00 53.63  ? 214 PHE B CE2 1 
ATOM   2111 C CZ  . PHE B 1 9   ? 6.493   -6.648  36.753  1.00 54.56  ? 214 PHE B CZ  1 
ATOM   2112 N N   . SER B 1 10  ? 11.417  -3.431  36.685  1.00 54.62  ? 215 SER B N   1 
ATOM   2113 C CA  . SER B 1 10  ? 11.289  -2.534  35.541  1.00 54.61  ? 215 SER B CA  1 
ATOM   2114 C C   . SER B 1 10  ? 12.394  -2.703  34.565  1.00 55.30  ? 215 SER B C   1 
ATOM   2115 O O   . SER B 1 10  ? 12.153  -2.883  33.376  1.00 56.72  ? 215 SER B O   1 
ATOM   2116 C CB  . SER B 1 10  ? 11.248  -1.083  35.997  1.00 52.90  ? 215 SER B CB  1 
ATOM   2117 O OG  . SER B 1 10  ? 10.133  -0.866  36.833  1.00 55.72  ? 215 SER B OG  1 
ATOM   2118 N N   . LYS B 1 11  ? 13.631  -2.639  35.040  1.00 54.69  ? 216 LYS B N   1 
ATOM   2119 C CA  . LYS B 1 11  ? 14.765  -2.799  34.151  1.00 53.85  ? 216 LYS B CA  1 
ATOM   2120 C C   . LYS B 1 11  ? 14.542  -3.991  33.272  1.00 53.05  ? 216 LYS B C   1 
ATOM   2121 O O   . LYS B 1 11  ? 14.708  -3.904  32.062  1.00 52.86  ? 216 LYS B O   1 
ATOM   2122 C CB  . LYS B 1 11  ? 16.057  -2.965  34.955  1.00 55.34  ? 216 LYS B CB  1 
ATOM   2123 N N   . HIS B 1 12  ? 14.149  -5.115  33.865  1.00 52.91  ? 217 HIS B N   1 
ATOM   2124 C CA  . HIS B 1 12  ? 13.908  -6.327  33.092  1.00 53.60  ? 217 HIS B CA  1 
ATOM   2125 C C   . HIS B 1 12  ? 12.916  -6.126  31.961  1.00 53.03  ? 217 HIS B C   1 
ATOM   2126 O O   . HIS B 1 12  ? 13.212  -6.421  30.804  1.00 52.48  ? 217 HIS B O   1 
ATOM   2127 C CB  . HIS B 1 12  ? 13.399  -7.455  33.980  1.00 55.14  ? 217 HIS B CB  1 
ATOM   2128 C CG  . HIS B 1 12  ? 13.262  -8.756  33.256  1.00 59.61  ? 217 HIS B CG  1 
ATOM   2129 N ND1 . HIS B 1 12  ? 12.844  -9.915  33.872  1.00 61.89  ? 217 HIS B ND1 1 
ATOM   2130 C CD2 . HIS B 1 12  ? 13.524  -9.087  31.968  1.00 61.14  ? 217 HIS B CD2 1 
ATOM   2131 C CE1 . HIS B 1 12  ? 12.858  -10.905 32.995  1.00 63.37  ? 217 HIS B CE1 1 
ATOM   2132 N NE2 . HIS B 1 12  ? 13.267  -10.429 31.832  1.00 62.41  ? 217 HIS B NE2 1 
ATOM   2133 N N   . ILE B 1 13  ? 11.724  -5.647  32.296  1.00 51.82  ? 218 ILE B N   1 
ATOM   2134 C CA  . ILE B 1 13  ? 10.699  -5.402  31.292  1.00 51.39  ? 218 ILE B CA  1 
ATOM   2135 C C   . ILE B 1 13  ? 11.170  -4.455  30.218  1.00 50.96  ? 218 ILE B C   1 
ATOM   2136 O O   . ILE B 1 13  ? 10.741  -4.550  29.070  1.00 49.92  ? 218 ILE B O   1 
ATOM   2137 C CB  . ILE B 1 13  ? 9.441   -4.831  31.936  1.00 51.70  ? 218 ILE B CB  1 
ATOM   2138 C CG1 . ILE B 1 13  ? 8.729   -5.941  32.700  1.00 51.76  ? 218 ILE B CG1 1 
ATOM   2139 C CG2 . ILE B 1 13  ? 8.549   -4.201  30.880  1.00 51.76  ? 218 ILE B CG2 1 
ATOM   2140 C CD1 . ILE B 1 13  ? 7.538   -5.465  33.499  1.00 53.64  ? 218 ILE B CD1 1 
ATOM   2141 N N   . TYR B 1 14  ? 12.050  -3.530  30.587  1.00 50.93  ? 219 TYR B N   1 
ATOM   2142 C CA  . TYR B 1 14  ? 12.592  -2.573  29.638  1.00 51.42  ? 219 TYR B CA  1 
ATOM   2143 C C   . TYR B 1 14  ? 13.613  -3.280  28.659  1.00 51.29  ? 219 TYR B C   1 
ATOM   2144 O O   . TYR B 1 14  ? 13.746  -2.893  27.494  1.00 49.82  ? 219 TYR B O   1 
ATOM   2145 C CB  . TYR B 1 14  ? 13.259  -1.420  30.387  1.00 52.39  ? 219 TYR B CB  1 
ATOM   2146 C CG  . TYR B 1 14  ? 13.850  -0.385  29.470  1.00 54.16  ? 219 TYR B CG  1 
ATOM   2147 C CD1 . TYR B 1 14  ? 13.144  0.070   28.368  1.00 56.55  ? 219 TYR B CD1 1 
ATOM   2148 C CD2 . TYR B 1 14  ? 15.124  0.119   29.686  1.00 54.78  ? 219 TYR B CD2 1 
ATOM   2149 C CE1 . TYR B 1 14  ? 13.692  0.996   27.500  1.00 56.98  ? 219 TYR B CE1 1 
ATOM   2150 C CE2 . TYR B 1 14  ? 15.678  1.046   28.826  1.00 55.45  ? 219 TYR B CE2 1 
ATOM   2151 C CZ  . TYR B 1 14  ? 14.957  1.477   27.735  1.00 56.27  ? 219 TYR B CZ  1 
ATOM   2152 O OH  . TYR B 1 14  ? 15.504  2.380   26.861  1.00 58.04  ? 219 TYR B OH  1 
ATOM   2153 N N   . ASN B 1 15  ? 14.312  -4.296  29.155  1.00 50.66  ? 220 ASN B N   1 
ATOM   2154 C CA  . ASN B 1 15  ? 15.241  -5.042  28.320  1.00 51.60  ? 220 ASN B CA  1 
ATOM   2155 C C   . ASN B 1 15  ? 14.408  -5.880  27.368  1.00 51.35  ? 220 ASN B C   1 
ATOM   2156 O O   . ASN B 1 15  ? 14.768  -6.059  26.201  1.00 51.18  ? 220 ASN B O   1 
ATOM   2157 C CB  . ASN B 1 15  ? 16.127  -5.959  29.164  1.00 55.21  ? 220 ASN B CB  1 
ATOM   2158 C CG  . ASN B 1 15  ? 16.905  -5.205  30.228  1.00 59.57  ? 220 ASN B CG  1 
ATOM   2159 O OD1 . ASN B 1 15  ? 17.445  -4.118  29.973  1.00 61.99  ? 220 ASN B OD1 1 
ATOM   2160 N ND2 . ASN B 1 15  ? 16.981  -5.784  31.429  1.00 59.12  ? 220 ASN B ND2 1 
ATOM   2161 N N   . ALA B 1 16  ? 13.288  -6.397  27.875  1.00 49.58  ? 221 ALA B N   1 
ATOM   2162 C CA  . ALA B 1 16  ? 12.369  -7.197  27.075  1.00 47.26  ? 221 ALA B CA  1 
ATOM   2163 C C   . ALA B 1 16  ? 11.833  -6.316  25.958  1.00 47.01  ? 221 ALA B C   1 
ATOM   2164 O O   . ALA B 1 16  ? 11.688  -6.751  24.815  1.00 45.39  ? 221 ALA B O   1 
ATOM   2165 C CB  . ALA B 1 16  ? 11.224  -7.701  27.941  1.00 45.83  ? 221 ALA B CB  1 
ATOM   2166 N N   . TYR B 1 17  ? 11.548  -5.064  26.295  1.00 46.10  ? 222 TYR B N   1 
ATOM   2167 C CA  . TYR B 1 17  ? 11.033  -4.112  25.325  1.00 47.60  ? 222 TYR B CA  1 
ATOM   2168 C C   . TYR B 1 17  ? 12.055  -3.832  24.229  1.00 48.27  ? 222 TYR B C   1 
ATOM   2169 O O   . TYR B 1 17  ? 11.714  -3.798  23.048  1.00 49.41  ? 222 TYR B O   1 
ATOM   2170 C CB  . TYR B 1 17  ? 10.639  -2.824  26.045  1.00 46.31  ? 222 TYR B CB  1 
ATOM   2171 C CG  . TYR B 1 17  ? 10.106  -1.712  25.170  1.00 45.59  ? 222 TYR B CG  1 
ATOM   2172 C CD1 . TYR B 1 17  ? 10.966  -0.794  24.579  1.00 45.38  ? 222 TYR B CD1 1 
ATOM   2173 C CD2 . TYR B 1 17  ? 8.736   -1.519  25.019  1.00 45.59  ? 222 TYR B CD2 1 
ATOM   2174 C CE1 . TYR B 1 17  ? 10.479  0.296   23.876  1.00 45.20  ? 222 TYR B CE1 1 
ATOM   2175 C CE2 . TYR B 1 17  ? 8.239   -0.436  24.317  1.00 44.65  ? 222 TYR B CE2 1 
ATOM   2176 C CZ  . TYR B 1 17  ? 9.114   0.473   23.755  1.00 45.72  ? 222 TYR B CZ  1 
ATOM   2177 O OH  . TYR B 1 17  ? 8.621   1.591   23.114  1.00 46.77  ? 222 TYR B OH  1 
ATOM   2178 N N   . LEU B 1 18  ? 13.312  -3.652  24.618  1.00 49.02  ? 223 LEU B N   1 
ATOM   2179 C CA  . LEU B 1 18  ? 14.371  -3.381  23.657  1.00 47.53  ? 223 LEU B CA  1 
ATOM   2180 C C   . LEU B 1 18  ? 14.750  -4.565  22.803  1.00 47.81  ? 223 LEU B C   1 
ATOM   2181 O O   . LEU B 1 18  ? 15.064  -4.402  21.631  1.00 45.81  ? 223 LEU B O   1 
ATOM   2182 C CB  . LEU B 1 18  ? 15.602  -2.861  24.379  1.00 47.66  ? 223 LEU B CB  1 
ATOM   2183 C CG  . LEU B 1 18  ? 15.366  -1.485  24.990  1.00 50.21  ? 223 LEU B CG  1 
ATOM   2184 C CD1 . LEU B 1 18  ? 16.590  -1.052  25.800  1.00 47.97  ? 223 LEU B CD1 1 
ATOM   2185 C CD2 . LEU B 1 18  ? 15.050  -0.498  23.868  1.00 46.71  ? 223 LEU B CD2 1 
ATOM   2186 N N   . LYS B 1 19  ? 14.730  -5.767  23.363  1.00 48.67  ? 224 LYS B N   1 
ATOM   2187 C CA  . LYS B 1 19  ? 15.098  -6.923  22.565  1.00 51.47  ? 224 LYS B CA  1 
ATOM   2188 C C   . LYS B 1 19  ? 13.962  -7.490  21.735  1.00 51.71  ? 224 LYS B C   1 
ATOM   2189 O O   . LYS B 1 19  ? 14.162  -8.448  20.990  1.00 52.57  ? 224 LYS B O   1 
ATOM   2190 C CB  . LYS B 1 19  ? 15.677  -8.036  23.449  1.00 54.23  ? 224 LYS B CB  1 
ATOM   2191 C CG  . LYS B 1 19  ? 14.654  -8.795  24.292  1.00 59.53  ? 224 LYS B CG  1 
ATOM   2192 C CD  . LYS B 1 19  ? 15.256  -10.130 24.878  1.00 62.23  ? 224 LYS B CD  1 
ATOM   2193 C CE  . LYS B 1 19  ? 15.668  -11.136 23.731  1.00 62.98  ? 224 LYS B CE  1 
ATOM   2194 N NZ  . LYS B 1 19  ? 16.141  -12.463 24.240  1.00 61.34  ? 224 LYS B NZ  1 
ATOM   2195 N N   . ASN B 1 20  ? 12.774  -6.901  21.836  1.00 51.61  ? 225 ASN B N   1 
ATOM   2196 C CA  . ASN B 1 20  ? 11.627  -7.406  21.090  1.00 50.15  ? 225 ASN B CA  1 
ATOM   2197 C C   . ASN B 1 20  ? 11.007  -6.496  20.090  1.00 50.57  ? 225 ASN B C   1 
ATOM   2198 O O   . ASN B 1 20  ? 10.276  -6.956  19.221  1.00 52.68  ? 225 ASN B O   1 
ATOM   2199 C CB  . ASN B 1 20  ? 10.555  -7.891  22.060  1.00 48.81  ? 225 ASN B CB  1 
ATOM   2200 C CG  . ASN B 1 20  ? 10.886  -9.234  22.657  1.00 48.49  ? 225 ASN B CG  1 
ATOM   2201 O OD1 . ASN B 1 20  ? 10.963  -10.228 21.943  1.00 49.11  ? 225 ASN B OD1 1 
ATOM   2202 N ND2 . ASN B 1 20  ? 11.086  -9.275  23.971  1.00 48.48  ? 225 ASN B ND2 1 
ATOM   2203 N N   . PHE B 1 21  ? 11.273  -5.200  20.175  1.00 50.62  ? 226 PHE B N   1 
ATOM   2204 C CA  . PHE B 1 21  ? 10.688  -4.266  19.219  1.00 51.16  ? 226 PHE B CA  1 
ATOM   2205 C C   . PHE B 1 21  ? 11.719  -3.616  18.389  1.00 52.98  ? 226 PHE B C   1 
ATOM   2206 O O   . PHE B 1 21  ? 12.534  -2.847  18.894  1.00 54.29  ? 226 PHE B O   1 
ATOM   2207 C CB  . PHE B 1 21  ? 9.867   -3.209  19.953  1.00 47.35  ? 226 PHE B CB  1 
ATOM   2208 C CG  . PHE B 1 21  ? 8.732   -3.780  20.732  1.00 45.77  ? 226 PHE B CG  1 
ATOM   2209 C CD1 . PHE B 1 21  ? 7.700   -4.446  20.086  1.00 42.29  ? 226 PHE B CD1 1 
ATOM   2210 C CD2 . PHE B 1 21  ? 8.708   -3.691  22.119  1.00 46.02  ? 226 PHE B CD2 1 
ATOM   2211 C CE1 . PHE B 1 21  ? 6.668   -5.014  20.805  1.00 40.22  ? 226 PHE B CE1 1 
ATOM   2212 C CE2 . PHE B 1 21  ? 7.675   -4.260  22.850  1.00 43.75  ? 226 PHE B CE2 1 
ATOM   2213 C CZ  . PHE B 1 21  ? 6.653   -4.923  22.188  1.00 42.73  ? 226 PHE B CZ  1 
ATOM   2214 N N   . ASN B 1 22  ? 11.695  -3.909  17.092  1.00 55.84  ? 227 ASN B N   1 
ATOM   2215 C CA  . ASN B 1 22  ? 12.660  -3.345  16.146  1.00 57.33  ? 227 ASN B CA  1 
ATOM   2216 C C   . ASN B 1 22  ? 12.714  -1.814  16.198  1.00 57.87  ? 227 ASN B C   1 
ATOM   2217 O O   . ASN B 1 22  ? 13.774  -1.231  16.409  1.00 59.62  ? 227 ASN B O   1 
ATOM   2218 C CB  . ASN B 1 22  ? 12.337  -3.811  14.721  1.00 57.28  ? 227 ASN B CB  1 
ATOM   2219 N N   . MET B 1 23  ? 11.577  -1.159  16.009  1.00 57.38  ? 228 MET B N   1 
ATOM   2220 C CA  . MET B 1 23  ? 11.569  0.290   16.047  1.00 57.25  ? 228 MET B CA  1 
ATOM   2221 C C   . MET B 1 23  ? 11.140  0.792   17.418  1.00 56.80  ? 228 MET B C   1 
ATOM   2222 O O   . MET B 1 23  ? 10.114  0.375   17.957  1.00 55.69  ? 228 MET B O   1 
ATOM   2223 C CB  . MET B 1 23  ? 10.636  0.839   14.971  1.00 58.06  ? 228 MET B CB  1 
ATOM   2224 C CG  . MET B 1 23  ? 10.554  2.377   14.924  1.00 61.91  ? 228 MET B CG  1 
ATOM   2225 S SD  . MET B 1 23  ? 12.000  3.199   14.205  1.00 64.83  ? 228 MET B SD  1 
ATOM   2226 C CE  . MET B 1 23  ? 11.418  3.483   12.547  1.00 64.25  ? 228 MET B CE  1 
ATOM   2227 N N   . THR B 1 24  ? 11.942  1.685   17.985  1.00 55.28  ? 229 THR B N   1 
ATOM   2228 C CA  . THR B 1 24  ? 11.643  2.261   19.286  1.00 54.16  ? 229 THR B CA  1 
ATOM   2229 C C   . THR B 1 24  ? 11.336  3.689   19.093  1.00 53.76  ? 229 THR B C   1 
ATOM   2230 O O   . THR B 1 24  ? 11.606  4.250   18.035  1.00 53.47  ? 229 THR B O   1 
ATOM   2231 C CB  . THR B 1 24  ? 12.841  2.152   20.248  1.00 54.75  ? 229 THR B CB  1 
ATOM   2232 O OG1 . THR B 1 24  ? 13.936  2.944   19.758  1.00 54.00  ? 229 THR B OG1 1 
ATOM   2233 C CG2 . THR B 1 24  ? 13.275  0.700   20.380  1.00 55.79  ? 229 THR B CG2 1 
ATOM   2234 N N   . LYS B 1 25  ? 10.761  4.318   20.106  1.00 53.30  ? 230 LYS B N   1 
ATOM   2235 C CA  . LYS B 1 25  ? 10.448  5.728   19.995  1.00 53.93  ? 230 LYS B CA  1 
ATOM   2236 C C   . LYS B 1 25  ? 11.758  6.487   19.828  1.00 55.65  ? 230 LYS B C   1 
ATOM   2237 O O   . LYS B 1 25  ? 11.807  7.521   19.163  1.00 56.04  ? 230 LYS B O   1 
ATOM   2238 C CB  . LYS B 1 25  ? 9.703   6.220   21.240  1.00 51.31  ? 230 LYS B CB  1 
ATOM   2239 C CG  . LYS B 1 25  ? 8.943   7.522   20.999  1.00 48.29  ? 230 LYS B CG  1 
ATOM   2240 C CD  . LYS B 1 25  ? 8.172   7.972   22.209  1.00 46.79  ? 230 LYS B CD  1 
ATOM   2241 C CE  . LYS B 1 25  ? 7.456   9.284   21.928  1.00 46.42  ? 230 LYS B CE  1 
ATOM   2242 N NZ  . LYS B 1 25  ? 6.712   9.785   23.119  1.00 49.78  ? 230 LYS B NZ  1 
ATOM   2243 N N   . LYS B 1 26  ? 12.820  5.969   20.438  1.00 57.76  ? 231 LYS B N   1 
ATOM   2244 C CA  . LYS B 1 26  ? 14.136  6.582   20.339  1.00 59.97  ? 231 LYS B CA  1 
ATOM   2245 C C   . LYS B 1 26  ? 14.487  6.655   18.836  1.00 60.51  ? 231 LYS B C   1 
ATOM   2246 O O   . LYS B 1 26  ? 14.500  7.734   18.235  1.00 60.91  ? 231 LYS B O   1 
ATOM   2247 C CB  . LYS B 1 26  ? 15.161  5.717   21.075  1.00 62.09  ? 231 LYS B CB  1 
ATOM   2248 C CG  . LYS B 1 26  ? 16.571  6.339   21.229  1.00 64.95  ? 231 LYS B CG  1 
ATOM   2249 C CD  . LYS B 1 26  ? 17.608  5.243   21.655  1.00 67.94  ? 231 LYS B CD  1 
ATOM   2250 C CE  . LYS B 1 26  ? 18.997  5.834   22.008  1.00 68.96  ? 231 LYS B CE  1 
ATOM   2251 N NZ  . LYS B 1 26  ? 18.966  6.651   23.254  1.00 68.31  ? 231 LYS B NZ  1 
ATOM   2252 N N   . LYS B 1 27  ? 14.743  5.490   18.247  1.00 59.16  ? 232 LYS B N   1 
ATOM   2253 C CA  . LYS B 1 27  ? 15.086  5.386   16.834  1.00 59.39  ? 232 LYS B CA  1 
ATOM   2254 C C   . LYS B 1 27  ? 14.094  6.115   15.904  1.00 59.05  ? 232 LYS B C   1 
ATOM   2255 O O   . LYS B 1 27  ? 14.496  6.778   14.951  1.00 58.07  ? 232 LYS B O   1 
ATOM   2256 C CB  . LYS B 1 27  ? 15.142  3.915   16.425  1.00 61.11  ? 232 LYS B CB  1 
ATOM   2257 C CG  . LYS B 1 27  ? 15.971  3.040   17.347  1.00 62.90  ? 232 LYS B CG  1 
ATOM   2258 C CD  . LYS B 1 27  ? 16.042  1.621   16.814  1.00 63.66  ? 232 LYS B CD  1 
ATOM   2259 C CE  . LYS B 1 27  ? 16.922  0.740   17.695  1.00 64.45  ? 232 LYS B CE  1 
ATOM   2260 N NZ  . LYS B 1 27  ? 17.026  -0.648  17.156  1.00 65.71  ? 232 LYS B NZ  1 
ATOM   2261 N N   . ALA B 1 28  ? 12.804  5.968   16.188  1.00 58.59  ? 233 ALA B N   1 
ATOM   2262 C CA  . ALA B 1 28  ? 11.758  6.576   15.382  1.00 57.42  ? 233 ALA B CA  1 
ATOM   2263 C C   . ALA B 1 28  ? 11.761  8.071   15.441  1.00 57.36  ? 233 ALA B C   1 
ATOM   2264 O O   . ALA B 1 28  ? 11.558  8.740   14.428  1.00 55.66  ? 233 ALA B O   1 
ATOM   2265 C CB  . ALA B 1 28  ? 10.407  6.043   15.814  1.00 56.23  ? 233 ALA B CB  1 
ATOM   2266 N N   . ARG B 1 29  ? 11.989  8.620   16.625  1.00 58.71  ? 234 ARG B N   1 
ATOM   2267 C CA  . ARG B 1 29  ? 11.999  10.067  16.782  1.00 60.80  ? 234 ARG B CA  1 
ATOM   2268 C C   . ARG B 1 29  ? 13.134  10.750  16.080  1.00 61.51  ? 234 ARG B C   1 
ATOM   2269 O O   . ARG B 1 29  ? 12.975  11.858  15.566  1.00 60.87  ? 234 ARG B O   1 
ATOM   2270 C CB  . ARG B 1 29  ? 11.994  10.439  18.262  1.00 61.36  ? 234 ARG B CB  1 
ATOM   2271 C CG  . ARG B 1 29  ? 10.626  10.432  18.829  1.00 62.24  ? 234 ARG B CG  1 
ATOM   2272 C CD  . ARG B 1 29  ? 9.745   11.231  17.931  1.00 65.08  ? 234 ARG B CD  1 
ATOM   2273 N NE  . ARG B 1 29  ? 8.347   11.151  18.322  1.00 69.24  ? 234 ARG B NE  1 
ATOM   2274 C CZ  . ARG B 1 29  ? 7.342   11.599  17.578  1.00 71.06  ? 234 ARG B CZ  1 
ATOM   2275 N NH1 . ARG B 1 29  ? 7.586   12.157  16.401  1.00 71.57  ? 234 ARG B NH1 1 
ATOM   2276 N NH2 . ARG B 1 29  ? 6.093   11.489  18.011  1.00 72.32  ? 234 ARG B NH2 1 
ATOM   2277 N N   . SER B 1 30  ? 14.294  10.107  16.046  1.00 61.60  ? 235 SER B N   1 
ATOM   2278 C CA  . SER B 1 30  ? 15.433  10.695  15.362  1.00 62.62  ? 235 SER B CA  1 
ATOM   2279 C C   . SER B 1 30  ? 15.082  10.872  13.857  1.00 63.36  ? 235 SER B C   1 
ATOM   2280 O O   . SER B 1 30  ? 15.332  11.929  13.270  1.00 63.64  ? 235 SER B O   1 
ATOM   2281 C CB  . SER B 1 30  ? 16.658  9.794   15.514  1.00 62.89  ? 235 SER B CB  1 
ATOM   2282 O OG  . SER B 1 30  ? 16.444  8.539   14.902  1.00 64.65  ? 235 SER B OG  1 
ATOM   2283 N N   . ILE B 1 31  ? 14.499  9.832   13.262  1.00 63.30  ? 236 ILE B N   1 
ATOM   2284 C CA  . ILE B 1 31  ? 14.105  9.856   11.856  1.00 62.82  ? 236 ILE B CA  1 
ATOM   2285 C C   . ILE B 1 31  ? 13.092  10.920  11.614  1.00 63.15  ? 236 ILE B C   1 
ATOM   2286 O O   . ILE B 1 31  ? 13.238  11.748  10.722  1.00 63.41  ? 236 ILE B O   1 
ATOM   2287 C CB  . ILE B 1 31  ? 13.481  8.517   11.422  1.00 62.13  ? 236 ILE B CB  1 
ATOM   2288 C CG1 . ILE B 1 31  ? 14.423  7.361   11.761  1.00 61.57  ? 236 ILE B CG1 1 
ATOM   2289 C CG2 . ILE B 1 31  ? 13.202  8.537   9.929   1.00 61.56  ? 236 ILE B CG2 1 
ATOM   2290 C CD1 . ILE B 1 31  ? 13.819  5.971   11.502  1.00 59.85  ? 236 ILE B CD1 1 
ATOM   2291 N N   . LEU B 1 32  ? 12.045  10.908  12.423  1.00 64.29  ? 237 LEU B N   1 
ATOM   2292 C CA  . LEU B 1 32  ? 10.962  11.870  12.306  1.00 66.51  ? 237 LEU B CA  1 
ATOM   2293 C C   . LEU B 1 32  ? 11.311  13.316  12.632  1.00 67.12  ? 237 LEU B C   1 
ATOM   2294 O O   . LEU B 1 32  ? 10.500  14.211  12.399  1.00 66.89  ? 237 LEU B O   1 
ATOM   2295 C CB  . LEU B 1 32  ? 9.806   11.427  13.200  1.00 67.54  ? 237 LEU B CB  1 
ATOM   2296 C CG  . LEU B 1 32  ? 9.158   10.100  12.820  1.00 67.89  ? 237 LEU B CG  1 
ATOM   2297 C CD1 . LEU B 1 32  ? 8.429   9.519   14.023  1.00 69.73  ? 237 LEU B CD1 1 
ATOM   2298 C CD2 . LEU B 1 32  ? 8.217   10.325  11.645  1.00 67.74  ? 237 LEU B CD2 1 
ATOM   2299 N N   . THR B 1 33  ? 12.501  13.560  13.166  1.00 68.84  ? 238 THR B N   1 
ATOM   2300 C CA  . THR B 1 33  ? 12.877  14.922  13.528  1.00 71.25  ? 238 THR B CA  1 
ATOM   2301 C C   . THR B 1 33  ? 13.426  15.788  12.392  1.00 73.30  ? 238 THR B C   1 
ATOM   2302 O O   . THR B 1 33  ? 13.241  17.009  12.397  1.00 73.22  ? 238 THR B O   1 
ATOM   2303 C CB  . THR B 1 33  ? 13.881  14.921  14.688  1.00 70.66  ? 238 THR B CB  1 
ATOM   2304 O OG1 . THR B 1 33  ? 14.883  13.925  14.456  1.00 70.39  ? 238 THR B OG1 1 
ATOM   2305 C CG2 . THR B 1 33  ? 13.169  14.645  15.997  1.00 69.16  ? 238 THR B CG2 1 
ATOM   2306 N N   . GLY B 1 34  ? 14.092  15.161  11.425  1.00 74.94  ? 239 GLY B N   1 
ATOM   2307 C CA  . GLY B 1 34  ? 14.641  15.900  10.299  1.00 76.62  ? 239 GLY B CA  1 
ATOM   2308 C C   . GLY B 1 34  ? 15.337  17.200  10.674  1.00 77.91  ? 239 GLY B C   1 
ATOM   2309 O O   . GLY B 1 34  ? 15.548  18.080  9.832   1.00 78.26  ? 239 GLY B O   1 
ATOM   2310 N N   . ALA B 1 40  ? 16.672  10.233  4.704   1.00 56.03  ? 245 ALA B N   1 
ATOM   2311 C CA  . ALA B 1 40  ? 15.291  10.559  5.054   1.00 57.09  ? 245 ALA B CA  1 
ATOM   2312 C C   . ALA B 1 40  ? 14.348  9.525   4.508   1.00 57.57  ? 245 ALA B C   1 
ATOM   2313 O O   . ALA B 1 40  ? 14.631  8.878   3.496   1.00 58.98  ? 245 ALA B O   1 
ATOM   2314 C CB  . ALA B 1 40  ? 14.913  11.938  4.515   1.00 54.33  ? 245 ALA B CB  1 
ATOM   2315 N N   . PRO B 1 41  ? 13.198  9.341   5.170   1.00 56.82  ? 246 PRO B N   1 
ATOM   2316 C CA  . PRO B 1 41  ? 12.232  8.355   4.698   1.00 55.28  ? 246 PRO B CA  1 
ATOM   2317 C C   . PRO B 1 41  ? 11.599  8.839   3.464   1.00 54.01  ? 246 PRO B C   1 
ATOM   2318 O O   . PRO B 1 41  ? 11.350  10.036  3.316   1.00 53.08  ? 246 PRO B O   1 
ATOM   2319 C CB  . PRO B 1 41  ? 11.247  8.270   5.850   1.00 56.45  ? 246 PRO B CB  1 
ATOM   2320 C CG  . PRO B 1 41  ? 11.215  9.699   6.336   1.00 56.14  ? 246 PRO B CG  1 
ATOM   2321 C CD  . PRO B 1 41  ? 12.682  10.065  6.346   1.00 56.62  ? 246 PRO B CD  1 
ATOM   2322 N N   . PHE B 1 42  ? 11.345  7.918   2.544   1.00 52.83  ? 247 PHE B N   1 
ATOM   2323 C CA  . PHE B 1 42  ? 10.695  8.239   1.284   1.00 51.52  ? 247 PHE B CA  1 
ATOM   2324 C C   . PHE B 1 42  ? 9.207   8.541   1.586   1.00 49.96  ? 247 PHE B C   1 
ATOM   2325 O O   . PHE B 1 42  ? 8.526   7.765   2.249   1.00 50.14  ? 247 PHE B O   1 
ATOM   2326 C CB  . PHE B 1 42  ? 10.822  7.048   0.330   1.00 53.35  ? 247 PHE B CB  1 
ATOM   2327 C CG  . PHE B 1 42  ? 10.060  7.208   -0.956  1.00 55.52  ? 247 PHE B CG  1 
ATOM   2328 C CD1 . PHE B 1 42  ? 10.310  8.276   -1.801  1.00 55.05  ? 247 PHE B CD1 1 
ATOM   2329 C CD2 . PHE B 1 42  ? 9.102   6.275   -1.326  1.00 55.29  ? 247 PHE B CD2 1 
ATOM   2330 C CE1 . PHE B 1 42  ? 9.621   8.407   -2.991  1.00 56.05  ? 247 PHE B CE1 1 
ATOM   2331 C CE2 . PHE B 1 42  ? 8.414   6.404   -2.512  1.00 57.02  ? 247 PHE B CE2 1 
ATOM   2332 C CZ  . PHE B 1 42  ? 8.673   7.470   -3.347  1.00 56.79  ? 247 PHE B CZ  1 
ATOM   2333 N N   . VAL B 1 43  ? 8.712   9.669   1.106   1.00 48.58  ? 248 VAL B N   1 
ATOM   2334 C CA  . VAL B 1 43  ? 7.330   10.023  1.371   1.00 48.07  ? 248 VAL B CA  1 
ATOM   2335 C C   . VAL B 1 43  ? 6.357   9.383   0.414   1.00 49.63  ? 248 VAL B C   1 
ATOM   2336 O O   . VAL B 1 43  ? 6.641   9.229   -0.774  1.00 52.34  ? 248 VAL B O   1 
ATOM   2337 C CB  . VAL B 1 43  ? 7.145   11.550  1.345   1.00 46.05  ? 248 VAL B CB  1 
ATOM   2338 C CG1 . VAL B 1 43  ? 5.730   11.924  1.779   1.00 42.81  ? 248 VAL B CG1 1 
ATOM   2339 C CG2 . VAL B 1 43  ? 8.168   12.191  2.261   1.00 44.19  ? 248 VAL B CG2 1 
ATOM   2340 N N   . ILE B 1 44  ? 5.208   8.987   0.947   1.00 48.96  ? 249 ILE B N   1 
ATOM   2341 C CA  . ILE B 1 44  ? 4.145   8.376   0.169   1.00 47.64  ? 249 ILE B CA  1 
ATOM   2342 C C   . ILE B 1 44  ? 2.958   9.238   0.433   1.00 48.24  ? 249 ILE B C   1 
ATOM   2343 O O   . ILE B 1 44  ? 2.340   9.139   1.489   1.00 49.55  ? 249 ILE B O   1 
ATOM   2344 C CB  . ILE B 1 44  ? 3.864   6.945   0.652   1.00 47.34  ? 249 ILE B CB  1 
ATOM   2345 C CG1 . ILE B 1 44  ? 5.157   6.127   0.607   1.00 46.34  ? 249 ILE B CG1 1 
ATOM   2346 C CG2 . ILE B 1 44  ? 2.775   6.309   -0.201  1.00 43.93  ? 249 ILE B CG2 1 
ATOM   2347 C CD1 . ILE B 1 44  ? 5.034   4.730   1.232   1.00 47.04  ? 249 ILE B CD1 1 
ATOM   2348 N N   . HIS B 1 45  ? 2.640   10.117  -0.513  1.00 47.74  ? 250 HIS B N   1 
ATOM   2349 C CA  . HIS B 1 45  ? 1.515   11.040  -0.361  1.00 47.27  ? 250 HIS B CA  1 
ATOM   2350 C C   . HIS B 1 45  ? 0.453   10.841  -1.405  1.00 46.75  ? 250 HIS B C   1 
ATOM   2351 O O   . HIS B 1 45  ? -0.566  11.534  -1.408  1.00 46.01  ? 250 HIS B O   1 
ATOM   2352 C CB  . HIS B 1 45  ? 2.021   12.487  -0.402  1.00 46.55  ? 250 HIS B CB  1 
ATOM   2353 C CG  . HIS B 1 45  ? 2.787   12.818  -1.645  1.00 45.76  ? 250 HIS B CG  1 
ATOM   2354 N ND1 . HIS B 1 45  ? 2.221   13.480  -2.714  1.00 43.19  ? 250 HIS B ND1 1 
ATOM   2355 C CD2 . HIS B 1 45  ? 4.060   12.530  -2.010  1.00 44.57  ? 250 HIS B CD2 1 
ATOM   2356 C CE1 . HIS B 1 45  ? 3.112   13.584  -3.683  1.00 44.08  ? 250 HIS B CE1 1 
ATOM   2357 N NE2 . HIS B 1 45  ? 4.235   13.015  -3.282  1.00 45.18  ? 250 HIS B NE2 1 
ATOM   2358 N N   . ASP B 1 46  ? 0.693   9.906   -2.316  1.00 46.82  ? 251 ASP B N   1 
ATOM   2359 C CA  . ASP B 1 46  ? -0.274  9.586   -3.360  1.00 47.49  ? 251 ASP B CA  1 
ATOM   2360 C C   . ASP B 1 46  ? 0.041   8.253   -4.010  1.00 45.99  ? 251 ASP B C   1 
ATOM   2361 O O   . ASP B 1 46  ? 0.945   7.532   -3.579  1.00 45.99  ? 251 ASP B O   1 
ATOM   2362 C CB  . ASP B 1 46  ? -0.325  10.682  -4.428  1.00 47.55  ? 251 ASP B CB  1 
ATOM   2363 C CG  . ASP B 1 46  ? 1.038   11.037  -4.970  1.00 48.40  ? 251 ASP B CG  1 
ATOM   2364 O OD1 . ASP B 1 46  ? 1.917   10.148  -5.065  1.00 46.88  ? 251 ASP B OD1 1 
ATOM   2365 O OD2 . ASP B 1 46  ? 1.220   12.219  -5.317  1.00 51.40  ? 251 ASP B OD2 1 
ATOM   2366 N N   . ILE B 1 47  ? -0.712  7.923   -5.051  1.00 43.28  ? 252 ILE B N   1 
ATOM   2367 C CA  . ILE B 1 47  ? -0.517  6.669   -5.750  1.00 41.80  ? 252 ILE B CA  1 
ATOM   2368 C C   . ILE B 1 47  ? 0.837   6.560   -6.291  1.00 43.18  ? 252 ILE B C   1 
ATOM   2369 O O   . ILE B 1 47  ? 1.504   5.555   -6.093  1.00 45.14  ? 252 ILE B O   1 
ATOM   2370 C CB  . ILE B 1 47  ? -1.521  6.529   -6.892  1.00 42.06  ? 252 ILE B CB  1 
ATOM   2371 C CG1 . ILE B 1 47  ? -2.941  6.513   -6.321  1.00 40.26  ? 252 ILE B CG1 1 
ATOM   2372 C CG2 . ILE B 1 47  ? -1.217  5.276   -7.707  1.00 39.61  ? 252 ILE B CG2 1 
ATOM   2373 C CD1 . ILE B 1 47  ? -4.010  6.461   -7.369  1.00 39.19  ? 252 ILE B CD1 1 
ATOM   2374 N N   . GLU B 1 48  ? 1.268   7.599   -6.997  1.00 43.91  ? 253 GLU B N   1 
ATOM   2375 C CA  . GLU B 1 48  ? 2.587   7.669   -7.618  1.00 44.81  ? 253 GLU B CA  1 
ATOM   2376 C C   . GLU B 1 48  ? 3.716   7.218   -6.684  1.00 45.00  ? 253 GLU B C   1 
ATOM   2377 O O   . GLU B 1 48  ? 4.480   6.308   -7.020  1.00 44.14  ? 253 GLU B O   1 
ATOM   2378 C CB  . GLU B 1 48  ? 2.826   9.111   -8.098  1.00 48.37  ? 253 GLU B CB  1 
ATOM   2379 C CG  . GLU B 1 48  ? 4.304   9.549   -8.268  1.00 50.27  ? 253 GLU B CG  1 
ATOM   2380 C CD  . GLU B 1 48  ? 4.901   9.129   -9.594  1.00 52.90  ? 253 GLU B CD  1 
ATOM   2381 O OE1 . GLU B 1 48  ? 4.342   9.522   -10.644 1.00 54.08  ? 253 GLU B OE1 1 
ATOM   2382 O OE2 . GLU B 1 48  ? 5.932   8.415   -9.587  1.00 52.23  ? 253 GLU B OE2 1 
ATOM   2383 N N   . THR B 1 49  ? 3.814   7.850   -5.515  1.00 44.71  ? 254 THR B N   1 
ATOM   2384 C CA  . THR B 1 49  ? 4.861   7.512   -4.552  1.00 45.88  ? 254 THR B CA  1 
ATOM   2385 C C   . THR B 1 49  ? 4.657   6.199   -3.935  1.00 46.49  ? 254 THR B C   1 
ATOM   2386 O O   . THR B 1 49  ? 5.622   5.509   -3.596  1.00 47.08  ? 254 THR B O   1 
ATOM   2387 C CB  . THR B 1 49  ? 4.971   8.565   -3.455  1.00 46.13  ? 254 THR B CB  1 
ATOM   2388 O OG1 . THR B 1 49  ? 3.659   8.923   -3.008  1.00 48.58  ? 254 THR B OG1 1 
ATOM   2389 C CG2 . THR B 1 49  ? 5.697   9.797   -3.982  1.00 46.46  ? 254 THR B CG2 1 
ATOM   2390 N N   . LEU B 1 50  ? 3.396   5.824   -3.753  1.00 45.84  ? 255 LEU B N   1 
ATOM   2391 C CA  . LEU B 1 50  ? 3.079   4.522   -3.204  1.00 45.14  ? 255 LEU B CA  1 
ATOM   2392 C C   . LEU B 1 50  ? 3.638   3.477   -4.179  1.00 47.73  ? 255 LEU B C   1 
ATOM   2393 O O   . LEU B 1 50  ? 4.284   2.513   -3.766  1.00 47.16  ? 255 LEU B O   1 
ATOM   2394 C CB  . LEU B 1 50  ? 1.566   4.350   -3.073  1.00 42.56  ? 255 LEU B CB  1 
ATOM   2395 C CG  . LEU B 1 50  ? 1.049   2.916   -2.871  1.00 41.89  ? 255 LEU B CG  1 
ATOM   2396 C CD1 . LEU B 1 50  ? 1.717   2.243   -1.674  1.00 39.68  ? 255 LEU B CD1 1 
ATOM   2397 C CD2 . LEU B 1 50  ? -0.455  2.965   -2.682  1.00 41.29  ? 255 LEU B CD2 1 
ATOM   2398 N N   . TRP B 1 51  ? 3.397   3.681   -5.472  1.00 49.19  ? 256 TRP B N   1 
ATOM   2399 C CA  . TRP B 1 51  ? 3.874   2.750   -6.481  1.00 52.03  ? 256 TRP B CA  1 
ATOM   2400 C C   . TRP B 1 51  ? 5.377   2.656   -6.428  1.00 53.39  ? 256 TRP B C   1 
ATOM   2401 O O   . TRP B 1 51  ? 5.935   1.566   -6.429  1.00 54.19  ? 256 TRP B O   1 
ATOM   2402 C CB  . TRP B 1 51  ? 3.426   3.188   -7.878  1.00 53.84  ? 256 TRP B CB  1 
ATOM   2403 C CG  . TRP B 1 51  ? 3.742   2.166   -8.940  1.00 55.72  ? 256 TRP B CG  1 
ATOM   2404 C CD1 . TRP B 1 51  ? 3.169   0.931   -9.086  1.00 56.26  ? 256 TRP B CD1 1 
ATOM   2405 C CD2 . TRP B 1 51  ? 4.748   2.261   -9.958  1.00 56.68  ? 256 TRP B CD2 1 
ATOM   2406 N NE1 . TRP B 1 51  ? 3.759   0.250   -10.129 1.00 57.06  ? 256 TRP B NE1 1 
ATOM   2407 C CE2 . TRP B 1 51  ? 4.732   1.046   -10.683 1.00 58.51  ? 256 TRP B CE2 1 
ATOM   2408 C CE3 . TRP B 1 51  ? 5.664   3.254   -10.330 1.00 56.99  ? 256 TRP B CE3 1 
ATOM   2409 C CZ2 . TRP B 1 51  ? 5.596   0.796   -11.753 1.00 58.43  ? 256 TRP B CZ2 1 
ATOM   2410 C CZ3 . TRP B 1 51  ? 6.523   3.006   -11.391 1.00 57.28  ? 256 TRP B CZ3 1 
ATOM   2411 C CH2 . TRP B 1 51  ? 6.482   1.786   -12.090 1.00 59.02  ? 256 TRP B CH2 1 
ATOM   2412 N N   . GLN B 1 52  ? 6.046   3.799   -6.376  1.00 54.72  ? 257 GLN B N   1 
ATOM   2413 C CA  . GLN B 1 52  ? 7.501   3.808   -6.316  1.00 57.00  ? 257 GLN B CA  1 
ATOM   2414 C C   . GLN B 1 52  ? 8.039   3.124   -5.074  1.00 57.95  ? 257 GLN B C   1 
ATOM   2415 O O   . GLN B 1 52  ? 8.963   2.310   -5.153  1.00 58.60  ? 257 GLN B O   1 
ATOM   2416 C CB  . GLN B 1 52  ? 8.014   5.245   -6.385  1.00 58.60  ? 257 GLN B CB  1 
ATOM   2417 C CG  . GLN B 1 52  ? 8.061   5.780   -7.793  1.00 59.89  ? 257 GLN B CG  1 
ATOM   2418 C CD  . GLN B 1 52  ? 8.262   7.270   -7.849  1.00 60.35  ? 257 GLN B CD  1 
ATOM   2419 O OE1 . GLN B 1 52  ? 8.595   7.813   -8.898  1.00 64.61  ? 257 GLN B OE1 1 
ATOM   2420 N NE2 . GLN B 1 52  ? 8.048   7.948   -6.728  1.00 60.33  ? 257 GLN B NE2 1 
ATOM   2421 N N   . ALA B 1 53  ? 7.468   3.453   -3.920  1.00 57.48  ? 258 ALA B N   1 
ATOM   2422 C CA  . ALA B 1 53  ? 7.899   2.853   -2.668  1.00 56.83  ? 258 ALA B CA  1 
ATOM   2423 C C   . ALA B 1 53  ? 7.682   1.355   -2.744  1.00 57.40  ? 258 ALA B C   1 
ATOM   2424 O O   . ALA B 1 53  ? 8.532   0.556   -2.351  1.00 56.00  ? 258 ALA B O   1 
ATOM   2425 C CB  . ALA B 1 53  ? 7.105   3.446   -1.514  1.00 55.54  ? 258 ALA B CB  1 
ATOM   2426 N N   . GLU B 1 54  ? 6.528   0.987   -3.279  1.00 58.91  ? 259 GLU B N   1 
ATOM   2427 C CA  . GLU B 1 54  ? 6.120   -0.396  -3.425  1.00 60.62  ? 259 GLU B CA  1 
ATOM   2428 C C   . GLU B 1 54  ? 7.060   -1.184  -4.243  1.00 62.84  ? 259 GLU B C   1 
ATOM   2429 O O   . GLU B 1 54  ? 7.272   -2.363  -3.984  1.00 64.11  ? 259 GLU B O   1 
ATOM   2430 C CB  . GLU B 1 54  ? 4.736   -0.437  -4.060  1.00 60.31  ? 259 GLU B CB  1 
ATOM   2431 C CG  . GLU B 1 54  ? 3.943   -1.653  -3.751  1.00 60.05  ? 259 GLU B CG  1 
ATOM   2432 C CD  . GLU B 1 54  ? 3.647   -1.799  -2.273  1.00 60.14  ? 259 GLU B CD  1 
ATOM   2433 O OE1 . GLU B 1 54  ? 3.175   -0.832  -1.637  1.00 58.46  ? 259 GLU B OE1 1 
ATOM   2434 O OE2 . GLU B 1 54  ? 3.875   -2.900  -1.751  1.00 60.42  ? 259 GLU B OE2 1 
ATOM   2435 N N   . LYS B 1 55  ? 7.640   -0.555  -5.258  1.00 65.62  ? 260 LYS B N   1 
ATOM   2436 C CA  . LYS B 1 55  ? 8.570   -1.250  -6.135  1.00 69.12  ? 260 LYS B CA  1 
ATOM   2437 C C   . LYS B 1 55  ? 9.944   -1.448  -5.527  1.00 71.46  ? 260 LYS B C   1 
ATOM   2438 O O   . LYS B 1 55  ? 10.331  -2.574  -5.189  1.00 72.47  ? 260 LYS B O   1 
ATOM   2439 C CB  . LYS B 1 55  ? 8.699   -0.514  -7.474  1.00 68.39  ? 260 LYS B CB  1 
ATOM   2440 C CG  . LYS B 1 55  ? 7.479   -0.665  -8.372  1.00 69.12  ? 260 LYS B CG  1 
ATOM   2441 C CD  . LYS B 1 55  ? 7.889   -1.043  -9.766  1.00 70.68  ? 260 LYS B CD  1 
ATOM   2442 C CE  . LYS B 1 55  ? 8.745   0.046   -10.389 1.00 73.53  ? 260 LYS B CE  1 
ATOM   2443 N NZ  . LYS B 1 55  ? 9.202   -0.321  -11.759 1.00 74.96  ? 260 LYS B NZ  1 
ATOM   2444 N N   . GLY B 1 56  ? 10.689  -0.358  -5.380  1.00 72.55  ? 261 GLY B N   1 
ATOM   2445 C CA  . GLY B 1 56  ? 12.022  -0.474  -4.823  1.00 73.50  ? 261 GLY B CA  1 
ATOM   2446 C C   . GLY B 1 56  ? 12.316  0.430   -3.646  1.00 73.66  ? 261 GLY B C   1 
ATOM   2447 O O   . GLY B 1 56  ? 12.962  0.005   -2.697  1.00 73.79  ? 261 GLY B O   1 
ATOM   2448 N N   . LEU B 1 57  ? 11.848  1.673   -3.713  1.00 74.41  ? 262 LEU B N   1 
ATOM   2449 C CA  . LEU B 1 57  ? 12.071  2.661   -2.659  1.00 75.18  ? 262 LEU B CA  1 
ATOM   2450 C C   . LEU B 1 57  ? 12.107  2.072   -1.266  1.00 75.64  ? 262 LEU B C   1 
ATOM   2451 O O   . LEU B 1 57  ? 13.179  1.963   -0.669  1.00 76.78  ? 262 LEU B O   1 
ATOM   2452 C CB  . LEU B 1 57  ? 10.999  3.741   -2.721  1.00 76.08  ? 262 LEU B CB  1 
ATOM   2453 N N   . VAL B 1 58  ? 10.934  1.698   -0.749  1.00 74.87  ? 263 VAL B N   1 
ATOM   2454 C CA  . VAL B 1 58  ? 10.815  1.149   0.597   1.00 73.87  ? 263 VAL B CA  1 
ATOM   2455 C C   . VAL B 1 58  ? 10.635  -0.410  0.673   1.00 74.16  ? 263 VAL B C   1 
ATOM   2456 O O   . VAL B 1 58  ? 11.304  -1.085  1.463   1.00 74.60  ? 263 VAL B O   1 
ATOM   2457 C CB  . VAL B 1 58  ? 9.646   1.839   1.352   1.00 72.77  ? 263 VAL B CB  1 
ATOM   2458 C CG1 . VAL B 1 58  ? 9.794   3.347   1.277   1.00 72.58  ? 263 VAL B CG1 1 
ATOM   2459 C CG2 . VAL B 1 58  ? 8.337   1.458   0.754   1.00 73.66  ? 263 VAL B CG2 1 
ATOM   2460 N N   . TRP B 1 59  ? 9.747   -0.948  -0.155  1.00 73.60  ? 264 TRP B N   1 
ATOM   2461 C CA  . TRP B 1 59  ? 9.459   -2.375  -0.171  1.00 72.32  ? 264 TRP B CA  1 
ATOM   2462 C C   . TRP B 1 59  ? 9.987   -3.013  -1.478  1.00 73.56  ? 264 TRP B C   1 
ATOM   2463 O O   . TRP B 1 59  ? 11.155  -3.406  -1.568  1.00 75.40  ? 264 TRP B O   1 
ATOM   2464 C CB  . TRP B 1 59  ? 7.942   -2.591  -0.058  1.00 69.72  ? 264 TRP B CB  1 
ATOM   2465 C CG  . TRP B 1 59  ? 7.288   -2.062  1.220   1.00 67.37  ? 264 TRP B CG  1 
ATOM   2466 C CD1 . TRP B 1 59  ? 7.448   -2.549  2.485   1.00 67.01  ? 264 TRP B CD1 1 
ATOM   2467 C CD2 . TRP B 1 59  ? 6.337   -0.986  1.330   1.00 65.75  ? 264 TRP B CD2 1 
ATOM   2468 N NE1 . TRP B 1 59  ? 6.656   -1.847  3.374   1.00 66.82  ? 264 TRP B NE1 1 
ATOM   2469 C CE2 . TRP B 1 59  ? 5.963   -0.879  2.686   1.00 64.42  ? 264 TRP B CE2 1 
ATOM   2470 C CE3 . TRP B 1 59  ? 5.763   -0.097  0.412   1.00 64.40  ? 264 TRP B CE3 1 
ATOM   2471 C CZ2 . TRP B 1 59  ? 5.050   0.056   3.146   1.00 62.04  ? 264 TRP B CZ2 1 
ATOM   2472 C CZ3 . TRP B 1 59  ? 4.859   0.835   0.870   1.00 63.53  ? 264 TRP B CZ3 1 
ATOM   2473 C CH2 . TRP B 1 59  ? 4.512   0.904   2.224   1.00 61.76  ? 264 TRP B CH2 1 
ATOM   2474 N N   . GLY B 1 65  ? 3.264   -10.372 -2.895  1.00 84.63  ? 270 GLY B N   1 
ATOM   2475 C CA  . GLY B 1 65  ? 3.599   -10.750 -1.532  1.00 85.05  ? 270 GLY B CA  1 
ATOM   2476 C C   . GLY B 1 65  ? 2.401   -10.741 -0.595  1.00 84.72  ? 270 GLY B C   1 
ATOM   2477 O O   . GLY B 1 65  ? 2.359   -11.476 0.394   1.00 83.78  ? 270 GLY B O   1 
ATOM   2478 N N   . LEU B 1 66  ? 1.426   -9.897  -0.913  1.00 84.39  ? 271 LEU B N   1 
ATOM   2479 C CA  . LEU B 1 66  ? 0.207   -9.768  -0.125  1.00 83.56  ? 271 LEU B CA  1 
ATOM   2480 C C   . LEU B 1 66  ? -0.930  -10.082 -1.060  1.00 83.29  ? 271 LEU B C   1 
ATOM   2481 O O   . LEU B 1 66  ? -0.727  -10.165 -2.273  1.00 84.31  ? 271 LEU B O   1 
ATOM   2482 C CB  . LEU B 1 66  ? 0.056   -8.333  0.376   1.00 83.69  ? 271 LEU B CB  1 
ATOM   2483 C CG  . LEU B 1 66  ? 1.315   -7.586  0.808   1.00 82.86  ? 271 LEU B CG  1 
ATOM   2484 C CD1 . LEU B 1 66  ? 0.925   -6.181  1.215   1.00 83.46  ? 271 LEU B CD1 1 
ATOM   2485 C CD2 . LEU B 1 66  ? 1.999   -8.312  1.953   1.00 83.82  ? 271 LEU B CD2 1 
ATOM   2486 N N   . PRO B 1 67  ? -2.152  -10.247 -0.525  1.00 82.10  ? 272 PRO B N   1 
ATOM   2487 C CA  . PRO B 1 67  ? -3.317  -10.553 -1.360  1.00 81.04  ? 272 PRO B CA  1 
ATOM   2488 C C   . PRO B 1 67  ? -3.281  -9.848  -2.721  1.00 79.22  ? 272 PRO B C   1 
ATOM   2489 O O   . PRO B 1 67  ? -2.755  -8.740  -2.849  1.00 78.68  ? 272 PRO B O   1 
ATOM   2490 C CB  . PRO B 1 67  ? -4.480  -10.090 -0.492  1.00 81.63  ? 272 PRO B CB  1 
ATOM   2491 C CG  . PRO B 1 67  ? -4.015  -10.475 0.872   1.00 82.07  ? 272 PRO B CG  1 
ATOM   2492 C CD  . PRO B 1 67  ? -2.558  -10.034 0.877   1.00 82.21  ? 272 PRO B CD  1 
ATOM   2493 N N   . PRO B 1 68  ? -3.845  -10.493 -3.752  1.00 77.88  ? 273 PRO B N   1 
ATOM   2494 C CA  . PRO B 1 68  ? -3.878  -9.932  -5.107  1.00 76.41  ? 273 PRO B CA  1 
ATOM   2495 C C   . PRO B 1 68  ? -4.288  -8.471  -5.094  1.00 74.32  ? 273 PRO B C   1 
ATOM   2496 O O   . PRO B 1 68  ? -5.143  -8.068  -4.307  1.00 74.30  ? 273 PRO B O   1 
ATOM   2497 C CB  . PRO B 1 68  ? -4.888  -10.828 -5.828  1.00 76.40  ? 273 PRO B CB  1 
ATOM   2498 C CG  . PRO B 1 68  ? -5.770  -11.323 -4.712  1.00 76.93  ? 273 PRO B CG  1 
ATOM   2499 C CD  . PRO B 1 68  ? -4.762  -11.637 -3.640  1.00 77.34  ? 273 PRO B CD  1 
ATOM   2500 N N   . TYR B 1 69  ? -3.680  -7.675  -5.964  1.00 71.50  ? 274 TYR B N   1 
ATOM   2501 C CA  . TYR B 1 69  ? -3.988  -6.255  -6.006  1.00 70.27  ? 274 TYR B CA  1 
ATOM   2502 C C   . TYR B 1 69  ? -5.396  -5.929  -6.429  1.00 70.19  ? 274 TYR B C   1 
ATOM   2503 O O   . TYR B 1 69  ? -5.704  -5.890  -7.623  1.00 71.66  ? 274 TYR B O   1 
ATOM   2504 C CB  . TYR B 1 69  ? -3.032  -5.511  -6.931  1.00 68.12  ? 274 TYR B CB  1 
ATOM   2505 C CG  . TYR B 1 69  ? -3.199  -4.020  -6.805  1.00 66.15  ? 274 TYR B CG  1 
ATOM   2506 C CD1 . TYR B 1 69  ? -2.682  -3.343  -5.713  1.00 65.51  ? 274 TYR B CD1 1 
ATOM   2507 C CD2 . TYR B 1 69  ? -3.919  -3.296  -7.744  1.00 65.43  ? 274 TYR B CD2 1 
ATOM   2508 C CE1 . TYR B 1 69  ? -2.876  -1.991  -5.555  1.00 64.63  ? 274 TYR B CE1 1 
ATOM   2509 C CE2 . TYR B 1 69  ? -4.120  -1.937  -7.591  1.00 63.76  ? 274 TYR B CE2 1 
ATOM   2510 C CZ  . TYR B 1 69  ? -3.596  -1.293  -6.493  1.00 63.48  ? 274 TYR B CZ  1 
ATOM   2511 O OH  . TYR B 1 69  ? -3.798  0.054   -6.310  1.00 63.25  ? 274 TYR B OH  1 
ATOM   2512 N N   . LYS B 1 70  ? -6.255  -5.669  -5.449  1.00 68.29  ? 275 LYS B N   1 
ATOM   2513 C CA  . LYS B 1 70  ? -7.640  -5.320  -5.716  1.00 65.66  ? 275 LYS B CA  1 
ATOM   2514 C C   . LYS B 1 70  ? -7.690  -3.858  -6.060  1.00 63.55  ? 275 LYS B C   1 
ATOM   2515 O O   . LYS B 1 70  ? -7.961  -3.485  -7.198  1.00 62.90  ? 275 LYS B O   1 
ATOM   2516 C CB  . LYS B 1 70  ? -8.500  -5.614  -4.490  1.00 66.14  ? 275 LYS B CB  1 
ATOM   2517 N N   . GLU B 1 71  ? -7.418  -3.013  -5.076  1.00 61.77  ? 276 GLU B N   1 
ATOM   2518 C CA  . GLU B 1 71  ? -7.426  -1.579  -5.302  1.00 59.01  ? 276 GLU B CA  1 
ATOM   2519 C C   . GLU B 1 71  ? -6.519  -0.862  -4.364  1.00 58.18  ? 276 GLU B C   1 
ATOM   2520 O O   . GLU B 1 71  ? -5.960  -1.447  -3.438  1.00 58.32  ? 276 GLU B O   1 
ATOM   2521 C CB  . GLU B 1 71  ? -8.844  -1.017  -5.185  1.00 58.05  ? 276 GLU B CB  1 
ATOM   2522 C CG  . GLU B 1 71  ? -9.539  -1.314  -3.880  1.00 57.19  ? 276 GLU B CG  1 
ATOM   2523 C CD  . GLU B 1 71  ? -10.896 -0.639  -3.782  1.00 58.66  ? 276 GLU B CD  1 
ATOM   2524 O OE1 . GLU B 1 71  ? -10.934 0.608   -3.684  1.00 59.44  ? 276 GLU B OE1 1 
ATOM   2525 O OE2 . GLU B 1 71  ? -11.923 -1.352  -3.810  1.00 57.27  ? 276 GLU B OE2 1 
ATOM   2526 N N   . ILE B 1 72  ? -6.367  0.431   -4.605  1.00 56.17  ? 277 ILE B N   1 
ATOM   2527 C CA  . ILE B 1 72  ? -5.506  1.285   -3.808  1.00 54.85  ? 277 ILE B CA  1 
ATOM   2528 C C   . ILE B 1 72  ? -5.813  1.230   -2.321  1.00 52.95  ? 277 ILE B C   1 
ATOM   2529 O O   . ILE B 1 72  ? -4.983  0.803   -1.523  1.00 52.71  ? 277 ILE B O   1 
ATOM   2530 C CB  . ILE B 1 72  ? -5.617  2.744   -4.314  1.00 56.22  ? 277 ILE B CB  1 
ATOM   2531 C CG1 . ILE B 1 72  ? -5.199  2.793   -5.795  1.00 57.36  ? 277 ILE B CG1 1 
ATOM   2532 C CG2 . ILE B 1 72  ? -4.754  3.669   -3.457  1.00 54.66  ? 277 ILE B CG2 1 
ATOM   2533 C CD1 . ILE B 1 72  ? -5.811  3.942   -6.607  1.00 55.92  ? 277 ILE B CD1 1 
ATOM   2534 N N   . SER B 1 73  ? -7.012  1.658   -1.954  1.00 50.36  ? 278 SER B N   1 
ATOM   2535 C CA  . SER B 1 73  ? -7.424  1.677   -0.566  1.00 48.29  ? 278 SER B CA  1 
ATOM   2536 C C   . SER B 1 73  ? -7.238  0.304   0.146   1.00 47.55  ? 278 SER B C   1 
ATOM   2537 O O   . SER B 1 73  ? -6.689  0.244   1.250   1.00 47.77  ? 278 SER B O   1 
ATOM   2538 C CB  . SER B 1 73  ? -8.885  2.135   -0.478  1.00 49.53  ? 278 SER B CB  1 
ATOM   2539 O OG  . SER B 1 73  ? -9.052  3.435   -1.032  1.00 48.63  ? 278 SER B OG  1 
ATOM   2540 N N   . VAL B 1 74  ? -7.690  -0.774  -0.491  1.00 45.55  ? 279 VAL B N   1 
ATOM   2541 C CA  . VAL B 1 74  ? -7.577  -2.123  0.078   1.00 43.12  ? 279 VAL B CA  1 
ATOM   2542 C C   . VAL B 1 74  ? -6.102  -2.582  0.243   1.00 42.22  ? 279 VAL B C   1 
ATOM   2543 O O   . VAL B 1 74  ? -5.724  -3.148  1.265   1.00 42.38  ? 279 VAL B O   1 
ATOM   2544 C CB  . VAL B 1 74  ? -8.343  -3.145  -0.797  1.00 42.56  ? 279 VAL B CB  1 
ATOM   2545 C CG1 . VAL B 1 74  ? -8.131  -4.564  -0.279  1.00 38.18  ? 279 VAL B CG1 1 
ATOM   2546 C CG2 . VAL B 1 74  ? -9.823  -2.787  -0.812  1.00 40.13  ? 279 VAL B CG2 1 
ATOM   2547 N N   . HIS B 1 75  ? -5.289  -2.332  -0.771  1.00 41.30  ? 280 HIS B N   1 
ATOM   2548 C CA  . HIS B 1 75  ? -3.880  -2.687  -0.718  1.00 41.01  ? 280 HIS B CA  1 
ATOM   2549 C C   . HIS B 1 75  ? -3.255  -2.145  0.556   1.00 41.57  ? 280 HIS B C   1 
ATOM   2550 O O   . HIS B 1 75  ? -2.471  -2.824  1.216   1.00 40.59  ? 280 HIS B O   1 
ATOM   2551 C CB  . HIS B 1 75  ? -3.147  -2.095  -1.918  1.00 41.12  ? 280 HIS B CB  1 
ATOM   2552 C CG  . HIS B 1 75  ? -1.665  -2.285  -1.866  1.00 41.38  ? 280 HIS B CG  1 
ATOM   2553 N ND1 . HIS B 1 75  ? -1.066  -3.513  -2.046  1.00 41.89  ? 280 HIS B ND1 1 
ATOM   2554 C CD2 . HIS B 1 75  ? -0.664  -1.412  -1.613  1.00 40.15  ? 280 HIS B CD2 1 
ATOM   2555 C CE1 . HIS B 1 75  ? 0.240   -3.388  -1.902  1.00 40.25  ? 280 HIS B CE1 1 
ATOM   2556 N NE2 . HIS B 1 75  ? 0.509   -2.123  -1.639  1.00 41.54  ? 280 HIS B NE2 1 
ATOM   2557 N N   . VAL B 1 76  ? -3.601  -0.903  0.880   1.00 41.37  ? 281 VAL B N   1 
ATOM   2558 C CA  . VAL B 1 76  ? -3.104  -0.227  2.066   1.00 42.09  ? 281 VAL B CA  1 
ATOM   2559 C C   . VAL B 1 76  ? -3.588  -0.907  3.302   1.00 44.09  ? 281 VAL B C   1 
ATOM   2560 O O   . VAL B 1 76  ? -2.859  -1.013  4.298   1.00 44.23  ? 281 VAL B O   1 
ATOM   2561 C CB  . VAL B 1 76  ? -3.573  1.238   2.087   1.00 41.67  ? 281 VAL B CB  1 
ATOM   2562 C CG1 . VAL B 1 76  ? -3.296  1.865   3.443   1.00 39.90  ? 281 VAL B CG1 1 
ATOM   2563 C CG2 . VAL B 1 76  ? -2.872  2.008   0.987   1.00 41.39  ? 281 VAL B CG2 1 
ATOM   2564 N N   . PHE B 1 77  ? -4.840  -1.360  3.252   1.00 44.57  ? 282 PHE B N   1 
ATOM   2565 C CA  . PHE B 1 77  ? -5.465  -2.061  4.368   1.00 45.45  ? 282 PHE B CA  1 
ATOM   2566 C C   . PHE B 1 77  ? -4.666  -3.359  4.665   1.00 45.98  ? 282 PHE B C   1 
ATOM   2567 O O   . PHE B 1 77  ? -4.489  -3.747  5.821   1.00 44.08  ? 282 PHE B O   1 
ATOM   2568 C CB  . PHE B 1 77  ? -6.908  -2.393  4.009   1.00 46.17  ? 282 PHE B CB  1 
ATOM   2569 C CG  . PHE B 1 77  ? -7.678  -3.044  5.116   1.00 46.66  ? 282 PHE B CG  1 
ATOM   2570 C CD1 . PHE B 1 77  ? -7.819  -2.414  6.344   1.00 47.04  ? 282 PHE B CD1 1 
ATOM   2571 C CD2 . PHE B 1 77  ? -8.311  -4.266  4.911   1.00 45.48  ? 282 PHE B CD2 1 
ATOM   2572 C CE1 . PHE B 1 77  ? -8.583  -2.989  7.345   1.00 47.29  ? 282 PHE B CE1 1 
ATOM   2573 C CE2 . PHE B 1 77  ? -9.074  -4.843  5.904   1.00 44.31  ? 282 PHE B CE2 1 
ATOM   2574 C CZ  . PHE B 1 77  ? -9.212  -4.206  7.120   1.00 46.39  ? 282 PHE B CZ  1 
ATOM   2575 N N   . TYR B 1 78  ? -4.198  -4.013  3.607   1.00 45.92  ? 283 TYR B N   1 
ATOM   2576 C CA  . TYR B 1 78  ? -3.397  -5.211  3.769   1.00 47.29  ? 283 TYR B CA  1 
ATOM   2577 C C   . TYR B 1 78  ? -2.066  -4.847  4.389   1.00 46.25  ? 283 TYR B C   1 
ATOM   2578 O O   . TYR B 1 78  ? -1.529  -5.601  5.190   1.00 47.53  ? 283 TYR B O   1 
ATOM   2579 C CB  . TYR B 1 78  ? -3.172  -5.901  2.420   1.00 50.25  ? 283 TYR B CB  1 
ATOM   2580 C CG  . TYR B 1 78  ? -4.427  -6.490  1.830   1.00 51.94  ? 283 TYR B CG  1 
ATOM   2581 C CD1 . TYR B 1 78  ? -5.327  -7.185  2.624   1.00 53.79  ? 283 TYR B CD1 1 
ATOM   2582 C CD2 . TYR B 1 78  ? -4.706  -6.367  0.480   1.00 53.76  ? 283 TYR B CD2 1 
ATOM   2583 C CE1 . TYR B 1 78  ? -6.466  -7.740  2.090   1.00 53.47  ? 283 TYR B CE1 1 
ATOM   2584 C CE2 . TYR B 1 78  ? -5.844  -6.921  -0.063  1.00 53.51  ? 283 TYR B CE2 1 
ATOM   2585 C CZ  . TYR B 1 78  ? -6.717  -7.605  0.747   1.00 52.98  ? 283 TYR B CZ  1 
ATOM   2586 O OH  . TYR B 1 78  ? -7.843  -8.169  0.210   1.00 54.68  ? 283 TYR B OH  1 
ATOM   2587 N N   . ARG B 1 79  ? -1.513  -3.697  4.013   1.00 45.58  ? 284 ARG B N   1 
ATOM   2588 C CA  . ARG B 1 79  ? -0.245  -3.261  4.592   1.00 45.75  ? 284 ARG B CA  1 
ATOM   2589 C C   . ARG B 1 79  ? -0.446  -3.126  6.101   1.00 44.76  ? 284 ARG B C   1 
ATOM   2590 O O   . ARG B 1 79  ? 0.375   -3.591  6.893   1.00 43.29  ? 284 ARG B O   1 
ATOM   2591 C CB  . ARG B 1 79  ? 0.197   -1.914  4.002   1.00 47.79  ? 284 ARG B CB  1 
ATOM   2592 C CG  . ARG B 1 79  ? 0.945   -2.011  2.630   1.00 48.94  ? 284 ARG B CG  1 
ATOM   2593 C CD  . ARG B 1 79  ? 2.212   -2.785  2.784   1.00 50.28  ? 284 ARG B CD  1 
ATOM   2594 N NE  . ARG B 1 79  ? 2.951   -2.949  1.535   1.00 52.34  ? 284 ARG B NE  1 
ATOM   2595 C CZ  . ARG B 1 79  ? 4.018   -3.734  1.424   1.00 51.89  ? 284 ARG B CZ  1 
ATOM   2596 N NH1 . ARG B 1 79  ? 4.656   -3.855  0.277   1.00 49.21  ? 284 ARG B NH1 1 
ATOM   2597 N NH2 . ARG B 1 79  ? 4.448   -4.409  2.479   1.00 54.63  ? 284 ARG B NH2 1 
ATOM   2598 N N   . CYS B 1 80  ? -1.550  -2.498  6.494   1.00 42.85  ? 285 CYS B N   1 
ATOM   2599 C CA  . CYS B 1 80  ? -1.854  -2.337  7.911   1.00 43.36  ? 285 CYS B CA  1 
ATOM   2600 C C   . CYS B 1 80  ? -1.932  -3.678  8.592   1.00 41.93  ? 285 CYS B C   1 
ATOM   2601 O O   . CYS B 1 80  ? -1.584  -3.800  9.762   1.00 40.62  ? 285 CYS B O   1 
ATOM   2602 C CB  . CYS B 1 80  ? -3.179  -1.599  8.099   1.00 43.25  ? 285 CYS B CB  1 
ATOM   2603 S SG  . CYS B 1 80  ? -3.171  0.072   7.454   1.00 42.60  ? 285 CYS B SG  1 
ATOM   2604 N N   . GLN B 1 81  ? -2.393  -4.691  7.863   1.00 41.03  ? 286 GLN B N   1 
ATOM   2605 C CA  . GLN B 1 81  ? -2.511  -6.026  8.419   1.00 40.24  ? 286 GLN B CA  1 
ATOM   2606 C C   . GLN B 1 81  ? -1.225  -6.658  8.643   1.00 40.00  ? 286 GLN B C   1 
ATOM   2607 O O   . GLN B 1 81  ? -0.994  -7.236  9.700   1.00 39.41  ? 286 GLN B O   1 
ATOM   2608 C CB  . GLN B 1 81  ? -3.385  -6.908  7.533   1.00 40.83  ? 286 GLN B CB  1 
ATOM   2609 C CG  . GLN B 1 81  ? -4.850  -6.557  7.627   1.00 43.90  ? 286 GLN B CG  1 
ATOM   2610 C CD  . GLN B 1 81  ? -5.740  -7.619  7.023   1.00 46.91  ? 286 GLN B CD  1 
ATOM   2611 O OE1 . GLN B 1 81  ? -5.566  -8.810  7.289   1.00 50.34  ? 286 GLN B OE1 1 
ATOM   2612 N NE2 . GLN B 1 81  ? -6.710  -7.197  6.218   1.00 46.84  ? 286 GLN B NE2 1 
ATOM   2613 N N   . CYS B 1 82  ? -0.332  -6.580  7.671   1.00 40.08  ? 287 CYS B N   1 
ATOM   2614 C CA  . CYS B 1 82  ? 0.973   -7.190  7.863   1.00 42.35  ? 287 CYS B CA  1 
ATOM   2615 C C   . CYS B 1 82  ? 1.642   -6.546  9.028   1.00 40.17  ? 287 CYS B C   1 
ATOM   2616 O O   . CYS B 1 82  ? 2.150   -7.220  9.919   1.00 41.25  ? 287 CYS B O   1 
ATOM   2617 C CB  . CYS B 1 82  ? 1.826   -7.039  6.607   1.00 44.78  ? 287 CYS B CB  1 
ATOM   2618 S SG  . CYS B 1 82  ? 1.086   -7.853  5.192   1.00 56.64  ? 287 CYS B SG  1 
ATOM   2619 N N   . THR B 1 83  ? 1.640   -5.222  9.048   1.00 38.15  ? 288 THR B N   1 
ATOM   2620 C CA  . THR B 1 83  ? 2.251   -4.500  10.143  1.00 36.43  ? 288 THR B CA  1 
ATOM   2621 C C   . THR B 1 83  ? 1.693   -4.993  11.464  1.00 36.16  ? 288 THR B C   1 
ATOM   2622 O O   . THR B 1 83  ? 2.436   -5.255  12.401  1.00 37.48  ? 288 THR B O   1 
ATOM   2623 C CB  . THR B 1 83  ? 1.980   -3.007  10.032  1.00 35.53  ? 288 THR B CB  1 
ATOM   2624 O OG1 . THR B 1 83  ? 2.361   -2.545  8.733   1.00 38.68  ? 288 THR B OG1 1 
ATOM   2625 C CG2 . THR B 1 83  ? 2.775   -2.274  11.058  1.00 35.74  ? 288 THR B CG2 1 
ATOM   2626 N N   . THR B 1 84  ? 0.374   -5.124  11.539  1.00 35.15  ? 289 THR B N   1 
ATOM   2627 C CA  . THR B 1 84  ? -0.287  -5.579  12.756  1.00 34.86  ? 289 THR B CA  1 
ATOM   2628 C C   . THR B 1 84  ? 0.086   -6.994  13.171  1.00 35.14  ? 289 THR B C   1 
ATOM   2629 O O   . THR B 1 84  ? 0.332   -7.262  14.347  1.00 35.27  ? 289 THR B O   1 
ATOM   2630 C CB  . THR B 1 84  ? -1.802  -5.486  12.600  1.00 32.25  ? 289 THR B CB  1 
ATOM   2631 O OG1 . THR B 1 84  ? -2.158  -4.118  12.399  1.00 33.63  ? 289 THR B OG1 1 
ATOM   2632 C CG2 . THR B 1 84  ? -2.496  -6.002  13.823  1.00 28.06  ? 289 THR B CG2 1 
ATOM   2633 N N   . VAL B 1 85  ? 0.122   -7.906  12.211  1.00 34.93  ? 290 VAL B N   1 
ATOM   2634 C CA  . VAL B 1 85  ? 0.479   -9.279  12.512  1.00 34.82  ? 290 VAL B CA  1 
ATOM   2635 C C   . VAL B 1 85  ? 1.895   -9.309  13.050  1.00 34.18  ? 290 VAL B C   1 
ATOM   2636 O O   . VAL B 1 85  ? 2.188   -10.023 14.007  1.00 33.80  ? 290 VAL B O   1 
ATOM   2637 C CB  . VAL B 1 85  ? 0.357   -10.176 11.253  1.00 34.56  ? 290 VAL B CB  1 
ATOM   2638 C CG1 . VAL B 1 85  ? 1.117   -11.477 11.458  1.00 35.76  ? 290 VAL B CG1 1 
ATOM   2639 C CG2 . VAL B 1 85  ? -1.112  -10.471 10.979  1.00 32.67  ? 290 VAL B CG2 1 
ATOM   2640 N N   . GLU B 1 86  ? 2.779   -8.524  12.442  1.00 33.19  ? 291 GLU B N   1 
ATOM   2641 C CA  . GLU B 1 86  ? 4.160   -8.467  12.900  1.00 34.03  ? 291 GLU B CA  1 
ATOM   2642 C C   . GLU B 1 86  ? 4.207   -7.855  14.318  1.00 34.03  ? 291 GLU B C   1 
ATOM   2643 O O   . GLU B 1 86  ? 4.942   -8.334  15.178  1.00 35.47  ? 291 GLU B O   1 
ATOM   2644 C CB  . GLU B 1 86  ? 5.012   -7.651  11.933  1.00 33.24  ? 291 GLU B CB  1 
ATOM   2645 N N   . THR B 1 87  ? 3.421   -6.812  14.562  1.00 32.56  ? 292 THR B N   1 
ATOM   2646 C CA  . THR B 1 87  ? 3.415   -6.215  15.882  1.00 33.37  ? 292 THR B CA  1 
ATOM   2647 C C   . THR B 1 87  ? 2.860   -7.170  16.896  1.00 33.76  ? 292 THR B C   1 
ATOM   2648 O O   . THR B 1 87  ? 3.292   -7.165  18.043  1.00 36.27  ? 292 THR B O   1 
ATOM   2649 C CB  . THR B 1 87  ? 2.602   -4.924  15.929  1.00 34.46  ? 292 THR B CB  1 
ATOM   2650 O OG1 . THR B 1 87  ? 3.146   -3.989  14.991  1.00 35.30  ? 292 THR B OG1 1 
ATOM   2651 C CG2 . THR B 1 87  ? 2.661   -4.318  17.337  1.00 32.33  ? 292 THR B CG2 1 
ATOM   2652 N N   . VAL B 1 88  ? 1.897   -7.993  16.500  1.00 32.28  ? 293 VAL B N   1 
ATOM   2653 C CA  . VAL B 1 88  ? 1.332   -8.972  17.416  1.00 32.65  ? 293 VAL B CA  1 
ATOM   2654 C C   . VAL B 1 88  ? 2.413   -10.061 17.733  1.00 34.28  ? 293 VAL B C   1 
ATOM   2655 O O   . VAL B 1 88  ? 2.442   -10.626 18.826  1.00 31.65  ? 293 VAL B O   1 
ATOM   2656 C CB  . VAL B 1 88  ? 0.071   -9.622  16.811  1.00 33.38  ? 293 VAL B CB  1 
ATOM   2657 C CG1 . VAL B 1 88  ? -0.366  -10.818 17.644  1.00 33.17  ? 293 VAL B CG1 1 
ATOM   2658 C CG2 . VAL B 1 88  ? -1.046  -8.590  16.742  1.00 31.72  ? 293 VAL B CG2 1 
ATOM   2659 N N   . ARG B 1 89  ? 3.294   -10.329 16.772  1.00 37.04  ? 294 ARG B N   1 
ATOM   2660 C CA  . ARG B 1 89  ? 4.359   -11.294 16.986  1.00 39.56  ? 294 ARG B CA  1 
ATOM   2661 C C   . ARG B 1 89  ? 5.337   -10.730 18.006  1.00 40.40  ? 294 ARG B C   1 
ATOM   2662 O O   . ARG B 1 89  ? 5.746   -11.421 18.940  1.00 41.17  ? 294 ARG B O   1 
ATOM   2663 C CB  . ARG B 1 89  ? 5.108   -11.593 15.686  1.00 42.02  ? 294 ARG B CB  1 
ATOM   2664 C CG  . ARG B 1 89  ? 4.444   -12.617 14.744  1.00 47.76  ? 294 ARG B CG  1 
ATOM   2665 C CD  . ARG B 1 89  ? 5.527   -13.288 13.838  1.00 52.92  ? 294 ARG B CD  1 
ATOM   2666 N NE  . ARG B 1 89  ? 4.975   -14.089 12.742  1.00 60.01  ? 294 ARG B NE  1 
ATOM   2667 C CZ  . ARG B 1 89  ? 4.556   -13.598 11.572  1.00 63.67  ? 294 ARG B CZ  1 
ATOM   2668 N NH1 . ARG B 1 89  ? 4.618   -12.291 11.324  1.00 63.83  ? 294 ARG B NH1 1 
ATOM   2669 N NH2 . ARG B 1 89  ? 4.081   -14.419 10.637  1.00 63.93  ? 294 ARG B NH2 1 
ATOM   2670 N N   . GLU B 1 90  ? 5.719   -9.468  17.830  1.00 41.07  ? 295 GLU B N   1 
ATOM   2671 C CA  . GLU B 1 90  ? 6.657   -8.827  18.753  1.00 41.21  ? 295 GLU B CA  1 
ATOM   2672 C C   . GLU B 1 90  ? 6.033   -8.706  20.153  1.00 40.79  ? 295 GLU B C   1 
ATOM   2673 O O   . GLU B 1 90  ? 6.689   -8.986  21.160  1.00 41.70  ? 295 GLU B O   1 
ATOM   2674 C CB  . GLU B 1 90  ? 7.062   -7.439  18.239  1.00 41.28  ? 295 GLU B CB  1 
ATOM   2675 C CG  . GLU B 1 90  ? 7.683   -7.435  16.826  1.00 44.06  ? 295 GLU B CG  1 
ATOM   2676 C CD  . GLU B 1 90  ? 8.211   -6.069  16.410  1.00 45.45  ? 295 GLU B CD  1 
ATOM   2677 O OE1 . GLU B 1 90  ? 7.441   -5.088  16.453  1.00 46.62  ? 295 GLU B OE1 1 
ATOM   2678 O OE2 . GLU B 1 90  ? 9.399   -5.976  16.034  1.00 48.62  ? 295 GLU B OE2 1 
ATOM   2679 N N   . LEU B 1 91  ? 4.773   -8.284  20.206  1.00 38.34  ? 296 LEU B N   1 
ATOM   2680 C CA  . LEU B 1 91  ? 4.063   -8.155  21.468  1.00 36.46  ? 296 LEU B CA  1 
ATOM   2681 C C   . LEU B 1 91  ? 3.976   -9.487  22.189  1.00 36.15  ? 296 LEU B C   1 
ATOM   2682 O O   . LEU B 1 91  ? 3.969   -9.527  23.411  1.00 35.16  ? 296 LEU B O   1 
ATOM   2683 C CB  . LEU B 1 91  ? 2.653   -7.601  21.240  1.00 36.26  ? 296 LEU B CB  1 
ATOM   2684 C CG  . LEU B 1 91  ? 2.535   -6.072  21.194  1.00 36.34  ? 296 LEU B CG  1 
ATOM   2685 C CD1 . LEU B 1 91  ? 1.085   -5.654  20.882  1.00 36.89  ? 296 LEU B CD1 1 
ATOM   2686 C CD2 . LEU B 1 91  ? 2.990   -5.498  22.534  1.00 31.78  ? 296 LEU B CD2 1 
ATOM   2687 N N   . THR B 1 92  ? 3.907   -10.584 21.442  1.00 36.22  ? 297 THR B N   1 
ATOM   2688 C CA  . THR B 1 92  ? 3.833   -11.894 22.065  1.00 35.87  ? 297 THR B CA  1 
ATOM   2689 C C   . THR B 1 92  ? 5.140   -12.242 22.734  1.00 37.14  ? 297 THR B C   1 
ATOM   2690 O O   . THR B 1 92  ? 5.146   -12.666 23.891  1.00 38.34  ? 297 THR B O   1 
ATOM   2691 C CB  . THR B 1 92  ? 3.467   -12.986 21.047  1.00 36.41  ? 297 THR B CB  1 
ATOM   2692 O OG1 . THR B 1 92  ? 2.153   -12.736 20.533  1.00 36.32  ? 297 THR B OG1 1 
ATOM   2693 C CG2 . THR B 1 92  ? 3.488   -14.360 21.710  1.00 35.23  ? 297 THR B CG2 1 
ATOM   2694 N N   . GLU B 1 93  ? 6.258   -12.064 22.032  1.00 37.03  ? 298 GLU B N   1 
ATOM   2695 C CA  . GLU B 1 93  ? 7.559   -12.358 22.623  1.00 36.69  ? 298 GLU B CA  1 
ATOM   2696 C C   . GLU B 1 93  ? 7.850   -11.450 23.776  1.00 36.41  ? 298 GLU B C   1 
ATOM   2697 O O   . GLU B 1 93  ? 8.528   -11.842 24.717  1.00 37.42  ? 298 GLU B O   1 
ATOM   2698 C CB  . GLU B 1 93  ? 8.663   -12.254 21.579  1.00 39.32  ? 298 GLU B CB  1 
ATOM   2699 C CG  . GLU B 1 93  ? 8.528   -13.304 20.483  1.00 46.47  ? 298 GLU B CG  1 
ATOM   2700 C CD  . GLU B 1 93  ? 8.372   -14.715 21.043  1.00 49.23  ? 298 GLU B CD  1 
ATOM   2701 O OE1 . GLU B 1 93  ? 7.737   -15.558 20.369  1.00 50.81  ? 298 GLU B OE1 1 
ATOM   2702 O OE2 . GLU B 1 93  ? 8.888   -14.982 22.151  1.00 50.71  ? 298 GLU B OE2 1 
ATOM   2703 N N   . PHE B 1 94  ? 7.345   -10.223 23.724  1.00 34.72  ? 299 PHE B N   1 
ATOM   2704 C CA  . PHE B 1 94  ? 7.546   -9.284  24.815  1.00 35.24  ? 299 PHE B CA  1 
ATOM   2705 C C   . PHE B 1 94  ? 6.888   -9.846  26.081  1.00 35.95  ? 299 PHE B C   1 
ATOM   2706 O O   . PHE B 1 94  ? 7.532   -10.028 27.109  1.00 37.31  ? 299 PHE B O   1 
ATOM   2707 C CB  . PHE B 1 94  ? 6.915   -7.938  24.475  1.00 34.76  ? 299 PHE B CB  1 
ATOM   2708 C CG  . PHE B 1 94  ? 6.955   -6.947  25.604  1.00 35.82  ? 299 PHE B CG  1 
ATOM   2709 C CD1 . PHE B 1 94  ? 8.170   -6.509  26.124  1.00 35.21  ? 299 PHE B CD1 1 
ATOM   2710 C CD2 . PHE B 1 94  ? 5.778   -6.419  26.122  1.00 34.57  ? 299 PHE B CD2 1 
ATOM   2711 C CE1 . PHE B 1 94  ? 8.208   -5.559  27.134  1.00 32.57  ? 299 PHE B CE1 1 
ATOM   2712 C CE2 . PHE B 1 94  ? 5.811   -5.470  27.132  1.00 32.90  ? 299 PHE B CE2 1 
ATOM   2713 C CZ  . PHE B 1 94  ? 7.029   -5.038  27.636  1.00 32.45  ? 299 PHE B CZ  1 
ATOM   2714 N N   . ALA B 1 95  ? 5.593   -10.109 25.987  1.00 35.70  ? 300 ALA B N   1 
ATOM   2715 C CA  . ALA B 1 95  ? 4.826   -10.648 27.090  1.00 35.11  ? 300 ALA B CA  1 
ATOM   2716 C C   . ALA B 1 95  ? 5.511   -11.865 27.677  1.00 38.10  ? 300 ALA B C   1 
ATOM   2717 O O   . ALA B 1 95  ? 5.671   -11.972 28.896  1.00 39.09  ? 300 ALA B O   1 
ATOM   2718 C CB  . ALA B 1 95  ? 3.445   -11.007 26.611  1.00 30.22  ? 300 ALA B CB  1 
ATOM   2719 N N   . LYS B 1 96  ? 5.916   -12.791 26.815  1.00 40.83  ? 301 LYS B N   1 
ATOM   2720 C CA  . LYS B 1 96  ? 6.590   -14.002 27.269  1.00 44.03  ? 301 LYS B CA  1 
ATOM   2721 C C   . LYS B 1 96  ? 7.901   -13.665 28.002  1.00 45.86  ? 301 LYS B C   1 
ATOM   2722 O O   . LYS B 1 96  ? 8.287   -14.358 28.941  1.00 47.57  ? 301 LYS B O   1 
ATOM   2723 C CB  . LYS B 1 96  ? 6.845   -14.948 26.085  1.00 42.73  ? 301 LYS B CB  1 
ATOM   2724 C CG  . LYS B 1 96  ? 5.585   -15.724 25.645  1.00 43.63  ? 301 LYS B CG  1 
ATOM   2725 C CD  . LYS B 1 96  ? 5.667   -16.245 24.194  1.00 46.69  ? 301 LYS B CD  1 
ATOM   2726 C CE  . LYS B 1 96  ? 6.678   -17.378 24.020  1.00 49.25  ? 301 LYS B CE  1 
ATOM   2727 N NZ  . LYS B 1 96  ? 6.718   -17.875 22.607  1.00 49.93  ? 301 LYS B NZ  1 
ATOM   2728 N N   . SER B 1 97  ? 8.570   -12.590 27.596  1.00 46.79  ? 302 SER B N   1 
ATOM   2729 C CA  . SER B 1 97  ? 9.810   -12.192 28.253  1.00 47.16  ? 302 SER B CA  1 
ATOM   2730 C C   . SER B 1 97  ? 9.566   -11.744 29.685  1.00 47.40  ? 302 SER B C   1 
ATOM   2731 O O   . SER B 1 97  ? 10.506  -11.496 30.428  1.00 48.84  ? 302 SER B O   1 
ATOM   2732 C CB  . SER B 1 97  ? 10.488  -11.070 27.476  1.00 47.25  ? 302 SER B CB  1 
ATOM   2733 O OG  . SER B 1 97  ? 10.811  -11.493 26.161  1.00 50.28  ? 302 SER B OG  1 
ATOM   2734 N N   . ILE B 1 98  ? 8.301   -11.619 30.069  1.00 47.57  ? 303 ILE B N   1 
ATOM   2735 C CA  . ILE B 1 98  ? 7.943   -11.227 31.424  1.00 49.49  ? 303 ILE B CA  1 
ATOM   2736 C C   . ILE B 1 98  ? 7.703   -12.561 32.216  1.00 51.82  ? 303 ILE B C   1 
ATOM   2737 O O   . ILE B 1 98  ? 6.693   -13.234 32.023  1.00 51.11  ? 303 ILE B O   1 
ATOM   2738 C CB  . ILE B 1 98  ? 6.664   -10.388 31.415  1.00 48.16  ? 303 ILE B CB  1 
ATOM   2739 C CG1 . ILE B 1 98  ? 6.867   -9.162  30.521  1.00 47.29  ? 303 ILE B CG1 1 
ATOM   2740 C CG2 . ILE B 1 98  ? 6.296   -10.002 32.821  1.00 46.77  ? 303 ILE B CG2 1 
ATOM   2741 C CD1 . ILE B 1 98  ? 5.653   -8.224  30.439  1.00 45.76  ? 303 ILE B CD1 1 
ATOM   2742 N N   . PRO B 1 99  ? 8.657   -12.943 33.087  1.00 53.42  ? 304 PRO B N   1 
ATOM   2743 C CA  . PRO B 1 99  ? 8.602   -14.164 33.903  1.00 53.32  ? 304 PRO B CA  1 
ATOM   2744 C C   . PRO B 1 99  ? 7.253   -14.510 34.480  1.00 52.40  ? 304 PRO B C   1 
ATOM   2745 O O   . PRO B 1 99  ? 6.744   -15.615 34.269  1.00 52.61  ? 304 PRO B O   1 
ATOM   2746 C CB  . PRO B 1 99  ? 9.654   -13.897 34.975  1.00 53.80  ? 304 PRO B CB  1 
ATOM   2747 C CG  . PRO B 1 99  ? 10.705  -13.177 34.184  1.00 53.23  ? 304 PRO B CG  1 
ATOM   2748 C CD  . PRO B 1 99  ? 9.874   -12.171 33.404  1.00 52.78  ? 304 PRO B CD  1 
ATOM   2749 N N   . SER B 1 100 ? 6.677   -13.570 35.223  1.00 50.64  ? 305 SER B N   1 
ATOM   2750 C CA  . SER B 1 100 ? 5.371   -13.757 35.834  1.00 50.07  ? 305 SER B CA  1 
ATOM   2751 C C   . SER B 1 100 ? 4.275   -14.015 34.758  1.00 48.73  ? 305 SER B C   1 
ATOM   2752 O O   . SER B 1 100 ? 3.334   -14.764 34.992  1.00 48.72  ? 305 SER B O   1 
ATOM   2753 C CB  . SER B 1 100 ? 5.027   -12.535 36.686  1.00 50.30  ? 305 SER B CB  1 
ATOM   2754 O OG  . SER B 1 100 ? 5.273   -11.339 35.970  1.00 50.04  ? 305 SER B OG  1 
ATOM   2755 N N   . PHE B 1 101 ? 4.415   -13.398 33.592  1.00 47.95  ? 306 PHE B N   1 
ATOM   2756 C CA  . PHE B 1 101 ? 3.464   -13.608 32.506  1.00 47.58  ? 306 PHE B CA  1 
ATOM   2757 C C   . PHE B 1 101 ? 3.512   -15.101 32.005  1.00 48.25  ? 306 PHE B C   1 
ATOM   2758 O O   . PHE B 1 101 ? 2.468   -15.734 31.811  1.00 49.04  ? 306 PHE B O   1 
ATOM   2759 C CB  . PHE B 1 101 ? 3.776   -12.682 31.322  1.00 46.80  ? 306 PHE B CB  1 
ATOM   2760 C CG  . PHE B 1 101 ? 2.862   -12.886 30.151  1.00 45.84  ? 306 PHE B CG  1 
ATOM   2761 C CD1 . PHE B 1 101 ? 1.586   -12.349 30.151  1.00 44.79  ? 306 PHE B CD1 1 
ATOM   2762 C CD2 . PHE B 1 101 ? 3.252   -13.677 29.077  1.00 44.93  ? 306 PHE B CD2 1 
ATOM   2763 C CE1 . PHE B 1 101 ? 0.715   -12.599 29.106  1.00 43.24  ? 306 PHE B CE1 1 
ATOM   2764 C CE2 . PHE B 1 101 ? 2.384   -13.929 28.033  1.00 42.76  ? 306 PHE B CE2 1 
ATOM   2765 C CZ  . PHE B 1 101 ? 1.116   -13.391 28.050  1.00 42.51  ? 306 PHE B CZ  1 
ATOM   2766 N N   . SER B 1 102 ? 4.720   -15.624 31.801  1.00 46.59  ? 307 SER B N   1 
ATOM   2767 C CA  . SER B 1 102 ? 4.894   -16.992 31.336  1.00 45.48  ? 307 SER B CA  1 
ATOM   2768 C C   . SER B 1 102 ? 4.538   -18.022 32.347  1.00 45.73  ? 307 SER B C   1 
ATOM   2769 O O   . SER B 1 102 ? 4.468   -19.210 32.027  1.00 48.48  ? 307 SER B O   1 
ATOM   2770 C CB  . SER B 1 102 ? 6.323   -17.206 30.870  1.00 46.25  ? 307 SER B CB  1 
ATOM   2771 O OG  . SER B 1 102 ? 6.574   -16.411 29.730  1.00 48.52  ? 307 SER B OG  1 
ATOM   2772 N N   . SER B 1 103 ? 4.319   -17.597 33.587  1.00 44.70  ? 308 SER B N   1 
ATOM   2773 C CA  . SER B 1 103 ? 3.919   -18.520 34.641  1.00 43.51  ? 308 SER B CA  1 
ATOM   2774 C C   . SER B 1 103 ? 2.441   -18.762 34.495  1.00 43.64  ? 308 SER B C   1 
ATOM   2775 O O   . SER B 1 103 ? 1.919   -19.737 35.016  1.00 45.69  ? 308 SER B O   1 
ATOM   2776 C CB  . SER B 1 103 ? 4.192   -17.935 36.028  1.00 43.80  ? 308 SER B CB  1 
ATOM   2777 O OG  . SER B 1 103 ? 3.096   -17.162 36.490  1.00 41.91  ? 308 SER B OG  1 
ATOM   2778 N N   . LEU B 1 104 ? 1.749   -17.862 33.800  1.00 42.73  ? 309 LEU B N   1 
ATOM   2779 C CA  . LEU B 1 104 ? 0.319   -18.008 33.566  1.00 41.53  ? 309 LEU B CA  1 
ATOM   2780 C C   . LEU B 1 104 ? 0.093   -19.201 32.623  1.00 42.26  ? 309 LEU B C   1 
ATOM   2781 O O   . LEU B 1 104 ? 0.970   -19.568 31.834  1.00 40.43  ? 309 LEU B O   1 
ATOM   2782 C CB  . LEU B 1 104 ? -0.243  -16.738 32.917  1.00 39.90  ? 309 LEU B CB  1 
ATOM   2783 C CG  . LEU B 1 104 ? -0.352  -15.469 33.765  1.00 40.15  ? 309 LEU B CG  1 
ATOM   2784 C CD1 . LEU B 1 104 ? -0.853  -14.318 32.913  1.00 36.78  ? 309 LEU B CD1 1 
ATOM   2785 C CD2 . LEU B 1 104 ? -1.303  -15.706 34.923  1.00 39.67  ? 309 LEU B CD2 1 
ATOM   2786 N N   . PHE B 1 105 ? -1.079  -19.815 32.705  1.00 43.01  ? 310 PHE B N   1 
ATOM   2787 C CA  . PHE B 1 105 ? -1.349  -20.930 31.820  1.00 41.87  ? 310 PHE B CA  1 
ATOM   2788 C C   . PHE B 1 105 ? -1.454  -20.424 30.456  1.00 41.58  ? 310 PHE B C   1 
ATOM   2789 O O   . PHE B 1 105 ? -1.990  -19.339 30.223  1.00 40.77  ? 310 PHE B O   1 
ATOM   2790 C CB  . PHE B 1 105 ? -2.613  -21.666 32.247  1.00 41.87  ? 310 PHE B CB  1 
ATOM   2791 C CG  . PHE B 1 105 ? -2.339  -22.807 33.177  1.00 42.86  ? 310 PHE B CG  1 
ATOM   2792 C CD1 . PHE B 1 105 ? -1.665  -23.933 32.721  1.00 43.13  ? 310 PHE B CD1 1 
ATOM   2793 C CD2 . PHE B 1 105 ? -2.696  -22.739 34.516  1.00 42.35  ? 310 PHE B CD2 1 
ATOM   2794 C CE1 . PHE B 1 105 ? -1.350  -24.965 33.582  1.00 42.08  ? 310 PHE B CE1 1 
ATOM   2795 C CE2 . PHE B 1 105 ? -2.383  -23.774 35.385  1.00 40.76  ? 310 PHE B CE2 1 
ATOM   2796 C CZ  . PHE B 1 105 ? -1.710  -24.884 34.917  1.00 41.20  ? 310 PHE B CZ  1 
ATOM   2797 N N   . LEU B 1 106 ? -0.912  -21.191 29.518  1.00 40.77  ? 311 LEU B N   1 
ATOM   2798 C CA  . LEU B 1 106 ? -0.900  -20.811 28.119  1.00 38.92  ? 311 LEU B CA  1 
ATOM   2799 C C   . LEU B 1 106 ? -2.235  -20.231 27.669  1.00 40.05  ? 311 LEU B C   1 
ATOM   2800 O O   . LEU B 1 106 ? -2.268  -19.213 26.972  1.00 39.92  ? 311 LEU B O   1 
ATOM   2801 C CB  . LEU B 1 106 ? -0.530  -22.020 27.263  1.00 38.47  ? 311 LEU B CB  1 
ATOM   2802 C CG  . LEU B 1 106 ? 0.280   -21.684 26.014  1.00 38.50  ? 311 LEU B CG  1 
ATOM   2803 C CD1 . LEU B 1 106 ? 1.493   -20.866 26.433  1.00 37.85  ? 311 LEU B CD1 1 
ATOM   2804 C CD2 . LEU B 1 106 ? 0.689   -22.951 25.293  1.00 36.13  ? 311 LEU B CD2 1 
ATOM   2805 N N   . ASN B 1 107 ? -3.334  -20.866 28.074  1.00 39.73  ? 312 ASN B N   1 
ATOM   2806 C CA  . ASN B 1 107 ? -4.668  -20.401 27.696  1.00 39.58  ? 312 ASN B CA  1 
ATOM   2807 C C   . ASN B 1 107 ? -4.948  -18.971 28.181  1.00 38.38  ? 312 ASN B C   1 
ATOM   2808 O O   . ASN B 1 107 ? -5.573  -18.192 27.473  1.00 39.52  ? 312 ASN B O   1 
ATOM   2809 C CB  . ASN B 1 107 ? -5.739  -21.361 28.223  1.00 38.95  ? 312 ASN B CB  1 
ATOM   2810 C CG  . ASN B 1 107 ? -5.822  -21.367 29.730  1.00 41.25  ? 312 ASN B CG  1 
ATOM   2811 O OD1 . ASN B 1 107 ? -4.802  -21.419 30.417  1.00 41.42  ? 312 ASN B OD1 1 
ATOM   2812 N ND2 . ASN B 1 107 ? -7.042  -21.322 30.257  1.00 42.95  ? 312 ASN B ND2 1 
ATOM   2813 N N   . ASP B 1 108 ? -4.496  -18.630 29.383  1.00 36.70  ? 313 ASP B N   1 
ATOM   2814 C CA  . ASP B 1 108 ? -4.690  -17.281 29.885  1.00 35.79  ? 313 ASP B CA  1 
ATOM   2815 C C   . ASP B 1 108 ? -3.773  -16.336 29.155  1.00 35.78  ? 313 ASP B C   1 
ATOM   2816 O O   . ASP B 1 108 ? -4.145  -15.201 28.876  1.00 36.71  ? 313 ASP B O   1 
ATOM   2817 C CB  . ASP B 1 108 ? -4.448  -17.208 31.394  1.00 34.33  ? 313 ASP B CB  1 
ATOM   2818 C CG  . ASP B 1 108 ? -5.699  -17.506 32.183  1.00 35.98  ? 313 ASP B CG  1 
ATOM   2819 O OD1 . ASP B 1 108 ? -6.762  -17.639 31.553  1.00 36.24  ? 313 ASP B OD1 1 
ATOM   2820 O OD2 . ASP B 1 108 ? -5.637  -17.603 33.421  1.00 38.97  ? 313 ASP B OD2 1 
ATOM   2821 N N   . GLN B 1 109 ? -2.565  -16.793 28.839  1.00 35.18  ? 314 GLN B N   1 
ATOM   2822 C CA  . GLN B 1 109 ? -1.623  -15.971 28.088  1.00 34.72  ? 314 GLN B CA  1 
ATOM   2823 C C   . GLN B 1 109 ? -2.326  -15.482 26.766  1.00 32.87  ? 314 GLN B C   1 
ATOM   2824 O O   . GLN B 1 109 ? -2.279  -14.304 26.414  1.00 32.46  ? 314 GLN B O   1 
ATOM   2825 C CB  . GLN B 1 109 ? -0.375  -16.789 27.735  1.00 35.07  ? 314 GLN B CB  1 
ATOM   2826 C CG  . GLN B 1 109 ? 0.663   -16.869 28.851  1.00 36.98  ? 314 GLN B CG  1 
ATOM   2827 C CD  . GLN B 1 109 ? 1.810   -17.823 28.529  1.00 39.12  ? 314 GLN B CD  1 
ATOM   2828 O OE1 . GLN B 1 109 ? 2.424   -17.747 27.463  1.00 39.65  ? 314 GLN B OE1 1 
ATOM   2829 N NE2 . GLN B 1 109 ? 2.107   -18.724 29.462  1.00 39.22  ? 314 GLN B NE2 1 
ATOM   2830 N N   . VAL B 1 110 ? -2.977  -16.415 26.082  1.00 30.06  ? 315 VAL B N   1 
ATOM   2831 C CA  . VAL B 1 110 ? -3.682  -16.137 24.838  1.00 28.78  ? 315 VAL B CA  1 
ATOM   2832 C C   . VAL B 1 110 ? -4.856  -15.213 25.049  1.00 28.15  ? 315 VAL B C   1 
ATOM   2833 O O   . VAL B 1 110 ? -5.184  -14.415 24.184  1.00 27.56  ? 315 VAL B O   1 
ATOM   2834 C CB  . VAL B 1 110 ? -4.145  -17.468 24.166  1.00 28.28  ? 315 VAL B CB  1 
ATOM   2835 C CG1 . VAL B 1 110 ? -5.168  -17.200 23.089  1.00 25.46  ? 315 VAL B CG1 1 
ATOM   2836 C CG2 . VAL B 1 110 ? -2.936  -18.191 23.580  1.00 25.03  ? 315 VAL B CG2 1 
ATOM   2837 N N   . THR B 1 111 ? -5.504  -15.305 26.198  1.00 28.45  ? 316 THR B N   1 
ATOM   2838 C CA  . THR B 1 111 ? -6.616  -14.416 26.451  1.00 31.74  ? 316 THR B CA  1 
ATOM   2839 C C   . THR B 1 111 ? -6.090  -12.998 26.664  1.00 33.73  ? 316 THR B C   1 
ATOM   2840 O O   . THR B 1 111 ? -6.721  -12.028 26.245  1.00 36.14  ? 316 THR B O   1 
ATOM   2841 C CB  . THR B 1 111 ? -7.419  -14.851 27.676  1.00 33.02  ? 316 THR B CB  1 
ATOM   2842 O OG1 . THR B 1 111 ? -8.159  -16.033 27.356  1.00 34.05  ? 316 THR B OG1 1 
ATOM   2843 C CG2 . THR B 1 111 ? -8.388  -13.759 28.093  1.00 33.29  ? 316 THR B CG2 1 
ATOM   2844 N N   . LEU B 1 112 ? -4.933  -12.867 27.302  1.00 31.98  ? 317 LEU B N   1 
ATOM   2845 C CA  . LEU B 1 112 ? -4.381  -11.543 27.518  1.00 31.67  ? 317 LEU B CA  1 
ATOM   2846 C C   . LEU B 1 112 ? -3.978  -10.909 26.205  1.00 32.90  ? 317 LEU B C   1 
ATOM   2847 O O   . LEU B 1 112 ? -4.300  -9.753  25.954  1.00 34.44  ? 317 LEU B O   1 
ATOM   2848 C CB  . LEU B 1 112 ? -3.186  -11.602 28.473  1.00 29.24  ? 317 LEU B CB  1 
ATOM   2849 C CG  . LEU B 1 112 ? -3.596  -11.818 29.930  1.00 27.73  ? 317 LEU B CG  1 
ATOM   2850 C CD1 . LEU B 1 112 ? -2.398  -11.739 30.821  1.00 26.04  ? 317 LEU B CD1 1 
ATOM   2851 C CD2 . LEU B 1 112 ? -4.607  -10.758 30.325  1.00 27.59  ? 317 LEU B CD2 1 
ATOM   2852 N N   . LEU B 1 113 ? -3.285  -11.663 25.358  1.00 31.80  ? 318 LEU B N   1 
ATOM   2853 C CA  . LEU B 1 113 ? -2.841  -11.150 24.065  1.00 32.41  ? 318 LEU B CA  1 
ATOM   2854 C C   . LEU B 1 113 ? -3.997  -10.839 23.110  1.00 35.14  ? 318 LEU B C   1 
ATOM   2855 O O   . LEU B 1 113 ? -3.973  -9.828  22.402  1.00 34.89  ? 318 LEU B O   1 
ATOM   2856 C CB  . LEU B 1 113 ? -1.887  -12.146 23.400  1.00 29.87  ? 318 LEU B CB  1 
ATOM   2857 C CG  . LEU B 1 113 ? -0.540  -12.324 24.093  1.00 26.46  ? 318 LEU B CG  1 
ATOM   2858 C CD1 . LEU B 1 113 ? 0.338   -13.263 23.318  1.00 26.78  ? 318 LEU B CD1 1 
ATOM   2859 C CD2 . LEU B 1 113 ? 0.123   -10.984 24.204  1.00 25.52  ? 318 LEU B CD2 1 
ATOM   2860 N N   . LYS B 1 114 ? -5.003  -11.715 23.099  1.00 36.73  ? 319 LYS B N   1 
ATOM   2861 C CA  . LYS B 1 114 ? -6.175  -11.552 22.242  1.00 36.03  ? 319 LYS B CA  1 
ATOM   2862 C C   . LYS B 1 114 ? -6.855  -10.221 22.470  1.00 35.07  ? 319 LYS B C   1 
ATOM   2863 O O   . LYS B 1 114 ? -7.104  -9.467  21.532  1.00 34.84  ? 319 LYS B O   1 
ATOM   2864 C CB  . LYS B 1 114 ? -7.175  -12.680 22.508  1.00 36.62  ? 319 LYS B CB  1 
ATOM   2865 C CG  . LYS B 1 114 ? -8.517  -12.576 21.744  1.00 37.50  ? 319 LYS B CG  1 
ATOM   2866 C CD  . LYS B 1 114 ? -9.473  -13.690 22.234  1.00 41.59  ? 319 LYS B CD  1 
ATOM   2867 C CE  . LYS B 1 114 ? -10.700 -13.917 21.312  1.00 42.15  ? 319 LYS B CE  1 
ATOM   2868 N NZ  . LYS B 1 114 ? -11.737 -12.869 21.442  1.00 43.76  ? 319 LYS B NZ  1 
ATOM   2869 N N   . TYR B 1 115 ? -7.141  -9.925  23.729  1.00 33.22  ? 320 TYR B N   1 
ATOM   2870 C CA  . TYR B 1 115 ? -7.825  -8.694  24.087  1.00 34.48  ? 320 TYR B CA  1 
ATOM   2871 C C   . TYR B 1 115 ? -6.920  -7.481  24.401  1.00 32.62  ? 320 TYR B C   1 
ATOM   2872 O O   . TYR B 1 115 ? -7.419  -6.381  24.617  1.00 30.68  ? 320 TYR B O   1 
ATOM   2873 C CB  . TYR B 1 115 ? -8.731  -8.966  25.288  1.00 38.16  ? 320 TYR B CB  1 
ATOM   2874 C CG  . TYR B 1 115 ? -9.800  -9.998  25.031  1.00 43.39  ? 320 TYR B CG  1 
ATOM   2875 C CD1 . TYR B 1 115 ? -10.940 -9.675  24.304  1.00 46.14  ? 320 TYR B CD1 1 
ATOM   2876 C CD2 . TYR B 1 115 ? -9.666  -11.299 25.501  1.00 44.08  ? 320 TYR B CD2 1 
ATOM   2877 C CE1 . TYR B 1 115 ? -11.917 -10.611 24.052  1.00 47.47  ? 320 TYR B CE1 1 
ATOM   2878 C CE2 . TYR B 1 115 ? -10.636 -12.245 25.251  1.00 48.26  ? 320 TYR B CE2 1 
ATOM   2879 C CZ  . TYR B 1 115 ? -11.763 -11.894 24.524  1.00 50.02  ? 320 TYR B CZ  1 
ATOM   2880 O OH  . TYR B 1 115 ? -12.735 -12.835 24.250  1.00 53.77  ? 320 TYR B OH  1 
ATOM   2881 N N   . GLY B 1 116 ? -5.608  -7.671  24.413  1.00 32.16  ? 321 GLY B N   1 
ATOM   2882 C CA  . GLY B 1 116 ? -4.742  -6.553  24.743  1.00 32.18  ? 321 GLY B CA  1 
ATOM   2883 C C   . GLY B 1 116 ? -3.856  -5.997  23.644  1.00 32.56  ? 321 GLY B C   1 
ATOM   2884 O O   . GLY B 1 116 ? -3.523  -4.813  23.656  1.00 31.00  ? 321 GLY B O   1 
ATOM   2885 N N   . VAL B 1 117 ? -3.483  -6.822  22.676  1.00 31.22  ? 322 VAL B N   1 
ATOM   2886 C CA  . VAL B 1 117 ? -2.594  -6.332  21.648  1.00 32.20  ? 322 VAL B CA  1 
ATOM   2887 C C   . VAL B 1 117 ? -3.024  -5.123  20.914  1.00 32.50  ? 322 VAL B C   1 
ATOM   2888 O O   . VAL B 1 117 ? -2.195  -4.290  20.600  1.00 35.33  ? 322 VAL B O   1 
ATOM   2889 C CB  . VAL B 1 117 ? -2.205  -7.441  20.642  1.00 32.08  ? 322 VAL B CB  1 
ATOM   2890 C CG1 . VAL B 1 117 ? -1.443  -8.519  21.377  1.00 31.09  ? 322 VAL B CG1 1 
ATOM   2891 C CG2 . VAL B 1 117 ? -3.441  -8.011  19.942  1.00 31.68  ? 322 VAL B CG2 1 
ATOM   2892 N N   . HIS B 1 118 ? -4.300  -4.960  20.620  1.00 32.33  ? 323 HIS B N   1 
ATOM   2893 C CA  . HIS B 1 118 ? -4.662  -3.757  19.894  1.00 34.99  ? 323 HIS B CA  1 
ATOM   2894 C C   . HIS B 1 118 ? -4.506  -2.514  20.728  1.00 34.72  ? 323 HIS B C   1 
ATOM   2895 O O   . HIS B 1 118 ? -4.018  -1.498  20.249  1.00 32.47  ? 323 HIS B O   1 
ATOM   2896 C CB  . HIS B 1 118 ? -6.066  -3.876  19.315  1.00 36.93  ? 323 HIS B CB  1 
ATOM   2897 C CG  . HIS B 1 118 ? -6.103  -4.675  18.050  1.00 38.47  ? 323 HIS B CG  1 
ATOM   2898 N ND1 . HIS B 1 118 ? -6.231  -6.048  18.041  1.00 38.16  ? 323 HIS B ND1 1 
ATOM   2899 C CD2 . HIS B 1 118 ? -5.891  -4.309  16.764  1.00 37.01  ? 323 HIS B CD2 1 
ATOM   2900 C CE1 . HIS B 1 118 ? -6.089  -6.494  16.807  1.00 37.27  ? 323 HIS B CE1 1 
ATOM   2901 N NE2 . HIS B 1 118 ? -5.879  -5.459  16.013  1.00 38.09  ? 323 HIS B NE2 1 
ATOM   2902 N N   . GLU B 1 119 ? -4.911  -2.586  21.986  1.00 34.08  ? 324 GLU B N   1 
ATOM   2903 C CA  . GLU B 1 119 ? -4.740  -1.455  22.873  1.00 34.02  ? 324 GLU B CA  1 
ATOM   2904 C C   . GLU B 1 119 ? -3.239  -1.162  22.922  1.00 34.44  ? 324 GLU B C   1 
ATOM   2905 O O   . GLU B 1 119 ? -2.810  -0.006  22.889  1.00 34.49  ? 324 GLU B O   1 
ATOM   2906 C CB  . GLU B 1 119 ? -5.261  -1.804  24.261  1.00 34.36  ? 324 GLU B CB  1 
ATOM   2907 C CG  . GLU B 1 119 ? -6.764  -1.722  24.371  1.00 38.87  ? 324 GLU B CG  1 
ATOM   2908 C CD  . GLU B 1 119 ? -7.294  -2.282  25.677  1.00 41.56  ? 324 GLU B CD  1 
ATOM   2909 O OE1 . GLU B 1 119 ? -6.541  -2.290  26.677  1.00 38.01  ? 324 GLU B OE1 1 
ATOM   2910 O OE2 . GLU B 1 119 ? -8.476  -2.699  25.700  1.00 45.36  ? 324 GLU B OE2 1 
ATOM   2911 N N   . ALA B 1 120 ? -2.445  -2.223  22.991  1.00 32.07  ? 325 ALA B N   1 
ATOM   2912 C CA  . ALA B 1 120 ? -1.005  -2.083  23.027  1.00 33.10  ? 325 ALA B CA  1 
ATOM   2913 C C   . ALA B 1 120 ? -0.537  -1.375  21.768  1.00 34.10  ? 325 ALA B C   1 
ATOM   2914 O O   . ALA B 1 120 ? 0.050   -0.293  21.817  1.00 33.91  ? 325 ALA B O   1 
ATOM   2915 C CB  . ALA B 1 120 ? -0.357  -3.453  23.118  1.00 32.35  ? 325 ALA B CB  1 
ATOM   2916 N N   . ILE B 1 121 ? -0.804  -2.013  20.638  1.00 32.58  ? 326 ILE B N   1 
ATOM   2917 C CA  . ILE B 1 121 ? -0.437  -1.519  19.330  1.00 31.66  ? 326 ILE B CA  1 
ATOM   2918 C C   . ILE B 1 121 ? -0.713  -0.057  19.113  1.00 32.73  ? 326 ILE B C   1 
ATOM   2919 O O   . ILE B 1 121 ? 0.138   0.667   18.612  1.00 34.51  ? 326 ILE B O   1 
ATOM   2920 C CB  . ILE B 1 121 ? -1.145  -2.353  18.259  1.00 30.45  ? 326 ILE B CB  1 
ATOM   2921 C CG1 . ILE B 1 121 ? -0.496  -3.733  18.202  1.00 32.03  ? 326 ILE B CG1 1 
ATOM   2922 C CG2 . ILE B 1 121 ? -1.084  -1.683  16.929  1.00 28.76  ? 326 ILE B CG2 1 
ATOM   2923 C CD1 . ILE B 1 121 ? -1.117  -4.651  17.194  1.00 35.21  ? 326 ILE B CD1 1 
ATOM   2924 N N   . PHE B 1 122 ? -1.889  0.411   19.502  1.00 31.95  ? 327 PHE B N   1 
ATOM   2925 C CA  . PHE B 1 122 ? -2.214  1.809   19.296  1.00 31.48  ? 327 PHE B CA  1 
ATOM   2926 C C   . PHE B 1 122 ? -1.503  2.754   20.190  1.00 33.44  ? 327 PHE B C   1 
ATOM   2927 O O   . PHE B 1 122 ? -1.450  3.951   19.922  1.00 35.25  ? 327 PHE B O   1 
ATOM   2928 C CB  . PHE B 1 122 ? -3.722  2.004   19.374  1.00 28.61  ? 327 PHE B CB  1 
ATOM   2929 C CG  . PHE B 1 122 ? -4.452  1.314   18.272  1.00 25.88  ? 327 PHE B CG  1 
ATOM   2930 C CD1 . PHE B 1 122 ? -3.955  1.354   16.984  1.00 25.42  ? 327 PHE B CD1 1 
ATOM   2931 C CD2 . PHE B 1 122 ? -5.613  0.616   18.512  1.00 24.87  ? 327 PHE B CD2 1 
ATOM   2932 C CE1 . PHE B 1 122 ? -4.602  0.708   15.957  1.00 26.53  ? 327 PHE B CE1 1 
ATOM   2933 C CE2 . PHE B 1 122 ? -6.265  -0.032  17.489  1.00 24.44  ? 327 PHE B CE2 1 
ATOM   2934 C CZ  . PHE B 1 122 ? -5.758  0.013   16.210  1.00 26.66  ? 327 PHE B CZ  1 
ATOM   2935 N N   . ALA B 1 123 ? -0.943  2.239   21.274  1.00 35.66  ? 328 ALA B N   1 
ATOM   2936 C CA  . ALA B 1 123 ? -0.176  3.063   22.195  1.00 34.78  ? 328 ALA B CA  1 
ATOM   2937 C C   . ALA B 1 123 ? 1.191   3.294   21.536  1.00 36.34  ? 328 ALA B C   1 
ATOM   2938 O O   . ALA B 1 123 ? 1.692   4.418   21.511  1.00 37.39  ? 328 ALA B O   1 
ATOM   2939 C CB  . ALA B 1 123 ? -0.007  2.346   23.512  1.00 33.62  ? 328 ALA B CB  1 
ATOM   2940 N N   . MET B 1 124 ? 1.770   2.218   20.999  1.00 36.42  ? 329 MET B N   1 
ATOM   2941 C CA  . MET B 1 124 ? 3.063   2.250   20.314  1.00 37.22  ? 329 MET B CA  1 
ATOM   2942 C C   . MET B 1 124 ? 2.987   2.995   18.969  1.00 37.95  ? 329 MET B C   1 
ATOM   2943 O O   . MET B 1 124 ? 3.975   3.550   18.493  1.00 38.11  ? 329 MET B O   1 
ATOM   2944 C CB  . MET B 1 124 ? 3.548   0.826   20.051  1.00 38.82  ? 329 MET B CB  1 
ATOM   2945 C CG  . MET B 1 124 ? 3.514   -0.064  21.280  1.00 41.42  ? 329 MET B CG  1 
ATOM   2946 S SD  . MET B 1 124 ? 4.173   -1.693  20.933  1.00 46.07  ? 329 MET B SD  1 
ATOM   2947 C CE  . MET B 1 124 ? 5.925   -1.327  20.838  1.00 45.43  ? 329 MET B CE  1 
ATOM   2948 N N   . LEU B 1 125 ? 1.814   2.986   18.349  1.00 36.76  ? 330 LEU B N   1 
ATOM   2949 C CA  . LEU B 1 125 ? 1.646   3.668   17.086  1.00 35.93  ? 330 LEU B CA  1 
ATOM   2950 C C   . LEU B 1 125 ? 2.105   5.115   17.213  1.00 37.04  ? 330 LEU B C   1 
ATOM   2951 O O   . LEU B 1 125 ? 2.675   5.680   16.277  1.00 37.29  ? 330 LEU B O   1 
ATOM   2952 C CB  . LEU B 1 125 ? 0.181   3.621   16.661  1.00 34.07  ? 330 LEU B CB  1 
ATOM   2953 C CG  . LEU B 1 125 ? -0.110  4.232   15.293  1.00 32.14  ? 330 LEU B CG  1 
ATOM   2954 C CD1 . LEU B 1 125 ? 0.853   3.664   14.259  1.00 31.72  ? 330 LEU B CD1 1 
ATOM   2955 C CD2 . LEU B 1 125 ? -1.539  3.945   14.911  1.00 31.45  ? 330 LEU B CD2 1 
ATOM   2956 N N   . ALA B 1 126 ? 1.860   5.710   18.375  1.00 37.34  ? 331 ALA B N   1 
ATOM   2957 C CA  . ALA B 1 126 ? 2.246   7.094   18.627  1.00 39.97  ? 331 ALA B CA  1 
ATOM   2958 C C   . ALA B 1 126 ? 3.752   7.329   18.572  1.00 41.71  ? 331 ALA B C   1 
ATOM   2959 O O   . ALA B 1 126 ? 4.198   8.444   18.340  1.00 43.99  ? 331 ALA B O   1 
ATOM   2960 C CB  . ALA B 1 126 ? 1.695   7.550   19.974  1.00 39.31  ? 331 ALA B CB  1 
ATOM   2961 N N   . SER B 1 127 ? 4.546   6.286   18.773  1.00 43.52  ? 332 SER B N   1 
ATOM   2962 C CA  . SER B 1 127 ? 5.997   6.433   18.737  1.00 44.32  ? 332 SER B CA  1 
ATOM   2963 C C   . SER B 1 127 ? 6.556   6.674   17.315  1.00 44.95  ? 332 SER B C   1 
ATOM   2964 O O   . SER B 1 127 ? 7.660   7.201   17.158  1.00 47.58  ? 332 SER B O   1 
ATOM   2965 C CB  . SER B 1 127 ? 6.651   5.200   19.349  1.00 43.56  ? 332 SER B CB  1 
ATOM   2966 O OG  . SER B 1 127 ? 6.019   4.888   20.575  1.00 46.55  ? 332 SER B OG  1 
ATOM   2967 N N   . ILE B 1 128 ? 5.802   6.295   16.291  1.00 43.49  ? 333 ILE B N   1 
ATOM   2968 C CA  . ILE B 1 128 ? 6.254   6.497   14.914  1.00 44.11  ? 333 ILE B CA  1 
ATOM   2969 C C   . ILE B 1 128 ? 5.380   7.511   14.182  1.00 43.96  ? 333 ILE B C   1 
ATOM   2970 O O   . ILE B 1 128 ? 5.413   7.601   12.958  1.00 43.00  ? 333 ILE B O   1 
ATOM   2971 C CB  . ILE B 1 128 ? 6.204   5.191   14.132  1.00 42.82  ? 333 ILE B CB  1 
ATOM   2972 C CG1 . ILE B 1 128 ? 4.742   4.743   13.982  1.00 42.39  ? 333 ILE B CG1 1 
ATOM   2973 C CG2 . ILE B 1 128 ? 7.041   4.142   14.850  1.00 44.09  ? 333 ILE B CG2 1 
ATOM   2974 C CD1 . ILE B 1 128 ? 4.548   3.414   13.244  1.00 39.47  ? 333 ILE B CD1 1 
ATOM   2975 N N   . VAL B 1 129 ? 4.628   8.290   14.946  1.00 44.03  ? 334 VAL B N   1 
ATOM   2976 C CA  . VAL B 1 129 ? 3.697   9.259   14.395  1.00 46.23  ? 334 VAL B CA  1 
ATOM   2977 C C   . VAL B 1 129 ? 3.987   10.719  14.769  1.00 47.61  ? 334 VAL B C   1 
ATOM   2978 O O   . VAL B 1 129 ? 4.591   10.998  15.800  1.00 48.15  ? 334 VAL B O   1 
ATOM   2979 C CB  . VAL B 1 129 ? 2.248   8.887   14.873  1.00 45.61  ? 334 VAL B CB  1 
ATOM   2980 C CG1 . VAL B 1 129 ? 1.312   10.068  14.792  1.00 45.27  ? 334 VAL B CG1 1 
ATOM   2981 C CG2 . VAL B 1 129 ? 1.706   7.751   14.036  1.00 48.63  ? 334 VAL B CG2 1 
ATOM   2982 N N   . ASN B 1 130 ? 3.585   11.637  13.893  1.00 48.73  ? 335 ASN B N   1 
ATOM   2983 C CA  . ASN B 1 130 ? 3.688   13.066  14.158  1.00 50.22  ? 335 ASN B CA  1 
ATOM   2984 C C   . ASN B 1 130 ? 2.422   13.677  13.562  1.00 51.84  ? 335 ASN B C   1 
ATOM   2985 O O   . ASN B 1 130 ? 1.608   12.975  12.963  1.00 53.26  ? 335 ASN B O   1 
ATOM   2986 C CB  . ASN B 1 130 ? 4.950   13.695  13.554  1.00 48.57  ? 335 ASN B CB  1 
ATOM   2987 C CG  . ASN B 1 130 ? 4.914   13.768  12.048  1.00 48.41  ? 335 ASN B CG  1 
ATOM   2988 O OD1 . ASN B 1 130 ? 3.925   14.198  11.456  1.00 45.28  ? 335 ASN B OD1 1 
ATOM   2989 N ND2 . ASN B 1 130 ? 6.014   13.366  11.414  1.00 48.89  ? 335 ASN B ND2 1 
ATOM   2990 N N   . LYS B 1 131 ? 2.241   14.976  13.730  1.00 54.29  ? 336 LYS B N   1 
ATOM   2991 C CA  . LYS B 1 131 ? 1.045   15.632  13.219  1.00 56.23  ? 336 LYS B CA  1 
ATOM   2992 C C   . LYS B 1 131 ? 0.673   15.281  11.752  1.00 56.00  ? 336 LYS B C   1 
ATOM   2993 O O   . LYS B 1 131 ? -0.503  15.111  11.434  1.00 56.10  ? 336 LYS B O   1 
ATOM   2994 C CB  . LYS B 1 131 ? 1.187   17.156  13.377  1.00 57.00  ? 336 LYS B CB  1 
ATOM   2995 N N   . ASP B 1 132 ? 1.675   15.155  10.889  1.00 56.17  ? 337 ASP B N   1 
ATOM   2996 C CA  . ASP B 1 132 ? 1.444   14.884  9.473   1.00 57.80  ? 337 ASP B CA  1 
ATOM   2997 C C   . ASP B 1 132 ? 1.465   13.453  8.930   1.00 57.77  ? 337 ASP B C   1 
ATOM   2998 O O   . ASP B 1 132 ? 0.966   13.212  7.830   1.00 59.17  ? 337 ASP B O   1 
ATOM   2999 C CB  . ASP B 1 132 ? 2.404   15.726  8.633   1.00 57.80  ? 337 ASP B CB  1 
ATOM   3000 C CG  . ASP B 1 132 ? 2.194   17.201  8.830   1.00 59.43  ? 337 ASP B CG  1 
ATOM   3001 O OD1 . ASP B 1 132 ? 1.025   17.651  8.755   1.00 59.48  ? 337 ASP B OD1 1 
ATOM   3002 O OD2 . ASP B 1 132 ? 3.198   17.907  9.058   1.00 59.55  ? 337 ASP B OD2 1 
ATOM   3003 N N   . GLY B 1 133 ? 2.039   12.508  9.658   1.00 56.67  ? 338 GLY B N   1 
ATOM   3004 C CA  . GLY B 1 133 ? 2.066   11.152  9.139   1.00 53.36  ? 338 GLY B CA  1 
ATOM   3005 C C   . GLY B 1 133 ? 2.734   10.165  10.062  1.00 51.17  ? 338 GLY B C   1 
ATOM   3006 O O   . GLY B 1 133 ? 2.873   10.412  11.260  1.00 50.76  ? 338 GLY B O   1 
ATOM   3007 N N   . LEU B 1 134 ? 3.156   9.041   9.498   1.00 48.79  ? 339 LEU B N   1 
ATOM   3008 C CA  . LEU B 1 134 ? 3.798   8.008   10.285  1.00 48.54  ? 339 LEU B CA  1 
ATOM   3009 C C   . LEU B 1 134 ? 4.732   7.253   9.505   1.00 48.41  ? 339 LEU B C   1 
ATOM   3010 O O   . LEU B 1 134 ? 4.595   7.147   8.290   1.00 49.87  ? 339 LEU B O   1 
ATOM   3011 C CB  . LEU B 1 134 ? 2.742   7.078   10.884  1.00 49.28  ? 339 LEU B CB  1 
ATOM   3012 C CG  . LEU B 1 134 ? 1.811   6.356   9.913   1.00 48.33  ? 339 LEU B CG  1 
ATOM   3013 C CD1 . LEU B 1 134 ? 2.370   4.983   9.623   1.00 47.75  ? 339 LEU B CD1 1 
ATOM   3014 C CD2 . LEU B 1 134 ? 0.424   6.237   10.527  1.00 47.85  ? 339 LEU B CD2 1 
ATOM   3015 N N   . LEU B 1 135 ? 5.724   6.694   10.186  1.00 48.79  ? 340 LEU B N   1 
ATOM   3016 C CA  . LEU B 1 135 ? 6.766   5.894   9.555   1.00 49.30  ? 340 LEU B CA  1 
ATOM   3017 C C   . LEU B 1 135 ? 6.273   4.563   9.155   1.00 48.50  ? 340 LEU B C   1 
ATOM   3018 O O   . LEU B 1 135 ? 5.386   4.006   9.789   1.00 49.20  ? 340 LEU B O   1 
ATOM   3019 C CB  . LEU B 1 135 ? 7.934   5.693   10.522  1.00 51.58  ? 340 LEU B CB  1 
ATOM   3020 C CG  . LEU B 1 135 ? 8.740   6.890   11.032  1.00 53.24  ? 340 LEU B CG  1 
ATOM   3021 C CD1 . LEU B 1 135 ? 9.562   6.476   12.248  1.00 51.75  ? 340 LEU B CD1 1 
ATOM   3022 C CD2 . LEU B 1 135 ? 9.638   7.409   9.917   1.00 54.29  ? 340 LEU B CD2 1 
ATOM   3023 N N   . VAL B 1 136 ? 6.855   4.023   8.094   1.00 48.73  ? 341 VAL B N   1 
ATOM   3024 C CA  . VAL B 1 136 ? 6.503   2.694   7.612   1.00 49.33  ? 341 VAL B CA  1 
ATOM   3025 C C   . VAL B 1 136 ? 7.765   2.049   7.084   1.00 49.31  ? 341 VAL B C   1 
ATOM   3026 O O   . VAL B 1 136 ? 8.799   2.702   6.960   1.00 47.56  ? 341 VAL B O   1 
ATOM   3027 C CB  . VAL B 1 136 ? 5.450   2.735   6.468   1.00 49.69  ? 341 VAL B CB  1 
ATOM   3028 C CG1 . VAL B 1 136 ? 4.237   3.538   6.904   1.00 49.49  ? 341 VAL B CG1 1 
ATOM   3029 C CG2 . VAL B 1 136 ? 6.072   3.312   5.192   1.00 49.73  ? 341 VAL B CG2 1 
ATOM   3030 N N   . ALA B 1 137 ? 7.689   0.762   6.777   1.00 50.78  ? 342 ALA B N   1 
ATOM   3031 C CA  . ALA B 1 137 ? 8.841   0.061   6.244   1.00 53.85  ? 342 ALA B CA  1 
ATOM   3032 C C   . ALA B 1 137 ? 10.071  0.372   7.069   1.00 56.02  ? 342 ALA B C   1 
ATOM   3033 O O   . ALA B 1 137 ? 11.018  0.992   6.587   1.00 56.95  ? 342 ALA B O   1 
ATOM   3034 C CB  . ALA B 1 137 ? 9.067   0.468   4.795   1.00 53.63  ? 342 ALA B CB  1 
ATOM   3035 N N   . ASN B 1 138 ? 10.044  -0.056  8.324   1.00 57.98  ? 343 ASN B N   1 
ATOM   3036 C CA  . ASN B 1 138 ? 11.146  0.140   9.261   1.00 59.60  ? 343 ASN B CA  1 
ATOM   3037 C C   . ASN B 1 138 ? 11.929  1.515   9.142   1.00 58.68  ? 343 ASN B C   1 
ATOM   3038 O O   . ASN B 1 138 ? 13.159  1.547   9.202   1.00 59.01  ? 343 ASN B O   1 
ATOM   3039 C CB  . ASN B 1 138 ? 12.117  -1.045  9.146   1.00 61.68  ? 343 ASN B CB  1 
ATOM   3040 C CG  . ASN B 1 138 ? 13.234  -0.984  10.167  1.00 65.15  ? 343 ASN B CG  1 
ATOM   3041 O OD1 . ASN B 1 138 ? 14.343  -0.530  9.870   1.00 67.26  ? 343 ASN B OD1 1 
ATOM   3042 N ND2 . ASN B 1 138 ? 12.943  -1.427  11.387  1.00 66.63  ? 343 ASN B ND2 1 
ATOM   3043 N N   . GLY B 1 139 ? 11.193  2.615   8.994   1.00 57.52  ? 344 GLY B N   1 
ATOM   3044 C CA  . GLY B 1 139 ? 11.829  3.919   8.893   1.00 56.08  ? 344 GLY B CA  1 
ATOM   3045 C C   . GLY B 1 139 ? 12.067  4.457   7.489   1.00 55.51  ? 344 GLY B C   1 
ATOM   3046 O O   . GLY B 1 139 ? 11.943  5.664   7.258   1.00 56.42  ? 344 GLY B O   1 
ATOM   3047 N N   . SER B 1 140 ? 12.405  3.579   6.547   1.00 53.39  ? 345 SER B N   1 
ATOM   3048 C CA  . SER B 1 140 ? 12.666  3.995   5.169   1.00 52.37  ? 345 SER B CA  1 
ATOM   3049 C C   . SER B 1 140 ? 11.478  4.674   4.439   1.00 52.00  ? 345 SER B C   1 
ATOM   3050 O O   . SER B 1 140 ? 11.668  5.275   3.384   1.00 52.31  ? 345 SER B O   1 
ATOM   3051 C CB  . SER B 1 140 ? 13.153  2.803   4.345   1.00 50.67  ? 345 SER B CB  1 
ATOM   3052 O OG  . SER B 1 140 ? 12.315  1.680   4.525   1.00 49.78  ? 345 SER B OG  1 
ATOM   3053 N N   . GLY B 1 141 ? 10.274  4.570   4.996   1.00 50.79  ? 346 GLY B N   1 
ATOM   3054 C CA  . GLY B 1 141 ? 9.120   5.192   4.374   1.00 49.04  ? 346 GLY B CA  1 
ATOM   3055 C C   . GLY B 1 141 ? 8.349   6.059   5.352   1.00 48.73  ? 346 GLY B C   1 
ATOM   3056 O O   . GLY B 1 141 ? 8.542   5.952   6.562   1.00 48.42  ? 346 GLY B O   1 
ATOM   3057 N N   . PHE B 1 142 ? 7.483   6.923   4.829   1.00 47.91  ? 347 PHE B N   1 
ATOM   3058 C CA  . PHE B 1 142 ? 6.666   7.804   5.655   1.00 47.84  ? 347 PHE B CA  1 
ATOM   3059 C C   . PHE B 1 142 ? 5.426   8.181   4.909   1.00 48.38  ? 347 PHE B C   1 
ATOM   3060 O O   . PHE B 1 142 ? 5.452   9.047   4.040   1.00 48.42  ? 347 PHE B O   1 
ATOM   3061 C CB  . PHE B 1 142 ? 7.452   9.059   6.043   1.00 48.85  ? 347 PHE B CB  1 
ATOM   3062 C CG  . PHE B 1 142 ? 6.639   10.084  6.801   1.00 49.92  ? 347 PHE B CG  1 
ATOM   3063 C CD1 . PHE B 1 142 ? 5.935   11.073  6.129   1.00 50.28  ? 347 PHE B CD1 1 
ATOM   3064 C CD2 . PHE B 1 142 ? 6.577   10.056  8.188   1.00 50.74  ? 347 PHE B CD2 1 
ATOM   3065 C CE1 . PHE B 1 142 ? 5.181   12.021  6.827   1.00 51.16  ? 347 PHE B CE1 1 
ATOM   3066 C CE2 . PHE B 1 142 ? 5.822   11.002  8.893   1.00 52.19  ? 347 PHE B CE2 1 
ATOM   3067 C CZ  . PHE B 1 142 ? 5.125   11.984  8.207   1.00 51.39  ? 347 PHE B CZ  1 
ATOM   3068 N N   . VAL B 1 143 ? 4.321   7.528   5.252   1.00 48.76  ? 348 VAL B N   1 
ATOM   3069 C CA  . VAL B 1 143 ? 3.033   7.764   4.608   1.00 48.53  ? 348 VAL B CA  1 
ATOM   3070 C C   . VAL B 1 143 ? 2.373   8.915   5.243   1.00 47.34  ? 348 VAL B C   1 
ATOM   3071 O O   . VAL B 1 143 ? 2.333   9.002   6.457   1.00 47.77  ? 348 VAL B O   1 
ATOM   3072 C CB  . VAL B 1 143 ? 2.126   6.515   4.741   1.00 48.91  ? 348 VAL B CB  1 
ATOM   3073 C CG1 . VAL B 1 143 ? 0.832   6.716   3.995   1.00 47.13  ? 348 VAL B CG1 1 
ATOM   3074 C CG2 . VAL B 1 143 ? 2.857   5.292   4.208   1.00 50.38  ? 348 VAL B CG2 1 
ATOM   3075 N N   . THR B 1 144 ? 1.835   9.833   4.449   1.00 47.54  ? 349 THR B N   1 
ATOM   3076 C CA  . THR B 1 144 ? 1.183   10.997  5.035   1.00 48.13  ? 349 THR B CA  1 
ATOM   3077 C C   . THR B 1 144 ? -0.200  10.722  5.509   1.00 48.43  ? 349 THR B C   1 
ATOM   3078 O O   . THR B 1 144 ? -0.877  9.805   5.047   1.00 48.85  ? 349 THR B O   1 
ATOM   3079 C CB  . THR B 1 144 ? 1.120   12.213  4.062   1.00 47.59  ? 349 THR B CB  1 
ATOM   3080 O OG1 . THR B 1 144 ? -0.088  12.163  3.285   1.00 48.51  ? 349 THR B OG1 1 
ATOM   3081 C CG2 . THR B 1 144 ? 2.326   12.224  3.146   1.00 46.22  ? 349 THR B CG2 1 
ATOM   3082 N N   . ARG B 1 145 ? -0.627  11.542  6.454   1.00 48.82  ? 350 ARG B N   1 
ATOM   3083 C CA  . ARG B 1 145 ? -1.939  11.452  7.051   1.00 48.94  ? 350 ARG B CA  1 
ATOM   3084 C C   . ARG B 1 145 ? -2.961  11.860  6.046   1.00 49.62  ? 350 ARG B C   1 
ATOM   3085 O O   . ARG B 1 145 ? -4.024  11.261  5.966   1.00 50.18  ? 350 ARG B O   1 
ATOM   3086 C CB  . ARG B 1 145 ? -1.965  12.359  8.283   1.00 49.75  ? 350 ARG B CB  1 
ATOM   3087 C CG  . ARG B 1 145 ? -3.266  12.443  9.037   1.00 51.22  ? 350 ARG B CG  1 
ATOM   3088 C CD  . ARG B 1 145 ? -3.019  13.216  10.318  1.00 50.71  ? 350 ARG B CD  1 
ATOM   3089 N NE  . ARG B 1 145 ? -4.237  13.557  11.044  1.00 52.09  ? 350 ARG B NE  1 
ATOM   3090 C CZ  . ARG B 1 145 ? -4.234  14.022  12.291  1.00 52.79  ? 350 ARG B CZ  1 
ATOM   3091 N NH1 . ARG B 1 145 ? -3.081  14.185  12.924  1.00 51.87  ? 350 ARG B NH1 1 
ATOM   3092 N NH2 . ARG B 1 145 ? -5.368  14.336  12.903  1.00 51.32  ? 350 ARG B NH2 1 
ATOM   3093 N N   . GLU B 1 146 ? -2.647  12.879  5.249   1.00 51.91  ? 351 GLU B N   1 
ATOM   3094 C CA  . GLU B 1 146 ? -3.575  13.360  4.227   1.00 51.88  ? 351 GLU B CA  1 
ATOM   3095 C C   . GLU B 1 146 ? -3.846  12.261  3.216   1.00 50.97  ? 351 GLU B C   1 
ATOM   3096 O O   . GLU B 1 146 ? -4.979  12.078  2.769   1.00 49.54  ? 351 GLU B O   1 
ATOM   3097 C CB  . GLU B 1 146 ? -2.998  14.591  3.520   1.00 54.38  ? 351 GLU B CB  1 
ATOM   3098 C CG  . GLU B 1 146 ? -4.059  15.619  3.063   1.00 57.08  ? 351 GLU B CG  1 
ATOM   3099 C CD  . GLU B 1 146 ? -4.823  16.217  4.239   1.00 61.50  ? 351 GLU B CD  1 
ATOM   3100 O OE1 . GLU B 1 146 ? -4.158  16.637  5.212   1.00 62.01  ? 351 GLU B OE1 1 
ATOM   3101 O OE2 . GLU B 1 146 ? -6.079  16.272  4.197   1.00 62.51  ? 351 GLU B OE2 1 
ATOM   3102 N N   . PHE B 1 147 ? -2.799  11.526  2.849   1.00 50.42  ? 352 PHE B N   1 
ATOM   3103 C CA  . PHE B 1 147 ? -2.947  10.426  1.902   1.00 49.70  ? 352 PHE B CA  1 
ATOM   3104 C C   . PHE B 1 147 ? -3.900  9.387   2.428   1.00 50.08  ? 352 PHE B C   1 
ATOM   3105 O O   . PHE B 1 147 ? -4.845  9.003   1.749   1.00 51.63  ? 352 PHE B O   1 
ATOM   3106 C CB  . PHE B 1 147 ? -1.609  9.757   1.625   1.00 48.31  ? 352 PHE B CB  1 
ATOM   3107 C CG  . PHE B 1 147 ? -1.722  8.558   0.731   1.00 49.69  ? 352 PHE B CG  1 
ATOM   3108 C CD1 . PHE B 1 147 ? -2.376  8.653   -0.490  1.00 48.89  ? 352 PHE B CD1 1 
ATOM   3109 C CD2 . PHE B 1 147 ? -1.172  7.341   1.100   1.00 49.72  ? 352 PHE B CD2 1 
ATOM   3110 C CE1 . PHE B 1 147 ? -2.479  7.561   -1.325  1.00 48.43  ? 352 PHE B CE1 1 
ATOM   3111 C CE2 . PHE B 1 147 ? -1.271  6.242   0.269   1.00 49.11  ? 352 PHE B CE2 1 
ATOM   3112 C CZ  . PHE B 1 147 ? -1.926  6.353   -0.947  1.00 49.79  ? 352 PHE B CZ  1 
ATOM   3113 N N   . LEU B 1 148 ? -3.644  8.910   3.641   1.00 49.62  ? 353 LEU B N   1 
ATOM   3114 C CA  . LEU B 1 148 ? -4.498  7.914   4.268   1.00 49.18  ? 353 LEU B CA  1 
ATOM   3115 C C   . LEU B 1 148 ? -5.877  8.449   4.387   1.00 50.52  ? 353 LEU B C   1 
ATOM   3116 O O   . LEU B 1 148 ? -6.851  7.768   4.080   1.00 51.10  ? 353 LEU B O   1 
ATOM   3117 C CB  . LEU B 1 148 ? -3.968  7.567   5.656   1.00 45.93  ? 353 LEU B CB  1 
ATOM   3118 C CG  . LEU B 1 148 ? -2.625  6.856   5.658   1.00 41.62  ? 353 LEU B CG  1 
ATOM   3119 C CD1 . LEU B 1 148 ? -2.037  6.893   7.044   1.00 41.18  ? 353 LEU B CD1 1 
ATOM   3120 C CD2 . LEU B 1 148 ? -2.810  5.436   5.159   1.00 39.34  ? 353 LEU B CD2 1 
ATOM   3121 N N   . ARG B 1 149 ? -5.965  9.696   4.832   1.00 51.69  ? 354 ARG B N   1 
ATOM   3122 C CA  . ARG B 1 149 ? -7.227  10.397  5.019   1.00 53.89  ? 354 ARG B CA  1 
ATOM   3123 C C   . ARG B 1 149 ? -8.058  10.498  3.674   1.00 54.67  ? 354 ARG B C   1 
ATOM   3124 O O   . ARG B 1 149 ? -9.251  10.801  3.693   1.00 55.31  ? 354 ARG B O   1 
ATOM   3125 C CB  . ARG B 1 149 ? -6.909  11.797  5.561   1.00 55.58  ? 354 ARG B CB  1 
ATOM   3126 C CG  . ARG B 1 149 ? -8.058  12.553  6.206   1.00 60.51  ? 354 ARG B CG  1 
ATOM   3127 C CD  . ARG B 1 149 ? -7.491  13.689  7.069   1.00 63.94  ? 354 ARG B CD  1 
ATOM   3128 N NE  . ARG B 1 149 ? -8.525  14.466  7.748   1.00 69.49  ? 354 ARG B NE  1 
ATOM   3129 C CZ  . ARG B 1 149 ? -8.271  15.418  8.644   1.00 72.04  ? 354 ARG B CZ  1 
ATOM   3130 N NH1 . ARG B 1 149 ? -7.015  15.705  8.970   1.00 74.01  ? 354 ARG B NH1 1 
ATOM   3131 N NH2 . ARG B 1 149 ? -9.269  16.090  9.210   1.00 71.94  ? 354 ARG B NH2 1 
ATOM   3132 N N   . SER B 1 150 ? -7.401  10.225  2.548   1.00 54.18  ? 355 SER B N   1 
ATOM   3133 C CA  . SER B 1 150 ? -8.021  10.314  1.235   1.00 53.57  ? 355 SER B CA  1 
ATOM   3134 C C   . SER B 1 150 ? -8.401  8.999   0.587   1.00 54.50  ? 355 SER B C   1 
ATOM   3135 O O   . SER B 1 150 ? -8.749  8.971   -0.590  1.00 55.08  ? 355 SER B O   1 
ATOM   3136 C CB  . SER B 1 150 ? -7.083  11.045  0.286   1.00 54.21  ? 355 SER B CB  1 
ATOM   3137 O OG  . SER B 1 150 ? -6.066  10.168  -0.165  1.00 55.31  ? 355 SER B OG  1 
ATOM   3138 N N   . LEU B 1 151 ? -8.333  7.898   1.319   1.00 54.40  ? 356 LEU B N   1 
ATOM   3139 C CA  . LEU B 1 151 ? -8.689  6.621   0.719   1.00 54.13  ? 356 LEU B CA  1 
ATOM   3140 C C   . LEU B 1 151 ? -10.187 6.553   0.647   1.00 54.40  ? 356 LEU B C   1 
ATOM   3141 O O   . LEU B 1 151 ? -10.870 7.330   1.309   1.00 55.32  ? 356 LEU B O   1 
ATOM   3142 C CB  . LEU B 1 151 ? -8.115  5.481   1.558   1.00 53.78  ? 356 LEU B CB  1 
ATOM   3143 C CG  . LEU B 1 151 ? -6.616  5.676   1.824   1.00 53.86  ? 356 LEU B CG  1 
ATOM   3144 C CD1 . LEU B 1 151 ? -6.057  4.503   2.604   1.00 52.17  ? 356 LEU B CD1 1 
ATOM   3145 C CD2 . LEU B 1 151 ? -5.879  5.838   0.498   1.00 52.87  ? 356 LEU B CD2 1 
ATOM   3146 N N   . ARG B 1 152 ? -10.732 5.656   -0.164  1.00 53.90  ? 357 ARG B N   1 
ATOM   3147 C CA  . ARG B 1 152 ? -12.182 5.587   -0.248  1.00 54.42  ? 357 ARG B CA  1 
ATOM   3148 C C   . ARG B 1 152 ? -12.709 5.082   1.032   1.00 55.29  ? 357 ARG B C   1 
ATOM   3149 O O   . ARG B 1 152 ? -12.152 4.148   1.604   1.00 55.29  ? 357 ARG B O   1 
ATOM   3150 C CB  . ARG B 1 152 ? -12.640 4.668   -1.392  1.00 53.37  ? 357 ARG B CB  1 
ATOM   3151 C CG  . ARG B 1 152 ? -12.675 3.136   -1.080  1.00 50.33  ? 357 ARG B CG  1 
ATOM   3152 C CD  . ARG B 1 152 ? -13.449 2.403   -2.185  1.00 48.60  ? 357 ARG B CD  1 
ATOM   3153 N NE  . ARG B 1 152 ? -13.253 0.953   -2.209  1.00 47.03  ? 357 ARG B NE  1 
ATOM   3154 C CZ  . ARG B 1 152 ? -13.867 0.078   -1.414  1.00 47.29  ? 357 ARG B CZ  1 
ATOM   3155 N NH1 . ARG B 1 152 ? -14.741 0.483   -0.496  1.00 43.91  ? 357 ARG B NH1 1 
ATOM   3156 N NH2 . ARG B 1 152 ? -13.615 -1.217  -1.550  1.00 46.58  ? 357 ARG B NH2 1 
ATOM   3157 N N   . LYS B 1 153 ? -13.775 5.695   1.537   1.00 56.38  ? 358 LYS B N   1 
ATOM   3158 C CA  . LYS B 1 153 ? -14.359 5.206   2.779   1.00 56.92  ? 358 LYS B CA  1 
ATOM   3159 C C   . LYS B 1 153 ? -14.741 3.770   2.481   1.00 57.11  ? 358 LYS B C   1 
ATOM   3160 O O   . LYS B 1 153 ? -15.005 3.419   1.332   1.00 56.72  ? 358 LYS B O   1 
ATOM   3161 C CB  . LYS B 1 153 ? -15.600 6.020   3.175   1.00 56.48  ? 358 LYS B CB  1 
ATOM   3162 C CG  . LYS B 1 153 ? -15.292 7.328   3.939   1.00 57.48  ? 358 LYS B CG  1 
ATOM   3163 C CD  . LYS B 1 153 ? -16.527 7.838   4.730   1.00 58.77  ? 358 LYS B CD  1 
ATOM   3164 C CE  . LYS B 1 153 ? -16.167 9.058   5.643   1.00 61.51  ? 358 LYS B CE  1 
ATOM   3165 N NZ  . LYS B 1 153 ? -17.206 9.373   6.685   1.00 61.48  ? 358 LYS B NZ  1 
ATOM   3166 N N   . PRO B 1 154 ? -14.782 2.908   3.505   1.00 57.62  ? 359 PRO B N   1 
ATOM   3167 C CA  . PRO B 1 154 ? -14.526 3.131   4.930   1.00 58.15  ? 359 PRO B CA  1 
ATOM   3168 C C   . PRO B 1 154 ? -13.016 3.070   5.349   1.00 58.48  ? 359 PRO B C   1 
ATOM   3169 O O   . PRO B 1 154 ? -12.676 3.278   6.512   1.00 57.65  ? 359 PRO B O   1 
ATOM   3170 C CB  . PRO B 1 154 ? -15.324 2.015   5.574   1.00 58.29  ? 359 PRO B CB  1 
ATOM   3171 C CG  . PRO B 1 154 ? -15.020 0.877   4.641   1.00 58.75  ? 359 PRO B CG  1 
ATOM   3172 C CD  . PRO B 1 154 ? -15.176 1.508   3.264   1.00 57.72  ? 359 PRO B CD  1 
ATOM   3173 N N   . PHE B 1 155 ? -12.136 2.786   4.401   1.00 58.42  ? 360 PHE B N   1 
ATOM   3174 C CA  . PHE B 1 155 ? -10.718 2.693   4.715   1.00 59.24  ? 360 PHE B CA  1 
ATOM   3175 C C   . PHE B 1 155 ? -10.079 4.021   5.169   1.00 59.54  ? 360 PHE B C   1 
ATOM   3176 O O   . PHE B 1 155 ? -9.076  4.023   5.875   1.00 58.82  ? 360 PHE B O   1 
ATOM   3177 C CB  . PHE B 1 155 ? -9.981  2.115   3.508   1.00 58.69  ? 360 PHE B CB  1 
ATOM   3178 C CG  . PHE B 1 155 ? -10.471 0.752   3.114   1.00 58.85  ? 360 PHE B CG  1 
ATOM   3179 C CD1 . PHE B 1 155 ? -10.255 -0.340  3.942   1.00 58.36  ? 360 PHE B CD1 1 
ATOM   3180 C CD2 . PHE B 1 155 ? -11.182 0.567   1.943   1.00 59.26  ? 360 PHE B CD2 1 
ATOM   3181 C CE1 . PHE B 1 155 ? -10.740 -1.593  3.612   1.00 58.00  ? 360 PHE B CE1 1 
ATOM   3182 C CE2 . PHE B 1 155 ? -11.672 -0.689  1.606   1.00 60.98  ? 360 PHE B CE2 1 
ATOM   3183 C CZ  . PHE B 1 155 ? -11.449 -1.770  2.445   1.00 59.03  ? 360 PHE B CZ  1 
ATOM   3184 N N   . SER B 1 156 ? -10.677 5.141   4.778   1.00 60.29  ? 361 SER B N   1 
ATOM   3185 C CA  . SER B 1 156 ? -10.159 6.451   5.147   1.00 60.52  ? 361 SER B CA  1 
ATOM   3186 C C   . SER B 1 156 ? -10.456 6.836   6.617   1.00 60.89  ? 361 SER B C   1 
ATOM   3187 O O   . SER B 1 156 ? -9.754  7.666   7.200   1.00 60.85  ? 361 SER B O   1 
ATOM   3188 C CB  . SER B 1 156 ? -10.753 7.513   4.224   1.00 62.00  ? 361 SER B CB  1 
ATOM   3189 O OG  . SER B 1 156 ? -12.161 7.598   4.392   1.00 63.79  ? 361 SER B OG  1 
ATOM   3190 N N   . ASP B 1 157 ? -11.489 6.224   7.193   1.00 61.22  ? 362 ASP B N   1 
ATOM   3191 C CA  . ASP B 1 157 ? -11.919 6.501   8.567   1.00 61.32  ? 362 ASP B CA  1 
ATOM   3192 C C   . ASP B 1 157 ? -11.284 5.659   9.631   1.00 60.52  ? 362 ASP B C   1 
ATOM   3193 O O   . ASP B 1 157 ? -11.520 5.885   10.817  1.00 61.41  ? 362 ASP B O   1 
ATOM   3194 C CB  . ASP B 1 157 ? -13.434 6.322   8.686   1.00 62.94  ? 362 ASP B CB  1 
ATOM   3195 C CG  . ASP B 1 157 ? -14.198 7.119   7.657   1.00 65.48  ? 362 ASP B CG  1 
ATOM   3196 O OD1 . ASP B 1 157 ? -15.124 6.546   7.038   1.00 65.67  ? 362 ASP B OD1 1 
ATOM   3197 O OD2 . ASP B 1 157 ? -13.875 8.316   7.473   1.00 67.14  ? 362 ASP B OD2 1 
ATOM   3198 N N   . ILE B 1 158 ? -10.479 4.681   9.240   1.00 59.33  ? 363 ILE B N   1 
ATOM   3199 C CA  . ILE B 1 158 ? -9.864  3.805   10.220  1.00 58.82  ? 363 ILE B CA  1 
ATOM   3200 C C   . ILE B 1 158 ? -8.561  4.294   10.917  1.00 57.59  ? 363 ILE B C   1 
ATOM   3201 O O   . ILE B 1 158 ? -8.416  4.123   12.126  1.00 58.08  ? 363 ILE B O   1 
ATOM   3202 C CB  . ILE B 1 158 ? -9.638  2.409   9.612   1.00 58.70  ? 363 ILE B CB  1 
ATOM   3203 C CG1 . ILE B 1 158 ? -8.722  1.592   10.507  1.00 59.47  ? 363 ILE B CG1 1 
ATOM   3204 C CG2 . ILE B 1 158 ? -9.058  2.526   8.233   1.00 59.25  ? 363 ILE B CG2 1 
ATOM   3205 C CD1 . ILE B 1 158 ? -8.560  0.189   10.020  1.00 61.63  ? 363 ILE B CD1 1 
ATOM   3206 N N   . ILE B 1 159 ? -7.641  4.910   10.184  1.00 55.94  ? 364 ILE B N   1 
ATOM   3207 C CA  . ILE B 1 159 ? -6.398  5.357   10.811  1.00 55.18  ? 364 ILE B CA  1 
ATOM   3208 C C   . ILE B 1 159 ? -6.407  6.803   11.389  1.00 55.69  ? 364 ILE B C   1 
ATOM   3209 O O   . ILE B 1 159 ? -5.634  7.121   12.297  1.00 55.31  ? 364 ILE B O   1 
ATOM   3210 C CB  . ILE B 1 159 ? -5.204  5.213   9.842   1.00 54.64  ? 364 ILE B CB  1 
ATOM   3211 C CG1 . ILE B 1 159 ? -5.090  3.761   9.377   1.00 54.50  ? 364 ILE B CG1 1 
ATOM   3212 C CG2 . ILE B 1 159 ? -3.914  5.609   10.539  1.00 54.75  ? 364 ILE B CG2 1 
ATOM   3213 C CD1 . ILE B 1 159 ? -3.790  3.441   8.649   1.00 53.56  ? 364 ILE B CD1 1 
ATOM   3214 N N   . GLU B 1 160 ? -7.273  7.662   10.865  1.00 55.57  ? 365 GLU B N   1 
ATOM   3215 C CA  . GLU B 1 160 ? -7.356  9.032   11.361  1.00 54.38  ? 365 GLU B CA  1 
ATOM   3216 C C   . GLU B 1 160 ? -7.602  9.093   12.942  1.00 53.78  ? 365 GLU B C   1 
ATOM   3217 O O   . GLU B 1 160 ? -6.968  9.888   13.643  1.00 53.74  ? 365 GLU B O   1 
ATOM   3218 C CB  . GLU B 1 160 ? -8.461  9.786   10.608  1.00 54.17  ? 365 GLU B CB  1 
ATOM   3219 C CG  . GLU B 1 160 ? -8.593  11.279  10.951  1.00 52.89  ? 365 GLU B CG  1 
ATOM   3220 C CD  . GLU B 1 160 ? -7.277  12.034  10.852  1.00 55.00  ? 365 GLU B CD  1 
ATOM   3221 O OE1 . GLU B 1 160 ? -6.344  11.550  10.171  1.00 55.34  ? 365 GLU B OE1 1 
ATOM   3222 O OE2 . GLU B 1 160 ? -7.182  13.125  11.451  1.00 54.15  ? 365 GLU B OE2 1 
ATOM   3223 N N   . PRO B 1 161 ? -8.515  8.255   13.475  1.00 53.29  ? 366 PRO B N   1 
ATOM   3224 C CA  . PRO B 1 161 ? -8.782  8.260   14.921  1.00 52.19  ? 366 PRO B CA  1 
ATOM   3225 C C   . PRO B 1 161 ? -7.514  8.061   15.762  1.00 52.01  ? 366 PRO B C   1 
ATOM   3226 O O   . PRO B 1 161 ? -7.325  8.719   16.790  1.00 50.51  ? 366 PRO B O   1 
ATOM   3227 C CB  . PRO B 1 161 ? -9.751  7.099   15.094  1.00 51.47  ? 366 PRO B CB  1 
ATOM   3228 C CG  . PRO B 1 161 ? -10.505 7.114   13.817  1.00 52.83  ? 366 PRO B CG  1 
ATOM   3229 C CD  . PRO B 1 161 ? -9.429  7.323   12.787  1.00 52.54  ? 366 PRO B CD  1 
ATOM   3230 N N   . LYS B 1 162 ? -6.656  7.146   15.312  1.00 50.83  ? 367 LYS B N   1 
ATOM   3231 C CA  . LYS B 1 162 ? -5.413  6.846   16.011  1.00 50.41  ? 367 LYS B CA  1 
ATOM   3232 C C   . LYS B 1 162 ? -4.485  8.022   16.032  1.00 50.25  ? 367 LYS B C   1 
ATOM   3233 O O   . LYS B 1 162 ? -3.783  8.234   17.016  1.00 49.76  ? 367 LYS B O   1 
ATOM   3234 C CB  . LYS B 1 162 ? -4.716  5.635   15.386  1.00 50.26  ? 367 LYS B CB  1 
ATOM   3235 C CG  . LYS B 1 162 ? -5.419  4.287   15.650  1.00 48.75  ? 367 LYS B CG  1 
ATOM   3236 C CD  . LYS B 1 162 ? -6.814  4.267   15.062  1.00 49.42  ? 367 LYS B CD  1 
ATOM   3237 C CE  . LYS B 1 162 ? -7.470  2.938   15.224  1.00 50.75  ? 367 LYS B CE  1 
ATOM   3238 N NZ  . LYS B 1 162 ? -8.906  3.076   14.909  1.00 50.90  ? 367 LYS B NZ  1 
ATOM   3239 N N   . PHE B 1 163 ? -4.453  8.791   14.947  1.00 50.17  ? 368 PHE B N   1 
ATOM   3240 C CA  . PHE B 1 163 ? -3.614  9.981   14.908  1.00 50.90  ? 368 PHE B CA  1 
ATOM   3241 C C   . PHE B 1 163 ? -4.037  10.886  16.085  1.00 53.39  ? 368 PHE B C   1 
ATOM   3242 O O   . PHE B 1 163 ? -3.207  11.319  16.896  1.00 51.58  ? 368 PHE B O   1 
ATOM   3243 C CB  . PHE B 1 163 ? -3.803  10.732  13.588  1.00 48.17  ? 368 PHE B CB  1 
ATOM   3244 C CG  . PHE B 1 163 ? -2.823  10.337  12.526  1.00 47.01  ? 368 PHE B CG  1 
ATOM   3245 C CD1 . PHE B 1 163 ? -1.471  10.597  12.687  1.00 46.24  ? 368 PHE B CD1 1 
ATOM   3246 C CD2 . PHE B 1 163 ? -3.243  9.677   11.384  1.00 45.07  ? 368 PHE B CD2 1 
ATOM   3247 C CE1 . PHE B 1 163 ? -0.555  10.201  11.732  1.00 45.12  ? 368 PHE B CE1 1 
ATOM   3248 C CE2 . PHE B 1 163 ? -2.334  9.279   10.426  1.00 44.14  ? 368 PHE B CE2 1 
ATOM   3249 C CZ  . PHE B 1 163 ? -0.986  9.539   10.599  1.00 44.58  ? 368 PHE B CZ  1 
ATOM   3250 N N   . GLU B 1 164 ? -5.336  11.155  16.166  1.00 54.61  ? 369 GLU B N   1 
ATOM   3251 C CA  . GLU B 1 164 ? -5.870  11.989  17.231  1.00 57.82  ? 369 GLU B CA  1 
ATOM   3252 C C   . GLU B 1 164 ? -5.324  11.538  18.589  1.00 58.18  ? 369 GLU B C   1 
ATOM   3253 O O   . GLU B 1 164 ? -4.742  12.337  19.337  1.00 58.88  ? 369 GLU B O   1 
ATOM   3254 C CB  . GLU B 1 164 ? -7.397  11.927  17.206  1.00 60.76  ? 369 GLU B CB  1 
ATOM   3255 C CG  . GLU B 1 164 ? -8.007  12.637  15.962  1.00 65.04  ? 369 GLU B CG  1 
ATOM   3256 C CD  . GLU B 1 164 ? -9.441  12.218  15.664  1.00 67.53  ? 369 GLU B CD  1 
ATOM   3257 O OE1 . GLU B 1 164 ? -9.651  11.045  15.275  1.00 67.57  ? 369 GLU B OE1 1 
ATOM   3258 O OE2 . GLU B 1 164 ? -10.354 13.062  15.815  1.00 69.00  ? 369 GLU B OE2 1 
ATOM   3259 N N   . PHE B 1 165 ? -5.502  10.253  18.895  1.00 56.59  ? 370 PHE B N   1 
ATOM   3260 C CA  . PHE B 1 165 ? -5.015  9.688   20.147  1.00 52.78  ? 370 PHE B CA  1 
ATOM   3261 C C   . PHE B 1 165 ? -3.521  9.856   20.246  1.00 52.37  ? 370 PHE B C   1 
ATOM   3262 O O   . PHE B 1 165 ? -2.995  10.339  21.253  1.00 51.54  ? 370 PHE B O   1 
ATOM   3263 C CB  . PHE B 1 165 ? -5.372  8.202   20.230  1.00 50.23  ? 370 PHE B CB  1 
ATOM   3264 C CG  . PHE B 1 165 ? -4.788  7.510   21.422  1.00 48.04  ? 370 PHE B CG  1 
ATOM   3265 C CD1 . PHE B 1 165 ? -3.548  6.907   21.352  1.00 46.14  ? 370 PHE B CD1 1 
ATOM   3266 C CD2 . PHE B 1 165 ? -5.453  7.518   22.633  1.00 47.88  ? 370 PHE B CD2 1 
ATOM   3267 C CE1 . PHE B 1 165 ? -2.982  6.333   22.463  1.00 46.05  ? 370 PHE B CE1 1 
ATOM   3268 C CE2 . PHE B 1 165 ? -4.887  6.943   23.751  1.00 47.46  ? 370 PHE B CE2 1 
ATOM   3269 C CZ  . PHE B 1 165 ? -3.650  6.352   23.664  1.00 46.23  ? 370 PHE B CZ  1 
ATOM   3270 N N   . ALA B 1 166 ? -2.834  9.464   19.182  1.00 51.80  ? 371 ALA B N   1 
ATOM   3271 C CA  . ALA B 1 166 ? -1.386  9.538   19.117  1.00 52.47  ? 371 ALA B CA  1 
ATOM   3272 C C   . ALA B 1 166 ? -0.831  10.929  19.438  1.00 53.72  ? 371 ALA B C   1 
ATOM   3273 O O   . ALA B 1 166 ? 0.137   11.056  20.190  1.00 54.39  ? 371 ALA B O   1 
ATOM   3274 C CB  . ALA B 1 166 ? -0.919  9.087   17.748  1.00 49.58  ? 371 ALA B CB  1 
ATOM   3275 N N   . VAL B 1 167 ? -1.437  11.970  18.874  1.00 54.96  ? 372 VAL B N   1 
ATOM   3276 C CA  . VAL B 1 167 ? -0.964  13.329  19.119  1.00 54.91  ? 372 VAL B CA  1 
ATOM   3277 C C   . VAL B 1 167 ? -1.024  13.633  20.609  1.00 54.94  ? 372 VAL B C   1 
ATOM   3278 O O   . VAL B 1 167 ? 0.002   13.921  21.228  1.00 54.86  ? 372 VAL B O   1 
ATOM   3279 C CB  . VAL B 1 167 ? -1.806  14.377  18.338  1.00 55.22  ? 372 VAL B CB  1 
ATOM   3280 C CG1 . VAL B 1 167 ? -1.244  15.772  18.569  1.00 54.62  ? 372 VAL B CG1 1 
ATOM   3281 C CG2 . VAL B 1 167 ? -1.796  14.057  16.853  1.00 53.37  ? 372 VAL B CG2 1 
ATOM   3282 N N   . LYS B 1 168 ? -2.225  13.556  21.183  1.00 54.96  ? 373 LYS B N   1 
ATOM   3283 C CA  . LYS B 1 168 ? -2.418  13.815  22.610  1.00 55.07  ? 373 LYS B CA  1 
ATOM   3284 C C   . LYS B 1 168 ? -1.482  12.959  23.453  1.00 53.72  ? 373 LYS B C   1 
ATOM   3285 O O   . LYS B 1 168 ? -0.977  13.404  24.480  1.00 53.79  ? 373 LYS B O   1 
ATOM   3286 C CB  . LYS B 1 168 ? -3.859  13.504  23.028  1.00 56.92  ? 373 LYS B CB  1 
ATOM   3287 C CG  . LYS B 1 168 ? -4.942  14.159  22.176  1.00 61.42  ? 373 LYS B CG  1 
ATOM   3288 C CD  . LYS B 1 168 ? -6.340  13.692  22.619  1.00 64.09  ? 373 LYS B CD  1 
ATOM   3289 C CE  . LYS B 1 168 ? -7.425  14.170  21.656  1.00 65.84  ? 373 LYS B CE  1 
ATOM   3290 N NZ  . LYS B 1 168 ? -8.733  13.502  21.932  1.00 67.46  ? 373 LYS B NZ  1 
ATOM   3291 N N   . PHE B 1 169 ? -1.260  11.722  23.019  1.00 51.49  ? 374 PHE B N   1 
ATOM   3292 C CA  . PHE B 1 169 ? -0.403  10.812  23.754  1.00 48.83  ? 374 PHE B CA  1 
ATOM   3293 C C   . PHE B 1 169 ? 1.033   11.244  23.768  1.00 48.11  ? 374 PHE B C   1 
ATOM   3294 O O   . PHE B 1 169 ? 1.671   11.233  24.815  1.00 47.01  ? 374 PHE B O   1 
ATOM   3295 C CB  . PHE B 1 169 ? -0.516  9.399   23.184  1.00 47.75  ? 374 PHE B CB  1 
ATOM   3296 C CG  . PHE B 1 169 ? -0.014  8.332   24.116  1.00 46.02  ? 374 PHE B CG  1 
ATOM   3297 C CD1 . PHE B 1 169 ? -0.725  8.003   25.257  1.00 46.98  ? 374 PHE B CD1 1 
ATOM   3298 C CD2 . PHE B 1 169 ? 1.178   7.669   23.863  1.00 45.27  ? 374 PHE B CD2 1 
ATOM   3299 C CE1 . PHE B 1 169 ? -0.253  7.029   26.126  1.00 46.91  ? 374 PHE B CE1 1 
ATOM   3300 C CE2 . PHE B 1 169 ? 1.654   6.699   24.726  1.00 42.60  ? 374 PHE B CE2 1 
ATOM   3301 C CZ  . PHE B 1 169 ? 0.938   6.378   25.858  1.00 43.83  ? 374 PHE B CZ  1 
ATOM   3302 N N   . ASN B 1 170 ? 1.573   11.636  22.621  1.00 48.79  ? 375 ASN B N   1 
ATOM   3303 C CA  . ASN B 1 170 ? 2.977   12.066  22.589  1.00 50.89  ? 375 ASN B CA  1 
ATOM   3304 C C   . ASN B 1 170 ? 3.263   13.355  23.308  1.00 50.65  ? 375 ASN B C   1 
ATOM   3305 O O   . ASN B 1 170 ? 4.418   13.766  23.406  1.00 49.88  ? 375 ASN B O   1 
ATOM   3306 C CB  . ASN B 1 170 ? 3.487   12.168  21.157  1.00 49.34  ? 375 ASN B CB  1 
ATOM   3307 C CG  . ASN B 1 170 ? 3.568   10.822  20.488  1.00 51.37  ? 375 ASN B CG  1 
ATOM   3308 O OD1 . ASN B 1 170 ? 4.067   9.850   21.073  1.00 47.97  ? 375 ASN B OD1 1 
ATOM   3309 N ND2 . ASN B 1 170 ? 3.078   10.749  19.253  1.00 51.43  ? 375 ASN B ND2 1 
ATOM   3310 N N   . ALA B 1 171 ? 2.212   14.004  23.799  1.00 51.29  ? 376 ALA B N   1 
ATOM   3311 C CA  . ALA B 1 171 ? 2.348   15.237  24.554  1.00 52.13  ? 376 ALA B CA  1 
ATOM   3312 C C   . ALA B 1 171 ? 2.938   14.875  25.956  1.00 54.03  ? 376 ALA B C   1 
ATOM   3313 O O   . ALA B 1 171 ? 3.644   15.678  26.571  1.00 55.58  ? 376 ALA B O   1 
ATOM   3314 C CB  . ALA B 1 171 ? 0.998   15.897  24.705  1.00 50.94  ? 376 ALA B CB  1 
ATOM   3315 N N   . LEU B 1 172 ? 2.643   13.663  26.428  1.00 53.78  ? 377 LEU B N   1 
ATOM   3316 C CA  . LEU B 1 172 ? 3.149   13.180  27.711  1.00 53.06  ? 377 LEU B CA  1 
ATOM   3317 C C   . LEU B 1 172 ? 4.687   12.999  27.637  1.00 52.13  ? 377 LEU B C   1 
ATOM   3318 O O   . LEU B 1 172 ? 5.354   12.868  28.657  1.00 51.54  ? 377 LEU B O   1 
ATOM   3319 C CB  . LEU B 1 172 ? 2.494   11.840  28.061  1.00 53.87  ? 377 LEU B CB  1 
ATOM   3320 C CG  . LEU B 1 172 ? 0.965   11.813  28.015  1.00 54.45  ? 377 LEU B CG  1 
ATOM   3321 C CD1 . LEU B 1 172 ? 0.471   10.400  28.247  1.00 53.81  ? 377 LEU B CD1 1 
ATOM   3322 C CD2 . LEU B 1 172 ? 0.401   12.763  29.051  1.00 54.36  ? 377 LEU B CD2 1 
ATOM   3323 N N   . GLU B 1 173 ? 5.222   12.976  26.423  1.00 51.36  ? 378 GLU B N   1 
ATOM   3324 C CA  . GLU B 1 173 ? 6.651   12.833  26.208  1.00 53.55  ? 378 GLU B CA  1 
ATOM   3325 C C   . GLU B 1 173 ? 7.267   11.683  26.953  1.00 52.49  ? 378 GLU B C   1 
ATOM   3326 O O   . GLU B 1 173 ? 8.163   11.873  27.775  1.00 52.48  ? 378 GLU B O   1 
ATOM   3327 C CB  . GLU B 1 173 ? 7.365   14.127  26.600  1.00 56.88  ? 378 GLU B CB  1 
ATOM   3328 C CG  . GLU B 1 173 ? 6.854   15.366  25.868  1.00 61.99  ? 378 GLU B CG  1 
ATOM   3329 C CD  . GLU B 1 173 ? 7.670   16.602  26.192  1.00 65.25  ? 378 GLU B CD  1 
ATOM   3330 O OE1 . GLU B 1 173 ? 7.604   17.093  27.344  1.00 67.19  ? 378 GLU B OE1 1 
ATOM   3331 O OE2 . GLU B 1 173 ? 8.390   17.077  25.289  1.00 67.39  ? 378 GLU B OE2 1 
ATOM   3332 N N   . LEU B 1 174 ? 6.809   10.474  26.663  1.00 50.77  ? 379 LEU B N   1 
ATOM   3333 C CA  . LEU B 1 174 ? 7.349   9.305   27.332  1.00 49.90  ? 379 LEU B CA  1 
ATOM   3334 C C   . LEU B 1 174 ? 8.433   8.720   26.547  1.00 50.30  ? 379 LEU B C   1 
ATOM   3335 O O   . LEU B 1 174 ? 8.462   8.833   25.327  1.00 50.43  ? 379 LEU B O   1 
ATOM   3336 C CB  . LEU B 1 174 ? 6.263   8.250   27.523  1.00 48.75  ? 379 LEU B CB  1 
ATOM   3337 C CG  . LEU B 1 174 ? 5.001   8.648   28.281  1.00 47.36  ? 379 LEU B CG  1 
ATOM   3338 C CD1 . LEU B 1 174 ? 4.009   7.496   28.235  1.00 44.68  ? 379 LEU B CD1 1 
ATOM   3339 C CD2 . LEU B 1 174 ? 5.358   9.014   29.713  1.00 45.61  ? 379 LEU B CD2 1 
ATOM   3340 N N   . ASP B 1 175 ? 9.371   8.080   27.225  1.00 50.90  ? 380 ASP B N   1 
ATOM   3341 C CA  . ASP B 1 175 ? 10.451  7.424   26.516  1.00 51.65  ? 380 ASP B CA  1 
ATOM   3342 C C   . ASP B 1 175 ? 10.132  5.986   26.541  1.00 50.38  ? 380 ASP B C   1 
ATOM   3343 O O   . ASP B 1 175 ? 9.148   5.569   27.156  1.00 50.18  ? 380 ASP B O   1 
ATOM   3344 C CB  . ASP B 1 175 ? 11.807  7.680   27.186  1.00 53.77  ? 380 ASP B CB  1 
ATOM   3345 C CG  . ASP B 1 175 ? 11.820  7.296   28.645  1.00 55.69  ? 380 ASP B CG  1 
ATOM   3346 O OD1 . ASP B 1 175 ? 11.132  6.323   29.010  1.00 57.89  ? 380 ASP B OD1 1 
ATOM   3347 O OD2 . ASP B 1 175 ? 12.528  7.959   29.426  1.00 56.09  ? 380 ASP B OD2 1 
ATOM   3348 N N   . ASP B 1 176 ? 10.957  5.191   25.880  1.00 49.03  ? 381 ASP B N   1 
ATOM   3349 C CA  . ASP B 1 176 ? 10.725  3.760   25.831  1.00 48.25  ? 381 ASP B CA  1 
ATOM   3350 C C   . ASP B 1 176 ? 10.633  3.141   27.171  1.00 47.46  ? 381 ASP B C   1 
ATOM   3351 O O   . ASP B 1 176 ? 9.761   2.301   27.402  1.00 47.12  ? 381 ASP B O   1 
ATOM   3352 C CB  . ASP B 1 176 ? 11.821  3.084   25.008  1.00 48.52  ? 381 ASP B CB  1 
ATOM   3353 C CG  . ASP B 1 176 ? 11.792  3.513   23.562  1.00 49.12  ? 381 ASP B CG  1 
ATOM   3354 O OD1 . ASP B 1 176 ? 10.770  3.234   22.902  1.00 48.91  ? 381 ASP B OD1 1 
ATOM   3355 O OD2 . ASP B 1 176 ? 12.771  4.137   23.091  1.00 49.33  ? 381 ASP B OD2 1 
ATOM   3356 N N   . SER B 1 177 ? 11.518  3.549   28.080  1.00 46.23  ? 382 SER B N   1 
ATOM   3357 C CA  . SER B 1 177 ? 11.533  3.002   29.431  1.00 44.60  ? 382 SER B CA  1 
ATOM   3358 C C   . SER B 1 177 ? 10.169  3.051   30.047  1.00 44.31  ? 382 SER B C   1 
ATOM   3359 O O   . SER B 1 177 ? 9.766   2.123   30.742  1.00 45.72  ? 382 SER B O   1 
ATOM   3360 C CB  . SER B 1 177 ? 12.541  3.748   30.306  1.00 44.87  ? 382 SER B CB  1 
ATOM   3361 O OG  . SER B 1 177 ? 12.127  5.073   30.583  1.00 47.04  ? 382 SER B OG  1 
ATOM   3362 N N   . ASP B 1 178 ? 9.435   4.127   29.804  1.00 43.25  ? 383 ASP B N   1 
ATOM   3363 C CA  . ASP B 1 178 ? 8.096   4.225   30.341  1.00 44.50  ? 383 ASP B CA  1 
ATOM   3364 C C   . ASP B 1 178 ? 7.190   3.246   29.573  1.00 46.06  ? 383 ASP B C   1 
ATOM   3365 O O   . ASP B 1 178 ? 6.531   2.389   30.174  1.00 45.82  ? 383 ASP B O   1 
ATOM   3366 C CB  . ASP B 1 178 ? 7.564   5.648   30.195  1.00 45.13  ? 383 ASP B CB  1 
ATOM   3367 C CG  . ASP B 1 178 ? 8.546   6.683   30.680  1.00 47.27  ? 383 ASP B CG  1 
ATOM   3368 O OD1 . ASP B 1 178 ? 9.086   6.526   31.790  1.00 49.24  ? 383 ASP B OD1 1 
ATOM   3369 O OD2 . ASP B 1 178 ? 8.780   7.662   29.950  1.00 49.67  ? 383 ASP B OD2 1 
ATOM   3370 N N   . LEU B 1 179 ? 7.179   3.370   28.246  1.00 46.16  ? 384 LEU B N   1 
ATOM   3371 C CA  . LEU B 1 179 ? 6.351   2.512   27.399  1.00 44.64  ? 384 LEU B CA  1 
ATOM   3372 C C   . LEU B 1 179 ? 6.448   1.071   27.740  1.00 44.05  ? 384 LEU B C   1 
ATOM   3373 O O   . LEU B 1 179 ? 5.429   0.402   27.880  1.00 43.98  ? 384 LEU B O   1 
ATOM   3374 C CB  . LEU B 1 179 ? 6.708   2.711   25.928  1.00 43.97  ? 384 LEU B CB  1 
ATOM   3375 C CG  . LEU B 1 179 ? 6.458   4.125   25.401  1.00 42.27  ? 384 LEU B CG  1 
ATOM   3376 C CD1 . LEU B 1 179 ? 6.855   4.199   23.944  1.00 41.67  ? 384 LEU B CD1 1 
ATOM   3377 C CD2 . LEU B 1 179 ? 5.002   4.489   25.580  1.00 38.57  ? 384 LEU B CD2 1 
ATOM   3378 N N   . ALA B 1 180 ? 7.671   0.566   27.881  1.00 42.44  ? 385 ALA B N   1 
ATOM   3379 C CA  . ALA B 1 180 ? 7.871   -0.838  28.220  1.00 41.02  ? 385 ALA B CA  1 
ATOM   3380 C C   . ALA B 1 180 ? 6.917   -1.238  29.345  1.00 41.23  ? 385 ALA B C   1 
ATOM   3381 O O   . ALA B 1 180 ? 6.189   -2.228  29.240  1.00 41.85  ? 385 ALA B O   1 
ATOM   3382 C CB  . ALA B 1 180 ? 9.312   -1.071  28.641  1.00 40.17  ? 385 ALA B CB  1 
ATOM   3383 N N   . LEU B 1 181 ? 6.921   -0.452  30.415  1.00 39.47  ? 386 LEU B N   1 
ATOM   3384 C CA  . LEU B 1 181 ? 6.069   -0.699  31.566  1.00 37.37  ? 386 LEU B CA  1 
ATOM   3385 C C   . LEU B 1 181 ? 4.632   -0.445  31.258  1.00 36.52  ? 386 LEU B C   1 
ATOM   3386 O O   . LEU B 1 181 ? 3.747   -1.179  31.695  1.00 34.63  ? 386 LEU B O   1 
ATOM   3387 C CB  . LEU B 1 181 ? 6.509   0.191   32.738  1.00 38.33  ? 386 LEU B CB  1 
ATOM   3388 C CG  . LEU B 1 181 ? 7.842   -0.184  33.403  1.00 38.15  ? 386 LEU B CG  1 
ATOM   3389 C CD1 . LEU B 1 181 ? 8.248   0.866   34.420  1.00 34.82  ? 386 LEU B CD1 1 
ATOM   3390 C CD2 . LEU B 1 181 ? 7.705   -1.551  34.066  1.00 35.49  ? 386 LEU B CD2 1 
ATOM   3391 N N   . PHE B 1 182 ? 4.385   0.614   30.499  1.00 35.79  ? 387 PHE B N   1 
ATOM   3392 C CA  . PHE B 1 182 ? 3.034   1.001   30.128  1.00 34.62  ? 387 PHE B CA  1 
ATOM   3393 C C   . PHE B 1 182 ? 2.333   -0.081  29.371  1.00 34.01  ? 387 PHE B C   1 
ATOM   3394 O O   . PHE B 1 182 ? 1.181   -0.406  29.643  1.00 33.99  ? 387 PHE B O   1 
ATOM   3395 C CB  . PHE B 1 182 ? 3.083   2.261   29.280  1.00 34.52  ? 387 PHE B CB  1 
ATOM   3396 C CG  . PHE B 1 182 ? 1.740   2.815   28.953  1.00 33.77  ? 387 PHE B CG  1 
ATOM   3397 C CD1 . PHE B 1 182 ? 0.923   3.306   29.950  1.00 33.90  ? 387 PHE B CD1 1 
ATOM   3398 C CD2 . PHE B 1 182 ? 1.294   2.855   27.650  1.00 35.58  ? 387 PHE B CD2 1 
ATOM   3399 C CE1 . PHE B 1 182 ? -0.317  3.830   29.653  1.00 34.93  ? 387 PHE B CE1 1 
ATOM   3400 C CE2 . PHE B 1 182 ? 0.047   3.381   27.345  1.00 36.61  ? 387 PHE B CE2 1 
ATOM   3401 C CZ  . PHE B 1 182 ? -0.754  3.866   28.348  1.00 36.08  ? 387 PHE B CZ  1 
ATOM   3402 N N   . ILE B 1 183 ? 3.032   -0.645  28.399  1.00 32.71  ? 388 ILE B N   1 
ATOM   3403 C CA  . ILE B 1 183 ? 2.485   -1.707  27.582  1.00 33.40  ? 388 ILE B CA  1 
ATOM   3404 C C   . ILE B 1 183 ? 2.324   -2.988  28.368  1.00 34.09  ? 388 ILE B C   1 
ATOM   3405 O O   . ILE B 1 183 ? 1.379   -3.750  28.145  1.00 33.58  ? 388 ILE B O   1 
ATOM   3406 C CB  . ILE B 1 183 ? 3.369   -1.920  26.366  1.00 34.12  ? 388 ILE B CB  1 
ATOM   3407 C CG1 . ILE B 1 183 ? 3.141   -0.759  25.400  1.00 33.71  ? 388 ILE B CG1 1 
ATOM   3408 C CG2 . ILE B 1 183 ? 3.069   -3.253  25.725  1.00 33.99  ? 388 ILE B CG2 1 
ATOM   3409 C CD1 . ILE B 1 183 ? 4.270   -0.543  24.440  1.00 39.57  ? 388 ILE B CD1 1 
ATOM   3410 N N   . ALA B 1 184 ? 3.241   -3.233  29.299  1.00 33.45  ? 389 ALA B N   1 
ATOM   3411 C CA  . ALA B 1 184 ? 3.140   -4.412  30.137  1.00 33.38  ? 389 ALA B CA  1 
ATOM   3412 C C   . ALA B 1 184 ? 1.826   -4.317  30.883  1.00 35.33  ? 389 ALA B C   1 
ATOM   3413 O O   . ALA B 1 184 ? 1.080   -5.298  30.977  1.00 36.37  ? 389 ALA B O   1 
ATOM   3414 C CB  . ALA B 1 184 ? 4.288   -4.463  31.112  1.00 33.67  ? 389 ALA B CB  1 
ATOM   3415 N N   . ALA B 1 185 ? 1.531   -3.125  31.404  1.00 35.68  ? 390 ALA B N   1 
ATOM   3416 C CA  . ALA B 1 185 ? 0.292   -2.894  32.147  1.00 35.29  ? 390 ALA B CA  1 
ATOM   3417 C C   . ALA B 1 185 ? -0.924  -3.125  31.287  1.00 35.11  ? 390 ALA B C   1 
ATOM   3418 O O   . ALA B 1 185 ? -1.891  -3.735  31.731  1.00 36.06  ? 390 ALA B O   1 
ATOM   3419 C CB  . ALA B 1 185 ? 0.271   -1.484  32.712  1.00 35.20  ? 390 ALA B CB  1 
ATOM   3420 N N   . ILE B 1 186 ? -0.892  -2.635  30.053  1.00 34.05  ? 391 ILE B N   1 
ATOM   3421 C CA  . ILE B 1 186 ? -2.013  -2.832  29.144  1.00 34.98  ? 391 ILE B CA  1 
ATOM   3422 C C   . ILE B 1 186 ? -2.286  -4.351  28.904  1.00 35.58  ? 391 ILE B C   1 
ATOM   3423 O O   . ILE B 1 186 ? -3.441  -4.776  28.849  1.00 35.04  ? 391 ILE B O   1 
ATOM   3424 C CB  . ILE B 1 186 ? -1.756  -2.145  27.769  1.00 33.78  ? 391 ILE B CB  1 
ATOM   3425 C CG1 . ILE B 1 186 ? -1.909  -0.629  27.917  1.00 32.47  ? 391 ILE B CG1 1 
ATOM   3426 C CG2 . ILE B 1 186 ? -2.716  -2.680  26.713  1.00 28.20  ? 391 ILE B CG2 1 
ATOM   3427 C CD1 . ILE B 1 186 ? -1.549  0.155   26.646  1.00 31.49  ? 391 ILE B CD1 1 
ATOM   3428 N N   . ILE B 1 187 ? -1.222  -5.142  28.785  1.00 36.38  ? 392 ILE B N   1 
ATOM   3429 C CA  . ILE B 1 187 ? -1.359  -6.575  28.536  1.00 37.93  ? 392 ILE B CA  1 
ATOM   3430 C C   . ILE B 1 187 ? -1.709  -7.406  29.729  1.00 39.39  ? 392 ILE B C   1 
ATOM   3431 O O   . ILE B 1 187 ? -2.441  -8.384  29.605  1.00 41.10  ? 392 ILE B O   1 
ATOM   3432 C CB  . ILE B 1 187 ? -0.087  -7.160  27.948  1.00 38.18  ? 392 ILE B CB  1 
ATOM   3433 C CG1 . ILE B 1 187 ? 0.237   -6.484  26.623  1.00 35.33  ? 392 ILE B CG1 1 
ATOM   3434 C CG2 . ILE B 1 187 ? -0.256  -8.664  27.772  1.00 38.72  ? 392 ILE B CG2 1 
ATOM   3435 C CD1 . ILE B 1 187 ? 1.690   -6.634  26.254  1.00 35.69  ? 392 ILE B CD1 1 
ATOM   3436 N N   . LEU B 1 188 ? -1.170  -7.058  30.893  1.00 40.15  ? 393 LEU B N   1 
ATOM   3437 C CA  . LEU B 1 188 ? -1.473  -7.805  32.108  1.00 39.90  ? 393 LEU B CA  1 
ATOM   3438 C C   . LEU B 1 188 ? -2.645  -7.173  32.745  1.00 40.52  ? 393 LEU B C   1 
ATOM   3439 O O   . LEU B 1 188 ? -2.578  -6.696  33.874  1.00 42.42  ? 393 LEU B O   1 
ATOM   3440 C CB  . LEU B 1 188 ? -0.281  -7.799  33.069  1.00 38.19  ? 393 LEU B CB  1 
ATOM   3441 C CG  . LEU B 1 188 ? 0.824   -8.827  32.800  1.00 39.04  ? 393 LEU B CG  1 
ATOM   3442 C CD1 . LEU B 1 188 ? 0.223   -10.224 32.813  1.00 35.20  ? 393 LEU B CD1 1 
ATOM   3443 C CD2 . LEU B 1 188 ? 1.502   -8.553  31.472  1.00 37.72  ? 393 LEU B CD2 1 
ATOM   3444 N N   . CYS B 1 189 ? -3.750  -7.156  32.014  1.00 40.30  ? 394 CYS B N   1 
ATOM   3445 C CA  . CYS B 1 189 ? -4.987  -6.559  32.481  1.00 40.26  ? 394 CYS B CA  1 
ATOM   3446 C C   . CYS B 1 189 ? -5.967  -7.645  32.941  1.00 39.83  ? 394 CYS B C   1 
ATOM   3447 O O   . CYS B 1 189 ? -6.405  -8.476  32.151  1.00 40.46  ? 394 CYS B O   1 
ATOM   3448 C CB  . CYS B 1 189 ? -5.578  -5.724  31.344  1.00 39.48  ? 394 CYS B CB  1 
ATOM   3449 S SG  . CYS B 1 189 ? -7.274  -5.245  31.546  1.00 43.25  ? 394 CYS B SG  1 
ATOM   3450 N N   . GLY B 1 190 ? -6.302  -7.635  34.225  1.00 40.38  ? 395 GLY B N   1 
ATOM   3451 C CA  . GLY B 1 190 ? -7.216  -8.634  34.754  1.00 41.27  ? 395 GLY B CA  1 
ATOM   3452 C C   . GLY B 1 190 ? -8.672  -8.509  34.330  1.00 42.64  ? 395 GLY B C   1 
ATOM   3453 O O   . GLY B 1 190 ? -9.470  -9.408  34.575  1.00 43.16  ? 395 GLY B O   1 
ATOM   3454 N N   . ASP B 1 191 ? -9.023  -7.406  33.683  1.00 43.80  ? 396 ASP B N   1 
ATOM   3455 C CA  . ASP B 1 191 ? -10.394 -7.174  33.247  1.00 45.70  ? 396 ASP B CA  1 
ATOM   3456 C C   . ASP B 1 191 ? -10.802 -8.014  32.008  1.00 44.97  ? 396 ASP B C   1 
ATOM   3457 O O   . ASP B 1 191 ? -11.979 -8.077  31.662  1.00 45.52  ? 396 ASP B O   1 
ATOM   3458 C CB  . ASP B 1 191 ? -10.589 -5.687  32.927  1.00 49.20  ? 396 ASP B CB  1 
ATOM   3459 C CG  . ASP B 1 191 ? -10.168 -4.774  34.077  1.00 55.18  ? 396 ASP B CG  1 
ATOM   3460 O OD1 . ASP B 1 191 ? -9.994  -3.553  33.839  1.00 56.27  ? 396 ASP B OD1 1 
ATOM   3461 O OD2 . ASP B 1 191 ? -10.020 -5.269  35.221  1.00 58.58  ? 396 ASP B OD2 1 
ATOM   3462 N N   . ARG B 1 192 ? -9.837  -8.650  31.356  1.00 43.56  ? 397 ARG B N   1 
ATOM   3463 C CA  . ARG B 1 192 ? -10.128 -9.437  30.156  1.00 42.58  ? 397 ARG B CA  1 
ATOM   3464 C C   . ARG B 1 192 ? -11.094 -10.571 30.398  1.00 42.81  ? 397 ARG B C   1 
ATOM   3465 O O   . ARG B 1 192 ? -10.955 -11.338 31.357  1.00 43.75  ? 397 ARG B O   1 
ATOM   3466 C CB  . ARG B 1 192 ? -8.839  -9.995  29.554  1.00 39.67  ? 397 ARG B CB  1 
ATOM   3467 C CG  . ARG B 1 192 ? -7.755  -8.962  29.344  1.00 37.92  ? 397 ARG B CG  1 
ATOM   3468 C CD  . ARG B 1 192 ? -8.244  -7.720  28.580  1.00 36.92  ? 397 ARG B CD  1 
ATOM   3469 N NE  . ARG B 1 192 ? -7.110  -6.843  28.307  1.00 40.33  ? 397 ARG B NE  1 
ATOM   3470 C CZ  . ARG B 1 192 ? -7.175  -5.631  27.765  1.00 38.17  ? 397 ARG B CZ  1 
ATOM   3471 N NH1 . ARG B 1 192 ? -8.337  -5.110  27.422  1.00 38.08  ? 397 ARG B NH1 1 
ATOM   3472 N NH2 . ARG B 1 192 ? -6.063  -4.943  27.563  1.00 37.84  ? 397 ARG B NH2 1 
ATOM   3473 N N   . PRO B 1 193 ? -12.092 -10.708 29.515  1.00 41.68  ? 398 PRO B N   1 
ATOM   3474 C CA  . PRO B 1 193 ? -13.117 -11.747 29.595  1.00 41.67  ? 398 PRO B CA  1 
ATOM   3475 C C   . PRO B 1 193 ? -12.577 -13.167 29.380  1.00 40.88  ? 398 PRO B C   1 
ATOM   3476 O O   . PRO B 1 193 ? -11.614 -13.377 28.639  1.00 41.15  ? 398 PRO B O   1 
ATOM   3477 C CB  . PRO B 1 193 ? -14.102 -11.330 28.508  1.00 40.73  ? 398 PRO B CB  1 
ATOM   3478 C CG  . PRO B 1 193 ? -13.219 -10.729 27.494  1.00 41.76  ? 398 PRO B CG  1 
ATOM   3479 C CD  . PRO B 1 193 ? -12.305 -9.869  28.328  1.00 41.86  ? 398 PRO B CD  1 
ATOM   3480 N N   . GLY B 1 194 ? -13.206 -14.135 30.039  1.00 38.84  ? 399 GLY B N   1 
ATOM   3481 C CA  . GLY B 1 194 ? -12.783 -15.512 29.894  1.00 37.82  ? 399 GLY B CA  1 
ATOM   3482 C C   . GLY B 1 194 ? -11.440 -15.793 30.524  1.00 38.01  ? 399 GLY B C   1 
ATOM   3483 O O   . GLY B 1 194 ? -10.888 -16.881 30.357  1.00 37.46  ? 399 GLY B O   1 
ATOM   3484 N N   . LEU B 1 195 ? -10.905 -14.816 31.247  1.00 38.63  ? 400 LEU B N   1 
ATOM   3485 C CA  . LEU B 1 195 ? -9.617  -14.990 31.892  1.00 40.28  ? 400 LEU B CA  1 
ATOM   3486 C C   . LEU B 1 195 ? -9.843  -15.954 32.986  1.00 40.22  ? 400 LEU B C   1 
ATOM   3487 O O   . LEU B 1 195 ? -10.844 -15.881 33.687  1.00 39.33  ? 400 LEU B O   1 
ATOM   3488 C CB  . LEU B 1 195 ? -9.100  -13.650 32.422  1.00 41.02  ? 400 LEU B CB  1 
ATOM   3489 C CG  . LEU B 1 195 ? -7.614  -13.534 32.791  1.00 41.56  ? 400 LEU B CG  1 
ATOM   3490 C CD1 . LEU B 1 195 ? -6.716  -14.045 31.652  1.00 38.38  ? 400 LEU B CD1 1 
ATOM   3491 C CD2 . LEU B 1 195 ? -7.316  -12.069 33.107  1.00 39.90  ? 400 LEU B CD2 1 
ATOM   3492 N N   . MET B 1 196 ? -8.912  -16.884 33.144  1.00 42.04  ? 401 MET B N   1 
ATOM   3493 C CA  . MET B 1 196 ? -9.025  -17.930 34.142  1.00 42.98  ? 401 MET B CA  1 
ATOM   3494 C C   . MET B 1 196 ? -8.548  -17.537 35.514  1.00 43.30  ? 401 MET B C   1 
ATOM   3495 O O   . MET B 1 196 ? -9.340  -17.490 36.449  1.00 43.67  ? 401 MET B O   1 
ATOM   3496 C CB  . MET B 1 196 ? -8.277  -19.164 33.646  1.00 44.02  ? 401 MET B CB  1 
ATOM   3497 C CG  . MET B 1 196 ? -8.411  -20.401 34.506  1.00 44.15  ? 401 MET B CG  1 
ATOM   3498 S SD  . MET B 1 196 ? -7.790  -21.826 33.588  1.00 48.23  ? 401 MET B SD  1 
ATOM   3499 C CE  . MET B 1 196 ? -6.000  -21.652 33.828  1.00 46.04  ? 401 MET B CE  1 
ATOM   3500 N N   . ASN B 1 197 ? -7.259  -17.253 35.658  1.00 42.88  ? 402 ASN B N   1 
ATOM   3501 C CA  . ASN B 1 197 ? -6.720  -16.872 36.960  1.00 43.35  ? 402 ASN B CA  1 
ATOM   3502 C C   . ASN B 1 197 ? -6.705  -15.355 37.102  1.00 43.63  ? 402 ASN B C   1 
ATOM   3503 O O   . ASN B 1 197 ? -5.649  -14.719 37.047  1.00 43.92  ? 402 ASN B O   1 
ATOM   3504 C CB  . ASN B 1 197 ? -5.295  -17.414 37.129  1.00 44.77  ? 402 ASN B CB  1 
ATOM   3505 C CG  . ASN B 1 197 ? -4.796  -17.324 38.569  1.00 46.48  ? 402 ASN B CG  1 
ATOM   3506 O OD1 . ASN B 1 197 ? -5.250  -16.485 39.360  1.00 46.59  ? 402 ASN B OD1 1 
ATOM   3507 N ND2 . ASN B 1 197 ? -3.839  -18.180 38.908  1.00 46.39  ? 402 ASN B ND2 1 
ATOM   3508 N N   . VAL B 1 198 ? -7.873  -14.767 37.295  1.00 42.47  ? 403 VAL B N   1 
ATOM   3509 C CA  . VAL B 1 198 ? -7.934  -13.328 37.434  1.00 43.18  ? 403 VAL B CA  1 
ATOM   3510 C C   . VAL B 1 198 ? -7.087  -12.783 38.609  1.00 43.75  ? 403 VAL B C   1 
ATOM   3511 O O   . VAL B 1 198 ? -6.282  -11.877 38.425  1.00 44.37  ? 403 VAL B O   1 
ATOM   3512 C CB  . VAL B 1 198 ? -9.389  -12.855 37.569  1.00 43.29  ? 403 VAL B CB  1 
ATOM   3513 C CG1 . VAL B 1 198 ? -9.429  -11.350 37.794  1.00 40.67  ? 403 VAL B CG1 1 
ATOM   3514 C CG2 . VAL B 1 198 ? -10.157 -13.230 36.312  1.00 40.08  ? 403 VAL B CG2 1 
ATOM   3515 N N   . PRO B 1 199 ? -7.252  -13.336 39.818  1.00 44.28  ? 404 PRO B N   1 
ATOM   3516 C CA  . PRO B 1 199 ? -6.447  -12.819 40.929  1.00 44.71  ? 404 PRO B CA  1 
ATOM   3517 C C   . PRO B 1 199 ? -4.950  -12.744 40.635  1.00 45.23  ? 404 PRO B C   1 
ATOM   3518 O O   . PRO B 1 199 ? -4.300  -11.752 40.967  1.00 45.22  ? 404 PRO B O   1 
ATOM   3519 C CB  . PRO B 1 199 ? -6.768  -13.791 42.060  1.00 43.01  ? 404 PRO B CB  1 
ATOM   3520 C CG  . PRO B 1 199 ? -8.201  -14.105 41.801  1.00 42.46  ? 404 PRO B CG  1 
ATOM   3521 C CD  . PRO B 1 199 ? -8.201  -14.355 40.299  1.00 44.05  ? 404 PRO B CD  1 
ATOM   3522 N N   . ARG B 1 200 ? -4.406  -13.793 40.022  1.00 45.35  ? 405 ARG B N   1 
ATOM   3523 C CA  . ARG B 1 200 ? -2.985  -13.823 39.691  1.00 46.20  ? 405 ARG B CA  1 
ATOM   3524 C C   . ARG B 1 200 ? -2.617  -12.677 38.738  1.00 45.20  ? 405 ARG B C   1 
ATOM   3525 O O   . ARG B 1 200 ? -1.654  -11.943 38.974  1.00 43.91  ? 405 ARG B O   1 
ATOM   3526 C CB  . ARG B 1 200 ? -2.611  -15.168 39.051  1.00 47.91  ? 405 ARG B CB  1 
ATOM   3527 C CG  . ARG B 1 200 ? -1.134  -15.297 38.642  1.00 51.21  ? 405 ARG B CG  1 
ATOM   3528 C CD  . ARG B 1 200 ? -0.201  -15.153 39.845  1.00 58.44  ? 405 ARG B CD  1 
ATOM   3529 N NE  . ARG B 1 200 ? 1.212   -15.161 39.461  1.00 64.72  ? 405 ARG B NE  1 
ATOM   3530 C CZ  . ARG B 1 200 ? 2.230   -15.003 40.309  1.00 67.12  ? 405 ARG B CZ  1 
ATOM   3531 N NH1 . ARG B 1 200 ? 3.483   -15.025 39.862  1.00 68.42  ? 405 ARG B NH1 1 
ATOM   3532 N NH2 . ARG B 1 200 ? 2.003   -14.824 41.605  1.00 67.89  ? 405 ARG B NH2 1 
ATOM   3533 N N   . VAL B 1 201 ? -3.391  -12.529 37.667  1.00 44.03  ? 406 VAL B N   1 
ATOM   3534 C CA  . VAL B 1 201 ? -3.131  -11.482 36.695  1.00 42.09  ? 406 VAL B CA  1 
ATOM   3535 C C   . VAL B 1 201 ? -3.216  -10.137 37.325  1.00 41.18  ? 406 VAL B C   1 
ATOM   3536 O O   . VAL B 1 201 ? -2.355  -9.294  37.100  1.00 41.11  ? 406 VAL B O   1 
ATOM   3537 C CB  . VAL B 1 201 ? -4.096  -11.578 35.498  1.00 41.37  ? 406 VAL B CB  1 
ATOM   3538 C CG1 . VAL B 1 201 ? -3.956  -10.357 34.607  1.00 41.15  ? 406 VAL B CG1 1 
ATOM   3539 C CG2 . VAL B 1 201 ? -3.771  -12.819 34.694  1.00 40.45  ? 406 VAL B CG2 1 
ATOM   3540 N N   . GLU B 1 202 ? -4.246  -9.915  38.131  1.00 39.85  ? 407 GLU B N   1 
ATOM   3541 C CA  . GLU B 1 202 ? -4.398  -8.641  38.816  1.00 39.61  ? 407 GLU B CA  1 
ATOM   3542 C C   . GLU B 1 202 ? -3.207  -8.379  39.694  1.00 39.10  ? 407 GLU B C   1 
ATOM   3543 O O   . GLU B 1 202 ? -2.678  -7.272  39.730  1.00 40.71  ? 407 GLU B O   1 
ATOM   3544 C CB  . GLU B 1 202 ? -5.653  -8.641  39.668  1.00 39.30  ? 407 GLU B CB  1 
ATOM   3545 C CG  . GLU B 1 202 ? -6.923  -8.753  38.895  1.00 42.75  ? 407 GLU B CG  1 
ATOM   3546 C CD  . GLU B 1 202 ? -8.135  -8.544  39.777  1.00 47.33  ? 407 GLU B CD  1 
ATOM   3547 O OE1 . GLU B 1 202 ? -8.245  -9.220  40.830  1.00 48.58  ? 407 GLU B OE1 1 
ATOM   3548 O OE2 . GLU B 1 202 ? -8.976  -7.696  39.421  1.00 49.66  ? 407 GLU B OE2 1 
ATOM   3549 N N   . ALA B 1 203 ? -2.780  -9.396  40.424  1.00 38.13  ? 408 ALA B N   1 
ATOM   3550 C CA  . ALA B 1 203 ? -1.625  -9.249  41.287  1.00 38.91  ? 408 ALA B CA  1 
ATOM   3551 C C   . ALA B 1 203 ? -0.410  -8.755  40.460  1.00 39.22  ? 408 ALA B C   1 
ATOM   3552 O O   . ALA B 1 203 ? 0.292   -7.828  40.867  1.00 40.07  ? 408 ALA B O   1 
ATOM   3553 C CB  . ALA B 1 203 ? -1.302  -10.581 41.958  1.00 38.55  ? 408 ALA B CB  1 
ATOM   3554 N N   . ILE B 1 204 ? -0.166  -9.376  39.311  1.00 38.47  ? 409 ILE B N   1 
ATOM   3555 C CA  . ILE B 1 204 ? 0.956   -8.957  38.481  1.00 38.10  ? 409 ILE B CA  1 
ATOM   3556 C C   . ILE B 1 204 ? 0.733   -7.557  37.940  1.00 38.04  ? 409 ILE B C   1 
ATOM   3557 O O   . ILE B 1 204 ? 1.660   -6.756  37.884  1.00 39.01  ? 409 ILE B O   1 
ATOM   3558 C CB  . ILE B 1 204 ? 1.193   -9.914  37.288  1.00 36.83  ? 409 ILE B CB  1 
ATOM   3559 C CG1 . ILE B 1 204 ? 1.487   -11.324 37.803  1.00 38.40  ? 409 ILE B CG1 1 
ATOM   3560 C CG2 . ILE B 1 204 ? 2.369   -9.419  36.450  1.00 32.53  ? 409 ILE B CG2 1 
ATOM   3561 C CD1 . ILE B 1 204 ? 1.743   -12.371 36.688  1.00 39.78  ? 409 ILE B CD1 1 
ATOM   3562 N N   . GLN B 1 205 ? -0.493  -7.245  37.544  1.00 37.08  ? 410 GLN B N   1 
ATOM   3563 C CA  . GLN B 1 205 ? -0.758  -5.923  37.018  1.00 38.06  ? 410 GLN B CA  1 
ATOM   3564 C C   . GLN B 1 205 ? -0.397  -4.895  38.054  1.00 37.39  ? 410 GLN B C   1 
ATOM   3565 O O   . GLN B 1 205 ? 0.312   -3.928  37.769  1.00 36.53  ? 410 GLN B O   1 
ATOM   3566 C CB  . GLN B 1 205 ? -2.233  -5.768  36.616  1.00 40.59  ? 410 GLN B CB  1 
ATOM   3567 C CG  . GLN B 1 205 ? -2.581  -4.315  36.119  1.00 45.27  ? 410 GLN B CG  1 
ATOM   3568 C CD  . GLN B 1 205 ? -3.963  -4.186  35.506  1.00 46.55  ? 410 GLN B CD  1 
ATOM   3569 O OE1 . GLN B 1 205 ? -4.971  -4.545  36.122  1.00 46.79  ? 410 GLN B OE1 1 
ATOM   3570 N NE2 . GLN B 1 205 ? -4.018  -3.656  34.282  1.00 47.92  ? 410 GLN B NE2 1 
ATOM   3571 N N   . ASP B 1 206 ? -0.871  -5.104  39.273  1.00 36.01  ? 411 ASP B N   1 
ATOM   3572 C CA  . ASP B 1 206 ? -0.599  -4.174  40.339  1.00 35.87  ? 411 ASP B CA  1 
ATOM   3573 C C   . ASP B 1 206 ? 0.930   -3.901  40.560  1.00 36.14  ? 411 ASP B C   1 
ATOM   3574 O O   . ASP B 1 206 ? 1.334   -2.745  40.684  1.00 35.55  ? 411 ASP B O   1 
ATOM   3575 C CB  . ASP B 1 206 ? -1.244  -4.667  41.626  1.00 38.85  ? 411 ASP B CB  1 
ATOM   3576 C CG  . ASP B 1 206 ? -1.420  -3.555  42.644  1.00 43.99  ? 411 ASP B CG  1 
ATOM   3577 O OD1 . ASP B 1 206 ? -2.243  -2.633  42.405  1.00 42.70  ? 411 ASP B OD1 1 
ATOM   3578 O OD2 . ASP B 1 206 ? -0.720  -3.607  43.681  1.00 46.12  ? 411 ASP B OD2 1 
ATOM   3579 N N   . THR B 1 207 ? 1.770   -4.931  40.602  1.00 34.67  ? 412 THR B N   1 
ATOM   3580 C CA  . THR B 1 207 ? 3.183   -4.639  40.806  1.00 37.16  ? 412 THR B CA  1 
ATOM   3581 C C   . THR B 1 207 ? 3.772   -3.931  39.597  1.00 38.43  ? 412 THR B C   1 
ATOM   3582 O O   . THR B 1 207 ? 4.715   -3.147  39.736  1.00 39.61  ? 412 THR B O   1 
ATOM   3583 C CB  . THR B 1 207 ? 4.033   -5.906  41.154  1.00 37.54  ? 412 THR B CB  1 
ATOM   3584 O OG1 . THR B 1 207 ? 4.377   -6.626  39.971  1.00 36.71  ? 412 THR B OG1 1 
ATOM   3585 C CG2 . THR B 1 207 ? 3.264   -6.807  42.088  1.00 39.25  ? 412 THR B CG2 1 
ATOM   3586 N N   . ILE B 1 208 ? 3.221   -4.192  38.411  1.00 37.45  ? 413 ILE B N   1 
ATOM   3587 C CA  . ILE B 1 208 ? 3.692   -3.517  37.205  1.00 39.02  ? 413 ILE B CA  1 
ATOM   3588 C C   . ILE B 1 208 ? 3.351   -2.017  37.329  1.00 39.07  ? 413 ILE B C   1 
ATOM   3589 O O   . ILE B 1 208 ? 4.185   -1.163  37.051  1.00 38.86  ? 413 ILE B O   1 
ATOM   3590 C CB  . ILE B 1 208 ? 3.018   -4.076  35.915  1.00 39.13  ? 413 ILE B CB  1 
ATOM   3591 C CG1 . ILE B 1 208 ? 3.572   -5.466  35.601  1.00 39.19  ? 413 ILE B CG1 1 
ATOM   3592 C CG2 . ILE B 1 208 ? 3.261   -3.135  34.745  1.00 34.57  ? 413 ILE B CG2 1 
ATOM   3593 C CD1 . ILE B 1 208 ? 2.872   -6.183  34.449  1.00 39.93  ? 413 ILE B CD1 1 
ATOM   3594 N N   . LEU B 1 209 ? 2.122   -1.720  37.742  1.00 39.16  ? 414 LEU B N   1 
ATOM   3595 C CA  . LEU B 1 209 ? 1.677   -0.344  37.923  1.00 40.77  ? 414 LEU B CA  1 
ATOM   3596 C C   . LEU B 1 209 ? 2.480   0.372   38.992  1.00 42.62  ? 414 LEU B C   1 
ATOM   3597 O O   . LEU B 1 209 ? 2.827   1.543   38.838  1.00 43.12  ? 414 LEU B O   1 
ATOM   3598 C CB  . LEU B 1 209 ? 0.199   -0.310  38.299  1.00 38.79  ? 414 LEU B CB  1 
ATOM   3599 C CG  . LEU B 1 209 ? -0.705  -0.583  37.103  1.00 39.19  ? 414 LEU B CG  1 
ATOM   3600 C CD1 . LEU B 1 209 ? -2.173  -0.505  37.504  1.00 37.80  ? 414 LEU B CD1 1 
ATOM   3601 C CD2 . LEU B 1 209 ? -0.381  0.443   36.026  1.00 38.55  ? 414 LEU B CD2 1 
ATOM   3602 N N   . ARG B 1 210 ? 2.763   -0.315  40.092  1.00 42.93  ? 415 ARG B N   1 
ATOM   3603 C CA  . ARG B 1 210 ? 3.551   0.298   41.145  1.00 44.93  ? 415 ARG B CA  1 
ATOM   3604 C C   . ARG B 1 210 ? 4.920   0.578   40.610  1.00 44.82  ? 415 ARG B C   1 
ATOM   3605 O O   . ARG B 1 210 ? 5.507   1.629   40.879  1.00 43.62  ? 415 ARG B O   1 
ATOM   3606 C CB  . ARG B 1 210 ? 3.621   -0.620  42.359  1.00 46.47  ? 415 ARG B CB  1 
ATOM   3607 C CG  . ARG B 1 210 ? 2.291   -0.783  43.008  1.00 49.59  ? 415 ARG B CG  1 
ATOM   3608 C CD  . ARG B 1 210 ? 2.379   -1.412  44.370  1.00 54.22  ? 415 ARG B CD  1 
ATOM   3609 N NE  . ARG B 1 210 ? 1.044   -1.503  44.958  1.00 58.58  ? 415 ARG B NE  1 
ATOM   3610 C CZ  . ARG B 1 210 ? 0.792   -1.712  46.246  1.00 59.18  ? 415 ARG B CZ  1 
ATOM   3611 N NH1 . ARG B 1 210 ? 1.790   -1.857  47.113  1.00 59.90  ? 415 ARG B NH1 1 
ATOM   3612 N NH2 . ARG B 1 210 ? -0.469  -1.763  46.665  1.00 59.70  ? 415 ARG B NH2 1 
ATOM   3613 N N   . ALA B 1 211 ? 5.439   -0.367  39.834  1.00 44.53  ? 416 ALA B N   1 
ATOM   3614 C CA  . ALA B 1 211 ? 6.748   -0.215  39.223  1.00 45.51  ? 416 ALA B CA  1 
ATOM   3615 C C   . ALA B 1 211 ? 6.719   0.980   38.275  1.00 45.47  ? 416 ALA B C   1 
ATOM   3616 O O   . ALA B 1 211 ? 7.706   1.687   38.114  1.00 44.97  ? 416 ALA B O   1 
ATOM   3617 C CB  . ALA B 1 211 ? 7.110   -1.479  38.459  1.00 44.81  ? 416 ALA B CB  1 
ATOM   3618 N N   . LEU B 1 212 ? 5.573   1.198   37.647  1.00 47.08  ? 417 LEU B N   1 
ATOM   3619 C CA  . LEU B 1 212 ? 5.411   2.300   36.720  1.00 49.41  ? 417 LEU B CA  1 
ATOM   3620 C C   . LEU B 1 212 ? 5.511   3.588   37.451  1.00 52.39  ? 417 LEU B C   1 
ATOM   3621 O O   . LEU B 1 212 ? 6.281   4.467   37.076  1.00 53.58  ? 417 LEU B O   1 
ATOM   3622 C CB  . LEU B 1 212 ? 4.054   2.209   36.031  1.00 47.25  ? 417 LEU B CB  1 
ATOM   3623 C CG  . LEU B 1 212 ? 3.816   3.253   34.943  1.00 46.51  ? 417 LEU B CG  1 
ATOM   3624 C CD1 . LEU B 1 212 ? 4.748   3.002   33.775  1.00 45.32  ? 417 LEU B CD1 1 
ATOM   3625 C CD2 . LEU B 1 212 ? 2.383   3.187   34.494  1.00 44.52  ? 417 LEU B CD2 1 
ATOM   3626 N N   . GLU B 1 213 ? 4.726   3.716   38.513  1.00 55.63  ? 418 GLU B N   1 
ATOM   3627 C CA  . GLU B 1 213 ? 4.714   4.923   39.329  1.00 57.97  ? 418 GLU B CA  1 
ATOM   3628 C C   . GLU B 1 213 ? 6.047   5.299   39.792  1.00 57.27  ? 418 GLU B C   1 
ATOM   3629 O O   . GLU B 1 213 ? 6.517   6.398   39.533  1.00 56.28  ? 418 GLU B O   1 
ATOM   3630 C CB  . GLU B 1 213 ? 3.816   4.730   40.540  1.00 61.32  ? 418 GLU B CB  1 
ATOM   3631 C CG  . GLU B 1 213 ? 3.929   5.843   41.535  1.00 66.04  ? 418 GLU B CG  1 
ATOM   3632 C CD  . GLU B 1 213 ? 3.090   5.597   42.760  1.00 68.58  ? 418 GLU B CD  1 
ATOM   3633 O OE1 . GLU B 1 213 ? 3.466   4.730   43.589  1.00 69.14  ? 418 GLU B OE1 1 
ATOM   3634 O OE2 . GLU B 1 213 ? 2.045   6.271   42.878  1.00 69.91  ? 418 GLU B OE2 1 
ATOM   3635 N N   . PHE B 1 214 ? 6.684   4.390   40.513  1.00 58.04  ? 419 PHE B N   1 
ATOM   3636 C CA  . PHE B 1 214 ? 8.014   4.640   41.031  1.00 60.01  ? 419 PHE B CA  1 
ATOM   3637 C C   . PHE B 1 214 ? 8.955   5.053   39.926  1.00 58.55  ? 419 PHE B C   1 
ATOM   3638 O O   . PHE B 1 214 ? 9.715   6.010   40.081  1.00 59.75  ? 419 PHE B O   1 
ATOM   3639 C CB  . PHE B 1 214 ? 8.516   3.399   41.776  1.00 62.96  ? 419 PHE B CB  1 
ATOM   3640 C CG  . PHE B 1 214 ? 8.046   3.330   43.210  1.00 68.29  ? 419 PHE B CG  1 
ATOM   3641 C CD1 . PHE B 1 214 ? 6.767   3.750   43.559  1.00 70.27  ? 419 PHE B CD1 1 
ATOM   3642 C CD2 . PHE B 1 214 ? 8.885   2.860   44.214  1.00 70.96  ? 419 PHE B CD2 1 
ATOM   3643 C CE1 . PHE B 1 214 ? 6.336   3.707   44.876  1.00 71.74  ? 419 PHE B CE1 1 
ATOM   3644 C CE2 . PHE B 1 214 ? 8.459   2.812   45.540  1.00 71.43  ? 419 PHE B CE2 1 
ATOM   3645 C CZ  . PHE B 1 214 ? 7.184   3.237   45.869  1.00 72.03  ? 419 PHE B CZ  1 
ATOM   3646 N N   . HIS B 1 215 ? 8.896   4.351   38.800  1.00 56.33  ? 420 HIS B N   1 
ATOM   3647 C CA  . HIS B 1 215 ? 9.737   4.670   37.650  1.00 54.92  ? 420 HIS B CA  1 
ATOM   3648 C C   . HIS B 1 215 ? 9.434   6.096   37.115  1.00 53.45  ? 420 HIS B C   1 
ATOM   3649 O O   . HIS B 1 215 ? 10.335  6.810   36.691  1.00 50.86  ? 420 HIS B O   1 
ATOM   3650 C CB  . HIS B 1 215 ? 9.501   3.655   36.530  1.00 54.96  ? 420 HIS B CB  1 
ATOM   3651 C CG  . HIS B 1 215 ? 10.261  3.956   35.275  1.00 55.06  ? 420 HIS B CG  1 
ATOM   3652 N ND1 . HIS B 1 215 ? 11.625  3.784   35.171  1.00 55.20  ? 420 HIS B ND1 1 
ATOM   3653 C CD2 . HIS B 1 215 ? 9.849   4.439   34.079  1.00 52.98  ? 420 HIS B CD2 1 
ATOM   3654 C CE1 . HIS B 1 215 ? 12.020  4.149   33.964  1.00 53.51  ? 420 HIS B CE1 1 
ATOM   3655 N NE2 . HIS B 1 215 ? 10.962  4.551   33.283  1.00 53.30  ? 420 HIS B NE2 1 
ATOM   3656 N N   . LEU B 1 216 ? 8.163   6.482   37.126  1.00 53.78  ? 421 LEU B N   1 
ATOM   3657 C CA  . LEU B 1 216 ? 7.774   7.801   36.660  1.00 55.41  ? 421 LEU B CA  1 
ATOM   3658 C C   . LEU B 1 216 ? 8.330   8.841   37.541  1.00 58.09  ? 421 LEU B C   1 
ATOM   3659 O O   . LEU B 1 216 ? 8.869   9.834   37.068  1.00 59.64  ? 421 LEU B O   1 
ATOM   3660 C CB  . LEU B 1 216 ? 6.258   7.941   36.609  1.00 54.24  ? 421 LEU B CB  1 
ATOM   3661 C CG  . LEU B 1 216 ? 5.520   7.064   35.598  1.00 54.19  ? 421 LEU B CG  1 
ATOM   3662 C CD1 . LEU B 1 216 ? 4.088   7.564   35.443  1.00 52.43  ? 421 LEU B CD1 1 
ATOM   3663 C CD2 . LEU B 1 216 ? 6.236   7.117   34.259  1.00 55.11  ? 421 LEU B CD2 1 
ATOM   3664 N N   . GLN B 1 217 ? 8.212   8.650   38.849  1.00 60.77  ? 422 GLN B N   1 
ATOM   3665 C CA  . GLN B 1 217 ? 8.747   9.623   39.786  1.00 63.10  ? 422 GLN B CA  1 
ATOM   3666 C C   . GLN B 1 217 ? 10.198  9.909   39.476  1.00 63.75  ? 422 GLN B C   1 
ATOM   3667 O O   . GLN B 1 217 ? 10.597  11.065  39.358  1.00 63.49  ? 422 GLN B O   1 
ATOM   3668 C CB  . GLN B 1 217 ? 8.605   9.117   41.220  1.00 65.89  ? 422 GLN B CB  1 
ATOM   3669 C CG  . GLN B 1 217 ? 7.234   9.386   41.833  1.00 68.91  ? 422 GLN B CG  1 
ATOM   3670 C CD  . GLN B 1 217 ? 7.077   8.780   43.217  1.00 71.86  ? 422 GLN B CD  1 
ATOM   3671 O OE1 . GLN B 1 217 ? 6.058   8.980   43.877  1.00 74.12  ? 422 GLN B OE1 1 
ATOM   3672 N NE2 . GLN B 1 217 ? 8.084   8.028   43.659  1.00 71.96  ? 422 GLN B NE2 1 
ATOM   3673 N N   . ALA B 1 218 ? 10.998  8.859   39.333  1.00 64.37  ? 423 ALA B N   1 
ATOM   3674 C CA  . ALA B 1 218 ? 12.409  9.035   39.019  1.00 66.20  ? 423 ALA B CA  1 
ATOM   3675 C C   . ALA B 1 218 ? 12.600  9.709   37.635  1.00 67.89  ? 423 ALA B C   1 
ATOM   3676 O O   . ALA B 1 218 ? 12.819  10.919  37.548  1.00 68.07  ? 423 ALA B O   1 
ATOM   3677 C CB  . ALA B 1 218 ? 13.116  7.688   39.044  1.00 65.05  ? 423 ALA B CB  1 
ATOM   3678 N N   . ASN B 1 219 ? 12.490  8.906   36.577  1.00 70.13  ? 424 ASN B N   1 
ATOM   3679 C CA  . ASN B 1 219 ? 12.663  9.348   35.191  1.00 71.97  ? 424 ASN B CA  1 
ATOM   3680 C C   . ASN B 1 219 ? 11.958  10.657  34.756  1.00 73.37  ? 424 ASN B C   1 
ATOM   3681 O O   . ASN B 1 219 ? 12.449  11.348  33.863  1.00 74.16  ? 424 ASN B O   1 
ATOM   3682 C CB  . ASN B 1 219 ? 12.258  8.215   34.242  1.00 72.97  ? 424 ASN B CB  1 
ATOM   3683 C CG  . ASN B 1 219 ? 12.615  8.508   32.795  1.00 73.99  ? 424 ASN B CG  1 
ATOM   3684 O OD1 . ASN B 1 219 ? 12.055  9.411   32.180  1.00 75.79  ? 424 ASN B OD1 1 
ATOM   3685 N ND2 . ASN B 1 219 ? 13.556  7.744   32.247  1.00 74.41  ? 424 ASN B ND2 1 
ATOM   3686 N N   . HIS B 1 220 ? 10.822  10.988  35.360  1.00 74.56  ? 425 HIS B N   1 
ATOM   3687 C CA  . HIS B 1 220 ? 10.115  12.216  35.003  1.00 76.10  ? 425 HIS B CA  1 
ATOM   3688 C C   . HIS B 1 220 ? 9.999   13.098  36.154  1.00 78.04  ? 425 HIS B C   1 
ATOM   3689 O O   . HIS B 1 220 ? 9.003   13.082  36.868  1.00 77.25  ? 425 HIS B O   1 
ATOM   3690 C CB  . HIS B 1 220 ? 8.739   11.897  34.449  1.00 76.61  ? 425 HIS B CB  1 
ATOM   3691 C CG  . HIS B 1 220 ? 8.780   11.262  33.100  1.00 77.52  ? 425 HIS B CG  1 
ATOM   3692 N ND1 . HIS B 1 220 ? 9.200   11.940  31.977  1.00 78.28  ? 425 HIS B ND1 1 
ATOM   3693 C CD2 . HIS B 1 220 ? 8.502   10.000  32.697  1.00 77.65  ? 425 HIS B CD2 1 
ATOM   3694 C CE1 . HIS B 1 220 ? 9.180   11.123  30.940  1.00 77.55  ? 425 HIS B CE1 1 
ATOM   3695 N NE2 . HIS B 1 220 ? 8.761   9.940   31.350  1.00 77.13  ? 425 HIS B NE2 1 
ATOM   3696 N N   . PRO B 1 221 ? 11.011  13.951  36.347  1.00 80.31  ? 426 PRO B N   1 
ATOM   3697 C CA  . PRO B 1 221 ? 11.191  14.944  37.410  1.00 80.82  ? 426 PRO B CA  1 
ATOM   3698 C C   . PRO B 1 221 ? 9.949   15.608  37.967  1.00 80.75  ? 426 PRO B C   1 
ATOM   3699 O O   . PRO B 1 221 ? 9.222   15.032  38.774  1.00 78.94  ? 426 PRO B O   1 
ATOM   3700 C CB  . PRO B 1 221 ? 12.146  15.959  36.771  1.00 82.13  ? 426 PRO B CB  1 
ATOM   3701 C CG  . PRO B 1 221 ? 11.860  15.822  35.289  1.00 81.55  ? 426 PRO B CG  1 
ATOM   3702 C CD  . PRO B 1 221 ? 11.812  14.327  35.168  1.00 81.59  ? 426 PRO B CD  1 
ATOM   3703 N N   . ASP B 1 222 ? 9.729   16.845  37.535  1.00 82.03  ? 427 ASP B N   1 
ATOM   3704 C CA  . ASP B 1 222 ? 8.607   17.648  37.989  1.00 82.25  ? 427 ASP B CA  1 
ATOM   3705 C C   . ASP B 1 222 ? 7.400   17.470  37.106  1.00 81.37  ? 427 ASP B C   1 
ATOM   3706 O O   . ASP B 1 222 ? 6.675   18.423  36.825  1.00 80.22  ? 427 ASP B O   1 
ATOM   3707 C CB  . ASP B 1 222 ? 9.004   19.126  38.011  1.00 83.58  ? 427 ASP B CB  1 
ATOM   3708 C CG  . ASP B 1 222 ? 10.037  19.441  39.081  1.00 83.95  ? 427 ASP B CG  1 
ATOM   3709 O OD1 . ASP B 1 222 ? 10.106  18.710  40.094  1.00 82.30  ? 427 ASP B OD1 1 
ATOM   3710 O OD2 . ASP B 1 222 ? 10.791  20.421  38.889  1.00 85.32  ? 427 ASP B OD2 1 
ATOM   3711 N N   . ALA B 1 223 ? 7.185   16.244  36.649  1.00 81.08  ? 428 ALA B N   1 
ATOM   3712 C CA  . ALA B 1 223 ? 6.039   15.942  35.808  1.00 80.49  ? 428 ALA B CA  1 
ATOM   3713 C C   . ALA B 1 223 ? 4.833   16.040  36.685  1.00 80.06  ? 428 ALA B C   1 
ATOM   3714 O O   . ALA B 1 223 ? 4.724   15.309  37.667  1.00 81.21  ? 428 ALA B O   1 
ATOM   3715 C CB  . ALA B 1 223 ? 6.163   14.539  35.242  1.00 80.50  ? 428 ALA B CB  1 
ATOM   3716 N N   . GLN B 1 224 ? 3.930   16.958  36.353  1.00 78.68  ? 429 GLN B N   1 
ATOM   3717 C CA  . GLN B 1 224 ? 2.708   17.170  37.122  1.00 76.73  ? 429 GLN B CA  1 
ATOM   3718 C C   . GLN B 1 224 ? 2.072   15.866  37.619  1.00 75.39  ? 429 GLN B C   1 
ATOM   3719 O O   . GLN B 1 224 ? 2.602   15.222  38.521  1.00 76.49  ? 429 GLN B O   1 
ATOM   3720 C CB  . GLN B 1 224 ? 1.715   17.958  36.291  1.00 78.19  ? 429 GLN B CB  1 
ATOM   3721 N N   . TYR B 1 225 ? 0.945   15.466  37.041  1.00 72.09  ? 430 TYR B N   1 
ATOM   3722 C CA  . TYR B 1 225 ? 0.289   14.239  37.482  1.00 69.09  ? 430 TYR B CA  1 
ATOM   3723 C C   . TYR B 1 225 ? 0.345   13.166  36.359  1.00 67.16  ? 430 TYR B C   1 
ATOM   3724 O O   . TYR B 1 225 ? -0.690  12.723  35.860  1.00 65.50  ? 430 TYR B O   1 
ATOM   3725 C CB  . TYR B 1 225 ? -1.153  14.550  37.866  1.00 68.34  ? 430 TYR B CB  1 
ATOM   3726 N N   . LEU B 1 226 ? 1.563   12.745  36.010  1.00 64.96  ? 431 LEU B N   1 
ATOM   3727 C CA  . LEU B 1 226 ? 1.770   11.773  34.938  1.00 63.36  ? 431 LEU B CA  1 
ATOM   3728 C C   . LEU B 1 226 ? 1.194   10.364  35.149  1.00 63.48  ? 431 LEU B C   1 
ATOM   3729 O O   . LEU B 1 226 ? 0.620   9.800   34.227  1.00 65.12  ? 431 LEU B O   1 
ATOM   3730 C CB  . LEU B 1 226 ? 3.266   11.671  34.579  1.00 60.86  ? 431 LEU B CB  1 
ATOM   3731 C CG  . LEU B 1 226 ? 3.625   11.044  33.231  1.00 58.51  ? 431 LEU B CG  1 
ATOM   3732 C CD1 . LEU B 1 226 ? 2.606   11.491  32.231  1.00 55.36  ? 431 LEU B CD1 1 
ATOM   3733 C CD2 . LEU B 1 226 ? 5.029   11.465  32.799  1.00 56.94  ? 431 LEU B CD2 1 
ATOM   3734 N N   . PHE B 1 227 ? 1.354   9.804   36.344  1.00 62.54  ? 432 PHE B N   1 
ATOM   3735 C CA  . PHE B 1 227 ? 0.820   8.472   36.623  1.00 60.19  ? 432 PHE B CA  1 
ATOM   3736 C C   . PHE B 1 227 ? -0.683  8.369   36.398  1.00 57.67  ? 432 PHE B C   1 
ATOM   3737 O O   . PHE B 1 227 ? -1.151  7.463   35.728  1.00 57.18  ? 432 PHE B O   1 
ATOM   3738 C CB  . PHE B 1 227 ? 1.156   8.019   38.051  1.00 61.67  ? 432 PHE B CB  1 
ATOM   3739 C CG  . PHE B 1 227 ? 0.914   6.547   38.295  1.00 63.18  ? 432 PHE B CG  1 
ATOM   3740 C CD1 . PHE B 1 227 ? 1.873   5.605   37.945  1.00 63.41  ? 432 PHE B CD1 1 
ATOM   3741 C CD2 . PHE B 1 227 ? -0.274  6.115   38.865  1.00 64.00  ? 432 PHE B CD2 1 
ATOM   3742 C CE1 . PHE B 1 227 ? 1.665   4.257   38.150  1.00 63.19  ? 432 PHE B CE1 1 
ATOM   3743 C CE2 . PHE B 1 227 ? -0.506  4.772   39.081  1.00 64.95  ? 432 PHE B CE2 1 
ATOM   3744 C CZ  . PHE B 1 227 ? 0.471   3.826   38.723  1.00 65.05  ? 432 PHE B CZ  1 
ATOM   3745 N N   . PRO B 1 228 ? -1.472  9.280   36.975  1.00 55.93  ? 433 PRO B N   1 
ATOM   3746 C CA  . PRO B 1 228 ? -2.930  9.228   36.777  1.00 54.04  ? 433 PRO B CA  1 
ATOM   3747 C C   . PRO B 1 228 ? -3.261  9.513   35.320  1.00 51.37  ? 433 PRO B C   1 
ATOM   3748 O O   . PRO B 1 228 ? -4.261  9.038   34.782  1.00 51.07  ? 433 PRO B O   1 
ATOM   3749 C CB  . PRO B 1 228 ? -3.436  10.334  37.699  1.00 53.57  ? 433 PRO B CB  1 
ATOM   3750 C CG  . PRO B 1 228 ? -2.417  10.282  38.825  1.00 55.53  ? 433 PRO B CG  1 
ATOM   3751 C CD  . PRO B 1 228 ? -1.130  10.166  38.099  1.00 54.93  ? 433 PRO B CD  1 
ATOM   3752 N N   . LYS B 1 229 ? -2.401  10.300  34.685  1.00 48.63  ? 434 LYS B N   1 
ATOM   3753 C CA  . LYS B 1 229 ? -2.569  10.654  33.287  1.00 48.32  ? 434 LYS B CA  1 
ATOM   3754 C C   . LYS B 1 229 ? -2.631  9.361   32.476  1.00 48.24  ? 434 LYS B C   1 
ATOM   3755 O O   . LYS B 1 229 ? -3.599  9.104   31.746  1.00 46.81  ? 434 LYS B O   1 
ATOM   3756 C CB  . LYS B 1 229 ? -1.391  11.518  32.825  1.00 47.06  ? 434 LYS B CB  1 
ATOM   3757 N N   . LEU B 1 230 ? -1.585  8.554   32.640  1.00 47.68  ? 435 LEU B N   1 
ATOM   3758 C CA  . LEU B 1 230 ? -1.434  7.285   31.957  1.00 46.06  ? 435 LEU B CA  1 
ATOM   3759 C C   . LEU B 1 230 ? -2.563  6.336   32.170  1.00 46.36  ? 435 LEU B C   1 
ATOM   3760 O O   . LEU B 1 230 ? -2.988  5.659   31.234  1.00 46.72  ? 435 LEU B O   1 
ATOM   3761 C CB  . LEU B 1 230 ? -0.118  6.655   32.375  1.00 45.53  ? 435 LEU B CB  1 
ATOM   3762 C CG  . LEU B 1 230 ? 1.077   7.500   31.928  1.00 45.87  ? 435 LEU B CG  1 
ATOM   3763 C CD1 . LEU B 1 230 ? 2.376   6.750   32.171  1.00 48.17  ? 435 LEU B CD1 1 
ATOM   3764 C CD2 . LEU B 1 230 ? 0.949   7.805   30.455  1.00 44.68  ? 435 LEU B CD2 1 
ATOM   3765 N N   . LEU B 1 231 ? -3.069  6.260   33.395  1.00 44.65  ? 436 LEU B N   1 
ATOM   3766 C CA  . LEU B 1 231 ? -4.196  5.382   33.676  1.00 43.97  ? 436 LEU B CA  1 
ATOM   3767 C C   . LEU B 1 231 ? -5.379  5.746   32.835  1.00 43.90  ? 436 LEU B C   1 
ATOM   3768 O O   . LEU B 1 231 ? -6.103  4.868   32.362  1.00 43.54  ? 436 LEU B O   1 
ATOM   3769 C CB  . LEU B 1 231 ? -4.571  5.459   35.151  1.00 42.87  ? 436 LEU B CB  1 
ATOM   3770 C CG  . LEU B 1 231 ? -3.562  4.735   36.032  1.00 43.18  ? 436 LEU B CG  1 
ATOM   3771 C CD1 . LEU B 1 231 ? -3.871  4.976   37.500  1.00 42.84  ? 436 LEU B CD1 1 
ATOM   3772 C CD2 . LEU B 1 231 ? -3.600  3.252   35.686  1.00 41.94  ? 436 LEU B CD2 1 
ATOM   3773 N N   . GLN B 1 232 ? -5.600  7.047   32.648  1.00 44.59  ? 437 GLN B N   1 
ATOM   3774 C CA  . GLN B 1 232 ? -6.717  7.513   31.827  1.00 45.19  ? 437 GLN B CA  1 
ATOM   3775 C C   . GLN B 1 232 ? -6.451  7.186   30.390  1.00 44.62  ? 437 GLN B C   1 
ATOM   3776 O O   . GLN B 1 232 ? -7.375  6.871   29.643  1.00 44.81  ? 437 GLN B O   1 
ATOM   3777 C CB  . GLN B 1 232 ? -6.931  9.023   31.968  1.00 45.15  ? 437 GLN B CB  1 
ATOM   3778 C CG  . GLN B 1 232 ? -8.208  9.541   31.239  1.00 45.84  ? 437 GLN B CG  1 
ATOM   3779 C CD  . GLN B 1 232 ? -9.495  8.875   31.727  1.00 46.62  ? 437 GLN B CD  1 
ATOM   3780 O OE1 . GLN B 1 232 ? -9.731  8.767   32.925  1.00 51.48  ? 437 GLN B OE1 1 
ATOM   3781 N NE2 . GLN B 1 232 ? -10.335 8.443   30.798  1.00 45.55  ? 437 GLN B NE2 1 
ATOM   3782 N N   . LYS B 1 233 ? -5.188  7.271   29.983  1.00 42.88  ? 438 LYS B N   1 
ATOM   3783 C CA  . LYS B 1 233 ? -4.820  6.940   28.617  1.00 43.95  ? 438 LYS B CA  1 
ATOM   3784 C C   . LYS B 1 233 ? -5.132  5.421   28.382  1.00 43.69  ? 438 LYS B C   1 
ATOM   3785 O O   . LYS B 1 233 ? -5.580  5.035   27.305  1.00 42.79  ? 438 LYS B O   1 
ATOM   3786 C CB  . LYS B 1 233 ? -3.336  7.258   28.378  1.00 44.86  ? 438 LYS B CB  1 
ATOM   3787 C CG  . LYS B 1 233 ? -3.042  8.784   28.282  1.00 45.68  ? 438 LYS B CG  1 
ATOM   3788 C CD  . LYS B 1 233 ? -3.636  9.387   26.969  1.00 48.22  ? 438 LYS B CD  1 
ATOM   3789 C CE  . LYS B 1 233 ? -3.873  10.931  27.056  1.00 47.27  ? 438 LYS B CE  1 
ATOM   3790 N NZ  . LYS B 1 233 ? -5.062  11.261  27.910  1.00 47.42  ? 438 LYS B NZ  1 
ATOM   3791 N N   . MET B 1 234 ? -4.899  4.596   29.405  1.00 42.92  ? 439 MET B N   1 
ATOM   3792 C CA  . MET B 1 234 ? -5.192  3.168   29.325  1.00 41.21  ? 439 MET B CA  1 
ATOM   3793 C C   . MET B 1 234 ? -6.635  3.009   29.156  1.00 40.35  ? 439 MET B C   1 
ATOM   3794 O O   . MET B 1 234 ? -7.089  2.146   28.412  1.00 42.27  ? 439 MET B O   1 
ATOM   3795 C CB  . MET B 1 234 ? -4.768  2.435   30.598  1.00 40.25  ? 439 MET B CB  1 
ATOM   3796 C CG  . MET B 1 234 ? -3.303  2.148   30.695  1.00 41.33  ? 439 MET B CG  1 
ATOM   3797 S SD  . MET B 1 234 ? -2.876  1.583   32.353  1.00 43.14  ? 439 MET B SD  1 
ATOM   3798 C CE  . MET B 1 234 ? -3.534  -0.121  32.306  1.00 44.40  ? 439 MET B CE  1 
ATOM   3799 N N   . ALA B 1 235 ? -7.398  3.836   29.861  1.00 39.89  ? 440 ALA B N   1 
ATOM   3800 C CA  . ALA B 1 235 ? -8.852  3.788   29.780  1.00 40.43  ? 440 ALA B CA  1 
ATOM   3801 C C   . ALA B 1 235 ? -9.290  4.158   28.383  1.00 40.69  ? 440 ALA B C   1 
ATOM   3802 O O   . ALA B 1 235 ? -10.157 3.513   27.802  1.00 39.51  ? 440 ALA B O   1 
ATOM   3803 C CB  . ALA B 1 235 ? -9.464  4.745   30.799  1.00 38.43  ? 440 ALA B CB  1 
ATOM   3804 N N   . ASP B 1 236 ? -8.672  5.200   27.837  1.00 41.88  ? 441 ASP B N   1 
ATOM   3805 C CA  . ASP B 1 236 ? -8.989  5.678   26.500  1.00 42.53  ? 441 ASP B CA  1 
ATOM   3806 C C   . ASP B 1 236 ? -8.733  4.625   25.461  1.00 41.77  ? 441 ASP B C   1 
ATOM   3807 O O   . ASP B 1 236 ? -9.589  4.354   24.624  1.00 41.52  ? 441 ASP B O   1 
ATOM   3808 C CB  . ASP B 1 236 ? -8.169  6.931   26.174  1.00 43.97  ? 441 ASP B CB  1 
ATOM   3809 C CG  . ASP B 1 236 ? -8.216  7.969   27.284  1.00 45.47  ? 441 ASP B CG  1 
ATOM   3810 O OD1 . ASP B 1 236 ? -9.250  8.063   27.979  1.00 42.70  ? 441 ASP B OD1 1 
ATOM   3811 O OD2 . ASP B 1 236 ? -7.215  8.700   27.452  1.00 48.82  ? 441 ASP B OD2 1 
ATOM   3812 N N   . LEU B 1 237 ? -7.546  4.026   25.500  1.00 40.27  ? 442 LEU B N   1 
ATOM   3813 C CA  . LEU B 1 237 ? -7.192  2.990   24.545  1.00 39.11  ? 442 LEU B CA  1 
ATOM   3814 C C   . LEU B 1 237 ? -8.232  1.919   24.455  1.00 40.68  ? 442 LEU B C   1 
ATOM   3815 O O   . LEU B 1 237 ? -8.519  1.424   23.368  1.00 41.26  ? 442 LEU B O   1 
ATOM   3816 C CB  . LEU B 1 237 ? -5.843  2.373   24.905  1.00 37.37  ? 442 LEU B CB  1 
ATOM   3817 C CG  . LEU B 1 237 ? -4.606  3.161   24.467  1.00 36.71  ? 442 LEU B CG  1 
ATOM   3818 C CD1 . LEU B 1 237 ? -3.367  2.526   25.074  1.00 36.67  ? 442 LEU B CD1 1 
ATOM   3819 C CD2 . LEU B 1 237 ? -4.511  3.192   22.947  1.00 32.25  ? 442 LEU B CD2 1 
ATOM   3820 N N   . ARG B 1 238 ? -8.820  1.542   25.585  1.00 41.57  ? 443 ARG B N   1 
ATOM   3821 C CA  . ARG B 1 238 ? -9.838  0.506   25.555  1.00 42.79  ? 443 ARG B CA  1 
ATOM   3822 C C   . ARG B 1 238 ? -10.978 0.926   24.698  1.00 42.70  ? 443 ARG B C   1 
ATOM   3823 O O   . ARG B 1 238 ? -11.531 0.118   23.954  1.00 42.77  ? 443 ARG B O   1 
ATOM   3824 C CB  . ARG B 1 238 ? -10.336 0.184   26.960  1.00 45.22  ? 443 ARG B CB  1 
ATOM   3825 C CG  . ARG B 1 238 ? -11.236 -1.048  26.986  1.00 49.87  ? 443 ARG B CG  1 
ATOM   3826 C CD  . ARG B 1 238 ? -11.605 -1.478  28.400  1.00 53.59  ? 443 ARG B CD  1 
ATOM   3827 N NE  . ARG B 1 238 ? -10.444 -1.844  29.207  1.00 55.86  ? 443 ARG B NE  1 
ATOM   3828 C CZ  . ARG B 1 238 ? -10.517 -2.538  30.341  1.00 56.92  ? 443 ARG B CZ  1 
ATOM   3829 N NH1 . ARG B 1 238 ? -11.692 -2.949  30.801  1.00 54.46  ? 443 ARG B NH1 1 
ATOM   3830 N NH2 . ARG B 1 238 ? -9.413  -2.806  31.024  1.00 58.55  ? 443 ARG B NH2 1 
ATOM   3831 N N   . GLN B 1 239 ? -11.337 2.205   24.794  1.00 43.37  ? 444 GLN B N   1 
ATOM   3832 C CA  . GLN B 1 239 ? -12.427 2.806   24.019  1.00 42.88  ? 444 GLN B CA  1 
ATOM   3833 C C   . GLN B 1 239 ? -12.044 2.894   22.584  1.00 42.31  ? 444 GLN B C   1 
ATOM   3834 O O   . GLN B 1 239 ? -12.813 2.526   21.703  1.00 41.93  ? 444 GLN B O   1 
ATOM   3835 C CB  . GLN B 1 239 ? -12.727 4.209   24.551  1.00 45.15  ? 444 GLN B CB  1 
ATOM   3836 C CG  . GLN B 1 239 ? -13.726 5.033   23.728  1.00 49.61  ? 444 GLN B CG  1 
ATOM   3837 C CD  . GLN B 1 239 ? -15.109 4.423   23.699  1.00 52.55  ? 444 GLN B CD  1 
ATOM   3838 O OE1 . GLN B 1 239 ? -15.455 3.592   24.549  1.00 54.33  ? 444 GLN B OE1 1 
ATOM   3839 N NE2 . GLN B 1 239 ? -15.922 4.843   22.734  1.00 51.73  ? 444 GLN B NE2 1 
ATOM   3840 N N   . LEU B 1 240 ? -10.840 3.397   22.333  1.00 41.96  ? 445 LEU B N   1 
ATOM   3841 C CA  . LEU B 1 240 ? -10.338 3.525   20.981  1.00 40.89  ? 445 LEU B CA  1 
ATOM   3842 C C   . LEU B 1 240 ? -10.473 2.216   20.289  1.00 41.17  ? 445 LEU B C   1 
ATOM   3843 O O   . LEU B 1 240 ? -10.998 2.144   19.183  1.00 40.58  ? 445 LEU B O   1 
ATOM   3844 C CB  . LEU B 1 240 ? -8.867  3.942   20.989  1.00 39.64  ? 445 LEU B CB  1 
ATOM   3845 C CG  . LEU B 1 240 ? -8.240  4.037   19.590  1.00 40.11  ? 445 LEU B CG  1 
ATOM   3846 C CD1 . LEU B 1 240 ? -8.870  5.199   18.839  1.00 37.53  ? 445 LEU B CD1 1 
ATOM   3847 C CD2 . LEU B 1 240 ? -6.730  4.218   19.686  1.00 38.71  ? 445 LEU B CD2 1 
ATOM   3848 N N   . VAL B 1 241 ? -10.003 1.154   20.935  1.00 41.44  ? 446 VAL B N   1 
ATOM   3849 C CA  . VAL B 1 241 ? -10.072 -0.171  20.340  1.00 42.31  ? 446 VAL B CA  1 
ATOM   3850 C C   . VAL B 1 241 ? -11.500 -0.644  20.135  1.00 43.17  ? 446 VAL B C   1 
ATOM   3851 O O   . VAL B 1 241 ? -11.817 -1.210  19.095  1.00 42.95  ? 446 VAL B O   1 
ATOM   3852 C CB  . VAL B 1 241 ? -9.286  -1.207  21.175  1.00 41.72  ? 446 VAL B CB  1 
ATOM   3853 C CG1 . VAL B 1 241 ? -9.559  -2.612  20.651  1.00 39.27  ? 446 VAL B CG1 1 
ATOM   3854 C CG2 . VAL B 1 241 ? -7.785  -0.900  21.101  1.00 39.12  ? 446 VAL B CG2 1 
ATOM   3855 N N   . THR B 1 242 ? -12.368 -0.407  21.114  1.00 43.84  ? 447 THR B N   1 
ATOM   3856 C CA  . THR B 1 242 ? -13.769 -0.805  20.990  1.00 44.75  ? 447 THR B CA  1 
ATOM   3857 C C   . THR B 1 242 ? -14.379 -0.208  19.729  1.00 45.84  ? 447 THR B C   1 
ATOM   3858 O O   . THR B 1 242 ? -15.093 -0.888  18.987  1.00 46.05  ? 447 THR B O   1 
ATOM   3859 C CB  . THR B 1 242 ? -14.607 -0.326  22.192  1.00 45.49  ? 447 THR B CB  1 
ATOM   3860 O OG1 . THR B 1 242 ? -14.233 -1.063  23.362  1.00 46.71  ? 447 THR B OG1 1 
ATOM   3861 C CG2 . THR B 1 242 ? -16.098 -0.521  21.915  1.00 45.32  ? 447 THR B CG2 1 
ATOM   3862 N N   . GLU B 1 243 ? -14.099 1.070   19.497  1.00 45.83  ? 448 GLU B N   1 
ATOM   3863 C CA  . GLU B 1 243 ? -14.610 1.766   18.330  1.00 47.00  ? 448 GLU B CA  1 
ATOM   3864 C C   . GLU B 1 243 ? -13.958 1.233   17.064  1.00 46.47  ? 448 GLU B C   1 
ATOM   3865 O O   . GLU B 1 243 ? -14.610 1.119   16.028  1.00 46.65  ? 448 GLU B O   1 
ATOM   3866 C CB  . GLU B 1 243 ? -14.371 3.270   18.489  1.00 49.90  ? 448 GLU B CB  1 
ATOM   3867 C CG  . GLU B 1 243 ? -14.961 3.810   19.820  1.00 56.45  ? 448 GLU B CG  1 
ATOM   3868 C CD  . GLU B 1 243 ? -14.745 5.305   20.047  1.00 60.02  ? 448 GLU B CD  1 
ATOM   3869 O OE1 . GLU B 1 243 ? -13.580 5.776   20.022  1.00 61.73  ? 448 GLU B OE1 1 
ATOM   3870 O OE2 . GLU B 1 243 ? -15.757 6.007   20.273  1.00 61.79  ? 448 GLU B OE2 1 
ATOM   3871 N N   . HIS B 1 244 ? -12.673 0.889   17.148  1.00 46.33  ? 449 HIS B N   1 
ATOM   3872 C CA  . HIS B 1 244 ? -11.942 0.345   16.007  1.00 44.13  ? 449 HIS B CA  1 
ATOM   3873 C C   . HIS B 1 244 ? -12.560 -0.998  15.591  1.00 43.82  ? 449 HIS B C   1 
ATOM   3874 O O   . HIS B 1 244 ? -12.634 -1.310  14.407  1.00 43.07  ? 449 HIS B O   1 
ATOM   3875 C CB  . HIS B 1 244 ? -10.463 0.152   16.359  1.00 42.95  ? 449 HIS B CB  1 
ATOM   3876 C CG  . HIS B 1 244 ? -9.653  -0.446  15.248  1.00 41.79  ? 449 HIS B CG  1 
ATOM   3877 N ND1 . HIS B 1 244 ? -9.342  0.241   14.094  1.00 39.91  ? 449 HIS B ND1 1 
ATOM   3878 C CD2 . HIS B 1 244 ? -9.121  -1.684  15.101  1.00 40.19  ? 449 HIS B CD2 1 
ATOM   3879 C CE1 . HIS B 1 244 ? -8.656  -0.545  13.286  1.00 39.51  ? 449 HIS B CE1 1 
ATOM   3880 N NE2 . HIS B 1 244 ? -8.509  -1.719  13.873  1.00 37.97  ? 449 HIS B NE2 1 
ATOM   3881 N N   . ALA B 1 245 ? -12.989 -1.785  16.574  1.00 45.15  ? 450 ALA B N   1 
ATOM   3882 C CA  . ALA B 1 245 ? -13.633 -3.071  16.324  1.00 47.03  ? 450 ALA B CA  1 
ATOM   3883 C C   . ALA B 1 245 ? -14.999 -2.826  15.647  1.00 49.16  ? 450 ALA B C   1 
ATOM   3884 O O   . ALA B 1 245 ? -15.510 -3.677  14.918  1.00 47.94  ? 450 ALA B O   1 
ATOM   3885 C CB  . ALA B 1 245 ? -13.833 -3.812  17.631  1.00 45.41  ? 450 ALA B CB  1 
ATOM   3886 N N   . GLN B 1 246 ? -15.579 -1.658  15.909  1.00 51.73  ? 451 GLN B N   1 
ATOM   3887 C CA  . GLN B 1 246 ? -16.854 -1.286  15.320  1.00 54.81  ? 451 GLN B CA  1 
ATOM   3888 C C   . GLN B 1 246 ? -16.651 -1.171  13.823  1.00 55.29  ? 451 GLN B C   1 
ATOM   3889 O O   . GLN B 1 246 ? -17.292 -1.875  13.044  1.00 54.84  ? 451 GLN B O   1 
ATOM   3890 C CB  . GLN B 1 246 ? -17.326 0.062   15.871  1.00 58.36  ? 451 GLN B CB  1 
ATOM   3891 C CG  . GLN B 1 246 ? -17.354 0.173   17.414  1.00 63.89  ? 451 GLN B CG  1 
ATOM   3892 C CD  . GLN B 1 246 ? -18.698 -0.188  18.025  1.00 67.06  ? 451 GLN B CD  1 
ATOM   3893 O OE1 . GLN B 1 246 ? -19.191 -1.304  17.851  1.00 70.04  ? 451 GLN B OE1 1 
ATOM   3894 N NE2 . GLN B 1 246 ? -19.296 0.759   18.755  1.00 66.77  ? 451 GLN B NE2 1 
ATOM   3895 N N   . MET B 1 247 ? -15.751 -0.278  13.420  1.00 55.33  ? 452 MET B N   1 
ATOM   3896 C CA  . MET B 1 247 ? -15.469 -0.074  12.008  1.00 55.97  ? 452 MET B CA  1 
ATOM   3897 C C   . MET B 1 247 ? -15.154 -1.352  11.334  1.00 56.61  ? 452 MET B C   1 
ATOM   3898 O O   . MET B 1 247 ? -15.578 -1.585  10.206  1.00 57.44  ? 452 MET B O   1 
ATOM   3899 C CB  . MET B 1 247 ? -14.287 0.878   11.813  1.00 57.16  ? 452 MET B CB  1 
ATOM   3900 C CG  . MET B 1 247 ? -14.531 2.314   12.213  1.00 59.49  ? 452 MET B CG  1 
ATOM   3901 S SD  . MET B 1 247 ? -13.204 3.390   11.608  1.00 64.33  ? 452 MET B SD  1 
ATOM   3902 C CE  . MET B 1 247 ? -12.107 3.447   13.025  1.00 61.47  ? 452 MET B CE  1 
ATOM   3903 N N   . MET B 1 248 ? -14.395 -2.207  12.009  1.00 56.88  ? 453 MET B N   1 
ATOM   3904 C CA  . MET B 1 248 ? -14.002 -3.474  11.422  1.00 57.80  ? 453 MET B CA  1 
ATOM   3905 C C   . MET B 1 248 ? -15.119 -4.406  11.246  1.00 58.26  ? 453 MET B C   1 
ATOM   3906 O O   . MET B 1 248 ? -15.113 -5.193  10.312  1.00 57.99  ? 453 MET B O   1 
ATOM   3907 C CB  . MET B 1 248 ? -12.892 -4.124  12.248  1.00 58.77  ? 453 MET B CB  1 
ATOM   3908 C CG  . MET B 1 248 ? -11.628 -3.247  12.388  1.00 60.60  ? 453 MET B CG  1 
ATOM   3909 S SD  . MET B 1 248 ? -11.046 -2.482  10.836  1.00 64.70  ? 453 MET B SD  1 
ATOM   3910 C CE  . MET B 1 248 ? -11.452 -0.744  11.106  1.00 62.56  ? 453 MET B CE  1 
ATOM   3911 N N   . GLN B 1 249 ? -16.103 -4.366  12.137  1.00 59.77  ? 454 GLN B N   1 
ATOM   3912 C CA  . GLN B 1 249 ? -17.255 -5.247  11.985  1.00 61.04  ? 454 GLN B CA  1 
ATOM   3913 C C   . GLN B 1 249 ? -17.957 -4.806  10.690  1.00 62.34  ? 454 GLN B C   1 
ATOM   3914 O O   . GLN B 1 249 ? -18.324 -5.633  9.850   1.00 62.53  ? 454 GLN B O   1 
ATOM   3915 C CB  . GLN B 1 249 ? -18.194 -5.113  13.177  1.00 61.03  ? 454 GLN B CB  1 
ATOM   3916 N N   . ARG B 1 250 ? -18.121 -3.494  10.536  1.00 62.72  ? 455 ARG B N   1 
ATOM   3917 C CA  . ARG B 1 250 ? -18.742 -2.937  9.346   1.00 64.38  ? 455 ARG B CA  1 
ATOM   3918 C C   . ARG B 1 250 ? -18.018 -3.405  8.148   1.00 64.86  ? 455 ARG B C   1 
ATOM   3919 O O   . ARG B 1 250 ? -18.557 -4.144  7.335   1.00 65.92  ? 455 ARG B O   1 
ATOM   3920 C CB  . ARG B 1 250 ? -18.715 -1.409  9.390   1.00 65.87  ? 455 ARG B CB  1 
ATOM   3921 C CG  . ARG B 1 250 ? -19.802 -0.805  10.253  1.00 70.44  ? 455 ARG B CG  1 
ATOM   3922 C CD  . ARG B 1 250 ? -21.186 -1.049  9.629   1.00 74.77  ? 455 ARG B CD  1 
ATOM   3923 N NE  . ARG B 1 250 ? -21.361 -0.300  8.384   1.00 77.21  ? 455 ARG B NE  1 
ATOM   3924 C CZ  . ARG B 1 250 ? -22.354 -0.496  7.520   1.00 77.81  ? 455 ARG B CZ  1 
ATOM   3925 N NH1 . ARG B 1 250 ? -23.273 -1.426  7.753   1.00 77.05  ? 455 ARG B NH1 1 
ATOM   3926 N NH2 . ARG B 1 250 ? -22.427 0.244   6.423   1.00 78.40  ? 455 ARG B NH2 1 
ATOM   3927 N N   . ILE B 1 251 ? -16.768 -2.984  8.023   1.00 65.10  ? 456 ILE B N   1 
ATOM   3928 C CA  . ILE B 1 251 ? -15.933 -3.357  6.894   1.00 65.06  ? 456 ILE B CA  1 
ATOM   3929 C C   . ILE B 1 251 ? -15.963 -4.853  6.569   1.00 65.85  ? 456 ILE B C   1 
ATOM   3930 O O   . ILE B 1 251 ? -16.028 -5.233  5.406   1.00 65.55  ? 456 ILE B O   1 
ATOM   3931 C CB  . ILE B 1 251 ? -14.485 -2.916  7.146   1.00 65.15  ? 456 ILE B CB  1 
ATOM   3932 C CG1 . ILE B 1 251 ? -14.453 -1.396  7.349   1.00 65.06  ? 456 ILE B CG1 1 
ATOM   3933 C CG2 . ILE B 1 251 ? -13.593 -3.355  5.995   1.00 64.13  ? 456 ILE B CG2 1 
ATOM   3934 C CD1 . ILE B 1 251 ? -13.069 -0.829  7.671   1.00 65.91  ? 456 ILE B CD1 1 
ATOM   3935 N N   . LYS B 1 252 ? -15.915 -5.704  7.589   1.00 67.52  ? 457 LYS B N   1 
ATOM   3936 C CA  . LYS B 1 252 ? -15.942 -7.141  7.353   1.00 69.27  ? 457 LYS B CA  1 
ATOM   3937 C C   . LYS B 1 252 ? -17.175 -7.469  6.563   1.00 71.17  ? 457 LYS B C   1 
ATOM   3938 O O   . LYS B 1 252 ? -17.120 -8.249  5.614   1.00 72.26  ? 457 LYS B O   1 
ATOM   3939 C CB  . LYS B 1 252 ? -15.940 -7.907  8.681   1.00 69.82  ? 457 LYS B CB  1 
ATOM   3940 C CG  . LYS B 1 252 ? -15.683 -9.451  8.531   1.00 72.63  ? 457 LYS B CG  1 
ATOM   3941 C CD  . LYS B 1 252 ? -15.266 -10.113 9.893   1.00 74.10  ? 457 LYS B CD  1 
ATOM   3942 C CE  . LYS B 1 252 ? -14.943 -11.645 9.756   1.00 74.52  ? 457 LYS B CE  1 
ATOM   3943 N NZ  . LYS B 1 252 ? -14.487 -12.269 11.046  1.00 72.01  ? 457 LYS B NZ  1 
ATOM   3944 N N   . LYS B 1 253 ? -18.296 -6.859  6.950   1.00 72.46  ? 458 LYS B N   1 
ATOM   3945 C CA  . LYS B 1 253 ? -19.585 -7.051  6.291   1.00 72.63  ? 458 LYS B CA  1 
ATOM   3946 C C   . LYS B 1 253 ? -19.629 -6.430  4.875   1.00 73.69  ? 458 LYS B C   1 
ATOM   3947 O O   . LYS B 1 253 ? -19.677 -7.155  3.881   1.00 75.76  ? 458 LYS B O   1 
ATOM   3948 C CB  . LYS B 1 253 ? -20.710 -6.435  7.134   1.00 73.29  ? 458 LYS B CB  1 
ATOM   3949 C CG  . LYS B 1 253 ? -21.096 -7.200  8.452   1.00 74.59  ? 458 LYS B CG  1 
ATOM   3950 C CD  . LYS B 1 253 ? -21.794 -8.569  8.157   1.00 75.51  ? 458 LYS B CD  1 
ATOM   3951 C CE  . LYS B 1 253 ? -22.534 -9.128  9.398   1.00 74.50  ? 458 LYS B CE  1 
ATOM   3952 N NZ  . LYS B 1 253 ? -21.637 -9.335  10.568  1.00 75.04  ? 458 LYS B NZ  1 
ATOM   3953 N N   . THR B 1 254 ? -19.604 -5.099  4.800   1.00 73.25  ? 459 THR B N   1 
ATOM   3954 C CA  . THR B 1 254 ? -19.675 -4.379  3.522   1.00 73.14  ? 459 THR B CA  1 
ATOM   3955 C C   . THR B 1 254 ? -18.522 -4.618  2.526   1.00 73.18  ? 459 THR B C   1 
ATOM   3956 O O   . THR B 1 254 ? -18.712 -4.502  1.317   1.00 73.09  ? 459 THR B O   1 
ATOM   3957 C CB  . THR B 1 254 ? -19.792 -2.846  3.734   1.00 72.80  ? 459 THR B CB  1 
ATOM   3958 O OG1 . THR B 1 254 ? -18.500 -2.295  4.019   1.00 73.65  ? 459 THR B OG1 1 
ATOM   3959 C CG2 . THR B 1 254 ? -20.733 -2.540  4.887   1.00 72.06  ? 459 THR B CG2 1 
ATOM   3960 N N   . GLU B 1 255 ? -17.335 -4.929  3.028   1.00 73.43  ? 460 GLU B N   1 
ATOM   3961 C CA  . GLU B 1 255 ? -16.201 -5.173  2.150   1.00 74.13  ? 460 GLU B CA  1 
ATOM   3962 C C   . GLU B 1 255 ? -15.966 -6.650  1.999   1.00 75.48  ? 460 GLU B C   1 
ATOM   3963 O O   . GLU B 1 255 ? -14.903 -7.163  2.351   1.00 75.84  ? 460 GLU B O   1 
ATOM   3964 C CB  . GLU B 1 255 ? -14.939 -4.508  2.701   1.00 73.53  ? 460 GLU B CB  1 
ATOM   3965 C CG  . GLU B 1 255 ? -15.062 -3.021  2.921   1.00 72.52  ? 460 GLU B CG  1 
ATOM   3966 C CD  . GLU B 1 255 ? -15.554 -2.296  1.691   1.00 72.84  ? 460 GLU B CD  1 
ATOM   3967 O OE1 . GLU B 1 255 ? -14.996 -2.535  0.600   1.00 71.90  ? 460 GLU B OE1 1 
ATOM   3968 O OE2 . GLU B 1 255 ? -16.495 -1.483  1.817   1.00 72.34  ? 460 GLU B OE2 1 
ATOM   3969 N N   . THR B 1 256 ? -16.965 -7.352  1.478   1.00 76.48  ? 461 THR B N   1 
ATOM   3970 C CA  . THR B 1 256 ? -16.846 -8.790  1.271   1.00 77.44  ? 461 THR B CA  1 
ATOM   3971 C C   . THR B 1 256 ? -15.615 -9.075  0.430   1.00 77.39  ? 461 THR B C   1 
ATOM   3972 O O   . THR B 1 256 ? -14.956 -10.103 0.592   1.00 77.61  ? 461 THR B O   1 
ATOM   3973 C CB  . THR B 1 256 ? -18.084 -9.345  0.549   1.00 78.15  ? 461 THR B CB  1 
ATOM   3974 O OG1 . THR B 1 256 ? -18.229 -8.692  -0.721  1.00 78.02  ? 461 THR B OG1 1 
ATOM   3975 C CG2 . THR B 1 256 ? -19.337 -9.107  1.391   1.00 77.93  ? 461 THR B CG2 1 
ATOM   3976 N N   . GLU B 1 257 ? -15.312 -8.150  -0.474  1.00 77.09  ? 462 GLU B N   1 
ATOM   3977 C CA  . GLU B 1 257 ? -14.161 -8.255  -1.357  1.00 77.19  ? 462 GLU B CA  1 
ATOM   3978 C C   . GLU B 1 257 ? -12.840 -8.461  -0.548  1.00 75.75  ? 462 GLU B C   1 
ATOM   3979 O O   . GLU B 1 257 ? -12.164 -9.479  -0.705  1.00 74.85  ? 462 GLU B O   1 
ATOM   3980 C CB  . GLU B 1 257 ? -14.061 -6.975  -2.202  1.00 79.35  ? 462 GLU B CB  1 
ATOM   3981 C CG  . GLU B 1 257 ? -12.874 -6.904  -3.197  1.00 82.45  ? 462 GLU B CG  1 
ATOM   3982 C CD  . GLU B 1 257 ? -13.137 -7.654  -4.494  1.00 84.24  ? 462 GLU B CD  1 
ATOM   3983 O OE1 . GLU B 1 257 ? -13.123 -8.904  -4.484  1.00 85.00  ? 462 GLU B OE1 1 
ATOM   3984 O OE2 . GLU B 1 257 ? -13.362 -6.986  -5.527  1.00 84.76  ? 462 GLU B OE2 1 
ATOM   3985 N N   . THR B 1 258 ? -12.517 -7.490  0.310   1.00 73.65  ? 463 THR B N   1 
ATOM   3986 C CA  . THR B 1 258 ? -11.296 -7.503  1.119   1.00 69.88  ? 463 THR B CA  1 
ATOM   3987 C C   . THR B 1 258 ? -11.203 -8.638  2.105   1.00 67.87  ? 463 THR B C   1 
ATOM   3988 O O   . THR B 1 258 ? -12.134 -8.898  2.867   1.00 67.71  ? 463 THR B O   1 
ATOM   3989 C CB  . THR B 1 258 ? -11.137 -6.180  1.884   1.00 69.69  ? 463 THR B CB  1 
ATOM   3990 O OG1 . THR B 1 258 ? -12.138 -6.089  2.900   1.00 70.62  ? 463 THR B OG1 1 
ATOM   3991 C CG2 . THR B 1 258 ? -11.313 -5.012  0.944   1.00 70.77  ? 463 THR B CG2 1 
ATOM   3992 N N   . SER B 1 259 ? -10.057 -9.310  2.099   1.00 64.99  ? 464 SER B N   1 
ATOM   3993 C CA  . SER B 1 259 ? -9.816  -10.442 2.982   1.00 63.10  ? 464 SER B CA  1 
ATOM   3994 C C   . SER B 1 259 ? -9.287  -10.021 4.344   1.00 61.55  ? 464 SER B C   1 
ATOM   3995 O O   . SER B 1 259 ? -8.768  -8.918  4.516   1.00 62.12  ? 464 SER B O   1 
ATOM   3996 C CB  . SER B 1 259 ? -8.829  -11.413 2.328   1.00 63.91  ? 464 SER B CB  1 
ATOM   3997 O OG  . SER B 1 259 ? -7.555  -10.818 2.158   1.00 65.68  ? 464 SER B OG  1 
ATOM   3998 N N   . LEU B 1 260 ? -9.416  -10.914 5.316   1.00 58.25  ? 465 LEU B N   1 
ATOM   3999 C CA  . LEU B 1 260 ? -8.961  -10.638 6.663   1.00 54.73  ? 465 LEU B CA  1 
ATOM   4000 C C   . LEU B 1 260 ? -8.022  -11.743 7.094   1.00 52.67  ? 465 LEU B C   1 
ATOM   4001 O O   . LEU B 1 260 ? -8.373  -12.919 7.016   1.00 53.86  ? 465 LEU B O   1 
ATOM   4002 C CB  . LEU B 1 260 ? -10.167 -10.562 7.602   1.00 55.27  ? 465 LEU B CB  1 
ATOM   4003 C CG  . LEU B 1 260 ? -9.922  -10.051 9.023   1.00 56.56  ? 465 LEU B CG  1 
ATOM   4004 C CD1 . LEU B 1 260 ? -9.293  -8.667  8.953   1.00 57.17  ? 465 LEU B CD1 1 
ATOM   4005 C CD2 . LEU B 1 260 ? -11.231 -10.015 9.804   1.00 56.07  ? 465 LEU B CD2 1 
ATOM   4006 N N   . HIS B 1 261 ? -6.820  -11.376 7.531   1.00 48.79  ? 466 HIS B N   1 
ATOM   4007 C CA  . HIS B 1 261 ? -5.837  -12.357 7.983   1.00 46.29  ? 466 HIS B CA  1 
ATOM   4008 C C   . HIS B 1 261 ? -6.435  -13.222 9.131   1.00 46.86  ? 466 HIS B C   1 
ATOM   4009 O O   . HIS B 1 261 ? -7.019  -12.702 10.087  1.00 46.18  ? 466 HIS B O   1 
ATOM   4010 C CB  . HIS B 1 261 ? -4.575  -11.645 8.470   1.00 43.74  ? 466 HIS B CB  1 
ATOM   4011 C CG  . HIS B 1 261 ? -3.520  -12.568 9.001   1.00 39.09  ? 466 HIS B CG  1 
ATOM   4012 N ND1 . HIS B 1 261 ? -2.317  -12.773 8.362   1.00 37.59  ? 466 HIS B ND1 1 
ATOM   4013 C CD2 . HIS B 1 261 ? -3.489  -13.339 10.110  1.00 38.00  ? 466 HIS B CD2 1 
ATOM   4014 C CE1 . HIS B 1 261 ? -1.591  -13.630 9.056   1.00 37.04  ? 466 HIS B CE1 1 
ATOM   4015 N NE2 . HIS B 1 261 ? -2.280  -13.989 10.122  1.00 36.34  ? 466 HIS B NE2 1 
ATOM   4016 N N   . PRO B 1 262 ? -6.283  -14.550 9.033   1.00 47.49  ? 467 PRO B N   1 
ATOM   4017 C CA  . PRO B 1 262 ? -6.782  -15.523 10.015  1.00 46.71  ? 467 PRO B CA  1 
ATOM   4018 C C   . PRO B 1 262 ? -6.548  -15.172 11.544  1.00 44.59  ? 467 PRO B C   1 
ATOM   4019 O O   . PRO B 1 262 ? -7.465  -15.289 12.350  1.00 43.54  ? 467 PRO B O   1 
ATOM   4020 C CB  . PRO B 1 262 ? -6.099  -16.829 9.584   1.00 48.29  ? 467 PRO B CB  1 
ATOM   4021 C CG  . PRO B 1 262 ? -4.905  -16.369 8.769   1.00 47.54  ? 467 PRO B CG  1 
ATOM   4022 C CD  . PRO B 1 262 ? -5.460  -15.214 8.008   1.00 46.79  ? 467 PRO B CD  1 
ATOM   4023 N N   . LEU B 1 263 ? -5.332  -14.764 11.897  1.00 43.77  ? 468 LEU B N   1 
ATOM   4024 C CA  . LEU B 1 263 ? -4.998  -14.387 13.271  1.00 43.08  ? 468 LEU B CA  1 
ATOM   4025 C C   . LEU B 1 263 ? -5.846  -13.203 13.711  1.00 43.43  ? 468 LEU B C   1 
ATOM   4026 O O   . LEU B 1 263 ? -6.346  -13.161 14.842  1.00 42.74  ? 468 LEU B O   1 
ATOM   4027 C CB  . LEU B 1 263 ? -3.517  -14.007 13.374  1.00 43.98  ? 468 LEU B CB  1 
ATOM   4028 C CG  . LEU B 1 263 ? -2.944  -13.685 14.763  1.00 44.43  ? 468 LEU B CG  1 
ATOM   4029 C CD1 . LEU B 1 263 ? -3.026  -14.918 15.661  1.00 44.04  ? 468 LEU B CD1 1 
ATOM   4030 C CD2 . LEU B 1 263 ? -1.498  -13.237 14.628  1.00 43.24  ? 468 LEU B CD2 1 
ATOM   4031 N N   . LEU B 1 264 ? -5.996  -12.225 12.820  1.00 42.79  ? 469 LEU B N   1 
ATOM   4032 C CA  . LEU B 1 264 ? -6.804  -11.054 13.127  1.00 42.64  ? 469 LEU B CA  1 
ATOM   4033 C C   . LEU B 1 264 ? -8.269  -11.461 13.250  1.00 43.41  ? 469 LEU B C   1 
ATOM   4034 O O   . LEU B 1 264 ? -9.000  -10.917 14.069  1.00 44.03  ? 469 LEU B O   1 
ATOM   4035 C CB  . LEU B 1 264 ? -6.622  -9.988  12.045  1.00 39.98  ? 469 LEU B CB  1 
ATOM   4036 C CG  . LEU B 1 264 ? -5.180  -9.487  11.913  1.00 38.25  ? 469 LEU B CG  1 
ATOM   4037 C CD1 . LEU B 1 264 ? -5.074  -8.408  10.844  1.00 35.47  ? 469 LEU B CD1 1 
ATOM   4038 C CD2 . LEU B 1 264 ? -4.726  -8.944  13.252  1.00 37.35  ? 469 LEU B CD2 1 
ATOM   4039 N N   . GLN B 1 265 ? -8.695  -12.421 12.435  1.00 44.67  ? 470 GLN B N   1 
ATOM   4040 C CA  . GLN B 1 265 ? -10.065 -12.909 12.489  1.00 47.27  ? 470 GLN B CA  1 
ATOM   4041 C C   . GLN B 1 265 ? -10.344 -13.502 13.857  1.00 47.31  ? 470 GLN B C   1 
ATOM   4042 O O   . GLN B 1 265 ? -11.377 -13.224 14.471  1.00 48.17  ? 470 GLN B O   1 
ATOM   4043 C CB  . GLN B 1 265 ? -10.294 -13.961 11.401  1.00 51.33  ? 470 GLN B CB  1 
ATOM   4044 C CG  . GLN B 1 265 ? -10.457 -13.355 10.002  1.00 58.44  ? 470 GLN B CG  1 
ATOM   4045 C CD  . GLN B 1 265 ? -10.643 -14.396 8.907   1.00 62.54  ? 470 GLN B CD  1 
ATOM   4046 O OE1 . GLN B 1 265 ? -9.725  -15.167 8.590   1.00 63.77  ? 470 GLN B OE1 1 
ATOM   4047 N NE2 . GLN B 1 265 ? -11.837 -14.419 8.320   1.00 64.08  ? 470 GLN B NE2 1 
ATOM   4048 N N   . GLU B 1 266 ? -9.417  -14.327 14.335  1.00 46.46  ? 471 GLU B N   1 
ATOM   4049 C CA  . GLU B 1 266 ? -9.535  -14.948 15.646  1.00 45.68  ? 471 GLU B CA  1 
ATOM   4050 C C   . GLU B 1 266 ? -9.670  -13.935 16.720  1.00 45.49  ? 471 GLU B C   1 
ATOM   4051 O O   . GLU B 1 266 ? -10.477 -14.103 17.625  1.00 44.85  ? 471 GLU B O   1 
ATOM   4052 C CB  . GLU B 1 266 ? -8.310  -15.810 15.948  1.00 46.38  ? 471 GLU B CB  1 
ATOM   4053 C CG  . GLU B 1 266 ? -8.324  -17.173 15.316  1.00 47.69  ? 471 GLU B CG  1 
ATOM   4054 C CD  . GLU B 1 266 ? -9.569  -17.960 15.676  1.00 49.29  ? 471 GLU B CD  1 
ATOM   4055 O OE1 . GLU B 1 266 ? -9.943  -18.004 16.868  1.00 47.70  ? 471 GLU B OE1 1 
ATOM   4056 O OE2 . GLU B 1 266 ? -10.174 -18.541 14.754  1.00 52.91  ? 471 GLU B OE2 1 
ATOM   4057 N N   . ILE B 1 267 ? -8.870  -12.873 16.646  1.00 46.35  ? 472 ILE B N   1 
ATOM   4058 C CA  . ILE B 1 267 ? -8.899  -11.816 17.647  1.00 48.17  ? 472 ILE B CA  1 
ATOM   4059 C C   . ILE B 1 267 ? -10.240 -11.170 17.768  1.00 50.45  ? 472 ILE B C   1 
ATOM   4060 O O   . ILE B 1 267 ? -10.854 -11.194 18.837  1.00 50.37  ? 472 ILE B O   1 
ATOM   4061 C CB  . ILE B 1 267 ? -7.842  -10.730 17.343  1.00 47.45  ? 472 ILE B CB  1 
ATOM   4062 C CG1 . ILE B 1 267 ? -6.446  -11.287 17.604  1.00 47.77  ? 472 ILE B CG1 1 
ATOM   4063 C CG2 . ILE B 1 267 ? -8.069  -9.509  18.204  1.00 46.42  ? 472 ILE B CG2 1 
ATOM   4064 C CD1 . ILE B 1 267 ? -5.318  -10.289 17.309  1.00 45.12  ? 472 ILE B CD1 1 
ATOM   4065 N N   . TYR B 1 268 ? -10.725 -10.602 16.670  1.00 53.48  ? 473 TYR B N   1 
ATOM   4066 C CA  . TYR B 1 268 ? -12.014 -9.916  16.659  1.00 57.91  ? 473 TYR B CA  1 
ATOM   4067 C C   . TYR B 1 268 ? -13.281 -10.829 16.705  1.00 61.04  ? 473 TYR B C   1 
ATOM   4068 O O   . TYR B 1 268 ? -14.392 -10.327 16.881  1.00 61.90  ? 473 TYR B O   1 
ATOM   4069 C CB  . TYR B 1 268 ? -12.083 -9.000  15.424  1.00 56.28  ? 473 TYR B CB  1 
ATOM   4070 C CG  . TYR B 1 268 ? -11.167 -7.798  15.505  1.00 55.82  ? 473 TYR B CG  1 
ATOM   4071 C CD1 . TYR B 1 268 ? -11.321 -6.854  16.509  1.00 55.82  ? 473 TYR B CD1 1 
ATOM   4072 C CD2 . TYR B 1 268 ? -10.145 -7.609  14.583  1.00 55.61  ? 473 TYR B CD2 1 
ATOM   4073 C CE1 . TYR B 1 268 ? -10.485 -5.760  16.591  1.00 55.40  ? 473 TYR B CE1 1 
ATOM   4074 C CE2 . TYR B 1 268 ? -9.303  -6.513  14.662  1.00 54.01  ? 473 TYR B CE2 1 
ATOM   4075 C CZ  . TYR B 1 268 ? -9.484  -5.598  15.668  1.00 53.37  ? 473 TYR B CZ  1 
ATOM   4076 O OH  . TYR B 1 268 ? -8.673  -4.508  15.767  1.00 56.28  ? 473 TYR B OH  1 
ATOM   4077 N N   . LYS B 1 269 ? -13.084 -12.141 16.583  1.00 65.08  ? 474 LYS B N   1 
ATOM   4078 C CA  . LYS B 1 269 ? -14.161 -13.135 16.542  1.00 69.51  ? 474 LYS B CA  1 
ATOM   4079 C C   . LYS B 1 269 ? -15.495 -12.876 17.272  1.00 73.62  ? 474 LYS B C   1 
ATOM   4080 O O   . LYS B 1 269 ? -16.549 -12.950 16.646  1.00 73.97  ? 474 LYS B O   1 
ATOM   4081 C CB  . LYS B 1 269 ? -13.626 -14.507 16.965  1.00 68.30  ? 474 LYS B CB  1 
ATOM   4082 C CG  . LYS B 1 269 ? -14.520 -15.654 16.505  1.00 68.11  ? 474 LYS B CG  1 
ATOM   4083 C CD  . LYS B 1 269 ? -13.740 -16.984 16.267  1.00 69.14  ? 474 LYS B CD  1 
ATOM   4084 C CE  . LYS B 1 269 ? -13.281 -17.631 17.562  1.00 69.09  ? 474 LYS B CE  1 
ATOM   4085 N NZ  . LYS B 1 269 ? -12.873 -19.056 17.375  1.00 70.26  ? 474 LYS B NZ  1 
ATOM   4086 N N   . ASP B 1 270 ? -15.452 -12.569 18.564  1.00 78.12  ? 475 ASP B N   1 
ATOM   4087 C CA  . ASP B 1 270 ? -16.668 -12.331 19.339  1.00 83.55  ? 475 ASP B CA  1 
ATOM   4088 C C   . ASP B 1 270 ? -17.967 -11.805 18.594  1.00 86.09  ? 475 ASP B C   1 
ATOM   4089 O O   . ASP B 1 270 ? -19.010 -12.466 18.654  1.00 86.82  ? 475 ASP B O   1 
ATOM   4090 C CB  . ASP B 1 270 ? -16.323 -11.441 20.521  1.00 84.78  ? 475 ASP B CB  1 
ATOM   4091 C CG  . ASP B 1 270 ? -15.650 -12.222 21.631  1.00 86.65  ? 475 ASP B CG  1 
ATOM   4092 O OD1 . ASP B 1 270 ? -15.226 -13.374 21.369  1.00 86.23  ? 475 ASP B OD1 1 
ATOM   4093 O OD2 . ASP B 1 270 ? -15.548 -11.689 22.758  1.00 87.40  ? 475 ASP B OD2 1 
ATOM   4094 N N   . MET B 1 271 ? -17.897 -10.654 17.925  1.00 88.52  ? 476 MET B N   1 
ATOM   4095 C CA  . MET B 1 271 ? -19.067 -10.141 17.205  1.00 90.86  ? 476 MET B CA  1 
ATOM   4096 C C   . MET B 1 271 ? -19.057 -10.640 15.741  1.00 91.52  ? 476 MET B C   1 
ATOM   4097 O O   . MET B 1 271 ? -18.009 -11.173 15.319  1.00 92.05  ? 476 MET B O   1 
ATOM   4098 C CB  . MET B 1 271 ? -19.102 -8.603  17.227  1.00 91.31  ? 476 MET B CB  1 
ATOM   4099 C CG  . MET B 1 271 ? -17.946 -7.889  16.482  1.00 92.34  ? 476 MET B CG  1 
ATOM   4100 S SD  . MET B 1 271 ? -16.359 -8.029  17.322  1.00 93.93  ? 476 MET B SD  1 
ATOM   4101 C CE  . MET B 1 271 ? -16.821 -7.490  19.012  1.00 92.45  ? 476 MET B CE  1 
HETATM 4102 I I   . IOD C 2 .   ? 25.106  -7.151  63.855  1.00 64.46  ? 200 IOD A I   1 
HETATM 4103 I I   . IOD D 2 .   ? 15.047  -1.942  66.768  1.00 85.94  ? 202 IOD A I   1 
HETATM 4104 I I   . IOD E 2 .   ? 49.336  1.216   60.192  1.00 167.82 ? 203 IOD A I   1 
HETATM 4105 I I   . IOD F 2 .   ? 26.928  11.000  52.184  1.00 158.73 ? 478 IOD A I   1 
HETATM 4106 I I   . IOD G 2 .   ? 36.452  13.139  77.448  1.00 200.58 ? 479 IOD A I   1 
HETATM 4107 I I   . IOD H 2 .   ? 32.002  25.848  57.650  1.00 91.93  ? 480 IOD A I   1 
HETATM 4108 I I   . IOD I 2 .   ? 28.004  28.864  85.851  1.00 96.61  ? 481 IOD A I   1 
HETATM 4109 C C1  . 331 J 3 .   ? 27.385  7.164   60.481  1.00 42.95  ? 482 331 A C1  1 
HETATM 4110 N N2  . 331 J 3 .   ? 28.575  7.072   59.852  1.00 40.47  ? 482 331 A N2  1 
HETATM 4111 C C3  . 331 J 3 .   ? 27.477  7.067   61.893  1.00 45.24  ? 482 331 A C3  1 
HETATM 4112 C C4  . 331 J 3 .   ? 26.123  7.336   59.888  1.00 41.91  ? 482 331 A C4  1 
HETATM 4113 C C5  . 331 J 3 .   ? 28.863  6.305   58.799  1.00 39.16  ? 482 331 A C5  1 
HETATM 4114 C C6  . 331 J 3 .   ? 26.374  7.139   62.735  1.00 43.94  ? 482 331 A C6  1 
HETATM 4115 F F7  . 331 J 3 .   ? 28.685  6.892   62.447  1.00 48.15  ? 482 331 A F7  1 
HETATM 4116 C C8  . 331 J 3 .   ? 24.999  7.408   60.736  1.00 43.78  ? 482 331 A C8  1 
HETATM 4117 N N9  . 331 J 3 .   ? 30.152  6.369   58.371  1.00 36.18  ? 482 331 A N9  1 
HETATM 4118 O O10 . 331 J 3 .   ? 28.028  5.584   58.256  1.00 41.66  ? 482 331 A O10 1 
HETATM 4119 C C11 . 331 J 3 .   ? 25.154  7.308   62.133  1.00 43.22  ? 482 331 A C11 1 
HETATM 4120 C C12 . 331 J 3 .   ? 31.205  7.211   58.981  1.00 33.50  ? 482 331 A C12 1 
HETATM 4121 C C13 . 331 J 3 .   ? 30.477  5.525   57.237  1.00 33.84  ? 482 331 A C13 1 
HETATM 4122 F F14 . 331 J 3 .   ? 24.129  7.369   62.950  1.00 46.12  ? 482 331 A F14 1 
HETATM 4123 C C15 . 331 J 3 .   ? 32.047  6.528   60.056  1.00 31.41  ? 482 331 A C15 1 
HETATM 4124 C C16 . 331 J 3 .   ? 30.248  6.264   55.956  1.00 33.16  ? 482 331 A C16 1 
HETATM 4125 C C17 . 331 J 3 .   ? 33.136  7.467   60.307  1.00 31.07  ? 482 331 A C17 1 
HETATM 4126 C C18 . 331 J 3 .   ? 30.943  5.418   54.942  1.00 35.02  ? 482 331 A C18 1 
HETATM 4127 C C19 . 331 J 3 .   ? 34.278  7.399   59.522  1.00 30.74  ? 482 331 A C19 1 
HETATM 4128 C C20 . 331 J 3 .   ? 33.050  8.450   61.312  1.00 31.31  ? 482 331 A C20 1 
HETATM 4129 C C21 . 331 J 3 .   ? 30.551  5.904   53.547  1.00 37.60  ? 482 331 A C21 1 
HETATM 4130 C C22 . 331 J 3 .   ? 35.310  8.310   59.731  1.00 29.71  ? 482 331 A C22 1 
HETATM 4131 C C23 . 331 J 3 .   ? 34.102  9.352   61.510  1.00 30.48  ? 482 331 A C23 1 
HETATM 4132 C C24 . 331 J 3 .   ? 31.228  5.133   52.403  1.00 37.87  ? 482 331 A C24 1 
HETATM 4133 C C25 . 331 J 3 .   ? 35.253  9.293   60.708  1.00 30.50  ? 482 331 A C25 1 
HETATM 4134 C C26 . 331 J 3 .   ? 30.725  5.543   51.029  1.00 38.08  ? 482 331 A C26 1 
HETATM 4135 O O27 . 331 J 3 .   ? 36.368  10.148  60.803  1.00 33.54  ? 482 331 A O27 1 
HETATM 4136 C C28 . 331 J 3 .   ? 30.861  4.326   50.134  1.00 39.49  ? 482 331 A C28 1 
HETATM 4137 C C29 . 331 J 3 .   ? 36.208  11.569  60.697  1.00 35.61  ? 482 331 A C29 1 
HETATM 4138 C C30 . 331 J 3 .   ? 35.674  12.152  62.027  1.00 36.87  ? 482 331 A C30 1 
HETATM 4139 C C31 . 331 J 3 .   ? 35.489  11.929  59.407  1.00 37.73  ? 482 331 A C31 1 
HETATM 4140 C C32 . 331 J 3 .   ? 37.537  12.330  60.609  1.00 34.95  ? 482 331 A C32 1 
HETATM 4141 O O33 . 331 J 3 .   ? 34.893  13.108  62.101  1.00 33.87  ? 482 331 A O33 1 
HETATM 4142 O O34 . 331 J 3 .   ? 36.090  11.599  63.041  1.00 36.09  ? 482 331 A O34 1 
HETATM 4143 C C35 . 331 J 3 .   ? 34.007  12.085  59.530  1.00 38.53  ? 482 331 A C35 1 
HETATM 4144 H H36 . 331 J 3 .   ? 29.329  7.615   60.220  1.00 40.57  ? 482 331 A H36 1 
HETATM 4145 H H37 . 331 J 3 .   ? 26.013  7.412   58.819  1.00 42.30  ? 482 331 A H37 1 
HETATM 4146 H H38 . 331 J 3 .   ? 26.451  7.066   63.803  1.00 44.00  ? 482 331 A H38 1 
HETATM 4147 H H39 . 331 J 3 .   ? 24.016  7.540   60.311  1.00 43.71  ? 482 331 A H39 1 
HETATM 4148 H H40 . 331 J 3 .   ? 30.790  8.131   59.356  1.00 33.71  ? 482 331 A H40 1 
HETATM 4149 H H41 . 331 J 3 .   ? 31.813  7.501   58.141  1.00 33.84  ? 482 331 A H41 1 
HETATM 4150 H H42 . 331 J 3 .   ? 29.879  4.636   57.282  1.00 34.07  ? 482 331 A H42 1 
HETATM 4151 H H43 . 331 J 3 .   ? 31.505  5.223   57.352  1.00 34.04  ? 482 331 A H43 1 
HETATM 4152 H H44 . 331 J 3 .   ? 32.462  5.595   59.707  1.00 31.74  ? 482 331 A H44 1 
HETATM 4153 H H45 . 331 J 3 .   ? 31.478  6.375   60.957  1.00 31.84  ? 482 331 A H45 1 
HETATM 4154 H H46 . 331 J 3 .   ? 30.665  7.256   55.985  1.00 33.31  ? 482 331 A H46 1 
HETATM 4155 H H47 . 331 J 3 .   ? 29.196  6.362   55.744  1.00 33.34  ? 482 331 A H47 1 
HETATM 4156 H H48 . 331 J 3 .   ? 30.693  4.376   55.090  1.00 35.11  ? 482 331 A H48 1 
HETATM 4157 H H49 . 331 J 3 .   ? 32.006  5.478   55.082  1.00 35.21  ? 482 331 A H49 1 
HETATM 4158 H H50 . 331 J 3 .   ? 34.348  6.651   58.752  1.00 30.75  ? 482 331 A H50 1 
HETATM 4159 H H51 . 331 J 3 .   ? 32.166  8.507   61.925  1.00 31.28  ? 482 331 A H51 1 
HETATM 4160 H H52 . 331 J 3 .   ? 30.781  6.956   53.456  1.00 37.56  ? 482 331 A H52 1 
HETATM 4161 H H53 . 331 J 3 .   ? 29.479  5.819   53.440  1.00 37.29  ? 482 331 A H53 1 
HETATM 4162 H H54 . 331 J 3 .   ? 36.172  8.240   59.103  1.00 30.36  ? 482 331 A H54 1 
HETATM 4163 H H55 . 331 J 3 .   ? 34.017  10.097  62.281  1.00 30.82  ? 482 331 A H55 1 
HETATM 4164 H H56 . 331 J 3 .   ? 31.066  4.074   52.537  1.00 37.86  ? 482 331 A H56 1 
HETATM 4165 H H57 . 331 J 3 .   ? 32.292  5.274   52.454  1.00 37.95  ? 482 331 A H57 1 
HETATM 4166 H H58 . 331 J 3 .   ? 31.272  6.379   50.625  1.00 38.35  ? 482 331 A H58 1 
HETATM 4167 H H59 . 331 J 3 .   ? 29.694  5.855   51.081  1.00 38.45  ? 482 331 A H59 1 
HETATM 4168 H H60 . 331 J 3 .   ? 30.467  4.517   49.146  1.00 39.42  ? 482 331 A H60 1 
HETATM 4169 H H61 . 331 J 3 .   ? 30.334  3.476   50.548  1.00 39.19  ? 482 331 A H61 1 
HETATM 4170 H H62 . 331 J 3 .   ? 31.900  4.046   50.034  1.00 39.35  ? 482 331 A H62 1 
HETATM 4171 H H63 . 331 J 3 .   ? 35.743  11.241  58.613  1.00 37.52  ? 482 331 A H63 1 
HETATM 4172 H H64 . 331 J 3 .   ? 35.848  12.896  59.088  1.00 38.00  ? 482 331 A H64 1 
HETATM 4173 H H65 . 331 J 3 .   ? 37.400  13.390  60.426  1.00 34.64  ? 482 331 A H65 1 
HETATM 4174 H H66 . 331 J 3 .   ? 38.164  11.933  59.827  1.00 35.05  ? 482 331 A H66 1 
HETATM 4175 H H67 . 331 J 3 .   ? 38.049  12.256  61.551  1.00 35.27  ? 482 331 A H67 1 
HETATM 4176 H H69 . 331 J 3 .   ? 33.694  13.065  59.212  1.00 38.46  ? 482 331 A H69 1 
HETATM 4177 H H70 . 331 J 3 .   ? 33.709  11.994  60.549  1.00 38.45  ? 482 331 A H70 1 
HETATM 4178 H H71 . 331 J 3 .   ? 33.496  11.313  58.977  1.00 38.48  ? 482 331 A H71 1 
HETATM 4179 C C5  . B7G K 4 .   ? 34.833  26.504  70.734  1.00 61.26  ? 483 B7G A C5  1 
HETATM 4180 O O5  . B7G K 4 .   ? 34.676  25.765  69.530  1.00 62.06  ? 483 B7G A O5  1 
HETATM 4181 C C1  . B7G K 4 .   ? 35.357  24.525  69.591  1.00 60.01  ? 483 B7G A C1  1 
HETATM 4182 C C2  . B7G K 4 .   ? 36.841  24.798  69.590  1.00 61.02  ? 483 B7G A C2  1 
HETATM 4183 C C3  . B7G K 4 .   ? 37.349  26.100  70.300  1.00 62.06  ? 483 B7G A C3  1 
HETATM 4184 C C4  . B7G K 4 .   ? 36.250  27.074  70.742  1.00 61.94  ? 483 B7G A C4  1 
HETATM 4185 C C6  . B7G K 4 .   ? 33.770  27.613  70.801  1.00 59.38  ? 483 B7G A C6  1 
HETATM 4186 O O1  . B7G K 4 .   ? 34.981  23.724  68.472  1.00 58.55  ? 483 B7G A O1  1 
HETATM 4187 C C7  . B7G K 4 .   ? 33.630  23.217  68.622  1.00 55.53  ? 483 B7G A C7  1 
HETATM 4188 C C8  . B7G K 4 .   ? 33.334  22.136  67.555  1.00 52.39  ? 483 B7G A C8  1 
HETATM 4189 C C9  . B7G K 4 .   ? 32.034  21.354  67.877  1.00 50.30  ? 483 B7G A C9  1 
HETATM 4190 C C10 . B7G K 4 .   ? 30.785  22.203  67.698  1.00 48.29  ? 483 B7G A C10 1 
HETATM 4191 C C11 . B7G K 4 .   ? 29.508  21.365  67.878  1.00 45.63  ? 483 B7G A C11 1 
HETATM 4192 C C12 . B7G K 4 .   ? 28.210  22.210  67.677  1.00 43.46  ? 483 B7G A C12 1 
HETATM 4193 O O2  . B7G K 4 .   ? 37.614  24.011  69.051  1.00 62.37  ? 483 B7G A O2  1 
HETATM 4194 O O3  . B7G K 4 .   ? 38.540  26.359  70.516  1.00 59.63  ? 483 B7G A O3  1 
HETATM 4195 O O4  . B7G K 4 .   ? 36.477  28.230  71.098  1.00 63.67  ? 483 B7G A O4  1 
HETATM 4196 O O6  . B7G K 4 .   ? 33.671  28.359  69.733  1.00 54.79  ? 483 B7G A O6  1 
HETATM 4197 C C13 . B7G K 4 .   ? 27.914  22.664  66.237  1.00 43.49  ? 483 B7G A C13 1 
HETATM 4198 I I   . IOD L 2 .   ? 3.362   14.549  17.642  1.00 80.21  ? 201 IOD B I   1 
HETATM 4199 I I   . IOD M 2 .   ? 7.745   0.959   11.081  1.00 158.71 ? 204 IOD B I   1 
HETATM 4200 I I   . IOD N 2 .   ? 11.931  9.119   22.967  1.00 106.12 ? 205 IOD B I   1 
HETATM 4201 I I   . IOD O 2 .   ? -11.611 -5.988  27.394  1.00 200.58 ? 478 IOD B I   1 
HETATM 4202 C C1  . 331 P 3 .   ? 1.875   0.228   13.774  1.00 54.61  ? 479 331 B C1  1 
HETATM 4203 N N2  . 331 P 3 .   ? 0.956   0.412   12.757  1.00 54.00  ? 479 331 B N2  1 
HETATM 4204 C C3  . 331 P 3 .   ? 1.465   0.321   15.121  1.00 55.94  ? 479 331 B C3  1 
HETATM 4205 C C4  . 331 P 3 .   ? 3.231   -0.073  13.524  1.00 54.54  ? 479 331 B C4  1 
HETATM 4206 C C5  . 331 P 3 .   ? 0.986   1.168   11.621  1.00 51.16  ? 479 331 B C5  1 
HETATM 4207 C C6  . 331 P 3 .   ? 2.379   0.114   16.200  1.00 55.89  ? 479 331 B C6  1 
HETATM 4208 F F7  . 331 P 3 .   ? 0.154   0.611   15.357  1.00 56.18  ? 479 331 B F7  1 
HETATM 4209 C C8  . 331 P 3 .   ? 4.143   -0.280  14.570  1.00 55.36  ? 479 331 B C8  1 
HETATM 4210 N N9  . 331 P 3 .   ? -0.121  1.090   10.810  1.00 48.42  ? 479 331 B N9  1 
HETATM 4211 O O10 . 331 P 3 .   ? 1.946   1.879   11.326  1.00 53.18  ? 479 331 B O10 1 
HETATM 4212 C C11 . 331 P 3 .   ? 3.715   -0.188  15.891  1.00 54.40  ? 479 331 B C11 1 
HETATM 4213 C C12 . 331 P 3 .   ? -1.289  0.254   11.081  1.00 45.18  ? 479 331 B C12 1 
HETATM 4214 C C13 . 331 P 3 .   ? -0.127  1.881   9.576   1.00 47.83  ? 479 331 B C13 1 
HETATM 4215 F F14 . 331 P 3 .   ? 4.620   -0.400  16.842  1.00 54.25  ? 479 331 B F14 1 
HETATM 4216 C C15 . 331 P 3 .   ? -2.340  0.911   11.960  1.00 43.25  ? 479 331 B C15 1 
HETATM 4217 C C16 . 331 P 3 .   ? 0.565   1.102   8.484   1.00 47.88  ? 479 331 B C16 1 
HETATM 4218 C C17 . 331 P 3 .   ? -3.494  -0.013  11.938  1.00 41.22  ? 479 331 B C17 1 
HETATM 4219 C C18 . 331 P 3 .   ? 0.335   1.832   7.182   1.00 48.77  ? 479 331 B C18 1 
HETATM 4220 C C19 . 331 P 3 .   ? -4.401  0.105   10.913  1.00 41.07  ? 479 331 B C19 1 
HETATM 4221 C C20 . 331 P 3 .   ? -3.686  -1.007  12.911  1.00 40.88  ? 479 331 B C20 1 
HETATM 4222 C C21 . 331 P 3 .   ? 1.169   1.302   5.965   1.00 48.09  ? 479 331 B C21 1 
HETATM 4223 C C22 . 331 P 3 .   ? -5.480  -0.765  10.843  1.00 41.41  ? 479 331 B C22 1 
HETATM 4224 C C23 . 331 P 3 .   ? -4.771  -1.876  12.851  1.00 39.39  ? 479 331 B C23 1 
HETATM 4225 C C24 . 331 P 3 .   ? 0.587   1.902   4.695   1.00 46.83  ? 479 331 B C24 1 
HETATM 4226 C C25 . 331 P 3 .   ? -5.687  -1.770  11.796  1.00 40.69  ? 479 331 B C25 1 
HETATM 4227 C C26 . 331 P 3 .   ? 1.432   1.721   3.461   1.00 46.31  ? 479 331 B C26 1 
HETATM 4228 O O27 . 331 P 3 .   ? -6.804  -2.586  11.589  1.00 40.84  ? 479 331 B O27 1 
HETATM 4229 C C28 . 331 P 3 .   ? 1.130   2.811   2.457   1.00 43.73  ? 479 331 B C28 1 
HETATM 4230 C C29 . 331 P 3 .   ? -6.701  -4.016  11.608  1.00 42.67  ? 479 331 B C29 1 
HETATM 4231 C C30 . 331 P 3 .   ? -6.511  -4.594  13.027  1.00 42.26  ? 479 331 B C30 1 
HETATM 4232 C C31 . 331 P 3 .   ? -5.705  -4.780  10.754  1.00 44.78  ? 479 331 B C31 1 
HETATM 4233 C C32 . 331 P 3 .   ? -8.066  -4.484  11.027  1.00 42.49  ? 479 331 B C32 1 
HETATM 4234 O O33 . 331 P 3 .   ? -5.781  -5.557  13.289  1.00 39.62  ? 479 331 B O33 1 
HETATM 4235 O O34 . 331 P 3 .   ? -7.144  -4.052  13.921  1.00 40.56  ? 479 331 B O34 1 
HETATM 4236 C C35 . 331 P 3 .   ? -4.307  -4.301  10.513  1.00 46.24  ? 479 331 B C35 1 
HETATM 4237 H H36 . 331 P 3 .   ? 0.107   -0.110  12.854  1.00 53.56  ? 479 331 B H36 1 
HETATM 4238 H H37 . 331 P 3 .   ? 3.599   -0.157  12.515  1.00 54.80  ? 479 331 B H37 1 
HETATM 4239 H H38 . 331 P 3 .   ? 2.068   0.181   17.233  1.00 55.67  ? 479 331 B H38 1 
HETATM 4240 H H39 . 331 P 3 .   ? 5.175   -0.514  14.352  1.00 55.36  ? 479 331 B H39 1 
HETATM 4241 H H40 . 331 P 3 .   ? -0.970  -0.695  11.485  1.00 45.47  ? 479 331 B H40 1 
HETATM 4242 H H41 . 331 P 3 .   ? -1.680  0.027   10.101  1.00 45.52  ? 479 331 B H41 1 
HETATM 4243 H H42 . 331 P 3 .   ? 0.360   2.823   9.766   1.00 47.88  ? 479 331 B H42 1 
HETATM 4244 H H43 . 331 P 3 .   ? -1.155  2.079   9.314   1.00 47.89  ? 479 331 B H43 1 
HETATM 4245 H H44 . 331 P 3 .   ? -2.642  1.858   11.545  1.00 43.24  ? 479 331 B H44 1 
HETATM 4246 H H45 . 331 P 3 .   ? -1.973  1.049   12.965  1.00 43.22  ? 479 331 B H45 1 
HETATM 4247 H H46 . 331 P 3 .   ? 0.140   0.113   8.420   1.00 48.04  ? 479 331 B H46 1 
HETATM 4248 H H47 . 331 P 3 .   ? 1.618   0.993   8.700   1.00 47.88  ? 479 331 B H47 1 
HETATM 4249 H H48 . 331 P 3 .   ? 0.508   2.888   7.333   1.00 48.53  ? 479 331 B H48 1 
HETATM 4250 H H49 . 331 P 3 .   ? -0.722  1.762   6.978   1.00 48.58  ? 479 331 B H49 1 
HETATM 4251 H H50 . 331 P 3 .   ? -4.256  0.866   10.166  1.00 41.55  ? 479 331 B H50 1 
HETATM 4252 H H51 . 331 P 3 .   ? -2.982  -1.112  13.722  1.00 41.10  ? 479 331 B H51 1 
HETATM 4253 H H52 . 331 P 3 .   ? 1.134   0.222   5.905   1.00 47.90  ? 479 331 B H52 1 
HETATM 4254 H H53 . 331 P 3 .   ? 2.211   1.583   6.049   1.00 47.96  ? 479 331 B H53 1 
HETATM 4255 H H54 . 331 P 3 .   ? -6.157  -0.650  10.020  1.00 41.26  ? 479 331 B H54 1 
HETATM 4256 H H55 . 331 P 3 .   ? -4.886  -2.631  13.610  1.00 40.30  ? 479 331 B H55 1 
HETATM 4257 H H56 . 331 P 3 .   ? 0.472   2.962   4.861   1.00 47.11  ? 479 331 B H56 1 
HETATM 4258 H H57 . 331 P 3 .   ? -0.398  1.502   4.511   1.00 46.98  ? 479 331 B H57 1 
HETATM 4259 H H58 . 331 P 3 .   ? 1.274   0.750   3.020   1.00 46.05  ? 479 331 B H58 1 
HETATM 4260 H H59 . 331 P 3 .   ? 2.465   1.765   3.761   1.00 46.30  ? 479 331 B H59 1 
HETATM 4261 H H60 . 331 P 3 .   ? 1.792   2.752   1.610   1.00 44.51  ? 479 331 B H60 1 
HETATM 4262 H H61 . 331 P 3 .   ? 1.209   3.786   2.890   1.00 44.33  ? 479 331 B H61 1 
HETATM 4263 H H62 . 331 P 3 .   ? 0.122   2.708   2.107   1.00 44.69  ? 479 331 B H62 1 
HETATM 4264 H H63 . 331 P 3 .   ? -6.149  -4.924  9.779   1.00 45.08  ? 479 331 B H63 1 
HETATM 4265 H H64 . 331 P 3 .   ? -5.607  -5.777  11.150  1.00 44.67  ? 479 331 B H64 1 
HETATM 4266 H H65 . 331 P 3 .   ? -8.124  -5.565  10.958  1.00 42.10  ? 479 331 B H65 1 
HETATM 4267 H H66 . 331 P 3 .   ? -8.207  -4.092  10.033  1.00 42.26  ? 479 331 B H66 1 
HETATM 4268 H H67 . 331 P 3 .   ? -8.891  -4.150  11.631  1.00 42.55  ? 479 331 B H67 1 
HETATM 4269 H H69 . 331 P 3 .   ? -3.673  -5.153  10.434  1.00 46.37  ? 479 331 B H69 1 
HETATM 4270 H H70 . 331 P 3 .   ? -3.873  -3.758  11.296  1.00 45.97  ? 479 331 B H70 1 
HETATM 4271 H H71 . 331 P 3 .   ? -4.266  -3.703  9.613   1.00 46.09  ? 479 331 B H71 1 
HETATM 4272 C C5  . B7G Q 4 .   ? -8.509  -19.431 21.275  1.00 62.58  ? 480 B7G B C5  1 
HETATM 4273 O O5  . B7G Q 4 .   ? -8.065  -18.526 20.240  1.00 62.74  ? 480 B7G B O5  1 
HETATM 4274 C C1  . B7G Q 4 .   ? -8.664  -17.215 20.296  1.00 60.68  ? 480 B7G B C1  1 
HETATM 4275 C C2  . B7G Q 4 .   ? -10.149 -17.356 20.002  1.00 62.13  ? 480 B7G B C2  1 
HETATM 4276 C C3  . B7G Q 4 .   ? -10.874 -18.651 20.391  1.00 62.81  ? 480 B7G B C3  1 
HETATM 4277 C C4  . B7G Q 4 .   ? -10.044 -19.592 21.290  1.00 62.76  ? 480 B7G B C4  1 
HETATM 4278 C C6  . B7G Q 4 .   ? -7.844  -20.796 21.070  1.00 62.33  ? 480 B7G B C6  1 
HETATM 4279 O O1  . B7G Q 4 .   ? -8.218  -16.298 19.280  1.00 58.03  ? 480 B7G B O1  1 
HETATM 4280 C C7  . B7G Q 4 .   ? -6.806  -16.129 19.084  1.00 53.63  ? 480 B7G B C7  1 
HETATM 4281 C C8  . B7G Q 4 .   ? -6.236  -14.826 19.663  1.00 48.60  ? 480 B7G B C8  1 
HETATM 4282 C C9  . B7G Q 4 .   ? -4.745  -14.689 19.346  1.00 44.73  ? 480 B7G B C9  1 
HETATM 4283 C C10 . B7G Q 4 .   ? -4.070  -13.601 20.192  1.00 39.80  ? 480 B7G B C10 1 
HETATM 4284 C C11 . B7G Q 4 .   ? -2.608  -13.500 19.845  1.00 35.53  ? 480 B7G B C11 1 
HETATM 4285 C C12 . B7G Q 4 .   ? -1.886  -14.786 20.145  1.00 35.36  ? 480 B7G B C12 1 
HETATM 4286 O O2  . B7G Q 4 .   ? -10.765 -16.441 19.460  1.00 63.99  ? 480 B7G B O2  1 
HETATM 4287 O O3  . B7G Q 4 .   ? -12.026 -18.900 20.018  1.00 60.76  ? 480 B7G B O3  1 
HETATM 4288 O O4  . B7G Q 4 .   ? -10.582 -20.437 22.009  1.00 61.77  ? 480 B7G B O4  1 
HETATM 4289 O O6  . B7G Q 4 .   ? -6.545  -20.698 21.156  1.00 61.80  ? 480 B7G B O6  1 
HETATM 4290 C C13 . B7G Q 4 .   ? -0.478  -14.852 19.519  1.00 36.91  ? 480 B7G B C13 1 
HETATM 4291 O O   . HOH R 5 .   ? 33.641  -8.700  64.174  1.00 26.75  ? 1   HOH A O   1 
HETATM 4292 O O   . HOH R 5 .   ? 20.855  -5.297  67.674  1.00 28.57  ? 2   HOH A O   1 
HETATM 4293 O O   . HOH R 5 .   ? 38.612  3.644   66.849  1.00 30.77  ? 3   HOH A O   1 
HETATM 4294 O O   . HOH R 5 .   ? 51.150  6.313   60.050  1.00 27.67  ? 4   HOH A O   1 
HETATM 4295 O O   . HOH R 5 .   ? 32.900  -2.995  73.254  1.00 18.47  ? 6   HOH A O   1 
HETATM 4296 O O   . HOH R 5 .   ? 33.199  12.099  71.510  1.00 21.74  ? 7   HOH A O   1 
HETATM 4297 O O   . HOH R 5 .   ? 21.620  -8.819  79.895  1.00 29.54  ? 10  HOH A O   1 
HETATM 4298 O O   . HOH R 5 .   ? 14.771  16.966  79.370  1.00 35.16  ? 12  HOH A O   1 
HETATM 4299 O O   . HOH R 5 .   ? 8.016   4.745   65.023  1.00 41.30  ? 14  HOH A O   1 
HETATM 4300 O O   . HOH R 5 .   ? 33.770  14.076  69.898  1.00 32.19  ? 15  HOH A O   1 
HETATM 4301 O O   . HOH R 5 .   ? 36.645  10.577  73.960  1.00 37.43  ? 19  HOH A O   1 
HETATM 4302 O O   . HOH R 5 .   ? 40.608  24.390  72.307  1.00 47.63  ? 22  HOH A O   1 
HETATM 4303 O O   . HOH R 5 .   ? 32.584  25.084  78.464  1.00 34.60  ? 26  HOH A O   1 
HETATM 4304 O O   . HOH R 5 .   ? 32.038  -7.676  53.496  1.00 41.12  ? 27  HOH A O   1 
HETATM 4305 O O   . HOH R 5 .   ? 22.600  -0.793  68.415  1.00 38.88  ? 30  HOH A O   1 
HETATM 4306 O O   . HOH R 5 .   ? 43.048  20.193  61.996  1.00 52.25  ? 31  HOH A O   1 
HETATM 4307 O O   . HOH R 5 .   ? 31.881  -10.261 63.371  1.00 40.63  ? 33  HOH A O   1 
HETATM 4308 O O   . HOH R 5 .   ? 20.512  14.761  89.572  1.00 47.91  ? 34  HOH A O   1 
HETATM 4309 O O   . HOH R 5 .   ? 12.165  -4.610  73.391  1.00 45.19  ? 37  HOH A O   1 
HETATM 4310 O O   . HOH R 5 .   ? 35.102  -8.875  67.690  1.00 61.51  ? 38  HOH A O   1 
HETATM 4311 O O   . HOH R 5 .   ? 10.786  6.300   76.705  1.00 45.73  ? 40  HOH A O   1 
HETATM 4312 O O   . HOH R 5 .   ? 22.130  -3.621  37.916  1.00 51.02  ? 41  HOH A O   1 
HETATM 4313 O O   . HOH R 5 .   ? 21.026  6.588   62.985  1.00 41.42  ? 42  HOH A O   1 
HETATM 4314 O O   . HOH R 5 .   ? 28.725  22.711  55.825  1.00 44.10  ? 43  HOH A O   1 
HETATM 4315 O O   . HOH R 5 .   ? 42.717  4.818   47.149  1.00 39.23  ? 51  HOH A O   1 
HETATM 4316 O O   . HOH R 5 .   ? 35.509  -2.350  40.230  1.00 49.13  ? 53  HOH A O   1 
HETATM 4317 O O   . HOH R 5 .   ? 15.965  22.300  82.920  1.00 62.89  ? 54  HOH A O   1 
HETATM 4318 O O   . HOH R 5 .   ? 34.359  -7.692  45.900  1.00 56.12  ? 59  HOH A O   1 
HETATM 4319 O O   . HOH R 5 .   ? 30.537  -4.377  77.812  1.00 61.42  ? 60  HOH A O   1 
HETATM 4320 O O   . HOH R 5 .   ? 15.796  7.859   50.492  1.00 59.83  ? 62  HOH A O   1 
HETATM 4321 O O   . HOH R 5 .   ? 29.283  10.197  79.779  1.00 51.24  ? 63  HOH A O   1 
HETATM 4322 O O   . HOH R 5 .   ? 31.728  8.497   78.074  1.00 41.29  ? 65  HOH A O   1 
HETATM 4323 O O   . HOH R 5 .   ? 48.389  2.586   73.082  1.00 53.11  ? 66  HOH A O   1 
HETATM 4324 O O   . HOH R 5 .   ? 43.281  -2.443  59.194  1.00 57.68  ? 67  HOH A O   1 
HETATM 4325 O O   . HOH R 5 .   ? 18.159  26.233  64.405  1.00 70.75  ? 68  HOH A O   1 
HETATM 4326 O O   . HOH R 5 .   ? 6.315   4.754   88.796  1.00 54.90  ? 69  HOH A O   1 
HETATM 4327 O O   . HOH R 5 .   ? 43.375  14.642  66.950  1.00 51.44  ? 70  HOH A O   1 
HETATM 4328 O O   . HOH R 5 .   ? 49.566  4.190   59.849  1.00 34.19  ? 71  HOH A O   1 
HETATM 4329 O O   . HOH R 5 .   ? 22.106  6.114   56.237  1.00 26.76  ? 76  HOH A O   1 
HETATM 4330 O O   . HOH R 5 .   ? 30.334  18.138  53.329  1.00 40.08  ? 77  HOH A O   1 
HETATM 4331 O O   . HOH R 5 .   ? 46.268  12.602  51.136  1.00 26.71  ? 78  HOH A O   1 
HETATM 4332 O O   . HOH R 5 .   ? 40.531  1.799   67.414  1.00 39.44  ? 80  HOH A O   1 
HETATM 4333 O O   . HOH R 5 .   ? 47.308  -1.097  52.131  1.00 45.99  ? 81  HOH A O   1 
HETATM 4334 O O   . HOH R 5 .   ? 20.734  8.846   61.832  1.00 36.59  ? 83  HOH A O   1 
HETATM 4335 O O   . HOH R 5 .   ? 38.682  12.248  46.461  1.00 40.42  ? 85  HOH A O   1 
HETATM 4336 O O   . HOH R 5 .   ? 32.817  17.362  53.320  1.00 35.66  ? 88  HOH A O   1 
HETATM 4337 O O   . HOH R 5 .   ? 21.427  -8.675  59.388  1.00 37.00  ? 89  HOH A O   1 
HETATM 4338 O O   . HOH R 5 .   ? 19.546  -4.836  84.257  1.00 54.32  ? 91  HOH A O   1 
HETATM 4339 O O   . HOH R 5 .   ? 18.142  17.267  86.393  1.00 40.03  ? 92  HOH A O   1 
HETATM 4340 O O   . HOH R 5 .   ? 35.743  17.514  53.278  1.00 43.68  ? 93  HOH A O   1 
HETATM 4341 O O   . HOH R 5 .   ? 34.876  -6.821  42.456  1.00 47.72  ? 96  HOH A O   1 
HETATM 4342 O O   . HOH R 5 .   ? 28.301  -5.879  83.888  1.00 40.15  ? 101 HOH A O   1 
HETATM 4343 O O   . HOH R 5 .   ? 22.024  25.658  65.711  1.00 51.67  ? 104 HOH A O   1 
HETATM 4344 O O   . HOH R 5 .   ? 35.949  -0.731  73.290  1.00 41.55  ? 106 HOH A O   1 
HETATM 4345 O O   . HOH R 5 .   ? 9.948   3.687   66.105  1.00 52.37  ? 107 HOH A O   1 
HETATM 4346 O O   . HOH R 5 .   ? 22.433  21.604  89.799  1.00 33.27  ? 109 HOH A O   1 
HETATM 4347 O O   . HOH R 5 .   ? 19.481  -5.895  52.982  1.00 54.36  ? 112 HOH A O   1 
HETATM 4348 O O   . HOH R 5 .   ? 28.100  18.428  54.788  1.00 61.02  ? 113 HOH A O   1 
HETATM 4349 O O   . HOH R 5 .   ? 38.324  28.342  68.144  1.00 40.04  ? 115 HOH A O   1 
HETATM 4350 O O   . HOH R 5 .   ? 14.278  -6.899  62.261  1.00 39.90  ? 119 HOH A O   1 
HETATM 4351 O O   . HOH R 5 .   ? 35.062  27.112  66.915  1.00 36.77  ? 120 HOH A O   1 
HETATM 4352 O O   . HOH R 5 .   ? 29.607  15.253  75.797  1.00 36.42  ? 122 HOH A O   1 
HETATM 4353 O O   . HOH R 5 .   ? 7.268   4.265   61.315  1.00 45.11  ? 123 HOH A O   1 
HETATM 4354 O O   . HOH R 5 .   ? 36.020  -2.066  57.513  1.00 42.79  ? 124 HOH A O   1 
HETATM 4355 O O   . HOH R 5 .   ? 36.071  13.203  73.370  1.00 43.74  ? 125 HOH A O   1 
HETATM 4356 O O   . HOH R 5 .   ? 38.922  21.064  82.659  1.00 49.28  ? 126 HOH A O   1 
HETATM 4357 O O   . HOH R 5 .   ? 43.227  20.308  55.428  1.00 49.66  ? 127 HOH A O   1 
HETATM 4358 O O   . HOH R 5 .   ? 12.011  -1.643  54.742  1.00 38.26  ? 128 HOH A O   1 
HETATM 4359 O O   . HOH R 5 .   ? 33.200  27.640  77.798  1.00 35.34  ? 131 HOH A O   1 
HETATM 4360 O O   . HOH R 5 .   ? 14.994  3.701   51.288  1.00 39.59  ? 134 HOH A O   1 
HETATM 4361 O O   . HOH R 5 .   ? 6.960   14.914  75.387  1.00 52.92  ? 135 HOH A O   1 
HETATM 4362 O O   . HOH R 5 .   ? 22.197  -6.149  53.622  1.00 51.30  ? 136 HOH A O   1 
HETATM 4363 O O   . HOH R 5 .   ? 26.556  8.037   53.686  1.00 23.70  ? 137 HOH A O   1 
HETATM 4364 O O   . HOH R 5 .   ? 26.010  6.424   56.336  1.00 37.25  ? 139 HOH A O   1 
HETATM 4365 O O   . HOH R 5 .   ? 34.375  9.628   41.955  1.00 45.87  ? 143 HOH A O   1 
HETATM 4366 O O   . HOH R 5 .   ? 23.106  1.763   67.700  1.00 37.55  ? 144 HOH A O   1 
HETATM 4367 O O   . HOH R 5 .   ? 10.349  3.458   84.853  1.00 44.13  ? 145 HOH A O   1 
HETATM 4368 O O   . HOH R 5 .   ? 38.003  -0.605  57.470  1.00 32.49  ? 148 HOH A O   1 
HETATM 4369 O O   . HOH R 5 .   ? 30.844  -2.918  71.622  1.00 33.33  ? 149 HOH A O   1 
HETATM 4370 O O   . HOH R 5 .   ? 13.900  -9.062  78.441  1.00 39.96  ? 153 HOH A O   1 
HETATM 4371 O O   . HOH R 5 .   ? 28.982  10.104  60.932  1.00 41.15  ? 155 HOH A O   1 
HETATM 4372 O O   . HOH R 5 .   ? 24.568  27.549  83.563  1.00 42.25  ? 156 HOH A O   1 
HETATM 4373 O O   . HOH R 5 .   ? 14.456  18.572  81.121  1.00 42.19  ? 157 HOH A O   1 
HETATM 4374 O O   . HOH R 5 .   ? 37.432  14.384  70.701  1.00 44.01  ? 161 HOH A O   1 
HETATM 4375 O O   . HOH S 5 .   ? -6.853  -4.805  22.600  1.00 26.89  ? 5   HOH B O   1 
HETATM 4376 O O   . HOH S 5 .   ? -0.340  9.601   -7.877  1.00 39.64  ? 8   HOH B O   1 
HETATM 4377 O O   . HOH S 5 .   ? -3.803  17.303  15.541  1.00 39.23  ? 9   HOH B O   1 
HETATM 4378 O O   . HOH S 5 .   ? -6.973  -6.977  20.653  1.00 30.04  ? 11  HOH B O   1 
HETATM 4379 O O   . HOH S 5 .   ? 12.053  5.303   -4.453  1.00 42.34  ? 13  HOH B O   1 
HETATM 4380 O O   . HOH S 5 .   ? -10.512 -13.266 4.061   1.00 33.51  ? 16  HOH B O   1 
HETATM 4381 O O   . HOH S 5 .   ? 6.746   12.518  22.707  1.00 37.82  ? 17  HOH B O   1 
HETATM 4382 O O   . HOH S 5 .   ? -2.785  13.865  32.915  1.00 39.84  ? 18  HOH B O   1 
HETATM 4383 O O   . HOH S 5 .   ? 5.011   -18.329 20.325  1.00 48.20  ? 20  HOH B O   1 
HETATM 4384 O O   . HOH S 5 .   ? -15.384 7.715   -0.352  1.00 36.76  ? 21  HOH B O   1 
HETATM 4385 O O   . HOH S 5 .   ? -4.453  -7.526  28.129  1.00 40.06  ? 23  HOH B O   1 
HETATM 4386 O O   . HOH S 5 .   ? 15.098  -1.959  19.660  1.00 47.80  ? 24  HOH B O   1 
HETATM 4387 O O   . HOH S 5 .   ? 10.734  0.075   -14.034 1.00 42.22  ? 25  HOH B O   1 
HETATM 4388 O O   . HOH S 5 .   ? 9.314   -10.138 35.807  1.00 57.14  ? 28  HOH B O   1 
HETATM 4389 O O   . HOH S 5 .   ? 6.650   -18.592 27.741  1.00 56.68  ? 29  HOH B O   1 
HETATM 4390 O O   . HOH S 5 .   ? -6.349  8.923   8.359   1.00 41.41  ? 32  HOH B O   1 
HETATM 4391 O O   . HOH S 5 .   ? 13.141  -11.240 36.645  1.00 36.07  ? 35  HOH B O   1 
HETATM 4392 O O   . HOH S 5 .   ? -6.347  13.189  32.898  1.00 43.90  ? 36  HOH B O   1 
HETATM 4393 O O   . HOH S 5 .   ? -7.370  -1.298  29.638  1.00 62.92  ? 39  HOH B O   1 
HETATM 4394 O O   . HOH S 5 .   ? -3.220  16.846  7.877   1.00 49.38  ? 44  HOH B O   1 
HETATM 4395 O O   . HOH S 5 .   ? 15.439  10.475  40.326  1.00 41.52  ? 45  HOH B O   1 
HETATM 4396 O O   . HOH S 5 .   ? 15.136  -6.089  43.902  1.00 68.49  ? 46  HOH B O   1 
HETATM 4397 O O   . HOH S 5 .   ? -11.341 4.151   16.526  1.00 48.79  ? 47  HOH B O   1 
HETATM 4398 O O   . HOH S 5 .   ? 13.501  0.624   33.533  1.00 61.26  ? 48  HOH B O   1 
HETATM 4399 O O   . HOH S 5 .   ? 2.916   7.640   -12.950 1.00 53.58  ? 49  HOH B O   1 
HETATM 4400 O O   . HOH S 5 .   ? 1.621   -14.600 9.018   1.00 46.25  ? 50  HOH B O   1 
HETATM 4401 O O   . HOH S 5 .   ? 9.290   -5.390  -4.553  1.00 64.09  ? 52  HOH B O   1 
HETATM 4402 O O   . HOH S 5 .   ? 8.988   -18.400 20.508  1.00 55.84  ? 55  HOH B O   1 
HETATM 4403 O O   . HOH S 5 .   ? -0.147  -13.860 43.052  1.00 44.65  ? 56  HOH B O   1 
HETATM 4404 O O   . HOH S 5 .   ? -13.928 -4.648  -0.290  1.00 46.57  ? 57  HOH B O   1 
HETATM 4405 O O   . HOH S 5 .   ? -2.696  -19.773 36.718  1.00 47.43  ? 58  HOH B O   1 
HETATM 4406 O O   . HOH S 5 .   ? -20.939 5.430   18.530  1.00 46.21  ? 61  HOH B O   1 
HETATM 4407 O O   . HOH S 5 .   ? -7.153  0.993   33.408  1.00 42.86  ? 64  HOH B O   1 
HETATM 4408 O O   . HOH S 5 .   ? 21.363  6.923   24.818  1.00 58.10  ? 72  HOH B O   1 
HETATM 4409 O O   . HOH S 5 .   ? -14.933 -8.912  12.386  1.00 47.89  ? 73  HOH B O   1 
HETATM 4410 O O   . HOH S 5 .   ? -8.943  3.060   -3.643  1.00 38.02  ? 74  HOH B O   1 
HETATM 4411 O O   . HOH S 5 .   ? 3.843   10.026  24.725  1.00 45.42  ? 75  HOH B O   1 
HETATM 4412 O O   . HOH S 5 .   ? -6.246  10.487  25.383  1.00 32.14  ? 79  HOH B O   1 
HETATM 4413 O O   . HOH S 5 .   ? -3.321  -9.310  4.344   1.00 35.73  ? 82  HOH B O   1 
HETATM 4414 O O   . HOH S 5 .   ? 7.557   -1.985  16.339  1.00 45.33  ? 84  HOH B O   1 
HETATM 4415 O O   . HOH S 5 .   ? 0.943   -11.024 6.080   1.00 33.57  ? 86  HOH B O   1 
HETATM 4416 O O   . HOH S 5 .   ? -9.758  1.371   33.051  1.00 50.09  ? 87  HOH B O   1 
HETATM 4417 O O   . HOH S 5 .   ? -1.258  -9.966  5.419   1.00 34.06  ? 90  HOH B O   1 
HETATM 4418 O O   . HOH S 5 .   ? 5.268   -0.473  47.700  1.00 47.05  ? 94  HOH B O   1 
HETATM 4419 O O   . HOH S 5 .   ? -0.197  14.652  -2.146  1.00 42.72  ? 95  HOH B O   1 
HETATM 4420 O O   . HOH S 5 .   ? -2.438  -14.924 43.383  1.00 40.11  ? 97  HOH B O   1 
HETATM 4421 O O   . HOH S 5 .   ? -5.444  15.546  15.670  1.00 38.55  ? 98  HOH B O   1 
HETATM 4422 O O   . HOH S 5 .   ? 1.434   -23.159 30.502  1.00 40.86  ? 99  HOH B O   1 
HETATM 4423 O O   . HOH S 5 .   ? -10.490 7.333   23.416  1.00 51.78  ? 100 HOH B O   1 
HETATM 4424 O O   . HOH S 5 .   ? 1.934   -23.176 34.692  1.00 51.03  ? 102 HOH B O   1 
HETATM 4425 O O   . HOH S 5 .   ? -4.902  -11.768 4.310   1.00 50.28  ? 103 HOH B O   1 
HETATM 4426 O O   . HOH S 5 .   ? 4.041   0.897   9.950   1.00 35.20  ? 105 HOH B O   1 
HETATM 4427 O O   . HOH S 5 .   ? 4.548   7.779   22.768  1.00 45.20  ? 108 HOH B O   1 
HETATM 4428 O O   . HOH S 5 .   ? -16.266 2.802   -0.704  1.00 52.80  ? 110 HOH B O   1 
HETATM 4429 O O   . HOH S 5 .   ? 4.381   5.722   -13.202 1.00 54.17  ? 111 HOH B O   1 
HETATM 4430 O O   . HOH S 5 .   ? 7.617   0.611   17.988  1.00 43.09  ? 114 HOH B O   1 
HETATM 4431 O O   . HOH S 5 .   ? 2.835   -22.500 32.519  1.00 52.56  ? 116 HOH B O   1 
HETATM 4432 O O   . HOH S 5 .   ? 16.693  14.001  11.736  1.00 53.12  ? 117 HOH B O   1 
HETATM 4433 O O   . HOH S 5 .   ? -5.674  13.077  35.340  1.00 48.85  ? 118 HOH B O   1 
HETATM 4434 O O   . HOH S 5 .   ? 2.495   -11.580 8.108   1.00 53.49  ? 121 HOH B O   1 
HETATM 4435 O O   . HOH S 5 .   ? 1.944   -15.747 18.376  1.00 45.37  ? 129 HOH B O   1 
HETATM 4436 O O   . HOH S 5 .   ? 4.155   -17.210 18.034  1.00 35.20  ? 130 HOH B O   1 
HETATM 4437 O O   . HOH S 5 .   ? 20.159  11.482  6.363   1.00 49.45  ? 132 HOH B O   1 
HETATM 4438 O O   . HOH S 5 .   ? 0.491   -7.386  43.651  1.00 48.61  ? 133 HOH B O   1 
HETATM 4439 O O   . HOH S 5 .   ? 4.695   -0.608  7.748   1.00 18.31  ? 138 HOH B O   1 
HETATM 4440 O O   . HOH S 5 .   ? -10.888 -7.323  20.704  1.00 41.98  ? 140 HOH B O   1 
HETATM 4441 O O   . HOH S 5 .   ? -5.372  -4.611  -3.124  1.00 54.23  ? 141 HOH B O   1 
HETATM 4442 O O   . HOH S 5 .   ? 3.731   -4.446  5.508   1.00 36.76  ? 142 HOH B O   1 
HETATM 4443 O O   . HOH S 5 .   ? -5.393  12.116  30.825  1.00 50.53  ? 146 HOH B O   1 
HETATM 4444 O O   . HOH S 5 .   ? 4.145   -1.883  5.939   1.00 41.12  ? 147 HOH B O   1 
HETATM 4445 O O   . HOH S 5 .   ? -17.294 -5.567  -1.996  1.00 50.56  ? 150 HOH B O   1 
HETATM 4446 O O   . HOH S 5 .   ? 4.409   -18.620 25.665  1.00 61.42  ? 151 HOH B O   1 
HETATM 4447 O O   . HOH S 5 .   ? 2.747   16.000  34.231  1.00 35.13  ? 152 HOH B O   1 
HETATM 4448 O O   . HOH S 5 .   ? -4.574  10.402  23.182  1.00 42.89  ? 154 HOH B O   1 
HETATM 4449 O O   . HOH S 5 .   ? 7.442   -11.192 35.198  1.00 66.63  ? 158 HOH B O   1 
HETATM 4450 O O   . HOH S 5 .   ? 5.998   -3.760  6.492   1.00 52.98  ? 159 HOH B O   1 
HETATM 4451 O O   . HOH S 5 .   ? 12.116  -9.881  38.748  1.00 55.33  ? 160 HOH B O   1 
HETATM 4452 O O   . HOH S 5 .   ? -8.568  4.615   -6.173  1.00 49.60  ? 162 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PRO 1   206 206 PRO PRO A . n 
A 1 2   GLN 2   207 207 GLN GLN A . n 
A 1 3   VAL 3   208 208 VAL VAL A . n 
A 1 4   ALA 4   209 209 ALA ALA A . n 
A 1 5   ASP 5   210 210 ASP ASP A . n 
A 1 6   LEU 6   211 211 LEU LEU A . n 
A 1 7   LYS 7   212 212 LYS LYS A . n 
A 1 8   ALA 8   213 213 ALA ALA A . n 
A 1 9   PHE 9   214 214 PHE PHE A . n 
A 1 10  SER 10  215 215 SER SER A . n 
A 1 11  LYS 11  216 216 LYS LYS A . n 
A 1 12  HIS 12  217 217 HIS HIS A . n 
A 1 13  ILE 13  218 218 ILE ILE A . n 
A 1 14  TYR 14  219 219 TYR TYR A . n 
A 1 15  ASN 15  220 220 ASN ASN A . n 
A 1 16  ALA 16  221 221 ALA ALA A . n 
A 1 17  TYR 17  222 222 TYR TYR A . n 
A 1 18  LEU 18  223 223 LEU LEU A . n 
A 1 19  LYS 19  224 224 LYS LYS A . n 
A 1 20  ASN 20  225 225 ASN ASN A . n 
A 1 21  PHE 21  226 226 PHE PHE A . n 
A 1 22  ASN 22  227 227 ASN ASN A . n 
A 1 23  MET 23  228 228 MET MET A . n 
A 1 24  THR 24  229 229 THR THR A . n 
A 1 25  LYS 25  230 230 LYS LYS A . n 
A 1 26  LYS 26  231 231 LYS LYS A . n 
A 1 27  LYS 27  232 232 LYS LYS A . n 
A 1 28  ALA 28  233 233 ALA ALA A . n 
A 1 29  ARG 29  234 234 ARG ARG A . n 
A 1 30  SER 30  235 235 SER SER A . n 
A 1 31  ILE 31  236 236 ILE ILE A . n 
A 1 32  LEU 32  237 237 LEU LEU A . n 
A 1 33  THR 33  238 238 THR THR A . n 
A 1 34  GLY 34  239 239 GLY GLY A . n 
A 1 35  LYS 35  240 ?   ?   ?   A . n 
A 1 36  ALA 36  241 ?   ?   ?   A . n 
A 1 37  SER 37  242 ?   ?   ?   A . n 
A 1 38  HIS 38  243 ?   ?   ?   A . n 
A 1 39  THR 39  244 ?   ?   ?   A . n 
A 1 40  ALA 40  245 245 ALA ALA A . n 
A 1 41  PRO 41  246 246 PRO PRO A . n 
A 1 42  PHE 42  247 247 PHE PHE A . n 
A 1 43  VAL 43  248 248 VAL VAL A . n 
A 1 44  ILE 44  249 249 ILE ILE A . n 
A 1 45  HIS 45  250 250 HIS HIS A . n 
A 1 46  ASP 46  251 251 ASP ASP A . n 
A 1 47  ILE 47  252 252 ILE ILE A . n 
A 1 48  GLU 48  253 253 GLU GLU A . n 
A 1 49  THR 49  254 254 THR THR A . n 
A 1 50  LEU 50  255 255 LEU LEU A . n 
A 1 51  TRP 51  256 256 TRP TRP A . n 
A 1 52  GLN 52  257 257 GLN GLN A . n 
A 1 53  ALA 53  258 258 ALA ALA A . n 
A 1 54  GLU 54  259 259 GLU GLU A . n 
A 1 55  LYS 55  260 260 LYS LYS A . n 
A 1 56  GLY 56  261 261 GLY GLY A . n 
A 1 57  LEU 57  262 262 LEU LEU A . n 
A 1 58  VAL 58  263 263 VAL VAL A . n 
A 1 59  TRP 59  264 264 TRP TRP A . n 
A 1 60  LYS 60  265 ?   ?   ?   A . n 
A 1 61  GLN 61  266 ?   ?   ?   A . n 
A 1 62  LEU 62  267 ?   ?   ?   A . n 
A 1 63  VAL 63  268 ?   ?   ?   A . n 
A 1 64  ASN 64  269 ?   ?   ?   A . n 
A 1 65  GLY 65  270 270 GLY GLY A . n 
A 1 66  LEU 66  271 271 LEU LEU A . n 
A 1 67  PRO 67  272 272 PRO PRO A . n 
A 1 68  PRO 68  273 273 PRO PRO A . n 
A 1 69  TYR 69  274 274 TYR TYR A . n 
A 1 70  LYS 70  275 275 LYS LYS A . n 
A 1 71  GLU 71  276 276 GLU GLU A . n 
A 1 72  ILE 72  277 277 ILE ILE A . n 
A 1 73  SER 73  278 278 SER SER A . n 
A 1 74  VAL 74  279 279 VAL VAL A . n 
A 1 75  HIS 75  280 280 HIS HIS A . n 
A 1 76  VAL 76  281 281 VAL VAL A . n 
A 1 77  PHE 77  282 282 PHE PHE A . n 
A 1 78  TYR 78  283 283 TYR TYR A . n 
A 1 79  ARG 79  284 284 ARG ARG A . n 
A 1 80  CYS 80  285 285 CYS CYS A . n 
A 1 81  GLN 81  286 286 GLN GLN A . n 
A 1 82  CYS 82  287 287 CYS CYS A . n 
A 1 83  THR 83  288 288 THR THR A . n 
A 1 84  THR 84  289 289 THR THR A . n 
A 1 85  VAL 85  290 290 VAL VAL A . n 
A 1 86  GLU 86  291 291 GLU GLU A . n 
A 1 87  THR 87  292 292 THR THR A . n 
A 1 88  VAL 88  293 293 VAL VAL A . n 
A 1 89  ARG 89  294 294 ARG ARG A . n 
A 1 90  GLU 90  295 295 GLU GLU A . n 
A 1 91  LEU 91  296 296 LEU LEU A . n 
A 1 92  THR 92  297 297 THR THR A . n 
A 1 93  GLU 93  298 298 GLU GLU A . n 
A 1 94  PHE 94  299 299 PHE PHE A . n 
A 1 95  ALA 95  300 300 ALA ALA A . n 
A 1 96  LYS 96  301 301 LYS LYS A . n 
A 1 97  SER 97  302 302 SER SER A . n 
A 1 98  ILE 98  303 303 ILE ILE A . n 
A 1 99  PRO 99  304 304 PRO PRO A . n 
A 1 100 SER 100 305 305 SER SER A . n 
A 1 101 PHE 101 306 306 PHE PHE A . n 
A 1 102 SER 102 307 307 SER SER A . n 
A 1 103 SER 103 308 308 SER SER A . n 
A 1 104 LEU 104 309 309 LEU LEU A . n 
A 1 105 PHE 105 310 310 PHE PHE A . n 
A 1 106 LEU 106 311 311 LEU LEU A . n 
A 1 107 ASN 107 312 312 ASN ASN A . n 
A 1 108 ASP 108 313 313 ASP ASP A . n 
A 1 109 GLN 109 314 314 GLN GLN A . n 
A 1 110 VAL 110 315 315 VAL VAL A . n 
A 1 111 THR 111 316 316 THR THR A . n 
A 1 112 LEU 112 317 317 LEU LEU A . n 
A 1 113 LEU 113 318 318 LEU LEU A . n 
A 1 114 LYS 114 319 319 LYS LYS A . n 
A 1 115 TYR 115 320 320 TYR TYR A . n 
A 1 116 GLY 116 321 321 GLY GLY A . n 
A 1 117 VAL 117 322 322 VAL VAL A . n 
A 1 118 HIS 118 323 323 HIS HIS A . n 
A 1 119 GLU 119 324 324 GLU GLU A . n 
A 1 120 ALA 120 325 325 ALA ALA A . n 
A 1 121 ILE 121 326 326 ILE ILE A . n 
A 1 122 PHE 122 327 327 PHE PHE A . n 
A 1 123 ALA 123 328 328 ALA ALA A . n 
A 1 124 MET 124 329 329 MET MET A . n 
A 1 125 LEU 125 330 330 LEU LEU A . n 
A 1 126 ALA 126 331 331 ALA ALA A . n 
A 1 127 SER 127 332 332 SER SER A . n 
A 1 128 ILE 128 333 333 ILE ILE A . n 
A 1 129 VAL 129 334 334 VAL VAL A . n 
A 1 130 ASN 130 335 335 ASN ASN A . n 
A 1 131 LYS 131 336 336 LYS LYS A . n 
A 1 132 ASP 132 337 337 ASP ASP A . n 
A 1 133 GLY 133 338 338 GLY GLY A . n 
A 1 134 LEU 134 339 339 LEU LEU A . n 
A 1 135 LEU 135 340 340 LEU LEU A . n 
A 1 136 VAL 136 341 341 VAL VAL A . n 
A 1 137 ALA 137 342 342 ALA ALA A . n 
A 1 138 ASN 138 343 343 ASN ASN A . n 
A 1 139 GLY 139 344 344 GLY GLY A . n 
A 1 140 SER 140 345 345 SER SER A . n 
A 1 141 GLY 141 346 346 GLY GLY A . n 
A 1 142 PHE 142 347 347 PHE PHE A . n 
A 1 143 VAL 143 348 348 VAL VAL A . n 
A 1 144 THR 144 349 349 THR THR A . n 
A 1 145 ARG 145 350 350 ARG ARG A . n 
A 1 146 GLU 146 351 351 GLU GLU A . n 
A 1 147 PHE 147 352 352 PHE PHE A . n 
A 1 148 LEU 148 353 353 LEU LEU A . n 
A 1 149 ARG 149 354 354 ARG ARG A . n 
A 1 150 SER 150 355 355 SER SER A . n 
A 1 151 LEU 151 356 356 LEU LEU A . n 
A 1 152 ARG 152 357 357 ARG ARG A . n 
A 1 153 LYS 153 358 358 LYS LYS A . n 
A 1 154 PRO 154 359 359 PRO PRO A . n 
A 1 155 PHE 155 360 360 PHE PHE A . n 
A 1 156 SER 156 361 361 SER SER A . n 
A 1 157 ASP 157 362 362 ASP ASP A . n 
A 1 158 ILE 158 363 363 ILE ILE A . n 
A 1 159 ILE 159 364 364 ILE ILE A . n 
A 1 160 GLU 160 365 365 GLU GLU A . n 
A 1 161 PRO 161 366 366 PRO PRO A . n 
A 1 162 LYS 162 367 367 LYS LYS A . n 
A 1 163 PHE 163 368 368 PHE PHE A . n 
A 1 164 GLU 164 369 369 GLU GLU A . n 
A 1 165 PHE 165 370 370 PHE PHE A . n 
A 1 166 ALA 166 371 371 ALA ALA A . n 
A 1 167 VAL 167 372 372 VAL VAL A . n 
A 1 168 LYS 168 373 373 LYS LYS A . n 
A 1 169 PHE 169 374 374 PHE PHE A . n 
A 1 170 ASN 170 375 375 ASN ASN A . n 
A 1 171 ALA 171 376 376 ALA ALA A . n 
A 1 172 LEU 172 377 377 LEU LEU A . n 
A 1 173 GLU 173 378 378 GLU GLU A . n 
A 1 174 LEU 174 379 379 LEU LEU A . n 
A 1 175 ASP 175 380 380 ASP ASP A . n 
A 1 176 ASP 176 381 381 ASP ASP A . n 
A 1 177 SER 177 382 382 SER SER A . n 
A 1 178 ASP 178 383 383 ASP ASP A . n 
A 1 179 LEU 179 384 384 LEU LEU A . n 
A 1 180 ALA 180 385 385 ALA ALA A . n 
A 1 181 LEU 181 386 386 LEU LEU A . n 
A 1 182 PHE 182 387 387 PHE PHE A . n 
A 1 183 ILE 183 388 388 ILE ILE A . n 
A 1 184 ALA 184 389 389 ALA ALA A . n 
A 1 185 ALA 185 390 390 ALA ALA A . n 
A 1 186 ILE 186 391 391 ILE ILE A . n 
A 1 187 ILE 187 392 392 ILE ILE A . n 
A 1 188 LEU 188 393 393 LEU LEU A . n 
A 1 189 CYS 189 394 394 CYS CYS A . n 
A 1 190 GLY 190 395 395 GLY GLY A . n 
A 1 191 ASP 191 396 396 ASP ASP A . n 
A 1 192 ARG 192 397 397 ARG ARG A . n 
A 1 193 PRO 193 398 398 PRO PRO A . n 
A 1 194 GLY 194 399 399 GLY GLY A . n 
A 1 195 LEU 195 400 400 LEU LEU A . n 
A 1 196 MET 196 401 401 MET MET A . n 
A 1 197 ASN 197 402 402 ASN ASN A . n 
A 1 198 VAL 198 403 403 VAL VAL A . n 
A 1 199 PRO 199 404 404 PRO PRO A . n 
A 1 200 ARG 200 405 405 ARG ARG A . n 
A 1 201 VAL 201 406 406 VAL VAL A . n 
A 1 202 GLU 202 407 407 GLU GLU A . n 
A 1 203 ALA 203 408 408 ALA ALA A . n 
A 1 204 ILE 204 409 409 ILE ILE A . n 
A 1 205 GLN 205 410 410 GLN GLN A . n 
A 1 206 ASP 206 411 411 ASP ASP A . n 
A 1 207 THR 207 412 412 THR THR A . n 
A 1 208 ILE 208 413 413 ILE ILE A . n 
A 1 209 LEU 209 414 414 LEU LEU A . n 
A 1 210 ARG 210 415 415 ARG ARG A . n 
A 1 211 ALA 211 416 416 ALA ALA A . n 
A 1 212 LEU 212 417 417 LEU LEU A . n 
A 1 213 GLU 213 418 418 GLU GLU A . n 
A 1 214 PHE 214 419 419 PHE PHE A . n 
A 1 215 HIS 215 420 420 HIS HIS A . n 
A 1 216 LEU 216 421 421 LEU LEU A . n 
A 1 217 GLN 217 422 422 GLN GLN A . n 
A 1 218 ALA 218 423 423 ALA ALA A . n 
A 1 219 ASN 219 424 424 ASN ASN A . n 
A 1 220 HIS 220 425 425 HIS HIS A . n 
A 1 221 PRO 221 426 426 PRO PRO A . n 
A 1 222 ASP 222 427 427 ASP ASP A . n 
A 1 223 ALA 223 428 428 ALA ALA A . n 
A 1 224 GLN 224 429 429 GLN GLN A . n 
A 1 225 TYR 225 430 430 TYR TYR A . n 
A 1 226 LEU 226 431 431 LEU LEU A . n 
A 1 227 PHE 227 432 432 PHE PHE A . n 
A 1 228 PRO 228 433 433 PRO PRO A . n 
A 1 229 LYS 229 434 434 LYS LYS A . n 
A 1 230 LEU 230 435 435 LEU LEU A . n 
A 1 231 LEU 231 436 436 LEU LEU A . n 
A 1 232 GLN 232 437 437 GLN GLN A . n 
A 1 233 LYS 233 438 438 LYS LYS A . n 
A 1 234 MET 234 439 439 MET MET A . n 
A 1 235 ALA 235 440 440 ALA ALA A . n 
A 1 236 ASP 236 441 441 ASP ASP A . n 
A 1 237 LEU 237 442 442 LEU LEU A . n 
A 1 238 ARG 238 443 443 ARG ARG A . n 
A 1 239 GLN 239 444 444 GLN GLN A . n 
A 1 240 LEU 240 445 445 LEU LEU A . n 
A 1 241 VAL 241 446 446 VAL VAL A . n 
A 1 242 THR 242 447 447 THR THR A . n 
A 1 243 GLU 243 448 448 GLU GLU A . n 
A 1 244 HIS 244 449 449 HIS HIS A . n 
A 1 245 ALA 245 450 450 ALA ALA A . n 
A 1 246 GLN 246 451 451 GLN GLN A . n 
A 1 247 MET 247 452 452 MET MET A . n 
A 1 248 MET 248 453 453 MET MET A . n 
A 1 249 GLN 249 454 454 GLN GLN A . n 
A 1 250 ARG 250 455 455 ARG ARG A . n 
A 1 251 ILE 251 456 456 ILE ILE A . n 
A 1 252 LYS 252 457 457 LYS LYS A . n 
A 1 253 LYS 253 458 458 LYS LYS A . n 
A 1 254 THR 254 459 459 THR THR A . n 
A 1 255 GLU 255 460 460 GLU GLU A . n 
A 1 256 THR 256 461 461 THR THR A . n 
A 1 257 GLU 257 462 462 GLU GLU A . n 
A 1 258 THR 258 463 463 THR THR A . n 
A 1 259 SER 259 464 464 SER SER A . n 
A 1 260 LEU 260 465 465 LEU LEU A . n 
A 1 261 HIS 261 466 466 HIS HIS A . n 
A 1 262 PRO 262 467 467 PRO PRO A . n 
A 1 263 LEU 263 468 468 LEU LEU A . n 
A 1 264 LEU 264 469 469 LEU LEU A . n 
A 1 265 GLN 265 470 470 GLN GLN A . n 
A 1 266 GLU 266 471 471 GLU GLU A . n 
A 1 267 ILE 267 472 472 ILE ILE A . n 
A 1 268 TYR 268 473 473 TYR TYR A . n 
A 1 269 LYS 269 474 474 LYS LYS A . n 
A 1 270 ASP 270 475 475 ASP ASP A . n 
A 1 271 MET 271 476 ?   ?   ?   A . n 
A 1 272 TYR 272 477 ?   ?   ?   A . n 
B 1 1   PRO 1   206 ?   ?   ?   B . n 
B 1 2   GLN 2   207 ?   ?   ?   B . n 
B 1 3   VAL 3   208 ?   ?   ?   B . n 
B 1 4   ALA 4   209 209 ALA ALA B . n 
B 1 5   ASP 5   210 210 ASP ASP B . n 
B 1 6   LEU 6   211 211 LEU LEU B . n 
B 1 7   LYS 7   212 212 LYS LYS B . n 
B 1 8   ALA 8   213 213 ALA ALA B . n 
B 1 9   PHE 9   214 214 PHE PHE B . n 
B 1 10  SER 10  215 215 SER SER B . n 
B 1 11  LYS 11  216 216 LYS LYS B . n 
B 1 12  HIS 12  217 217 HIS HIS B . n 
B 1 13  ILE 13  218 218 ILE ILE B . n 
B 1 14  TYR 14  219 219 TYR TYR B . n 
B 1 15  ASN 15  220 220 ASN ASN B . n 
B 1 16  ALA 16  221 221 ALA ALA B . n 
B 1 17  TYR 17  222 222 TYR TYR B . n 
B 1 18  LEU 18  223 223 LEU LEU B . n 
B 1 19  LYS 19  224 224 LYS LYS B . n 
B 1 20  ASN 20  225 225 ASN ASN B . n 
B 1 21  PHE 21  226 226 PHE PHE B . n 
B 1 22  ASN 22  227 227 ASN ASN B . n 
B 1 23  MET 23  228 228 MET MET B . n 
B 1 24  THR 24  229 229 THR THR B . n 
B 1 25  LYS 25  230 230 LYS LYS B . n 
B 1 26  LYS 26  231 231 LYS LYS B . n 
B 1 27  LYS 27  232 232 LYS LYS B . n 
B 1 28  ALA 28  233 233 ALA ALA B . n 
B 1 29  ARG 29  234 234 ARG ARG B . n 
B 1 30  SER 30  235 235 SER SER B . n 
B 1 31  ILE 31  236 236 ILE ILE B . n 
B 1 32  LEU 32  237 237 LEU LEU B . n 
B 1 33  THR 33  238 238 THR THR B . n 
B 1 34  GLY 34  239 239 GLY GLY B . n 
B 1 35  LYS 35  240 ?   ?   ?   B . n 
B 1 36  ALA 36  241 ?   ?   ?   B . n 
B 1 37  SER 37  242 ?   ?   ?   B . n 
B 1 38  HIS 38  243 ?   ?   ?   B . n 
B 1 39  THR 39  244 ?   ?   ?   B . n 
B 1 40  ALA 40  245 245 ALA ALA B . n 
B 1 41  PRO 41  246 246 PRO PRO B . n 
B 1 42  PHE 42  247 247 PHE PHE B . n 
B 1 43  VAL 43  248 248 VAL VAL B . n 
B 1 44  ILE 44  249 249 ILE ILE B . n 
B 1 45  HIS 45  250 250 HIS HIS B . n 
B 1 46  ASP 46  251 251 ASP ASP B . n 
B 1 47  ILE 47  252 252 ILE ILE B . n 
B 1 48  GLU 48  253 253 GLU GLU B . n 
B 1 49  THR 49  254 254 THR THR B . n 
B 1 50  LEU 50  255 255 LEU LEU B . n 
B 1 51  TRP 51  256 256 TRP TRP B . n 
B 1 52  GLN 52  257 257 GLN GLN B . n 
B 1 53  ALA 53  258 258 ALA ALA B . n 
B 1 54  GLU 54  259 259 GLU GLU B . n 
B 1 55  LYS 55  260 260 LYS LYS B . n 
B 1 56  GLY 56  261 261 GLY GLY B . n 
B 1 57  LEU 57  262 262 LEU LEU B . n 
B 1 58  VAL 58  263 263 VAL VAL B . n 
B 1 59  TRP 59  264 264 TRP TRP B . n 
B 1 60  LYS 60  265 ?   ?   ?   B . n 
B 1 61  GLN 61  266 ?   ?   ?   B . n 
B 1 62  LEU 62  267 ?   ?   ?   B . n 
B 1 63  VAL 63  268 ?   ?   ?   B . n 
B 1 64  ASN 64  269 ?   ?   ?   B . n 
B 1 65  GLY 65  270 270 GLY GLY B . n 
B 1 66  LEU 66  271 271 LEU LEU B . n 
B 1 67  PRO 67  272 272 PRO PRO B . n 
B 1 68  PRO 68  273 273 PRO PRO B . n 
B 1 69  TYR 69  274 274 TYR TYR B . n 
B 1 70  LYS 70  275 275 LYS LYS B . n 
B 1 71  GLU 71  276 276 GLU GLU B . n 
B 1 72  ILE 72  277 277 ILE ILE B . n 
B 1 73  SER 73  278 278 SER SER B . n 
B 1 74  VAL 74  279 279 VAL VAL B . n 
B 1 75  HIS 75  280 280 HIS HIS B . n 
B 1 76  VAL 76  281 281 VAL VAL B . n 
B 1 77  PHE 77  282 282 PHE PHE B . n 
B 1 78  TYR 78  283 283 TYR TYR B . n 
B 1 79  ARG 79  284 284 ARG ARG B . n 
B 1 80  CYS 80  285 285 CYS CYS B . n 
B 1 81  GLN 81  286 286 GLN GLN B . n 
B 1 82  CYS 82  287 287 CYS CYS B . n 
B 1 83  THR 83  288 288 THR THR B . n 
B 1 84  THR 84  289 289 THR THR B . n 
B 1 85  VAL 85  290 290 VAL VAL B . n 
B 1 86  GLU 86  291 291 GLU GLU B . n 
B 1 87  THR 87  292 292 THR THR B . n 
B 1 88  VAL 88  293 293 VAL VAL B . n 
B 1 89  ARG 89  294 294 ARG ARG B . n 
B 1 90  GLU 90  295 295 GLU GLU B . n 
B 1 91  LEU 91  296 296 LEU LEU B . n 
B 1 92  THR 92  297 297 THR THR B . n 
B 1 93  GLU 93  298 298 GLU GLU B . n 
B 1 94  PHE 94  299 299 PHE PHE B . n 
B 1 95  ALA 95  300 300 ALA ALA B . n 
B 1 96  LYS 96  301 301 LYS LYS B . n 
B 1 97  SER 97  302 302 SER SER B . n 
B 1 98  ILE 98  303 303 ILE ILE B . n 
B 1 99  PRO 99  304 304 PRO PRO B . n 
B 1 100 SER 100 305 305 SER SER B . n 
B 1 101 PHE 101 306 306 PHE PHE B . n 
B 1 102 SER 102 307 307 SER SER B . n 
B 1 103 SER 103 308 308 SER SER B . n 
B 1 104 LEU 104 309 309 LEU LEU B . n 
B 1 105 PHE 105 310 310 PHE PHE B . n 
B 1 106 LEU 106 311 311 LEU LEU B . n 
B 1 107 ASN 107 312 312 ASN ASN B . n 
B 1 108 ASP 108 313 313 ASP ASP B . n 
B 1 109 GLN 109 314 314 GLN GLN B . n 
B 1 110 VAL 110 315 315 VAL VAL B . n 
B 1 111 THR 111 316 316 THR THR B . n 
B 1 112 LEU 112 317 317 LEU LEU B . n 
B 1 113 LEU 113 318 318 LEU LEU B . n 
B 1 114 LYS 114 319 319 LYS LYS B . n 
B 1 115 TYR 115 320 320 TYR TYR B . n 
B 1 116 GLY 116 321 321 GLY GLY B . n 
B 1 117 VAL 117 322 322 VAL VAL B . n 
B 1 118 HIS 118 323 323 HIS HIS B . n 
B 1 119 GLU 119 324 324 GLU GLU B . n 
B 1 120 ALA 120 325 325 ALA ALA B . n 
B 1 121 ILE 121 326 326 ILE ILE B . n 
B 1 122 PHE 122 327 327 PHE PHE B . n 
B 1 123 ALA 123 328 328 ALA ALA B . n 
B 1 124 MET 124 329 329 MET MET B . n 
B 1 125 LEU 125 330 330 LEU LEU B . n 
B 1 126 ALA 126 331 331 ALA ALA B . n 
B 1 127 SER 127 332 332 SER SER B . n 
B 1 128 ILE 128 333 333 ILE ILE B . n 
B 1 129 VAL 129 334 334 VAL VAL B . n 
B 1 130 ASN 130 335 335 ASN ASN B . n 
B 1 131 LYS 131 336 336 LYS LYS B . n 
B 1 132 ASP 132 337 337 ASP ASP B . n 
B 1 133 GLY 133 338 338 GLY GLY B . n 
B 1 134 LEU 134 339 339 LEU LEU B . n 
B 1 135 LEU 135 340 340 LEU LEU B . n 
B 1 136 VAL 136 341 341 VAL VAL B . n 
B 1 137 ALA 137 342 342 ALA ALA B . n 
B 1 138 ASN 138 343 343 ASN ASN B . n 
B 1 139 GLY 139 344 344 GLY GLY B . n 
B 1 140 SER 140 345 345 SER SER B . n 
B 1 141 GLY 141 346 346 GLY GLY B . n 
B 1 142 PHE 142 347 347 PHE PHE B . n 
B 1 143 VAL 143 348 348 VAL VAL B . n 
B 1 144 THR 144 349 349 THR THR B . n 
B 1 145 ARG 145 350 350 ARG ARG B . n 
B 1 146 GLU 146 351 351 GLU GLU B . n 
B 1 147 PHE 147 352 352 PHE PHE B . n 
B 1 148 LEU 148 353 353 LEU LEU B . n 
B 1 149 ARG 149 354 354 ARG ARG B . n 
B 1 150 SER 150 355 355 SER SER B . n 
B 1 151 LEU 151 356 356 LEU LEU B . n 
B 1 152 ARG 152 357 357 ARG ARG B . n 
B 1 153 LYS 153 358 358 LYS LYS B . n 
B 1 154 PRO 154 359 359 PRO PRO B . n 
B 1 155 PHE 155 360 360 PHE PHE B . n 
B 1 156 SER 156 361 361 SER SER B . n 
B 1 157 ASP 157 362 362 ASP ASP B . n 
B 1 158 ILE 158 363 363 ILE ILE B . n 
B 1 159 ILE 159 364 364 ILE ILE B . n 
B 1 160 GLU 160 365 365 GLU GLU B . n 
B 1 161 PRO 161 366 366 PRO PRO B . n 
B 1 162 LYS 162 367 367 LYS LYS B . n 
B 1 163 PHE 163 368 368 PHE PHE B . n 
B 1 164 GLU 164 369 369 GLU GLU B . n 
B 1 165 PHE 165 370 370 PHE PHE B . n 
B 1 166 ALA 166 371 371 ALA ALA B . n 
B 1 167 VAL 167 372 372 VAL VAL B . n 
B 1 168 LYS 168 373 373 LYS LYS B . n 
B 1 169 PHE 169 374 374 PHE PHE B . n 
B 1 170 ASN 170 375 375 ASN ASN B . n 
B 1 171 ALA 171 376 376 ALA ALA B . n 
B 1 172 LEU 172 377 377 LEU LEU B . n 
B 1 173 GLU 173 378 378 GLU GLU B . n 
B 1 174 LEU 174 379 379 LEU LEU B . n 
B 1 175 ASP 175 380 380 ASP ASP B . n 
B 1 176 ASP 176 381 381 ASP ASP B . n 
B 1 177 SER 177 382 382 SER SER B . n 
B 1 178 ASP 178 383 383 ASP ASP B . n 
B 1 179 LEU 179 384 384 LEU LEU B . n 
B 1 180 ALA 180 385 385 ALA ALA B . n 
B 1 181 LEU 181 386 386 LEU LEU B . n 
B 1 182 PHE 182 387 387 PHE PHE B . n 
B 1 183 ILE 183 388 388 ILE ILE B . n 
B 1 184 ALA 184 389 389 ALA ALA B . n 
B 1 185 ALA 185 390 390 ALA ALA B . n 
B 1 186 ILE 186 391 391 ILE ILE B . n 
B 1 187 ILE 187 392 392 ILE ILE B . n 
B 1 188 LEU 188 393 393 LEU LEU B . n 
B 1 189 CYS 189 394 394 CYS CYS B . n 
B 1 190 GLY 190 395 395 GLY GLY B . n 
B 1 191 ASP 191 396 396 ASP ASP B . n 
B 1 192 ARG 192 397 397 ARG ARG B . n 
B 1 193 PRO 193 398 398 PRO PRO B . n 
B 1 194 GLY 194 399 399 GLY GLY B . n 
B 1 195 LEU 195 400 400 LEU LEU B . n 
B 1 196 MET 196 401 401 MET MET B . n 
B 1 197 ASN 197 402 402 ASN ASN B . n 
B 1 198 VAL 198 403 403 VAL VAL B . n 
B 1 199 PRO 199 404 404 PRO PRO B . n 
B 1 200 ARG 200 405 405 ARG ARG B . n 
B 1 201 VAL 201 406 406 VAL VAL B . n 
B 1 202 GLU 202 407 407 GLU GLU B . n 
B 1 203 ALA 203 408 408 ALA ALA B . n 
B 1 204 ILE 204 409 409 ILE ILE B . n 
B 1 205 GLN 205 410 410 GLN GLN B . n 
B 1 206 ASP 206 411 411 ASP ASP B . n 
B 1 207 THR 207 412 412 THR THR B . n 
B 1 208 ILE 208 413 413 ILE ILE B . n 
B 1 209 LEU 209 414 414 LEU LEU B . n 
B 1 210 ARG 210 415 415 ARG ARG B . n 
B 1 211 ALA 211 416 416 ALA ALA B . n 
B 1 212 LEU 212 417 417 LEU LEU B . n 
B 1 213 GLU 213 418 418 GLU GLU B . n 
B 1 214 PHE 214 419 419 PHE PHE B . n 
B 1 215 HIS 215 420 420 HIS HIS B . n 
B 1 216 LEU 216 421 421 LEU LEU B . n 
B 1 217 GLN 217 422 422 GLN GLN B . n 
B 1 218 ALA 218 423 423 ALA ALA B . n 
B 1 219 ASN 219 424 424 ASN ASN B . n 
B 1 220 HIS 220 425 425 HIS HIS B . n 
B 1 221 PRO 221 426 426 PRO PRO B . n 
B 1 222 ASP 222 427 427 ASP ASP B . n 
B 1 223 ALA 223 428 428 ALA ALA B . n 
B 1 224 GLN 224 429 429 GLN GLN B . n 
B 1 225 TYR 225 430 430 TYR TYR B . n 
B 1 226 LEU 226 431 431 LEU LEU B . n 
B 1 227 PHE 227 432 432 PHE PHE B . n 
B 1 228 PRO 228 433 433 PRO PRO B . n 
B 1 229 LYS 229 434 434 LYS LYS B . n 
B 1 230 LEU 230 435 435 LEU LEU B . n 
B 1 231 LEU 231 436 436 LEU LEU B . n 
B 1 232 GLN 232 437 437 GLN GLN B . n 
B 1 233 LYS 233 438 438 LYS LYS B . n 
B 1 234 MET 234 439 439 MET MET B . n 
B 1 235 ALA 235 440 440 ALA ALA B . n 
B 1 236 ASP 236 441 441 ASP ASP B . n 
B 1 237 LEU 237 442 442 LEU LEU B . n 
B 1 238 ARG 238 443 443 ARG ARG B . n 
B 1 239 GLN 239 444 444 GLN GLN B . n 
B 1 240 LEU 240 445 445 LEU LEU B . n 
B 1 241 VAL 241 446 446 VAL VAL B . n 
B 1 242 THR 242 447 447 THR THR B . n 
B 1 243 GLU 243 448 448 GLU GLU B . n 
B 1 244 HIS 244 449 449 HIS HIS B . n 
B 1 245 ALA 245 450 450 ALA ALA B . n 
B 1 246 GLN 246 451 451 GLN GLN B . n 
B 1 247 MET 247 452 452 MET MET B . n 
B 1 248 MET 248 453 453 MET MET B . n 
B 1 249 GLN 249 454 454 GLN GLN B . n 
B 1 250 ARG 250 455 455 ARG ARG B . n 
B 1 251 ILE 251 456 456 ILE ILE B . n 
B 1 252 LYS 252 457 457 LYS LYS B . n 
B 1 253 LYS 253 458 458 LYS LYS B . n 
B 1 254 THR 254 459 459 THR THR B . n 
B 1 255 GLU 255 460 460 GLU GLU B . n 
B 1 256 THR 256 461 461 THR THR B . n 
B 1 257 GLU 257 462 462 GLU GLU B . n 
B 1 258 THR 258 463 463 THR THR B . n 
B 1 259 SER 259 464 464 SER SER B . n 
B 1 260 LEU 260 465 465 LEU LEU B . n 
B 1 261 HIS 261 466 466 HIS HIS B . n 
B 1 262 PRO 262 467 467 PRO PRO B . n 
B 1 263 LEU 263 468 468 LEU LEU B . n 
B 1 264 LEU 264 469 469 LEU LEU B . n 
B 1 265 GLN 265 470 470 GLN GLN B . n 
B 1 266 GLU 266 471 471 GLU GLU B . n 
B 1 267 ILE 267 472 472 ILE ILE B . n 
B 1 268 TYR 268 473 473 TYR TYR B . n 
B 1 269 LYS 269 474 474 LYS LYS B . n 
B 1 270 ASP 270 475 475 ASP ASP B . n 
B 1 271 MET 271 476 476 MET MET B . n 
B 1 272 TYR 272 477 ?   ?   ?   B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,F,G,H,I,J,K,R 
2 1 B,L,M,N,O,P,Q,S       
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-03-29 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
CNS       phasing          . ? 4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             HIS 
_pdbx_validate_rmsd_angle.auth_seq_id_1              425 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              426 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              426 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                129.02 
_pdbx_validate_rmsd_angle.angle_target_value         119.30 
_pdbx_validate_rmsd_angle.angle_deviation            9.72 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.50 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 235 ? ? -50.10  -71.09  
2  1 ASP A 251 ? ? -170.74 -179.64 
3  1 GLU A 259 ? ? -45.14  -74.92  
4  1 LYS A 260 ? ? -35.14  -86.18  
5  1 VAL A 263 ? ? -131.96 -59.24  
6  1 LYS A 275 ? ? -150.24 -41.59  
7  1 LYS A 336 ? ? -39.85  -35.79  
8  1 GLN A 429 ? ? -48.50  -103.90 
9  1 TYR A 430 ? ? -86.45  35.34   
10 1 GLU A 460 ? ? -92.16  58.06   
11 1 LYS B 231 ? ? -57.50  -70.28  
12 1 LYS B 260 ? ? -76.91  -70.16  
13 1 LEU B 262 ? ? -33.94  -74.13  
14 1 PRO B 272 ? ? -36.03  148.01  
15 1 TYR B 274 ? ? -65.34  98.68   
16 1 ASN B 343 ? ? 36.60   43.96   
17 1 ALA B 423 ? ? -63.30  -80.35  
18 1 PRO B 426 ? ? -32.72  -102.82 
19 1 ASP B 427 ? ? -90.94  37.97   
20 1 GLN B 429 ? ? -39.46  -108.16 
21 1 TYR B 430 ? ? -113.07 63.51   
22 1 GLU B 460 ? ? -101.12 60.50   
23 1 LYS B 474 ? ? -29.22  -53.96  
24 1 ASP B 475 ? ? -26.99  -58.42  
# 
loop_
_pdbx_validate_chiral.id 
_pdbx_validate_chiral.PDB_model_num 
_pdbx_validate_chiral.auth_atom_id 
_pdbx_validate_chiral.label_alt_id 
_pdbx_validate_chiral.auth_asym_id 
_pdbx_validate_chiral.auth_comp_id 
_pdbx_validate_chiral.auth_seq_id 
_pdbx_validate_chiral.PDB_ins_code 
_pdbx_validate_chiral.details 
_pdbx_validate_chiral.omega 
1 1 C2 ? A B7G 483 ? PLANAR . 
2 1 C3 ? A B7G 483 ? PLANAR . 
3 1 C4 ? A B7G 483 ? PLANAR . 
4 1 C2 ? B B7G 480 ? PLANAR . 
5 1 C3 ? B B7G 480 ? PLANAR . 
6 1 C4 ? B B7G 480 ? PLANAR . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 212 ? CG  ? A LYS 7   CG  
2  1 Y 1 A LYS 212 ? CD  ? A LYS 7   CD  
3  1 Y 1 A LYS 212 ? CE  ? A LYS 7   CE  
4  1 Y 1 A LYS 212 ? NZ  ? A LYS 7   NZ  
5  1 Y 1 A LYS 216 ? CG  ? A LYS 11  CG  
6  1 Y 1 A LYS 216 ? CD  ? A LYS 11  CD  
7  1 Y 1 A LYS 216 ? CE  ? A LYS 11  CE  
8  1 Y 1 A LYS 216 ? NZ  ? A LYS 11  NZ  
9  1 Y 1 A LEU 262 ? CG  ? A LEU 57  CG  
10 1 Y 1 A LEU 262 ? CD1 ? A LEU 57  CD1 
11 1 Y 1 A LEU 262 ? CD2 ? A LEU 57  CD2 
12 1 Y 1 A LYS 275 ? CG  ? A LYS 70  CG  
13 1 Y 1 A LYS 275 ? CD  ? A LYS 70  CD  
14 1 Y 1 A LYS 275 ? CE  ? A LYS 70  CE  
15 1 Y 1 A LYS 275 ? NZ  ? A LYS 70  NZ  
16 1 Y 1 A GLN 429 ? CG  ? A GLN 224 CG  
17 1 Y 1 A GLN 429 ? CD  ? A GLN 224 CD  
18 1 Y 1 A GLN 429 ? OE1 ? A GLN 224 OE1 
19 1 Y 1 A GLN 429 ? NE2 ? A GLN 224 NE2 
20 1 Y 1 A GLU 462 ? CG  ? A GLU 257 CG  
21 1 Y 1 A GLU 462 ? CD  ? A GLU 257 CD  
22 1 Y 1 A GLU 462 ? OE1 ? A GLU 257 OE1 
23 1 Y 1 A GLU 462 ? OE2 ? A GLU 257 OE2 
24 1 Y 1 B LYS 212 ? CG  ? B LYS 7   CG  
25 1 Y 1 B LYS 212 ? CD  ? B LYS 7   CD  
26 1 Y 1 B LYS 212 ? CE  ? B LYS 7   CE  
27 1 Y 1 B LYS 212 ? NZ  ? B LYS 7   NZ  
28 1 Y 1 B LYS 216 ? CG  ? B LYS 11  CG  
29 1 Y 1 B LYS 216 ? CD  ? B LYS 11  CD  
30 1 Y 1 B LYS 216 ? CE  ? B LYS 11  CE  
31 1 Y 1 B LYS 216 ? NZ  ? B LYS 11  NZ  
32 1 Y 1 B ASN 227 ? CG  ? B ASN 22  CG  
33 1 Y 1 B ASN 227 ? OD1 ? B ASN 22  OD1 
34 1 Y 1 B ASN 227 ? ND2 ? B ASN 22  ND2 
35 1 Y 1 B LEU 262 ? CG  ? B LEU 57  CG  
36 1 Y 1 B LEU 262 ? CD1 ? B LEU 57  CD1 
37 1 Y 1 B LEU 262 ? CD2 ? B LEU 57  CD2 
38 1 Y 1 B LYS 275 ? CG  ? B LYS 70  CG  
39 1 Y 1 B LYS 275 ? CD  ? B LYS 70  CD  
40 1 Y 1 B LYS 275 ? CE  ? B LYS 70  CE  
41 1 Y 1 B LYS 275 ? NZ  ? B LYS 70  NZ  
42 1 Y 1 B GLU 291 ? CG  ? B GLU 86  CG  
43 1 Y 1 B GLU 291 ? CD  ? B GLU 86  CD  
44 1 Y 1 B GLU 291 ? OE1 ? B GLU 86  OE1 
45 1 Y 1 B GLU 291 ? OE2 ? B GLU 86  OE2 
46 1 Y 1 B LYS 336 ? CG  ? B LYS 131 CG  
47 1 Y 1 B LYS 336 ? CD  ? B LYS 131 CD  
48 1 Y 1 B LYS 336 ? CE  ? B LYS 131 CE  
49 1 Y 1 B LYS 336 ? NZ  ? B LYS 131 NZ  
50 1 Y 1 B GLN 429 ? CG  ? B GLN 224 CG  
51 1 Y 1 B GLN 429 ? CD  ? B GLN 224 CD  
52 1 Y 1 B GLN 429 ? OE1 ? B GLN 224 OE1 
53 1 Y 1 B GLN 429 ? NE2 ? B GLN 224 NE2 
54 1 Y 1 B TYR 430 ? CG  ? B TYR 225 CG  
55 1 Y 1 B TYR 430 ? CD1 ? B TYR 225 CD1 
56 1 Y 1 B TYR 430 ? CD2 ? B TYR 225 CD2 
57 1 Y 1 B TYR 430 ? CE1 ? B TYR 225 CE1 
58 1 Y 1 B TYR 430 ? CE2 ? B TYR 225 CE2 
59 1 Y 1 B TYR 430 ? CZ  ? B TYR 225 CZ  
60 1 Y 1 B TYR 430 ? OH  ? B TYR 225 OH  
61 1 Y 1 B LYS 434 ? CG  ? B LYS 229 CG  
62 1 Y 1 B LYS 434 ? CD  ? B LYS 229 CD  
63 1 Y 1 B LYS 434 ? CE  ? B LYS 229 CE  
64 1 Y 1 B LYS 434 ? NZ  ? B LYS 229 NZ  
65 1 Y 1 B GLN 454 ? CG  ? B GLN 249 CG  
66 1 Y 1 B GLN 454 ? CD  ? B GLN 249 CD  
67 1 Y 1 B GLN 454 ? OE1 ? B GLN 249 OE1 
68 1 Y 1 B GLN 454 ? NE2 ? B GLN 249 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A LYS 240 ? A LYS 35  
2  1 Y 1 A ALA 241 ? A ALA 36  
3  1 Y 1 A SER 242 ? A SER 37  
4  1 Y 1 A HIS 243 ? A HIS 38  
5  1 Y 1 A THR 244 ? A THR 39  
6  1 Y 1 A LYS 265 ? A LYS 60  
7  1 Y 1 A GLN 266 ? A GLN 61  
8  1 Y 1 A LEU 267 ? A LEU 62  
9  1 Y 1 A VAL 268 ? A VAL 63  
10 1 Y 1 A ASN 269 ? A ASN 64  
11 1 Y 1 A MET 476 ? A MET 271 
12 1 Y 1 A TYR 477 ? A TYR 272 
13 1 Y 1 B PRO 206 ? B PRO 1   
14 1 Y 1 B GLN 207 ? B GLN 2   
15 1 Y 1 B VAL 208 ? B VAL 3   
16 1 Y 1 B LYS 240 ? B LYS 35  
17 1 Y 1 B ALA 241 ? B ALA 36  
18 1 Y 1 B SER 242 ? B SER 37  
19 1 Y 1 B HIS 243 ? B HIS 38  
20 1 Y 1 B THR 244 ? B THR 39  
21 1 Y 1 B LYS 265 ? B LYS 60  
22 1 Y 1 B GLN 266 ? B GLN 61  
23 1 Y 1 B LEU 267 ? B LEU 62  
24 1 Y 1 B VAL 268 ? B VAL 63  
25 1 Y 1 B ASN 269 ? B ASN 64  
26 1 Y 1 B TYR 477 ? B TYR 272 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'IODIDE ION'                                                                              IOD 
3 '(2S)-2-(4-[2-(3-[2,4-DIFLUOROPHENYL]-1-HEPTYLUREIDO)ETHYL]PHENOXY)-2-METHYLBUTYRIC ACID' 331 
4 HEPTYL-BETA-D-GLUCOPYRANOSIDE                                                             B7G 
5 water                                                                                     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 IOD 1  200 200 IOD IOD A . 
D 2 IOD 1  202 202 IOD IOD A . 
E 2 IOD 1  203 203 IOD IOD A . 
F 2 IOD 1  478 206 IOD IOD A . 
G 2 IOD 1  479 207 IOD IOD A . 
H 2 IOD 1  480 208 IOD IOD A . 
I 2 IOD 1  481 209 IOD IOD A . 
J 3 331 1  482 300 331 331 A . 
K 4 B7G 1  483 400 B7G B7G A . 
L 2 IOD 1  201 201 IOD IOD B . 
M 2 IOD 1  204 204 IOD IOD B . 
N 2 IOD 1  205 205 IOD IOD B . 
O 2 IOD 1  478 210 IOD IOD B . 
P 3 331 1  479 301 331 331 B . 
Q 4 B7G 1  480 401 B7G B7G B . 
R 5 HOH 1  1   1   HOH HOH A . 
R 5 HOH 2  2   2   HOH HOH A . 
R 5 HOH 3  3   3   HOH HOH A . 
R 5 HOH 4  4   4   HOH HOH A . 
R 5 HOH 5  6   6   HOH HOH A . 
R 5 HOH 6  7   7   HOH HOH A . 
R 5 HOH 7  10  10  HOH HOH A . 
R 5 HOH 8  12  12  HOH HOH A . 
R 5 HOH 9  14  14  HOH HOH A . 
R 5 HOH 10 15  15  HOH HOH A . 
R 5 HOH 11 19  19  HOH HOH A . 
R 5 HOH 12 22  22  HOH HOH A . 
R 5 HOH 13 26  26  HOH HOH A . 
R 5 HOH 14 27  27  HOH HOH A . 
R 5 HOH 15 30  30  HOH HOH A . 
R 5 HOH 16 31  31  HOH HOH A . 
R 5 HOH 17 33  33  HOH HOH A . 
R 5 HOH 18 34  34  HOH HOH A . 
R 5 HOH 19 37  37  HOH HOH A . 
R 5 HOH 20 38  38  HOH HOH A . 
R 5 HOH 21 40  40  HOH HOH A . 
R 5 HOH 22 41  41  HOH HOH A . 
R 5 HOH 23 42  42  HOH HOH A . 
R 5 HOH 24 43  43  HOH HOH A . 
R 5 HOH 25 51  51  HOH HOH A . 
R 5 HOH 26 53  53  HOH HOH A . 
R 5 HOH 27 54  54  HOH HOH A . 
R 5 HOH 28 59  59  HOH HOH A . 
R 5 HOH 29 60  60  HOH HOH A . 
R 5 HOH 30 62  62  HOH HOH A . 
R 5 HOH 31 63  63  HOH HOH A . 
R 5 HOH 32 65  65  HOH HOH A . 
R 5 HOH 33 66  66  HOH HOH A . 
R 5 HOH 34 67  67  HOH HOH A . 
R 5 HOH 35 68  68  HOH HOH A . 
R 5 HOH 36 69  69  HOH HOH A . 
R 5 HOH 37 70  70  HOH HOH A . 
R 5 HOH 38 71  71  HOH HOH A . 
R 5 HOH 39 76  76  HOH HOH A . 
R 5 HOH 40 77  77  HOH HOH A . 
R 5 HOH 41 78  78  HOH HOH A . 
R 5 HOH 42 80  80  HOH HOH A . 
R 5 HOH 43 81  81  HOH HOH A . 
R 5 HOH 44 83  83  HOH HOH A . 
R 5 HOH 45 85  85  HOH HOH A . 
R 5 HOH 46 88  88  HOH HOH A . 
R 5 HOH 47 89  89  HOH HOH A . 
R 5 HOH 48 91  91  HOH HOH A . 
R 5 HOH 49 92  92  HOH HOH A . 
R 5 HOH 50 93  93  HOH HOH A . 
R 5 HOH 51 96  96  HOH HOH A . 
R 5 HOH 52 101 101 HOH HOH A . 
R 5 HOH 53 104 104 HOH HOH A . 
R 5 HOH 54 106 106 HOH HOH A . 
R 5 HOH 55 107 107 HOH HOH A . 
R 5 HOH 56 109 109 HOH HOH A . 
R 5 HOH 57 112 112 HOH HOH A . 
R 5 HOH 58 113 113 HOH HOH A . 
R 5 HOH 59 115 115 HOH HOH A . 
R 5 HOH 60 119 119 HOH HOH A . 
R 5 HOH 61 120 120 HOH HOH A . 
R 5 HOH 62 122 122 HOH HOH A . 
R 5 HOH 63 123 123 HOH HOH A . 
R 5 HOH 64 124 124 HOH HOH A . 
R 5 HOH 65 125 125 HOH HOH A . 
R 5 HOH 66 126 126 HOH HOH A . 
R 5 HOH 67 127 127 HOH HOH A . 
R 5 HOH 68 128 128 HOH HOH A . 
R 5 HOH 69 131 131 HOH HOH A . 
R 5 HOH 70 134 134 HOH HOH A . 
R 5 HOH 71 135 135 HOH HOH A . 
R 5 HOH 72 136 136 HOH HOH A . 
R 5 HOH 73 137 137 HOH HOH A . 
R 5 HOH 74 139 139 HOH HOH A . 
R 5 HOH 75 143 143 HOH HOH A . 
R 5 HOH 76 144 144 HOH HOH A . 
R 5 HOH 77 145 145 HOH HOH A . 
R 5 HOH 78 148 148 HOH HOH A . 
R 5 HOH 79 149 149 HOH HOH A . 
R 5 HOH 80 153 153 HOH HOH A . 
R 5 HOH 81 155 155 HOH HOH A . 
R 5 HOH 82 156 156 HOH HOH A . 
R 5 HOH 83 157 157 HOH HOH A . 
R 5 HOH 84 161 161 HOH HOH A . 
S 5 HOH 1  5   5   HOH HOH B . 
S 5 HOH 2  8   8   HOH HOH B . 
S 5 HOH 3  9   9   HOH HOH B . 
S 5 HOH 4  11  11  HOH HOH B . 
S 5 HOH 5  13  13  HOH HOH B . 
S 5 HOH 6  16  16  HOH HOH B . 
S 5 HOH 7  17  17  HOH HOH B . 
S 5 HOH 8  18  18  HOH HOH B . 
S 5 HOH 9  20  20  HOH HOH B . 
S 5 HOH 10 21  21  HOH HOH B . 
S 5 HOH 11 23  23  HOH HOH B . 
S 5 HOH 12 24  24  HOH HOH B . 
S 5 HOH 13 25  25  HOH HOH B . 
S 5 HOH 14 28  28  HOH HOH B . 
S 5 HOH 15 29  29  HOH HOH B . 
S 5 HOH 16 32  32  HOH HOH B . 
S 5 HOH 17 35  35  HOH HOH B . 
S 5 HOH 18 36  36  HOH HOH B . 
S 5 HOH 19 39  39  HOH HOH B . 
S 5 HOH 20 44  44  HOH HOH B . 
S 5 HOH 21 45  45  HOH HOH B . 
S 5 HOH 22 46  46  HOH HOH B . 
S 5 HOH 23 47  47  HOH HOH B . 
S 5 HOH 24 48  48  HOH HOH B . 
S 5 HOH 25 49  49  HOH HOH B . 
S 5 HOH 26 50  50  HOH HOH B . 
S 5 HOH 27 52  52  HOH HOH B . 
S 5 HOH 28 55  55  HOH HOH B . 
S 5 HOH 29 56  56  HOH HOH B . 
S 5 HOH 30 57  57  HOH HOH B . 
S 5 HOH 31 58  58  HOH HOH B . 
S 5 HOH 32 61  61  HOH HOH B . 
S 5 HOH 33 64  64  HOH HOH B . 
S 5 HOH 34 72  72  HOH HOH B . 
S 5 HOH 35 73  73  HOH HOH B . 
S 5 HOH 36 74  74  HOH HOH B . 
S 5 HOH 37 75  75  HOH HOH B . 
S 5 HOH 38 79  79  HOH HOH B . 
S 5 HOH 39 82  82  HOH HOH B . 
S 5 HOH 40 84  84  HOH HOH B . 
S 5 HOH 41 86  86  HOH HOH B . 
S 5 HOH 42 87  87  HOH HOH B . 
S 5 HOH 43 90  90  HOH HOH B . 
S 5 HOH 44 94  94  HOH HOH B . 
S 5 HOH 45 95  95  HOH HOH B . 
S 5 HOH 46 97  97  HOH HOH B . 
S 5 HOH 47 98  98  HOH HOH B . 
S 5 HOH 48 99  99  HOH HOH B . 
S 5 HOH 49 100 100 HOH HOH B . 
S 5 HOH 50 102 102 HOH HOH B . 
S 5 HOH 51 103 103 HOH HOH B . 
S 5 HOH 52 105 105 HOH HOH B . 
S 5 HOH 53 108 108 HOH HOH B . 
S 5 HOH 54 110 110 HOH HOH B . 
S 5 HOH 55 111 111 HOH HOH B . 
S 5 HOH 56 114 114 HOH HOH B . 
S 5 HOH 57 116 116 HOH HOH B . 
S 5 HOH 58 117 117 HOH HOH B . 
S 5 HOH 59 118 118 HOH HOH B . 
S 5 HOH 60 121 121 HOH HOH B . 
S 5 HOH 61 129 129 HOH HOH B . 
S 5 HOH 62 130 130 HOH HOH B . 
S 5 HOH 63 132 132 HOH HOH B . 
S 5 HOH 64 133 133 HOH HOH B . 
S 5 HOH 65 138 138 HOH HOH B . 
S 5 HOH 66 140 140 HOH HOH B . 
S 5 HOH 67 141 141 HOH HOH B . 
S 5 HOH 68 142 142 HOH HOH B . 
S 5 HOH 69 146 146 HOH HOH B . 
S 5 HOH 70 147 147 HOH HOH B . 
S 5 HOH 71 150 150 HOH HOH B . 
S 5 HOH 72 151 151 HOH HOH B . 
S 5 HOH 73 152 152 HOH HOH B . 
S 5 HOH 74 154 154 HOH HOH B . 
S 5 HOH 75 158 158 HOH HOH B . 
S 5 HOH 76 159 159 HOH HOH B . 
S 5 HOH 77 160 160 HOH HOH B . 
S 5 HOH 78 162 162 HOH HOH B . 
#