data_1Y1V
# 
_entry.id   1Y1V 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1Y1V         
RCSB  RCSB031010   
WWPDB D_1000031010 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1PQV 
_pdbx_database_related.details        'The new model replaces the unrefined backbone model of the same protein complex' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1Y1V 
_pdbx_database_status.recvd_initial_deposition_date   2004-11-19 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kettenberger, H.' 1 
'Armache, K.-J.'   2 
'Cramer, P.'       3 
# 
_citation.id                        primary 
_citation.title                     
'Complete RNA polymerase II elongation complex structure and its interactions with NTP and TFIIS.' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            16 
_citation.page_first                955 
_citation.page_last                 965 
_citation.year                      2004 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15610738 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2004.11.040 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kettenberger, H.' 1 ? 
primary 'Armache, K.J.'    2 ? 
primary 'Cramer, P.'       3 ? 
# 
_cell.entry_id           1Y1V 
_cell.length_a           218.9 
_cell.length_b           395.3 
_cell.length_c           281.0 
_cell.angle_alpha        90 
_cell.angle_beta         90 
_cell.angle_gamma        90 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
# 
_symmetry.entry_id                         1Y1V 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                20 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-directed RNA polymerase II largest subunit'                   191821.578 1 2.7.7.6 ? ? ? 
2  polymer     nat 'DNA-directed RNA polymerase II 140 kDa polypeptide'               138937.297 1 2.7.7.6 ? ? ? 
3  polymer     nat 'DNA-directed RNA polymerase II 45 kDa polypeptide'                35330.457  1 2.7.7.6 ? ? ? 
4  polymer     nat 'DNA-directed RNA polymerase II 32 kDa polypeptide'                25451.191  1 2.7.7.6 ? ? ? 
5  polymer     nat 'DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide'   25117.094  1 2.7.7.6 ? ? ? 
6  polymer     nat 'DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide'   17931.834  1 2.7.7.6 ? ? ? 
7  polymer     nat 'DNA-directed RNA polymerase II 19 kDa polypeptide'                19081.053  1 2.7.7.6 ? ? ? 
8  polymer     nat 'DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide' 16525.363  1 2.7.7.6 ? ? ? 
9  polymer     nat 'DNA-directed RNA polymerase II subunit 9'                         14308.161  1 2.7.7.6 ? ? ? 
10 polymer     nat 'DNA-directed RNA polymerases I/II/III subunit 10'                 8290.732   1 2.7.7.6 ? ? ? 
11 polymer     nat 'DNA-directed RNA polymerase II 13.6 kDa polypeptide'              13633.493  1 2.7.7.6 ? ? ? 
12 polymer     nat 'DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide'  7729.969   1 2.7.7.6 ? ? ? 
13 polymer     man 'Transcription elongation factor S-II'                             20271.938  1 ?       ? ? ? 
14 non-polymer syn 'ZINC ION'                                                         65.409     9 ?       ? ? ? 
15 non-polymer syn 'MAGNESIUM ION'                                                    24.305     1 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  'RNA polymerase II subunit 1, B220'                                                                               
2  'B150, RNA polymerase II subunit 2'                                                                               
3  B44.5                                                                                                             
4  B32                                                                                                               
5  ABC27                                                                                                             
6  ABC23                                                                                                             
7  B16                                                                                                               
8  ABC14.4                                                                                                           
9  'DNA-directed RNA polymerase II 14.2 kDa polypeptide, B12.6'                                                      
10 'DNA- directed RNA polymerases I, II, and III 8.3 kDa polypeptide, ABC10- beta, ABC8'                             
11 B13.6                                                                                                             
12 ABC10-alpha                                                                                                       
13 'DNA strand transfer protein alpha, STP-alpha, DNA strand transferase 1, Pyrimidine pathway regulatory protein 2' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no 
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
A ? 
2  'polypeptide(L)' no no 
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
B ? 
3  'polypeptide(L)' no no 
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
C ? 
4  'polypeptide(L)' no no 
;MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKKK
HLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETV
GAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY
;
;MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKKK
HLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETV
GAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY
;
D ? 
5  'polypeptide(L)' no no 
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
E ? 
6  'polypeptide(L)' no no 
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
F ? 
7  'polypeptide(L)' no no 
;MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFK
PFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAI
GSIKEDYLGAI
;
;MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFK
PFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAI
GSIKEDYLGAI
;
G ? 
8  'polypeptide(L)' no no 
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
H ? 
9  'polypeptide(L)' no no 
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
I ? 
10 'polypeptide(L)' no no MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD J ? 
11 'polypeptide(L)' no no 
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
K ? 
12 'polypeptide(L)' no no MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 
MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR L ? 
13 'polypeptide(L)' no no 
;PRNSKNDGVDTAIYHHKLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVISKN
NPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSAD
EPLTTFCTCEACGNRWKFS
;
;PRNSKNDGVDTAIYHHKLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVISKN
NPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSAD
EPLTTFCTCEACGNRWKFS
;
S ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    MET n 
1  2    VAL n 
1  3    GLY n 
1  4    GLN n 
1  5    GLN n 
1  6    TYR n 
1  7    SER n 
1  8    SER n 
1  9    ALA n 
1  10   PRO n 
1  11   LEU n 
1  12   ARG n 
1  13   THR n 
1  14   VAL n 
1  15   LYS n 
1  16   GLU n 
1  17   VAL n 
1  18   GLN n 
1  19   PHE n 
1  20   GLY n 
1  21   LEU n 
1  22   PHE n 
1  23   SER n 
1  24   PRO n 
1  25   GLU n 
1  26   GLU n 
1  27   VAL n 
1  28   ARG n 
1  29   ALA n 
1  30   ILE n 
1  31   SER n 
1  32   VAL n 
1  33   ALA n 
1  34   LYS n 
1  35   ILE n 
1  36   ARG n 
1  37   PHE n 
1  38   PRO n 
1  39   GLU n 
1  40   THR n 
1  41   MET n 
1  42   ASP n 
1  43   GLU n 
1  44   THR n 
1  45   GLN n 
1  46   THR n 
1  47   ARG n 
1  48   ALA n 
1  49   LYS n 
1  50   ILE n 
1  51   GLY n 
1  52   GLY n 
1  53   LEU n 
1  54   ASN n 
1  55   ASP n 
1  56   PRO n 
1  57   ARG n 
1  58   LEU n 
1  59   GLY n 
1  60   SER n 
1  61   ILE n 
1  62   ASP n 
1  63   ARG n 
1  64   ASN n 
1  65   LEU n 
1  66   LYS n 
1  67   CYS n 
1  68   GLN n 
1  69   THR n 
1  70   CYS n 
1  71   GLN n 
1  72   GLU n 
1  73   GLY n 
1  74   MET n 
1  75   ASN n 
1  76   GLU n 
1  77   CYS n 
1  78   PRO n 
1  79   GLY n 
1  80   HIS n 
1  81   PHE n 
1  82   GLY n 
1  83   HIS n 
1  84   ILE n 
1  85   ASP n 
1  86   LEU n 
1  87   ALA n 
1  88   LYS n 
1  89   PRO n 
1  90   VAL n 
1  91   PHE n 
1  92   HIS n 
1  93   VAL n 
1  94   GLY n 
1  95   PHE n 
1  96   ILE n 
1  97   ALA n 
1  98   LYS n 
1  99   ILE n 
1  100  LYS n 
1  101  LYS n 
1  102  VAL n 
1  103  CYS n 
1  104  GLU n 
1  105  CYS n 
1  106  VAL n 
1  107  CYS n 
1  108  MET n 
1  109  HIS n 
1  110  CYS n 
1  111  GLY n 
1  112  LYS n 
1  113  LEU n 
1  114  LEU n 
1  115  LEU n 
1  116  ASP n 
1  117  GLU n 
1  118  HIS n 
1  119  ASN n 
1  120  GLU n 
1  121  LEU n 
1  122  MET n 
1  123  ARG n 
1  124  GLN n 
1  125  ALA n 
1  126  LEU n 
1  127  ALA n 
1  128  ILE n 
1  129  LYS n 
1  130  ASP n 
1  131  SER n 
1  132  LYS n 
1  133  LYS n 
1  134  ARG n 
1  135  PHE n 
1  136  ALA n 
1  137  ALA n 
1  138  ILE n 
1  139  TRP n 
1  140  THR n 
1  141  LEU n 
1  142  CYS n 
1  143  LYS n 
1  144  THR n 
1  145  LYS n 
1  146  MET n 
1  147  VAL n 
1  148  CYS n 
1  149  GLU n 
1  150  THR n 
1  151  ASP n 
1  152  VAL n 
1  153  PRO n 
1  154  SER n 
1  155  GLU n 
1  156  ASP n 
1  157  ASP n 
1  158  PRO n 
1  159  THR n 
1  160  GLN n 
1  161  LEU n 
1  162  VAL n 
1  163  SER n 
1  164  ARG n 
1  165  GLY n 
1  166  GLY n 
1  167  CYS n 
1  168  GLY n 
1  169  ASN n 
1  170  THR n 
1  171  GLN n 
1  172  PRO n 
1  173  THR n 
1  174  ILE n 
1  175  ARG n 
1  176  LYS n 
1  177  ASP n 
1  178  GLY n 
1  179  LEU n 
1  180  LYS n 
1  181  LEU n 
1  182  VAL n 
1  183  GLY n 
1  184  SER n 
1  185  TRP n 
1  186  LYS n 
1  187  LYS n 
1  188  ASP n 
1  189  ARG n 
1  190  ALA n 
1  191  THR n 
1  192  GLY n 
1  193  ASP n 
1  194  ALA n 
1  195  ASP n 
1  196  GLU n 
1  197  PRO n 
1  198  GLU n 
1  199  LEU n 
1  200  ARG n 
1  201  VAL n 
1  202  LEU n 
1  203  SER n 
1  204  THR n 
1  205  GLU n 
1  206  GLU n 
1  207  ILE n 
1  208  LEU n 
1  209  ASN n 
1  210  ILE n 
1  211  PHE n 
1  212  LYS n 
1  213  HIS n 
1  214  ILE n 
1  215  SER n 
1  216  VAL n 
1  217  LYS n 
1  218  ASP n 
1  219  PHE n 
1  220  THR n 
1  221  SER n 
1  222  LEU n 
1  223  GLY n 
1  224  PHE n 
1  225  ASN n 
1  226  GLU n 
1  227  VAL n 
1  228  PHE n 
1  229  SER n 
1  230  ARG n 
1  231  PRO n 
1  232  GLU n 
1  233  TRP n 
1  234  MET n 
1  235  ILE n 
1  236  LEU n 
1  237  THR n 
1  238  CYS n 
1  239  LEU n 
1  240  PRO n 
1  241  VAL n 
1  242  PRO n 
1  243  PRO n 
1  244  PRO n 
1  245  PRO n 
1  246  VAL n 
1  247  ARG n 
1  248  PRO n 
1  249  SER n 
1  250  ILE n 
1  251  SER n 
1  252  PHE n 
1  253  ASN n 
1  254  GLU n 
1  255  SER n 
1  256  GLN n 
1  257  ARG n 
1  258  GLY n 
1  259  GLU n 
1  260  ASP n 
1  261  ASP n 
1  262  LEU n 
1  263  THR n 
1  264  PHE n 
1  265  LYS n 
1  266  LEU n 
1  267  ALA n 
1  268  ASP n 
1  269  ILE n 
1  270  LEU n 
1  271  LYS n 
1  272  ALA n 
1  273  ASN n 
1  274  ILE n 
1  275  SER n 
1  276  LEU n 
1  277  GLU n 
1  278  THR n 
1  279  LEU n 
1  280  GLU n 
1  281  HIS n 
1  282  ASN n 
1  283  GLY n 
1  284  ALA n 
1  285  PRO n 
1  286  HIS n 
1  287  HIS n 
1  288  ALA n 
1  289  ILE n 
1  290  GLU n 
1  291  GLU n 
1  292  ALA n 
1  293  GLU n 
1  294  SER n 
1  295  LEU n 
1  296  LEU n 
1  297  GLN n 
1  298  PHE n 
1  299  HIS n 
1  300  VAL n 
1  301  ALA n 
1  302  THR n 
1  303  TYR n 
1  304  MET n 
1  305  ASP n 
1  306  ASN n 
1  307  ASP n 
1  308  ILE n 
1  309  ALA n 
1  310  GLY n 
1  311  GLN n 
1  312  PRO n 
1  313  GLN n 
1  314  ALA n 
1  315  LEU n 
1  316  GLN n 
1  317  LYS n 
1  318  SER n 
1  319  GLY n 
1  320  ARG n 
1  321  PRO n 
1  322  VAL n 
1  323  LYS n 
1  324  SER n 
1  325  ILE n 
1  326  ARG n 
1  327  ALA n 
1  328  ARG n 
1  329  LEU n 
1  330  LYS n 
1  331  GLY n 
1  332  LYS n 
1  333  GLU n 
1  334  GLY n 
1  335  ARG n 
1  336  ILE n 
1  337  ARG n 
1  338  GLY n 
1  339  ASN n 
1  340  LEU n 
1  341  MET n 
1  342  GLY n 
1  343  LYS n 
1  344  ARG n 
1  345  VAL n 
1  346  ASP n 
1  347  PHE n 
1  348  SER n 
1  349  ALA n 
1  350  ARG n 
1  351  THR n 
1  352  VAL n 
1  353  ILE n 
1  354  SER n 
1  355  GLY n 
1  356  ASP n 
1  357  PRO n 
1  358  ASN n 
1  359  LEU n 
1  360  GLU n 
1  361  LEU n 
1  362  ASP n 
1  363  GLN n 
1  364  VAL n 
1  365  GLY n 
1  366  VAL n 
1  367  PRO n 
1  368  LYS n 
1  369  SER n 
1  370  ILE n 
1  371  ALA n 
1  372  LYS n 
1  373  THR n 
1  374  LEU n 
1  375  THR n 
1  376  TYR n 
1  377  PRO n 
1  378  GLU n 
1  379  VAL n 
1  380  VAL n 
1  381  THR n 
1  382  PRO n 
1  383  TYR n 
1  384  ASN n 
1  385  ILE n 
1  386  ASP n 
1  387  ARG n 
1  388  LEU n 
1  389  THR n 
1  390  GLN n 
1  391  LEU n 
1  392  VAL n 
1  393  ARG n 
1  394  ASN n 
1  395  GLY n 
1  396  PRO n 
1  397  ASN n 
1  398  GLU n 
1  399  HIS n 
1  400  PRO n 
1  401  GLY n 
1  402  ALA n 
1  403  LYS n 
1  404  TYR n 
1  405  VAL n 
1  406  ILE n 
1  407  ARG n 
1  408  ASP n 
1  409  SER n 
1  410  GLY n 
1  411  ASP n 
1  412  ARG n 
1  413  ILE n 
1  414  ASP n 
1  415  LEU n 
1  416  ARG n 
1  417  TYR n 
1  418  SER n 
1  419  LYS n 
1  420  ARG n 
1  421  ALA n 
1  422  GLY n 
1  423  ASP n 
1  424  ILE n 
1  425  GLN n 
1  426  LEU n 
1  427  GLN n 
1  428  TYR n 
1  429  GLY n 
1  430  TRP n 
1  431  LYS n 
1  432  VAL n 
1  433  GLU n 
1  434  ARG n 
1  435  HIS n 
1  436  ILE n 
1  437  MET n 
1  438  ASP n 
1  439  ASN n 
1  440  ASP n 
1  441  PRO n 
1  442  VAL n 
1  443  LEU n 
1  444  PHE n 
1  445  ASN n 
1  446  ARG n 
1  447  GLN n 
1  448  PRO n 
1  449  SER n 
1  450  LEU n 
1  451  HIS n 
1  452  LYS n 
1  453  MET n 
1  454  SER n 
1  455  MET n 
1  456  MET n 
1  457  ALA n 
1  458  HIS n 
1  459  ARG n 
1  460  VAL n 
1  461  LYS n 
1  462  VAL n 
1  463  ILE n 
1  464  PRO n 
1  465  TYR n 
1  466  SER n 
1  467  THR n 
1  468  PHE n 
1  469  ARG n 
1  470  LEU n 
1  471  ASN n 
1  472  LEU n 
1  473  SER n 
1  474  VAL n 
1  475  THR n 
1  476  SER n 
1  477  PRO n 
1  478  TYR n 
1  479  ASN n 
1  480  ALA n 
1  481  ASP n 
1  482  PHE n 
1  483  ASP n 
1  484  GLY n 
1  485  ASP n 
1  486  GLU n 
1  487  MET n 
1  488  ASN n 
1  489  LEU n 
1  490  HIS n 
1  491  VAL n 
1  492  PRO n 
1  493  GLN n 
1  494  SER n 
1  495  GLU n 
1  496  GLU n 
1  497  THR n 
1  498  ARG n 
1  499  ALA n 
1  500  GLU n 
1  501  LEU n 
1  502  SER n 
1  503  GLN n 
1  504  LEU n 
1  505  CYS n 
1  506  ALA n 
1  507  VAL n 
1  508  PRO n 
1  509  LEU n 
1  510  GLN n 
1  511  ILE n 
1  512  VAL n 
1  513  SER n 
1  514  PRO n 
1  515  GLN n 
1  516  SER n 
1  517  ASN n 
1  518  LYS n 
1  519  PRO n 
1  520  CYS n 
1  521  MET n 
1  522  GLY n 
1  523  ILE n 
1  524  VAL n 
1  525  GLN n 
1  526  ASP n 
1  527  THR n 
1  528  LEU n 
1  529  CYS n 
1  530  GLY n 
1  531  ILE n 
1  532  ARG n 
1  533  LYS n 
1  534  LEU n 
1  535  THR n 
1  536  LEU n 
1  537  ARG n 
1  538  ASP n 
1  539  THR n 
1  540  PHE n 
1  541  ILE n 
1  542  GLU n 
1  543  LEU n 
1  544  ASP n 
1  545  GLN n 
1  546  VAL n 
1  547  LEU n 
1  548  ASN n 
1  549  MET n 
1  550  LEU n 
1  551  TYR n 
1  552  TRP n 
1  553  VAL n 
1  554  PRO n 
1  555  ASP n 
1  556  TRP n 
1  557  ASP n 
1  558  GLY n 
1  559  VAL n 
1  560  ILE n 
1  561  PRO n 
1  562  THR n 
1  563  PRO n 
1  564  ALA n 
1  565  ILE n 
1  566  ILE n 
1  567  LYS n 
1  568  PRO n 
1  569  LYS n 
1  570  PRO n 
1  571  LEU n 
1  572  TRP n 
1  573  SER n 
1  574  GLY n 
1  575  LYS n 
1  576  GLN n 
1  577  ILE n 
1  578  LEU n 
1  579  SER n 
1  580  VAL n 
1  581  ALA n 
1  582  ILE n 
1  583  PRO n 
1  584  ASN n 
1  585  GLY n 
1  586  ILE n 
1  587  HIS n 
1  588  LEU n 
1  589  GLN n 
1  590  ARG n 
1  591  PHE n 
1  592  ASP n 
1  593  GLU n 
1  594  GLY n 
1  595  THR n 
1  596  THR n 
1  597  LEU n 
1  598  LEU n 
1  599  SER n 
1  600  PRO n 
1  601  LYS n 
1  602  ASP n 
1  603  ASN n 
1  604  GLY n 
1  605  MET n 
1  606  LEU n 
1  607  ILE n 
1  608  ILE n 
1  609  ASP n 
1  610  GLY n 
1  611  GLN n 
1  612  ILE n 
1  613  ILE n 
1  614  PHE n 
1  615  GLY n 
1  616  VAL n 
1  617  VAL n 
1  618  GLU n 
1  619  LYS n 
1  620  LYS n 
1  621  THR n 
1  622  VAL n 
1  623  GLY n 
1  624  SER n 
1  625  SER n 
1  626  ASN n 
1  627  GLY n 
1  628  GLY n 
1  629  LEU n 
1  630  ILE n 
1  631  HIS n 
1  632  VAL n 
1  633  VAL n 
1  634  THR n 
1  635  ARG n 
1  636  GLU n 
1  637  LYS n 
1  638  GLY n 
1  639  PRO n 
1  640  GLN n 
1  641  VAL n 
1  642  CYS n 
1  643  ALA n 
1  644  LYS n 
1  645  LEU n 
1  646  PHE n 
1  647  GLY n 
1  648  ASN n 
1  649  ILE n 
1  650  GLN n 
1  651  LYS n 
1  652  VAL n 
1  653  VAL n 
1  654  ASN n 
1  655  PHE n 
1  656  TRP n 
1  657  LEU n 
1  658  LEU n 
1  659  HIS n 
1  660  ASN n 
1  661  GLY n 
1  662  PHE n 
1  663  SER n 
1  664  THR n 
1  665  GLY n 
1  666  ILE n 
1  667  GLY n 
1  668  ASP n 
1  669  THR n 
1  670  ILE n 
1  671  ALA n 
1  672  ASP n 
1  673  GLY n 
1  674  PRO n 
1  675  THR n 
1  676  MET n 
1  677  ARG n 
1  678  GLU n 
1  679  ILE n 
1  680  THR n 
1  681  GLU n 
1  682  THR n 
1  683  ILE n 
1  684  ALA n 
1  685  GLU n 
1  686  ALA n 
1  687  LYS n 
1  688  LYS n 
1  689  LYS n 
1  690  VAL n 
1  691  LEU n 
1  692  ASP n 
1  693  VAL n 
1  694  THR n 
1  695  LYS n 
1  696  GLU n 
1  697  ALA n 
1  698  GLN n 
1  699  ALA n 
1  700  ASN n 
1  701  LEU n 
1  702  LEU n 
1  703  THR n 
1  704  ALA n 
1  705  LYS n 
1  706  HIS n 
1  707  GLY n 
1  708  MET n 
1  709  THR n 
1  710  LEU n 
1  711  ARG n 
1  712  GLU n 
1  713  SER n 
1  714  PHE n 
1  715  GLU n 
1  716  ASP n 
1  717  ASN n 
1  718  VAL n 
1  719  VAL n 
1  720  ARG n 
1  721  PHE n 
1  722  LEU n 
1  723  ASN n 
1  724  GLU n 
1  725  ALA n 
1  726  ARG n 
1  727  ASP n 
1  728  LYS n 
1  729  ALA n 
1  730  GLY n 
1  731  ARG n 
1  732  LEU n 
1  733  ALA n 
1  734  GLU n 
1  735  VAL n 
1  736  ASN n 
1  737  LEU n 
1  738  LYS n 
1  739  ASP n 
1  740  LEU n 
1  741  ASN n 
1  742  ASN n 
1  743  VAL n 
1  744  LYS n 
1  745  GLN n 
1  746  MET n 
1  747  VAL n 
1  748  MET n 
1  749  ALA n 
1  750  GLY n 
1  751  SER n 
1  752  LYS n 
1  753  GLY n 
1  754  SER n 
1  755  PHE n 
1  756  ILE n 
1  757  ASN n 
1  758  ILE n 
1  759  ALA n 
1  760  GLN n 
1  761  MET n 
1  762  SER n 
1  763  ALA n 
1  764  CYS n 
1  765  VAL n 
1  766  GLY n 
1  767  GLN n 
1  768  GLN n 
1  769  SER n 
1  770  VAL n 
1  771  GLU n 
1  772  GLY n 
1  773  LYS n 
1  774  ARG n 
1  775  ILE n 
1  776  ALA n 
1  777  PHE n 
1  778  GLY n 
1  779  PHE n 
1  780  VAL n 
1  781  ASP n 
1  782  ARG n 
1  783  THR n 
1  784  LEU n 
1  785  PRO n 
1  786  HIS n 
1  787  PHE n 
1  788  SER n 
1  789  LYS n 
1  790  ASP n 
1  791  ASP n 
1  792  TYR n 
1  793  SER n 
1  794  PRO n 
1  795  GLU n 
1  796  SER n 
1  797  LYS n 
1  798  GLY n 
1  799  PHE n 
1  800  VAL n 
1  801  GLU n 
1  802  ASN n 
1  803  SER n 
1  804  TYR n 
1  805  LEU n 
1  806  ARG n 
1  807  GLY n 
1  808  LEU n 
1  809  THR n 
1  810  PRO n 
1  811  GLN n 
1  812  GLU n 
1  813  PHE n 
1  814  PHE n 
1  815  PHE n 
1  816  HIS n 
1  817  ALA n 
1  818  MET n 
1  819  GLY n 
1  820  GLY n 
1  821  ARG n 
1  822  GLU n 
1  823  GLY n 
1  824  LEU n 
1  825  ILE n 
1  826  ASP n 
1  827  THR n 
1  828  ALA n 
1  829  VAL n 
1  830  LYS n 
1  831  THR n 
1  832  ALA n 
1  833  GLU n 
1  834  THR n 
1  835  GLY n 
1  836  TYR n 
1  837  ILE n 
1  838  GLN n 
1  839  ARG n 
1  840  ARG n 
1  841  LEU n 
1  842  VAL n 
1  843  LYS n 
1  844  ALA n 
1  845  LEU n 
1  846  GLU n 
1  847  ASP n 
1  848  ILE n 
1  849  MET n 
1  850  VAL n 
1  851  HIS n 
1  852  TYR n 
1  853  ASP n 
1  854  ASN n 
1  855  THR n 
1  856  THR n 
1  857  ARG n 
1  858  ASN n 
1  859  SER n 
1  860  LEU n 
1  861  GLY n 
1  862  ASN n 
1  863  VAL n 
1  864  ILE n 
1  865  GLN n 
1  866  PHE n 
1  867  ILE n 
1  868  TYR n 
1  869  GLY n 
1  870  GLU n 
1  871  ASP n 
1  872  GLY n 
1  873  MET n 
1  874  ASP n 
1  875  ALA n 
1  876  ALA n 
1  877  HIS n 
1  878  ILE n 
1  879  GLU n 
1  880  LYS n 
1  881  GLN n 
1  882  SER n 
1  883  LEU n 
1  884  ASP n 
1  885  THR n 
1  886  ILE n 
1  887  GLY n 
1  888  GLY n 
1  889  SER n 
1  890  ASP n 
1  891  ALA n 
1  892  ALA n 
1  893  PHE n 
1  894  GLU n 
1  895  LYS n 
1  896  ARG n 
1  897  TYR n 
1  898  ARG n 
1  899  VAL n 
1  900  ASP n 
1  901  LEU n 
1  902  LEU n 
1  903  ASN n 
1  904  THR n 
1  905  ASP n 
1  906  HIS n 
1  907  THR n 
1  908  LEU n 
1  909  ASP n 
1  910  PRO n 
1  911  SER n 
1  912  LEU n 
1  913  LEU n 
1  914  GLU n 
1  915  SER n 
1  916  GLY n 
1  917  SER n 
1  918  GLU n 
1  919  ILE n 
1  920  LEU n 
1  921  GLY n 
1  922  ASP n 
1  923  LEU n 
1  924  LYS n 
1  925  LEU n 
1  926  GLN n 
1  927  VAL n 
1  928  LEU n 
1  929  LEU n 
1  930  ASP n 
1  931  GLU n 
1  932  GLU n 
1  933  TYR n 
1  934  LYS n 
1  935  GLN n 
1  936  LEU n 
1  937  VAL n 
1  938  LYS n 
1  939  ASP n 
1  940  ARG n 
1  941  LYS n 
1  942  PHE n 
1  943  LEU n 
1  944  ARG n 
1  945  GLU n 
1  946  VAL n 
1  947  PHE n 
1  948  VAL n 
1  949  ASP n 
1  950  GLY n 
1  951  GLU n 
1  952  ALA n 
1  953  ASN n 
1  954  TRP n 
1  955  PRO n 
1  956  LEU n 
1  957  PRO n 
1  958  VAL n 
1  959  ASN n 
1  960  ILE n 
1  961  ARG n 
1  962  ARG n 
1  963  ILE n 
1  964  ILE n 
1  965  GLN n 
1  966  ASN n 
1  967  ALA n 
1  968  GLN n 
1  969  GLN n 
1  970  THR n 
1  971  PHE n 
1  972  HIS n 
1  973  ILE n 
1  974  ASP n 
1  975  HIS n 
1  976  THR n 
1  977  LYS n 
1  978  PRO n 
1  979  SER n 
1  980  ASP n 
1  981  LEU n 
1  982  THR n 
1  983  ILE n 
1  984  LYS n 
1  985  ASP n 
1  986  ILE n 
1  987  VAL n 
1  988  LEU n 
1  989  GLY n 
1  990  VAL n 
1  991  LYS n 
1  992  ASP n 
1  993  LEU n 
1  994  GLN n 
1  995  GLU n 
1  996  ASN n 
1  997  LEU n 
1  998  LEU n 
1  999  VAL n 
1  1000 LEU n 
1  1001 ARG n 
1  1002 GLY n 
1  1003 LYS n 
1  1004 ASN n 
1  1005 GLU n 
1  1006 ILE n 
1  1007 ILE n 
1  1008 GLN n 
1  1009 ASN n 
1  1010 ALA n 
1  1011 GLN n 
1  1012 ARG n 
1  1013 ASP n 
1  1014 ALA n 
1  1015 VAL n 
1  1016 THR n 
1  1017 LEU n 
1  1018 PHE n 
1  1019 CYS n 
1  1020 CYS n 
1  1021 LEU n 
1  1022 LEU n 
1  1023 ARG n 
1  1024 SER n 
1  1025 ARG n 
1  1026 LEU n 
1  1027 ALA n 
1  1028 THR n 
1  1029 ARG n 
1  1030 ARG n 
1  1031 VAL n 
1  1032 LEU n 
1  1033 GLN n 
1  1034 GLU n 
1  1035 TYR n 
1  1036 ARG n 
1  1037 LEU n 
1  1038 THR n 
1  1039 LYS n 
1  1040 GLN n 
1  1041 ALA n 
1  1042 PHE n 
1  1043 ASP n 
1  1044 TRP n 
1  1045 VAL n 
1  1046 LEU n 
1  1047 SER n 
1  1048 ASN n 
1  1049 ILE n 
1  1050 GLU n 
1  1051 ALA n 
1  1052 GLN n 
1  1053 PHE n 
1  1054 LEU n 
1  1055 ARG n 
1  1056 SER n 
1  1057 VAL n 
1  1058 VAL n 
1  1059 HIS n 
1  1060 PRO n 
1  1061 GLY n 
1  1062 GLU n 
1  1063 MET n 
1  1064 VAL n 
1  1065 GLY n 
1  1066 VAL n 
1  1067 LEU n 
1  1068 ALA n 
1  1069 ALA n 
1  1070 GLN n 
1  1071 SER n 
1  1072 ILE n 
1  1073 GLY n 
1  1074 GLU n 
1  1075 PRO n 
1  1076 ALA n 
1  1077 THR n 
1  1078 GLN n 
1  1079 MET n 
1  1080 THR n 
1  1081 LEU n 
1  1082 ASN n 
1  1083 THR n 
1  1084 PHE n 
1  1085 HIS n 
1  1086 PHE n 
1  1087 ALA n 
1  1088 GLY n 
1  1089 VAL n 
1  1090 ALA n 
1  1091 SER n 
1  1092 LYS n 
1  1093 LYS n 
1  1094 VAL n 
1  1095 THR n 
1  1096 SER n 
1  1097 GLY n 
1  1098 VAL n 
1  1099 PRO n 
1  1100 ARG n 
1  1101 LEU n 
1  1102 LYS n 
1  1103 GLU n 
1  1104 ILE n 
1  1105 LEU n 
1  1106 ASN n 
1  1107 VAL n 
1  1108 ALA n 
1  1109 LYS n 
1  1110 ASN n 
1  1111 MET n 
1  1112 LYS n 
1  1113 THR n 
1  1114 PRO n 
1  1115 SER n 
1  1116 LEU n 
1  1117 THR n 
1  1118 VAL n 
1  1119 TYR n 
1  1120 LEU n 
1  1121 GLU n 
1  1122 PRO n 
1  1123 GLY n 
1  1124 HIS n 
1  1125 ALA n 
1  1126 ALA n 
1  1127 ASP n 
1  1128 GLN n 
1  1129 GLU n 
1  1130 GLN n 
1  1131 ALA n 
1  1132 LYS n 
1  1133 LEU n 
1  1134 ILE n 
1  1135 ARG n 
1  1136 SER n 
1  1137 ALA n 
1  1138 ILE n 
1  1139 GLU n 
1  1140 HIS n 
1  1141 THR n 
1  1142 THR n 
1  1143 LEU n 
1  1144 LYS n 
1  1145 SER n 
1  1146 VAL n 
1  1147 THR n 
1  1148 ILE n 
1  1149 ALA n 
1  1150 SER n 
1  1151 GLU n 
1  1152 ILE n 
1  1153 TYR n 
1  1154 TYR n 
1  1155 ASP n 
1  1156 PRO n 
1  1157 ASP n 
1  1158 PRO n 
1  1159 ARG n 
1  1160 SER n 
1  1161 THR n 
1  1162 VAL n 
1  1163 ILE n 
1  1164 PRO n 
1  1165 GLU n 
1  1166 ASP n 
1  1167 GLU n 
1  1168 GLU n 
1  1169 ILE n 
1  1170 ILE n 
1  1171 GLN n 
1  1172 LEU n 
1  1173 HIS n 
1  1174 PHE n 
1  1175 SER n 
1  1176 LEU n 
1  1177 LEU n 
1  1178 ASP n 
1  1179 GLU n 
1  1180 GLU n 
1  1181 ALA n 
1  1182 GLU n 
1  1183 GLN n 
1  1184 SER n 
1  1185 PHE n 
1  1186 ASP n 
1  1187 GLN n 
1  1188 GLN n 
1  1189 SER n 
1  1190 PRO n 
1  1191 TRP n 
1  1192 LEU n 
1  1193 LEU n 
1  1194 ARG n 
1  1195 LEU n 
1  1196 GLU n 
1  1197 LEU n 
1  1198 ASP n 
1  1199 ARG n 
1  1200 ALA n 
1  1201 ALA n 
1  1202 MET n 
1  1203 ASN n 
1  1204 ASP n 
1  1205 LYS n 
1  1206 ASP n 
1  1207 LEU n 
1  1208 THR n 
1  1209 MET n 
1  1210 GLY n 
1  1211 GLN n 
1  1212 VAL n 
1  1213 GLY n 
1  1214 GLU n 
1  1215 ARG n 
1  1216 ILE n 
1  1217 LYS n 
1  1218 GLN n 
1  1219 THR n 
1  1220 PHE n 
1  1221 LYS n 
1  1222 ASN n 
1  1223 ASP n 
1  1224 LEU n 
1  1225 PHE n 
1  1226 VAL n 
1  1227 ILE n 
1  1228 TRP n 
1  1229 SER n 
1  1230 GLU n 
1  1231 ASP n 
1  1232 ASN n 
1  1233 ASP n 
1  1234 GLU n 
1  1235 LYS n 
1  1236 LEU n 
1  1237 ILE n 
1  1238 ILE n 
1  1239 ARG n 
1  1240 CYS n 
1  1241 ARG n 
1  1242 VAL n 
1  1243 VAL n 
1  1244 ARG n 
1  1245 PRO n 
1  1246 LYS n 
1  1247 SER n 
1  1248 LEU n 
1  1249 ASP n 
1  1250 ALA n 
1  1251 GLU n 
1  1252 THR n 
1  1253 GLU n 
1  1254 ALA n 
1  1255 GLU n 
1  1256 GLU n 
1  1257 ASP n 
1  1258 HIS n 
1  1259 MET n 
1  1260 LEU n 
1  1261 LYS n 
1  1262 LYS n 
1  1263 ILE n 
1  1264 GLU n 
1  1265 ASN n 
1  1266 THR n 
1  1267 MET n 
1  1268 LEU n 
1  1269 GLU n 
1  1270 ASN n 
1  1271 ILE n 
1  1272 THR n 
1  1273 LEU n 
1  1274 ARG n 
1  1275 GLY n 
1  1276 VAL n 
1  1277 GLU n 
1  1278 ASN n 
1  1279 ILE n 
1  1280 GLU n 
1  1281 ARG n 
1  1282 VAL n 
1  1283 VAL n 
1  1284 MET n 
1  1285 MET n 
1  1286 LYS n 
1  1287 TYR n 
1  1288 ASP n 
1  1289 ARG n 
1  1290 LYS n 
1  1291 VAL n 
1  1292 PRO n 
1  1293 SER n 
1  1294 PRO n 
1  1295 THR n 
1  1296 GLY n 
1  1297 GLU n 
1  1298 TYR n 
1  1299 VAL n 
1  1300 LYS n 
1  1301 GLU n 
1  1302 PRO n 
1  1303 GLU n 
1  1304 TRP n 
1  1305 VAL n 
1  1306 LEU n 
1  1307 GLU n 
1  1308 THR n 
1  1309 ASP n 
1  1310 GLY n 
1  1311 VAL n 
1  1312 ASN n 
1  1313 LEU n 
1  1314 SER n 
1  1315 GLU n 
1  1316 VAL n 
1  1317 MET n 
1  1318 THR n 
1  1319 VAL n 
1  1320 PRO n 
1  1321 GLY n 
1  1322 ILE n 
1  1323 ASP n 
1  1324 PRO n 
1  1325 THR n 
1  1326 ARG n 
1  1327 ILE n 
1  1328 TYR n 
1  1329 THR n 
1  1330 ASN n 
1  1331 SER n 
1  1332 PHE n 
1  1333 ILE n 
1  1334 ASP n 
1  1335 ILE n 
1  1336 MET n 
1  1337 GLU n 
1  1338 VAL n 
1  1339 LEU n 
1  1340 GLY n 
1  1341 ILE n 
1  1342 GLU n 
1  1343 ALA n 
1  1344 GLY n 
1  1345 ARG n 
1  1346 ALA n 
1  1347 ALA n 
1  1348 LEU n 
1  1349 TYR n 
1  1350 LYS n 
1  1351 GLU n 
1  1352 VAL n 
1  1353 TYR n 
1  1354 ASN n 
1  1355 VAL n 
1  1356 ILE n 
1  1357 ALA n 
1  1358 SER n 
1  1359 ASP n 
1  1360 GLY n 
1  1361 SER n 
1  1362 TYR n 
1  1363 VAL n 
1  1364 ASN n 
1  1365 TYR n 
1  1366 ARG n 
1  1367 HIS n 
1  1368 MET n 
1  1369 ALA n 
1  1370 LEU n 
1  1371 LEU n 
1  1372 VAL n 
1  1373 ASP n 
1  1374 VAL n 
1  1375 MET n 
1  1376 THR n 
1  1377 THR n 
1  1378 GLN n 
1  1379 GLY n 
1  1380 GLY n 
1  1381 LEU n 
1  1382 THR n 
1  1383 SER n 
1  1384 VAL n 
1  1385 THR n 
1  1386 ARG n 
1  1387 HIS n 
1  1388 GLY n 
1  1389 PHE n 
1  1390 ASN n 
1  1391 ARG n 
1  1392 SER n 
1  1393 ASN n 
1  1394 THR n 
1  1395 GLY n 
1  1396 ALA n 
1  1397 LEU n 
1  1398 MET n 
1  1399 ARG n 
1  1400 CYS n 
1  1401 SER n 
1  1402 PHE n 
1  1403 GLU n 
1  1404 GLU n 
1  1405 THR n 
1  1406 VAL n 
1  1407 GLU n 
1  1408 ILE n 
1  1409 LEU n 
1  1410 PHE n 
1  1411 GLU n 
1  1412 ALA n 
1  1413 GLY n 
1  1414 ALA n 
1  1415 SER n 
1  1416 ALA n 
1  1417 GLU n 
1  1418 LEU n 
1  1419 ASP n 
1  1420 ASP n 
1  1421 CYS n 
1  1422 ARG n 
1  1423 GLY n 
1  1424 VAL n 
1  1425 SER n 
1  1426 GLU n 
1  1427 ASN n 
1  1428 VAL n 
1  1429 ILE n 
1  1430 LEU n 
1  1431 GLY n 
1  1432 GLN n 
1  1433 MET n 
1  1434 ALA n 
1  1435 PRO n 
1  1436 ILE n 
1  1437 GLY n 
1  1438 THR n 
1  1439 GLY n 
1  1440 ALA n 
1  1441 PHE n 
1  1442 ASP n 
1  1443 VAL n 
1  1444 MET n 
1  1445 ILE n 
1  1446 ASP n 
1  1447 GLU n 
1  1448 GLU n 
1  1449 SER n 
1  1450 LEU n 
1  1451 VAL n 
1  1452 LYS n 
1  1453 TYR n 
1  1454 MET n 
1  1455 PRO n 
1  1456 GLU n 
1  1457 GLN n 
1  1458 LYS n 
1  1459 ILE n 
1  1460 THR n 
1  1461 GLU n 
1  1462 ILE n 
1  1463 GLU n 
1  1464 ASP n 
1  1465 GLY n 
1  1466 GLN n 
1  1467 ASP n 
1  1468 GLY n 
1  1469 GLY n 
1  1470 VAL n 
1  1471 THR n 
1  1472 PRO n 
1  1473 TYR n 
1  1474 SER n 
1  1475 ASN n 
1  1476 GLU n 
1  1477 SER n 
1  1478 GLY n 
1  1479 LEU n 
1  1480 VAL n 
1  1481 ASN n 
1  1482 ALA n 
1  1483 ASP n 
1  1484 LEU n 
1  1485 ASP n 
1  1486 VAL n 
1  1487 LYS n 
1  1488 ASP n 
1  1489 GLU n 
1  1490 LEU n 
1  1491 MET n 
1  1492 PHE n 
1  1493 SER n 
1  1494 PRO n 
1  1495 LEU n 
1  1496 VAL n 
1  1497 ASP n 
1  1498 SER n 
1  1499 GLY n 
1  1500 SER n 
1  1501 ASN n 
1  1502 ASP n 
1  1503 ALA n 
1  1504 MET n 
1  1505 ALA n 
1  1506 GLY n 
1  1507 GLY n 
1  1508 PHE n 
1  1509 THR n 
1  1510 ALA n 
1  1511 TYR n 
1  1512 GLY n 
1  1513 GLY n 
1  1514 ALA n 
1  1515 ASP n 
1  1516 TYR n 
1  1517 GLY n 
1  1518 GLU n 
1  1519 ALA n 
1  1520 THR n 
1  1521 SER n 
1  1522 PRO n 
1  1523 PHE n 
1  1524 GLY n 
1  1525 ALA n 
1  1526 TYR n 
1  1527 GLY n 
1  1528 GLU n 
1  1529 ALA n 
1  1530 PRO n 
1  1531 THR n 
1  1532 SER n 
1  1533 PRO n 
1  1534 GLY n 
1  1535 PHE n 
1  1536 GLY n 
1  1537 VAL n 
1  1538 SER n 
1  1539 SER n 
1  1540 PRO n 
1  1541 GLY n 
1  1542 PHE n 
1  1543 SER n 
1  1544 PRO n 
1  1545 THR n 
1  1546 SER n 
1  1547 PRO n 
1  1548 THR n 
1  1549 TYR n 
1  1550 SER n 
1  1551 PRO n 
1  1552 THR n 
1  1553 SER n 
1  1554 PRO n 
1  1555 ALA n 
1  1556 TYR n 
1  1557 SER n 
1  1558 PRO n 
1  1559 THR n 
1  1560 SER n 
1  1561 PRO n 
1  1562 SER n 
1  1563 TYR n 
1  1564 SER n 
1  1565 PRO n 
1  1566 THR n 
1  1567 SER n 
1  1568 PRO n 
1  1569 SER n 
1  1570 TYR n 
1  1571 SER n 
1  1572 PRO n 
1  1573 THR n 
1  1574 SER n 
1  1575 PRO n 
1  1576 SER n 
1  1577 TYR n 
1  1578 SER n 
1  1579 PRO n 
1  1580 THR n 
1  1581 SER n 
1  1582 PRO n 
1  1583 SER n 
1  1584 TYR n 
1  1585 SER n 
1  1586 PRO n 
1  1587 THR n 
1  1588 SER n 
1  1589 PRO n 
1  1590 SER n 
1  1591 TYR n 
1  1592 SER n 
1  1593 PRO n 
1  1594 THR n 
1  1595 SER n 
1  1596 PRO n 
1  1597 SER n 
1  1598 TYR n 
1  1599 SER n 
1  1600 PRO n 
1  1601 THR n 
1  1602 SER n 
1  1603 PRO n 
1  1604 SER n 
1  1605 TYR n 
1  1606 SER n 
1  1607 PRO n 
1  1608 THR n 
1  1609 SER n 
1  1610 PRO n 
1  1611 SER n 
1  1612 TYR n 
1  1613 SER n 
1  1614 PRO n 
1  1615 THR n 
1  1616 SER n 
1  1617 PRO n 
1  1618 SER n 
1  1619 TYR n 
1  1620 SER n 
1  1621 PRO n 
1  1622 THR n 
1  1623 SER n 
1  1624 PRO n 
1  1625 SER n 
1  1626 TYR n 
1  1627 SER n 
1  1628 PRO n 
1  1629 THR n 
1  1630 SER n 
1  1631 PRO n 
1  1632 SER n 
1  1633 TYR n 
1  1634 SER n 
1  1635 PRO n 
1  1636 THR n 
1  1637 SER n 
1  1638 PRO n 
1  1639 SER n 
1  1640 TYR n 
1  1641 SER n 
1  1642 PRO n 
1  1643 THR n 
1  1644 SER n 
1  1645 PRO n 
1  1646 SER n 
1  1647 TYR n 
1  1648 SER n 
1  1649 PRO n 
1  1650 THR n 
1  1651 SER n 
1  1652 PRO n 
1  1653 SER n 
1  1654 TYR n 
1  1655 SER n 
1  1656 PRO n 
1  1657 THR n 
1  1658 SER n 
1  1659 PRO n 
1  1660 ALA n 
1  1661 TYR n 
1  1662 SER n 
1  1663 PRO n 
1  1664 THR n 
1  1665 SER n 
1  1666 PRO n 
1  1667 SER n 
1  1668 TYR n 
1  1669 SER n 
1  1670 PRO n 
1  1671 THR n 
1  1672 SER n 
1  1673 PRO n 
1  1674 SER n 
1  1675 TYR n 
1  1676 SER n 
1  1677 PRO n 
1  1678 THR n 
1  1679 SER n 
1  1680 PRO n 
1  1681 SER n 
1  1682 TYR n 
1  1683 SER n 
1  1684 PRO n 
1  1685 THR n 
1  1686 SER n 
1  1687 PRO n 
1  1688 SER n 
1  1689 TYR n 
1  1690 SER n 
1  1691 PRO n 
1  1692 THR n 
1  1693 SER n 
1  1694 PRO n 
1  1695 ASN n 
1  1696 TYR n 
1  1697 SER n 
1  1698 PRO n 
1  1699 THR n 
1  1700 SER n 
1  1701 PRO n 
1  1702 SER n 
1  1703 TYR n 
1  1704 SER n 
1  1705 PRO n 
1  1706 THR n 
1  1707 SER n 
1  1708 PRO n 
1  1709 GLY n 
1  1710 TYR n 
1  1711 SER n 
1  1712 PRO n 
1  1713 GLY n 
1  1714 SER n 
1  1715 PRO n 
1  1716 ALA n 
1  1717 TYR n 
1  1718 SER n 
1  1719 PRO n 
1  1720 LYS n 
1  1721 GLN n 
1  1722 ASP n 
1  1723 GLU n 
1  1724 GLN n 
1  1725 LYS n 
1  1726 HIS n 
1  1727 ASN n 
1  1728 GLU n 
1  1729 ASN n 
1  1730 GLU n 
1  1731 ASN n 
1  1732 SER n 
1  1733 ARG n 
2  1    MET n 
2  2    SER n 
2  3    ASP n 
2  4    LEU n 
2  5    ALA n 
2  6    ASN n 
2  7    SER n 
2  8    GLU n 
2  9    LYS n 
2  10   TYR n 
2  11   TYR n 
2  12   ASP n 
2  13   GLU n 
2  14   ASP n 
2  15   PRO n 
2  16   TYR n 
2  17   GLY n 
2  18   PHE n 
2  19   GLU n 
2  20   ASP n 
2  21   GLU n 
2  22   SER n 
2  23   ALA n 
2  24   PRO n 
2  25   ILE n 
2  26   THR n 
2  27   ALA n 
2  28   GLU n 
2  29   ASP n 
2  30   SER n 
2  31   TRP n 
2  32   ALA n 
2  33   VAL n 
2  34   ILE n 
2  35   SER n 
2  36   ALA n 
2  37   PHE n 
2  38   PHE n 
2  39   ARG n 
2  40   GLU n 
2  41   LYS n 
2  42   GLY n 
2  43   LEU n 
2  44   VAL n 
2  45   SER n 
2  46   GLN n 
2  47   GLN n 
2  48   LEU n 
2  49   ASP n 
2  50   SER n 
2  51   PHE n 
2  52   ASN n 
2  53   GLN n 
2  54   PHE n 
2  55   VAL n 
2  56   ASP n 
2  57   TYR n 
2  58   THR n 
2  59   LEU n 
2  60   GLN n 
2  61   ASP n 
2  62   ILE n 
2  63   ILE n 
2  64   CYS n 
2  65   GLU n 
2  66   ASP n 
2  67   SER n 
2  68   THR n 
2  69   LEU n 
2  70   ILE n 
2  71   LEU n 
2  72   GLU n 
2  73   GLN n 
2  74   LEU n 
2  75   ALA n 
2  76   GLN n 
2  77   HIS n 
2  78   THR n 
2  79   THR n 
2  80   GLU n 
2  81   SER n 
2  82   ASP n 
2  83   ASN n 
2  84   ILE n 
2  85   SER n 
2  86   ARG n 
2  87   LYS n 
2  88   TYR n 
2  89   GLU n 
2  90   ILE n 
2  91   SER n 
2  92   PHE n 
2  93   GLY n 
2  94   LYS n 
2  95   ILE n 
2  96   TYR n 
2  97   VAL n 
2  98   THR n 
2  99   LYS n 
2  100  PRO n 
2  101  MET n 
2  102  VAL n 
2  103  ASN n 
2  104  GLU n 
2  105  SER n 
2  106  ASP n 
2  107  GLY n 
2  108  VAL n 
2  109  THR n 
2  110  HIS n 
2  111  ALA n 
2  112  LEU n 
2  113  TYR n 
2  114  PRO n 
2  115  GLN n 
2  116  GLU n 
2  117  ALA n 
2  118  ARG n 
2  119  LEU n 
2  120  ARG n 
2  121  ASN n 
2  122  LEU n 
2  123  THR n 
2  124  TYR n 
2  125  SER n 
2  126  SER n 
2  127  GLY n 
2  128  LEU n 
2  129  PHE n 
2  130  VAL n 
2  131  ASP n 
2  132  VAL n 
2  133  LYS n 
2  134  LYS n 
2  135  ARG n 
2  136  THR n 
2  137  TYR n 
2  138  GLU n 
2  139  ALA n 
2  140  ILE n 
2  141  ASP n 
2  142  VAL n 
2  143  PRO n 
2  144  GLY n 
2  145  ARG n 
2  146  GLU n 
2  147  LEU n 
2  148  LYS n 
2  149  TYR n 
2  150  GLU n 
2  151  LEU n 
2  152  ILE n 
2  153  ALA n 
2  154  GLU n 
2  155  GLU n 
2  156  SER n 
2  157  GLU n 
2  158  ASP n 
2  159  ASP n 
2  160  SER n 
2  161  GLU n 
2  162  SER n 
2  163  GLY n 
2  164  LYS n 
2  165  VAL n 
2  166  PHE n 
2  167  ILE n 
2  168  GLY n 
2  169  ARG n 
2  170  LEU n 
2  171  PRO n 
2  172  ILE n 
2  173  MET n 
2  174  LEU n 
2  175  ARG n 
2  176  SER n 
2  177  LYS n 
2  178  ASN n 
2  179  CYS n 
2  180  TYR n 
2  181  LEU n 
2  182  SER n 
2  183  GLU n 
2  184  ALA n 
2  185  THR n 
2  186  GLU n 
2  187  SER n 
2  188  ASP n 
2  189  LEU n 
2  190  TYR n 
2  191  LYS n 
2  192  LEU n 
2  193  LYS n 
2  194  GLU n 
2  195  CYS n 
2  196  PRO n 
2  197  PHE n 
2  198  ASP n 
2  199  MET n 
2  200  GLY n 
2  201  GLY n 
2  202  TYR n 
2  203  PHE n 
2  204  ILE n 
2  205  ILE n 
2  206  ASN n 
2  207  GLY n 
2  208  SER n 
2  209  GLU n 
2  210  LYS n 
2  211  VAL n 
2  212  LEU n 
2  213  ILE n 
2  214  ALA n 
2  215  GLN n 
2  216  GLU n 
2  217  ARG n 
2  218  SER n 
2  219  ALA n 
2  220  GLY n 
2  221  ASN n 
2  222  ILE n 
2  223  VAL n 
2  224  GLN n 
2  225  VAL n 
2  226  PHE n 
2  227  LYS n 
2  228  LYS n 
2  229  ALA n 
2  230  ALA n 
2  231  PRO n 
2  232  SER n 
2  233  PRO n 
2  234  ILE n 
2  235  SER n 
2  236  HIS n 
2  237  VAL n 
2  238  ALA n 
2  239  GLU n 
2  240  ILE n 
2  241  ARG n 
2  242  SER n 
2  243  ALA n 
2  244  LEU n 
2  245  GLU n 
2  246  LYS n 
2  247  GLY n 
2  248  SER n 
2  249  ARG n 
2  250  PHE n 
2  251  ILE n 
2  252  SER n 
2  253  THR n 
2  254  LEU n 
2  255  GLN n 
2  256  VAL n 
2  257  LYS n 
2  258  LEU n 
2  259  TYR n 
2  260  GLY n 
2  261  ARG n 
2  262  GLU n 
2  263  GLY n 
2  264  SER n 
2  265  SER n 
2  266  ALA n 
2  267  ARG n 
2  268  THR n 
2  269  ILE n 
2  270  LYS n 
2  271  ALA n 
2  272  THR n 
2  273  LEU n 
2  274  PRO n 
2  275  TYR n 
2  276  ILE n 
2  277  LYS n 
2  278  GLN n 
2  279  ASP n 
2  280  ILE n 
2  281  PRO n 
2  282  ILE n 
2  283  VAL n 
2  284  ILE n 
2  285  ILE n 
2  286  PHE n 
2  287  ARG n 
2  288  ALA n 
2  289  LEU n 
2  290  GLY n 
2  291  ILE n 
2  292  ILE n 
2  293  PRO n 
2  294  ASP n 
2  295  GLY n 
2  296  GLU n 
2  297  ILE n 
2  298  LEU n 
2  299  GLU n 
2  300  HIS n 
2  301  ILE n 
2  302  CYS n 
2  303  TYR n 
2  304  ASP n 
2  305  VAL n 
2  306  ASN n 
2  307  ASP n 
2  308  TRP n 
2  309  GLN n 
2  310  MET n 
2  311  LEU n 
2  312  GLU n 
2  313  MET n 
2  314  LEU n 
2  315  LYS n 
2  316  PRO n 
2  317  CYS n 
2  318  VAL n 
2  319  GLU n 
2  320  ASP n 
2  321  GLY n 
2  322  PHE n 
2  323  VAL n 
2  324  ILE n 
2  325  GLN n 
2  326  ASP n 
2  327  ARG n 
2  328  GLU n 
2  329  THR n 
2  330  ALA n 
2  331  LEU n 
2  332  ASP n 
2  333  PHE n 
2  334  ILE n 
2  335  GLY n 
2  336  ARG n 
2  337  ARG n 
2  338  GLY n 
2  339  THR n 
2  340  ALA n 
2  341  LEU n 
2  342  GLY n 
2  343  ILE n 
2  344  LYS n 
2  345  LYS n 
2  346  GLU n 
2  347  LYS n 
2  348  ARG n 
2  349  ILE n 
2  350  GLN n 
2  351  TYR n 
2  352  ALA n 
2  353  LYS n 
2  354  ASP n 
2  355  ILE n 
2  356  LEU n 
2  357  GLN n 
2  358  LYS n 
2  359  GLU n 
2  360  PHE n 
2  361  LEU n 
2  362  PRO n 
2  363  HIS n 
2  364  ILE n 
2  365  THR n 
2  366  GLN n 
2  367  LEU n 
2  368  GLU n 
2  369  GLY n 
2  370  PHE n 
2  371  GLU n 
2  372  SER n 
2  373  ARG n 
2  374  LYS n 
2  375  ALA n 
2  376  PHE n 
2  377  PHE n 
2  378  LEU n 
2  379  GLY n 
2  380  TYR n 
2  381  MET n 
2  382  ILE n 
2  383  ASN n 
2  384  ARG n 
2  385  LEU n 
2  386  LEU n 
2  387  LEU n 
2  388  CYS n 
2  389  ALA n 
2  390  LEU n 
2  391  ASP n 
2  392  ARG n 
2  393  LYS n 
2  394  ASP n 
2  395  GLN n 
2  396  ASP n 
2  397  ASP n 
2  398  ARG n 
2  399  ASP n 
2  400  HIS n 
2  401  PHE n 
2  402  GLY n 
2  403  LYS n 
2  404  LYS n 
2  405  ARG n 
2  406  LEU n 
2  407  ASP n 
2  408  LEU n 
2  409  ALA n 
2  410  GLY n 
2  411  PRO n 
2  412  LEU n 
2  413  LEU n 
2  414  ALA n 
2  415  GLN n 
2  416  LEU n 
2  417  PHE n 
2  418  LYS n 
2  419  THR n 
2  420  LEU n 
2  421  PHE n 
2  422  LYS n 
2  423  LYS n 
2  424  LEU n 
2  425  THR n 
2  426  LYS n 
2  427  ASP n 
2  428  ILE n 
2  429  PHE n 
2  430  ARG n 
2  431  TYR n 
2  432  MET n 
2  433  GLN n 
2  434  ARG n 
2  435  THR n 
2  436  VAL n 
2  437  GLU n 
2  438  GLU n 
2  439  ALA n 
2  440  HIS n 
2  441  ASP n 
2  442  PHE n 
2  443  ASN n 
2  444  MET n 
2  445  LYS n 
2  446  LEU n 
2  447  ALA n 
2  448  ILE n 
2  449  ASN n 
2  450  ALA n 
2  451  LYS n 
2  452  THR n 
2  453  ILE n 
2  454  THR n 
2  455  SER n 
2  456  GLY n 
2  457  LEU n 
2  458  LYS n 
2  459  TYR n 
2  460  ALA n 
2  461  LEU n 
2  462  ALA n 
2  463  THR n 
2  464  GLY n 
2  465  ASN n 
2  466  TRP n 
2  467  GLY n 
2  468  GLU n 
2  469  GLN n 
2  470  LYS n 
2  471  LYS n 
2  472  ALA n 
2  473  MET n 
2  474  SER n 
2  475  SER n 
2  476  ARG n 
2  477  ALA n 
2  478  GLY n 
2  479  VAL n 
2  480  SER n 
2  481  GLN n 
2  482  VAL n 
2  483  LEU n 
2  484  ASN n 
2  485  ARG n 
2  486  TYR n 
2  487  THR n 
2  488  TYR n 
2  489  SER n 
2  490  SER n 
2  491  THR n 
2  492  LEU n 
2  493  SER n 
2  494  HIS n 
2  495  LEU n 
2  496  ARG n 
2  497  ARG n 
2  498  THR n 
2  499  ASN n 
2  500  THR n 
2  501  PRO n 
2  502  ILE n 
2  503  GLY n 
2  504  ARG n 
2  505  ASP n 
2  506  GLY n 
2  507  LYS n 
2  508  LEU n 
2  509  ALA n 
2  510  LYS n 
2  511  PRO n 
2  512  ARG n 
2  513  GLN n 
2  514  LEU n 
2  515  HIS n 
2  516  ASN n 
2  517  THR n 
2  518  HIS n 
2  519  TRP n 
2  520  GLY n 
2  521  LEU n 
2  522  VAL n 
2  523  CYS n 
2  524  PRO n 
2  525  ALA n 
2  526  GLU n 
2  527  THR n 
2  528  PRO n 
2  529  GLU n 
2  530  GLY n 
2  531  GLN n 
2  532  ALA n 
2  533  CYS n 
2  534  GLY n 
2  535  LEU n 
2  536  VAL n 
2  537  LYS n 
2  538  ASN n 
2  539  LEU n 
2  540  SER n 
2  541  LEU n 
2  542  MET n 
2  543  SER n 
2  544  CYS n 
2  545  ILE n 
2  546  SER n 
2  547  VAL n 
2  548  GLY n 
2  549  THR n 
2  550  ASP n 
2  551  PRO n 
2  552  MET n 
2  553  PRO n 
2  554  ILE n 
2  555  ILE n 
2  556  THR n 
2  557  PHE n 
2  558  LEU n 
2  559  SER n 
2  560  GLU n 
2  561  TRP n 
2  562  GLY n 
2  563  MET n 
2  564  GLU n 
2  565  PRO n 
2  566  LEU n 
2  567  GLU n 
2  568  ASP n 
2  569  TYR n 
2  570  VAL n 
2  571  PRO n 
2  572  HIS n 
2  573  GLN n 
2  574  SER n 
2  575  PRO n 
2  576  ASP n 
2  577  ALA n 
2  578  THR n 
2  579  ARG n 
2  580  VAL n 
2  581  PHE n 
2  582  VAL n 
2  583  ASN n 
2  584  GLY n 
2  585  VAL n 
2  586  TRP n 
2  587  HIS n 
2  588  GLY n 
2  589  VAL n 
2  590  HIS n 
2  591  ARG n 
2  592  ASN n 
2  593  PRO n 
2  594  ALA n 
2  595  ARG n 
2  596  LEU n 
2  597  MET n 
2  598  GLU n 
2  599  THR n 
2  600  LEU n 
2  601  ARG n 
2  602  THR n 
2  603  LEU n 
2  604  ARG n 
2  605  ARG n 
2  606  LYS n 
2  607  GLY n 
2  608  ASP n 
2  609  ILE n 
2  610  ASN n 
2  611  PRO n 
2  612  GLU n 
2  613  VAL n 
2  614  SER n 
2  615  MET n 
2  616  ILE n 
2  617  ARG n 
2  618  ASP n 
2  619  ILE n 
2  620  ARG n 
2  621  GLU n 
2  622  LYS n 
2  623  GLU n 
2  624  LEU n 
2  625  LYS n 
2  626  ILE n 
2  627  PHE n 
2  628  THR n 
2  629  ASP n 
2  630  ALA n 
2  631  GLY n 
2  632  ARG n 
2  633  VAL n 
2  634  TYR n 
2  635  ARG n 
2  636  PRO n 
2  637  LEU n 
2  638  PHE n 
2  639  ILE n 
2  640  VAL n 
2  641  GLU n 
2  642  ASP n 
2  643  ASP n 
2  644  GLU n 
2  645  SER n 
2  646  LEU n 
2  647  GLY n 
2  648  HIS n 
2  649  LYS n 
2  650  GLU n 
2  651  LEU n 
2  652  LYS n 
2  653  VAL n 
2  654  ARG n 
2  655  LYS n 
2  656  GLY n 
2  657  HIS n 
2  658  ILE n 
2  659  ALA n 
2  660  LYS n 
2  661  LEU n 
2  662  MET n 
2  663  ALA n 
2  664  THR n 
2  665  GLU n 
2  666  TYR n 
2  667  GLN n 
2  668  ASP n 
2  669  ILE n 
2  670  GLU n 
2  671  GLY n 
2  672  GLY n 
2  673  PHE n 
2  674  GLU n 
2  675  ASP n 
2  676  VAL n 
2  677  GLU n 
2  678  GLU n 
2  679  TYR n 
2  680  THR n 
2  681  TRP n 
2  682  SER n 
2  683  SER n 
2  684  LEU n 
2  685  LEU n 
2  686  ASN n 
2  687  GLU n 
2  688  GLY n 
2  689  LEU n 
2  690  VAL n 
2  691  GLU n 
2  692  TYR n 
2  693  ILE n 
2  694  ASP n 
2  695  ALA n 
2  696  GLU n 
2  697  GLU n 
2  698  GLU n 
2  699  GLU n 
2  700  SER n 
2  701  ILE n 
2  702  LEU n 
2  703  ILE n 
2  704  ALA n 
2  705  MET n 
2  706  GLN n 
2  707  PRO n 
2  708  GLU n 
2  709  ASP n 
2  710  LEU n 
2  711  GLU n 
2  712  PRO n 
2  713  ALA n 
2  714  GLU n 
2  715  ALA n 
2  716  ASN n 
2  717  GLU n 
2  718  GLU n 
2  719  ASN n 
2  720  ASP n 
2  721  LEU n 
2  722  ASP n 
2  723  VAL n 
2  724  ASP n 
2  725  PRO n 
2  726  ALA n 
2  727  LYS n 
2  728  ARG n 
2  729  ILE n 
2  730  ARG n 
2  731  VAL n 
2  732  SER n 
2  733  HIS n 
2  734  HIS n 
2  735  ALA n 
2  736  THR n 
2  737  THR n 
2  738  PHE n 
2  739  THR n 
2  740  HIS n 
2  741  CYS n 
2  742  GLU n 
2  743  ILE n 
2  744  HIS n 
2  745  PRO n 
2  746  SER n 
2  747  MET n 
2  748  ILE n 
2  749  LEU n 
2  750  GLY n 
2  751  VAL n 
2  752  ALA n 
2  753  ALA n 
2  754  SER n 
2  755  ILE n 
2  756  ILE n 
2  757  PRO n 
2  758  PHE n 
2  759  PRO n 
2  760  ASP n 
2  761  HIS n 
2  762  ASN n 
2  763  GLN n 
2  764  SER n 
2  765  PRO n 
2  766  ARG n 
2  767  ASN n 
2  768  THR n 
2  769  TYR n 
2  770  GLN n 
2  771  SER n 
2  772  ALA n 
2  773  MET n 
2  774  GLY n 
2  775  LYS n 
2  776  GLN n 
2  777  ALA n 
2  778  MET n 
2  779  GLY n 
2  780  VAL n 
2  781  PHE n 
2  782  LEU n 
2  783  THR n 
2  784  ASN n 
2  785  TYR n 
2  786  ASN n 
2  787  VAL n 
2  788  ARG n 
2  789  MET n 
2  790  ASP n 
2  791  THR n 
2  792  MET n 
2  793  ALA n 
2  794  ASN n 
2  795  ILE n 
2  796  LEU n 
2  797  TYR n 
2  798  TYR n 
2  799  PRO n 
2  800  GLN n 
2  801  LYS n 
2  802  PRO n 
2  803  LEU n 
2  804  GLY n 
2  805  THR n 
2  806  THR n 
2  807  ARG n 
2  808  ALA n 
2  809  MET n 
2  810  GLU n 
2  811  TYR n 
2  812  LEU n 
2  813  LYS n 
2  814  PHE n 
2  815  ARG n 
2  816  GLU n 
2  817  LEU n 
2  818  PRO n 
2  819  ALA n 
2  820  GLY n 
2  821  GLN n 
2  822  ASN n 
2  823  ALA n 
2  824  ILE n 
2  825  VAL n 
2  826  ALA n 
2  827  ILE n 
2  828  ALA n 
2  829  CYS n 
2  830  TYR n 
2  831  SER n 
2  832  GLY n 
2  833  TYR n 
2  834  ASN n 
2  835  GLN n 
2  836  GLU n 
2  837  ASP n 
2  838  SER n 
2  839  MET n 
2  840  ILE n 
2  841  MET n 
2  842  ASN n 
2  843  GLN n 
2  844  SER n 
2  845  SER n 
2  846  ILE n 
2  847  ASP n 
2  848  ARG n 
2  849  GLY n 
2  850  LEU n 
2  851  PHE n 
2  852  ARG n 
2  853  SER n 
2  854  LEU n 
2  855  PHE n 
2  856  PHE n 
2  857  ARG n 
2  858  SER n 
2  859  TYR n 
2  860  MET n 
2  861  ASP n 
2  862  GLN n 
2  863  GLU n 
2  864  LYS n 
2  865  LYS n 
2  866  TYR n 
2  867  GLY n 
2  868  MET n 
2  869  SER n 
2  870  ILE n 
2  871  THR n 
2  872  GLU n 
2  873  THR n 
2  874  PHE n 
2  875  GLU n 
2  876  LYS n 
2  877  PRO n 
2  878  GLN n 
2  879  ARG n 
2  880  THR n 
2  881  ASN n 
2  882  THR n 
2  883  LEU n 
2  884  ARG n 
2  885  MET n 
2  886  LYS n 
2  887  HIS n 
2  888  GLY n 
2  889  THR n 
2  890  TYR n 
2  891  ASP n 
2  892  LYS n 
2  893  LEU n 
2  894  ASP n 
2  895  ASP n 
2  896  ASP n 
2  897  GLY n 
2  898  LEU n 
2  899  ILE n 
2  900  ALA n 
2  901  PRO n 
2  902  GLY n 
2  903  VAL n 
2  904  ARG n 
2  905  VAL n 
2  906  SER n 
2  907  GLY n 
2  908  GLU n 
2  909  ASP n 
2  910  VAL n 
2  911  ILE n 
2  912  ILE n 
2  913  GLY n 
2  914  LYS n 
2  915  THR n 
2  916  THR n 
2  917  PRO n 
2  918  ILE n 
2  919  SER n 
2  920  PRO n 
2  921  ASP n 
2  922  GLU n 
2  923  GLU n 
2  924  GLU n 
2  925  LEU n 
2  926  GLY n 
2  927  GLN n 
2  928  ARG n 
2  929  THR n 
2  930  ALA n 
2  931  TYR n 
2  932  HIS n 
2  933  SER n 
2  934  LYS n 
2  935  ARG n 
2  936  ASP n 
2  937  ALA n 
2  938  SER n 
2  939  THR n 
2  940  PRO n 
2  941  LEU n 
2  942  ARG n 
2  943  SER n 
2  944  THR n 
2  945  GLU n 
2  946  ASN n 
2  947  GLY n 
2  948  ILE n 
2  949  VAL n 
2  950  ASP n 
2  951  GLN n 
2  952  VAL n 
2  953  LEU n 
2  954  VAL n 
2  955  THR n 
2  956  THR n 
2  957  ASN n 
2  958  GLN n 
2  959  ASP n 
2  960  GLY n 
2  961  LEU n 
2  962  LYS n 
2  963  PHE n 
2  964  VAL n 
2  965  LYS n 
2  966  VAL n 
2  967  ARG n 
2  968  VAL n 
2  969  ARG n 
2  970  THR n 
2  971  THR n 
2  972  LYS n 
2  973  ILE n 
2  974  PRO n 
2  975  GLN n 
2  976  ILE n 
2  977  GLY n 
2  978  ASP n 
2  979  LYS n 
2  980  PHE n 
2  981  ALA n 
2  982  SER n 
2  983  ARG n 
2  984  HIS n 
2  985  GLY n 
2  986  GLN n 
2  987  LYS n 
2  988  GLY n 
2  989  THR n 
2  990  ILE n 
2  991  GLY n 
2  992  ILE n 
2  993  THR n 
2  994  TYR n 
2  995  ARG n 
2  996  ARG n 
2  997  GLU n 
2  998  ASP n 
2  999  MET n 
2  1000 PRO n 
2  1001 PHE n 
2  1002 THR n 
2  1003 ALA n 
2  1004 GLU n 
2  1005 GLY n 
2  1006 ILE n 
2  1007 VAL n 
2  1008 PRO n 
2  1009 ASP n 
2  1010 LEU n 
2  1011 ILE n 
2  1012 ILE n 
2  1013 ASN n 
2  1014 PRO n 
2  1015 HIS n 
2  1016 ALA n 
2  1017 ILE n 
2  1018 PRO n 
2  1019 SER n 
2  1020 ARG n 
2  1021 MET n 
2  1022 THR n 
2  1023 VAL n 
2  1024 ALA n 
2  1025 HIS n 
2  1026 LEU n 
2  1027 ILE n 
2  1028 GLU n 
2  1029 CYS n 
2  1030 LEU n 
2  1031 LEU n 
2  1032 SER n 
2  1033 LYS n 
2  1034 VAL n 
2  1035 ALA n 
2  1036 ALA n 
2  1037 LEU n 
2  1038 SER n 
2  1039 GLY n 
2  1040 ASN n 
2  1041 GLU n 
2  1042 GLY n 
2  1043 ASP n 
2  1044 ALA n 
2  1045 SER n 
2  1046 PRO n 
2  1047 PHE n 
2  1048 THR n 
2  1049 ASP n 
2  1050 ILE n 
2  1051 THR n 
2  1052 VAL n 
2  1053 GLU n 
2  1054 GLY n 
2  1055 ILE n 
2  1056 SER n 
2  1057 LYS n 
2  1058 LEU n 
2  1059 LEU n 
2  1060 ARG n 
2  1061 GLU n 
2  1062 HIS n 
2  1063 GLY n 
2  1064 TYR n 
2  1065 GLN n 
2  1066 SER n 
2  1067 ARG n 
2  1068 GLY n 
2  1069 PHE n 
2  1070 GLU n 
2  1071 VAL n 
2  1072 MET n 
2  1073 TYR n 
2  1074 ASN n 
2  1075 GLY n 
2  1076 HIS n 
2  1077 THR n 
2  1078 GLY n 
2  1079 LYS n 
2  1080 LYS n 
2  1081 LEU n 
2  1082 MET n 
2  1083 ALA n 
2  1084 GLN n 
2  1085 ILE n 
2  1086 PHE n 
2  1087 PHE n 
2  1088 GLY n 
2  1089 PRO n 
2  1090 THR n 
2  1091 TYR n 
2  1092 TYR n 
2  1093 GLN n 
2  1094 ARG n 
2  1095 LEU n 
2  1096 ARG n 
2  1097 HIS n 
2  1098 MET n 
2  1099 VAL n 
2  1100 ASP n 
2  1101 ASP n 
2  1102 LYS n 
2  1103 ILE n 
2  1104 HIS n 
2  1105 ALA n 
2  1106 ARG n 
2  1107 ALA n 
2  1108 ARG n 
2  1109 GLY n 
2  1110 PRO n 
2  1111 MET n 
2  1112 GLN n 
2  1113 VAL n 
2  1114 LEU n 
2  1115 THR n 
2  1116 ARG n 
2  1117 GLN n 
2  1118 PRO n 
2  1119 VAL n 
2  1120 GLU n 
2  1121 GLY n 
2  1122 ARG n 
2  1123 SER n 
2  1124 ARG n 
2  1125 ASP n 
2  1126 GLY n 
2  1127 GLY n 
2  1128 LEU n 
2  1129 ARG n 
2  1130 PHE n 
2  1131 GLY n 
2  1132 GLU n 
2  1133 MET n 
2  1134 GLU n 
2  1135 ARG n 
2  1136 ASP n 
2  1137 CYS n 
2  1138 MET n 
2  1139 ILE n 
2  1140 ALA n 
2  1141 HIS n 
2  1142 GLY n 
2  1143 ALA n 
2  1144 ALA n 
2  1145 SER n 
2  1146 PHE n 
2  1147 LEU n 
2  1148 LYS n 
2  1149 GLU n 
2  1150 ARG n 
2  1151 LEU n 
2  1152 MET n 
2  1153 GLU n 
2  1154 ALA n 
2  1155 SER n 
2  1156 ASP n 
2  1157 ALA n 
2  1158 PHE n 
2  1159 ARG n 
2  1160 VAL n 
2  1161 HIS n 
2  1162 ILE n 
2  1163 CYS n 
2  1164 GLY n 
2  1165 ILE n 
2  1166 CYS n 
2  1167 GLY n 
2  1168 LEU n 
2  1169 MET n 
2  1170 THR n 
2  1171 VAL n 
2  1172 ILE n 
2  1173 ALA n 
2  1174 LYS n 
2  1175 LEU n 
2  1176 ASN n 
2  1177 HIS n 
2  1178 ASN n 
2  1179 GLN n 
2  1180 PHE n 
2  1181 GLU n 
2  1182 CYS n 
2  1183 LYS n 
2  1184 GLY n 
2  1185 CYS n 
2  1186 ASP n 
2  1187 ASN n 
2  1188 LYS n 
2  1189 ILE n 
2  1190 ASP n 
2  1191 ILE n 
2  1192 TYR n 
2  1193 GLN n 
2  1194 ILE n 
2  1195 HIS n 
2  1196 ILE n 
2  1197 PRO n 
2  1198 TYR n 
2  1199 ALA n 
2  1200 ALA n 
2  1201 LYS n 
2  1202 LEU n 
2  1203 LEU n 
2  1204 PHE n 
2  1205 GLN n 
2  1206 GLU n 
2  1207 LEU n 
2  1208 MET n 
2  1209 ALA n 
2  1210 MET n 
2  1211 ASN n 
2  1212 ILE n 
2  1213 THR n 
2  1214 PRO n 
2  1215 ARG n 
2  1216 LEU n 
2  1217 TYR n 
2  1218 THR n 
2  1219 ASP n 
2  1220 ARG n 
2  1221 SER n 
2  1222 ARG n 
2  1223 ASP n 
2  1224 PHE n 
3  1    MET n 
3  2    SER n 
3  3    GLU n 
3  4    GLU n 
3  5    GLY n 
3  6    PRO n 
3  7    GLN n 
3  8    VAL n 
3  9    LYS n 
3  10   ILE n 
3  11   ARG n 
3  12   GLU n 
3  13   ALA n 
3  14   SER n 
3  15   LYS n 
3  16   ASP n 
3  17   ASN n 
3  18   VAL n 
3  19   ASP n 
3  20   PHE n 
3  21   ILE n 
3  22   LEU n 
3  23   SER n 
3  24   ASN n 
3  25   VAL n 
3  26   ASP n 
3  27   LEU n 
3  28   ALA n 
3  29   MET n 
3  30   ALA n 
3  31   ASN n 
3  32   SER n 
3  33   LEU n 
3  34   ARG n 
3  35   ARG n 
3  36   VAL n 
3  37   MET n 
3  38   ILE n 
3  39   ALA n 
3  40   GLU n 
3  41   ILE n 
3  42   PRO n 
3  43   THR n 
3  44   LEU n 
3  45   ALA n 
3  46   ILE n 
3  47   ASP n 
3  48   SER n 
3  49   VAL n 
3  50   GLU n 
3  51   VAL n 
3  52   GLU n 
3  53   THR n 
3  54   ASN n 
3  55   THR n 
3  56   THR n 
3  57   VAL n 
3  58   LEU n 
3  59   ALA n 
3  60   ASP n 
3  61   GLU n 
3  62   PHE n 
3  63   ILE n 
3  64   ALA n 
3  65   HIS n 
3  66   ARG n 
3  67   LEU n 
3  68   GLY n 
3  69   LEU n 
3  70   ILE n 
3  71   PRO n 
3  72   LEU n 
3  73   GLN n 
3  74   SER n 
3  75   MET n 
3  76   ASP n 
3  77   ILE n 
3  78   GLU n 
3  79   GLN n 
3  80   LEU n 
3  81   GLU n 
3  82   TYR n 
3  83   SER n 
3  84   ARG n 
3  85   ASP n 
3  86   CYS n 
3  87   PHE n 
3  88   CYS n 
3  89   GLU n 
3  90   ASP n 
3  91   HIS n 
3  92   CYS n 
3  93   ASP n 
3  94   LYS n 
3  95   CYS n 
3  96   SER n 
3  97   VAL n 
3  98   VAL n 
3  99   LEU n 
3  100  THR n 
3  101  LEU n 
3  102  GLN n 
3  103  ALA n 
3  104  PHE n 
3  105  GLY n 
3  106  GLU n 
3  107  SER n 
3  108  GLU n 
3  109  SER n 
3  110  THR n 
3  111  THR n 
3  112  ASN n 
3  113  VAL n 
3  114  TYR n 
3  115  SER n 
3  116  LYS n 
3  117  ASP n 
3  118  LEU n 
3  119  VAL n 
3  120  ILE n 
3  121  VAL n 
3  122  SER n 
3  123  ASN n 
3  124  LEU n 
3  125  MET n 
3  126  GLY n 
3  127  ARG n 
3  128  ASN n 
3  129  ILE n 
3  130  GLY n 
3  131  HIS n 
3  132  PRO n 
3  133  ILE n 
3  134  ILE n 
3  135  GLN n 
3  136  ASP n 
3  137  LYS n 
3  138  GLU n 
3  139  GLY n 
3  140  ASN n 
3  141  GLY n 
3  142  VAL n 
3  143  LEU n 
3  144  ILE n 
3  145  CYS n 
3  146  LYS n 
3  147  LEU n 
3  148  ARG n 
3  149  LYS n 
3  150  GLY n 
3  151  GLN n 
3  152  GLU n 
3  153  LEU n 
3  154  LYS n 
3  155  LEU n 
3  156  THR n 
3  157  CYS n 
3  158  VAL n 
3  159  ALA n 
3  160  LYS n 
3  161  LYS n 
3  162  GLY n 
3  163  ILE n 
3  164  ALA n 
3  165  LYS n 
3  166  GLU n 
3  167  HIS n 
3  168  ALA n 
3  169  LYS n 
3  170  TRP n 
3  171  GLY n 
3  172  PRO n 
3  173  ALA n 
3  174  ALA n 
3  175  ALA n 
3  176  ILE n 
3  177  GLU n 
3  178  PHE n 
3  179  GLU n 
3  180  TYR n 
3  181  ASP n 
3  182  PRO n 
3  183  TRP n 
3  184  ASN n 
3  185  LYS n 
3  186  LEU n 
3  187  LYS n 
3  188  HIS n 
3  189  THR n 
3  190  ASP n 
3  191  TYR n 
3  192  TRP n 
3  193  TYR n 
3  194  GLU n 
3  195  GLN n 
3  196  ASP n 
3  197  SER n 
3  198  ALA n 
3  199  LYS n 
3  200  GLU n 
3  201  TRP n 
3  202  PRO n 
3  203  GLN n 
3  204  SER n 
3  205  LYS n 
3  206  ASN n 
3  207  CYS n 
3  208  GLU n 
3  209  TYR n 
3  210  GLU n 
3  211  ASP n 
3  212  PRO n 
3  213  PRO n 
3  214  ASN n 
3  215  GLU n 
3  216  GLY n 
3  217  ASP n 
3  218  PRO n 
3  219  PHE n 
3  220  ASP n 
3  221  TYR n 
3  222  LYS n 
3  223  ALA n 
3  224  GLN n 
3  225  ALA n 
3  226  ASP n 
3  227  THR n 
3  228  PHE n 
3  229  TYR n 
3  230  MET n 
3  231  ASN n 
3  232  VAL n 
3  233  GLU n 
3  234  SER n 
3  235  VAL n 
3  236  GLY n 
3  237  SER n 
3  238  ILE n 
3  239  PRO n 
3  240  VAL n 
3  241  ASP n 
3  242  GLN n 
3  243  VAL n 
3  244  VAL n 
3  245  VAL n 
3  246  ARG n 
3  247  GLY n 
3  248  ILE n 
3  249  ASP n 
3  250  THR n 
3  251  LEU n 
3  252  GLN n 
3  253  LYS n 
3  254  LYS n 
3  255  VAL n 
3  256  ALA n 
3  257  SER n 
3  258  ILE n 
3  259  LEU n 
3  260  LEU n 
3  261  ALA n 
3  262  LEU n 
3  263  THR n 
3  264  GLN n 
3  265  MET n 
3  266  ASP n 
3  267  GLN n 
3  268  ASP n 
3  269  LYS n 
3  270  VAL n 
3  271  ASN n 
3  272  PHE n 
3  273  ALA n 
3  274  SER n 
3  275  GLY n 
3  276  ASP n 
3  277  ASN n 
3  278  ASN n 
3  279  THR n 
3  280  ALA n 
3  281  SER n 
3  282  ASN n 
3  283  MET n 
3  284  LEU n 
3  285  GLY n 
3  286  SER n 
3  287  ASN n 
3  288  GLU n 
3  289  ASP n 
3  290  VAL n 
3  291  MET n 
3  292  MET n 
3  293  THR n 
3  294  GLY n 
3  295  ALA n 
3  296  GLU n 
3  297  GLN n 
3  298  ASP n 
3  299  PRO n 
3  300  TYR n 
3  301  SER n 
3  302  ASN n 
3  303  ALA n 
3  304  SER n 
3  305  GLN n 
3  306  MET n 
3  307  GLY n 
3  308  ASN n 
3  309  THR n 
3  310  GLY n 
3  311  SER n 
3  312  GLY n 
3  313  GLY n 
3  314  TYR n 
3  315  ASP n 
3  316  ASN n 
3  317  ALA n 
3  318  TRP n 
4  1    MET n 
4  2    ASN n 
4  3    VAL n 
4  4    SER n 
4  5    THR n 
4  6    SER n 
4  7    THR n 
4  8    PHE n 
4  9    GLN n 
4  10   THR n 
4  11   ARG n 
4  12   ARG n 
4  13   ARG n 
4  14   ARG n 
4  15   LEU n 
4  16   LYS n 
4  17   LYS n 
4  18   VAL n 
4  19   GLU n 
4  20   GLU n 
4  21   GLU n 
4  22   GLU n 
4  23   ASN n 
4  24   ALA n 
4  25   ALA n 
4  26   THR n 
4  27   LEU n 
4  28   GLN n 
4  29   LEU n 
4  30   GLY n 
4  31   GLN n 
4  32   GLU n 
4  33   PHE n 
4  34   GLN n 
4  35   LEU n 
4  36   LYS n 
4  37   GLN n 
4  38   ILE n 
4  39   ASN n 
4  40   HIS n 
4  41   GLN n 
4  42   GLY n 
4  43   GLU n 
4  44   GLU n 
4  45   GLU n 
4  46   GLU n 
4  47   LEU n 
4  48   ILE n 
4  49   ALA n 
4  50   LEU n 
4  51   ASN n 
4  52   LEU n 
4  53   SER n 
4  54   GLU n 
4  55   ALA n 
4  56   ARG n 
4  57   LEU n 
4  58   VAL n 
4  59   ILE n 
4  60   LYS n 
4  61   GLU n 
4  62   ALA n 
4  63   LEU n 
4  64   VAL n 
4  65   GLU n 
4  66   ARG n 
4  67   ARG n 
4  68   ARG n 
4  69   ALA n 
4  70   PHE n 
4  71   LYS n 
4  72   ARG n 
4  73   SER n 
4  74   GLN n 
4  75   LYS n 
4  76   LYS n 
4  77   HIS n 
4  78   LYS n 
4  79   LYS n 
4  80   LYS n 
4  81   HIS n 
4  82   LEU n 
4  83   LYS n 
4  84   HIS n 
4  85   GLU n 
4  86   ASN n 
4  87   ALA n 
4  88   ASN n 
4  89   ASP n 
4  90   GLU n 
4  91   THR n 
4  92   THR n 
4  93   ALA n 
4  94   VAL n 
4  95   GLU n 
4  96   ASP n 
4  97   GLU n 
4  98   ASP n 
4  99   ASP n 
4  100  ASP n 
4  101  LEU n 
4  102  ASP n 
4  103  GLU n 
4  104  ASP n 
4  105  ASP n 
4  106  VAL n 
4  107  ASN n 
4  108  ALA n 
4  109  ASP n 
4  110  ASP n 
4  111  ASP n 
4  112  ASP n 
4  113  PHE n 
4  114  MET n 
4  115  HIS n 
4  116  SER n 
4  117  GLU n 
4  118  THR n 
4  119  ARG n 
4  120  GLU n 
4  121  LYS n 
4  122  GLU n 
4  123  LEU n 
4  124  GLU n 
4  125  SER n 
4  126  ILE n 
4  127  ASP n 
4  128  VAL n 
4  129  LEU n 
4  130  LEU n 
4  131  GLU n 
4  132  GLN n 
4  133  THR n 
4  134  THR n 
4  135  GLY n 
4  136  GLY n 
4  137  ASN n 
4  138  ASN n 
4  139  LYS n 
4  140  ASP n 
4  141  LEU n 
4  142  LYS n 
4  143  ASN n 
4  144  THR n 
4  145  MET n 
4  146  GLN n 
4  147  TYR n 
4  148  LEU n 
4  149  THR n 
4  150  ASN n 
4  151  PHE n 
4  152  SER n 
4  153  ARG n 
4  154  PHE n 
4  155  ARG n 
4  156  ASP n 
4  157  GLN n 
4  158  GLU n 
4  159  THR n 
4  160  VAL n 
4  161  GLY n 
4  162  ALA n 
4  163  VAL n 
4  164  ILE n 
4  165  GLN n 
4  166  LEU n 
4  167  LEU n 
4  168  LYS n 
4  169  SER n 
4  170  THR n 
4  171  GLY n 
4  172  LEU n 
4  173  HIS n 
4  174  PRO n 
4  175  PHE n 
4  176  GLU n 
4  177  VAL n 
4  178  ALA n 
4  179  GLN n 
4  180  LEU n 
4  181  GLY n 
4  182  SER n 
4  183  LEU n 
4  184  ALA n 
4  185  CYS n 
4  186  ASP n 
4  187  THR n 
4  188  ALA n 
4  189  ASP n 
4  190  GLU n 
4  191  ALA n 
4  192  LYS n 
4  193  THR n 
4  194  LEU n 
4  195  ILE n 
4  196  PRO n 
4  197  SER n 
4  198  LEU n 
4  199  ASN n 
4  200  ASN n 
4  201  LYS n 
4  202  ILE n 
4  203  SER n 
4  204  ASP n 
4  205  ASP n 
4  206  GLU n 
4  207  LEU n 
4  208  GLU n 
4  209  ARG n 
4  210  ILE n 
4  211  LEU n 
4  212  LYS n 
4  213  GLU n 
4  214  LEU n 
4  215  SER n 
4  216  ASN n 
4  217  LEU n 
4  218  GLU n 
4  219  THR n 
4  220  LEU n 
4  221  TYR n 
5  1    MET n 
5  2    ASP n 
5  3    GLN n 
5  4    GLU n 
5  5    ASN n 
5  6    GLU n 
5  7    ARG n 
5  8    ASN n 
5  9    ILE n 
5  10   SER n 
5  11   ARG n 
5  12   LEU n 
5  13   TRP n 
5  14   ARG n 
5  15   ALA n 
5  16   PHE n 
5  17   ARG n 
5  18   THR n 
5  19   VAL n 
5  20   LYS n 
5  21   GLU n 
5  22   MET n 
5  23   VAL n 
5  24   LYS n 
5  25   ASP n 
5  26   ARG n 
5  27   GLY n 
5  28   TYR n 
5  29   PHE n 
5  30   ILE n 
5  31   THR n 
5  32   GLN n 
5  33   GLU n 
5  34   GLU n 
5  35   VAL n 
5  36   GLU n 
5  37   LEU n 
5  38   PRO n 
5  39   LEU n 
5  40   GLU n 
5  41   ASP n 
5  42   PHE n 
5  43   LYS n 
5  44   ALA n 
5  45   LYS n 
5  46   TYR n 
5  47   CYS n 
5  48   ASP n 
5  49   SER n 
5  50   MET n 
5  51   GLY n 
5  52   ARG n 
5  53   PRO n 
5  54   GLN n 
5  55   ARG n 
5  56   LYS n 
5  57   MET n 
5  58   MET n 
5  59   SER n 
5  60   PHE n 
5  61   GLN n 
5  62   ALA n 
5  63   ASN n 
5  64   PRO n 
5  65   THR n 
5  66   GLU n 
5  67   GLU n 
5  68   SER n 
5  69   ILE n 
5  70   SER n 
5  71   LYS n 
5  72   PHE n 
5  73   PRO n 
5  74   ASP n 
5  75   MET n 
5  76   GLY n 
5  77   SER n 
5  78   LEU n 
5  79   TRP n 
5  80   VAL n 
5  81   GLU n 
5  82   PHE n 
5  83   CYS n 
5  84   ASP n 
5  85   GLU n 
5  86   PRO n 
5  87   SER n 
5  88   VAL n 
5  89   GLY n 
5  90   VAL n 
5  91   LYS n 
5  92   THR n 
5  93   MET n 
5  94   LYS n 
5  95   THR n 
5  96   PHE n 
5  97   VAL n 
5  98   ILE n 
5  99   HIS n 
5  100  ILE n 
5  101  GLN n 
5  102  GLU n 
5  103  LYS n 
5  104  ASN n 
5  105  PHE n 
5  106  GLN n 
5  107  THR n 
5  108  GLY n 
5  109  ILE n 
5  110  PHE n 
5  111  VAL n 
5  112  TYR n 
5  113  GLN n 
5  114  ASN n 
5  115  ASN n 
5  116  ILE n 
5  117  THR n 
5  118  PRO n 
5  119  SER n 
5  120  ALA n 
5  121  MET n 
5  122  LYS n 
5  123  LEU n 
5  124  VAL n 
5  125  PRO n 
5  126  SER n 
5  127  ILE n 
5  128  PRO n 
5  129  PRO n 
5  130  ALA n 
5  131  THR n 
5  132  ILE n 
5  133  GLU n 
5  134  THR n 
5  135  PHE n 
5  136  ASN n 
5  137  GLU n 
5  138  ALA n 
5  139  ALA n 
5  140  LEU n 
5  141  VAL n 
5  142  VAL n 
5  143  ASN n 
5  144  ILE n 
5  145  THR n 
5  146  HIS n 
5  147  HIS n 
5  148  GLU n 
5  149  LEU n 
5  150  VAL n 
5  151  PRO n 
5  152  LYS n 
5  153  HIS n 
5  154  ILE n 
5  155  ARG n 
5  156  LEU n 
5  157  SER n 
5  158  SER n 
5  159  ASP n 
5  160  GLU n 
5  161  LYS n 
5  162  ARG n 
5  163  GLU n 
5  164  LEU n 
5  165  LEU n 
5  166  LYS n 
5  167  ARG n 
5  168  TYR n 
5  169  ARG n 
5  170  LEU n 
5  171  LYS n 
5  172  GLU n 
5  173  SER n 
5  174  GLN n 
5  175  LEU n 
5  176  PRO n 
5  177  ARG n 
5  178  ILE n 
5  179  GLN n 
5  180  ARG n 
5  181  ALA n 
5  182  ASP n 
5  183  PRO n 
5  184  VAL n 
5  185  ALA n 
5  186  LEU n 
5  187  TYR n 
5  188  LEU n 
5  189  GLY n 
5  190  LEU n 
5  191  LYS n 
5  192  ARG n 
5  193  GLY n 
5  194  GLU n 
5  195  VAL n 
5  196  VAL n 
5  197  LYS n 
5  198  ILE n 
5  199  ILE n 
5  200  ARG n 
5  201  LYS n 
5  202  SER n 
5  203  GLU n 
5  204  THR n 
5  205  SER n 
5  206  GLY n 
5  207  ARG n 
5  208  TYR n 
5  209  ALA n 
5  210  SER n 
5  211  TYR n 
5  212  ARG n 
5  213  ILE n 
5  214  CYS n 
5  215  MET n 
6  1    MET n 
6  2    SER n 
6  3    ASP n 
6  4    TYR n 
6  5    GLU n 
6  6    GLU n 
6  7    ALA n 
6  8    PHE n 
6  9    ASN n 
6  10   ASP n 
6  11   GLY n 
6  12   ASN n 
6  13   GLU n 
6  14   ASN n 
6  15   PHE n 
6  16   GLU n 
6  17   ASP n 
6  18   PHE n 
6  19   ASP n 
6  20   VAL n 
6  21   GLU n 
6  22   HIS n 
6  23   PHE n 
6  24   SER n 
6  25   ASP n 
6  26   GLU n 
6  27   GLU n 
6  28   THR n 
6  29   TYR n 
6  30   GLU n 
6  31   GLU n 
6  32   LYS n 
6  33   PRO n 
6  34   GLN n 
6  35   PHE n 
6  36   LYS n 
6  37   ASP n 
6  38   GLY n 
6  39   GLU n 
6  40   THR n 
6  41   THR n 
6  42   ASP n 
6  43   ALA n 
6  44   ASN n 
6  45   GLY n 
6  46   LYS n 
6  47   THR n 
6  48   ILE n 
6  49   VAL n 
6  50   THR n 
6  51   GLY n 
6  52   GLY n 
6  53   ASN n 
6  54   GLY n 
6  55   PRO n 
6  56   GLU n 
6  57   ASP n 
6  58   PHE n 
6  59   GLN n 
6  60   GLN n 
6  61   HIS n 
6  62   GLU n 
6  63   GLN n 
6  64   ILE n 
6  65   ARG n 
6  66   ARG n 
6  67   LYS n 
6  68   THR n 
6  69   LEU n 
6  70   LYS n 
6  71   GLU n 
6  72   LYS n 
6  73   ALA n 
6  74   ILE n 
6  75   PRO n 
6  76   LYS n 
6  77   ASP n 
6  78   GLN n 
6  79   ARG n 
6  80   ALA n 
6  81   THR n 
6  82   THR n 
6  83   PRO n 
6  84   TYR n 
6  85   MET n 
6  86   THR n 
6  87   LYS n 
6  88   TYR n 
6  89   GLU n 
6  90   ARG n 
6  91   ALA n 
6  92   ARG n 
6  93   ILE n 
6  94   LEU n 
6  95   GLY n 
6  96   THR n 
6  97   ARG n 
6  98   ALA n 
6  99   LEU n 
6  100  GLN n 
6  101  ILE n 
6  102  SER n 
6  103  MET n 
6  104  ASN n 
6  105  ALA n 
6  106  PRO n 
6  107  VAL n 
6  108  PHE n 
6  109  VAL n 
6  110  ASP n 
6  111  LEU n 
6  112  GLU n 
6  113  GLY n 
6  114  GLU n 
6  115  THR n 
6  116  ASP n 
6  117  PRO n 
6  118  LEU n 
6  119  ARG n 
6  120  ILE n 
6  121  ALA n 
6  122  MET n 
6  123  LYS n 
6  124  GLU n 
6  125  LEU n 
6  126  ALA n 
6  127  GLU n 
6  128  LYS n 
6  129  LYS n 
6  130  ILE n 
6  131  PRO n 
6  132  LEU n 
6  133  VAL n 
6  134  ILE n 
6  135  ARG n 
6  136  ARG n 
6  137  TYR n 
6  138  LEU n 
6  139  PRO n 
6  140  ASP n 
6  141  GLY n 
6  142  SER n 
6  143  PHE n 
6  144  GLU n 
6  145  ASP n 
6  146  TRP n 
6  147  SER n 
6  148  VAL n 
6  149  GLU n 
6  150  GLU n 
6  151  LEU n 
6  152  ILE n 
6  153  VAL n 
6  154  ASP n 
6  155  LEU n 
7  1    MET n 
7  2    PHE n 
7  3    PHE n 
7  4    ILE n 
7  5    LYS n 
7  6    ASP n 
7  7    LEU n 
7  8    SER n 
7  9    LEU n 
7  10   ASN n 
7  11   ILE n 
7  12   THR n 
7  13   LEU n 
7  14   HIS n 
7  15   PRO n 
7  16   SER n 
7  17   PHE n 
7  18   PHE n 
7  19   GLY n 
7  20   PRO n 
7  21   ARG n 
7  22   MET n 
7  23   LYS n 
7  24   GLN n 
7  25   TYR n 
7  26   LEU n 
7  27   LYS n 
7  28   THR n 
7  29   LYS n 
7  30   LEU n 
7  31   LEU n 
7  32   GLU n 
7  33   GLU n 
7  34   VAL n 
7  35   GLU n 
7  36   GLY n 
7  37   SER n 
7  38   CYS n 
7  39   THR n 
7  40   GLY n 
7  41   LYS n 
7  42   PHE n 
7  43   GLY n 
7  44   TYR n 
7  45   ILE n 
7  46   LEU n 
7  47   CYS n 
7  48   VAL n 
7  49   LEU n 
7  50   ASP n 
7  51   TYR n 
7  52   ASP n 
7  53   ASN n 
7  54   ILE n 
7  55   ASP n 
7  56   ILE n 
7  57   GLN n 
7  58   ARG n 
7  59   GLY n 
7  60   ARG n 
7  61   ILE n 
7  62   LEU n 
7  63   PRO n 
7  64   THR n 
7  65   ASP n 
7  66   GLY n 
7  67   SER n 
7  68   ALA n 
7  69   GLU n 
7  70   PHE n 
7  71   ASN n 
7  72   VAL n 
7  73   LYS n 
7  74   TYR n 
7  75   ARG n 
7  76   ALA n 
7  77   VAL n 
7  78   VAL n 
7  79   PHE n 
7  80   LYS n 
7  81   PRO n 
7  82   PHE n 
7  83   LYS n 
7  84   GLY n 
7  85   GLU n 
7  86   VAL n 
7  87   VAL n 
7  88   ASP n 
7  89   GLY n 
7  90   THR n 
7  91   VAL n 
7  92   VAL n 
7  93   SER n 
7  94   CYS n 
7  95   SER n 
7  96   GLN n 
7  97   HIS n 
7  98   GLY n 
7  99   PHE n 
7  100  GLU n 
7  101  VAL n 
7  102  GLN n 
7  103  VAL n 
7  104  GLY n 
7  105  PRO n 
7  106  MET n 
7  107  LYS n 
7  108  VAL n 
7  109  PHE n 
7  110  VAL n 
7  111  THR n 
7  112  LYS n 
7  113  HIS n 
7  114  LEU n 
7  115  MET n 
7  116  PRO n 
7  117  GLN n 
7  118  ASP n 
7  119  LEU n 
7  120  THR n 
7  121  PHE n 
7  122  ASN n 
7  123  ALA n 
7  124  GLY n 
7  125  SER n 
7  126  ASN n 
7  127  PRO n 
7  128  PRO n 
7  129  SER n 
7  130  TYR n 
7  131  GLN n 
7  132  SER n 
7  133  SER n 
7  134  GLU n 
7  135  ASP n 
7  136  VAL n 
7  137  ILE n 
7  138  THR n 
7  139  ILE n 
7  140  LYS n 
7  141  SER n 
7  142  ARG n 
7  143  ILE n 
7  144  ARG n 
7  145  VAL n 
7  146  LYS n 
7  147  ILE n 
7  148  GLU n 
7  149  GLY n 
7  150  CYS n 
7  151  ILE n 
7  152  SER n 
7  153  GLN n 
7  154  VAL n 
7  155  SER n 
7  156  SER n 
7  157  ILE n 
7  158  HIS n 
7  159  ALA n 
7  160  ILE n 
7  161  GLY n 
7  162  SER n 
7  163  ILE n 
7  164  LYS n 
7  165  GLU n 
7  166  ASP n 
7  167  TYR n 
7  168  LEU n 
7  169  GLY n 
7  170  ALA n 
7  171  ILE n 
8  1    MET n 
8  2    SER n 
8  3    ASN n 
8  4    THR n 
8  5    LEU n 
8  6    PHE n 
8  7    ASP n 
8  8    ASP n 
8  9    ILE n 
8  10   PHE n 
8  11   GLN n 
8  12   VAL n 
8  13   SER n 
8  14   GLU n 
8  15   VAL n 
8  16   ASP n 
8  17   PRO n 
8  18   GLY n 
8  19   ARG n 
8  20   TYR n 
8  21   ASN n 
8  22   LYS n 
8  23   VAL n 
8  24   CYS n 
8  25   ARG n 
8  26   ILE n 
8  27   GLU n 
8  28   ALA n 
8  29   ALA n 
8  30   SER n 
8  31   THR n 
8  32   THR n 
8  33   GLN n 
8  34   ASP n 
8  35   GLN n 
8  36   CYS n 
8  37   LYS n 
8  38   LEU n 
8  39   THR n 
8  40   LEU n 
8  41   ASP n 
8  42   ILE n 
8  43   ASN n 
8  44   VAL n 
8  45   GLU n 
8  46   LEU n 
8  47   PHE n 
8  48   PRO n 
8  49   VAL n 
8  50   ALA n 
8  51   ALA n 
8  52   GLN n 
8  53   ASP n 
8  54   SER n 
8  55   LEU n 
8  56   THR n 
8  57   VAL n 
8  58   THR n 
8  59   ILE n 
8  60   ALA n 
8  61   SER n 
8  62   SER n 
8  63   LEU n 
8  64   ASN n 
8  65   LEU n 
8  66   GLU n 
8  67   ASP n 
8  68   THR n 
8  69   PRO n 
8  70   ALA n 
8  71   ASN n 
8  72   ASP n 
8  73   SER n 
8  74   SER n 
8  75   ALA n 
8  76   THR n 
8  77   ARG n 
8  78   SER n 
8  79   TRP n 
8  80   ARG n 
8  81   PRO n 
8  82   PRO n 
8  83   GLN n 
8  84   ALA n 
8  85   GLY n 
8  86   ASP n 
8  87   ARG n 
8  88   SER n 
8  89   LEU n 
8  90   ALA n 
8  91   ASP n 
8  92   ASP n 
8  93   TYR n 
8  94   ASP n 
8  95   TYR n 
8  96   VAL n 
8  97   MET n 
8  98   TYR n 
8  99   GLY n 
8  100  THR n 
8  101  ALA n 
8  102  TYR n 
8  103  LYS n 
8  104  PHE n 
8  105  GLU n 
8  106  GLU n 
8  107  VAL n 
8  108  SER n 
8  109  LYS n 
8  110  ASP n 
8  111  LEU n 
8  112  ILE n 
8  113  ALA n 
8  114  VAL n 
8  115  TYR n 
8  116  TYR n 
8  117  SER n 
8  118  PHE n 
8  119  GLY n 
8  120  GLY n 
8  121  LEU n 
8  122  LEU n 
8  123  MET n 
8  124  ARG n 
8  125  LEU n 
8  126  GLU n 
8  127  GLY n 
8  128  ASN n 
8  129  TYR n 
8  130  ARG n 
8  131  ASN n 
8  132  LEU n 
8  133  ASN n 
8  134  ASN n 
8  135  LEU n 
8  136  LYS n 
8  137  GLN n 
8  138  GLU n 
8  139  ASN n 
8  140  ALA n 
8  141  TYR n 
8  142  LEU n 
8  143  LEU n 
8  144  ILE n 
8  145  ARG n 
8  146  ARG n 
9  1    MET n 
9  2    THR n 
9  3    THR n 
9  4    PHE n 
9  5    ARG n 
9  6    PHE n 
9  7    CYS n 
9  8    ARG n 
9  9    ASP n 
9  10   CYS n 
9  11   ASN n 
9  12   ASN n 
9  13   MET n 
9  14   LEU n 
9  15   TYR n 
9  16   PRO n 
9  17   ARG n 
9  18   GLU n 
9  19   ASP n 
9  20   LYS n 
9  21   GLU n 
9  22   ASN n 
9  23   ASN n 
9  24   ARG n 
9  25   LEU n 
9  26   LEU n 
9  27   PHE n 
9  28   GLU n 
9  29   CYS n 
9  30   ARG n 
9  31   THR n 
9  32   CYS n 
9  33   SER n 
9  34   TYR n 
9  35   VAL n 
9  36   GLU n 
9  37   GLU n 
9  38   ALA n 
9  39   GLY n 
9  40   SER n 
9  41   PRO n 
9  42   LEU n 
9  43   VAL n 
9  44   TYR n 
9  45   ARG n 
9  46   HIS n 
9  47   GLU n 
9  48   LEU n 
9  49   ILE n 
9  50   THR n 
9  51   ASN n 
9  52   ILE n 
9  53   GLY n 
9  54   GLU n 
9  55   THR n 
9  56   ALA n 
9  57   GLY n 
9  58   VAL n 
9  59   VAL n 
9  60   GLN n 
9  61   ASP n 
9  62   ILE n 
9  63   GLY n 
9  64   SER n 
9  65   ASP n 
9  66   PRO n 
9  67   THR n 
9  68   LEU n 
9  69   PRO n 
9  70   ARG n 
9  71   SER n 
9  72   ASP n 
9  73   ARG n 
9  74   GLU n 
9  75   CYS n 
9  76   PRO n 
9  77   LYS n 
9  78   CYS n 
9  79   HIS n 
9  80   SER n 
9  81   ARG n 
9  82   GLU n 
9  83   ASN n 
9  84   VAL n 
9  85   PHE n 
9  86   PHE n 
9  87   GLN n 
9  88   SER n 
9  89   GLN n 
9  90   GLN n 
9  91   ARG n 
9  92   ARG n 
9  93   LYS n 
9  94   ASP n 
9  95   THR n 
9  96   SER n 
9  97   MET n 
9  98   VAL n 
9  99   LEU n 
9  100  PHE n 
9  101  PHE n 
9  102  VAL n 
9  103  CYS n 
9  104  LEU n 
9  105  SER n 
9  106  CYS n 
9  107  SER n 
9  108  HIS n 
9  109  ILE n 
9  110  PHE n 
9  111  THR n 
9  112  SER n 
9  113  ASP n 
9  114  GLN n 
9  115  LYS n 
9  116  ASN n 
9  117  LYS n 
9  118  ARG n 
9  119  THR n 
9  120  GLN n 
9  121  PHE n 
9  122  SER n 
10 1    MET n 
10 2    ILE n 
10 3    VAL n 
10 4    PRO n 
10 5    VAL n 
10 6    ARG n 
10 7    CYS n 
10 8    PHE n 
10 9    SER n 
10 10   CYS n 
10 11   GLY n 
10 12   LYS n 
10 13   VAL n 
10 14   VAL n 
10 15   GLY n 
10 16   ASP n 
10 17   LYS n 
10 18   TRP n 
10 19   GLU n 
10 20   SER n 
10 21   TYR n 
10 22   LEU n 
10 23   ASN n 
10 24   LEU n 
10 25   LEU n 
10 26   GLN n 
10 27   GLU n 
10 28   ASP n 
10 29   GLU n 
10 30   LEU n 
10 31   ASP n 
10 32   GLU n 
10 33   GLY n 
10 34   THR n 
10 35   ALA n 
10 36   LEU n 
10 37   SER n 
10 38   ARG n 
10 39   LEU n 
10 40   GLY n 
10 41   LEU n 
10 42   LYS n 
10 43   ARG n 
10 44   TYR n 
10 45   CYS n 
10 46   CYS n 
10 47   ARG n 
10 48   ARG n 
10 49   MET n 
10 50   ILE n 
10 51   LEU n 
10 52   THR n 
10 53   HIS n 
10 54   VAL n 
10 55   ASP n 
10 56   LEU n 
10 57   ILE n 
10 58   GLU n 
10 59   LYS n 
10 60   PHE n 
10 61   LEU n 
10 62   ARG n 
10 63   TYR n 
10 64   ASN n 
10 65   PRO n 
10 66   LEU n 
10 67   GLU n 
10 68   LYS n 
10 69   ARG n 
10 70   ASP n 
11 1    MET n 
11 2    ASN n 
11 3    ALA n 
11 4    PRO n 
11 5    ASP n 
11 6    ARG n 
11 7    PHE n 
11 8    GLU n 
11 9    LEU n 
11 10   PHE n 
11 11   LEU n 
11 12   LEU n 
11 13   GLY n 
11 14   GLU n 
11 15   GLY n 
11 16   GLU n 
11 17   SER n 
11 18   LYS n 
11 19   LEU n 
11 20   LYS n 
11 21   ILE n 
11 22   ASP n 
11 23   PRO n 
11 24   ASP n 
11 25   THR n 
11 26   LYS n 
11 27   ALA n 
11 28   PRO n 
11 29   ASN n 
11 30   ALA n 
11 31   VAL n 
11 32   VAL n 
11 33   ILE n 
11 34   THR n 
11 35   PHE n 
11 36   GLU n 
11 37   LYS n 
11 38   GLU n 
11 39   ASP n 
11 40   HIS n 
11 41   THR n 
11 42   LEU n 
11 43   GLY n 
11 44   ASN n 
11 45   LEU n 
11 46   ILE n 
11 47   ARG n 
11 48   ALA n 
11 49   GLU n 
11 50   LEU n 
11 51   LEU n 
11 52   ASN n 
11 53   ASP n 
11 54   ARG n 
11 55   LYS n 
11 56   VAL n 
11 57   LEU n 
11 58   PHE n 
11 59   ALA n 
11 60   ALA n 
11 61   TYR n 
11 62   LYS n 
11 63   VAL n 
11 64   GLU n 
11 65   HIS n 
11 66   PRO n 
11 67   PHE n 
11 68   PHE n 
11 69   ALA n 
11 70   ARG n 
11 71   PHE n 
11 72   LYS n 
11 73   LEU n 
11 74   ARG n 
11 75   ILE n 
11 76   GLN n 
11 77   THR n 
11 78   THR n 
11 79   GLU n 
11 80   GLY n 
11 81   TYR n 
11 82   ASP n 
11 83   PRO n 
11 84   LYS n 
11 85   ASP n 
11 86   ALA n 
11 87   LEU n 
11 88   LYS n 
11 89   ASN n 
11 90   ALA n 
11 91   CYS n 
11 92   ASN n 
11 93   SER n 
11 94   ILE n 
11 95   ILE n 
11 96   ASN n 
11 97   LYS n 
11 98   LEU n 
11 99   GLY n 
11 100  ALA n 
11 101  LEU n 
11 102  LYS n 
11 103  THR n 
11 104  ASN n 
11 105  PHE n 
11 106  GLU n 
11 107  THR n 
11 108  GLU n 
11 109  TRP n 
11 110  ASN n 
11 111  LEU n 
11 112  GLN n 
11 113  THR n 
11 114  LEU n 
11 115  ALA n 
11 116  ALA n 
11 117  ASP n 
11 118  ASP n 
11 119  ALA n 
11 120  PHE n 
12 1    MET n 
12 2    SER n 
12 3    ARG n 
12 4    GLU n 
12 5    GLY n 
12 6    PHE n 
12 7    GLN n 
12 8    ILE n 
12 9    PRO n 
12 10   THR n 
12 11   ASN n 
12 12   LEU n 
12 13   ASP n 
12 14   ALA n 
12 15   ALA n 
12 16   ALA n 
12 17   ALA n 
12 18   GLY n 
12 19   THR n 
12 20   SER n 
12 21   GLN n 
12 22   ALA n 
12 23   ARG n 
12 24   THR n 
12 25   ALA n 
12 26   THR n 
12 27   LEU n 
12 28   LYS n 
12 29   TYR n 
12 30   ILE n 
12 31   CYS n 
12 32   ALA n 
12 33   GLU n 
12 34   CYS n 
12 35   SER n 
12 36   SER n 
12 37   LYS n 
12 38   LEU n 
12 39   SER n 
12 40   LEU n 
12 41   SER n 
12 42   ARG n 
12 43   THR n 
12 44   ASP n 
12 45   ALA n 
12 46   VAL n 
12 47   ARG n 
12 48   CYS n 
12 49   LYS n 
12 50   ASP n 
12 51   CYS n 
12 52   GLY n 
12 53   HIS n 
12 54   ARG n 
12 55   ILE n 
12 56   LEU n 
12 57   LEU n 
12 58   LYS n 
12 59   ALA n 
12 60   ARG n 
12 61   THR n 
12 62   LYS n 
12 63   ARG n 
12 64   LEU n 
12 65   VAL n 
12 66   GLN n 
12 67   PHE n 
12 68   GLU n 
12 69   ALA n 
12 70   ARG n 
13 1    PRO n 
13 2    ARG n 
13 3    ASN n 
13 4    SER n 
13 5    LYS n 
13 6    ASN n 
13 7    ASP n 
13 8    GLY n 
13 9    VAL n 
13 10   ASP n 
13 11   THR n 
13 12   ALA n 
13 13   ILE n 
13 14   TYR n 
13 15   HIS n 
13 16   HIS n 
13 17   LYS n 
13 18   LEU n 
13 19   ARG n 
13 20   ASP n 
13 21   GLN n 
13 22   VAL n 
13 23   LEU n 
13 24   LYS n 
13 25   ALA n 
13 26   LEU n 
13 27   TYR n 
13 28   ASP n 
13 29   VAL n 
13 30   LEU n 
13 31   ALA n 
13 32   LYS n 
13 33   GLU n 
13 34   SER n 
13 35   GLU n 
13 36   HIS n 
13 37   PRO n 
13 38   PRO n 
13 39   GLN n 
13 40   SER n 
13 41   ILE n 
13 42   LEU n 
13 43   HIS n 
13 44   THR n 
13 45   ALA n 
13 46   LYS n 
13 47   ALA n 
13 48   ILE n 
13 49   GLU n 
13 50   SER n 
13 51   GLU n 
13 52   MET n 
13 53   ASN n 
13 54   LYS n 
13 55   VAL n 
13 56   ASN n 
13 57   ASN n 
13 58   CYS n 
13 59   ASP n 
13 60   THR n 
13 61   ASN n 
13 62   GLU n 
13 63   ALA n 
13 64   ALA n 
13 65   TYR n 
13 66   LYS n 
13 67   ALA n 
13 68   ARG n 
13 69   TYR n 
13 70   ARG n 
13 71   ILE n 
13 72   ILE n 
13 73   TYR n 
13 74   SER n 
13 75   ASN n 
13 76   VAL n 
13 77   ILE n 
13 78   SER n 
13 79   LYS n 
13 80   ASN n 
13 81   ASN n 
13 82   PRO n 
13 83   ASP n 
13 84   LEU n 
13 85   LYS n 
13 86   HIS n 
13 87   LYS n 
13 88   ILE n 
13 89   ALA n 
13 90   ASN n 
13 91   GLY n 
13 92   ASP n 
13 93   ILE n 
13 94   THR n 
13 95   PRO n 
13 96   GLU n 
13 97   PHE n 
13 98   LEU n 
13 99   ALA n 
13 100  THR n 
13 101  CYS n 
13 102  ASP n 
13 103  ALA n 
13 104  LYS n 
13 105  ASP n 
13 106  LEU n 
13 107  ALA n 
13 108  PRO n 
13 109  ALA n 
13 110  PRO n 
13 111  LEU n 
13 112  LYS n 
13 113  GLN n 
13 114  LYS n 
13 115  ILE n 
13 116  GLU n 
13 117  GLU n 
13 118  ILE n 
13 119  ALA n 
13 120  LYS n 
13 121  GLN n 
13 122  ASN n 
13 123  LEU n 
13 124  TYR n 
13 125  ASN n 
13 126  ALA n 
13 127  GLN n 
13 128  GLY n 
13 129  ALA n 
13 130  THR n 
13 131  ILE n 
13 132  GLU n 
13 133  ARG n 
13 134  SER n 
13 135  VAL n 
13 136  THR n 
13 137  ASP n 
13 138  ARG n 
13 139  PHE n 
13 140  THR n 
13 141  CYS n 
13 142  GLY n 
13 143  LYS n 
13 144  CYS n 
13 145  LYS n 
13 146  GLU n 
13 147  LYS n 
13 148  LYS n 
13 149  VAL n 
13 150  SER n 
13 151  TYR n 
13 152  TYR n 
13 153  GLN n 
13 154  LEU n 
13 155  GLN n 
13 156  THR n 
13 157  ARG n 
13 158  SER n 
13 159  ALA n 
13 160  ASP n 
13 161  GLU n 
13 162  PRO n 
13 163  LEU n 
13 164  THR n 
13 165  THR n 
13 166  PHE n 
13 167  CYS n 
13 168  THR n 
13 169  CYS n 
13 170  GLU n 
13 171  ALA n 
13 172  CYS n 
13 173  GLY n 
13 174  ASN n 
13 175  ARG n 
13 176  TRP n 
13 177  LYS n 
13 178  PHE n 
13 179  SER n 
# 
_entity_src_gen.entity_id                          13 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               
;baker's yeast
;
_entity_src_gen.gene_src_genus                     Saccharomyces 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     4932 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1  UNP RPB1_YEAST  P04050 1  
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
1   ? 
2  UNP RPB2_YEAST  P08518 2  
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
1   ? 
3  UNP RPB3_YEAST  P16370 3  
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
1   ? 
4  UNP RPB4_YEAST  P20433 4  
;MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKKK
HLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETV
GAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY
;
1   ? 
5  UNP RPB5_YEAST  P20434 5  
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
1   ? 
6  UNP RPB6_YEAST  P20435 6  
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
1   ? 
7  UNP RPB7_YEAST  P34087 7  
;MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFK
PFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAI
GSIKEDYLGAI
;
1   ? 
8  UNP RPB8_YEAST  P20436 8  
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
1   ? 
9  UNP RPB9_YEAST  P27999 9  
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
1   ? 
10 UNP RPB10_YEAST P22139 10 MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 1   ? 
11 UNP RPB11_YEAST P38902 11 
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
1   ? 
12 UNP RPC10_YEAST P40422 12 MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 1   ? 
13 UNP TFS2_YEAST  P07273 13 
;PRNSKNDGVDTAIYHHKLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVISKN
NPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSAD
EPLTTFCTCEACGNRWKFS
;
131 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  1Y1V A 1 ? 1733 ? P04050 1   ? 1733 ? 1   1733 
2  2  1Y1V B 1 ? 1224 ? P08518 1   ? 1224 ? 1   1224 
3  3  1Y1V C 1 ? 318  ? P16370 1   ? 318  ? 1   318  
4  4  1Y1V D 1 ? 221  ? P20433 1   ? 221  ? 1   221  
5  5  1Y1V E 1 ? 215  ? P20434 1   ? 215  ? 1   215  
6  6  1Y1V F 1 ? 155  ? P20435 1   ? 155  ? 1   155  
7  7  1Y1V G 1 ? 171  ? P34087 1   ? 171  ? 1   171  
8  8  1Y1V H 1 ? 146  ? P20436 1   ? 146  ? 1   146  
9  9  1Y1V I 1 ? 122  ? P27999 1   ? 122  ? 1   122  
10 10 1Y1V J 1 ? 70   ? P22139 1   ? 70   ? 1   70   
11 11 1Y1V K 1 ? 120  ? P38902 1   ? 120  ? 1   120  
12 12 1Y1V L 1 ? 70   ? P40422 1   ? 70   ? 1   70   
13 13 1Y1V S 1 ? 179  ? P07273 131 ? 309  ? 131 309  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          1Y1V 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      5.69 
_exptl_crystal.density_percent_sol   78.37 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 1Y1V 
_refine.ls_d_res_high                            3.8 
_refine.ls_d_res_low                             50 
_refine.pdbx_ls_sigma_F                          1.9 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     115508 
_refine.ls_number_reflns_obs                     115508 
_refine.ls_number_reflns_R_free                  1155 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.282 
_refine.ls_R_factor_R_free                       0.294 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  
;Some parts of the coordinates for only the alpha carbons are present in the structure. 
THE NUMBER OF MISSING atoms WAS SO MUCH THAT REMARK 470 FOR THE MISSING atoms LIST WERE REMOVED.
;
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        31793 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               31803 
_refine_hist.d_res_high                       3.8 
_refine_hist.d_res_low                        50 
# 
_struct.entry_id                  1Y1V 
_struct.title                     'Refined RNA Polymerase II-TFIIS complex' 
_struct.pdbx_descriptor           'RNA polymerase II (E.C.2.7.7.6)/Transcription elongation factor S-II' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1Y1V 
_struct_keywords.pdbx_keywords   TRANSFERASE/TRANSCRIPTION 
_struct_keywords.text            'RNA Polymerase II, TFIIS, Transcription, Elongation, TRANSFERASE-TRANSCRIPTION COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 8  ? 
I N N 9  ? 
J N N 10 ? 
K N N 11 ? 
L N N 12 ? 
M N N 13 ? 
N N N 14 ? 
O N N 14 ? 
P N N 14 ? 
Q N N 14 ? 
R N N 14 ? 
S N N 14 ? 
T N N 14 ? 
U N N 14 ? 
V N N 15 ? 
W N N 14 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   SER A 23   ? SER A 31   ? SER A 23   SER A 31   1 ? 9  
HELX_P HELX_P2   2   PHE A 95   ? CYS A 105  ? PHE A 95   CYS A 105  1 ? 11 
HELX_P HELX_P3   3   ASN A 119  ? ALA A 127  ? ASN A 119  ALA A 127  1 ? 9  
HELX_P HELX_P4   4   ARG A 134  ? TRP A 139  ? ARG A 134  TRP A 139  1 ? 6  
HELX_P HELX_P5   5   SER A 203  ? ILE A 214  ? SER A 203  ILE A 214  1 ? 12 
HELX_P HELX_P6   6   SER A 215  ? LEU A 222  ? SER A 215  LEU A 222  1 ? 8  
HELX_P HELX_P7   7   ARG A 230  ? MET A 234  ? ARG A 230  MET A 234  5 ? 5  
HELX_P HELX_P8   8   PRO A 243  ? ARG A 247  ? PRO A 243  ARG A 247  5 ? 5  
HELX_P HELX_P9   9   ASP A 260  ? THR A 278  ? ASP A 260  THR A 278  1 ? 19 
HELX_P HELX_P10  10  PRO A 285  ? ILE A 289  ? PRO A 285  ILE A 289  5 ? 5  
HELX_P HELX_P11  11  ALA A 292  ? TYR A 303  ? ALA A 292  TYR A 303  1 ? 12 
HELX_P HELX_P12  12  SER A 324  ? LYS A 330  ? SER A 324  LYS A 330  1 ? 7  
HELX_P HELX_P13  13  GLY A 334  ? LEU A 340  ? GLY A 334  LEU A 340  1 ? 7  
HELX_P HELX_P14  14  LYS A 368  ? LYS A 372  ? LYS A 368  LYS A 372  1 ? 5  
HELX_P HELX_P15  15  ASN A 384  ? GLY A 395  ? ASN A 384  GLY A 395  1 ? 12 
HELX_P HELX_P16  16  HIS A 451  ? MET A 453  ? HIS A 451  MET A 453  5 ? 3  
HELX_P HELX_P17  17  ASN A 471  ? THR A 475  ? ASN A 471  THR A 475  5 ? 5  
HELX_P HELX_P18  18  SER A 494  ? GLN A 503  ? SER A 494  GLN A 503  1 ? 10 
HELX_P HELX_P19  19  ALA A 506  ? GLN A 510  ? ALA A 506  GLN A 510  5 ? 5  
HELX_P HELX_P20  20  PRO A 514  ? ASN A 517  ? PRO A 514  ASN A 517  5 ? 4  
HELX_P HELX_P21  21  VAL A 524  ? LEU A 536  ? VAL A 524  LEU A 536  1 ? 13 
HELX_P HELX_P22  22  LEU A 543  ? VAL A 553  ? LEU A 543  VAL A 553  1 ? 11 
HELX_P HELX_P23  23  GLY A 574  ? SER A 579  ? GLY A 574  SER A 579  1 ? 6  
HELX_P HELX_P24  24  VAL A 580  ? ILE A 582  ? VAL A 580  ILE A 582  5 ? 3  
HELX_P HELX_P25  25  GLU A 618  ? GLY A 623  ? GLU A 618  GLY A 623  1 ? 6  
HELX_P HELX_P26  26  GLY A 628  ? LYS A 637  ? GLY A 628  LYS A 637  1 ? 10 
HELX_P HELX_P27  27  GLY A 638  ? GLY A 661  ? GLY A 638  GLY A 661  1 ? 24 
HELX_P HELX_P28  28  GLY A 665  ? THR A 669  ? GLY A 665  THR A 669  5 ? 5  
HELX_P HELX_P29  29  ASP A 672  ? GLU A 696  ? ASP A 672  GLU A 696  1 ? 25 
HELX_P HELX_P30  30  THR A 709  ? LEU A 737  ? THR A 709  LEU A 737  1 ? 29 
HELX_P HELX_P31  31  ASN A 741  ? ALA A 749  ? ASN A 741  ALA A 749  1 ? 9  
HELX_P HELX_P32  32  SER A 754  ? ALA A 763  ? SER A 754  ALA A 763  1 ? 10 
HELX_P HELX_P33  33  SER A 793  ? GLY A 798  ? SER A 793  GLY A 798  1 ? 6  
HELX_P HELX_P34  34  THR A 809  ? ARG A 821  ? THR A 809  ARG A 821  1 ? 13 
HELX_P HELX_P35  35  GLU A 822  ? THR A 827  ? GLU A 822  THR A 827  1 ? 6  
HELX_P HELX_P36  36  VAL A 829  ? LEU A 845  ? VAL A 829  LEU A 845  1 ? 17 
HELX_P HELX_P37  37  ILE A 867  ? ASP A 871  ? ILE A 867  ASP A 871  5 ? 5  
HELX_P HELX_P38  38  SER A 889  ? ARG A 898  ? SER A 889  ARG A 898  1 ? 10 
HELX_P HELX_P39  39  VAL A 927  ? GLU A 945  ? VAL A 927  GLU A 945  1 ? 19 
HELX_P HELX_P40  40  ASN A 959  ? THR A 970  ? ASN A 959  THR A 970  1 ? 12 
HELX_P HELX_P41  41  THR A 982  ? GLU A 995  ? THR A 982  GLU A 995  1 ? 14 
HELX_P HELX_P42  42  ASN A 1004 ? LEU A 1026 ? ASN A 1004 LEU A 1026 1 ? 23 
HELX_P HELX_P43  43  ALA A 1027 ? GLU A 1034 ? ALA A 1027 GLU A 1034 1 ? 8  
HELX_P HELX_P44  44  THR A 1038 ? VAL A 1057 ? THR A 1038 VAL A 1057 1 ? 20 
HELX_P HELX_P45  45  MET A 1063 ? MET A 1079 ? MET A 1063 MET A 1079 1 ? 17 
HELX_P HELX_P46  46  GLY A 1097 ? VAL A 1107 ? GLY A 1097 VAL A 1107 1 ? 11 
HELX_P HELX_P47  47  GLU A 1129 ? GLU A 1139 ? GLU A 1129 GLU A 1139 1 ? 11 
HELX_P HELX_P48  48  THR A 1142 ? THR A 1147 ? THR A 1142 THR A 1147 1 ? 6  
HELX_P HELX_P49  49  ASP A 1166 ? LEU A 1176 ? ASP A 1166 LEU A 1176 1 ? 11 
HELX_P HELX_P50  50  ARG A 1199 ? ASN A 1203 ? ARG A 1199 ASN A 1203 5 ? 5  
HELX_P HELX_P51  51  THR A 1208 ? LYS A 1221 ? THR A 1208 LYS A 1221 1 ? 14 
HELX_P HELX_P52  52  HIS A 1258 ? THR A 1266 ? HIS A 1258 THR A 1266 1 ? 9  
HELX_P HELX_P53  53  ASN A 1312 ? MET A 1317 ? ASN A 1312 MET A 1317 1 ? 6  
HELX_P HELX_P54  54  SER A 1331 ? VAL A 1338 ? SER A 1331 VAL A 1338 1 ? 8  
HELX_P HELX_P55  55  GLY A 1340 ? SER A 1358 ? GLY A 1340 SER A 1358 1 ? 19 
HELX_P HELX_P56  56  TYR A 1365 ? THR A 1377 ? TYR A 1365 THR A 1377 1 ? 13 
HELX_P HELX_P57  57  GLY A 1388 ? SER A 1392 ? GLY A 1388 SER A 1392 5 ? 5  
HELX_P HELX_P58  58  GLY A 1395 ? SER A 1401 ? GLY A 1395 SER A 1401 1 ? 7  
HELX_P HELX_P59  59  GLU A 1404 ? ALA A 1414 ? GLU A 1404 ALA A 1414 1 ? 11 
HELX_P HELX_P60  60  GLY A 1423 ? ILE A 1429 ? GLY A 1423 ILE A 1429 1 ? 7  
HELX_P HELX_P61  61  ILE A 1436 ? ALA A 1440 ? ILE A 1436 ALA A 1440 5 ? 5  
HELX_P HELX_P62  62  ASP A 1446 ? LYS A 1452 ? ASP A 1446 LYS A 1452 1 ? 7  
HELX_P HELX_P63  63  THR B 26   ? LYS B 41   ? THR B 26   LYS B 41   1 ? 16 
HELX_P HELX_P64  64  VAL B 44   ? TYR B 57   ? VAL B 44   TYR B 57   1 ? 14 
HELX_P HELX_P65  65  TYR B 57   ? CYS B 64   ? TYR B 57   CYS B 64   1 ? 8  
HELX_P HELX_P66  66  TYR B 113  ? ARG B 120  ? TYR B 113  ARG B 120  1 ? 8  
HELX_P HELX_P67  67  THR B 185  ? LYS B 191  ? THR B 185  LYS B 191  1 ? 7  
HELX_P HELX_P68  68  ILE B 282  ? LEU B 289  ? ILE B 282  LEU B 289  1 ? 8  
HELX_P HELX_P69  69  ILE B 297  ? CYS B 302  ? ILE B 297  CYS B 302  1 ? 6  
HELX_P HELX_P70  70  ASP B 307  ? PHE B 322  ? ASP B 307  PHE B 322  1 ? 16 
HELX_P HELX_P71  71  ASP B 326  ? PHE B 333  ? ASP B 326  PHE B 333  1 ? 8  
HELX_P HELX_P72  72  LYS B 347  ? GLU B 359  ? LYS B 347  GLU B 359  1 ? 13 
HELX_P HELX_P73  73  PHE B 370  ? LEU B 390  ? PHE B 370  LEU B 390  1 ? 21 
HELX_P HELX_P74  74  HIS B 400  ? GLY B 402  ? HIS B 400  GLY B 402  5 ? 3  
HELX_P HELX_P75  75  LEU B 408  ? GLN B 433  ? LEU B 408  GLN B 433  1 ? 26 
HELX_P HELX_P76  76  ALA B 450  ? THR B 463  ? ALA B 450  THR B 463  1 ? 14 
HELX_P HELX_P77  77  TYR B 488  ? ARG B 496  ? TYR B 488  ARG B 496  1 ? 9  
HELX_P HELX_P78  78  PRO B 551  ? SER B 559  ? PRO B 551  SER B 559  1 ? 9  
HELX_P HELX_P79  79  PRO B 565  ? TYR B 569  ? PRO B 565  TYR B 569  5 ? 5  
HELX_P HELX_P80  80  ASN B 592  ? ARG B 605  ? ASN B 592  ARG B 605  1 ? 14 
HELX_P HELX_P81  81  ILE B 619  ? LYS B 622  ? ILE B 619  LYS B 622  5 ? 4  
HELX_P HELX_P82  82  ARG B 654  ? GLN B 667  ? ARG B 654  GLN B 667  1 ? 14 
HELX_P HELX_P83  83  THR B 680  ? GLU B 687  ? THR B 680  GLU B 687  1 ? 8  
HELX_P HELX_P84  84  ALA B 695  ? SER B 700  ? ALA B 695  SER B 700  1 ? 6  
HELX_P HELX_P85  85  HIS B 744  ? LEU B 749  ? HIS B 744  LEU B 749  5 ? 6  
HELX_P HELX_P86  86  GLY B 750  ? ILE B 755  ? GLY B 750  ILE B 755  1 ? 6  
HELX_P HELX_P87  87  GLN B 763  ? GLY B 774  ? GLN B 763  GLY B 774  1 ? 12 
HELX_P HELX_P88  88  ASN B 784  ? ARG B 788  ? ASN B 784  ARG B 788  5 ? 5  
HELX_P HELX_P89  89  THR B 806  ? LEU B 812  ? THR B 806  LEU B 812  5 ? 7  
HELX_P HELX_P90  90  ASN B 842  ? ARG B 848  ? ASN B 842  ARG B 848  1 ? 7  
HELX_P HELX_P91  91  THR B 889  ? LEU B 893  ? THR B 889  LEU B 893  5 ? 5  
HELX_P HELX_P92  92  ASN B 1013 ? MET B 1021 ? ASN B 1013 MET B 1021 5 ? 9  
HELX_P HELX_P93  93  THR B 1022 ? GLY B 1039 ? THR B 1022 GLY B 1039 1 ? 18 
HELX_P HELX_P94  94  THR B 1051 ? GLU B 1061 ? THR B 1051 GLU B 1061 1 ? 11 
HELX_P HELX_P95  95  MET B 1098 ? LYS B 1102 ? MET B 1098 LYS B 1102 5 ? 5  
HELX_P HELX_P96  96  GLY B 1131 ? GLY B 1142 ? GLY B 1131 GLY B 1142 1 ? 12 
HELX_P HELX_P97  97  ALA B 1143 ? MET B 1152 ? ALA B 1143 MET B 1152 1 ? 10 
HELX_P HELX_P98  98  PRO B 1197 ? MET B 1210 ? PRO B 1197 MET B 1210 1 ? 14 
HELX_P HELX_P99  99  ASP C 26   ? GLU C 40   ? ASP C 26   GLU C 40   1 ? 15 
HELX_P HELX_P100 100 ALA C 59   ? ILE C 70   ? ALA C 59   ILE C 70   1 ? 12 
HELX_P HELX_P101 101 SER C 74   ? GLU C 78   ? SER C 74   GLU C 78   5 ? 5  
HELX_P HELX_P102 102 LYS C 116  ? LEU C 118  ? LYS C 116  LEU C 118  5 ? 3  
HELX_P HELX_P103 103 ILE C 163  ? HIS C 167  ? ILE C 163  HIS C 167  5 ? 5  
HELX_P HELX_P104 104 ASP C 196  ? TRP C 201  ? ASP C 196  TRP C 201  1 ? 6  
HELX_P HELX_P105 105 SER C 204  ? GLU C 210  ? SER C 204  GLU C 210  5 ? 7  
HELX_P HELX_P106 106 PRO C 239  ? GLN C 264  ? PRO C 239  GLN C 264  1 ? 26 
HELX_P HELX_P107 107 GLY D 30   ? GLN D 34   ? GLY D 30   GLN D 34   5 ? 5  
HELX_P HELX_P108 108 SER D 53   ? ARG D 72   ? SER D 53   ARG D 72   1 ? 20 
HELX_P HELX_P109 109 ARG D 119  ? THR D 134  ? ARG D 119  THR D 134  1 ? 16 
HELX_P HELX_P110 110 ASN D 138  ? SER D 152  ? ASN D 138  SER D 152  1 ? 15 
HELX_P HELX_P111 111 GLU D 158  ? LYS D 168  ? GLU D 158  LYS D 168  1 ? 11 
HELX_P HELX_P112 112 HIS D 173  ? LEU D 180  ? HIS D 173  LEU D 180  1 ? 8  
HELX_P HELX_P113 113 THR D 187  ? ILE D 195  ? THR D 187  ILE D 195  1 ? 9  
HELX_P HELX_P114 114 SER D 203  ? GLU D 218  ? SER D 203  GLU D 218  1 ? 16 
HELX_P HELX_P115 115 ASP E 2    ? GLU E 4    ? ASP E 2    GLU E 4    5 ? 3  
HELX_P HELX_P116 116 ASN E 5    ? ARG E 26   ? ASN E 5    ARG E 26   1 ? 22 
HELX_P HELX_P117 117 THR E 31   ? GLU E 36   ? THR E 31   GLU E 36   1 ? 6  
HELX_P HELX_P118 118 PRO E 38   ? ALA E 44   ? PRO E 38   ALA E 44   1 ? 7  
HELX_P HELX_P119 119 GLN E 54   ? MET E 58   ? GLN E 54   MET E 58   5 ? 5  
HELX_P HELX_P120 120 GLU E 66   ? PHE E 72   ? GLU E 66   PHE E 72   1 ? 7  
HELX_P HELX_P121 121 LYS E 91   ? ASN E 104  ? LYS E 91   ASN E 104  1 ? 14 
HELX_P HELX_P122 122 LEU E 123  ? ILE E 127  ? LEU E 123  ILE E 127  5 ? 5  
HELX_P HELX_P123 123 GLU E 137  ? VAL E 141  ? GLU E 137  VAL E 141  1 ? 5  
HELX_P HELX_P124 124 ASN E 143  ? HIS E 147  ? ASN E 143  HIS E 147  5 ? 5  
HELX_P HELX_P125 125 ASP E 159  ? ARG E 167  ? ASP E 159  ARG E 167  1 ? 9  
HELX_P HELX_P126 126 LYS E 171  ? LEU E 175  ? LYS E 171  LEU E 175  5 ? 5  
HELX_P HELX_P127 127 ASP E 182  ? LEU E 188  ? ASP E 182  LEU E 188  1 ? 7  
HELX_P HELX_P128 128 THR F 86   ? MET F 103  ? THR F 86   MET F 103  1 ? 18 
HELX_P HELX_P129 129 ASP F 116  ? GLU F 127  ? ASP F 116  GLU F 127  1 ? 12 
HELX_P HELX_P130 130 ARG G 21   ? VAL G 34   ? ARG G 21   VAL G 34   1 ? 14 
HELX_P HELX_P131 131 HIS G 113  ? MET G 115  ? HIS G 113  MET G 115  5 ? 3  
HELX_P HELX_P132 132 GLN H 83   ? ARG H 87   ? GLN H 83   ARG H 87   5 ? 5  
HELX_P HELX_P133 133 ASP J 16   ? GLU J 27   ? ASP J 16   GLU J 27   1 ? 12 
HELX_P HELX_P134 134 ASP J 31   ? LEU J 39   ? ASP J 31   LEU J 39   1 ? 9  
HELX_P HELX_P135 135 ARG J 43   ? HIS J 53   ? ARG J 43   HIS J 53   1 ? 11 
HELX_P HELX_P136 136 ASP J 55   ? ARG J 62   ? ASP J 55   ARG J 62   1 ? 8  
HELX_P HELX_P137 137 ASP K 5    ? PHE K 10   ? ASP K 5    PHE K 10   5 ? 6  
HELX_P HELX_P138 138 ASP K 39   ? LEU K 51   ? ASP K 39   LEU K 51   1 ? 13 
HELX_P HELX_P139 139 ASP K 82   ? LEU K 111  ? ASP K 82   LEU K 111  1 ? 30 
HELX_P HELX_P140 140 LEU M 111  ? ASN M 125  ? LEU S 241  ASN S 255  1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? N ZN  .   ZN ? ? ? 1_555 A CYS 110  SG  ? ? A ZN  1734 A CYS 110  1_555 ? ? ? ? ? ? ? 2.715 ? 
metalc2  metalc ? ? N ZN  .   ZN ? ? ? 1_555 A CYS 148  SG  ? ? A ZN  1734 A CYS 148  1_555 ? ? ? ? ? ? ? 2.717 ? 
metalc3  metalc ? ? N ZN  .   ZN ? ? ? 1_555 A CYS 167  SG  ? ? A ZN  1734 A CYS 167  1_555 ? ? ? ? ? ? ? 2.625 ? 
metalc4  metalc ? ? N ZN  .   ZN ? ? ? 1_555 A CYS 107  SG  ? ? A ZN  1734 A CYS 107  1_555 ? ? ? ? ? ? ? 2.458 ? 
metalc5  metalc ? ? O ZN  .   ZN ? ? ? 1_555 A CYS 67   SG  ? ? A ZN  1735 A CYS 67   1_555 ? ? ? ? ? ? ? 2.293 ? 
metalc6  metalc ? ? O ZN  .   ZN ? ? ? 1_555 A CYS 70   SG  ? ? A ZN  1735 A CYS 70   1_555 ? ? ? ? ? ? ? 2.668 ? 
metalc7  metalc ? ? O ZN  .   ZN ? ? ? 1_555 A CYS 77   SG  ? ? A ZN  1735 A CYS 77   1_555 ? ? ? ? ? ? ? 2.374 ? 
metalc8  metalc ? ? O ZN  .   ZN ? ? ? 1_555 A HIS 80   NE2 ? ? A ZN  1735 A HIS 80   1_555 ? ? ? ? ? ? ? 2.410 ? 
metalc9  metalc ? ? P ZN  .   ZN ? ? ? 1_555 B CYS 1166 SG  ? ? B ZN  1307 B CYS 1166 1_555 ? ? ? ? ? ? ? 2.261 ? 
metalc10 metalc ? ? P ZN  .   ZN ? ? ? 1_555 B CYS 1182 SG  ? ? B ZN  1307 B CYS 1182 1_555 ? ? ? ? ? ? ? 2.562 ? 
metalc11 metalc ? ? P ZN  .   ZN ? ? ? 1_555 B CYS 1185 SG  ? ? B ZN  1307 B CYS 1185 1_555 ? ? ? ? ? ? ? 2.406 ? 
metalc12 metalc ? ? P ZN  .   ZN ? ? ? 1_555 B CYS 1163 SG  ? ? B ZN  1307 B CYS 1163 1_555 ? ? ? ? ? ? ? 2.299 ? 
metalc13 metalc ? ? Q ZN  .   ZN ? ? ? 1_555 C CYS 86   SG  ? ? C ZN  319  C CYS 86   1_555 ? ? ? ? ? ? ? 2.650 ? 
metalc14 metalc ? ? Q ZN  .   ZN ? ? ? 1_555 C CYS 88   SG  ? ? C ZN  319  C CYS 88   1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc15 metalc ? ? Q ZN  .   ZN ? ? ? 1_555 C CYS 92   SG  ? ? C ZN  319  C CYS 92   1_555 ? ? ? ? ? ? ? 2.542 ? 
metalc16 metalc ? ? Q ZN  .   ZN ? ? ? 1_555 C CYS 86   O   ? ? C ZN  319  C CYS 86   1_555 ? ? ? ? ? ? ? 2.688 ? 
metalc17 metalc ? ? R ZN  .   ZN ? ? ? 1_555 I CYS 29   SG  ? ? I ZN  203  I CYS 29   1_555 ? ? ? ? ? ? ? 2.703 ? 
metalc18 metalc ? ? R ZN  .   ZN ? ? ? 1_555 I CYS 32   SG  ? ? I ZN  203  I CYS 32   1_555 ? ? ? ? ? ? ? 2.060 ? 
metalc19 metalc ? ? R ZN  .   ZN ? ? ? 1_555 I CYS 7    SG  ? ? I ZN  203  I CYS 7    1_555 ? ? ? ? ? ? ? 2.177 ? 
metalc20 metalc ? ? S ZN  .   ZN ? ? ? 1_555 I CYS 106  SG  ? ? I ZN  204  I CYS 106  1_555 ? ? ? ? ? ? ? 2.647 ? 
metalc21 metalc ? ? S ZN  .   ZN ? ? ? 1_555 I CYS 103  SG  ? ? I ZN  204  I CYS 103  1_555 ? ? ? ? ? ? ? 2.603 ? 
metalc22 metalc ? ? T ZN  .   ZN ? ? ? 1_555 J CYS 7    SG  ? ? J ZN  101  J CYS 7    1_555 ? ? ? ? ? ? ? 2.376 ? 
metalc23 metalc ? ? T ZN  .   ZN ? ? ? 1_555 J CYS 46   SG  ? ? J ZN  101  J CYS 46   1_555 ? ? ? ? ? ? ? 2.553 ? 
metalc24 metalc ? ? T ZN  .   ZN ? ? ? 1_555 J CYS 10   SG  ? ? J ZN  101  J CYS 10   1_555 ? ? ? ? ? ? ? 2.278 ? 
metalc25 metalc ? ? T ZN  .   ZN ? ? ? 1_555 J CYS 45   SG  ? ? J ZN  101  J CYS 45   1_555 ? ? ? ? ? ? ? 2.689 ? 
metalc26 metalc ? ? U ZN  .   ZN ? ? ? 1_555 L CYS 51   O   ? ? L ZN  105  L CYS 51   1_555 ? ? ? ? ? ? ? 2.455 ? 
metalc27 metalc ? ? U ZN  .   ZN ? ? ? 1_555 L CYS 31   SG  ? ? L ZN  105  L CYS 31   1_555 ? ? ? ? ? ? ? 2.515 ? 
metalc28 metalc ? ? U ZN  .   ZN ? ? ? 1_555 L CYS 34   SG  ? ? L ZN  105  L CYS 34   1_555 ? ? ? ? ? ? ? 2.356 ? 
metalc29 metalc ? ? U ZN  .   ZN ? ? ? 1_555 L CYS 51   SG  ? ? L ZN  105  L CYS 51   1_555 ? ? ? ? ? ? ? 2.475 ? 
metalc30 metalc ? ? V MG  .   MG ? ? ? 1_555 M ASP 160  OD2 ? ? S MG  1    S ASP 290  1_555 ? ? ? ? ? ? ? 3.059 ? 
metalc31 metalc ? ? W ZN  .   ZN ? ? ? 1_555 M CYS 144  SG  ? ? S ZN  310  S CYS 274  1_555 ? ? ? ? ? ? ? 2.185 ? 
metalc32 metalc ? ? I CYS 10  SG ? ? ? 1_555 R ZN  .    ZN  ? ? I CYS 10   I ZN  203  1_555 ? ? ? ? ? ? ? 2.901 ? 
metalc33 metalc ? ? I CYS 75  SG ? ? ? 1_555 S ZN  .    ZN  ? ? I CYS 75   I ZN  204  1_555 ? ? ? ? ? ? ? 2.914 ? 
metalc34 metalc ? ? I CYS 78  SG ? ? ? 1_555 S ZN  .    ZN  ? ? I CYS 78   I ZN  204  1_555 ? ? ? ? ? ? ? 2.897 ? 
metalc35 metalc ? ? L CYS 48  SG ? ? ? 1_555 U ZN  .    ZN  ? ? L CYS 48   L ZN  105  1_555 ? ? ? ? ? ? ? 2.918 ? 
metalc36 metalc ? ? M CYS 141 SG ? ? ? 1_555 W ZN  .    ZN  ? ? S CYS 271  S ZN  310  1_555 ? ? ? ? ? ? ? 2.947 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLN 447 A . ? GLN 447 A PRO 448 A ? PRO 448 A 1 -0.57 
2 PRO 128 E . ? PRO 128 E PRO 129 E ? PRO 129 E 1 0.94  
3 ASN 126 G . ? ASN 126 G PRO 127 G ? PRO 127 G 1 -0.27 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 2 ? 
B  ? 2 ? 
C  ? 2 ? 
D  ? 3 ? 
E  ? 2 ? 
F  ? 8 ? 
G  ? 2 ? 
H  ? 2 ? 
I  ? 2 ? 
J  ? 2 ? 
K  ? 3 ? 
L  ? 6 ? 
M  ? 4 ? 
N  ? 2 ? 
O  ? 2 ? 
P  ? 3 ? 
Q  ? 2 ? 
R  ? 2 ? 
S  ? 2 ? 
T  ? 6 ? 
U  ? 3 ? 
V  ? 2 ? 
W  ? 4 ? 
X  ? 5 ? 
Y  ? 2 ? 
Z  ? 4 ? 
AA ? 4 ? 
AB ? 4 ? 
AC ? 3 ? 
AD ? 2 ? 
AE ? 2 ? 
AF ? 2 ? 
AG ? 3 ? 
AH ? 5 ? 
AI ? 2 ? 
AJ ? 2 ? 
AK ? 5 ? 
AL ? 4 ? 
AM ? 2 ? 
AN ? 2 ? 
AO ? 7 ? 
AP ? 3 ? 
AQ ? 7 ? 
AR ? 3 ? 
AS ? 4 ? 
AT ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
B  1 2 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
E  1 2 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
F  4 5 ? anti-parallel 
F  5 6 ? parallel      
F  6 7 ? anti-parallel 
F  7 8 ? parallel      
G  1 2 ? anti-parallel 
H  1 2 ? anti-parallel 
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? parallel      
L  3 4 ? anti-parallel 
L  4 5 ? parallel      
L  5 6 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
M  3 4 ? anti-parallel 
N  1 2 ? anti-parallel 
O  1 2 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
Q  1 2 ? anti-parallel 
R  1 2 ? anti-parallel 
S  1 2 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
T  3 4 ? anti-parallel 
T  4 5 ? anti-parallel 
T  5 6 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
V  1 2 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? parallel      
W  3 4 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
X  4 5 ? anti-parallel 
Y  1 2 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? parallel      
Z  3 4 ? anti-parallel 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? parallel      
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AD 1 2 ? parallel      
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AH 3 4 ? anti-parallel 
AH 4 5 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AK 3 4 ? anti-parallel 
AK 4 5 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? parallel      
AL 3 4 ? parallel      
AM 1 2 ? parallel      
AN 1 2 ? anti-parallel 
AO 1 2 ? anti-parallel 
AO 2 3 ? parallel      
AO 3 4 ? anti-parallel 
AO 4 5 ? anti-parallel 
AO 5 6 ? anti-parallel 
AO 6 7 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AQ 3 4 ? anti-parallel 
AQ 4 5 ? anti-parallel 
AQ 5 6 ? anti-parallel 
AQ 6 7 ? anti-parallel 
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AS 1 2 ? anti-parallel 
AS 2 3 ? anti-parallel 
AS 3 4 ? anti-parallel 
AT 1 2 ? anti-parallel 
AT 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 GLU A 16   ? LEU A 21   ? GLU A 16   LEU A 21   
A  2 ILE B 1212 ? TYR B 1217 ? ILE B 1212 TYR B 1217 
B  1 ASP A 85   ? VAL A 90   ? ASP A 85   VAL A 90   
B  2 LEU A 236  ? CYS A 238  ? LEU A 236  CYS A 238  
C  1 ASP A 151  ? PRO A 153  ? ASP A 151  PRO A 153  
C  2 LEU A 161  ? SER A 163  ? LEU A 161  SER A 163  
D  1 THR A 173  ? ASP A 177  ? THR A 173  ASP A 177  
D  2 LYS A 180  ? SER A 184  ? LYS A 180  SER A 184  
D  3 ARG A 200  ? LEU A 202  ? ARG A 200  LEU A 202  
E  1 LYS A 343  ? VAL A 345  ? LYS A 343  VAL A 345  
E  2 LEU B 1128 ? PHE B 1130 ? LEU B 1128 PHE B 1130 
F  1 HIS B 1104 ? ARG B 1106 ? HIS B 1104 ARG B 1106 
F  2 SER A 348  ? GLY A 355  ? SER A 348  GLY A 355  
F  3 GLU A 486  ? HIS A 490  ? GLU A 486  HIS A 490  
F  4 PRO A 441  ? ASN A 445  ? PRO A 441  ASN A 445  
F  5 MET A 455  ? ILE A 463  ? MET A 455  ILE A 463  
F  6 GLN A 363  ? PRO A 367  ? GLN A 363  PRO A 367  
F  7 PHE A 468  ? LEU A 470  ? PHE A 468  LEU A 470  
F  8 SER A 348  ? GLY A 355  ? SER A 348  GLY A 355  
G  1 THR A 375  ? VAL A 379  ? THR A 375  VAL A 379  
G  2 LYS A 431  ? HIS A 435  ? LYS A 431  HIS A 435  
H  1 VAL A 405  ? ARG A 407  ? VAL A 405  ARG A 407  
H  2 ASP A 411  ? ILE A 413  ? ASP A 411  ILE A 413  
I  1 VAL A 512  ? SER A 513  ? VAL A 512  SER A 513  
I  2 LYS A 518  ? PRO A 519  ? LYS A 518  PRO A 519  
J  1 PHE A 540  ? GLU A 542  ? PHE A 540  GLU A 542  
J  2 LEU A 571  ? SER A 573  ? LEU A 571  SER A 573  
K  1 HIS A 587  ? GLN A 589  ? HIS A 587  GLN A 589  
K  2 LEU A 606  ? ILE A 608  ? LEU A 606  ILE A 608  
K  3 GLN A 611  ? PHE A 614  ? GLN A 611  PHE A 614  
L  1 PHE A 662  ? SER A 663  ? PHE A 662  SER A 663  
L  2 GLY B 820  ? CYS B 829  ? GLY B 820  CYS B 829  
L  3 LEU B 1010 ? ILE B 1012 ? LEU B 1010 ILE B 1012 
L  4 SER B 838  ? MET B 841  ? SER B 838  MET B 841  
L  5 GLY B 988  ? ILE B 990  ? GLY B 988  ILE B 990  
L  6 LYS B 979  ? PHE B 980  ? LYS B 979  PHE B 980  
M  1 PHE A 662  ? SER A 663  ? PHE A 662  SER A 663  
M  2 GLY B 820  ? CYS B 829  ? GLY B 820  CYS B 829  
M  3 ILE B 1085 ? GLN B 1093 ? ILE B 1085 GLN B 1093 
M  4 PHE B 1069 ? GLU B 1070 ? PHE B 1069 GLU B 1070 
N  1 GLY A 766  ? GLN A 767  ? GLY A 766  GLN A 767  
N  2 PHE A 799  ? VAL A 800  ? PHE A 799  VAL A 800  
O  1 GLU A 879  ? SER A 882  ? GLU A 879  SER A 882  
O  2 ASN A 953  ? LEU A 956  ? ASN A 953  LEU A 956  
P  1 THR A 1117 ? TYR A 1119 ? THR A 1117 TYR A 1119 
P  2 GLU A 1303 ? GLU A 1307 ? GLU A 1303 GLU A 1307 
P  3 VAL A 1283 ? TYR A 1287 ? VAL A 1283 TYR A 1287 
Q  1 GLU A 1151 ? TYR A 1154 ? GLU A 1151 TYR A 1154 
Q  2 TRP A 1191 ? ARG A 1194 ? TRP A 1191 ARG A 1194 
R  1 PHE A 1225 ? VAL A 1226 ? PHE A 1225 VAL A 1226 
R  2 CYS A 1240 ? ARG A 1241 ? CYS A 1240 ARG A 1241 
S  1 LYS A 1290 ? PRO A 1292 ? LYS A 1290 PRO A 1292 
S  2 TYR A 1298 ? LYS A 1300 ? TYR A 1298 LYS A 1300 
T  1 PHE F 143  ? SER F 147  ? PHE F 143  SER F 147  
T  2 LEU F 132  ? TYR F 137  ? LEU F 132  TYR F 137  
T  3 ASP A 1442 ? ILE A 1445 ? ASP A 1442 ILE A 1445 
T  4 GLY G 59   ? ILE G 61   ? GLY G 59   ILE G 61   
T  5 ALA G 68   ? ASN G 71   ? ALA G 68   ASN G 71   
T  6 ASN G 10   ? LEU G 13   ? ASN G 10   LEU G 13   
U  1 SER B 91   ? VAL B 97   ? SER B 91   VAL B 97   
U  2 GLY B 127  ? LYS B 133  ? GLY B 127  LYS B 133  
U  3 PHE B 166  ? ARG B 169  ? PHE B 166  ARG B 169  
V  1 LYS B 210  ? VAL B 211  ? LYS B 210  VAL B 211  
V  2 GLN B 481  ? VAL B 482  ? GLN B 481  VAL B 482  
W  1 LYS B 404  ? ASP B 407  ? LYS B 404  ASP B 407  
W  2 ALA B 214  ? SER B 218  ? ALA B 214  SER B 218  
W  3 ARG B 497  ? ASN B 499  ? ARG B 497  ASN B 499  
W  4 LYS B 537  ? ASN B 538  ? LYS B 537  ASN B 538  
X  1 VAL B 223  ? LYS B 227  ? VAL B 223  LYS B 227  
X  2 HIS B 236  ? SER B 242  ? HIS B 236  SER B 242  
X  3 SER B 252  ? VAL B 256  ? SER B 252  VAL B 256  
X  4 LYS B 270  ? THR B 272  ? LYS B 270  THR B 272  
X  5 ILE B 280  ? PRO B 281  ? ILE B 280  PRO B 281  
Y  1 CYS B 544  ? ILE B 545  ? CYS B 544  ILE B 545  
Y  2 VAL B 633  ? TYR B 634  ? VAL B 633  TYR B 634  
Z  1 VAL B 585  ? TRP B 586  ? VAL B 585  TRP B 586  
Z  2 VAL B 580  ? VAL B 582  ? VAL B 580  VAL B 582  
Z  3 GLU B 623  ? PHE B 627  ? GLU B 623  PHE B 627  
Z  4 SER B 614  ? ASP B 618  ? SER B 614  ASP B 618  
AA 1 VAL B 690  ? GLU B 691  ? VAL B 690  GLU B 691  
AA 2 LEU B 637  ? ILE B 639  ? LEU B 637  ILE B 639  
AA 3 HIS B 740  ? CYS B 741  ? HIS B 740  CYS B 741  
AA 4 ILE B 703  ? ALA B 704  ? ILE B 703  ALA B 704  
AB 1 ASN B 794  ? LEU B 796  ? ASN B 794  LEU B 796  
AB 2 SER B 853  ? PHE B 856  ? SER B 853  PHE B 856  
AB 3 LEU B 961  ? LYS B 972  ? LEU B 961  LYS B 972  
AB 4 ILE B 948  ? GLN B 951  ? ILE B 948  GLN B 951  
AC 1 TYR B 859  ? GLN B 862  ? TYR B 859  GLN B 862  
AC 2 LEU B 961  ? LYS B 972  ? LEU B 961  LYS B 972  
AC 3 VAL B 954  ? ASN B 957  ? VAL B 954  ASN B 957  
AD 1 GLY B 804  ? THR B 805  ? GLY B 804  THR B 805  
AD 2 GLY B 1042 ? ASP B 1043 ? GLY B 1042 ASP B 1043 
AE 1 THR B 915  ? THR B 916  ? THR B 915  THR B 916  
AE 2 ARG B 935  ? ASP B 936  ? ARG B 935  ASP B 936  
AF 1 ARG B 1159 ? CYS B 1163 ? ARG B 1159 CYS B 1163 
AF 2 ILE B 1191 ? HIS B 1195 ? ILE B 1191 HIS B 1195 
AG 1 ASN C 17   ? LEU C 22   ? ASN C 17   LEU C 22   
AG 2 PHE C 228  ? GLU C 233  ? PHE C 228  GLU C 233  
AG 3 ILE C 176  ? GLU C 177  ? ILE C 176  GLU C 177  
AH 1 VAL C 119  ? ILE C 120  ? VAL C 119  ILE C 120  
AH 2 LEU C 99   ? ALA C 103  ? LEU C 99   ALA C 103  
AH 3 LEU C 153  ? LYS C 160  ? LEU C 153  LYS C 160  
AH 4 ALA C 45   ? ASN C 54   ? ALA C 45   ASN C 54   
AH 5 VAL L 65   ? PHE L 67   ? VAL L 65   PHE L 67   
AI 1 VAL C 113  ? TYR C 114  ? VAL C 113  TYR C 114  
AI 2 LEU C 143  ? CYS C 145  ? LEU C 143  CYS C 145  
AJ 1 GLN D 37   ? ILE D 38   ? GLN D 37   ILE D 38   
AJ 2 GLU D 44   ? GLU D 45   ? GLU D 44   GLU D 45   
AK 1 ALA D 49   ? LEU D 50   ? ALA D 49   LEU D 50   
AK 2 PHE G 2    ? LEU G 7    ? PHE G 2    LEU G 7    
AK 3 TYR G 74   ? PHE G 79   ? TYR G 74   PHE G 79   
AK 4 GLY G 43   ? VAL G 48   ? GLY G 43   VAL G 48   
AK 5 SER G 37   ? THR G 39   ? SER G 37   THR G 39   
AL 1 PHE E 60   ? ALA E 62   ? PHE E 60   ALA E 62   
AL 2 LEU E 78   ? PHE E 82   ? LEU E 78   PHE E 82   
AL 3 THR E 107  ? TYR E 112  ? THR E 107  TYR E 112  
AL 4 THR E 131  ? ASN E 136  ? THR E 131  ASN E 136  
AM 1 ARG E 177  ? ILE E 178  ? ARG E 177  ILE E 178  
AM 2 ILE E 213  ? CYS E 214  ? ILE E 213  CYS E 214  
AN 1 ARG E 200  ? LYS E 201  ? ARG E 200  LYS E 201  
AN 2 ARG E 207  ? TYR E 208  ? ARG E 207  TYR E 208  
AO 1 GLY G 149  ? GLN G 153  ? GLY G 149  GLN G 153  
AO 2 SER G 156  ? ILE G 160  ? SER G 156  ILE G 160  
AO 3 MET G 106  ? THR G 111  ? MET G 106  THR G 111  
AO 4 GLY G 98   ? VAL G 103  ? GLY G 98   VAL G 103  
AO 5 VAL G 86   ? SER G 95   ? VAL G 86   SER G 95   
AO 6 ARG G 142  ? LYS G 146  ? ARG G 142  LYS G 146  
AO 7 GLY G 169  ? ALA G 170  ? GLY G 169  ALA G 170  
AP 1 LEU G 119  ? ASN G 122  ? LEU G 119  ASN G 122  
AP 2 SER G 129  ? SER G 132  ? SER G 129  SER G 132  
AP 3 VAL G 136  ? ILE G 137  ? VAL G 136  ILE G 137  
AQ 1 SER H 54   ? THR H 58   ? SER H 54   THR H 58   
AQ 2 ASP H 7    ? ASP H 16   ? ASP H 7    ASP H 16   
AQ 3 VAL H 23   ? SER H 30   ? VAL H 23   SER H 30   
AQ 4 LYS H 37   ? ASN H 43   ? LYS H 37   ASN H 43   
AQ 5 LEU H 121  ? GLY H 127  ? LEU H 121  GLY H 127  
AQ 6 ILE H 112  ? PHE H 118  ? ILE H 112  PHE H 118  
AQ 7 THR H 100  ? GLU H 106  ? THR H 100  GLU H 106  
AR 1 ARG I 17   ? ASP I 19   ? ARG I 17   ASP I 19   
AR 2 ARG I 24   ? GLU I 28   ? ARG I 24   GLU I 28   
AR 3 VAL I 35   ? GLU I 37   ? VAL I 35   GLU I 37   
AS 1 ILE K 21   ? PRO K 23   ? ILE K 21   PRO K 23   
AS 2 ALA K 30   ? GLU K 36   ? ALA K 30   GLU K 36   
AS 3 ARG K 70   ? THR K 77   ? ARG K 70   THR K 77   
AS 4 VAL K 56   ? LYS K 62   ? VAL K 56   LYS K 62   
AT 1 VAL M 149  ? TYR M 152  ? VAL S 279  TYR S 282  
AT 2 PHE M 166  ? CYS M 169  ? PHE S 296  CYS S 299  
AT 3 ARG M 175  ? LYS M 177  ? ARG S 305  LYS S 307  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N GLU A 16   ? N GLU A 16   O TYR B 1217 ? O TYR B 1217 
B  1 2 N VAL A 90   ? N VAL A 90   O LEU A 236  ? O LEU A 236  
C  1 2 N VAL A 152  ? N VAL A 152  O VAL A 162  ? O VAL A 162  
D  1 2 N ARG A 175  ? N ARG A 175  O VAL A 182  ? O VAL A 182  
D  2 3 N LEU A 181  ? N LEU A 181  O LEU A 202  ? O LEU A 202  
E  1 2 N LYS A 343  ? N LYS A 343  O PHE B 1130 ? O PHE B 1130 
F  1 2 O ARG B 1106 ? O ARG B 1106 N SER A 348  ? N SER A 348  
F  2 3 N ALA A 349  ? N ALA A 349  O LEU A 489  ? O LEU A 489  
F  3 4 O ASN A 488  ? O ASN A 488  N ASN A 445  ? N ASN A 445  
F  4 5 N VAL A 442  ? N VAL A 442  O HIS A 458  ? O HIS A 458  
F  5 6 O ILE A 463  ? O ILE A 463  N VAL A 366  ? N VAL A 366  
F  6 7 N GLY A 365  ? N GLY A 365  O ARG A 469  ? O ARG A 469  
F  7 8 O LEU A 470  ? O LEU A 470  N SER A 354  ? N SER A 354  
G  1 2 N GLU A 378  ? N GLU A 378  O VAL A 432  ? O VAL A 432  
H  1 2 N ARG A 407  ? N ARG A 407  O ASP A 411  ? O ASP A 411  
I  1 2 N SER A 513  ? N SER A 513  O LYS A 518  ? O LYS A 518  
J  1 2 N ILE A 541  ? N ILE A 541  O TRP A 572  ? O TRP A 572  
K  1 2 N LEU A 588  ? N LEU A 588  O ILE A 607  ? O ILE A 607  
K  2 3 N LEU A 606  ? N LEU A 606  O ILE A 613  ? O ILE A 613  
L  1 2 N PHE A 662  ? N PHE A 662  O CYS B 829  ? O CYS B 829  
L  2 3 N ALA B 826  ? N ALA B 826  O LEU B 1010 ? O LEU B 1010 
L  3 4 O ILE B 1011 ? O ILE B 1011 N ILE B 840  ? N ILE B 840  
L  4 5 N MET B 839  ? N MET B 839  O THR B 989  ? O THR B 989  
L  5 6 O GLY B 988  ? O GLY B 988  N PHE B 980  ? N PHE B 980  
M  1 2 N PHE A 662  ? N PHE A 662  O CYS B 829  ? O CYS B 829  
M  2 3 N VAL B 825  ? N VAL B 825  O GLY B 1088 ? O GLY B 1088 
M  3 4 O ILE B 1085 ? O ILE B 1085 N GLU B 1070 ? N GLU B 1070 
N  1 2 N GLY A 766  ? N GLY A 766  O VAL A 800  ? O VAL A 800  
O  1 2 N GLN A 881  ? N GLN A 881  O TRP A 954  ? O TRP A 954  
P  1 2 N VAL A 1118 ? N VAL A 1118 O LEU A 1306 ? O LEU A 1306 
P  2 3 O VAL A 1305 ? O VAL A 1305 N MET A 1285 ? N MET A 1285 
Q  1 2 N GLU A 1151 ? N GLU A 1151 O ARG A 1194 ? O ARG A 1194 
R  1 2 N PHE A 1225 ? N PHE A 1225 O ARG A 1241 ? O ARG A 1241 
S  1 2 N VAL A 1291 ? N VAL A 1291 O VAL A 1299 ? O VAL A 1299 
T  1 2 O TRP F 146  ? O TRP F 146  N ILE F 134  ? N ILE F 134  
T  2 3 O ARG F 135  ? O ARG F 135  N ASP A 1442 ? N ASP A 1442 
T  3 4 N VAL A 1443 ? N VAL A 1443 O ILE G 61   ? O ILE G 61   
T  4 5 N ARG G 60   ? N ARG G 60   O GLU G 69   ? O GLU G 69   
T  5 6 O ALA G 68   ? O ALA G 68   N LEU G 13   ? N LEU G 13   
U  1 2 N TYR B 96   ? N TYR B 96   O PHE B 129  ? O PHE B 129  
U  2 3 N LEU B 128  ? N LEU B 128  O ILE B 167  ? O ILE B 167  
V  1 2 N VAL B 211  ? N VAL B 211  O GLN B 481  ? O GLN B 481  
W  1 2 O ARG B 405  ? O ARG B 405  N ARG B 217  ? N ARG B 217  
W  2 3 N ALA B 214  ? N ALA B 214  O ASN B 499  ? O ASN B 499  
W  3 4 N THR B 498  ? N THR B 498  O LYS B 537  ? O LYS B 537  
X  1 2 N PHE B 226  ? N PHE B 226  O VAL B 237  ? O VAL B 237  
X  2 3 N ALA B 238  ? N ALA B 238  O VAL B 256  ? O VAL B 256  
X  3 4 N GLN B 255  ? N GLN B 255  O THR B 272  ? O THR B 272  
X  4 5 N ALA B 271  ? N ALA B 271  O ILE B 280  ? O ILE B 280  
Y  1 2 N CYS B 544  ? N CYS B 544  O TYR B 634  ? O TYR B 634  
Z  1 2 O VAL B 585  ? O VAL B 585  N VAL B 582  ? N VAL B 582  
Z  2 3 N PHE B 581  ? N PHE B 581  O LEU B 624  ? O LEU B 624  
Z  3 4 O PHE B 627  ? O PHE B 627  N SER B 614  ? N SER B 614  
AA 1 2 O GLU B 691  ? O GLU B 691  N LEU B 637  ? N LEU B 637  
AA 2 3 N PHE B 638  ? N PHE B 638  O CYS B 741  ? O CYS B 741  
AA 3 4 O HIS B 740  ? O HIS B 740  N ALA B 704  ? N ALA B 704  
AB 1 2 N ILE B 795  ? N ILE B 795  O LEU B 854  ? O LEU B 854  
AB 2 3 N SER B 853  ? N SER B 853  O LYS B 972  ? O LYS B 972  
AB 3 4 O ARG B 969  ? O ARG B 969  N ILE B 948  ? N ILE B 948  
AC 1 2 N ASP B 861  ? N ASP B 861  O VAL B 964  ? O VAL B 964  
AC 2 3 O PHE B 963  ? O PHE B 963  N THR B 955  ? N THR B 955  
AD 1 2 N THR B 805  ? N THR B 805  O GLY B 1042 ? O GLY B 1042 
AE 1 2 N THR B 916  ? N THR B 916  O ARG B 935  ? O ARG B 935  
AF 1 2 N VAL B 1160 ? N VAL B 1160 O ILE B 1194 ? O ILE B 1194 
AG 1 2 N PHE C 20   ? N PHE C 20   O MET C 230  ? O MET C 230  
AG 2 3 O ASN C 231  ? O ASN C 231  N GLU C 177  ? N GLU C 177  
AH 1 2 O VAL C 119  ? O VAL C 119  N THR C 100  ? N THR C 100  
AH 2 3 N LEU C 99   ? N LEU C 99   O CYS C 157  ? O CYS C 157  
AH 3 4 O LYS C 154  ? O LYS C 154  N THR C 53   ? N THR C 53   
AH 4 5 N VAL C 51   ? N VAL C 51   O VAL L 65   ? O VAL L 65   
AI 1 2 N VAL C 113  ? N VAL C 113  O CYS C 145  ? O CYS C 145  
AJ 1 2 N GLN D 37   ? N GLN D 37   O GLU D 45   ? O GLU D 45   
AK 1 2 N LEU D 50   ? N LEU D 50   O PHE G 2    ? O PHE G 2    
AK 2 3 N PHE G 3    ? N PHE G 3    O VAL G 78   ? O VAL G 78   
AK 3 4 O PHE G 79   ? O PHE G 79   N TYR G 44   ? N TYR G 44   
AK 4 5 O GLY G 43   ? O GLY G 43   N THR G 39   ? N THR G 39   
AL 1 2 N PHE E 60   ? N PHE E 60   O VAL E 80   ? O VAL E 80   
AL 2 3 N TRP E 79   ? N TRP E 79   O ILE E 109  ? O ILE E 109  
AL 3 4 N GLY E 108  ? N GLY E 108  O GLU E 133  ? O GLU E 133  
AM 1 2 N ILE E 178  ? N ILE E 178  O ILE E 213  ? O ILE E 213  
AN 1 2 N ARG E 200  ? N ARG E 200  O TYR E 208  ? O TYR E 208  
AO 1 2 N GLN G 153  ? N GLN G 153  O SER G 156  ? O SER G 156  
AO 2 3 O ALA G 159  ? O ALA G 159  N PHE G 109  ? N PHE G 109  
AO 3 4 O VAL G 108  ? O VAL G 108  N VAL G 101  ? N VAL G 101  
AO 4 5 O GLN G 102  ? O GLN G 102  N THR G 90   ? N THR G 90   
AO 5 6 N VAL G 87   ? N VAL G 87   O VAL G 145  ? O VAL G 145  
AO 6 7 N ARG G 144  ? N ARG G 144  O GLY G 169  ? O GLY G 169  
AP 1 2 N ASN G 122  ? N ASN G 122  O SER G 129  ? O SER G 129  
AP 2 3 N TYR G 130  ? N TYR G 130  O ILE G 137  ? O ILE G 137  
AQ 1 2 O VAL H 57   ? O VAL H 57   N ASP H 8    ? N ASP H 8    
AQ 2 3 N GLN H 11   ? N GLN H 11   O ALA H 29   ? O ALA H 29   
AQ 3 4 N ILE H 26   ? N ILE H 26   O LEU H 40   ? O LEU H 40   
AQ 4 5 N THR H 39   ? N THR H 39   O ARG H 124  ? O ARG H 124  
AQ 5 6 O LEU H 121  ? O LEU H 121  N PHE H 118  ? N PHE H 118  
AQ 6 7 O SER H 117  ? O SER H 117  N THR H 100  ? N THR H 100  
AR 1 2 N ARG I 17   ? N ARG I 17   O LEU I 26   ? O LEU I 26   
AR 2 3 N PHE I 27   ? N PHE I 27   O GLU I 36   ? O GLU I 36   
AS 1 2 N ASP K 22   ? N ASP K 22   O VAL K 32   ? O VAL K 32   
AS 2 3 N VAL K 31   ? N VAL K 31   O ILE K 75   ? O ILE K 75   
AS 3 4 O ARG K 74   ? O ARG K 74   N ALA K 60   ? N ALA K 60   
AT 1 2 N SER M 150  ? N SER S 280  O THR M 168  ? O THR S 298  
AT 2 3 N CYS M 167  ? N CYS S 297  O TRP M 176  ? O TRP S 306  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MG S 1'    
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN A 1734' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1735' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 1307' 
AC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN C 319'  
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN I 203'  
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN I 204'  
AC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN J 101'  
AC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN L 105'  
BC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN S 310'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 1 ASP M 160  ? ASP S 290  . ? 1_555 ? 
2  AC2 5 CYS A 107  ? CYS A 107  . ? 1_555 ? 
3  AC2 5 CYS A 110  ? CYS A 110  . ? 1_555 ? 
4  AC2 5 CYS A 148  ? CYS A 148  . ? 1_555 ? 
5  AC2 5 GLY A 166  ? GLY A 166  . ? 1_555 ? 
6  AC2 5 CYS A 167  ? CYS A 167  . ? 1_555 ? 
7  AC3 4 CYS A 67   ? CYS A 67   . ? 1_555 ? 
8  AC3 4 CYS A 70   ? CYS A 70   . ? 1_555 ? 
9  AC3 4 CYS A 77   ? CYS A 77   . ? 1_555 ? 
10 AC3 4 HIS A 80   ? HIS A 80   . ? 1_555 ? 
11 AC4 4 CYS B 1163 ? CYS B 1163 . ? 1_555 ? 
12 AC4 4 CYS B 1166 ? CYS B 1166 . ? 1_555 ? 
13 AC4 4 CYS B 1182 ? CYS B 1182 . ? 1_555 ? 
14 AC4 4 CYS B 1185 ? CYS B 1185 . ? 1_555 ? 
15 AC5 5 CYS C 86   ? CYS C 86   . ? 1_555 ? 
16 AC5 5 CYS C 88   ? CYS C 88   . ? 1_555 ? 
17 AC5 5 HIS C 91   ? HIS C 91   . ? 1_555 ? 
18 AC5 5 CYS C 92   ? CYS C 92   . ? 1_555 ? 
19 AC5 5 CYS C 95   ? CYS C 95   . ? 1_555 ? 
20 AC6 4 CYS I 7    ? CYS I 7    . ? 1_555 ? 
21 AC6 4 CYS I 10   ? CYS I 10   . ? 1_555 ? 
22 AC6 4 CYS I 29   ? CYS I 29   . ? 1_555 ? 
23 AC6 4 CYS I 32   ? CYS I 32   . ? 1_555 ? 
24 AC7 4 CYS I 75   ? CYS I 75   . ? 1_555 ? 
25 AC7 4 CYS I 78   ? CYS I 78   . ? 1_555 ? 
26 AC7 4 CYS I 103  ? CYS I 103  . ? 1_555 ? 
27 AC7 4 CYS I 106  ? CYS I 106  . ? 1_555 ? 
28 AC8 5 CYS J 7    ? CYS J 7    . ? 1_555 ? 
29 AC8 5 SER J 9    ? SER J 9    . ? 1_555 ? 
30 AC8 5 CYS J 10   ? CYS J 10   . ? 1_555 ? 
31 AC8 5 CYS J 45   ? CYS J 45   . ? 1_555 ? 
32 AC8 5 CYS J 46   ? CYS J 46   . ? 1_555 ? 
33 AC9 4 CYS L 31   ? CYS L 31   . ? 1_555 ? 
34 AC9 4 CYS L 34   ? CYS L 34   . ? 1_555 ? 
35 AC9 4 CYS L 48   ? CYS L 48   . ? 1_555 ? 
36 AC9 4 CYS L 51   ? CYS L 51   . ? 1_555 ? 
37 BC1 4 CYS M 141  ? CYS S 271  . ? 1_555 ? 
38 BC1 4 CYS M 144  ? CYS S 274  . ? 1_555 ? 
39 BC1 4 CYS M 169  ? CYS S 299  . ? 1_555 ? 
40 BC1 4 CYS M 172  ? CYS S 302  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1Y1V 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1Y1V 
_atom_sites.fract_transf_matrix[1][1]   0.004568 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.002530 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003559 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . VAL A 1  2    ? 112.724 27.079  -25.628 1.00 115.39 ? 2    VAL A N   1 
ATOM   2     C  CA  . VAL A 1  2    ? 111.308 27.423  -25.299 1.00 117.16 ? 2    VAL A CA  1 
ATOM   3     C  C   . VAL A 1  2    ? 110.369 27.170  -26.483 1.00 117.90 ? 2    VAL A C   1 
ATOM   4     O  O   . VAL A 1  2    ? 110.683 27.532  -27.615 1.00 120.75 ? 2    VAL A O   1 
ATOM   5     C  CB  . VAL A 1  2    ? 111.193 28.900  -24.864 1.00 116.78 ? 2    VAL A CB  1 
ATOM   6     C  CG1 . VAL A 1  2    ? 112.247 29.737  -25.573 1.00 115.32 ? 2    VAL A CG1 1 
ATOM   7     C  CG2 . VAL A 1  2    ? 109.798 29.426  -25.179 1.00 116.54 ? 2    VAL A CG2 1 
ATOM   8     N  N   . GLY A 1  3    ? 109.215 26.560  -26.212 1.00 117.63 ? 3    GLY A N   1 
ATOM   9     C  CA  . GLY A 1  3    ? 108.260 26.252  -27.267 1.00 113.54 ? 3    GLY A CA  1 
ATOM   10    C  C   . GLY A 1  3    ? 108.472 24.838  -27.793 1.00 111.57 ? 3    GLY A C   1 
ATOM   11    O  O   . GLY A 1  3    ? 107.690 24.343  -28.609 1.00 111.19 ? 3    GLY A O   1 
ATOM   12    N  N   . GLN A 1  4    ? 109.532 24.192  -27.301 1.00 108.02 ? 4    GLN A N   1 
ATOM   13    C  CA  . GLN A 1  4    ? 109.923 22.839  -27.690 1.00 104.71 ? 4    GLN A CA  1 
ATOM   14    C  C   . GLN A 1  4    ? 109.920 22.605  -29.206 1.00 101.39 ? 4    GLN A C   1 
ATOM   15    O  O   . GLN A 1  4    ? 109.252 23.312  -29.959 1.00 99.52  ? 4    GLN A O   1 
ATOM   16    C  CB  . GLN A 1  4    ? 109.050 21.790  -26.971 1.00 107.18 ? 4    GLN A CB  1 
ATOM   17    C  CG  . GLN A 1  4    ? 109.429 21.567  -25.492 1.00 108.75 ? 4    GLN A CG  1 
ATOM   18    C  CD  . GLN A 1  4    ? 108.825 20.298  -24.883 1.00 109.75 ? 4    GLN A CD  1 
ATOM   19    O  OE1 . GLN A 1  4    ? 108.975 19.197  -25.422 1.00 110.32 ? 4    GLN A OE1 1 
ATOM   20    N  NE2 . GLN A 1  4    ? 108.153 20.450  -23.747 1.00 108.98 ? 4    GLN A NE2 1 
ATOM   21    N  N   . GLN A 1  5    ? 110.691 21.610  -29.638 1.00 98.06  ? 5    GLN A N   1 
ATOM   22    C  CA  . GLN A 1  5    ? 110.828 21.247  -31.048 1.00 93.13  ? 5    GLN A CA  1 
ATOM   23    C  C   . GLN A 1  5    ? 111.765 22.175  -31.809 1.00 88.14  ? 5    GLN A C   1 
ATOM   24    O  O   . GLN A 1  5    ? 111.476 23.349  -32.019 1.00 87.88  ? 5    GLN A O   1 
ATOM   25    C  CB  . GLN A 1  5    ? 109.463 21.195  -31.757 1.00 95.81  ? 5    GLN A CB  1 
ATOM   26    C  CG  . GLN A 1  5    ? 108.785 19.816  -31.726 1.00 98.53  ? 5    GLN A CG  1 
ATOM   27    C  CD  . GLN A 1  5    ? 107.808 19.603  -32.881 1.00 99.75  ? 5    GLN A CD  1 
ATOM   28    O  OE1 . GLN A 1  5    ? 106.795 20.302  -32.995 1.00 99.84  ? 5    GLN A OE1 1 
ATOM   29    N  NE2 . GLN A 1  5    ? 108.112 18.630  -33.743 1.00 99.13  ? 5    GLN A NE2 1 
ATOM   30    N  N   . TYR A 1  6    ? 112.897 21.619  -32.216 1.00 81.59  ? 6    TYR A N   1 
ATOM   31    C  CA  . TYR A 1  6    ? 113.915 22.336  -32.968 1.00 75.95  ? 6    TYR A CA  1 
ATOM   32    C  C   . TYR A 1  6    ? 113.382 22.774  -34.336 1.00 71.06  ? 6    TYR A C   1 
ATOM   33    O  O   . TYR A 1  6    ? 112.424 22.196  -34.848 1.00 70.55  ? 6    TYR A O   1 
ATOM   34    C  CB  . TYR A 1  6    ? 115.112 21.405  -33.126 1.00 79.22  ? 6    TYR A CB  1 
ATOM   35    C  CG  . TYR A 1  6    ? 116.147 21.827  -34.130 1.00 82.00  ? 6    TYR A CG  1 
ATOM   36    C  CD1 . TYR A 1  6    ? 116.977 22.918  -33.892 1.00 83.60  ? 6    TYR A CD1 1 
ATOM   37    C  CD2 . TYR A 1  6    ? 116.334 21.096  -35.301 1.00 83.42  ? 6    TYR A CD2 1 
ATOM   38    C  CE1 . TYR A 1  6    ? 117.977 23.267  -34.796 1.00 85.83  ? 6    TYR A CE1 1 
ATOM   39    C  CE2 . TYR A 1  6    ? 117.325 21.434  -36.210 1.00 86.20  ? 6    TYR A CE2 1 
ATOM   40    C  CZ  . TYR A 1  6    ? 118.146 22.518  -35.952 1.00 86.55  ? 6    TYR A CZ  1 
ATOM   41    O  OH  . TYR A 1  6    ? 119.147 22.834  -36.844 1.00 87.49  ? 6    TYR A OH  1 
ATOM   42    N  N   . SER A 1  7    ? 113.996 23.800  -34.921 1.00 65.50  ? 7    SER A N   1 
ATOM   43    C  CA  . SER A 1  7    ? 113.579 24.296  -36.231 1.00 59.68  ? 7    SER A CA  1 
ATOM   44    C  C   . SER A 1  7    ? 114.772 24.817  -37.017 1.00 56.45  ? 7    SER A C   1 
ATOM   45    O  O   . SER A 1  7    ? 115.535 25.642  -36.526 1.00 54.84  ? 7    SER A O   1 
ATOM   46    C  CB  . SER A 1  7    ? 112.576 25.426  -36.081 1.00 58.81  ? 7    SER A CB  1 
ATOM   47    O  OG  . SER A 1  7    ? 113.250 26.663  -35.996 1.00 60.64  ? 7    SER A OG  1 
ATOM   48    N  N   . SER A 1  8    ? 114.921 24.345  -38.247 1.00 54.00  ? 8    SER A N   1 
ATOM   49    C  CA  . SER A 1  8    ? 116.039 24.764  -39.082 1.00 54.61  ? 8    SER A CA  1 
ATOM   50    C  C   . SER A 1  8    ? 116.268 26.245  -38.877 1.00 52.78  ? 8    SER A C   1 
ATOM   51    O  O   . SER A 1  8    ? 117.398 26.693  -38.679 1.00 53.44  ? 8    SER A O   1 
ATOM   52    C  CB  . SER A 1  8    ? 115.753 24.485  -40.571 1.00 58.16  ? 8    SER A CB  1 
ATOM   53    O  OG  . SER A 1  8    ? 115.020 25.529  -41.202 1.00 57.30  ? 8    SER A OG  1 
ATOM   54    N  N   . ALA A 1  9    ? 115.163 26.983  -38.907 1.00 51.73  ? 9    ALA A N   1 
ATOM   55    C  CA  . ALA A 1  9    ? 115.162 28.432  -38.743 1.00 51.22  ? 9    ALA A CA  1 
ATOM   56    C  C   . ALA A 1  9    ? 116.335 28.901  -37.908 1.00 48.93  ? 9    ALA A C   1 
ATOM   57    O  O   . ALA A 1  9    ? 116.719 28.231  -36.938 1.00 53.54  ? 9    ALA A O   1 
ATOM   58    C  CB  . ALA A 1  9    ? 113.851 28.884  -38.087 1.00 53.33  ? 9    ALA A CB  1 
ATOM   59    N  N   . PRO A 1  10   ? 116.944 30.039  -38.294 1.00 43.96  ? 10   PRO A N   1 
ATOM   60    C  CA  . PRO A 1  10   ? 118.083 30.601  -37.565 1.00 40.19  ? 10   PRO A CA  1 
ATOM   61    C  C   . PRO A 1  10   ? 117.539 31.383  -36.388 1.00 38.44  ? 10   PRO A C   1 
ATOM   62    O  O   . PRO A 1  10   ? 116.415 31.873  -36.432 1.00 38.24  ? 10   PRO A O   1 
ATOM   63    C  CB  . PRO A 1  10   ? 118.765 31.471  -38.608 1.00 39.15  ? 10   PRO A CB  1 
ATOM   64    C  CG  . PRO A 1  10   ? 117.641 31.907  -39.461 1.00 40.72  ? 10   PRO A CG  1 
ATOM   65    C  CD  . PRO A 1  10   ? 116.792 30.682  -39.609 1.00 41.46  ? 10   PRO A CD  1 
ATOM   66    N  N   . LEU A 1  11   ? 118.315 31.481  -35.323 1.00 36.94  ? 11   LEU A N   1 
ATOM   67    C  CA  . LEU A 1  11   ? 117.837 32.192  -34.156 1.00 37.19  ? 11   LEU A CA  1 
ATOM   68    C  C   . LEU A 1  11   ? 118.465 33.551  -34.010 1.00 36.83  ? 11   LEU A C   1 
ATOM   69    O  O   . LEU A 1  11   ? 119.678 33.645  -33.831 1.00 38.34  ? 11   LEU A O   1 
ATOM   70    C  CB  . LEU A 1  11   ? 118.149 31.412  -32.897 1.00 42.98  ? 11   LEU A CB  1 
ATOM   71    C  CG  . LEU A 1  11   ? 117.981 32.272  -31.645 1.00 46.83  ? 11   LEU A CG  1 
ATOM   72    C  CD1 . LEU A 1  11   ? 116.537 32.185  -31.197 1.00 50.67  ? 11   LEU A CD1 1 
ATOM   73    C  CD2 . LEU A 1  11   ? 118.914 31.805  -30.535 1.00 51.01  ? 11   LEU A CD2 1 
ATOM   74    N  N   . ARG A 1  12   ? 117.649 34.600  -34.061 1.00 34.42  ? 12   ARG A N   1 
ATOM   75    C  CA  . ARG A 1  12   ? 118.166 35.951  -33.895 1.00 33.85  ? 12   ARG A CA  1 
ATOM   76    C  C   . ARG A 1  12   ? 117.382 36.727  -32.850 1.00 31.60  ? 12   ARG A C   1 
ATOM   77    O  O   . ARG A 1  12   ? 116.456 36.194  -32.219 1.00 29.34  ? 12   ARG A O   1 
ATOM   78    C  CB  . ARG A 1  12   ? 118.146 36.720  -35.217 1.00 36.66  ? 12   ARG A CB  1 
ATOM   79    C  CG  . ARG A 1  12   ? 119.205 36.291  -36.212 1.00 45.15  ? 12   ARG A CG  1 
ATOM   80    C  CD  . ARG A 1  12   ? 119.438 37.396  -37.234 1.00 54.98  ? 12   ARG A CD  1 
ATOM   81    N  NE  . ARG A 1  12   ? 120.269 36.972  -38.363 1.00 63.29  ? 12   ARG A NE  1 
ATOM   82    C  CZ  . ARG A 1  12   ? 120.623 37.760  -39.381 1.00 65.47  ? 12   ARG A CZ  1 
ATOM   83    N  NH1 . ARG A 1  12   ? 120.229 39.031  -39.423 1.00 64.82  ? 12   ARG A NH1 1 
ATOM   84    N  NH2 . ARG A 1  12   ? 121.359 37.270  -40.374 1.00 66.86  ? 12   ARG A NH2 1 
ATOM   85    N  N   . THR A 1  13   ? 117.783 37.986  -32.666 1.00 29.02  ? 13   THR A N   1 
ATOM   86    C  CA  . THR A 1  13   ? 117.138 38.896  -31.722 1.00 26.07  ? 13   THR A CA  1 
ATOM   87    C  C   . THR A 1  13   ? 116.516 40.067  -32.478 1.00 23.02  ? 13   THR A C   1 
ATOM   88    O  O   . THR A 1  13   ? 116.859 40.317  -33.643 1.00 22.19  ? 13   THR A O   1 
ATOM   89    C  CB  . THR A 1  13   ? 118.140 39.451  -30.698 1.00 26.09  ? 13   THR A CB  1 
ATOM   90    O  OG1 . THR A 1  13   ? 119.443 39.526  -31.290 1.00 27.05  ? 13   THR A OG1 1 
ATOM   91    C  CG2 . THR A 1  13   ? 118.178 38.569  -29.477 1.00 29.57  ? 13   THR A CG2 1 
ATOM   92    N  N   . VAL A 1  14   ? 115.589 40.770  -31.826 1.00 17.86  ? 14   VAL A N   1 
ATOM   93    C  CA  . VAL A 1  14   ? 114.944 41.911  -32.457 1.00 15.91  ? 14   VAL A CA  1 
ATOM   94    C  C   . VAL A 1  14   ? 115.841 43.104  -32.194 1.00 17.66  ? 14   VAL A C   1 
ATOM   95    O  O   . VAL A 1  14   ? 116.313 43.305  -31.072 1.00 20.43  ? 14   VAL A O   1 
ATOM   96    C  CB  . VAL A 1  14   ? 113.547 42.193  -31.879 1.00 13.90  ? 14   VAL A CB  1 
ATOM   97    C  CG1 . VAL A 1  14   ? 112.558 42.472  -33.027 1.00 12.37  ? 14   VAL A CG1 1 
ATOM   98    C  CG2 . VAL A 1  14   ? 113.093 41.033  -31.008 1.00 13.94  ? 14   VAL A CG2 1 
ATOM   99    N  N   . LYS A 1  15   ? 116.076 43.883  -33.243 1.00 19.73  ? 15   LYS A N   1 
ATOM   100   C  CA  . LYS A 1  15   ? 116.941 45.046  -33.175 1.00 23.22  ? 15   LYS A CA  1 
ATOM   101   C  C   . LYS A 1  15   ? 116.138 46.333  -33.353 1.00 24.49  ? 15   LYS A C   1 
ATOM   102   O  O   . LYS A 1  15   ? 116.334 47.304  -32.614 1.00 27.54  ? 15   LYS A O   1 
ATOM   103   C  CB  . LYS A 1  15   ? 117.998 44.933  -34.267 1.00 27.85  ? 15   LYS A CB  1 
ATOM   104   C  CG  . LYS A 1  15   ? 118.762 43.601  -34.276 1.00 34.82  ? 15   LYS A CG  1 
ATOM   105   C  CD  . LYS A 1  15   ? 119.822 43.508  -33.174 1.00 40.06  ? 15   LYS A CD  1 
ATOM   106   C  CE  . LYS A 1  15   ? 120.793 42.345  -33.426 1.00 43.34  ? 15   LYS A CE  1 
ATOM   107   N  NZ  . LYS A 1  15   ? 121.974 42.340  -32.498 1.00 48.14  ? 15   LYS A NZ  1 
ATOM   108   N  N   . GLU A 1  16   ? 115.240 46.331  -34.340 1.00 25.05  ? 16   GLU A N   1 
ATOM   109   C  CA  . GLU A 1  16   ? 114.384 47.485  -34.633 1.00 25.07  ? 16   GLU A CA  1 
ATOM   110   C  C   . GLU A 1  16   ? 112.919 47.077  -34.560 1.00 22.63  ? 16   GLU A C   1 
ATOM   111   O  O   . GLU A 1  16   ? 112.587 45.904  -34.716 1.00 21.64  ? 16   GLU A O   1 
ATOM   112   C  CB  . GLU A 1  16   ? 114.635 48.018  -36.051 1.00 28.58  ? 16   GLU A CB  1 
ATOM   113   C  CG  . GLU A 1  16   ? 116.076 48.289  -36.421 1.00 34.34  ? 16   GLU A CG  1 
ATOM   114   C  CD  . GLU A 1  16   ? 116.212 48.907  -37.811 1.00 38.43  ? 16   GLU A CD  1 
ATOM   115   O  OE1 . GLU A 1  16   ? 115.575 48.421  -38.781 1.00 40.70  ? 16   GLU A OE1 1 
ATOM   116   O  OE2 . GLU A 1  16   ? 116.976 49.883  -37.936 1.00 41.79  ? 16   GLU A OE2 1 
ATOM   117   N  N   . VAL A 1  17   ? 112.044 48.044  -34.323 1.00 18.38  ? 17   VAL A N   1 
ATOM   118   C  CA  . VAL A 1  17   ? 110.620 47.763  -34.306 1.00 20.41  ? 17   VAL A CA  1 
ATOM   119   C  C   . VAL A 1  17   ? 110.036 48.775  -35.265 1.00 21.83  ? 17   VAL A C   1 
ATOM   120   O  O   . VAL A 1  17   ? 109.880 49.930  -34.923 1.00 25.23  ? 17   VAL A O   1 
ATOM   121   C  CB  . VAL A 1  17   ? 110.025 47.946  -32.918 1.00 19.30  ? 17   VAL A CB  1 
ATOM   122   C  CG1 . VAL A 1  17   ? 108.539 47.683  -32.954 1.00 16.06  ? 17   VAL A CG1 1 
ATOM   123   C  CG2 . VAL A 1  17   ? 110.678 46.983  -31.967 1.00 21.76  ? 17   VAL A CG2 1 
ATOM   124   N  N   . GLN A 1  18   ? 109.718 48.339  -36.472 1.00 22.74  ? 18   GLN A N   1 
ATOM   125   C  CA  . GLN A 1  18   ? 109.211 49.236  -37.500 1.00 23.60  ? 18   GLN A CA  1 
ATOM   126   C  C   . GLN A 1  18   ? 107.708 49.485  -37.559 1.00 23.85  ? 18   GLN A C   1 
ATOM   127   O  O   . GLN A 1  18   ? 107.088 49.071  -38.528 1.00 25.76  ? 18   GLN A O   1 
ATOM   128   C  CB  . GLN A 1  18   ? 109.626 48.702  -38.862 1.00 24.94  ? 18   GLN A CB  1 
ATOM   129   C  CG  . GLN A 1  18   ? 110.307 49.692  -39.765 1.00 32.29  ? 18   GLN A CG  1 
ATOM   130   C  CD  . GLN A 1  18   ? 109.755 51.091  -39.635 1.00 36.22  ? 18   GLN A CD  1 
ATOM   131   O  OE1 . GLN A 1  18   ? 108.635 51.294  -39.165 1.00 38.62  ? 18   GLN A OE1 1 
ATOM   132   N  NE2 . GLN A 1  18   ? 110.539 52.074  -40.071 1.00 40.22  ? 18   GLN A NE2 1 
ATOM   133   N  N   . PHE A 1  19   ? 107.110 50.185  -36.598 1.00 24.44  ? 19   PHE A N   1 
ATOM   134   C  CA  . PHE A 1  19   ? 105.656 50.407  -36.658 1.00 24.28  ? 19   PHE A CA  1 
ATOM   135   C  C   . PHE A 1  19   ? 105.106 50.991  -37.969 1.00 25.07  ? 19   PHE A C   1 
ATOM   136   O  O   . PHE A 1  19   ? 105.585 52.011  -38.457 1.00 24.68  ? 19   PHE A O   1 
ATOM   137   C  CB  . PHE A 1  19   ? 105.206 51.306  -35.528 1.00 22.71  ? 19   PHE A CB  1 
ATOM   138   C  CG  . PHE A 1  19   ? 105.522 50.779  -34.179 1.00 20.38  ? 19   PHE A CG  1 
ATOM   139   C  CD1 . PHE A 1  19   ? 106.669 51.173  -33.521 1.00 19.38  ? 19   PHE A CD1 1 
ATOM   140   C  CD2 . PHE A 1  19   ? 104.646 49.933  -33.538 1.00 20.54  ? 19   PHE A CD2 1 
ATOM   141   C  CE1 . PHE A 1  19   ? 106.941 50.731  -32.234 1.00 18.29  ? 19   PHE A CE1 1 
ATOM   142   C  CE2 . PHE A 1  19   ? 104.908 49.486  -32.252 1.00 20.55  ? 19   PHE A CE2 1 
ATOM   143   C  CZ  . PHE A 1  19   ? 106.059 49.891  -31.597 1.00 18.46  ? 19   PHE A CZ  1 
ATOM   144   N  N   . GLY A 1  20   ? 104.080 50.347  -38.520 1.00 25.52  ? 20   GLY A N   1 
ATOM   145   C  CA  . GLY A 1  20   ? 103.475 50.799  -39.764 1.00 24.26  ? 20   GLY A CA  1 
ATOM   146   C  C   . GLY A 1  20   ? 101.970 50.632  -39.687 1.00 24.68  ? 20   GLY A C   1 
ATOM   147   O  O   . GLY A 1  20   ? 101.429 50.455  -38.591 1.00 26.40  ? 20   GLY A O   1 
ATOM   148   N  N   . LEU A 1  21   ? 101.292 50.693  -40.834 1.00 23.54  ? 21   LEU A N   1 
ATOM   149   C  CA  . LEU A 1  21   ? 99.829  50.537  -40.893 1.00 20.49  ? 21   LEU A CA  1 
ATOM   150   C  C   . LEU A 1  21   ? 99.457  49.558  -41.999 1.00 22.17  ? 21   LEU A C   1 
ATOM   151   O  O   . LEU A 1  21   ? 100.061 49.571  -43.071 1.00 27.05  ? 21   LEU A O   1 
ATOM   152   C  CB  . LEU A 1  21   ? 99.137  51.879  -41.158 1.00 15.64  ? 21   LEU A CB  1 
ATOM   153   C  CG  . LEU A 1  21   ? 99.245  53.013  -40.131 1.00 14.62  ? 21   LEU A CG  1 
ATOM   154   C  CD1 . LEU A 1  21   ? 98.540  54.239  -40.669 1.00 11.25  ? 21   LEU A CD1 1 
ATOM   155   C  CD2 . LEU A 1  21   ? 98.628  52.594  -38.809 1.00 18.18  ? 21   LEU A CD2 1 
ATOM   156   N  N   . PHE A 1  22   ? 98.451  48.727  -41.755 1.00 23.21  ? 22   PHE A N   1 
ATOM   157   C  CA  . PHE A 1  22   ? 98.045  47.714  -42.735 1.00 26.14  ? 22   PHE A CA  1 
ATOM   158   C  C   . PHE A 1  22   ? 97.374  48.159  -44.017 1.00 28.09  ? 22   PHE A C   1 
ATOM   159   O  O   . PHE A 1  22   ? 96.249  48.652  -44.004 1.00 29.98  ? 22   PHE A O   1 
ATOM   160   C  CB  . PHE A 1  22   ? 97.138  46.674  -42.076 1.00 26.26  ? 22   PHE A CB  1 
ATOM   161   C  CG  . PHE A 1  22   ? 97.869  45.469  -41.562 1.00 24.74  ? 22   PHE A CG  1 
ATOM   162   C  CD1 . PHE A 1  22   ? 97.717  45.060  -40.231 1.00 23.32  ? 22   PHE A CD1 1 
ATOM   163   C  CD2 . PHE A 1  22   ? 98.712  44.745  -42.399 1.00 24.15  ? 22   PHE A CD2 1 
ATOM   164   C  CE1 . PHE A 1  22   ? 98.393  43.950  -39.740 1.00 20.92  ? 22   PHE A CE1 1 
ATOM   165   C  CE2 . PHE A 1  22   ? 99.391  43.637  -41.920 1.00 25.08  ? 22   PHE A CE2 1 
ATOM   166   C  CZ  . PHE A 1  22   ? 99.232  43.236  -40.583 1.00 21.33  ? 22   PHE A CZ  1 
ATOM   167   N  N   . SER A 1  23   ? 98.056  47.965  -45.134 1.00 30.35  ? 23   SER A N   1 
ATOM   168   C  CA  . SER A 1  23   ? 97.454  48.325  -46.402 1.00 33.47  ? 23   SER A CA  1 
ATOM   169   C  C   . SER A 1  23   ? 96.464  47.207  -46.652 1.00 32.71  ? 23   SER A C   1 
ATOM   170   O  O   . SER A 1  23   ? 96.805  46.044  -46.479 1.00 32.21  ? 23   SER A O   1 
ATOM   171   C  CB  . SER A 1  23   ? 98.504  48.369  -47.517 1.00 37.08  ? 23   SER A CB  1 
ATOM   172   O  OG  . SER A 1  23   ? 99.209  47.146  -47.639 1.00 45.02  ? 23   SER A OG  1 
ATOM   173   N  N   . PRO A 1  24   ? 95.221  47.533  -47.041 1.00 32.76  ? 24   PRO A N   1 
ATOM   174   C  CA  . PRO A 1  24   ? 94.252  46.461  -47.283 1.00 34.79  ? 24   PRO A CA  1 
ATOM   175   C  C   . PRO A 1  24   ? 94.825  45.259  -48.052 1.00 38.09  ? 24   PRO A C   1 
ATOM   176   O  O   . PRO A 1  24   ? 94.555  44.099  -47.713 1.00 36.15  ? 24   PRO A O   1 
ATOM   177   C  CB  . PRO A 1  24   ? 93.120  47.182  -48.031 1.00 32.04  ? 24   PRO A CB  1 
ATOM   178   C  CG  . PRO A 1  24   ? 93.778  48.409  -48.598 1.00 29.97  ? 24   PRO A CG  1 
ATOM   179   C  CD  . PRO A 1  24   ? 94.673  48.826  -47.474 1.00 31.90  ? 24   PRO A CD  1 
ATOM   180   N  N   . GLU A 1  25   ? 95.639  45.564  -49.060 1.00 44.26  ? 25   GLU A N   1 
ATOM   181   C  CA  . GLU A 1  25   ? 96.290  44.578  -49.932 1.00 49.48  ? 25   GLU A CA  1 
ATOM   182   C  C   . GLU A 1  25   ? 97.113  43.534  -49.165 1.00 47.10  ? 25   GLU A C   1 
ATOM   183   O  O   . GLU A 1  25   ? 97.193  42.372  -49.558 1.00 48.36  ? 25   GLU A O   1 
ATOM   184   C  CB  . GLU A 1  25   ? 97.208  45.305  -50.932 1.00 56.66  ? 25   GLU A CB  1 
ATOM   185   C  CG  . GLU A 1  25   ? 96.545  46.409  -51.797 1.00 65.50  ? 25   GLU A CG  1 
ATOM   186   C  CD  . GLU A 1  25   ? 95.873  47.518  -50.981 1.00 69.59  ? 25   GLU A CD  1 
ATOM   187   O  OE1 . GLU A 1  25   ? 96.390  47.866  -49.892 1.00 71.61  ? 25   GLU A OE1 1 
ATOM   188   O  OE2 . GLU A 1  25   ? 94.834  48.052  -51.439 1.00 71.23  ? 25   GLU A OE2 1 
ATOM   189   N  N   . GLU A 1  26   ? 97.744  43.966  -48.084 1.00 43.83  ? 26   GLU A N   1 
ATOM   190   C  CA  . GLU A 1  26   ? 98.542  43.076  -47.268 1.00 40.94  ? 26   GLU A CA  1 
ATOM   191   C  C   . GLU A 1  26   ? 97.593  42.303  -46.378 1.00 39.23  ? 26   GLU A C   1 
ATOM   192   O  O   . GLU A 1  26   ? 97.734  41.097  -46.213 1.00 37.38  ? 26   GLU A O   1 
ATOM   193   C  CB  . GLU A 1  26   ? 99.517  43.885  -46.415 1.00 44.84  ? 26   GLU A CB  1 
ATOM   194   C  CG  . GLU A 1  26   ? 100.401 43.066  -45.480 1.00 46.57  ? 26   GLU A CG  1 
ATOM   195   C  CD  . GLU A 1  26   ? 101.480 43.912  -44.808 1.00 47.01  ? 26   GLU A CD  1 
ATOM   196   O  OE1 . GLU A 1  26   ? 101.130 44.972  -44.235 1.00 45.72  ? 26   GLU A OE1 1 
ATOM   197   O  OE2 . GLU A 1  26   ? 102.670 43.514  -44.852 1.00 46.17  ? 26   GLU A OE2 1 
ATOM   198   N  N   . VAL A 1  27   ? 96.616  42.997  -45.807 1.00 38.91  ? 27   VAL A N   1 
ATOM   199   C  CA  . VAL A 1  27   ? 95.655  42.336  -44.940 1.00 39.09  ? 27   VAL A CA  1 
ATOM   200   C  C   . VAL A 1  27   ? 95.162  41.075  -45.612 1.00 40.32  ? 27   VAL A C   1 
ATOM   201   O  O   . VAL A 1  27   ? 95.138  40.020  -44.991 1.00 39.95  ? 27   VAL A O   1 
ATOM   202   C  CB  . VAL A 1  27   ? 94.466  43.238  -44.619 1.00 37.21  ? 27   VAL A CB  1 
ATOM   203   C  CG1 . VAL A 1  27   ? 93.376  42.438  -43.951 1.00 37.59  ? 27   VAL A CG1 1 
ATOM   204   C  CG2 . VAL A 1  27   ? 94.912  44.332  -43.678 1.00 39.72  ? 27   VAL A CG2 1 
ATOM   205   N  N   . ARG A 1  28   ? 94.776  41.186  -46.880 1.00 44.30  ? 28   ARG A N   1 
ATOM   206   C  CA  . ARG A 1  28   ? 94.319  40.023  -47.639 1.00 49.44  ? 28   ARG A CA  1 
ATOM   207   C  C   . ARG A 1  28   ? 95.501  39.091  -47.785 1.00 47.41  ? 28   ARG A C   1 
ATOM   208   O  O   . ARG A 1  28   ? 95.427  37.929  -47.411 1.00 50.73  ? 28   ARG A O   1 
ATOM   209   C  CB  . ARG A 1  28   ? 93.834  40.413  -49.037 1.00 57.52  ? 28   ARG A CB  1 
ATOM   210   C  CG  . ARG A 1  28   ? 92.612  41.311  -49.035 1.00 70.57  ? 28   ARG A CG  1 
ATOM   211   C  CD  . ARG A 1  28   ? 92.138  41.657  -50.440 1.00 78.24  ? 28   ARG A CD  1 
ATOM   212   N  NE  . ARG A 1  28   ? 91.129  42.712  -50.392 1.00 86.23  ? 28   ARG A NE  1 
ATOM   213   C  CZ  . ARG A 1  28   ? 90.521  43.227  -51.457 1.00 91.53  ? 28   ARG A CZ  1 
ATOM   214   N  NH1 . ARG A 1  28   ? 90.811  42.786  -52.679 1.00 94.73  ? 28   ARG A NH1 1 
ATOM   215   N  NH2 . ARG A 1  28   ? 89.624  44.194  -51.297 1.00 95.11  ? 28   ARG A NH2 1 
ATOM   216   N  N   . ALA A 1  29   ? 96.592  39.607  -48.336 1.00 43.91  ? 29   ALA A N   1 
ATOM   217   C  CA  . ALA A 1  29   ? 97.804  38.820  -48.518 1.00 41.24  ? 29   ALA A CA  1 
ATOM   218   C  C   . ALA A 1  29   ? 98.074  37.898  -47.319 1.00 38.63  ? 29   ALA A C   1 
ATOM   219   O  O   . ALA A 1  29   ? 98.094  36.674  -47.456 1.00 40.62  ? 29   ALA A O   1 
ATOM   220   C  CB  . ALA A 1  29   ? 98.979  39.746  -48.733 1.00 42.84  ? 29   ALA A CB  1 
ATOM   221   N  N   . ILE A 1  30   ? 98.276  38.489  -46.148 1.00 34.75  ? 30   ILE A N   1 
ATOM   222   C  CA  . ILE A 1  30   ? 98.530  37.732  -44.928 1.00 33.77  ? 30   ILE A CA  1 
ATOM   223   C  C   . ILE A 1  30   ? 97.444  36.698  -44.603 1.00 32.95  ? 30   ILE A C   1 
ATOM   224   O  O   . ILE A 1  30   ? 97.738  35.561  -44.211 1.00 31.30  ? 30   ILE A O   1 
ATOM   225   C  CB  . ILE A 1  30   ? 98.655  38.691  -43.726 1.00 34.78  ? 30   ILE A CB  1 
ATOM   226   C  CG1 . ILE A 1  30   ? 100.113 39.087  -43.540 1.00 39.98  ? 30   ILE A CG1 1 
ATOM   227   C  CG2 . ILE A 1  30   ? 98.115  38.051  -42.462 1.00 32.85  ? 30   ILE A CG2 1 
ATOM   228   C  CD1 . ILE A 1  30   ? 100.360 39.903  -42.287 1.00 42.74  ? 30   ILE A CD1 1 
ATOM   229   N  N   . SER A 1  31   ? 96.190  37.116  -44.760 1.00 32.09  ? 31   SER A N   1 
ATOM   230   C  CA  . SER A 1  31   ? 95.019  36.288  -44.468 1.00 28.78  ? 31   SER A CA  1 
ATOM   231   C  C   . SER A 1  31   ? 94.924  34.921  -45.129 1.00 28.29  ? 31   SER A C   1 
ATOM   232   O  O   . SER A 1  31   ? 95.295  34.720  -46.304 1.00 34.01  ? 31   SER A O   1 
ATOM   233   C  CB  . SER A 1  31   ? 93.732  37.065  -44.766 1.00 26.59  ? 31   SER A CB  1 
ATOM   234   O  OG  . SER A 1  31   ? 92.593  36.239  -44.607 1.00 24.42  ? 31   SER A OG  1 
ATOM   235   N  N   . VAL A 1  32   ? 94.374  33.999  -44.340 1.00 25.05  ? 32   VAL A N   1 
ATOM   236   C  CA  . VAL A 1  32   ? 94.175  32.605  -44.714 1.00 23.62  ? 32   VAL A CA  1 
ATOM   237   C  C   . VAL A 1  32   ? 92.696  32.235  -44.668 1.00 24.11  ? 32   VAL A C   1 
ATOM   238   O  O   . VAL A 1  32   ? 92.271  31.247  -45.260 1.00 26.11  ? 32   VAL A O   1 
ATOM   239   C  CB  . VAL A 1  32   ? 94.948  31.693  -43.752 1.00 20.67  ? 32   VAL A CB  1 
ATOM   240   C  CG1 . VAL A 1  32   ? 96.429  32.043  -43.817 1.00 19.62  ? 32   VAL A CG1 1 
ATOM   241   C  CG2 . VAL A 1  32   ? 94.429  31.872  -42.318 1.00 17.41  ? 32   VAL A CG2 1 
ATOM   242   N  N   . ALA A 1  33   ? 91.909  33.037  -43.968 1.00 25.82  ? 33   ALA A N   1 
ATOM   243   C  CA  . ALA A 1  33   ? 90.492  32.751  -43.859 1.00 27.97  ? 33   ALA A CA  1 
ATOM   244   C  C   . ALA A 1  33   ? 89.625  33.729  -44.617 1.00 29.40  ? 33   ALA A C   1 
ATOM   245   O  O   . ALA A 1  33   ? 89.705  34.942  -44.443 1.00 26.65  ? 33   ALA A O   1 
ATOM   246   C  CB  . ALA A 1  33   ? 90.080  32.730  -42.407 1.00 33.62  ? 33   ALA A CB  1 
ATOM   247   N  N   . LYS A 1  34   ? 88.775  33.185  -45.461 1.00 32.58  ? 34   LYS A N   1 
ATOM   248   C  CA  . LYS A 1  34   ? 87.881  34.015  -46.229 1.00 34.30  ? 34   LYS A CA  1 
ATOM   249   C  C   . LYS A 1  34   ? 86.876  34.666  -45.261 1.00 35.64  ? 34   LYS A C   1 
ATOM   250   O  O   . LYS A 1  34   ? 86.314  35.711  -45.559 1.00 37.45  ? 34   LYS A O   1 
ATOM   251   C  CB  . LYS A 1  34   ? 87.180  33.148  -47.289 1.00 33.57  ? 34   LYS A CB  1 
ATOM   252   C  CG  . LYS A 1  34   ? 88.086  32.642  -48.464 1.00 24.29  ? 34   LYS A CG  1 
ATOM   253   C  CD  . LYS A 1  34   ? 89.439  32.056  -48.046 1.00 12.23  ? 34   LYS A CD  1 
ATOM   254   C  CE  . LYS A 1  34   ? 89.914  31.087  -49.078 1.00 1.00   ? 34   LYS A CE  1 
ATOM   255   N  NZ  . LYS A 1  34   ? 88.888  30.051  -49.132 1.00 1.00   ? 34   LYS A NZ  1 
ATOM   256   N  N   . ILE A 1  35   ? 86.695  34.056  -44.090 1.00 37.62  ? 35   ILE A N   1 
ATOM   257   C  CA  . ILE A 1  35   ? 85.762  34.524  -43.054 1.00 39.45  ? 35   ILE A CA  1 
ATOM   258   C  C   . ILE A 1  35   ? 84.473  35.170  -43.557 1.00 42.58  ? 35   ILE A C   1 
ATOM   259   O  O   . ILE A 1  35   ? 84.281  36.382  -43.457 1.00 38.12  ? 35   ILE A O   1 
ATOM   260   C  CB  . ILE A 1  35   ? 86.426  35.504  -42.081 1.00 36.74  ? 35   ILE A CB  1 
ATOM   261   C  CG1 . ILE A 1  35   ? 87.620  34.841  -41.416 1.00 34.14  ? 35   ILE A CG1 1 
ATOM   262   C  CG2 . ILE A 1  35   ? 85.440  35.894  -40.987 1.00 37.40  ? 35   ILE A CG2 1 
ATOM   263   C  CD1 . ILE A 1  35   ? 88.142  35.611  -40.239 1.00 33.71  ? 35   ILE A CD1 1 
ATOM   264   N  N   . ARG A 1  36   ? 83.570  34.343  -44.063 1.00 48.53  ? 36   ARG A N   1 
ATOM   265   C  CA  . ARG A 1  36   ? 82.314  34.835  -44.598 1.00 55.62  ? 36   ARG A CA  1 
ATOM   266   C  C   . ARG A 1  36   ? 81.153  34.822  -43.618 1.00 56.58  ? 36   ARG A C   1 
ATOM   267   O  O   . ARG A 1  36   ? 80.481  35.834  -43.428 1.00 55.51  ? 36   ARG A O   1 
ATOM   268   C  CB  . ARG A 1  36   ? 81.953  34.031  -45.851 1.00 60.94  ? 36   ARG A CB  1 
ATOM   269   C  CG  . ARG A 1  36   ? 82.678  34.509  -47.105 1.00 66.30  ? 36   ARG A CG  1 
ATOM   270   C  CD  . ARG A 1  36   ? 82.843  33.413  -48.135 1.00 69.17  ? 36   ARG A CD  1 
ATOM   271   N  NE  . ARG A 1  36   ? 84.100  32.688  -47.959 1.00 72.37  ? 36   ARG A NE  1 
ATOM   272   C  CZ  . ARG A 1  36   ? 84.449  31.622  -48.675 1.00 75.22  ? 36   ARG A CZ  1 
ATOM   273   N  NH1 . ARG A 1  36   ? 83.629  31.158  -49.614 1.00 77.93  ? 36   ARG A NH1 1 
ATOM   274   N  NH2 . ARG A 1  36   ? 85.613  31.020  -48.457 1.00 74.35  ? 36   ARG A NH2 1 
ATOM   275   N  N   . PHE A 1  37   ? 80.925  33.675  -42.996 1.00 58.66  ? 37   PHE A N   1 
ATOM   276   C  CA  . PHE A 1  37   ? 79.827  33.522  -42.059 1.00 62.85  ? 37   PHE A CA  1 
ATOM   277   C  C   . PHE A 1  37   ? 80.192  34.017  -40.674 1.00 63.08  ? 37   PHE A C   1 
ATOM   278   O  O   . PHE A 1  37   ? 81.346  33.952  -40.273 1.00 63.37  ? 37   PHE A O   1 
ATOM   279   C  CB  . PHE A 1  37   ? 79.417  32.060  -42.007 1.00 69.98  ? 37   PHE A CB  1 
ATOM   280   C  CG  . PHE A 1  37   ? 79.316  31.422  -43.358 1.00 78.67  ? 37   PHE A CG  1 
ATOM   281   C  CD1 . PHE A 1  37   ? 80.463  31.131  -44.093 1.00 81.68  ? 37   PHE A CD1 1 
ATOM   282   C  CD2 . PHE A 1  37   ? 78.073  31.140  -43.915 1.00 83.88  ? 37   PHE A CD2 1 
ATOM   283   C  CE1 . PHE A 1  37   ? 80.377  30.565  -45.366 1.00 85.48  ? 37   PHE A CE1 1 
ATOM   284   C  CE2 . PHE A 1  37   ? 77.973  30.573  -45.189 1.00 87.89  ? 37   PHE A CE2 1 
ATOM   285   C  CZ  . PHE A 1  37   ? 79.130  30.287  -45.917 1.00 87.19  ? 37   PHE A CZ  1 
ATOM   286   N  N   . PRO A 1  38   ? 79.204  34.521  -39.924 1.00 63.83  ? 38   PRO A N   1 
ATOM   287   C  CA  . PRO A 1  38   ? 79.386  35.046  -38.571 1.00 65.26  ? 38   PRO A CA  1 
ATOM   288   C  C   . PRO A 1  38   ? 79.277  33.994  -37.485 1.00 67.46  ? 38   PRO A C   1 
ATOM   289   O  O   . PRO A 1  38   ? 79.647  34.238  -36.343 1.00 68.55  ? 38   PRO A O   1 
ATOM   290   C  CB  . PRO A 1  38   ? 78.272  36.069  -38.466 1.00 64.26  ? 38   PRO A CB  1 
ATOM   291   C  CG  . PRO A 1  38   ? 77.158  35.359  -39.155 1.00 64.47  ? 38   PRO A CG  1 
ATOM   292   C  CD  . PRO A 1  38   ? 77.833  34.787  -40.394 1.00 64.95  ? 38   PRO A CD  1 
ATOM   293   N  N   . GLU A 1  39   ? 78.757  32.829  -37.849 1.00 70.98  ? 39   GLU A N   1 
ATOM   294   C  CA  . GLU A 1  39   ? 78.567  31.730  -36.908 1.00 75.33  ? 39   GLU A CA  1 
ATOM   295   C  C   . GLU A 1  39   ? 79.901  31.135  -36.471 1.00 75.76  ? 39   GLU A C   1 
ATOM   296   O  O   . GLU A 1  39   ? 80.927  31.356  -37.114 1.00 75.24  ? 39   GLU A O   1 
ATOM   297   C  CB  . GLU A 1  39   ? 77.678  30.680  -37.564 1.00 79.00  ? 39   GLU A CB  1 
ATOM   298   C  CG  . GLU A 1  39   ? 76.448  31.319  -38.192 1.00 86.45  ? 39   GLU A CG  1 
ATOM   299   C  CD  . GLU A 1  39   ? 75.822  30.486  -39.293 1.00 91.63  ? 39   GLU A CD  1 
ATOM   300   O  OE1 . GLU A 1  39   ? 76.556  30.020  -40.200 1.00 93.36  ? 39   GLU A OE1 1 
ATOM   301   O  OE2 . GLU A 1  39   ? 74.584  30.314  -39.258 1.00 95.91  ? 39   GLU A OE2 1 
ATOM   302   N  N   . THR A 1  40   ? 79.894  30.386  -35.376 1.00 77.18  ? 40   THR A N   1 
ATOM   303   C  CA  . THR A 1  40   ? 81.127  29.807  -34.882 1.00 79.54  ? 40   THR A CA  1 
ATOM   304   C  C   . THR A 1  40   ? 81.415  28.436  -35.424 1.00 83.87  ? 40   THR A C   1 
ATOM   305   O  O   . THR A 1  40   ? 82.439  28.224  -36.068 1.00 84.02  ? 40   THR A O   1 
ATOM   306   C  CB  . THR A 1  40   ? 81.123  29.675  -33.383 1.00 79.00  ? 40   THR A CB  1 
ATOM   307   O  OG1 . THR A 1  40   ? 80.665  30.898  -32.805 1.00 82.51  ? 40   THR A OG1 1 
ATOM   308   C  CG2 . THR A 1  40   ? 82.528  29.374  -32.892 1.00 78.03  ? 40   THR A CG2 1 
ATOM   309   N  N   . MET A 1  41   ? 80.514  27.497  -35.161 1.00 90.57  ? 41   MET A N   1 
ATOM   310   C  CA  . MET A 1  41   ? 80.731  26.129  -35.611 1.00 99.67  ? 41   MET A CA  1 
ATOM   311   C  C   . MET A 1  41   ? 79.496  25.398  -36.104 1.00 104.99 ? 41   MET A C   1 
ATOM   312   O  O   . MET A 1  41   ? 79.063  25.570  -37.240 1.00 102.69 ? 41   MET A O   1 
ATOM   313   C  CB  . MET A 1  41   ? 81.333  25.317  -34.474 1.00 99.88  ? 41   MET A CB  1 
ATOM   314   C  CG  . MET A 1  41   ? 81.821  26.159  -33.332 1.00 100.23 ? 41   MET A CG  1 
ATOM   315   S  SD  . MET A 1  41   ? 81.771  25.222  -31.828 1.00 102.54 ? 41   MET A SD  1 
ATOM   316   C  CE  . MET A 1  41   ? 80.316  25.936  -31.032 1.00 102.79 ? 41   MET A CE  1 
ATOM   317   N  N   . ASP A 1  42   ? 78.952  24.565  -35.221 1.00 115.34 ? 42   ASP A N   1 
ATOM   318   C  CA  . ASP A 1  42   ? 77.779  23.753  -35.511 1.00 124.50 ? 42   ASP A CA  1 
ATOM   319   C  C   . ASP A 1  42   ? 77.497  23.694  -37.008 1.00 127.63 ? 42   ASP A C   1 
ATOM   320   O  O   . ASP A 1  42   ? 76.795  24.546  -37.558 1.00 128.35 ? 42   ASP A O   1 
ATOM   321   C  CB  . ASP A 1  42   ? 76.535  24.271  -34.747 1.00 126.91 ? 42   ASP A CB  1 
ATOM   322   C  CG  . ASP A 1  42   ? 76.502  23.825  -33.266 1.00 127.96 ? 42   ASP A CG  1 
ATOM   323   O  OD1 . ASP A 1  42   ? 76.802  22.641  -32.974 1.00 126.97 ? 42   ASP A OD1 1 
ATOM   324   O  OD2 . ASP A 1  42   ? 76.156  24.658  -32.395 1.00 127.40 ? 42   ASP A OD2 1 
ATOM   325   N  N   . GLU A 1  43   ? 78.086  22.701  -37.666 1.00 132.21 ? 43   GLU A N   1 
ATOM   326   C  CA  . GLU A 1  43   ? 77.876  22.498  -39.093 1.00 138.23 ? 43   GLU A CA  1 
ATOM   327   C  C   . GLU A 1  43   ? 76.423  22.013  -39.168 1.00 140.53 ? 43   GLU A C   1 
ATOM   328   O  O   . GLU A 1  43   ? 76.125  20.992  -39.792 1.00 142.12 ? 43   GLU A O   1 
ATOM   329   C  CB  . GLU A 1  43   ? 78.823  21.403  -39.620 1.00 140.51 ? 43   GLU A CB  1 
ATOM   330   C  CG  . GLU A 1  43   ? 80.297  21.529  -39.191 1.00 142.01 ? 43   GLU A CG  1 
ATOM   331   C  CD  . GLU A 1  43   ? 81.179  20.392  -39.728 1.00 142.76 ? 43   GLU A CD  1 
ATOM   332   O  OE1 . GLU A 1  43   ? 80.891  19.210  -39.432 1.00 142.47 ? 43   GLU A OE1 1 
ATOM   333   O  OE2 . GLU A 1  43   ? 82.164  20.681  -40.444 1.00 142.97 ? 43   GLU A OE2 1 
ATOM   334   N  N   . THR A 1  44   ? 75.538  22.767  -38.514 1.00 141.97 ? 44   THR A N   1 
ATOM   335   C  CA  . THR A 1  44   ? 74.110  22.473  -38.394 1.00 143.13 ? 44   THR A CA  1 
ATOM   336   C  C   . THR A 1  44   ? 74.002  21.647  -37.108 1.00 142.57 ? 44   THR A C   1 
ATOM   337   O  O   . THR A 1  44   ? 73.195  20.719  -37.004 1.00 144.84 ? 44   THR A O   1 
ATOM   338   C  CB  . THR A 1  44   ? 73.562  21.667  -39.606 1.00 144.31 ? 44   THR A CB  1 
ATOM   339   O  OG1 . THR A 1  44   ? 73.846  22.377  -40.819 1.00 144.27 ? 44   THR A OG1 1 
ATOM   340   C  CG2 . THR A 1  44   ? 72.047  21.472  -39.487 1.00 144.16 ? 44   THR A CG2 1 
ATOM   341   N  N   . GLN A 1  45   ? 74.852  22.017  -36.146 1.00 140.36 ? 45   GLN A N   1 
ATOM   342   C  CA  . GLN A 1  45   ? 74.975  21.401  -34.818 1.00 138.42 ? 45   GLN A CA  1 
ATOM   343   C  C   . GLN A 1  45   ? 76.175  20.451  -34.713 1.00 134.85 ? 45   GLN A C   1 
ATOM   344   O  O   . GLN A 1  45   ? 76.755  20.279  -33.637 1.00 133.49 ? 45   GLN A O   1 
ATOM   345   C  CB  . GLN A 1  45   ? 73.680  20.678  -34.398 1.00 142.35 ? 45   GLN A CB  1 
ATOM   346   C  CG  . GLN A 1  45   ? 72.526  21.625  -34.022 1.00 144.84 ? 45   GLN A CG  1 
ATOM   347   C  CD  . GLN A 1  45   ? 71.346  20.913  -33.365 1.00 145.42 ? 45   GLN A CD  1 
ATOM   348   O  OE1 . GLN A 1  45   ? 71.470  20.348  -32.275 1.00 145.72 ? 45   GLN A OE1 1 
ATOM   349   N  NE2 . GLN A 1  45   ? 70.193  20.945  -34.028 1.00 145.24 ? 45   GLN A NE2 1 
ATOM   350   N  N   . THR A 1  46   ? 76.554  19.844  -35.831 1.00 130.58 ? 46   THR A N   1 
ATOM   351   C  CA  . THR A 1  46   ? 77.690  18.933  -35.846 1.00 126.87 ? 46   THR A CA  1 
ATOM   352   C  C   . THR A 1  46   ? 78.908  19.654  -35.276 1.00 124.52 ? 46   THR A C   1 
ATOM   353   O  O   . THR A 1  46   ? 79.325  20.684  -35.802 1.00 124.91 ? 46   THR A O   1 
ATOM   354   C  CB  . THR A 1  46   ? 77.996  18.467  -37.282 1.00 127.04 ? 46   THR A CB  1 
ATOM   355   O  OG1 . THR A 1  46   ? 76.900  17.682  -37.771 1.00 126.21 ? 46   THR A OG1 1 
ATOM   356   C  CG2 . THR A 1  46   ? 79.274  17.641  -37.319 1.00 126.72 ? 46   THR A CG2 1 
ATOM   357   N  N   . ARG A 1  47   ? 79.475  19.113  -34.203 1.00 121.08 ? 47   ARG A N   1 
ATOM   358   C  CA  . ARG A 1  47   ? 80.635  19.728  -33.564 1.00 117.96 ? 47   ARG A CA  1 
ATOM   359   C  C   . ARG A 1  47   ? 81.890  19.715  -34.430 1.00 113.37 ? 47   ARG A C   1 
ATOM   360   O  O   . ARG A 1  47   ? 82.345  18.666  -34.891 1.00 112.37 ? 47   ARG A O   1 
ATOM   361   C  CB  . ARG A 1  47   ? 80.930  19.042  -32.234 1.00 122.32 ? 47   ARG A CB  1 
ATOM   362   C  CG  . ARG A 1  47   ? 79.717  18.921  -31.330 1.00 128.52 ? 47   ARG A CG  1 
ATOM   363   C  CD  . ARG A 1  47   ? 80.070  18.256  -29.999 1.00 132.80 ? 47   ARG A CD  1 
ATOM   364   N  NE  . ARG A 1  47   ? 80.811  19.149  -29.110 1.00 136.88 ? 47   ARG A NE  1 
ATOM   365   C  CZ  . ARG A 1  47   ? 81.222  18.819  -27.888 1.00 137.96 ? 47   ARG A CZ  1 
ATOM   366   N  NH1 . ARG A 1  47   ? 80.968  17.610  -27.408 1.00 137.73 ? 47   ARG A NH1 1 
ATOM   367   N  NH2 . ARG A 1  47   ? 81.876  19.700  -27.141 1.00 138.57 ? 47   ARG A NH2 1 
ATOM   368   N  N   . ALA A 1  48   ? 82.438  20.910  -34.626 1.00 107.58 ? 48   ALA A N   1 
ATOM   369   C  CA  . ALA A 1  48   ? 83.634  21.147  -35.426 1.00 100.70 ? 48   ALA A CA  1 
ATOM   370   C  C   . ALA A 1  48   ? 83.730  22.662  -35.570 1.00 95.97  ? 48   ALA A C   1 
ATOM   371   O  O   . ALA A 1  48   ? 83.591  23.385  -34.587 1.00 94.53  ? 48   ALA A O   1 
ATOM   372   C  CB  . ALA A 1  48   ? 83.496  20.496  -36.797 1.00 102.36 ? 48   ALA A CB  1 
ATOM   373   N  N   . LYS A 1  49   ? 83.957  23.141  -36.789 1.00 90.56  ? 49   LYS A N   1 
ATOM   374   C  CA  . LYS A 1  49   ? 84.053  24.576  -37.051 1.00 86.92  ? 49   LYS A CA  1 
ATOM   375   C  C   . LYS A 1  49   ? 83.691  24.812  -38.500 1.00 83.51  ? 49   LYS A C   1 
ATOM   376   O  O   . LYS A 1  49   ? 84.129  24.061  -39.366 1.00 85.25  ? 49   LYS A O   1 
ATOM   377   C  CB  . LYS A 1  49   ? 85.474  25.077  -36.823 1.00 89.56  ? 49   LYS A CB  1 
ATOM   378   C  CG  . LYS A 1  49   ? 86.050  24.731  -35.466 1.00 94.44  ? 49   LYS A CG  1 
ATOM   379   C  CD  . LYS A 1  49   ? 87.417  25.381  -35.260 1.00 97.33  ? 49   LYS A CD  1 
ATOM   380   C  CE  . LYS A 1  49   ? 88.054  24.939  -33.951 1.00 97.53  ? 49   LYS A CE  1 
ATOM   381   N  NZ  . LYS A 1  49   ? 89.358  25.608  -33.717 1.00 96.20  ? 49   LYS A NZ  1 
ATOM   382   N  N   . ILE A 1  50   ? 82.903  25.844  -38.781 1.00 78.15  ? 50   ILE A N   1 
ATOM   383   C  CA  . ILE A 1  50   ? 82.530  26.096  -40.169 1.00 74.81  ? 50   ILE A CA  1 
ATOM   384   C  C   . ILE A 1  50   ? 83.641  26.833  -40.881 1.00 68.13  ? 50   ILE A C   1 
ATOM   385   O  O   . ILE A 1  50   ? 84.373  27.595  -40.248 1.00 67.75  ? 50   ILE A O   1 
ATOM   386   C  CB  . ILE A 1  50   ? 81.231  26.948  -40.299 1.00 79.54  ? 50   ILE A CB  1 
ATOM   387   C  CG1 . ILE A 1  50   ? 80.027  26.166  -39.765 1.00 83.30  ? 50   ILE A CG1 1 
ATOM   388   C  CG2 . ILE A 1  50   ? 80.974  27.307  -41.777 1.00 81.37  ? 50   ILE A CG2 1 
ATOM   389   C  CD1 . ILE A 1  50   ? 78.671  26.779  -40.128 1.00 83.93  ? 50   ILE A CD1 1 
ATOM   390   N  N   . GLY A 1  51   ? 83.785  26.587  -42.183 1.00 59.19  ? 51   GLY A N   1 
ATOM   391   C  CA  . GLY A 1  51   ? 84.782  27.305  -42.941 1.00 48.16  ? 51   GLY A CA  1 
ATOM   392   C  C   . GLY A 1  51   ? 84.226  28.722  -43.007 1.00 45.35  ? 51   GLY A C   1 
ATOM   393   O  O   . GLY A 1  51   ? 84.173  29.313  -44.071 1.00 46.26  ? 51   GLY A O   1 
ATOM   394   N  N   . GLY A 1  52   ? 83.793  29.255  -41.860 1.00 42.11  ? 52   GLY A N   1 
ATOM   395   C  CA  . GLY A 1  52   ? 83.218  30.597  -41.777 1.00 36.37  ? 52   GLY A CA  1 
ATOM   396   C  C   . GLY A 1  52   ? 83.936  31.522  -40.799 1.00 33.01  ? 52   GLY A C   1 
ATOM   397   O  O   . GLY A 1  52   ? 84.699  32.376  -41.241 1.00 34.38  ? 52   GLY A O   1 
ATOM   398   N  N   . LEU A 1  53   ? 83.679  31.410  -39.492 1.00 27.59  ? 53   LEU A N   1 
ATOM   399   C  CA  . LEU A 1  53   ? 84.410  32.238  -38.528 1.00 21.25  ? 53   LEU A CA  1 
ATOM   400   C  C   . LEU A 1  53   ? 85.291  31.278  -37.767 1.00 22.16  ? 53   LEU A C   1 
ATOM   401   O  O   . LEU A 1  53   ? 85.019  30.081  -37.718 1.00 24.25  ? 53   LEU A O   1 
ATOM   402   C  CB  . LEU A 1  53   ? 83.501  32.994  -37.552 1.00 14.50  ? 53   LEU A CB  1 
ATOM   403   C  CG  . LEU A 1  53   ? 84.252  34.106  -36.780 1.00 10.73  ? 53   LEU A CG  1 
ATOM   404   C  CD1 . LEU A 1  53   ? 83.310  35.245  -36.311 1.00 5.33   ? 53   LEU A CD1 1 
ATOM   405   C  CD2 . LEU A 1  53   ? 84.968  33.484  -35.607 1.00 5.10   ? 53   LEU A CD2 1 
ATOM   406   N  N   . ASN A 1  54   ? 86.341  31.817  -37.170 1.00 21.43  ? 54   ASN A N   1 
ATOM   407   C  CA  . ASN A 1  54   ? 87.349  31.053  -36.439 1.00 23.75  ? 54   ASN A CA  1 
ATOM   408   C  C   . ASN A 1  54   ? 87.627  29.556  -36.789 1.00 23.27  ? 54   ASN A C   1 
ATOM   409   O  O   . ASN A 1  54   ? 87.120  28.588  -36.206 1.00 17.48  ? 54   ASN A O   1 
ATOM   410   C  CB  . ASN A 1  54   ? 87.228  31.306  -34.910 1.00 22.36  ? 54   ASN A CB  1 
ATOM   411   C  CG  . ASN A 1  54   ? 86.220  30.433  -34.226 1.00 23.10  ? 54   ASN A CG  1 
ATOM   412   O  OD1 . ASN A 1  54   ? 86.565  29.708  -33.292 1.00 22.95  ? 54   ASN A OD1 1 
ATOM   413   N  ND2 . ASN A 1  54   ? 84.966  30.511  -34.656 1.00 26.89  ? 54   ASN A ND2 1 
ATOM   414   N  N   . ASP A 1  55   ? 88.498  29.468  -37.789 1.00 22.98  ? 55   ASP A N   1 
ATOM   415   C  CA  . ASP A 1  55   ? 89.102  28.307  -38.406 1.00 24.51  ? 55   ASP A CA  1 
ATOM   416   C  C   . ASP A 1  55   ? 88.741  27.926  -39.791 1.00 31.46  ? 55   ASP A C   1 
ATOM   417   O  O   . ASP A 1  55   ? 88.690  26.751  -40.126 1.00 29.00  ? 55   ASP A O   1 
ATOM   418   C  CB  . ASP A 1  55   ? 89.075  27.034  -37.586 1.00 19.06  ? 55   ASP A CB  1 
ATOM   419   C  CG  . ASP A 1  55   ? 89.845  25.909  -38.305 1.00 17.43  ? 55   ASP A CG  1 
ATOM   420   O  OD1 . ASP A 1  55   ? 91.033  26.108  -38.666 1.00 7.71   ? 55   ASP A OD1 1 
ATOM   421   O  OD2 . ASP A 1  55   ? 89.254  24.843  -38.566 1.00 17.70  ? 55   ASP A OD2 1 
ATOM   422   N  N   . PRO A 1  56   ? 88.443  28.908  -40.628 1.00 42.42  ? 56   PRO A N   1 
ATOM   423   C  CA  . PRO A 1  56   ? 88.135  28.474  -41.996 1.00 51.69  ? 56   PRO A CA  1 
ATOM   424   C  C   . PRO A 1  56   ? 89.542  28.170  -42.566 1.00 57.58  ? 56   PRO A C   1 
ATOM   425   O  O   . PRO A 1  56   ? 89.803  28.278  -43.787 1.00 52.85  ? 56   PRO A O   1 
ATOM   426   C  CB  . PRO A 1  56   ? 87.492  29.710  -42.607 1.00 52.72  ? 56   PRO A CB  1 
ATOM   427   C  CG  . PRO A 1  56   ? 86.776  30.303  -41.415 1.00 51.67  ? 56   PRO A CG  1 
ATOM   428   C  CD  . PRO A 1  56   ? 87.821  30.205  -40.324 1.00 45.01  ? 56   PRO A CD  1 
ATOM   429   N  N   . ARG A 1  57   ? 90.414  27.832  -41.596 1.00 61.79  ? 57   ARG A N   1 
ATOM   430   C  CA  . ARG A 1  57   ? 91.831  27.466  -41.700 1.00 61.65  ? 57   ARG A CA  1 
ATOM   431   C  C   . ARG A 1  57   ? 92.673  27.962  -40.517 1.00 56.65  ? 57   ARG A C   1 
ATOM   432   O  O   . ARG A 1  57   ? 93.644  27.311  -40.182 1.00 55.56  ? 57   ARG A O   1 
ATOM   433   C  CB  . ARG A 1  57   ? 92.457  27.955  -43.012 1.00 70.01  ? 57   ARG A CB  1 
ATOM   434   C  CG  . ARG A 1  57   ? 92.056  27.121  -44.207 1.00 78.74  ? 57   ARG A CG  1 
ATOM   435   C  CD  . ARG A 1  57   ? 92.593  27.666  -45.497 1.00 87.58  ? 57   ARG A CD  1 
ATOM   436   N  NE  . ARG A 1  57   ? 91.895  27.065  -46.630 1.00 98.94  ? 57   ARG A NE  1 
ATOM   437   C  CZ  . ARG A 1  57   ? 92.396  26.970  -47.859 1.00 103.44 ? 57   ARG A CZ  1 
ATOM   438   N  NH1 . ARG A 1  57   ? 93.612  27.436  -48.122 1.00 105.74 ? 57   ARG A NH1 1 
ATOM   439   N  NH2 . ARG A 1  57   ? 91.684  26.404  -48.830 1.00 105.84 ? 57   ARG A NH2 1 
ATOM   440   N  N   . LEU A 1  58   ? 92.299  29.084  -39.884 1.00 54.82  ? 58   LEU A N   1 
ATOM   441   C  CA  . LEU A 1  58   ? 93.050  29.661  -38.744 1.00 56.00  ? 58   LEU A CA  1 
ATOM   442   C  C   . LEU A 1  58   ? 93.420  28.600  -37.745 1.00 59.84  ? 58   LEU A C   1 
ATOM   443   O  O   . LEU A 1  58   ? 93.258  27.413  -38.005 1.00 62.32  ? 58   LEU A O   1 
ATOM   444   C  CB  . LEU A 1  58   ? 92.244  30.684  -37.945 1.00 52.16  ? 58   LEU A CB  1 
ATOM   445   C  CG  . LEU A 1  58   ? 91.258  31.675  -38.533 1.00 51.47  ? 58   LEU A CG  1 
ATOM   446   C  CD1 . LEU A 1  58   ? 90.707  32.510  -37.386 1.00 50.83  ? 58   LEU A CD1 1 
ATOM   447   C  CD2 . LEU A 1  58   ? 91.936  32.552  -39.561 1.00 52.45  ? 58   LEU A CD2 1 
ATOM   448   N  N   . GLY A 1  59   ? 93.877  29.039  -36.574 1.00 61.98  ? 59   GLY A N   1 
ATOM   449   C  CA  . GLY A 1  59   ? 94.253  28.095  -35.529 1.00 66.58  ? 59   GLY A CA  1 
ATOM   450   C  C   . GLY A 1  59   ? 93.135  27.120  -35.192 1.00 67.83  ? 59   GLY A C   1 
ATOM   451   O  O   . GLY A 1  59   ? 92.172  26.989  -35.950 1.00 68.36  ? 59   GLY A O   1 
ATOM   452   N  N   . SER A 1  60   ? 93.235  26.423  -34.067 1.00 69.06  ? 60   SER A N   1 
ATOM   453   C  CA  . SER A 1  60   ? 92.161  25.494  -33.737 1.00 74.04  ? 60   SER A CA  1 
ATOM   454   C  C   . SER A 1  60   ? 91.831  25.418  -32.257 1.00 77.17  ? 60   SER A C   1 
ATOM   455   O  O   . SER A 1  60   ? 92.148  26.321  -31.485 1.00 78.58  ? 60   SER A O   1 
ATOM   456   C  CB  . SER A 1  60   ? 92.485  24.087  -34.247 1.00 73.96  ? 60   SER A CB  1 
ATOM   457   O  OG  . SER A 1  60   ? 93.379  23.418  -33.373 1.00 74.90  ? 60   SER A OG  1 
ATOM   458   N  N   . ILE A 1  61   ? 91.172  24.324  -31.886 1.00 80.34  ? 61   ILE A N   1 
ATOM   459   C  CA  . ILE A 1  61   ? 90.768  24.052  -30.512 1.00 82.09  ? 61   ILE A CA  1 
ATOM   460   C  C   . ILE A 1  61   ? 90.910  22.532  -30.319 1.00 86.27  ? 61   ILE A C   1 
ATOM   461   O  O   . ILE A 1  61   ? 91.948  21.958  -30.647 1.00 86.88  ? 61   ILE A O   1 
ATOM   462   C  CB  . ILE A 1  61   ? 89.297  24.459  -30.293 1.00 77.79  ? 61   ILE A CB  1 
ATOM   463   C  CG1 . ILE A 1  61   ? 89.010  25.778  -31.002 1.00 72.15  ? 61   ILE A CG1 1 
ATOM   464   C  CG2 . ILE A 1  61   ? 89.016  24.621  -28.809 1.00 78.89  ? 61   ILE A CG2 1 
ATOM   465   C  CD1 . ILE A 1  61   ? 87.549  26.074  -31.133 1.00 68.19  ? 61   ILE A CD1 1 
ATOM   466   N  N   . ASP A 1  62   ? 89.866  21.903  -29.782 1.00 91.47  ? 62   ASP A N   1 
ATOM   467   C  CA  . ASP A 1  62   ? 89.791  20.450  -29.565 1.00 96.99  ? 62   ASP A CA  1 
ATOM   468   C  C   . ASP A 1  62   ? 91.082  19.619  -29.509 1.00 97.82  ? 62   ASP A C   1 
ATOM   469   O  O   . ASP A 1  62   ? 91.052  18.414  -29.784 1.00 99.05  ? 62   ASP A O   1 
ATOM   470   C  CB  . ASP A 1  62   ? 88.883  19.839  -30.645 1.00 101.00 ? 62   ASP A CB  1 
ATOM   471   C  CG  . ASP A 1  62   ? 87.488  19.522  -30.137 1.00 104.89 ? 62   ASP A CG  1 
ATOM   472   O  OD1 . ASP A 1  62   ? 87.364  18.647  -29.245 1.00 107.38 ? 62   ASP A OD1 1 
ATOM   473   O  OD2 . ASP A 1  62   ? 86.519  20.143  -30.633 1.00 106.24 ? 62   ASP A OD2 1 
ATOM   474   N  N   . ARG A 1  63   ? 92.202  20.221  -29.137 1.00 97.48  ? 63   ARG A N   1 
ATOM   475   C  CA  . ARG A 1  63   ? 93.441  19.466  -29.113 1.00 99.04  ? 63   ARG A CA  1 
ATOM   476   C  C   . ARG A 1  63   ? 93.605  18.718  -30.430 1.00 98.72  ? 63   ARG A C   1 
ATOM   477   O  O   . ARG A 1  63   ? 93.683  17.491  -30.444 1.00 97.13  ? 63   ARG A O   1 
ATOM   478   C  CB  . ARG A 1  63   ? 93.440  18.457  -27.968 1.00 103.87 ? 63   ARG A CB  1 
ATOM   479   C  CG  . ARG A 1  63   ? 93.275  19.055  -26.578 1.00 111.45 ? 63   ARG A CG  1 
ATOM   480   C  CD  . ARG A 1  63   ? 93.436  17.966  -25.501 1.00 117.67 ? 63   ARG A CD  1 
ATOM   481   N  NE  . ARG A 1  63   ? 93.122  18.437  -24.148 1.00 119.74 ? 63   ARG A NE  1 
ATOM   482   C  CZ  . ARG A 1  63   ? 93.188  17.681  -23.053 1.00 118.62 ? 63   ARG A CZ  1 
ATOM   483   N  NH1 . ARG A 1  63   ? 93.561  16.408  -23.136 1.00 117.43 ? 63   ARG A NH1 1 
ATOM   484   N  NH2 . ARG A 1  63   ? 92.876  18.201  -21.872 1.00 118.09 ? 63   ARG A NH2 1 
ATOM   485   N  N   . ASN A 1  64   ? 93.621  19.457  -31.536 1.00 99.98  ? 64   ASN A N   1 
ATOM   486   C  CA  . ASN A 1  64   ? 93.793  18.863  -32.862 1.00 100.95 ? 64   ASN A CA  1 
ATOM   487   C  C   . ASN A 1  64   ? 94.836  19.607  -33.659 1.00 103.05 ? 64   ASN A C   1 
ATOM   488   O  O   . ASN A 1  64   ? 94.683  20.791  -33.958 1.00 101.61 ? 64   ASN A O   1 
ATOM   489   C  CB  . ASN A 1  64   ? 92.497  18.863  -33.667 1.00 98.22  ? 64   ASN A CB  1 
ATOM   490   C  CG  . ASN A 1  64   ? 91.457  17.978  -33.069 1.00 97.76  ? 64   ASN A CG  1 
ATOM   491   O  OD1 . ASN A 1  64   ? 91.777  17.015  -32.368 1.00 97.79  ? 64   ASN A OD1 1 
ATOM   492   N  ND2 . ASN A 1  64   ? 90.196  18.282  -33.343 1.00 98.33  ? 64   ASN A ND2 1 
ATOM   493   N  N   . LEU A 1  65   ? 95.895  18.891  -34.007 1.00 106.66 ? 65   LEU A N   1 
ATOM   494   C  CA  . LEU A 1  65   ? 96.991  19.451  -34.774 1.00 109.29 ? 65   LEU A CA  1 
ATOM   495   C  C   . LEU A 1  65   ? 96.457  20.472  -35.778 1.00 109.32 ? 65   LEU A C   1 
ATOM   496   O  O   . LEU A 1  65   ? 96.742  21.669  -35.682 1.00 108.76 ? 65   LEU A O   1 
ATOM   497   C  CB  . LEU A 1  65   ? 97.735  18.327  -35.520 1.00 111.80 ? 65   LEU A CB  1 
ATOM   498   C  CG  . LEU A 1  65   ? 98.191  17.059  -34.768 1.00 114.97 ? 65   LEU A CG  1 
ATOM   499   C  CD1 . LEU A 1  65   ? 98.728  16.039  -35.779 1.00 115.64 ? 65   LEU A CD1 1 
ATOM   500   C  CD2 . LEU A 1  65   ? 99.252  17.393  -33.719 1.00 114.21 ? 65   LEU A CD2 1 
ATOM   501   N  N   . LYS A 1  66   ? 95.653  19.977  -36.716 1.00 110.22 ? 66   LYS A N   1 
ATOM   502   C  CA  . LYS A 1  66   ? 95.069  20.771  -37.797 1.00 110.61 ? 66   LYS A CA  1 
ATOM   503   C  C   . LYS A 1  66   ? 95.104  22.279  -37.611 1.00 106.90 ? 66   LYS A C   1 
ATOM   504   O  O   . LYS A 1  66   ? 94.549  22.821  -36.663 1.00 107.15 ? 66   LYS A O   1 
ATOM   505   C  CB  . LYS A 1  66   ? 93.640  20.285  -38.091 1.00 115.03 ? 66   LYS A CB  1 
ATOM   506   C  CG  . LYS A 1  66   ? 93.592  18.775  -38.414 1.00 119.73 ? 66   LYS A CG  1 
ATOM   507   C  CD  . LYS A 1  66   ? 92.451  18.382  -39.353 1.00 120.73 ? 66   LYS A CD  1 
ATOM   508   C  CE  . LYS A 1  66   ? 92.597  16.933  -39.826 1.00 120.89 ? 66   LYS A CE  1 
ATOM   509   N  NZ  . LYS A 1  66   ? 91.598  16.589  -40.879 1.00 121.22 ? 66   LYS A NZ  1 
ATOM   510   N  N   . CYS A 1  67   ? 95.784  22.939  -38.541 1.00 103.18 ? 67   CYS A N   1 
ATOM   511   C  CA  . CYS A 1  67   ? 95.949  24.381  -38.534 1.00 100.65 ? 67   CYS A CA  1 
ATOM   512   C  C   . CYS A 1  67   ? 96.566  24.675  -39.889 1.00 100.93 ? 67   CYS A C   1 
ATOM   513   O  O   . CYS A 1  67   ? 97.576  25.382  -40.000 1.00 99.28  ? 67   CYS A O   1 
ATOM   514   C  CB  . CYS A 1  67   ? 96.906  24.786  -37.416 1.00 98.86  ? 67   CYS A CB  1 
ATOM   515   S  SG  . CYS A 1  67   ? 96.748  26.501  -36.898 1.00 101.63 ? 67   CYS A SG  1 
ATOM   516   N  N   . GLN A 1  68   ? 95.925  24.119  -40.915 1.00 101.06 ? 68   GLN A N   1 
ATOM   517   C  CA  . GLN A 1  68   ? 96.384  24.223  -42.295 1.00 102.81 ? 68   GLN A CA  1 
ATOM   518   C  C   . GLN A 1  68   ? 97.638  23.365  -42.334 1.00 105.35 ? 68   GLN A C   1 
ATOM   519   O  O   . GLN A 1  68   ? 98.718  23.874  -42.670 1.00 107.48 ? 68   GLN A O   1 
ATOM   520   C  CB  . GLN A 1  68   ? 96.801  25.639  -42.674 1.00 101.63 ? 68   GLN A CB  1 
ATOM   521   C  CG  . GLN A 1  68   ? 95.871  26.732  -42.278 1.00 103.30 ? 68   GLN A CG  1 
ATOM   522   C  CD  . GLN A 1  68   ? 96.617  27.837  -41.565 1.00 103.25 ? 68   GLN A CD  1 
ATOM   523   O  OE1 . GLN A 1  68   ? 97.830  27.997  -41.736 1.00 103.93 ? 68   GLN A OE1 1 
ATOM   524   N  NE2 . GLN A 1  68   ? 95.896  28.613  -40.766 1.00 104.55 ? 68   GLN A NE2 1 
ATOM   525   N  N   . THR A 1  69   ? 97.487  22.083  -41.971 1.00 106.04 ? 69   THR A N   1 
ATOM   526   C  CA  . THR A 1  69   ? 98.578  21.082  -41.920 1.00 103.31 ? 69   THR A CA  1 
ATOM   527   C  C   . THR A 1  69   ? 99.657  21.492  -40.906 1.00 97.73  ? 69   THR A C   1 
ATOM   528   O  O   . THR A 1  69   ? 100.247 20.644  -40.223 1.00 93.44  ? 69   THR A O   1 
ATOM   529   C  CB  . THR A 1  69   ? 99.243  20.859  -43.328 1.00 106.69 ? 69   THR A CB  1 
ATOM   530   O  OG1 . THR A 1  69   ? 98.258  20.398  -44.268 1.00 106.98 ? 69   THR A OG1 1 
ATOM   531   C  CG2 . THR A 1  69   ? 100.365 19.818  -43.238 1.00 108.07 ? 69   THR A CG2 1 
ATOM   532   N  N   . CYS A 1  70   ? 99.888  22.804  -40.831 1.00 91.11  ? 70   CYS A N   1 
ATOM   533   C  CA  . CYS A 1  70   ? 100.841 23.424  -39.933 1.00 81.48  ? 70   CYS A CA  1 
ATOM   534   C  C   . CYS A 1  70   ? 100.906 22.637  -38.642 1.00 81.27  ? 70   CYS A C   1 
ATOM   535   O  O   . CYS A 1  70   ? 101.879 22.714  -37.914 1.00 79.31  ? 70   CYS A O   1 
ATOM   536   C  CB  . CYS A 1  70   ? 100.401 24.857  -39.654 1.00 75.40  ? 70   CYS A CB  1 
ATOM   537   S  SG  . CYS A 1  70   ? 101.090 25.550  -38.157 1.00 68.84  ? 70   CYS A SG  1 
ATOM   538   N  N   . GLN A 1  71   ? 99.860  21.870  -38.374 1.00 82.82  ? 71   GLN A N   1 
ATOM   539   C  CA  . GLN A 1  71   ? 99.792  21.061  -37.179 1.00 86.77  ? 71   GLN A CA  1 
ATOM   540   C  C   . GLN A 1  71   ? 100.413 21.790  -36.004 1.00 85.08  ? 71   GLN A C   1 
ATOM   541   O  O   . GLN A 1  71   ? 100.066 22.930  -35.736 1.00 83.86  ? 71   GLN A O   1 
ATOM   542   C  CB  . GLN A 1  71   ? 100.476 19.706  -37.404 1.00 93.85  ? 71   GLN A CB  1 
ATOM   543   C  CG  . GLN A 1  71   ? 101.908 19.759  -37.926 1.00 105.46 ? 71   GLN A CG  1 
ATOM   544   C  CD  . GLN A 1  71   ? 102.547 18.371  -38.026 1.00 110.93 ? 71   GLN A CD  1 
ATOM   545   O  OE1 . GLN A 1  71   ? 102.653 17.649  -37.027 1.00 113.83 ? 71   GLN A OE1 1 
ATOM   546   N  NE2 . GLN A 1  71   ? 102.975 17.995  -39.234 1.00 114.11 ? 71   GLN A NE2 1 
ATOM   547   N  N   . GLU A 1  72   ? 101.332 21.134  -35.308 1.00 84.24  ? 72   GLU A N   1 
ATOM   548   C  CA  . GLU A 1  72   ? 101.983 21.726  -34.149 1.00 84.04  ? 72   GLU A CA  1 
ATOM   549   C  C   . GLU A 1  72   ? 100.916 21.963  -33.076 1.00 83.79  ? 72   GLU A C   1 
ATOM   550   O  O   . GLU A 1  72   ? 101.215 22.019  -31.885 1.00 85.11  ? 72   GLU A O   1 
ATOM   551   C  CB  . GLU A 1  72   ? 102.660 23.039  -34.540 1.00 84.07  ? 72   GLU A CB  1 
ATOM   552   C  CG  . GLU A 1  72   ? 103.471 22.980  -35.837 1.00 81.35  ? 72   GLU A CG  1 
ATOM   553   C  CD  . GLU A 1  72   ? 104.639 22.015  -35.785 1.00 80.19  ? 72   GLU A CD  1 
ATOM   554   O  OE1 . GLU A 1  72   ? 104.858 21.408  -34.711 1.00 82.03  ? 72   GLU A OE1 1 
ATOM   555   O  OE2 . GLU A 1  72   ? 105.338 21.872  -36.819 1.00 78.38  ? 72   GLU A OE2 1 
ATOM   556   N  N   . GLY A 1  73   ? 99.673  22.093  -33.529 1.00 82.06  ? 73   GLY A N   1 
ATOM   557   C  CA  . GLY A 1  73   ? 98.525  22.280  -32.661 1.00 82.38  ? 73   GLY A CA  1 
ATOM   558   C  C   . GLY A 1  73   ? 98.637  23.041  -31.356 1.00 83.88  ? 73   GLY A C   1 
ATOM   559   O  O   . GLY A 1  73   ? 99.695  23.123  -30.735 1.00 81.61  ? 73   GLY A O   1 
ATOM   560   N  N   . MET A 1  74   ? 97.494  23.584  -30.942 1.00 87.06  ? 74   MET A N   1 
ATOM   561   C  CA  . MET A 1  74   ? 97.357  24.364  -29.716 1.00 88.46  ? 74   MET A CA  1 
ATOM   562   C  C   . MET A 1  74   ? 98.670  25.054  -29.348 1.00 84.92  ? 74   MET A C   1 
ATOM   563   O  O   . MET A 1  74   ? 98.981  26.127  -29.867 1.00 84.53  ? 74   MET A O   1 
ATOM   564   C  CB  . MET A 1  74   ? 96.886  23.453  -28.574 1.00 96.97  ? 74   MET A CB  1 
ATOM   565   C  CG  . MET A 1  74   ? 95.712  22.516  -28.951 1.00 108.01 ? 74   MET A CG  1 
ATOM   566   S  SD  . MET A 1  74   ? 95.291  21.191  -27.721 1.00 118.83 ? 74   MET A SD  1 
ATOM   567   C  CE  . MET A 1  74   ? 96.479  19.853  -28.174 1.00 115.91 ? 74   MET A CE  1 
ATOM   568   N  N   . ASN A 1  75   ? 99.449  24.437  -28.468 1.00 81.06  ? 75   ASN A N   1 
ATOM   569   C  CA  . ASN A 1  75   ? 100.717 25.025  -28.057 1.00 75.67  ? 75   ASN A CA  1 
ATOM   570   C  C   . ASN A 1  75   ? 101.790 24.790  -29.109 1.00 70.76  ? 75   ASN A C   1 
ATOM   571   O  O   . ASN A 1  75   ? 102.083 23.645  -29.444 1.00 71.00  ? 75   ASN A O   1 
ATOM   572   C  CB  . ASN A 1  75   ? 101.179 24.426  -26.729 1.00 78.30  ? 75   ASN A CB  1 
ATOM   573   C  CG  . ASN A 1  75   ? 102.353 25.178  -26.135 1.00 79.38  ? 75   ASN A CG  1 
ATOM   574   O  OD1 . ASN A 1  75   ? 103.262 25.600  -26.853 1.00 79.59  ? 75   ASN A OD1 1 
ATOM   575   N  ND2 . ASN A 1  75   ? 102.345 25.344  -24.817 1.00 80.40  ? 75   ASN A ND2 1 
ATOM   576   N  N   . GLU A 1  76   ? 102.364 25.887  -29.609 1.00 63.86  ? 76   GLU A N   1 
ATOM   577   C  CA  . GLU A 1  76   ? 103.425 25.902  -30.633 1.00 57.06  ? 76   GLU A CA  1 
ATOM   578   C  C   . GLU A 1  76   ? 102.916 26.445  -31.959 1.00 50.66  ? 76   GLU A C   1 
ATOM   579   O  O   . GLU A 1  76   ? 103.584 26.348  -32.986 1.00 46.88  ? 76   GLU A O   1 
ATOM   580   C  CB  . GLU A 1  76   ? 104.041 24.505  -30.836 1.00 58.43  ? 76   GLU A CB  1 
ATOM   581   C  CG  . GLU A 1  76   ? 104.997 24.338  -32.036 1.00 57.53  ? 76   GLU A CG  1 
ATOM   582   C  CD  . GLU A 1  76   ? 106.098 25.391  -32.117 1.00 58.84  ? 76   GLU A CD  1 
ATOM   583   O  OE1 . GLU A 1  76   ? 106.841 25.575  -31.122 1.00 59.61  ? 76   GLU A OE1 1 
ATOM   584   O  OE2 . GLU A 1  76   ? 106.224 26.026  -33.193 1.00 57.17  ? 76   GLU A OE2 1 
ATOM   585   N  N   . CYS A 1  77   ? 101.729 27.032  -31.929 1.00 46.79  ? 77   CYS A N   1 
ATOM   586   C  CA  . CYS A 1  77   ? 101.144 27.592  -33.136 1.00 42.48  ? 77   CYS A CA  1 
ATOM   587   C  C   . CYS A 1  77   ? 100.390 28.888  -32.912 1.00 40.28  ? 77   CYS A C   1 
ATOM   588   O  O   . CYS A 1  77   ? 99.263  28.876  -32.401 1.00 39.60  ? 77   CYS A O   1 
ATOM   589   C  CB  . CYS A 1  77   ? 100.184 26.605  -33.785 1.00 41.54  ? 77   CYS A CB  1 
ATOM   590   S  SG  . CYS A 1  77   ? 99.100  27.395  -34.968 1.00 40.23  ? 77   CYS A SG  1 
ATOM   591   N  N   . PRO A 1  78   ? 101.002 30.026  -33.295 1.00 38.53  ? 78   PRO A N   1 
ATOM   592   C  CA  . PRO A 1  78   ? 100.407 31.358  -33.160 1.00 37.36  ? 78   PRO A CA  1 
ATOM   593   C  C   . PRO A 1  78   ? 99.321  31.398  -34.197 1.00 37.48  ? 78   PRO A C   1 
ATOM   594   O  O   . PRO A 1  78   ? 99.580  31.087  -35.351 1.00 40.20  ? 78   PRO A O   1 
ATOM   595   C  CB  . PRO A 1  78   ? 101.544 32.269  -33.553 1.00 36.79  ? 78   PRO A CB  1 
ATOM   596   C  CG  . PRO A 1  78   ? 102.238 31.457  -34.627 1.00 36.41  ? 78   PRO A CG  1 
ATOM   597   C  CD  . PRO A 1  78   ? 102.327 30.126  -33.934 1.00 36.15  ? 78   PRO A CD  1 
ATOM   598   N  N   . GLY A 1  79   ? 98.112  31.768  -33.820 1.00 39.90  ? 79   GLY A N   1 
ATOM   599   C  CA  . GLY A 1  79   ? 97.064  31.780  -34.821 1.00 43.75  ? 79   GLY A CA  1 
ATOM   600   C  C   . GLY A 1  79   ? 97.520  32.446  -36.104 1.00 45.76  ? 79   GLY A C   1 
ATOM   601   O  O   . GLY A 1  79   ? 98.643  32.945  -36.202 1.00 48.99  ? 79   GLY A O   1 
ATOM   602   N  N   . HIS A 1  80   ? 96.657  32.450  -37.108 1.00 43.74  ? 80   HIS A N   1 
ATOM   603   C  CA  . HIS A 1  80   ? 96.996  33.112  -38.359 1.00 39.75  ? 80   HIS A CA  1 
ATOM   604   C  C   . HIS A 1  80   ? 95.884  34.084  -38.615 1.00 38.67  ? 80   HIS A C   1 
ATOM   605   O  O   . HIS A 1  80   ? 94.753  33.862  -38.182 1.00 43.58  ? 80   HIS A O   1 
ATOM   606   C  CB  . HIS A 1  80   ? 97.056  32.109  -39.477 1.00 38.25  ? 80   HIS A CB  1 
ATOM   607   C  CG  . HIS A 1  80   ? 97.875  30.917  -39.137 1.00 34.75  ? 80   HIS A CG  1 
ATOM   608   N  ND1 . HIS A 1  80   ? 99.250  30.948  -39.122 1.00 32.20  ? 80   HIS A ND1 1 
ATOM   609   C  CD2 . HIS A 1  80   ? 97.516  29.669  -38.749 1.00 32.33  ? 80   HIS A CD2 1 
ATOM   610   C  CE1 . HIS A 1  80   ? 99.704  29.766  -38.743 1.00 35.25  ? 80   HIS A CE1 1 
ATOM   611   N  NE2 . HIS A 1  80   ? 98.670  28.973  -38.511 1.00 33.61  ? 80   HIS A NE2 1 
ATOM   612   N  N   . PHE A 1  81   ? 96.184  35.162  -39.316 1.00 34.19  ? 81   PHE A N   1 
ATOM   613   C  CA  . PHE A 1  81   ? 95.142  36.125  -39.559 1.00 31.52  ? 81   PHE A CA  1 
ATOM   614   C  C   . PHE A 1  81   ? 94.268  35.860  -40.749 1.00 31.63  ? 81   PHE A C   1 
ATOM   615   O  O   . PHE A 1  81   ? 94.718  35.446  -41.816 1.00 35.08  ? 81   PHE A O   1 
ATOM   616   C  CB  . PHE A 1  81   ? 95.708  37.530  -39.652 1.00 30.45  ? 81   PHE A CB  1 
ATOM   617   C  CG  . PHE A 1  81   ? 95.891  38.163  -38.333 1.00 30.03  ? 81   PHE A CG  1 
ATOM   618   C  CD1 . PHE A 1  81   ? 97.017  37.892  -37.572 1.00 32.51  ? 81   PHE A CD1 1 
ATOM   619   C  CD2 . PHE A 1  81   ? 94.913  38.987  -37.821 1.00 32.19  ? 81   PHE A CD2 1 
ATOM   620   C  CE1 . PHE A 1  81   ? 97.168  38.431  -36.304 1.00 35.18  ? 81   PHE A CE1 1 
ATOM   621   C  CE2 . PHE A 1  81   ? 95.044  39.534  -36.561 1.00 36.23  ? 81   PHE A CE2 1 
ATOM   622   C  CZ  . PHE A 1  81   ? 96.179  39.257  -35.793 1.00 37.73  ? 81   PHE A CZ  1 
ATOM   623   N  N   . GLY A 1  82   ? 92.987  36.085  -40.511 1.00 30.16  ? 82   GLY A N   1 
ATOM   624   C  CA  . GLY A 1  82   ? 91.993  35.935  -41.535 1.00 30.81  ? 82   GLY A CA  1 
ATOM   625   C  C   . GLY A 1  82   ? 91.553  37.361  -41.770 1.00 33.75  ? 82   GLY A C   1 
ATOM   626   O  O   . GLY A 1  82   ? 91.819  38.246  -40.950 1.00 33.37  ? 82   GLY A O   1 
ATOM   627   N  N   . HIS A 1  83   ? 90.890  37.592  -42.894 1.00 35.14  ? 83   HIS A N   1 
ATOM   628   C  CA  . HIS A 1  83   ? 90.419  38.921  -43.229 1.00 34.13  ? 83   HIS A CA  1 
ATOM   629   C  C   . HIS A 1  83   ? 88.920  38.874  -43.415 1.00 34.04  ? 83   HIS A C   1 
ATOM   630   O  O   . HIS A 1  83   ? 88.315  37.800  -43.399 1.00 31.90  ? 83   HIS A O   1 
ATOM   631   C  CB  . HIS A 1  83   ? 91.053  39.395  -44.519 1.00 34.05  ? 83   HIS A CB  1 
ATOM   632   C  CG  . HIS A 1  83   ? 90.568  38.655  -45.713 1.00 31.31  ? 83   HIS A CG  1 
ATOM   633   N  ND1 . HIS A 1  83   ? 90.384  39.261  -46.935 1.00 31.09  ? 83   HIS A ND1 1 
ATOM   634   C  CD2 . HIS A 1  83   ? 90.202  37.363  -45.870 1.00 32.47  ? 83   HIS A CD2 1 
ATOM   635   C  CE1 . HIS A 1  83   ? 89.919  38.373  -47.795 1.00 34.48  ? 83   HIS A CE1 1 
ATOM   636   N  NE2 . HIS A 1  83   ? 89.800  37.212  -47.173 1.00 35.21  ? 83   HIS A NE2 1 
ATOM   637   N  N   . ILE A 1  84   ? 88.332  40.043  -43.630 1.00 35.49  ? 84   ILE A N   1 
ATOM   638   C  CA  . ILE A 1  84   ? 86.893  40.155  -43.793 1.00 39.42  ? 84   ILE A CA  1 
ATOM   639   C  C   . ILE A 1  84   ? 86.562  41.449  -44.533 1.00 43.54  ? 84   ILE A C   1 
ATOM   640   O  O   . ILE A 1  84   ? 86.430  42.506  -43.922 1.00 45.68  ? 84   ILE A O   1 
ATOM   641   C  CB  . ILE A 1  84   ? 86.214  40.113  -42.395 1.00 36.62  ? 84   ILE A CB  1 
ATOM   642   C  CG1 . ILE A 1  84   ? 84.739  40.452  -42.495 1.00 36.13  ? 84   ILE A CG1 1 
ATOM   643   C  CG2 . ILE A 1  84   ? 86.901  41.064  -41.451 1.00 35.75  ? 84   ILE A CG2 1 
ATOM   644   C  CD1 . ILE A 1  84   ? 84.055  40.365  -41.160 1.00 33.84  ? 84   ILE A CD1 1 
ATOM   645   N  N   . ASP A 1  85   ? 86.441  41.352  -45.855 1.00 47.48  ? 85   ASP A N   1 
ATOM   646   C  CA  . ASP A 1  85   ? 86.140  42.506  -46.704 1.00 48.29  ? 85   ASP A CA  1 
ATOM   647   C  C   . ASP A 1  85   ? 84.895  43.266  -46.265 1.00 48.56  ? 85   ASP A C   1 
ATOM   648   O  O   . ASP A 1  85   ? 83.798  42.695  -46.240 1.00 49.66  ? 85   ASP A O   1 
ATOM   649   C  CB  . ASP A 1  85   ? 85.944  42.066  -48.157 1.00 48.12  ? 85   ASP A CB  1 
ATOM   650   C  CG  . ASP A 1  85   ? 87.168  41.386  -48.734 1.00 48.61  ? 85   ASP A CG  1 
ATOM   651   O  OD1 . ASP A 1  85   ? 88.258  42.004  -48.737 1.00 46.07  ? 85   ASP A OD1 1 
ATOM   652   O  OD2 . ASP A 1  85   ? 87.034  40.228  -49.191 1.00 49.12  ? 85   ASP A OD2 1 
ATOM   653   N  N   . LEU A 1  86   ? 85.073  44.550  -45.934 1.00 47.15  ? 86   LEU A N   1 
ATOM   654   C  CA  . LEU A 1  86   ? 83.975  45.428  -45.511 1.00 45.90  ? 86   LEU A CA  1 
ATOM   655   C  C   . LEU A 1  86   ? 83.233  45.842  -46.769 1.00 46.63  ? 86   LEU A C   1 
ATOM   656   O  O   . LEU A 1  86   ? 83.844  45.928  -47.831 1.00 50.63  ? 86   LEU A O   1 
ATOM   657   C  CB  . LEU A 1  86   ? 84.519  46.682  -44.827 1.00 43.13  ? 86   LEU A CB  1 
ATOM   658   C  CG  . LEU A 1  86   ? 85.409  46.517  -43.592 1.00 42.39  ? 86   LEU A CG  1 
ATOM   659   C  CD1 . LEU A 1  86   ? 85.822  47.885  -43.086 1.00 40.65  ? 86   LEU A CD1 1 
ATOM   660   C  CD2 . LEU A 1  86   ? 84.668  45.770  -42.503 1.00 41.89  ? 86   LEU A CD2 1 
ATOM   661   N  N   . ALA A 1  87   ? 81.931  46.101  -46.666 1.00 46.07  ? 87   ALA A N   1 
ATOM   662   C  CA  . ALA A 1  87   ? 81.159  46.504  -47.846 1.00 47.24  ? 87   ALA A CA  1 
ATOM   663   C  C   . ALA A 1  87   ? 81.460  47.958  -48.251 1.00 48.04  ? 87   ALA A C   1 
ATOM   664   O  O   . ALA A 1  87   ? 81.577  48.280  -49.447 1.00 49.24  ? 87   ALA A O   1 
ATOM   665   C  CB  . ALA A 1  87   ? 79.673  46.325  -47.586 1.00 47.67  ? 87   ALA A CB  1 
ATOM   666   N  N   . LYS A 1  88   ? 81.578  48.829  -47.249 1.00 45.79  ? 88   LYS A N   1 
ATOM   667   C  CA  . LYS A 1  88   ? 81.892  50.233  -47.480 1.00 44.43  ? 88   LYS A CA  1 
ATOM   668   C  C   . LYS A 1  88   ? 82.867  50.733  -46.428 1.00 40.30  ? 88   LYS A C   1 
ATOM   669   O  O   . LYS A 1  88   ? 82.611  50.624  -45.236 1.00 40.69  ? 88   LYS A O   1 
ATOM   670   C  CB  . LYS A 1  88   ? 80.629  51.093  -47.451 1.00 48.27  ? 88   LYS A CB  1 
ATOM   671   C  CG  . LYS A 1  88   ? 80.009  51.335  -48.824 1.00 54.91  ? 88   LYS A CG  1 
ATOM   672   C  CD  . LYS A 1  88   ? 78.825  52.311  -48.749 1.00 58.26  ? 88   LYS A CD  1 
ATOM   673   C  CE  . LYS A 1  88   ? 78.214  52.564  -50.133 1.00 61.48  ? 88   LYS A CE  1 
ATOM   674   N  NZ  . LYS A 1  88   ? 77.020  53.464  -50.095 1.00 60.27  ? 88   LYS A NZ  1 
ATOM   675   N  N   . PRO A 1  89   ? 84.006  51.284  -46.867 1.00 37.03  ? 89   PRO A N   1 
ATOM   676   C  CA  . PRO A 1  89   ? 85.090  51.834  -46.048 1.00 32.98  ? 89   PRO A CA  1 
ATOM   677   C  C   . PRO A 1  89   ? 84.650  52.462  -44.737 1.00 29.76  ? 89   PRO A C   1 
ATOM   678   O  O   . PRO A 1  89   ? 83.547  52.976  -44.623 1.00 28.11  ? 89   PRO A O   1 
ATOM   679   C  CB  . PRO A 1  89   ? 85.766  52.831  -46.984 1.00 33.15  ? 89   PRO A CB  1 
ATOM   680   C  CG  . PRO A 1  89   ? 84.933  52.786  -48.288 1.00 37.94  ? 89   PRO A CG  1 
ATOM   681   C  CD  . PRO A 1  89   ? 84.318  51.442  -48.292 1.00 38.01  ? 89   PRO A CD  1 
ATOM   682   N  N   . VAL A 1  90   ? 85.534  52.429  -43.749 1.00 27.53  ? 90   VAL A N   1 
ATOM   683   C  CA  . VAL A 1  90   ? 85.219  52.947  -42.431 1.00 23.92  ? 90   VAL A CA  1 
ATOM   684   C  C   . VAL A 1  90   ? 86.334  53.768  -41.788 1.00 25.82  ? 90   VAL A C   1 
ATOM   685   O  O   . VAL A 1  90   ? 87.461  53.825  -42.279 1.00 27.21  ? 90   VAL A O   1 
ATOM   686   C  CB  . VAL A 1  90   ? 84.874  51.778  -41.514 1.00 20.52  ? 90   VAL A CB  1 
ATOM   687   C  CG1 . VAL A 1  90   ? 84.618  52.250  -40.122 1.00 21.17  ? 90   VAL A CG1 1 
ATOM   688   C  CG2 . VAL A 1  90   ? 83.669  51.070  -42.049 1.00 20.14  ? 90   VAL A CG2 1 
ATOM   689   N  N   . PHE A 1  91   ? 86.002  54.412  -40.679 1.00 26.36  ? 91   PHE A N   1 
ATOM   690   C  CA  . PHE A 1  91   ? 86.956  55.222  -39.945 1.00 28.99  ? 91   PHE A CA  1 
ATOM   691   C  C   . PHE A 1  91   ? 87.657  54.350  -38.941 1.00 29.91  ? 91   PHE A C   1 
ATOM   692   O  O   . PHE A 1  91   ? 87.161  53.293  -38.585 1.00 31.46  ? 91   PHE A O   1 
ATOM   693   C  CB  . PHE A 1  91   ? 86.230  56.367  -39.236 1.00 31.22  ? 91   PHE A CB  1 
ATOM   694   C  CG  . PHE A 1  91   ? 86.059  57.593  -40.095 1.00 36.64  ? 91   PHE A CG  1 
ATOM   695   C  CD1 . PHE A 1  91   ? 85.840  57.473  -41.472 1.00 38.98  ? 91   PHE A CD1 1 
ATOM   696   C  CD2 . PHE A 1  91   ? 86.156  58.861  -39.548 1.00 37.44  ? 91   PHE A CD2 1 
ATOM   697   C  CE1 . PHE A 1  91   ? 85.727  58.595  -42.290 1.00 39.07  ? 91   PHE A CE1 1 
ATOM   698   C  CE2 . PHE A 1  91   ? 86.042  59.982  -40.364 1.00 40.16  ? 91   PHE A CE2 1 
ATOM   699   C  CZ  . PHE A 1  91   ? 85.830  59.846  -41.740 1.00 37.56  ? 91   PHE A CZ  1 
ATOM   700   N  N   . HIS A 1  92   ? 88.819  54.774  -38.487 1.00 31.62  ? 92   HIS A N   1 
ATOM   701   C  CA  . HIS A 1  92   ? 89.525  53.979  -37.512 1.00 35.21  ? 92   HIS A CA  1 
ATOM   702   C  C   . HIS A 1  92   ? 89.450  54.636  -36.155 1.00 36.10  ? 92   HIS A C   1 
ATOM   703   O  O   . HIS A 1  92   ? 90.366  55.324  -35.750 1.00 35.94  ? 92   HIS A O   1 
ATOM   704   C  CB  . HIS A 1  92   ? 90.987  53.802  -37.913 1.00 39.69  ? 92   HIS A CB  1 
ATOM   705   C  CG  . HIS A 1  92   ? 91.783  52.993  -36.934 1.00 42.75  ? 92   HIS A CG  1 
ATOM   706   N  ND1 . HIS A 1  92   ? 93.138  52.776  -37.072 1.00 43.87  ? 92   HIS A ND1 1 
ATOM   707   C  CD2 . HIS A 1  92   ? 91.418  52.357  -35.795 1.00 42.56  ? 92   HIS A CD2 1 
ATOM   708   C  CE1 . HIS A 1  92   ? 93.571  52.043  -36.062 1.00 43.33  ? 92   HIS A CE1 1 
ATOM   709   N  NE2 . HIS A 1  92   ? 92.547  51.776  -35.272 1.00 41.81  ? 92   HIS A NE2 1 
ATOM   710   N  N   . VAL A 1  93   ? 88.344  54.428  -35.466 1.00 36.51  ? 93   VAL A N   1 
ATOM   711   C  CA  . VAL A 1  93   ? 88.138  54.966  -34.132 1.00 39.61  ? 93   VAL A CA  1 
ATOM   712   C  C   . VAL A 1  93   ? 89.242  55.866  -33.605 1.00 40.97  ? 93   VAL A C   1 
ATOM   713   O  O   . VAL A 1  93   ? 88.996  57.020  -33.272 1.00 44.74  ? 93   VAL A O   1 
ATOM   714   C  CB  . VAL A 1  93   ? 87.987  53.841  -33.141 1.00 41.29  ? 93   VAL A CB  1 
ATOM   715   C  CG1 . VAL A 1  93   ? 86.871  54.152  -32.165 1.00 44.24  ? 93   VAL A CG1 1 
ATOM   716   C  CG2 . VAL A 1  93   ? 87.742  52.548  -33.891 1.00 43.01  ? 93   VAL A CG2 1 
ATOM   717   N  N   . GLY A 1  94   ? 90.452  55.327  -33.498 1.00 42.06  ? 94   GLY A N   1 
ATOM   718   C  CA  . GLY A 1  94   ? 91.570  56.113  -33.002 1.00 45.70  ? 94   GLY A CA  1 
ATOM   719   C  C   . GLY A 1  94   ? 92.078  57.184  -33.964 1.00 48.47  ? 94   GLY A C   1 
ATOM   720   O  O   . GLY A 1  94   ? 92.450  58.289  -33.549 1.00 48.90  ? 94   GLY A O   1 
ATOM   721   N  N   . PHE A 1  95   ? 92.085  56.872  -35.256 1.00 49.12  ? 95   PHE A N   1 
ATOM   722   C  CA  . PHE A 1  95   ? 92.578  57.810  -36.259 1.00 50.08  ? 95   PHE A CA  1 
ATOM   723   C  C   . PHE A 1  95   ? 91.635  58.913  -36.719 1.00 51.21  ? 95   PHE A C   1 
ATOM   724   O  O   . PHE A 1  95   ? 92.051  59.791  -37.474 1.00 53.24  ? 95   PHE A O   1 
ATOM   725   C  CB  . PHE A 1  95   ? 93.116  57.040  -37.474 1.00 49.20  ? 95   PHE A CB  1 
ATOM   726   C  CG  . PHE A 1  95   ? 94.431  56.367  -37.211 1.00 49.56  ? 95   PHE A CG  1 
ATOM   727   C  CD1 . PHE A 1  95   ? 95.139  55.763  -38.229 1.00 50.76  ? 95   PHE A CD1 1 
ATOM   728   C  CD2 . PHE A 1  95   ? 94.981  56.370  -35.927 1.00 50.61  ? 95   PHE A CD2 1 
ATOM   729   C  CE1 . PHE A 1  95   ? 96.386  55.173  -37.975 1.00 52.87  ? 95   PHE A CE1 1 
ATOM   730   C  CE2 . PHE A 1  95   ? 96.221  55.784  -35.661 1.00 48.98  ? 95   PHE A CE2 1 
ATOM   731   C  CZ  . PHE A 1  95   ? 96.925  55.187  -36.682 1.00 49.45  ? 95   PHE A CZ  1 
ATOM   732   N  N   . ILE A 1  96   ? 90.379  58.879  -36.272 1.00 52.67  ? 96   ILE A N   1 
ATOM   733   C  CA  . ILE A 1  96   ? 89.403  59.911  -36.644 1.00 51.16  ? 96   ILE A CA  1 
ATOM   734   C  C   . ILE A 1  96   ? 90.082  61.256  -36.447 1.00 51.99  ? 96   ILE A C   1 
ATOM   735   O  O   . ILE A 1  96   ? 90.031  62.136  -37.317 1.00 50.10  ? 96   ILE A O   1 
ATOM   736   C  CB  . ILE A 1  96   ? 88.151  59.841  -35.751 1.00 49.40  ? 96   ILE A CB  1 
ATOM   737   C  CG1 . ILE A 1  96   ? 87.261  58.693  -36.215 1.00 50.44  ? 96   ILE A CG1 1 
ATOM   738   C  CG2 . ILE A 1  96   ? 87.401  61.146  -35.795 1.00 45.61  ? 96   ILE A CG2 1 
ATOM   739   C  CD1 . ILE A 1  96   ? 86.096  58.422  -35.299 1.00 55.34  ? 96   ILE A CD1 1 
ATOM   740   N  N   . ALA A 1  97   ? 90.729  61.389  -35.292 1.00 52.43  ? 97   ALA A N   1 
ATOM   741   C  CA  . ALA A 1  97   ? 91.459  62.594  -34.948 1.00 51.33  ? 97   ALA A CA  1 
ATOM   742   C  C   . ALA A 1  97   ? 92.208  63.089  -36.183 1.00 49.75  ? 97   ALA A C   1 
ATOM   743   O  O   . ALA A 1  97   ? 91.804  64.075  -36.795 1.00 47.83  ? 97   ALA A O   1 
ATOM   744   C  CB  . ALA A 1  97   ? 92.435  62.297  -33.820 1.00 53.45  ? 97   ALA A CB  1 
ATOM   745   N  N   . LYS A 1  98   ? 93.278  62.391  -36.564 1.00 49.29  ? 98   LYS A N   1 
ATOM   746   C  CA  . LYS A 1  98   ? 94.062  62.803  -37.725 1.00 50.09  ? 98   LYS A CA  1 
ATOM   747   C  C   . LYS A 1  98   ? 93.310  62.836  -39.047 1.00 49.75  ? 98   LYS A C   1 
ATOM   748   O  O   . LYS A 1  98   ? 93.443  63.803  -39.796 1.00 50.43  ? 98   LYS A O   1 
ATOM   749   C  CB  . LYS A 1  98   ? 95.324  61.943  -37.895 1.00 50.75  ? 98   LYS A CB  1 
ATOM   750   C  CG  . LYS A 1  98   ? 96.495  62.352  -36.999 1.00 55.95  ? 98   LYS A CG  1 
ATOM   751   C  CD  . LYS A 1  98   ? 97.843  61.859  -37.559 1.00 61.20  ? 98   LYS A CD  1 
ATOM   752   C  CE  . LYS A 1  98   ? 99.038  62.199  -36.634 1.00 62.48  ? 98   LYS A CE  1 
ATOM   753   N  NZ  . LYS A 1  98   ? 100.386 61.843  -37.216 1.00 62.48  ? 98   LYS A NZ  1 
ATOM   754   N  N   . ILE A 1  99   ? 92.522  61.806  -39.348 1.00 48.58  ? 99   ILE A N   1 
ATOM   755   C  CA  . ILE A 1  99   ? 91.805  61.793  -40.622 1.00 46.48  ? 99   ILE A CA  1 
ATOM   756   C  C   . ILE A 1  99   ? 91.180  63.168  -40.812 1.00 47.32  ? 99   ILE A C   1 
ATOM   757   O  O   . ILE A 1  99   ? 91.205  63.734  -41.910 1.00 45.92  ? 99   ILE A O   1 
ATOM   758   C  CB  . ILE A 1  99   ? 90.689  60.715  -40.676 1.00 44.57  ? 99   ILE A CB  1 
ATOM   759   C  CG1 . ILE A 1  99   ? 91.194  59.377  -40.148 1.00 43.16  ? 99   ILE A CG1 1 
ATOM   760   C  CG2 . ILE A 1  99   ? 90.281  60.472  -42.122 1.00 45.25  ? 99   ILE A CG2 1 
ATOM   761   C  CD1 . ILE A 1  99   ? 90.177  58.276  -40.290 1.00 42.88  ? 99   ILE A CD1 1 
ATOM   762   N  N   . LYS A 1  100  ? 90.634  63.709  -39.727 1.00 50.23  ? 100  LYS A N   1 
ATOM   763   C  CA  . LYS A 1  100  ? 90.030  65.032  -39.774 1.00 54.10  ? 100  LYS A CA  1 
ATOM   764   C  C   . LYS A 1  100  ? 91.147  66.013  -40.099 1.00 54.48  ? 100  LYS A C   1 
ATOM   765   O  O   . LYS A 1  100  ? 91.311  66.418  -41.251 1.00 55.00  ? 100  LYS A O   1 
ATOM   766   C  CB  . LYS A 1  100  ? 89.401  65.407  -38.420 1.00 57.42  ? 100  LYS A CB  1 
ATOM   767   C  CG  . LYS A 1  100  ? 88.602  66.725  -38.436 1.00 58.68  ? 100  LYS A CG  1 
ATOM   768   C  CD  . LYS A 1  100  ? 89.071  67.728  -37.384 1.00 62.26  ? 100  LYS A CD  1 
ATOM   769   C  CE  . LYS A 1  100  ? 88.587  67.367  -35.988 1.00 67.39  ? 100  LYS A CE  1 
ATOM   770   N  NZ  . LYS A 1  100  ? 89.136  68.289  -34.942 1.00 71.98  ? 100  LYS A NZ  1 
ATOM   771   N  N   . LYS A 1  101  ? 91.922  66.368  -39.077 1.00 54.97  ? 101  LYS A N   1 
ATOM   772   C  CA  . LYS A 1  101  ? 93.017  67.306  -39.241 1.00 57.89  ? 101  LYS A CA  1 
ATOM   773   C  C   . LYS A 1  101  ? 93.630  67.241  -40.631 1.00 59.11  ? 101  LYS A C   1 
ATOM   774   O  O   . LYS A 1  101  ? 93.855  68.276  -41.253 1.00 60.40  ? 101  LYS A O   1 
ATOM   775   C  CB  . LYS A 1  101  ? 94.085  67.084  -38.164 1.00 58.63  ? 101  LYS A CB  1 
ATOM   776   C  CG  . LYS A 1  101  ? 93.655  67.576  -36.779 1.00 60.14  ? 101  LYS A CG  1 
ATOM   777   C  CD  . LYS A 1  101  ? 94.809  67.580  -35.769 1.00 61.05  ? 101  LYS A CD  1 
ATOM   778   C  CE  . LYS A 1  101  ? 94.354  68.081  -34.386 1.00 62.15  ? 101  LYS A CE  1 
ATOM   779   N  NZ  . LYS A 1  101  ? 95.413  68.000  -33.326 1.00 58.81  ? 101  LYS A NZ  1 
ATOM   780   N  N   . VAL A 1  102  ? 93.880  66.041  -41.138 1.00 59.93  ? 102  VAL A N   1 
ATOM   781   C  CA  . VAL A 1  102  ? 94.449  65.932  -42.474 1.00 62.17  ? 102  VAL A CA  1 
ATOM   782   C  C   . VAL A 1  102  ? 93.593  66.696  -43.479 1.00 65.17  ? 102  VAL A C   1 
ATOM   783   O  O   . VAL A 1  102  ? 94.103  67.553  -44.206 1.00 67.82  ? 102  VAL A O   1 
ATOM   784   C  CB  . VAL A 1  102  ? 94.557  64.482  -42.927 1.00 60.37  ? 102  VAL A CB  1 
ATOM   785   C  CG1 . VAL A 1  102  ? 95.134  64.422  -44.334 1.00 58.42  ? 102  VAL A CG1 1 
ATOM   786   C  CG2 . VAL A 1  102  ? 95.437  63.726  -41.964 1.00 62.56  ? 102  VAL A CG2 1 
ATOM   787   N  N   . CYS A 1  103  ? 92.300  66.389  -43.532 1.00 66.02  ? 103  CYS A N   1 
ATOM   788   C  CA  . CYS A 1  103  ? 91.411  67.096  -44.445 1.00 66.57  ? 103  CYS A CA  1 
ATOM   789   C  C   . CYS A 1  103  ? 91.614  68.586  -44.280 1.00 69.17  ? 103  CYS A C   1 
ATOM   790   O  O   . CYS A 1  103  ? 91.839  69.308  -45.249 1.00 70.50  ? 103  CYS A O   1 
ATOM   791   C  CB  . CYS A 1  103  ? 89.962  66.763  -44.146 1.00 64.29  ? 103  CYS A CB  1 
ATOM   792   S  SG  . CYS A 1  103  ? 89.430  65.327  -45.009 1.00 65.44  ? 103  CYS A SG  1 
ATOM   793   N  N   . GLU A 1  104  ? 91.538  69.042  -43.036 1.00 71.23  ? 104  GLU A N   1 
ATOM   794   C  CA  . GLU A 1  104  ? 91.720  70.448  -42.744 1.00 72.65  ? 104  GLU A CA  1 
ATOM   795   C  C   . GLU A 1  104  ? 93.017  70.924  -43.390 1.00 72.50  ? 104  GLU A C   1 
ATOM   796   O  O   . GLU A 1  104  ? 93.163  72.105  -43.689 1.00 73.73  ? 104  GLU A O   1 
ATOM   797   C  CB  . GLU A 1  104  ? 91.738  70.669  -41.228 1.00 73.90  ? 104  GLU A CB  1 
ATOM   798   C  CG  . GLU A 1  104  ? 90.498  70.096  -40.536 1.00 79.23  ? 104  GLU A CG  1 
ATOM   799   C  CD  . GLU A 1  104  ? 90.307  70.577  -39.101 1.00 82.59  ? 104  GLU A CD  1 
ATOM   800   O  OE1 . GLU A 1  104  ? 91.257  70.455  -38.293 1.00 83.53  ? 104  GLU A OE1 1 
ATOM   801   O  OE2 . GLU A 1  104  ? 89.196  71.067  -38.781 1.00 84.72  ? 104  GLU A OE2 1 
ATOM   802   N  N   . CYS A 1  105  ? 93.941  69.999  -43.635 1.00 71.53  ? 105  CYS A N   1 
ATOM   803   C  CA  . CYS A 1  105  ? 95.218  70.341  -44.251 1.00 72.83  ? 105  CYS A CA  1 
ATOM   804   C  C   . CYS A 1  105  ? 95.257  70.187  -45.761 1.00 74.63  ? 105  CYS A C   1 
ATOM   805   O  O   . CYS A 1  105  ? 96.272  70.485  -46.383 1.00 74.51  ? 105  CYS A O   1 
ATOM   806   C  CB  . CYS A 1  105  ? 96.344  69.512  -43.644 1.00 72.76  ? 105  CYS A CB  1 
ATOM   807   S  SG  . CYS A 1  105  ? 96.859  70.065  -42.014 1.00 75.60  ? 105  CYS A SG  1 
ATOM   808   N  N   . VAL A 1  106  ? 94.168  69.714  -46.353 1.00 78.39  ? 106  VAL A N   1 
ATOM   809   C  CA  . VAL A 1  106  ? 94.112  69.550  -47.806 1.00 82.82  ? 106  VAL A CA  1 
ATOM   810   C  C   . VAL A 1  106  ? 92.698  69.702  -48.351 1.00 87.13  ? 106  VAL A C   1 
ATOM   811   O  O   . VAL A 1  106  ? 91.748  69.148  -47.793 1.00 90.68  ? 106  VAL A O   1 
ATOM   812   C  CB  . VAL A 1  106  ? 94.634  68.177  -48.246 1.00 80.65  ? 106  VAL A CB  1 
ATOM   813   C  CG1 . VAL A 1  106  ? 94.455  68.015  -49.750 1.00 80.09  ? 106  VAL A CG1 1 
ATOM   814   C  CG2 . VAL A 1  106  ? 96.085  68.036  -47.873 1.00 80.84  ? 106  VAL A CG2 1 
ATOM   815   N  N   . CYS A 1  107  ? 92.562  70.443  -49.448 1.00 89.01  ? 107  CYS A N   1 
ATOM   816   C  CA  . CYS A 1  107  ? 91.252  70.651  -50.052 1.00 90.70  ? 107  CYS A CA  1 
ATOM   817   C  C   . CYS A 1  107  ? 90.913  69.435  -50.884 1.00 89.97  ? 107  CYS A C   1 
ATOM   818   O  O   . CYS A 1  107  ? 91.787  68.826  -51.505 1.00 90.43  ? 107  CYS A O   1 
ATOM   819   C  CB  . CYS A 1  107  ? 91.245  71.881  -50.951 1.00 93.43  ? 107  CYS A CB  1 
ATOM   820   S  SG  . CYS A 1  107  ? 91.780  71.535  -52.634 1.00 101.78 ? 107  CYS A SG  1 
ATOM   821   N  N   . MET A 1  108  ? 89.632  69.101  -50.906 1.00 89.29  ? 108  MET A N   1 
ATOM   822   C  CA  . MET A 1  108  ? 89.155  67.944  -51.635 1.00 89.66  ? 108  MET A CA  1 
ATOM   823   C  C   . MET A 1  108  ? 89.164  68.200  -53.136 1.00 92.81  ? 108  MET A C   1 
ATOM   824   O  O   . MET A 1  108  ? 89.717  69.198  -53.593 1.00 92.01  ? 108  MET A O   1 
ATOM   825   C  CB  . MET A 1  108  ? 87.758  67.601  -51.130 1.00 84.71  ? 108  MET A CB  1 
ATOM   826   C  CG  . MET A 1  108  ? 87.553  67.992  -49.649 1.00 79.39  ? 108  MET A CG  1 
ATOM   827   S  SD  . MET A 1  108  ? 88.825  67.453  -48.426 1.00 69.11  ? 108  MET A SD  1 
ATOM   828   C  CE  . MET A 1  108  ? 87.833  66.640  -47.234 1.00 65.16  ? 108  MET A CE  1 
ATOM   829   N  N   . HIS A 1  109  ? 88.575  67.284  -53.897 1.00 98.88  ? 109  HIS A N   1 
ATOM   830   C  CA  . HIS A 1  109  ? 88.510  67.400  -55.354 1.00 106.74 ? 109  HIS A CA  1 
ATOM   831   C  C   . HIS A 1  109  ? 89.837  67.079  -56.049 1.00 107.39 ? 109  HIS A C   1 
ATOM   832   O  O   . HIS A 1  109  ? 89.923  66.103  -56.803 1.00 108.82 ? 109  HIS A O   1 
ATOM   833   C  CB  . HIS A 1  109  ? 88.038  68.802  -55.755 1.00 113.50 ? 109  HIS A CB  1 
ATOM   834   C  CG  . HIS A 1  109  ? 86.722  69.182  -55.155 1.00 120.99 ? 109  HIS A CG  1 
ATOM   835   N  ND1 . HIS A 1  109  ? 85.531  68.606  -55.546 1.00 124.34 ? 109  HIS A ND1 1 
ATOM   836   C  CD2 . HIS A 1  109  ? 86.411  70.042  -54.157 1.00 124.38 ? 109  HIS A CD2 1 
ATOM   837   C  CE1 . HIS A 1  109  ? 84.546  69.094  -54.814 1.00 126.62 ? 109  HIS A CE1 1 
ATOM   838   N  NE2 . HIS A 1  109  ? 85.052  69.969  -53.962 1.00 126.51 ? 109  HIS A NE2 1 
ATOM   839   N  N   . CYS A 1  110  ? 90.866  67.894  -55.813 1.00 105.76 ? 110  CYS A N   1 
ATOM   840   C  CA  . CYS A 1  110  ? 92.165  67.647  -56.441 1.00 102.07 ? 110  CYS A CA  1 
ATOM   841   C  C   . CYS A 1  110  ? 93.130  67.137  -55.392 1.00 99.81  ? 110  CYS A C   1 
ATOM   842   O  O   . CYS A 1  110  ? 94.187  66.594  -55.716 1.00 98.99  ? 110  CYS A O   1 
ATOM   843   C  CB  . CYS A 1  110  ? 92.725  68.920  -57.100 1.00 101.89 ? 110  CYS A CB  1 
ATOM   844   S  SG  . CYS A 1  110  ? 93.713  70.012  -56.046 1.00 97.87  ? 110  CYS A SG  1 
ATOM   845   N  N   . GLY A 1  111  ? 92.744  67.316  -54.133 1.00 97.38  ? 111  GLY A N   1 
ATOM   846   C  CA  . GLY A 1  111  ? 93.560  66.864  -53.026 1.00 95.36  ? 111  GLY A CA  1 
ATOM   847   C  C   . GLY A 1  111  ? 95.023  67.215  -53.165 1.00 93.46  ? 111  GLY A C   1 
ATOM   848   O  O   . GLY A 1  111  ? 95.796  66.507  -53.811 1.00 94.02  ? 111  GLY A O   1 
ATOM   849   N  N   . LYS A 1  112  ? 95.406  68.323  -52.552 1.00 90.56  ? 112  LYS A N   1 
ATOM   850   C  CA  . LYS A 1  112  ? 96.784  68.764  -52.598 1.00 88.40  ? 112  LYS A CA  1 
ATOM   851   C  C   . LYS A 1  112  ? 96.995  69.668  -51.407 1.00 87.37  ? 112  LYS A C   1 
ATOM   852   O  O   . LYS A 1  112  ? 96.031  70.114  -50.784 1.00 86.37  ? 112  LYS A O   1 
ATOM   853   C  CB  . LYS A 1  112  ? 97.056  69.529  -53.894 1.00 89.02  ? 112  LYS A CB  1 
ATOM   854   C  CG  . LYS A 1  112  ? 98.462  70.088  -53.993 1.00 90.30  ? 112  LYS A CG  1 
ATOM   855   C  CD  . LYS A 1  112  ? 98.727  70.701  -55.356 1.00 89.95  ? 112  LYS A CD  1 
ATOM   856   C  CE  . LYS A 1  112  ? 100.192 71.087  -55.488 1.00 90.80  ? 112  LYS A CE  1 
ATOM   857   N  NZ  . LYS A 1  112  ? 100.560 71.436  -56.886 1.00 90.58  ? 112  LYS A NZ  1 
ATOM   858   N  N   . LEU A 1  113  ? 98.254  69.926  -51.077 1.00 86.61  ? 113  LEU A N   1 
ATOM   859   C  CA  . LEU A 1  113  ? 98.551  70.797  -49.958 1.00 86.73  ? 113  LEU A CA  1 
ATOM   860   C  C   . LEU A 1  113  ? 97.841  72.120  -50.160 1.00 87.29  ? 113  LEU A C   1 
ATOM   861   O  O   . LEU A 1  113  ? 97.295  72.390  -51.228 1.00 87.46  ? 113  LEU A O   1 
ATOM   862   C  CB  . LEU A 1  113  ? 100.050 71.030  -49.843 1.00 86.71  ? 113  LEU A CB  1 
ATOM   863   C  CG  . LEU A 1  113  ? 100.800 69.977  -49.038 1.00 85.77  ? 113  LEU A CG  1 
ATOM   864   C  CD1 . LEU A 1  113  ? 102.287 70.304  -49.057 1.00 87.18  ? 113  LEU A CD1 1 
ATOM   865   C  CD2 . LEU A 1  113  ? 100.261 69.949  -47.613 1.00 83.24  ? 113  LEU A CD2 1 
ATOM   866   N  N   . LEU A 1  114  ? 97.857  72.954  -49.134 1.00 87.95  ? 114  LEU A N   1 
ATOM   867   C  CA  . LEU A 1  114  ? 97.188  74.232  -49.222 1.00 88.94  ? 114  LEU A CA  1 
ATOM   868   C  C   . LEU A 1  114  ? 98.175  75.364  -49.034 1.00 89.71  ? 114  LEU A C   1 
ATOM   869   O  O   . LEU A 1  114  ? 97.777  76.513  -48.876 1.00 90.68  ? 114  LEU A O   1 
ATOM   870   C  CB  . LEU A 1  114  ? 96.102  74.300  -48.153 1.00 89.98  ? 114  LEU A CB  1 
ATOM   871   C  CG  . LEU A 1  114  ? 95.337  72.983  -47.986 1.00 90.00  ? 114  LEU A CG  1 
ATOM   872   C  CD1 . LEU A 1  114  ? 94.322  73.114  -46.859 1.00 90.23  ? 114  LEU A CD1 1 
ATOM   873   C  CD2 . LEU A 1  114  ? 94.662  72.611  -49.299 1.00 89.25  ? 114  LEU A CD2 1 
ATOM   874   N  N   . LEU A 1  115  ? 99.462  75.035  -49.058 1.00 90.39  ? 115  LEU A N   1 
ATOM   875   C  CA  . LEU A 1  115  ? 100.504 76.033  -48.877 1.00 93.23  ? 115  LEU A CA  1 
ATOM   876   C  C   . LEU A 1  115  ? 101.835 75.536  -49.419 1.00 96.08  ? 115  LEU A C   1 
ATOM   877   O  O   . LEU A 1  115  ? 102.530 74.781  -48.752 1.00 96.50  ? 115  LEU A O   1 
ATOM   878   C  CB  . LEU A 1  115  ? 100.647 76.359  -47.391 1.00 92.75  ? 115  LEU A CB  1 
ATOM   879   C  CG  . LEU A 1  115  ? 99.440  76.982  -46.684 1.00 92.82  ? 115  LEU A CG  1 
ATOM   880   C  CD1 . LEU A 1  115  ? 99.669  77.025  -45.187 1.00 93.95  ? 115  LEU A CD1 1 
ATOM   881   C  CD2 . LEU A 1  115  ? 99.209  78.380  -47.223 1.00 93.21  ? 115  LEU A CD2 1 
ATOM   882   N  N   . ASP A 1  116  ? 102.197 75.963  -50.623 1.00 100.24 ? 116  ASP A N   1 
ATOM   883   C  CA  . ASP A 1  116  ? 103.455 75.535  -51.222 1.00 105.32 ? 116  ASP A CA  1 
ATOM   884   C  C   . ASP A 1  116  ? 104.659 76.292  -50.705 1.00 107.57 ? 116  ASP A C   1 
ATOM   885   O  O   . ASP A 1  116  ? 104.560 77.051  -49.745 1.00 107.80 ? 116  ASP A O   1 
ATOM   886   C  CB  . ASP A 1  116  ? 103.392 75.674  -52.736 1.00 108.63 ? 116  ASP A CB  1 
ATOM   887   C  CG  . ASP A 1  116  ? 102.623 74.553  -53.381 1.00 113.19 ? 116  ASP A CG  1 
ATOM   888   O  OD1 . ASP A 1  116  ? 103.101 73.397  -53.327 1.00 116.28 ? 116  ASP A OD1 1 
ATOM   889   O  OD2 . ASP A 1  116  ? 101.538 74.824  -53.935 1.00 116.01 ? 116  ASP A OD2 1 
ATOM   890   N  N   . GLU A 1  117  ? 105.801 76.071  -51.352 1.00 111.50 ? 117  GLU A N   1 
ATOM   891   C  CA  . GLU A 1  117  ? 107.048 76.734  -50.977 1.00 116.29 ? 117  GLU A CA  1 
ATOM   892   C  C   . GLU A 1  117  ? 106.846 78.245  -51.074 1.00 118.18 ? 117  GLU A C   1 
ATOM   893   O  O   . GLU A 1  117  ? 107.552 79.030  -50.433 1.00 118.85 ? 117  GLU A O   1 
ATOM   894   C  CB  . GLU A 1  117  ? 108.190 76.323  -51.922 1.00 117.89 ? 117  GLU A CB  1 
ATOM   895   C  CG  . GLU A 1  117  ? 108.378 74.821  -52.120 1.00 120.60 ? 117  GLU A CG  1 
ATOM   896   C  CD  . GLU A 1  117  ? 107.336 74.205  -53.047 1.00 122.72 ? 117  GLU A CD  1 
ATOM   897   O  OE1 . GLU A 1  117  ? 107.262 74.609  -54.229 1.00 123.22 ? 117  GLU A OE1 1 
ATOM   898   O  OE2 . GLU A 1  117  ? 106.590 73.311  -52.593 1.00 123.95 ? 117  GLU A OE2 1 
ATOM   899   N  N   . HIS A 1  118  ? 105.865 78.633  -51.885 1.00 119.63 ? 118  HIS A N   1 
ATOM   900   C  CA  . HIS A 1  118  ? 105.537 80.030  -52.125 1.00 119.45 ? 118  HIS A CA  1 
ATOM   901   C  C   . HIS A 1  118  ? 105.223 80.810  -50.855 1.00 120.03 ? 118  HIS A C   1 
ATOM   902   O  O   . HIS A 1  118  ? 105.939 81.752  -50.527 1.00 120.70 ? 118  HIS A O   1 
ATOM   903   C  CB  . HIS A 1  118  ? 104.395 80.097  -53.134 1.00 118.64 ? 118  HIS A CB  1 
ATOM   904   C  CG  . HIS A 1  118  ? 104.680 79.332  -54.391 1.00 118.56 ? 118  HIS A CG  1 
ATOM   905   N  ND1 . HIS A 1  118  ? 105.829 79.522  -55.131 1.00 118.49 ? 118  HIS A ND1 1 
ATOM   906   C  CD2 . HIS A 1  118  ? 103.988 78.352  -55.021 1.00 118.57 ? 118  HIS A CD2 1 
ATOM   907   C  CE1 . HIS A 1  118  ? 105.833 78.693  -56.159 1.00 117.79 ? 118  HIS A CE1 1 
ATOM   908   N  NE2 . HIS A 1  118  ? 104.728 77.971  -56.116 1.00 118.05 ? 118  HIS A NE2 1 
ATOM   909   N  N   . ASN A 1  119  ? 104.172 80.439  -50.133 1.00 120.48 ? 119  ASN A N   1 
ATOM   910   C  CA  . ASN A 1  119  ? 103.869 81.148  -48.895 1.00 121.49 ? 119  ASN A CA  1 
ATOM   911   C  C   . ASN A 1  119  ? 105.089 80.979  -47.977 1.00 123.81 ? 119  ASN A C   1 
ATOM   912   O  O   . ASN A 1  119  ? 105.500 79.857  -47.688 1.00 124.24 ? 119  ASN A O   1 
ATOM   913   C  CB  . ASN A 1  119  ? 102.620 80.565  -48.238 1.00 118.07 ? 119  ASN A CB  1 
ATOM   914   C  CG  . ASN A 1  119  ? 102.167 81.372  -47.041 1.00 116.12 ? 119  ASN A CG  1 
ATOM   915   O  OD1 . ASN A 1  119  ? 102.918 81.563  -46.086 1.00 114.88 ? 119  ASN A OD1 1 
ATOM   916   N  ND2 . ASN A 1  119  ? 100.931 81.852  -47.087 1.00 115.01 ? 119  ASN A ND2 1 
ATOM   917   N  N   . GLU A 1  120  ? 105.669 82.089  -47.525 1.00 127.12 ? 120  GLU A N   1 
ATOM   918   C  CA  . GLU A 1  120  ? 106.861 82.034  -46.679 1.00 130.77 ? 120  GLU A CA  1 
ATOM   919   C  C   . GLU A 1  120  ? 106.706 81.360  -45.319 1.00 131.89 ? 120  GLU A C   1 
ATOM   920   O  O   . GLU A 1  120  ? 107.523 80.515  -44.962 1.00 134.04 ? 120  GLU A O   1 
ATOM   921   C  CB  . GLU A 1  120  ? 107.447 83.435  -46.475 1.00 133.53 ? 120  GLU A CB  1 
ATOM   922   C  CG  . GLU A 1  120  ? 108.730 83.432  -45.639 1.00 137.40 ? 120  GLU A CG  1 
ATOM   923   C  CD  . GLU A 1  120  ? 109.398 84.793  -45.563 1.00 139.10 ? 120  GLU A CD  1 
ATOM   924   O  OE1 . GLU A 1  120  ? 108.733 85.758  -45.127 1.00 139.89 ? 120  GLU A OE1 1 
ATOM   925   O  OE2 . GLU A 1  120  ? 110.590 84.891  -45.935 1.00 139.25 ? 120  GLU A OE2 1 
ATOM   926   N  N   . LEU A 1  121  ? 105.685 81.732  -44.550 1.00 132.26 ? 121  LEU A N   1 
ATOM   927   C  CA  . LEU A 1  121  ? 105.481 81.122  -43.233 1.00 131.80 ? 121  LEU A CA  1 
ATOM   928   C  C   . LEU A 1  121  ? 105.590 79.604  -43.339 1.00 131.47 ? 121  LEU A C   1 
ATOM   929   O  O   . LEU A 1  121  ? 105.977 78.920  -42.388 1.00 130.80 ? 121  LEU A O   1 
ATOM   930   C  CB  . LEU A 1  121  ? 104.101 81.486  -42.680 1.00 131.76 ? 121  LEU A CB  1 
ATOM   931   C  CG  . LEU A 1  121  ? 103.849 82.933  -42.263 1.00 132.31 ? 121  LEU A CG  1 
ATOM   932   C  CD1 . LEU A 1  121  ? 102.387 83.101  -41.881 1.00 131.82 ? 121  LEU A CD1 1 
ATOM   933   C  CD2 . LEU A 1  121  ? 104.759 83.296  -41.097 1.00 132.66 ? 121  LEU A CD2 1 
ATOM   934   N  N   . MET A 1  122  ? 105.248 79.096  -44.517 1.00 131.10 ? 122  MET A N   1 
ATOM   935   C  CA  . MET A 1  122  ? 105.281 77.672  -44.800 1.00 130.65 ? 122  MET A CA  1 
ATOM   936   C  C   . MET A 1  122  ? 106.691 77.113  -44.704 1.00 130.96 ? 122  MET A C   1 
ATOM   937   O  O   . MET A 1  122  ? 106.983 76.309  -43.824 1.00 131.09 ? 122  MET A O   1 
ATOM   938   C  CB  . MET A 1  122  ? 104.725 77.409  -46.199 1.00 130.35 ? 122  MET A CB  1 
ATOM   939   C  CG  . MET A 1  122  ? 104.332 75.969  -46.434 1.00 130.83 ? 122  MET A CG  1 
ATOM   940   S  SD  . MET A 1  122  ? 103.042 75.467  -45.280 1.00 132.06 ? 122  MET A SD  1 
ATOM   941   C  CE  . MET A 1  122  ? 102.449 73.958  -46.039 1.00 131.67 ? 122  MET A CE  1 
ATOM   942   N  N   . ARG A 1  123  ? 107.556 77.537  -45.622 1.00 131.86 ? 123  ARG A N   1 
ATOM   943   C  CA  . ARG A 1  123  ? 108.940 77.079  -45.650 1.00 132.86 ? 123  ARG A CA  1 
ATOM   944   C  C   . ARG A 1  123  ? 109.418 76.762  -44.244 1.00 132.89 ? 123  ARG A C   1 
ATOM   945   O  O   . ARG A 1  123  ? 109.749 75.618  -43.937 1.00 133.31 ? 123  ARG A O   1 
ATOM   946   C  CB  . ARG A 1  123  ? 109.859 78.152  -46.230 1.00 134.60 ? 123  ARG A CB  1 
ATOM   947   C  CG  . ARG A 1  123  ? 109.495 78.692  -47.600 1.00 136.98 ? 123  ARG A CG  1 
ATOM   948   C  CD  . ARG A 1  123  ? 110.410 79.869  -47.904 1.00 139.63 ? 123  ARG A CD  1 
ATOM   949   N  NE  . ARG A 1  123  ? 110.123 80.536  -49.168 1.00 142.37 ? 123  ARG A NE  1 
ATOM   950   C  CZ  . ARG A 1  123  ? 110.735 81.647  -49.567 1.00 144.18 ? 123  ARG A CZ  1 
ATOM   951   N  NH1 . ARG A 1  123  ? 111.662 82.205  -48.794 1.00 145.28 ? 123  ARG A NH1 1 
ATOM   952   N  NH2 . ARG A 1  123  ? 110.427 82.199  -50.735 1.00 144.71 ? 123  ARG A NH2 1 
ATOM   953   N  N   . GLN A 1  124  ? 109.437 77.788  -43.394 1.00 133.00 ? 124  GLN A N   1 
ATOM   954   C  CA  . GLN A 1  124  ? 109.888 77.659  -42.011 1.00 132.91 ? 124  GLN A CA  1 
ATOM   955   C  C   . GLN A 1  124  ? 109.359 76.422  -41.301 1.00 130.35 ? 124  GLN A C   1 
ATOM   956   O  O   . GLN A 1  124  ? 109.903 76.000  -40.279 1.00 130.57 ? 124  GLN A O   1 
ATOM   957   C  CB  . GLN A 1  124  ? 109.526 78.914  -41.210 1.00 135.95 ? 124  GLN A CB  1 
ATOM   958   C  CG  . GLN A 1  124  ? 110.406 80.119  -41.524 1.00 140.13 ? 124  GLN A CG  1 
ATOM   959   C  CD  . GLN A 1  124  ? 110.776 80.907  -40.278 1.00 142.81 ? 124  GLN A CD  1 
ATOM   960   O  OE1 . GLN A 1  124  ? 109.908 81.443  -39.584 1.00 143.51 ? 124  GLN A OE1 1 
ATOM   961   N  NE2 . GLN A 1  124  ? 112.074 80.975  -39.984 1.00 144.11 ? 124  GLN A NE2 1 
ATOM   962   N  N   . ALA A 1  125  ? 108.294 75.844  -41.841 1.00 126.33 ? 125  ALA A N   1 
ATOM   963   C  CA  . ALA A 1  125  ? 107.724 74.639  -41.270 1.00 121.58 ? 125  ALA A CA  1 
ATOM   964   C  C   . ALA A 1  125  ? 108.332 73.448  -42.008 1.00 117.88 ? 125  ALA A C   1 
ATOM   965   O  O   . ALA A 1  125  ? 108.921 72.560  -41.394 1.00 117.35 ? 125  ALA A O   1 
ATOM   966   C  CB  . ALA A 1  125  ? 106.208 74.648  -41.425 1.00 121.92 ? 125  ALA A CB  1 
ATOM   967   N  N   . LEU A 1  126  ? 108.210 73.455  -43.331 1.00 113.48 ? 126  LEU A N   1 
ATOM   968   C  CA  . LEU A 1  126  ? 108.729 72.378  -44.165 1.00 111.11 ? 126  LEU A CA  1 
ATOM   969   C  C   . LEU A 1  126  ? 110.188 72.016  -43.924 1.00 110.63 ? 126  LEU A C   1 
ATOM   970   O  O   . LEU A 1  126  ? 110.729 71.144  -44.602 1.00 109.79 ? 126  LEU A O   1 
ATOM   971   C  CB  . LEU A 1  126  ? 108.549 72.724  -45.640 1.00 110.41 ? 126  LEU A CB  1 
ATOM   972   C  CG  . LEU A 1  126  ? 107.113 72.845  -46.139 1.00 109.61 ? 126  LEU A CG  1 
ATOM   973   C  CD1 . LEU A 1  126  ? 107.122 73.117  -47.630 1.00 110.38 ? 126  LEU A CD1 1 
ATOM   974   C  CD2 . LEU A 1  126  ? 106.361 71.565  -45.853 1.00 109.92 ? 126  LEU A CD2 1 
ATOM   975   N  N   . ALA A 1  127  ? 110.828 72.677  -42.968 1.00 110.39 ? 127  ALA A N   1 
ATOM   976   C  CA  . ALA A 1  127  ? 112.227 72.394  -42.676 1.00 111.12 ? 127  ALA A CA  1 
ATOM   977   C  C   . ALA A 1  127  ? 112.385 71.681  -41.343 1.00 111.53 ? 127  ALA A C   1 
ATOM   978   O  O   . ALA A 1  127  ? 113.300 70.874  -41.167 1.00 110.62 ? 127  ALA A O   1 
ATOM   979   C  CB  . ALA A 1  127  ? 113.030 73.682  -42.671 1.00 111.11 ? 127  ALA A CB  1 
ATOM   980   N  N   . ILE A 1  128  ? 111.498 71.981  -40.402 1.00 112.19 ? 128  ILE A N   1 
ATOM   981   C  CA  . ILE A 1  128  ? 111.569 71.350  -39.093 1.00 111.63 ? 128  ILE A CA  1 
ATOM   982   C  C   . ILE A 1  128  ? 111.573 69.847  -39.304 1.00 109.52 ? 128  ILE A C   1 
ATOM   983   O  O   . ILE A 1  128  ? 110.575 69.274  -39.739 1.00 109.00 ? 128  ILE A O   1 
ATOM   984   C  CB  . ILE A 1  128  ? 110.356 71.723  -38.201 1.00 112.93 ? 128  ILE A CB  1 
ATOM   985   C  CG1 . ILE A 1  128  ? 110.143 73.239  -38.208 1.00 114.41 ? 128  ILE A CG1 1 
ATOM   986   C  CG2 . ILE A 1  128  ? 110.601 71.254  -36.768 1.00 113.83 ? 128  ILE A CG2 1 
ATOM   987   C  CD1 . ILE A 1  128  ? 108.958 73.704  -37.379 1.00 114.68 ? 128  ILE A CD1 1 
ATOM   988   N  N   . LYS A 1  129  ? 112.704 69.213  -39.026 1.00 107.98 ? 129  LYS A N   1 
ATOM   989   C  CA  . LYS A 1  129  ? 112.800 67.771  -39.178 1.00 107.62 ? 129  LYS A CA  1 
ATOM   990   C  C   . LYS A 1  129  ? 112.270 67.175  -37.880 1.00 104.86 ? 129  LYS A C   1 
ATOM   991   O  O   . LYS A 1  129  ? 112.898 67.305  -36.828 1.00 104.63 ? 129  LYS A O   1 
ATOM   992   C  CB  . LYS A 1  129  ? 114.253 67.351  -39.398 1.00 111.90 ? 129  LYS A CB  1 
ATOM   993   C  CG  . LYS A 1  129  ? 114.968 68.086  -40.529 1.00 115.76 ? 129  LYS A CG  1 
ATOM   994   C  CD  . LYS A 1  129  ? 116.436 67.665  -40.601 1.00 118.21 ? 129  LYS A CD  1 
ATOM   995   C  CE  . LYS A 1  129  ? 117.219 68.477  -41.623 1.00 119.01 ? 129  LYS A CE  1 
ATOM   996   N  NZ  . LYS A 1  129  ? 118.646 68.047  -41.694 1.00 120.02 ? 129  LYS A NZ  1 
ATOM   997   N  N   . ASP A 1  130  ? 111.106 66.539  -37.965 1.00 101.42 ? 130  ASP A N   1 
ATOM   998   C  CA  . ASP A 1  130  ? 110.435 65.925  -36.820 1.00 98.47  ? 130  ASP A CA  1 
ATOM   999   C  C   . ASP A 1  130  ? 108.974 65.808  -37.217 1.00 95.41  ? 130  ASP A C   1 
ATOM   1000  O  O   . ASP A 1  130  ? 108.139 66.606  -36.800 1.00 92.89  ? 130  ASP A O   1 
ATOM   1001  C  CB  . ASP A 1  130  ? 110.554 66.811  -35.568 1.00 101.75 ? 130  ASP A CB  1 
ATOM   1002  C  CG  . ASP A 1  130  ? 109.810 66.243  -34.357 1.00 103.43 ? 130  ASP A CG  1 
ATOM   1003  O  OD1 . ASP A 1  130  ? 108.601 65.962  -34.475 1.00 104.56 ? 130  ASP A OD1 1 
ATOM   1004  O  OD2 . ASP A 1  130  ? 110.430 66.088  -33.279 1.00 105.12 ? 130  ASP A OD2 1 
ATOM   1005  N  N   . SER A 1  131  ? 108.677 64.814  -38.041 1.00 93.57  ? 131  SER A N   1 
ATOM   1006  C  CA  . SER A 1  131  ? 107.320 64.586  -38.516 1.00 93.32  ? 131  SER A CA  1 
ATOM   1007  C  C   . SER A 1  131  ? 106.216 64.804  -37.474 1.00 91.98  ? 131  SER A C   1 
ATOM   1008  O  O   . SER A 1  131  ? 105.043 64.908  -37.821 1.00 91.92  ? 131  SER A O   1 
ATOM   1009  C  CB  . SER A 1  131  ? 107.218 63.172  -39.111 1.00 94.69  ? 131  SER A CB  1 
ATOM   1010  O  OG  . SER A 1  131  ? 107.832 62.201  -38.277 1.00 94.09  ? 131  SER A OG  1 
ATOM   1011  N  N   . LYS A 1  132  ? 106.591 64.889  -36.203 1.00 91.69  ? 132  LYS A N   1 
ATOM   1012  C  CA  . LYS A 1  132  ? 105.620 65.080  -35.128 1.00 91.64  ? 132  LYS A CA  1 
ATOM   1013  C  C   . LYS A 1  132  ? 105.186 66.536  -34.941 1.00 88.78  ? 132  LYS A C   1 
ATOM   1014  O  O   . LYS A 1  132  ? 104.052 66.802  -34.532 1.00 86.28  ? 132  LYS A O   1 
ATOM   1015  C  CB  . LYS A 1  132  ? 106.195 64.544  -33.807 1.00 96.75  ? 132  LYS A CB  1 
ATOM   1016  C  CG  . LYS A 1  132  ? 105.510 63.290  -33.239 1.00 101.30 ? 132  LYS A CG  1 
ATOM   1017  C  CD  . LYS A 1  132  ? 106.107 62.934  -31.874 1.00 105.66 ? 132  LYS A CD  1 
ATOM   1018  C  CE  . LYS A 1  132  ? 105.140 62.137  -31.003 1.00 108.45 ? 132  LYS A CE  1 
ATOM   1019  N  NZ  . LYS A 1  132  ? 105.582 62.111  -29.571 1.00 108.08 ? 132  LYS A NZ  1 
ATOM   1020  N  N   . LYS A 1  133  ? 106.088 67.472  -35.232 1.00 86.43  ? 133  LYS A N   1 
ATOM   1021  C  CA  . LYS A 1  133  ? 105.795 68.899  -35.082 1.00 84.11  ? 133  LYS A CA  1 
ATOM   1022  C  C   . LYS A 1  133  ? 105.704 69.593  -36.433 1.00 80.97  ? 133  LYS A C   1 
ATOM   1023  O  O   . LYS A 1  133  ? 104.987 70.579  -36.581 1.00 80.43  ? 133  LYS A O   1 
ATOM   1024  C  CB  . LYS A 1  133  ? 106.868 69.577  -34.227 1.00 85.91  ? 133  LYS A CB  1 
ATOM   1025  C  CG  . LYS A 1  133  ? 107.011 68.979  -32.841 1.00 89.36  ? 133  LYS A CG  1 
ATOM   1026  C  CD  . LYS A 1  133  ? 108.134 69.634  -32.063 1.00 93.33  ? 133  LYS A CD  1 
ATOM   1027  C  CE  . LYS A 1  133  ? 108.311 68.979  -30.703 1.00 96.01  ? 133  LYS A CE  1 
ATOM   1028  N  NZ  . LYS A 1  133  ? 109.409 69.612  -29.918 1.00 97.99  ? 133  LYS A NZ  1 
ATOM   1029  N  N   . ARG A 1  134  ? 106.443 69.076  -37.410 1.00 77.52  ? 134  ARG A N   1 
ATOM   1030  C  CA  . ARG A 1  134  ? 106.430 69.619  -38.764 1.00 74.42  ? 134  ARG A CA  1 
ATOM   1031  C  C   . ARG A 1  134  ? 105.010 69.437  -39.264 1.00 72.41  ? 134  ARG A C   1 
ATOM   1032  O  O   . ARG A 1  134  ? 104.664 69.812  -40.378 1.00 73.48  ? 134  ARG A O   1 
ATOM   1033  C  CB  . ARG A 1  134  ? 107.381 68.822  -39.660 1.00 74.81  ? 134  ARG A CB  1 
ATOM   1034  C  CG  . ARG A 1  134  ? 107.211 69.089  -41.141 1.00 75.65  ? 134  ARG A CG  1 
ATOM   1035  C  CD  . ARG A 1  134  ? 107.412 67.832  -41.952 1.00 78.18  ? 134  ARG A CD  1 
ATOM   1036  N  NE  . ARG A 1  134  ? 108.738 67.265  -41.750 1.00 85.09  ? 134  ARG A NE  1 
ATOM   1037  C  CZ  . ARG A 1  134  ? 109.189 66.182  -42.376 1.00 89.67  ? 134  ARG A CZ  1 
ATOM   1038  N  NH1 . ARG A 1  134  ? 108.412 65.549  -43.247 1.00 91.00  ? 134  ARG A NH1 1 
ATOM   1039  N  NH2 . ARG A 1  134  ? 110.418 65.732  -42.133 1.00 93.08  ? 134  ARG A NH2 1 
ATOM   1040  N  N   . PHE A 1  135  ? 104.187 68.845  -38.413 1.00 68.01  ? 135  PHE A N   1 
ATOM   1041  C  CA  . PHE A 1  135  ? 102.808 68.573  -38.752 1.00 64.06  ? 135  PHE A CA  1 
ATOM   1042  C  C   . PHE A 1  135  ? 101.870 69.497  -38.012 1.00 64.41  ? 135  PHE A C   1 
ATOM   1043  O  O   . PHE A 1  135  ? 101.128 70.260  -38.624 1.00 63.56  ? 135  PHE A O   1 
ATOM   1044  C  CB  . PHE A 1  135  ? 102.483 67.143  -38.388 1.00 59.76  ? 135  PHE A CB  1 
ATOM   1045  C  CG  . PHE A 1  135  ? 101.141 66.721  -38.824 1.00 55.25  ? 135  PHE A CG  1 
ATOM   1046  C  CD1 . PHE A 1  135  ? 100.899 66.447  -40.159 1.00 54.26  ? 135  PHE A CD1 1 
ATOM   1047  C  CD2 . PHE A 1  135  ? 100.112 66.605  -37.905 1.00 53.37  ? 135  PHE A CD2 1 
ATOM   1048  C  CE1 . PHE A 1  135  ? 99.646  66.066  -40.573 1.00 55.89  ? 135  PHE A CE1 1 
ATOM   1049  C  CE2 . PHE A 1  135  ? 98.854  66.225  -38.305 1.00 53.36  ? 135  PHE A CE2 1 
ATOM   1050  C  CZ  . PHE A 1  135  ? 98.614  65.952  -39.643 1.00 54.32  ? 135  PHE A CZ  1 
ATOM   1051  N  N   . ALA A 1  136  ? 101.900 69.410  -36.685 1.00 68.04  ? 136  ALA A N   1 
ATOM   1052  C  CA  . ALA A 1  136  ? 101.059 70.248  -35.833 1.00 70.54  ? 136  ALA A CA  1 
ATOM   1053  C  C   . ALA A 1  136  ? 101.445 71.696  -36.072 1.00 71.46  ? 136  ALA A C   1 
ATOM   1054  O  O   . ALA A 1  136  ? 101.000 72.603  -35.366 1.00 71.36  ? 136  ALA A O   1 
ATOM   1055  C  CB  . ALA A 1  136  ? 101.257 69.885  -34.364 1.00 73.17  ? 136  ALA A CB  1 
ATOM   1056  N  N   . ALA A 1  137  ? 102.309 71.882  -37.066 1.00 71.85  ? 137  ALA A N   1 
ATOM   1057  C  CA  . ALA A 1  137  ? 102.772 73.189  -37.488 1.00 71.09  ? 137  ALA A CA  1 
ATOM   1058  C  C   . ALA A 1  137  ? 102.036 73.432  -38.796 1.00 69.68  ? 137  ALA A C   1 
ATOM   1059  O  O   . ALA A 1  137  ? 101.199 74.328  -38.876 1.00 71.34  ? 137  ALA A O   1 
ATOM   1060  C  CB  . ALA A 1  137  ? 104.269 73.174  -37.720 1.00 72.28  ? 137  ALA A CB  1 
ATOM   1061  N  N   . ILE A 1  138  ? 102.332 72.613  -39.807 1.00 65.97  ? 138  ILE A N   1 
ATOM   1062  C  CA  . ILE A 1  138  ? 101.683 72.731  -41.114 1.00 62.97  ? 138  ILE A CA  1 
ATOM   1063  C  C   . ILE A 1  138  ? 100.178 72.863  -40.950 1.00 62.51  ? 138  ILE A C   1 
ATOM   1064  O  O   . ILE A 1  138  ? 99.516  73.546  -41.734 1.00 61.46  ? 138  ILE A O   1 
ATOM   1065  C  CB  . ILE A 1  138  ? 101.933 71.501  -42.000 1.00 61.91  ? 138  ILE A CB  1 
ATOM   1066  C  CG1 . ILE A 1  138  ? 103.423 71.353  -42.294 1.00 60.18  ? 138  ILE A CG1 1 
ATOM   1067  C  CG2 . ILE A 1  138  ? 101.166 71.644  -43.304 1.00 61.62  ? 138  ILE A CG2 1 
ATOM   1068  C  CD1 . ILE A 1  138  ? 103.768 70.102  -43.099 1.00 57.28  ? 138  ILE A CD1 1 
ATOM   1069  N  N   . TRP A 1  139  ? 99.643  72.193  -39.934 1.00 62.01  ? 139  TRP A N   1 
ATOM   1070  C  CA  . TRP A 1  139  ? 98.216  72.241  -39.652 1.00 63.27  ? 139  TRP A CA  1 
ATOM   1071  C  C   . TRP A 1  139  ? 97.838  73.627  -39.130 1.00 65.93  ? 139  TRP A C   1 
ATOM   1072  O  O   . TRP A 1  139  ? 96.917  74.268  -39.644 1.00 68.60  ? 139  TRP A O   1 
ATOM   1073  C  CB  . TRP A 1  139  ? 97.844  71.179  -38.618 1.00 60.81  ? 139  TRP A CB  1 
ATOM   1074  C  CG  . TRP A 1  139  ? 96.397  71.184  -38.246 1.00 59.63  ? 139  TRP A CG  1 
ATOM   1075  C  CD1 . TRP A 1  139  ? 95.338  70.917  -39.062 1.00 58.74  ? 139  TRP A CD1 1 
ATOM   1076  C  CD2 . TRP A 1  139  ? 95.847  71.476  -36.958 1.00 61.43  ? 139  TRP A CD2 1 
ATOM   1077  N  NE1 . TRP A 1  139  ? 94.160  71.022  -38.363 1.00 59.26  ? 139  TRP A NE1 1 
ATOM   1078  C  CE2 . TRP A 1  139  ? 94.444  71.364  -37.068 1.00 61.50  ? 139  TRP A CE2 1 
ATOM   1079  C  CE3 . TRP A 1  139  ? 96.405  71.822  -35.720 1.00 63.42  ? 139  TRP A CE3 1 
ATOM   1080  C  CZ2 . TRP A 1  139  ? 93.586  71.585  -35.984 1.00 63.34  ? 139  TRP A CZ2 1 
ATOM   1081  C  CZ3 . TRP A 1  139  ? 95.554  72.043  -34.641 1.00 64.07  ? 139  TRP A CZ3 1 
ATOM   1082  C  CH2 . TRP A 1  139  ? 94.158  71.923  -34.781 1.00 65.14  ? 139  TRP A CH2 1 
ATOM   1083  N  N   . THR A 1  140  ? 98.553  74.098  -38.115 1.00 67.19  ? 140  THR A N   1 
ATOM   1084  C  CA  . THR A 1  140  ? 98.268  75.408  -37.551 1.00 69.17  ? 140  THR A CA  1 
ATOM   1085  C  C   . THR A 1  140  ? 98.234  76.473  -38.648 1.00 70.08  ? 140  THR A C   1 
ATOM   1086  O  O   . THR A 1  140  ? 97.616  77.527  -38.486 1.00 69.06  ? 140  THR A O   1 
ATOM   1087  C  CB  . THR A 1  140  ? 99.323  75.796  -36.515 1.00 69.29  ? 140  THR A CB  1 
ATOM   1088  O  OG1 . THR A 1  140  ? 99.571  74.683  -35.651 1.00 71.12  ? 140  THR A OG1 1 
ATOM   1089  C  CG2 . THR A 1  140  ? 98.831  76.958  -35.675 1.00 71.66  ? 140  THR A CG2 1 
ATOM   1090  N  N   . LEU A 1  141  ? 98.891  76.185  -39.769 1.00 71.88  ? 141  LEU A N   1 
ATOM   1091  C  CA  . LEU A 1  141  ? 98.943  77.117  -40.891 1.00 73.44  ? 141  LEU A CA  1 
ATOM   1092  C  C   . LEU A 1  141  ? 97.879  76.873  -41.950 1.00 75.06  ? 141  LEU A C   1 
ATOM   1093  O  O   . LEU A 1  141  ? 97.666  77.722  -42.813 1.00 76.74  ? 141  LEU A O   1 
ATOM   1094  C  CB  . LEU A 1  141  ? 100.316 77.079  -41.580 1.00 72.28  ? 141  LEU A CB  1 
ATOM   1095  C  CG  . LEU A 1  141  ? 101.593 77.438  -40.811 1.00 73.21  ? 141  LEU A CG  1 
ATOM   1096  C  CD1 . LEU A 1  141  ? 102.734 77.629  -41.810 1.00 72.08  ? 141  LEU A CD1 1 
ATOM   1097  C  CD2 . LEU A 1  141  ? 101.387 78.705  -39.994 1.00 74.29  ? 141  LEU A CD2 1 
ATOM   1098  N  N   . CYS A 1  142  ? 97.207  75.728  -41.898 1.00 76.21  ? 142  CYS A N   1 
ATOM   1099  C  CA  . CYS A 1  142  ? 96.193  75.437  -42.902 1.00 77.79  ? 142  CYS A CA  1 
ATOM   1100  C  C   . CYS A 1  142  ? 94.772  75.308  -42.394 1.00 80.55  ? 142  CYS A C   1 
ATOM   1101  O  O   . CYS A 1  142  ? 93.825  75.315  -43.181 1.00 79.75  ? 142  CYS A O   1 
ATOM   1102  C  CB  . CYS A 1  142  ? 96.575  74.180  -43.667 1.00 74.97  ? 142  CYS A CB  1 
ATOM   1103  S  SG  . CYS A 1  142  ? 98.116  74.386  -44.541 1.00 72.96  ? 142  CYS A SG  1 
ATOM   1104  N  N   . LYS A 1  143  ? 94.607  75.191  -41.086 1.00 85.58  ? 143  LYS A N   1 
ATOM   1105  C  CA  . LYS A 1  143  ? 93.262  75.078  -40.565 1.00 92.50  ? 143  LYS A CA  1 
ATOM   1106  C  C   . LYS A 1  143  ? 92.542  76.371  -40.916 1.00 96.58  ? 143  LYS A C   1 
ATOM   1107  O  O   . LYS A 1  143  ? 91.310  76.421  -40.944 1.00 97.59  ? 143  LYS A O   1 
ATOM   1108  C  CB  . LYS A 1  143  ? 93.273  74.864  -39.046 1.00 93.88  ? 143  LYS A CB  1 
ATOM   1109  C  CG  . LYS A 1  143  ? 93.688  76.062  -38.213 1.00 96.94  ? 143  LYS A CG  1 
ATOM   1110  C  CD  . LYS A 1  143  ? 93.398  75.808  -36.734 1.00 98.66  ? 143  LYS A CD  1 
ATOM   1111  C  CE  . LYS A 1  143  ? 93.634  77.059  -35.888 1.00 100.05 ? 143  LYS A CE  1 
ATOM   1112  N  NZ  . LYS A 1  143  ? 93.267  76.879  -34.449 1.00 99.85  ? 143  LYS A NZ  1 
ATOM   1113  N  N   . THR A 1  144  ? 93.329  77.406  -41.211 1.00 100.91 ? 144  THR A N   1 
ATOM   1114  C  CA  . THR A 1  144  ? 92.797  78.721  -41.554 1.00 104.21 ? 144  THR A CA  1 
ATOM   1115  C  C   . THR A 1  144  ? 92.498  78.890  -43.039 1.00 105.99 ? 144  THR A C   1 
ATOM   1116  O  O   . THR A 1  144  ? 91.405  79.322  -43.398 1.00 106.28 ? 144  THR A O   1 
ATOM   1117  C  CB  . THR A 1  144  ? 93.754  79.838  -41.120 1.00 103.79 ? 144  THR A CB  1 
ATOM   1118  O  OG1 . THR A 1  144  ? 94.179  79.608  -39.770 1.00 104.28 ? 144  THR A OG1 1 
ATOM   1119  C  CG2 . THR A 1  144  ? 93.048  81.186  -41.192 1.00 104.90 ? 144  THR A CG2 1 
ATOM   1120  N  N   . LYS A 1  145  ? 93.459  78.574  -43.904 1.00 108.36 ? 145  LYS A N   1 
ATOM   1121  C  CA  . LYS A 1  145  ? 93.214  78.698  -45.338 1.00 112.28 ? 145  LYS A CA  1 
ATOM   1122  C  C   . LYS A 1  145  ? 91.986  77.876  -45.643 1.00 113.76 ? 145  LYS A C   1 
ATOM   1123  O  O   . LYS A 1  145  ? 91.946  76.691  -45.333 1.00 113.87 ? 145  LYS A O   1 
ATOM   1124  C  CB  . LYS A 1  145  ? 94.390  78.170  -46.161 1.00 113.31 ? 145  LYS A CB  1 
ATOM   1125  C  CG  . LYS A 1  145  ? 95.576  79.117  -46.223 1.00 118.10 ? 145  LYS A CG  1 
ATOM   1126  C  CD  . LYS A 1  145  ? 95.196  80.472  -46.839 1.00 120.01 ? 145  LYS A CD  1 
ATOM   1127  C  CE  . LYS A 1  145  ? 96.331  81.493  -46.696 1.00 120.26 ? 145  LYS A CE  1 
ATOM   1128  N  NZ  . LYS A 1  145  ? 95.954  82.859  -47.161 1.00 118.40 ? 145  LYS A NZ  1 
ATOM   1129  N  N   . MET A 1  146  ? 90.979  78.502  -46.237 1.00 116.84 ? 146  MET A N   1 
ATOM   1130  C  CA  . MET A 1  146  ? 89.756  77.789  -46.552 1.00 121.07 ? 146  MET A CA  1 
ATOM   1131  C  C   . MET A 1  146  ? 89.296  78.036  -47.981 1.00 123.33 ? 146  MET A C   1 
ATOM   1132  O  O   . MET A 1  146  ? 88.103  78.173  -48.252 1.00 123.84 ? 146  MET A O   1 
ATOM   1133  C  CB  . MET A 1  146  ? 88.671  78.160  -45.533 1.00 122.62 ? 146  MET A CB  1 
ATOM   1134  C  CG  . MET A 1  146  ? 89.034  77.704  -44.116 1.00 125.26 ? 146  MET A CG  1 
ATOM   1135  S  SD  . MET A 1  146  ? 87.873  78.131  -42.802 1.00 128.84 ? 146  MET A SD  1 
ATOM   1136  C  CE  . MET A 1  146  ? 88.654  79.614  -42.120 1.00 127.97 ? 146  MET A CE  1 
ATOM   1137  N  N   . VAL A 1  147  ? 90.274  78.071  -48.884 1.00 126.52 ? 147  VAL A N   1 
ATOM   1138  C  CA  . VAL A 1  147  ? 90.066  78.278  -50.318 1.00 130.43 ? 147  VAL A CA  1 
ATOM   1139  C  C   . VAL A 1  147  ? 91.319  77.776  -51.034 1.00 131.48 ? 147  VAL A C   1 
ATOM   1140  O  O   . VAL A 1  147  ? 92.421  78.242  -50.745 1.00 131.49 ? 147  VAL A O   1 
ATOM   1141  C  CB  . VAL A 1  147  ? 89.893  79.779  -50.662 1.00 132.30 ? 147  VAL A CB  1 
ATOM   1142  C  CG1 . VAL A 1  147  ? 89.882  79.971  -52.171 1.00 133.61 ? 147  VAL A CG1 1 
ATOM   1143  C  CG2 . VAL A 1  147  ? 88.603  80.313  -50.064 1.00 134.22 ? 147  VAL A CG2 1 
ATOM   1144  N  N   . CYS A 1  148  ? 91.162  76.829  -51.956 1.00 133.61 ? 148  CYS A N   1 
ATOM   1145  C  CA  . CYS A 1  148  ? 92.313  76.300  -52.687 1.00 136.83 ? 148  CYS A CA  1 
ATOM   1146  C  C   . CYS A 1  148  ? 92.804  77.311  -53.714 1.00 141.42 ? 148  CYS A C   1 
ATOM   1147  O  O   . CYS A 1  148  ? 92.516  77.193  -54.906 1.00 142.85 ? 148  CYS A O   1 
ATOM   1148  C  CB  . CYS A 1  148  ? 91.958  74.990  -53.395 1.00 134.68 ? 148  CYS A CB  1 
ATOM   1149  S  SG  . CYS A 1  148  ? 93.277  74.355  -54.471 1.00 128.23 ? 148  CYS A SG  1 
ATOM   1150  N  N   . GLU A 1  149  ? 93.553  78.301  -53.239 1.00 145.99 ? 149  GLU A N   1 
ATOM   1151  C  CA  . GLU A 1  149  ? 94.086  79.358  -54.091 1.00 149.92 ? 149  GLU A CA  1 
ATOM   1152  C  C   . GLU A 1  149  ? 94.637  78.829  -55.419 1.00 151.03 ? 149  GLU A C   1 
ATOM   1153  O  O   . GLU A 1  149  ? 95.309  77.796  -55.461 1.00 150.84 ? 149  GLU A O   1 
ATOM   1154  C  CB  . GLU A 1  149  ? 95.164  80.131  -53.325 1.00 152.21 ? 149  GLU A CB  1 
ATOM   1155  C  CG  . GLU A 1  149  ? 94.676  80.648  -51.970 1.00 156.21 ? 149  GLU A CG  1 
ATOM   1156  C  CD  . GLU A 1  149  ? 95.696  81.517  -51.256 1.00 157.93 ? 149  GLU A CD  1 
ATOM   1157  O  OE1 . GLU A 1  149  ? 96.837  81.050  -51.046 1.00 159.23 ? 149  GLU A OE1 1 
ATOM   1158  O  OE2 . GLU A 1  149  ? 95.351  82.665  -50.899 1.00 158.43 ? 149  GLU A OE2 1 
ATOM   1159  N  N   . THR A 1  150  ? 94.328  79.545  -56.500 1.00 152.71 ? 150  THR A N   1 
ATOM   1160  C  CA  . THR A 1  150  ? 94.762  79.177  -57.850 1.00 154.21 ? 150  THR A CA  1 
ATOM   1161  C  C   . THR A 1  150  ? 96.072  79.861  -58.229 1.00 154.57 ? 150  THR A C   1 
ATOM   1162  O  O   . THR A 1  150  ? 96.873  79.312  -58.988 1.00 154.15 ? 150  THR A O   1 
ATOM   1163  C  CB  . THR A 1  150  ? 93.702  79.579  -58.919 1.00 154.47 ? 150  THR A CB  1 
ATOM   1164  O  OG1 . THR A 1  150  ? 92.441  78.980  -58.601 1.00 155.32 ? 150  THR A OG1 1 
ATOM   1165  C  CG2 . THR A 1  150  ? 94.136  79.123  -60.312 1.00 153.46 ? 150  THR A CG2 1 
ATOM   1166  N  N   . ASP A 1  151  ? 96.282  81.064  -57.701 1.00 155.00 ? 151  ASP A N   1 
ATOM   1167  C  CA  . ASP A 1  151  ? 97.482  81.828  -58.013 1.00 154.96 ? 151  ASP A CA  1 
ATOM   1168  C  C   . ASP A 1  151  ? 97.883  82.752  -56.861 1.00 154.96 ? 151  ASP A C   1 
ATOM   1169  O  O   . ASP A 1  151  ? 97.034  83.357  -56.204 1.00 153.21 ? 151  ASP A O   1 
ATOM   1170  C  CB  . ASP A 1  151  ? 97.229  82.631  -59.289 1.00 156.23 ? 151  ASP A CB  1 
ATOM   1171  C  CG  . ASP A 1  151  ? 96.537  81.802  -60.369 1.00 157.13 ? 151  ASP A CG  1 
ATOM   1172  O  OD1 . ASP A 1  151  ? 97.151  80.839  -60.872 1.00 156.63 ? 151  ASP A OD1 1 
ATOM   1173  O  OD2 . ASP A 1  151  ? 95.370  82.104  -60.706 1.00 157.94 ? 151  ASP A OD2 1 
ATOM   1174  N  N   . VAL A 1  152  ? 99.188  82.851  -56.625 1.00 156.20 ? 152  VAL A N   1 
ATOM   1175  C  CA  . VAL A 1  152  ? 99.729  83.676  -55.549 1.00 158.48 ? 152  VAL A CA  1 
ATOM   1176  C  C   . VAL A 1  152  ? 100.979 84.408  -56.035 1.00 160.56 ? 152  VAL A C   1 
ATOM   1177  O  O   . VAL A 1  152  ? 101.696 83.919  -56.911 1.00 158.69 ? 152  VAL A O   1 
ATOM   1178  C  CB  . VAL A 1  152  ? 100.095 82.794  -54.322 1.00 158.60 ? 152  VAL A CB  1 
ATOM   1179  C  CG1 . VAL A 1  152  ? 100.678 83.636  -53.197 1.00 158.69 ? 152  VAL A CG1 1 
ATOM   1180  C  CG2 . VAL A 1  152  ? 98.863  82.059  -53.835 1.00 158.95 ? 152  VAL A CG2 1 
ATOM   1181  N  N   . PRO A 1  153  ? 101.249 85.603  -55.482 1.00 163.67 ? 153  PRO A N   1 
ATOM   1182  C  CA  . PRO A 1  153  ? 102.433 86.360  -55.896 1.00 166.58 ? 153  PRO A CA  1 
ATOM   1183  C  C   . PRO A 1  153  ? 103.736 85.605  -55.635 1.00 169.05 ? 153  PRO A C   1 
ATOM   1184  O  O   . PRO A 1  153  ? 103.990 85.154  -54.514 1.00 169.54 ? 153  PRO A O   1 
ATOM   1185  C  CB  . PRO A 1  153  ? 102.323 87.651  -55.077 1.00 166.33 ? 153  PRO A CB  1 
ATOM   1186  C  CG  . PRO A 1  153  ? 101.545 87.223  -53.856 1.00 165.01 ? 153  PRO A CG  1 
ATOM   1187  C  CD  . PRO A 1  153  ? 100.479 86.356  -54.474 1.00 164.28 ? 153  PRO A CD  1 
ATOM   1188  N  N   . SER A 1  154  ? 104.554 85.471  -56.677 1.00 171.44 ? 154  SER A N   1 
ATOM   1189  C  CA  . SER A 1  154  ? 105.835 84.775  -56.577 1.00 173.48 ? 154  SER A CA  1 
ATOM   1190  C  C   . SER A 1  154  ? 106.858 85.511  -55.698 1.00 175.07 ? 154  SER A C   1 
ATOM   1191  O  O   . SER A 1  154  ? 106.486 86.221  -54.760 1.00 176.41 ? 154  SER A O   1 
ATOM   1192  C  CB  . SER A 1  154  ? 106.408 84.527  -57.983 1.00 173.00 ? 154  SER A CB  1 
ATOM   1193  O  OG  . SER A 1  154  ? 106.272 85.662  -58.825 1.00 171.68 ? 154  SER A OG  1 
ATOM   1194  N  N   . GLU A 1  155  ? 108.142 85.334  -56.004 1.00 176.02 ? 155  GLU A N   1 
ATOM   1195  C  CA  . GLU A 1  155  ? 109.230 85.957  -55.243 1.00 176.08 ? 155  GLU A CA  1 
ATOM   1196  C  C   . GLU A 1  155  ? 109.593 87.345  -55.780 1.00 176.05 ? 155  GLU A C   1 
ATOM   1197  O  O   . GLU A 1  155  ? 110.538 87.981  -55.302 1.00 175.20 ? 155  GLU A O   1 
ATOM   1198  C  CB  . GLU A 1  155  ? 110.463 85.046  -55.291 1.00 176.10 ? 155  GLU A CB  1 
ATOM   1199  C  CG  . GLU A 1  155  ? 110.135 83.569  -55.061 1.00 175.85 ? 155  GLU A CG  1 
ATOM   1200  C  CD  . GLU A 1  155  ? 111.252 82.629  -55.487 1.00 175.48 ? 155  GLU A CD  1 
ATOM   1201  O  OE1 . GLU A 1  155  ? 111.699 82.715  -56.653 1.00 174.69 ? 155  GLU A OE1 1 
ATOM   1202  O  OE2 . GLU A 1  155  ? 111.674 81.796  -54.657 1.00 174.97 ? 155  GLU A OE2 1 
ATOM   1203  N  N   . ASP A 1  156  ? 108.828 87.810  -56.767 1.00 176.53 ? 156  ASP A N   1 
ATOM   1204  C  CA  . ASP A 1  156  ? 109.066 89.107  -57.395 1.00 175.95 ? 156  ASP A CA  1 
ATOM   1205  C  C   . ASP A 1  156  ? 108.026 90.164  -57.019 1.00 175.11 ? 156  ASP A C   1 
ATOM   1206  O  O   . ASP A 1  156  ? 107.826 90.481  -55.842 1.00 174.85 ? 156  ASP A O   1 
ATOM   1207  C  CB  . ASP A 1  156  ? 109.084 88.948  -58.921 1.00 176.05 ? 156  ASP A CB  1 
ATOM   1208  C  CG  . ASP A 1  156  ? 109.801 87.689  -59.368 1.00 176.10 ? 156  ASP A CG  1 
ATOM   1209  O  OD1 . ASP A 1  156  ? 110.994 87.530  -59.035 1.00 176.08 ? 156  ASP A OD1 1 
ATOM   1210  O  OD2 . ASP A 1  156  ? 109.166 86.856  -60.053 1.00 175.83 ? 156  ASP A OD2 1 
ATOM   1211  N  N   . ASP A 1  157  ? 107.367 90.700  -58.041 1.00 173.83 ? 157  ASP A N   1 
ATOM   1212  C  CA  . ASP A 1  157  ? 106.359 91.735  -57.869 1.00 172.82 ? 157  ASP A CA  1 
ATOM   1213  C  C   . ASP A 1  157  ? 105.016 91.192  -57.400 1.00 171.10 ? 157  ASP A C   1 
ATOM   1214  O  O   . ASP A 1  157  ? 104.521 90.198  -57.931 1.00 169.82 ? 157  ASP A O   1 
ATOM   1215  C  CB  . ASP A 1  157  ? 106.151 92.481  -59.193 1.00 174.22 ? 157  ASP A CB  1 
ATOM   1216  C  CG  . ASP A 1  157  ? 107.425 93.126  -59.713 1.00 175.52 ? 157  ASP A CG  1 
ATOM   1217  O  OD1 . ASP A 1  157  ? 107.952 94.039  -59.040 1.00 176.37 ? 157  ASP A OD1 1 
ATOM   1218  O  OD2 . ASP A 1  157  ? 107.898 92.721  -60.798 1.00 175.23 ? 157  ASP A OD2 1 
ATOM   1219  N  N   . PRO A 1  158  ? 104.414 91.832  -56.383 1.00 170.27 ? 158  PRO A N   1 
ATOM   1220  C  CA  . PRO A 1  158  ? 103.113 91.374  -55.891 1.00 170.02 ? 158  PRO A CA  1 
ATOM   1221  C  C   . PRO A 1  158  ? 102.020 91.795  -56.890 1.00 170.15 ? 158  PRO A C   1 
ATOM   1222  O  O   . PRO A 1  158  ? 100.823 91.718  -56.597 1.00 169.62 ? 158  PRO A O   1 
ATOM   1223  C  CB  . PRO A 1  158  ? 102.993 92.072  -54.535 1.00 169.01 ? 158  PRO A CB  1 
ATOM   1224  C  CG  . PRO A 1  158  ? 103.755 93.340  -54.744 1.00 168.92 ? 158  PRO A CG  1 
ATOM   1225  C  CD  . PRO A 1  158  ? 104.977 92.864  -55.493 1.00 169.48 ? 158  PRO A CD  1 
ATOM   1226  N  N   . THR A 1  159  ? 102.461 92.241  -58.070 1.00 170.19 ? 159  THR A N   1 
ATOM   1227  C  CA  . THR A 1  159  ? 101.578 92.675  -59.162 1.00 169.41 ? 159  THR A CA  1 
ATOM   1228  C  C   . THR A 1  159  ? 101.403 91.530  -60.165 1.00 168.49 ? 159  THR A C   1 
ATOM   1229  O  O   . THR A 1  159  ? 100.345 91.385  -60.786 1.00 168.11 ? 159  THR A O   1 
ATOM   1230  C  CB  . THR A 1  159  ? 102.163 93.902  -59.928 1.00 169.70 ? 159  THR A CB  1 
ATOM   1231  O  OG1 . THR A 1  159  ? 102.284 95.019  -59.038 1.00 169.33 ? 159  THR A OG1 1 
ATOM   1232  C  CG2 . THR A 1  159  ? 101.259 94.289  -61.099 1.00 169.12 ? 159  THR A CG2 1 
ATOM   1233  N  N   . GLN A 1  160  ? 102.460 90.735  -60.324 1.00 166.94 ? 160  GLN A N   1 
ATOM   1234  C  CA  . GLN A 1  160  ? 102.451 89.585  -61.226 1.00 164.60 ? 160  GLN A CA  1 
ATOM   1235  C  C   . GLN A 1  160  ? 102.028 88.348  -60.439 1.00 162.92 ? 160  GLN A C   1 
ATOM   1236  O  O   . GLN A 1  160  ? 102.581 88.059  -59.375 1.00 163.03 ? 160  GLN A O   1 
ATOM   1237  C  CB  . GLN A 1  160  ? 103.843 89.347  -61.805 1.00 164.65 ? 160  GLN A CB  1 
ATOM   1238  C  CG  . GLN A 1  160  ? 104.392 90.486  -62.627 1.00 164.08 ? 160  GLN A CG  1 
ATOM   1239  C  CD  . GLN A 1  160  ? 105.788 90.189  -63.127 1.00 164.02 ? 160  GLN A CD  1 
ATOM   1240  O  OE1 . GLN A 1  160  ? 106.718 90.015  -62.336 1.00 163.70 ? 160  GLN A OE1 1 
ATOM   1241  N  NE2 . GLN A 1  160  ? 105.943 90.120  -64.444 1.00 163.60 ? 160  GLN A NE2 1 
ATOM   1242  N  N   . LEU A 1  161  ? 101.056 87.614  -60.970 1.00 159.88 ? 161  LEU A N   1 
ATOM   1243  C  CA  . LEU A 1  161  ? 100.554 86.418  -60.303 1.00 155.86 ? 161  LEU A CA  1 
ATOM   1244  C  C   . LEU A 1  161  ? 101.004 85.139  -61.020 1.00 153.81 ? 161  LEU A C   1 
ATOM   1245  O  O   . LEU A 1  161  ? 100.922 85.039  -62.247 1.00 152.82 ? 161  LEU A O   1 
ATOM   1246  C  CB  . LEU A 1  161  ? 99.018  86.475  -60.229 1.00 154.63 ? 161  LEU A CB  1 
ATOM   1247  C  CG  . LEU A 1  161  ? 98.368  87.748  -59.655 1.00 153.27 ? 161  LEU A CG  1 
ATOM   1248  C  CD1 . LEU A 1  161  ? 96.859  87.673  -59.830 1.00 151.60 ? 161  LEU A CD1 1 
ATOM   1249  C  CD2 . LEU A 1  161  ? 98.730  87.919  -58.185 1.00 152.12 ? 161  LEU A CD2 1 
ATOM   1250  N  N   . VAL A 1  162  ? 101.487 84.170  -60.244 1.00 151.25 ? 162  VAL A N   1 
ATOM   1251  C  CA  . VAL A 1  162  ? 101.942 82.893  -60.792 1.00 147.90 ? 162  VAL A CA  1 
ATOM   1252  C  C   . VAL A 1  162  ? 100.964 81.781  -60.402 1.00 146.13 ? 162  VAL A C   1 
ATOM   1253  O  O   . VAL A 1  162  ? 100.375 81.813  -59.320 1.00 145.16 ? 162  VAL A O   1 
ATOM   1254  C  CB  . VAL A 1  162  ? 103.349 82.532  -60.271 1.00 147.46 ? 162  VAL A CB  1 
ATOM   1255  C  CG1 . VAL A 1  162  ? 103.860 81.292  -60.983 1.00 146.40 ? 162  VAL A CG1 1 
ATOM   1256  C  CG2 . VAL A 1  162  ? 104.299 83.704  -60.480 1.00 146.74 ? 162  VAL A CG2 1 
ATOM   1257  N  N   . SER A 1  163  ? 100.796 80.797  -61.281 1.00 144.04 ? 163  SER A N   1 
ATOM   1258  C  CA  . SER A 1  163  ? 99.870  79.698  -61.023 1.00 142.72 ? 163  SER A CA  1 
ATOM   1259  C  C   . SER A 1  163  ? 100.539 78.384  -60.615 1.00 142.12 ? 163  SER A C   1 
ATOM   1260  O  O   . SER A 1  163  ? 101.687 78.119  -60.974 1.00 141.90 ? 163  SER A O   1 
ATOM   1261  C  CB  . SER A 1  163  ? 98.991  79.461  -62.254 1.00 142.09 ? 163  SER A CB  1 
ATOM   1262  O  OG  . SER A 1  163  ? 99.777  79.210  -63.401 1.00 142.07 ? 163  SER A OG  1 
ATOM   1263  N  N   . ARG A 1  164  ? 99.798  77.570  -59.862 1.00 141.20 ? 164  ARG A N   1 
ATOM   1264  C  CA  . ARG A 1  164  ? 100.263 76.265  -59.383 1.00 139.05 ? 164  ARG A CA  1 
ATOM   1265  C  C   . ARG A 1  164  ? 99.229  75.185  -59.735 1.00 138.94 ? 164  ARG A C   1 
ATOM   1266  O  O   . ARG A 1  164  ? 99.098  74.794  -60.894 1.00 139.42 ? 164  ARG A O   1 
ATOM   1267  C  CB  . ARG A 1  164  ? 100.477 76.311  -57.864 1.00 137.31 ? 164  ARG A CB  1 
ATOM   1268  C  CG  . ARG A 1  164  ? 99.228  76.656  -57.049 1.00 135.40 ? 164  ARG A CG  1 
ATOM   1269  C  CD  . ARG A 1  164  ? 99.515  76.634  -55.556 1.00 134.44 ? 164  ARG A CD  1 
ATOM   1270  N  NE  . ARG A 1  164  ? 98.298  76.557  -54.753 1.00 132.67 ? 164  ARG A NE  1 
ATOM   1271  C  CZ  . ARG A 1  164  ? 98.276  76.619  -53.425 1.00 132.46 ? 164  ARG A CZ  1 
ATOM   1272  N  NH1 . ARG A 1  164  ? 99.407  76.764  -52.746 1.00 132.36 ? 164  ARG A NH1 1 
ATOM   1273  N  NH2 . ARG A 1  164  ? 97.125  76.528  -52.772 1.00 131.72 ? 164  ARG A NH2 1 
ATOM   1274  N  N   . GLY A 1  165  ? 98.505  74.706  -58.728 1.00 138.62 ? 165  GLY A N   1 
ATOM   1275  C  CA  . GLY A 1  165  ? 97.477  73.705  -58.946 1.00 138.31 ? 165  GLY A CA  1 
ATOM   1276  C  C   . GLY A 1  165  ? 96.134  74.407  -59.032 1.00 138.74 ? 165  GLY A C   1 
ATOM   1277  O  O   . GLY A 1  165  ? 95.876  75.357  -58.290 1.00 138.42 ? 165  GLY A O   1 
ATOM   1278  N  N   . GLY A 1  166  ? 95.272  73.936  -59.926 1.00 138.58 ? 166  GLY A N   1 
ATOM   1279  C  CA  . GLY A 1  166  ? 93.978  74.569  -60.104 1.00 139.84 ? 166  GLY A CA  1 
ATOM   1280  C  C   . GLY A 1  166  ? 92.833  74.262  -59.152 1.00 139.99 ? 166  GLY A C   1 
ATOM   1281  O  O   . GLY A 1  166  ? 92.988  73.603  -58.116 1.00 140.60 ? 166  GLY A O   1 
ATOM   1282  N  N   . CYS A 1  167  ? 91.666  74.777  -59.538 1.00 139.76 ? 167  CYS A N   1 
ATOM   1283  C  CA  . CYS A 1  167  ? 90.418  74.624  -58.805 1.00 138.65 ? 167  CYS A CA  1 
ATOM   1284  C  C   . CYS A 1  167  ? 90.495  75.288  -57.438 1.00 137.73 ? 167  CYS A C   1 
ATOM   1285  O  O   . CYS A 1  167  ? 91.272  74.877  -56.581 1.00 138.17 ? 167  CYS A O   1 
ATOM   1286  C  CB  . CYS A 1  167  ? 90.065  73.140  -58.665 1.00 139.38 ? 167  CYS A CB  1 
ATOM   1287  S  SG  . CYS A 1  167  ? 90.606  72.335  -57.143 1.00 141.43 ? 167  CYS A SG  1 
ATOM   1288  N  N   . GLY A 1  168  ? 89.691  76.327  -57.245 1.00 137.28 ? 168  GLY A N   1 
ATOM   1289  C  CA  . GLY A 1  168  ? 89.696  77.030  -55.976 1.00 137.70 ? 168  GLY A CA  1 
ATOM   1290  C  C   . GLY A 1  168  ? 88.511  76.661  -55.111 1.00 138.29 ? 168  GLY A C   1 
ATOM   1291  O  O   . GLY A 1  168  ? 88.328  77.222  -54.026 1.00 137.16 ? 168  GLY A O   1 
ATOM   1292  N  N   . ASN A 1  169  ? 87.706  75.717  -55.597 1.00 139.45 ? 169  ASN A N   1 
ATOM   1293  C  CA  . ASN A 1  169  ? 86.530  75.268  -54.865 1.00 140.60 ? 169  ASN A CA  1 
ATOM   1294  C  C   . ASN A 1  169  ? 86.798  75.451  -53.382 1.00 140.48 ? 169  ASN A C   1 
ATOM   1295  O  O   . ASN A 1  169  ? 87.697  74.837  -52.814 1.00 141.21 ? 169  ASN A O   1 
ATOM   1296  C  CB  . ASN A 1  169  ? 86.226  73.802  -55.186 1.00 141.17 ? 169  ASN A CB  1 
ATOM   1297  C  CG  . ASN A 1  169  ? 85.718  73.609  -56.607 1.00 141.48 ? 169  ASN A CG  1 
ATOM   1298  O  OD1 . ASN A 1  169  ? 84.628  74.062  -56.959 1.00 141.26 ? 169  ASN A OD1 1 
ATOM   1299  N  ND2 . ASN A 1  169  ? 86.513  72.938  -57.430 1.00 142.00 ? 169  ASN A ND2 1 
ATOM   1300  N  N   . THR A 1  170  ? 86.029  76.339  -52.775 1.00 140.17 ? 170  THR A N   1 
ATOM   1301  C  CA  . THR A 1  170  ? 86.169  76.650  -51.366 1.00 141.39 ? 170  THR A CA  1 
ATOM   1302  C  C   . THR A 1  170  ? 86.351  75.406  -50.510 1.00 140.37 ? 170  THR A C   1 
ATOM   1303  O  O   . THR A 1  170  ? 85.784  74.356  -50.803 1.00 141.21 ? 170  THR A O   1 
ATOM   1304  C  CB  . THR A 1  170  ? 84.929  77.387  -50.867 1.00 143.25 ? 170  THR A CB  1 
ATOM   1305  O  OG1 . THR A 1  170  ? 84.467  78.277  -51.889 1.00 144.90 ? 170  THR A OG1 1 
ATOM   1306  C  CG2 . THR A 1  170  ? 85.254  78.184  -49.608 1.00 145.06 ? 170  THR A CG2 1 
ATOM   1307  N  N   . GLN A 1  171  ? 87.149  75.527  -49.454 1.00 138.82 ? 171  GLN A N   1 
ATOM   1308  C  CA  . GLN A 1  171  ? 87.364  74.414  -48.537 1.00 136.67 ? 171  GLN A CA  1 
ATOM   1309  C  C   . GLN A 1  171  ? 86.387  74.582  -47.385 1.00 132.02 ? 171  GLN A C   1 
ATOM   1310  O  O   . GLN A 1  171  ? 86.154  75.696  -46.914 1.00 132.93 ? 171  GLN A O   1 
ATOM   1311  C  CB  . GLN A 1  171  ? 88.773  74.425  -47.961 1.00 141.70 ? 171  GLN A CB  1 
ATOM   1312  C  CG  . GLN A 1  171  ? 89.891  74.242  -48.949 1.00 147.97 ? 171  GLN A CG  1 
ATOM   1313  C  CD  . GLN A 1  171  ? 91.232  74.150  -48.242 1.00 152.03 ? 171  GLN A CD  1 
ATOM   1314  O  OE1 . GLN A 1  171  ? 91.500  73.188  -47.516 1.00 152.88 ? 171  GLN A OE1 1 
ATOM   1315  N  NE2 . GLN A 1  171  ? 92.076  75.162  -48.435 1.00 155.45 ? 171  GLN A NE2 1 
ATOM   1316  N  N   . PRO A 1  172  ? 85.808  73.476  -46.907 1.00 126.42 ? 172  PRO A N   1 
ATOM   1317  C  CA  . PRO A 1  172  ? 84.854  73.541  -45.802 1.00 122.26 ? 172  PRO A CA  1 
ATOM   1318  C  C   . PRO A 1  172  ? 85.502  73.405  -44.440 1.00 118.20 ? 172  PRO A C   1 
ATOM   1319  O  O   . PRO A 1  172  ? 86.480  72.685  -44.283 1.00 116.92 ? 172  PRO A O   1 
ATOM   1320  C  CB  . PRO A 1  172  ? 83.929  72.377  -46.098 1.00 122.69 ? 172  PRO A CB  1 
ATOM   1321  C  CG  . PRO A 1  172  ? 84.887  71.361  -46.606 1.00 123.05 ? 172  PRO A CG  1 
ATOM   1322  C  CD  . PRO A 1  172  ? 85.767  72.153  -47.551 1.00 124.56 ? 172  PRO A CD  1 
ATOM   1323  N  N   . THR A 1  173  ? 84.959  74.112  -43.459 1.00 115.20 ? 173  THR A N   1 
ATOM   1324  C  CA  . THR A 1  173  ? 85.470  74.011  -42.105 1.00 114.61 ? 173  THR A CA  1 
ATOM   1325  C  C   . THR A 1  173  ? 84.881  72.677  -41.676 1.00 112.51 ? 173  THR A C   1 
ATOM   1326  O  O   . THR A 1  173  ? 83.873  72.258  -42.239 1.00 111.74 ? 173  THR A O   1 
ATOM   1327  C  CB  . THR A 1  173  ? 84.917  75.129  -41.202 1.00 115.58 ? 173  THR A CB  1 
ATOM   1328  O  OG1 . THR A 1  173  ? 85.105  76.397  -41.840 1.00 117.14 ? 173  THR A OG1 1 
ATOM   1329  C  CG2 . THR A 1  173  ? 85.648  75.140  -39.861 1.00 116.69 ? 173  THR A CG2 1 
ATOM   1330  N  N   . ILE A 1  174  ? 85.486  72.002  -40.703 1.00 110.47 ? 174  ILE A N   1 
ATOM   1331  C  CA  . ILE A 1  174  ? 84.956  70.711  -40.288 1.00 107.30 ? 174  ILE A CA  1 
ATOM   1332  C  C   . ILE A 1  174  ? 84.817  70.493  -38.795 1.00 108.31 ? 174  ILE A C   1 
ATOM   1333  O  O   . ILE A 1  174  ? 85.648  70.942  -38.004 1.00 108.57 ? 174  ILE A O   1 
ATOM   1334  C  CB  . ILE A 1  174  ? 85.805  69.576  -40.808 1.00 104.49 ? 174  ILE A CB  1 
ATOM   1335  C  CG1 . ILE A 1  174  ? 86.230  69.854  -42.243 1.00 104.08 ? 174  ILE A CG1 1 
ATOM   1336  C  CG2 . ILE A 1  174  ? 85.006  68.308  -40.763 1.00 104.01 ? 174  ILE A CG2 1 
ATOM   1337  C  CD1 . ILE A 1  174  ? 87.191  68.834  -42.793 1.00 104.34 ? 174  ILE A CD1 1 
ATOM   1338  N  N   . ARG A 1  175  ? 83.764  69.773  -38.425 1.00 109.28 ? 175  ARG A N   1 
ATOM   1339  C  CA  . ARG A 1  175  ? 83.495  69.461  -37.030 1.00 111.15 ? 175  ARG A CA  1 
ATOM   1340  C  C   . ARG A 1  175  ? 83.185  67.972  -36.835 1.00 108.34 ? 175  ARG A C   1 
ATOM   1341  O  O   . ARG A 1  175  ? 82.572  67.326  -37.688 1.00 107.46 ? 175  ARG A O   1 
ATOM   1342  C  CB  . ARG A 1  175  ? 82.334  70.312  -36.514 1.00 116.61 ? 175  ARG A CB  1 
ATOM   1343  C  CG  . ARG A 1  175  ? 81.049  70.156  -37.310 1.00 123.65 ? 175  ARG A CG  1 
ATOM   1344  C  CD  . ARG A 1  175  ? 79.880  70.819  -36.592 1.00 129.03 ? 175  ARG A CD  1 
ATOM   1345  N  NE  . ARG A 1  175  ? 78.604  70.552  -37.250 1.00 132.96 ? 175  ARG A NE  1 
ATOM   1346  C  CZ  . ARG A 1  175  ? 77.422  70.918  -36.762 1.00 135.22 ? 175  ARG A CZ  1 
ATOM   1347  N  NH1 . ARG A 1  175  ? 77.349  71.568  -35.606 1.00 135.88 ? 175  ARG A NH1 1 
ATOM   1348  N  NH2 . ARG A 1  175  ? 76.313  70.635  -37.433 1.00 136.32 ? 175  ARG A NH2 1 
ATOM   1349  N  N   . LYS A 1  176  ? 83.615  67.439  -35.697 1.00 104.21 ? 176  LYS A N   1 
ATOM   1350  C  CA  . LYS A 1  176  ? 83.415  66.037  -35.376 1.00 100.39 ? 176  LYS A CA  1 
ATOM   1351  C  C   . LYS A 1  176  ? 82.102  65.742  -34.671 1.00 98.79  ? 176  LYS A C   1 
ATOM   1352  O  O   . LYS A 1  176  ? 81.916  66.113  -33.512 1.00 99.60  ? 176  LYS A O   1 
ATOM   1353  C  CB  . LYS A 1  176  ? 84.569  65.536  -34.499 1.00 100.91 ? 176  LYS A CB  1 
ATOM   1354  C  CG  . LYS A 1  176  ? 84.218  64.301  -33.677 1.00 100.88 ? 176  LYS A CG  1 
ATOM   1355  C  CD  . LYS A 1  176  ? 85.348  63.829  -32.783 1.00 100.12 ? 176  LYS A CD  1 
ATOM   1356  C  CE  . LYS A 1  176  ? 84.886  62.622  -31.980 1.00 100.79 ? 176  LYS A CE  1 
ATOM   1357  N  NZ  . LYS A 1  176  ? 85.983  61.951  -31.234 1.00 104.21 ? 176  LYS A NZ  1 
ATOM   1358  N  N   . ASP A 1  177  ? 81.191  65.073  -35.369 1.00 96.97  ? 177  ASP A N   1 
ATOM   1359  C  CA  . ASP A 1  177  ? 79.921  64.686  -34.763 1.00 96.30  ? 177  ASP A CA  1 
ATOM   1360  C  C   . ASP A 1  177  ? 79.899  63.165  -34.708 1.00 94.24  ? 177  ASP A C   1 
ATOM   1361  O  O   . ASP A 1  177  ? 79.806  62.501  -35.746 1.00 93.93  ? 177  ASP A O   1 
ATOM   1362  C  CB  . ASP A 1  177  ? 78.725  65.165  -35.584 1.00 98.93  ? 177  ASP A CB  1 
ATOM   1363  C  CG  . ASP A 1  177  ? 77.399  64.949  -34.857 1.00 100.84 ? 177  ASP A CG  1 
ATOM   1364  O  OD1 . ASP A 1  177  ? 77.207  63.872  -34.251 1.00 101.34 ? 177  ASP A OD1 1 
ATOM   1365  O  OD2 . ASP A 1  177  ? 76.543  65.857  -34.895 1.00 102.97 ? 177  ASP A OD2 1 
ATOM   1366  N  N   . GLY A 1  178  ? 79.986  62.615  -33.501 1.00 91.63  ? 178  GLY A N   1 
ATOM   1367  C  CA  . GLY A 1  178  ? 79.983  61.172  -33.357 1.00 87.80  ? 178  GLY A CA  1 
ATOM   1368  C  C   . GLY A 1  178  ? 81.177  60.557  -34.061 1.00 85.43  ? 178  GLY A C   1 
ATOM   1369  O  O   . GLY A 1  178  ? 82.319  60.836  -33.707 1.00 84.83  ? 178  GLY A O   1 
ATOM   1370  N  N   . LEU A 1  179  ? 80.917  59.729  -35.068 1.00 83.04  ? 179  LEU A N   1 
ATOM   1371  C  CA  . LEU A 1  179  ? 81.985  59.074  -35.808 1.00 81.46  ? 179  LEU A CA  1 
ATOM   1372  C  C   . LEU A 1  179  ? 82.042  59.520  -37.262 1.00 82.65  ? 179  LEU A C   1 
ATOM   1373  O  O   . LEU A 1  179  ? 82.672  58.862  -38.096 1.00 82.41  ? 179  LEU A O   1 
ATOM   1374  C  CB  . LEU A 1  179  ? 81.804  57.558  -35.757 1.00 79.54  ? 179  LEU A CB  1 
ATOM   1375  C  CG  . LEU A 1  179  ? 81.809  56.895  -34.383 1.00 78.17  ? 179  LEU A CG  1 
ATOM   1376  C  CD1 . LEU A 1  179  ? 81.552  55.413  -34.556 1.00 79.02  ? 179  LEU A CD1 1 
ATOM   1377  C  CD2 . LEU A 1  179  ? 83.138  57.125  -33.688 1.00 77.78  ? 179  LEU A CD2 1 
ATOM   1378  N  N   . LYS A 1  180  ? 81.383  60.631  -37.572 1.00 83.82  ? 180  LYS A N   1 
ATOM   1379  C  CA  . LYS A 1  180  ? 81.384  61.132  -38.938 1.00 85.33  ? 180  LYS A CA  1 
ATOM   1380  C  C   . LYS A 1  180  ? 81.903  62.549  -39.025 1.00 83.50  ? 180  LYS A C   1 
ATOM   1381  O  O   . LYS A 1  180  ? 81.927  63.284  -38.038 1.00 83.27  ? 180  LYS A O   1 
ATOM   1382  C  CB  . LYS A 1  180  ? 79.979  61.057  -39.544 1.00 89.40  ? 180  LYS A CB  1 
ATOM   1383  C  CG  . LYS A 1  180  ? 79.508  59.631  -39.811 1.00 96.96  ? 180  LYS A CG  1 
ATOM   1384  C  CD  . LYS A 1  180  ? 78.213  59.577  -40.629 1.00 100.23 ? 180  LYS A CD  1 
ATOM   1385  C  CE  . LYS A 1  180  ? 77.795  58.125  -40.913 1.00 102.96 ? 180  LYS A CE  1 
ATOM   1386  N  NZ  . LYS A 1  180  ? 76.609  58.001  -41.818 1.00 102.87 ? 180  LYS A NZ  1 
ATOM   1387  N  N   . LEU A 1  181  ? 82.332  62.933  -40.215 1.00 82.88  ? 181  LEU A N   1 
ATOM   1388  C  CA  . LEU A 1  181  ? 82.835  64.274  -40.390 1.00 85.82  ? 181  LEU A CA  1 
ATOM   1389  C  C   . LEU A 1  181  ? 81.896  65.136  -41.216 1.00 91.05  ? 181  LEU A C   1 
ATOM   1390  O  O   . LEU A 1  181  ? 81.456  64.753  -42.307 1.00 92.50  ? 181  LEU A O   1 
ATOM   1391  C  CB  . LEU A 1  181  ? 84.225  64.248  -41.019 1.00 80.38  ? 181  LEU A CB  1 
ATOM   1392  C  CG  . LEU A 1  181  ? 85.350  63.768  -40.099 1.00 75.80  ? 181  LEU A CG  1 
ATOM   1393  C  CD1 . LEU A 1  181  ? 86.687  64.008  -40.794 1.00 72.22  ? 181  LEU A CD1 1 
ATOM   1394  C  CD2 . LEU A 1  181  ? 85.298  64.499  -38.755 1.00 71.60  ? 181  LEU A CD2 1 
ATOM   1395  N  N   . VAL A 1  182  ? 81.583  66.305  -40.667 1.00 95.44  ? 182  VAL A N   1 
ATOM   1396  C  CA  . VAL A 1  182  ? 80.705  67.253  -41.326 1.00 98.83  ? 182  VAL A CA  1 
ATOM   1397  C  C   . VAL A 1  182  ? 81.393  68.592  -41.533 1.00 101.54 ? 182  VAL A C   1 
ATOM   1398  O  O   . VAL A 1  182  ? 82.091  69.089  -40.644 1.00 101.36 ? 182  VAL A O   1 
ATOM   1399  C  CB  . VAL A 1  182  ? 79.443  67.496  -40.510 1.00 98.14  ? 182  VAL A CB  1 
ATOM   1400  C  CG1 . VAL A 1  182  ? 78.650  68.635  -41.124 1.00 100.30 ? 182  VAL A CG1 1 
ATOM   1401  C  CG2 . VAL A 1  182  ? 78.614  66.236  -40.471 1.00 98.06  ? 182  VAL A CG2 1 
ATOM   1402  N  N   . GLY A 1  183  ? 81.178  69.170  -42.712 1.00 103.55 ? 183  GLY A N   1 
ATOM   1403  C  CA  . GLY A 1  183  ? 81.770  70.453  -43.038 1.00 106.52 ? 183  GLY A CA  1 
ATOM   1404  C  C   . GLY A 1  183  ? 80.749  71.375  -43.671 1.00 108.55 ? 183  GLY A C   1 
ATOM   1405  O  O   . GLY A 1  183  ? 79.758  70.906  -44.226 1.00 107.22 ? 183  GLY A O   1 
ATOM   1406  N  N   . SER A 1  184  ? 81.003  72.680  -43.588 1.00 112.77 ? 184  SER A N   1 
ATOM   1407  C  CA  . SER A 1  184  ? 80.116  73.700  -44.132 1.00 118.11 ? 184  SER A CA  1 
ATOM   1408  C  C   . SER A 1  184  ? 80.820  74.593  -45.170 1.00 122.16 ? 184  SER A C   1 
ATOM   1409  O  O   . SER A 1  184  ? 82.033  74.810  -45.101 1.00 123.52 ? 184  SER A O   1 
ATOM   1410  C  CB  . SER A 1  184  ? 79.579  74.574  -42.990 1.00 116.46 ? 184  SER A CB  1 
ATOM   1411  O  OG  . SER A 1  184  ? 80.578  75.464  -42.521 1.00 114.63 ? 184  SER A OG  1 
ATOM   1412  N  N   . TRP A 1  185  ? 80.038  75.080  -46.138 1.00 126.84 ? 185  TRP A N   1 
ATOM   1413  C  CA  . TRP A 1  185  ? 80.488  75.981  -47.212 1.00 131.85 ? 185  TRP A CA  1 
ATOM   1414  C  C   . TRP A 1  185  ? 79.638  77.272  -47.026 1.00 134.91 ? 185  TRP A C   1 
ATOM   1415  O  O   . TRP A 1  185  ? 78.501  77.195  -46.529 1.00 136.36 ? 185  TRP A O   1 
ATOM   1416  C  CB  . TRP A 1  185  ? 80.261  75.312  -48.603 1.00 132.12 ? 185  TRP A CB  1 
ATOM   1417  C  CG  . TRP A 1  185  ? 81.168  74.066  -48.923 1.00 132.31 ? 185  TRP A CG  1 
ATOM   1418  C  CD1 . TRP A 1  185  ? 82.372  74.061  -49.598 1.00 132.70 ? 185  TRP A CD1 1 
ATOM   1419  C  CD2 . TRP A 1  185  ? 80.984  72.714  -48.453 1.00 131.90 ? 185  TRP A CD2 1 
ATOM   1420  N  NE1 . TRP A 1  185  ? 82.944  72.805  -49.549 1.00 131.88 ? 185  TRP A NE1 1 
ATOM   1421  C  CE2 . TRP A 1  185  ? 82.121  71.966  -48.846 1.00 130.93 ? 185  TRP A CE2 1 
ATOM   1422  C  CE3 . TRP A 1  185  ? 79.983  72.075  -47.711 1.00 132.33 ? 185  TRP A CE3 1 
ATOM   1423  C  CZ2 . TRP A 1  185  ? 82.267  70.604  -48.539 1.00 129.29 ? 185  TRP A CZ2 1 
ATOM   1424  C  CZ3 . TRP A 1  185  ? 80.135  70.718  -47.403 1.00 131.71 ? 185  TRP A CZ3 1 
ATOM   1425  C  CH2 . TRP A 1  185  ? 81.274  70.005  -47.808 1.00 129.68 ? 185  TRP A CH2 1 
ATOM   1426  N  N   . LYS A 1  186  ? 80.204  78.433  -47.403 1.00 139.53 ? 186  LYS A N   1 
ATOM   1427  C  CA  . LYS A 1  186  ? 79.586  79.794  -47.266 1.00 145.06 ? 186  LYS A CA  1 
ATOM   1428  C  C   . LYS A 1  186  ? 79.837  80.554  -48.588 1.00 147.60 ? 186  LYS A C   1 
ATOM   1429  O  O   . LYS A 1  186  ? 80.644  79.972  -49.345 1.00 145.79 ? 186  LYS A O   1 
ATOM   1430  C  CB  . LYS A 1  186  ? 80.274  80.512  -46.084 1.00 145.90 ? 186  LYS A CB  1 
ATOM   1431  C  CG  . LYS A 1  186  ? 79.635  81.805  -45.537 1.00 146.91 ? 186  LYS A CG  1 
ATOM   1432  C  CD  . LYS A 1  186  ? 79.984  81.988  -44.061 1.00 146.40 ? 186  LYS A CD  1 
ATOM   1433  C  CE  . LYS A 1  186  ? 79.016  81.212  -43.187 1.00 146.16 ? 186  LYS A CE  1 
ATOM   1434  N  NZ  . LYS A 1  186  ? 79.162  81.658  -41.788 1.00 144.64 ? 186  LYS A NZ  1 
ATOM   1435  N  N   . ASP A 1  195  ? 77.714  83.661  -46.759 1.00 149.14 ? 195  ASP A N   1 
ATOM   1436  C  CA  . ASP A 1  195  ? 76.224  83.403  -47.175 1.00 150.91 ? 195  ASP A CA  1 
ATOM   1437  C  C   . ASP A 1  195  ? 75.072  82.274  -46.837 1.00 152.07 ? 195  ASP A C   1 
ATOM   1438  O  O   . ASP A 1  195  ? 74.238  82.017  -47.701 1.00 152.65 ? 195  ASP A O   1 
ATOM   1439  C  CB  . ASP A 1  195  ? 76.214  83.643  -48.714 1.00 150.19 ? 195  ASP A CB  1 
ATOM   1440  C  CG  . ASP A 1  195  ? 75.826  85.125  -49.117 1.00 149.14 ? 195  ASP A CG  1 
ATOM   1441  O  OD1 . ASP A 1  195  ? 76.322  86.120  -48.547 1.00 148.49 ? 195  ASP A OD1 1 
ATOM   1442  O  OD2 . ASP A 1  195  ? 74.995  85.327  -50.036 1.00 148.34 ? 195  ASP A OD2 1 
ATOM   1443  N  N   . GLU A 1  196  ? 74.940  81.705  -45.618 1.00 152.86 ? 196  GLU A N   1 
ATOM   1444  C  CA  . GLU A 1  196  ? 73.893  80.657  -45.207 1.00 151.43 ? 196  GLU A CA  1 
ATOM   1445  C  C   . GLU A 1  196  ? 74.569  79.389  -45.662 1.00 151.31 ? 196  GLU A C   1 
ATOM   1446  O  O   . GLU A 1  196  ? 74.628  79.079  -46.856 1.00 150.89 ? 196  GLU A O   1 
ATOM   1447  C  CB  . GLU A 1  196  ? 72.466  80.738  -45.867 1.00 151.62 ? 196  GLU A CB  1 
ATOM   1448  C  CG  . GLU A 1  196  ? 71.395  79.674  -45.295 1.00 150.34 ? 196  GLU A CG  1 
ATOM   1449  C  CD  . GLU A 1  196  ? 70.427  79.140  -46.373 1.00 150.66 ? 196  GLU A CD  1 
ATOM   1450  O  OE1 . GLU A 1  196  ? 70.892  79.003  -47.518 1.00 150.22 ? 196  GLU A OE1 1 
ATOM   1451  O  OE2 . GLU A 1  196  ? 69.232  78.845  -46.105 1.00 151.01 ? 196  GLU A OE2 1 
ATOM   1452  N  N   . PRO A 1  197  ? 75.141  78.664  -44.700 1.00 149.28 ? 197  PRO A N   1 
ATOM   1453  C  CA  . PRO A 1  197  ? 75.878  77.410  -44.849 1.00 146.75 ? 197  PRO A CA  1 
ATOM   1454  C  C   . PRO A 1  197  ? 75.229  76.308  -45.695 1.00 143.13 ? 197  PRO A C   1 
ATOM   1455  O  O   . PRO A 1  197  ? 74.090  76.418  -46.162 1.00 142.64 ? 197  PRO A O   1 
ATOM   1456  C  CB  . PRO A 1  197  ? 76.161  76.999  -43.397 1.00 148.08 ? 197  PRO A CB  1 
ATOM   1457  C  CG  . PRO A 1  197  ? 75.095  77.704  -42.591 1.00 148.94 ? 197  PRO A CG  1 
ATOM   1458  C  CD  . PRO A 1  197  ? 74.922  79.010  -43.282 1.00 149.40 ? 197  PRO A CD  1 
ATOM   1459  N  N   . GLU A 1  198  ? 75.997  75.256  -45.925 1.00 139.47 ? 198  GLU A N   1 
ATOM   1460  C  CA  . GLU A 1  198  ? 75.541  74.113  -46.696 1.00 135.99 ? 198  GLU A CA  1 
ATOM   1461  C  C   . GLU A 1  198  ? 76.070  72.910  -45.957 1.00 132.35 ? 198  GLU A C   1 
ATOM   1462  O  O   . GLU A 1  198  ? 77.159  72.430  -46.243 1.00 131.98 ? 198  GLU A O   1 
ATOM   1463  C  CB  . GLU A 1  198  ? 76.126  74.149  -48.105 1.00 137.47 ? 198  GLU A CB  1 
ATOM   1464  C  CG  . GLU A 1  198  ? 75.195  74.696  -49.169 1.00 140.15 ? 198  GLU A CG  1 
ATOM   1465  C  CD  . GLU A 1  198  ? 75.764  74.514  -50.564 1.00 141.42 ? 198  GLU A CD  1 
ATOM   1466  O  OE1 . GLU A 1  198  ? 76.111  73.364  -50.917 1.00 142.08 ? 198  GLU A OE1 1 
ATOM   1467  O  OE2 . GLU A 1  198  ? 75.866  75.516  -51.304 1.00 142.92 ? 198  GLU A OE2 1 
ATOM   1468  N  N   . LEU A 1  199  ? 75.298  72.420  -45.000 1.00 128.56 ? 199  LEU A N   1 
ATOM   1469  C  CA  . LEU A 1  199  ? 75.746  71.287  -44.214 1.00 125.74 ? 199  LEU A CA  1 
ATOM   1470  C  C   . LEU A 1  199  ? 75.495  69.894  -44.792 1.00 123.27 ? 199  LEU A C   1 
ATOM   1471  O  O   . LEU A 1  199  ? 74.353  69.428  -44.849 1.00 123.96 ? 199  LEU A O   1 
ATOM   1472  C  CB  . LEU A 1  199  ? 75.144  71.374  -42.810 1.00 126.80 ? 199  LEU A CB  1 
ATOM   1473  C  CG  . LEU A 1  199  ? 75.389  72.703  -42.089 1.00 127.52 ? 199  LEU A CG  1 
ATOM   1474  C  CD1 . LEU A 1  199  ? 74.865  72.625  -40.662 1.00 128.14 ? 199  LEU A CD1 1 
ATOM   1475  C  CD2 . LEU A 1  199  ? 76.874  73.015  -42.088 1.00 127.17 ? 199  LEU A CD2 1 
ATOM   1476  N  N   . ARG A 1  200  ? 76.576  69.237  -45.217 1.00 119.12 ? 200  ARG A N   1 
ATOM   1477  C  CA  . ARG A 1  200  ? 76.497  67.874  -45.743 1.00 114.49 ? 200  ARG A CA  1 
ATOM   1478  C  C   . ARG A 1  200  ? 77.553  66.994  -45.072 1.00 110.82 ? 200  ARG A C   1 
ATOM   1479  O  O   . ARG A 1  200  ? 78.633  67.464  -44.702 1.00 109.05 ? 200  ARG A O   1 
ATOM   1480  C  CB  . ARG A 1  200  ? 76.672  67.832  -47.271 1.00 114.73 ? 200  ARG A CB  1 
ATOM   1481  C  CG  . ARG A 1  200  ? 78.095  67.953  -47.802 1.00 115.12 ? 200  ARG A CG  1 
ATOM   1482  C  CD  . ARG A 1  200  ? 78.259  67.074  -49.041 1.00 116.00 ? 200  ARG A CD  1 
ATOM   1483  N  NE  . ARG A 1  200  ? 79.355  67.482  -49.920 1.00 118.62 ? 200  ARG A NE  1 
ATOM   1484  C  CZ  . ARG A 1  200  ? 79.307  68.510  -50.768 1.00 120.54 ? 200  ARG A CZ  1 
ATOM   1485  N  NH1 . ARG A 1  200  ? 78.214  69.258  -50.866 1.00 120.54 ? 200  ARG A NH1 1 
ATOM   1486  N  NH2 . ARG A 1  200  ? 80.354  68.787  -51.534 1.00 121.54 ? 200  ARG A NH2 1 
ATOM   1487  N  N   . VAL A 1  201  ? 77.222  65.717  -44.908 1.00 106.50 ? 201  VAL A N   1 
ATOM   1488  C  CA  . VAL A 1  201  ? 78.120  64.762  -44.274 1.00 101.20 ? 201  VAL A CA  1 
ATOM   1489  C  C   . VAL A 1  201  ? 79.203  64.307  -45.233 1.00 98.14  ? 201  VAL A C   1 
ATOM   1490  O  O   . VAL A 1  201  ? 78.944  64.071  -46.414 1.00 98.30  ? 201  VAL A O   1 
ATOM   1491  C  CB  . VAL A 1  201  ? 77.361  63.516  -43.798 1.00 101.36 ? 201  VAL A CB  1 
ATOM   1492  C  CG1 . VAL A 1  201  ? 78.308  62.591  -43.055 1.00 101.54 ? 201  VAL A CG1 1 
ATOM   1493  C  CG2 . VAL A 1  201  ? 76.196  63.924  -42.912 1.00 102.92 ? 201  VAL A CG2 1 
ATOM   1494  N  N   . LEU A 1  202  ? 80.417  64.182  -44.713 1.00 93.70  ? 202  LEU A N   1 
ATOM   1495  C  CA  . LEU A 1  202  ? 81.547  63.746  -45.514 1.00 90.83  ? 202  LEU A CA  1 
ATOM   1496  C  C   . LEU A 1  202  ? 81.605  62.232  -45.584 1.00 91.36  ? 202  LEU A C   1 
ATOM   1497  O  O   . LEU A 1  202  ? 82.026  61.572  -44.632 1.00 93.25  ? 202  LEU A O   1 
ATOM   1498  C  CB  . LEU A 1  202  ? 82.835  64.292  -44.917 1.00 87.16  ? 202  LEU A CB  1 
ATOM   1499  C  CG  . LEU A 1  202  ? 82.969  65.778  -45.208 1.00 84.92  ? 202  LEU A CG  1 
ATOM   1500  C  CD1 . LEU A 1  202  ? 84.119  66.374  -44.431 1.00 83.49  ? 202  LEU A CD1 1 
ATOM   1501  C  CD2 . LEU A 1  202  ? 83.164  65.950  -46.707 1.00 84.40  ? 202  LEU A CD2 1 
ATOM   1502  N  N   . SER A 1  203  ? 81.176  61.682  -46.716 1.00 91.72  ? 203  SER A N   1 
ATOM   1503  C  CA  . SER A 1  203  ? 81.171  60.237  -46.894 1.00 90.83  ? 203  SER A CA  1 
ATOM   1504  C  C   . SER A 1  203  ? 82.583  59.688  -46.892 1.00 87.82  ? 203  SER A C   1 
ATOM   1505  O  O   . SER A 1  203  ? 83.474  60.192  -47.581 1.00 85.78  ? 203  SER A O   1 
ATOM   1506  C  CB  . SER A 1  203  ? 80.459  59.847  -48.197 1.00 92.98  ? 203  SER A CB  1 
ATOM   1507  O  OG  . SER A 1  203  ? 81.106  60.398  -49.329 1.00 95.51  ? 203  SER A OG  1 
ATOM   1508  N  N   . THR A 1  204  ? 82.779  58.653  -46.093 1.00 83.83  ? 204  THR A N   1 
ATOM   1509  C  CA  . THR A 1  204  ? 84.072  58.021  -45.986 1.00 80.53  ? 204  THR A CA  1 
ATOM   1510  C  C   . THR A 1  204  ? 84.574  57.700  -47.384 1.00 80.41  ? 204  THR A C   1 
ATOM   1511  O  O   . THR A 1  204  ? 85.719  57.980  -47.724 1.00 80.67  ? 204  THR A O   1 
ATOM   1512  C  CB  . THR A 1  204  ? 83.949  56.746  -45.176 1.00 78.77  ? 204  THR A CB  1 
ATOM   1513  O  OG1 . THR A 1  204  ? 83.302  57.047  -43.934 1.00 78.91  ? 204  THR A OG1 1 
ATOM   1514  C  CG2 . THR A 1  204  ? 85.310  56.161  -44.903 1.00 77.20  ? 204  THR A CG2 1 
ATOM   1515  N  N   . GLU A 1  205  ? 83.692  57.129  -48.193 1.00 81.13  ? 205  GLU A N   1 
ATOM   1516  C  CA  . GLU A 1  205  ? 84.005  56.747  -49.566 1.00 81.71  ? 205  GLU A CA  1 
ATOM   1517  C  C   . GLU A 1  205  ? 84.727  57.861  -50.318 1.00 80.12  ? 205  GLU A C   1 
ATOM   1518  O  O   . GLU A 1  205  ? 85.517  57.595  -51.225 1.00 78.52  ? 205  GLU A O   1 
ATOM   1519  C  CB  . GLU A 1  205  ? 82.708  56.387  -50.292 1.00 85.68  ? 205  GLU A CB  1 
ATOM   1520  C  CG  . GLU A 1  205  ? 81.840  55.386  -49.525 1.00 92.44  ? 205  GLU A CG  1 
ATOM   1521  C  CD  . GLU A 1  205  ? 80.340  55.607  -49.717 1.00 95.46  ? 205  GLU A CD  1 
ATOM   1522  O  OE1 . GLU A 1  205  ? 79.875  55.580  -50.880 1.00 97.50  ? 205  GLU A OE1 1 
ATOM   1523  O  OE2 . GLU A 1  205  ? 79.628  55.802  -48.699 1.00 95.41  ? 205  GLU A OE2 1 
ATOM   1524  N  N   . GLU A 1  206  ? 84.452  59.103  -49.923 1.00 79.13  ? 206  GLU A N   1 
ATOM   1525  C  CA  . GLU A 1  206  ? 85.038  60.293  -50.551 1.00 77.49  ? 206  GLU A CA  1 
ATOM   1526  C  C   . GLU A 1  206  ? 86.371  60.666  -49.923 1.00 72.43  ? 206  GLU A C   1 
ATOM   1527  O  O   . GLU A 1  206  ? 87.377  60.824  -50.621 1.00 71.40  ? 206  GLU A O   1 
ATOM   1528  C  CB  . GLU A 1  206  ? 84.071  61.475  -50.421 1.00 82.91  ? 206  GLU A CB  1 
ATOM   1529  C  CG  . GLU A 1  206  ? 84.440  62.716  -51.235 1.00 90.58  ? 206  GLU A CG  1 
ATOM   1530  C  CD  . GLU A 1  206  ? 83.404  63.831  -51.092 1.00 95.03  ? 206  GLU A CD  1 
ATOM   1531  O  OE1 . GLU A 1  206  ? 83.251  64.366  -49.965 1.00 96.51  ? 206  GLU A OE1 1 
ATOM   1532  O  OE2 . GLU A 1  206  ? 82.741  64.161  -52.107 1.00 98.10  ? 206  GLU A OE2 1 
ATOM   1533  N  N   . ILE A 1  207  ? 86.358  60.828  -48.603 1.00 66.24  ? 207  ILE A N   1 
ATOM   1534  C  CA  . ILE A 1  207  ? 87.557  61.167  -47.852 1.00 60.59  ? 207  ILE A CA  1 
ATOM   1535  C  C   . ILE A 1  207  ? 88.678  60.300  -48.381 1.00 59.61  ? 207  ILE A C   1 
ATOM   1536  O  O   . ILE A 1  207  ? 89.717  60.783  -48.818 1.00 58.31  ? 207  ILE A O   1 
ATOM   1537  C  CB  . ILE A 1  207  ? 87.405  60.817  -46.379 1.00 58.62  ? 207  ILE A CB  1 
ATOM   1538  C  CG1 . ILE A 1  207  ? 86.219  61.551  -45.771 1.00 56.75  ? 207  ILE A CG1 1 
ATOM   1539  C  CG2 . ILE A 1  207  ? 88.674  61.162  -45.651 1.00 57.48  ? 207  ILE A CG2 1 
ATOM   1540  C  CD1 . ILE A 1  207  ? 86.506  62.981  -45.458 1.00 55.40  ? 207  ILE A CD1 1 
ATOM   1541  N  N   . LEU A 1  208  ? 88.439  58.998  -48.319 1.00 59.37  ? 208  LEU A N   1 
ATOM   1542  C  CA  . LEU A 1  208  ? 89.390  58.008  -48.776 1.00 60.60  ? 208  LEU A CA  1 
ATOM   1543  C  C   . LEU A 1  208  ? 89.946  58.468  -50.111 1.00 65.34  ? 208  LEU A C   1 
ATOM   1544  O  O   . LEU A 1  208  ? 91.147  58.713  -50.251 1.00 65.83  ? 208  LEU A O   1 
ATOM   1545  C  CB  . LEU A 1  208  ? 88.693  56.658  -48.949 1.00 55.70  ? 208  LEU A CB  1 
ATOM   1546  C  CG  . LEU A 1  208  ? 89.489  55.408  -48.580 1.00 53.00  ? 208  LEU A CG  1 
ATOM   1547  C  CD1 . LEU A 1  208  ? 88.817  54.190  -49.170 1.00 54.37  ? 208  LEU A CD1 1 
ATOM   1548  C  CD2 . LEU A 1  208  ? 90.888  55.510  -49.121 1.00 55.39  ? 208  LEU A CD2 1 
ATOM   1549  N  N   . ASN A 1  209  ? 89.051  58.599  -51.085 1.00 71.62  ? 209  ASN A N   1 
ATOM   1550  C  CA  . ASN A 1  209  ? 89.435  59.023  -52.424 1.00 76.61  ? 209  ASN A CA  1 
ATOM   1551  C  C   . ASN A 1  209  ? 90.457  60.143  -52.355 1.00 74.87  ? 209  ASN A C   1 
ATOM   1552  O  O   . ASN A 1  209  ? 91.607  59.983  -52.763 1.00 76.21  ? 209  ASN A O   1 
ATOM   1553  C  CB  . ASN A 1  209  ? 88.214  59.497  -53.213 1.00 82.78  ? 209  ASN A CB  1 
ATOM   1554  C  CG  . ASN A 1  209  ? 88.494  59.587  -54.703 1.00 87.88  ? 209  ASN A CG  1 
ATOM   1555  O  OD1 . ASN A 1  209  ? 89.259  60.444  -55.154 1.00 89.74  ? 209  ASN A OD1 1 
ATOM   1556  N  ND2 . ASN A 1  209  ? 87.889  58.684  -55.475 1.00 91.99  ? 209  ASN A ND2 1 
ATOM   1557  N  N   . ILE A 1  210  ? 90.029  61.282  -51.839 1.00 70.86  ? 210  ILE A N   1 
ATOM   1558  C  CA  . ILE A 1  210  ? 90.918  62.414  -51.697 1.00 69.08  ? 210  ILE A CA  1 
ATOM   1559  C  C   . ILE A 1  210  ? 92.300  61.947  -51.245 1.00 67.69  ? 210  ILE A C   1 
ATOM   1560  O  O   . ILE A 1  210  ? 93.277  62.099  -51.977 1.00 67.98  ? 210  ILE A O   1 
ATOM   1561  C  CB  . ILE A 1  210  ? 90.353  63.371  -50.676 1.00 69.70  ? 210  ILE A CB  1 
ATOM   1562  C  CG1 . ILE A 1  210  ? 88.920  63.708  -51.077 1.00 71.97  ? 210  ILE A CG1 1 
ATOM   1563  C  CG2 . ILE A 1  210  ? 91.231  64.604  -50.567 1.00 68.48  ? 210  ILE A CG2 1 
ATOM   1564  C  CD1 . ILE A 1  210  ? 88.159  64.453  -50.023 1.00 76.33  ? 210  ILE A CD1 1 
ATOM   1565  N  N   . PHE A 1  211  ? 92.373  61.373  -50.045 1.00 65.08  ? 211  PHE A N   1 
ATOM   1566  C  CA  . PHE A 1  211  ? 93.634  60.873  -49.501 1.00 61.52  ? 211  PHE A CA  1 
ATOM   1567  C  C   . PHE A 1  211  ? 94.404  60.096  -50.547 1.00 63.20  ? 211  PHE A C   1 
ATOM   1568  O  O   . PHE A 1  211  ? 95.585  60.357  -50.787 1.00 63.91  ? 211  PHE A O   1 
ATOM   1569  C  CB  . PHE A 1  211  ? 93.378  59.949  -48.328 1.00 56.94  ? 211  PHE A CB  1 
ATOM   1570  C  CG  . PHE A 1  211  ? 93.009  60.652  -47.079 1.00 52.76  ? 211  PHE A CG  1 
ATOM   1571  C  CD1 . PHE A 1  211  ? 91.978  61.566  -47.061 1.00 52.60  ? 211  PHE A CD1 1 
ATOM   1572  C  CD2 . PHE A 1  211  ? 93.679  60.376  -45.902 1.00 52.54  ? 211  PHE A CD2 1 
ATOM   1573  C  CE1 . PHE A 1  211  ? 91.613  62.192  -45.879 1.00 52.90  ? 211  PHE A CE1 1 
ATOM   1574  C  CE2 . PHE A 1  211  ? 93.321  60.995  -44.713 1.00 52.05  ? 211  PHE A CE2 1 
ATOM   1575  C  CZ  . PHE A 1  211  ? 92.288  61.907  -44.700 1.00 51.40  ? 211  PHE A CZ  1 
ATOM   1576  N  N   . LYS A 1  212  ? 93.732  59.120  -51.150 1.00 62.83  ? 212  LYS A N   1 
ATOM   1577  C  CA  . LYS A 1  212  ? 94.345  58.301  -52.183 1.00 64.14  ? 212  LYS A CA  1 
ATOM   1578  C  C   . LYS A 1  212  ? 95.048  59.191  -53.201 1.00 64.16  ? 212  LYS A C   1 
ATOM   1579  O  O   . LYS A 1  212  ? 96.118  58.857  -53.716 1.00 64.62  ? 212  LYS A O   1 
ATOM   1580  C  CB  . LYS A 1  212  ? 93.283  57.464  -52.893 1.00 66.27  ? 212  LYS A CB  1 
ATOM   1581  C  CG  . LYS A 1  212  ? 93.113  56.057  -52.352 1.00 71.94  ? 212  LYS A CG  1 
ATOM   1582  C  CD  . LYS A 1  212  ? 92.130  55.261  -53.214 1.00 77.70  ? 212  LYS A CD  1 
ATOM   1583  C  CE  . LYS A 1  212  ? 92.122  53.776  -52.853 1.00 80.17  ? 212  LYS A CE  1 
ATOM   1584  N  NZ  . LYS A 1  212  ? 91.191  53.003  -53.724 1.00 84.57  ? 212  LYS A NZ  1 
ATOM   1585  N  N   . HIS A 1  213  ? 94.436  60.335  -53.475 1.00 63.54  ? 213  HIS A N   1 
ATOM   1586  C  CA  . HIS A 1  213  ? 94.974  61.277  -54.432 1.00 63.43  ? 213  HIS A CA  1 
ATOM   1587  C  C   . HIS A 1  213  ? 96.052  62.212  -53.896 1.00 63.45  ? 213  HIS A C   1 
ATOM   1588  O  O   . HIS A 1  213  ? 96.639  62.973  -54.664 1.00 65.59  ? 213  HIS A O   1 
ATOM   1589  C  CB  . HIS A 1  213  ? 93.835  62.083  -55.036 1.00 64.98  ? 213  HIS A CB  1 
ATOM   1590  C  CG  . HIS A 1  213  ? 93.187  61.416  -56.205 1.00 68.67  ? 213  HIS A CG  1 
ATOM   1591  N  ND1 . HIS A 1  213  ? 93.863  61.159  -57.378 1.00 71.05  ? 213  HIS A ND1 1 
ATOM   1592  C  CD2 . HIS A 1  213  ? 91.926  60.964  -56.392 1.00 70.87  ? 213  HIS A CD2 1 
ATOM   1593  C  CE1 . HIS A 1  213  ? 93.046  60.580  -58.239 1.00 72.39  ? 213  HIS A CE1 1 
ATOM   1594  N  NE2 . HIS A 1  213  ? 91.864  60.449  -57.665 1.00 73.33  ? 213  HIS A NE2 1 
ATOM   1595  N  N   . ILE A 1  214  ? 96.323  62.165  -52.594 1.00 62.09  ? 214  ILE A N   1 
ATOM   1596  C  CA  . ILE A 1  214  ? 97.361  63.025  -52.031 1.00 59.86  ? 214  ILE A CA  1 
ATOM   1597  C  C   . ILE A 1  214  ? 98.714  62.593  -52.561 1.00 61.51  ? 214  ILE A C   1 
ATOM   1598  O  O   . ILE A 1  214  ? 98.987  61.400  -52.689 1.00 60.01  ? 214  ILE A O   1 
ATOM   1599  C  CB  . ILE A 1  214  ? 97.395  62.965  -50.507 1.00 57.85  ? 214  ILE A CB  1 
ATOM   1600  C  CG1 . ILE A 1  214  ? 96.163  63.670  -49.944 1.00 58.60  ? 214  ILE A CG1 1 
ATOM   1601  C  CG2 . ILE A 1  214  ? 98.664  63.618  -49.996 1.00 55.02  ? 214  ILE A CG2 1 
ATOM   1602  C  CD1 . ILE A 1  214  ? 96.101  63.705  -48.435 1.00 59.09  ? 214  ILE A CD1 1 
ATOM   1603  N  N   . SER A 1  215  ? 99.559  63.574  -52.859 1.00 64.00  ? 215  SER A N   1 
ATOM   1604  C  CA  . SER A 1  215  ? 100.884 63.319  -53.414 1.00 67.46  ? 215  SER A CA  1 
ATOM   1605  C  C   . SER A 1  215  ? 101.886 62.683  -52.481 1.00 67.33  ? 215  SER A C   1 
ATOM   1606  O  O   . SER A 1  215  ? 101.744 62.723  -51.262 1.00 67.41  ? 215  SER A O   1 
ATOM   1607  C  CB  . SER A 1  215  ? 101.499 64.611  -53.942 1.00 70.81  ? 215  SER A CB  1 
ATOM   1608  O  OG  . SER A 1  215  ? 102.784 64.811  -53.370 1.00 72.82  ? 215  SER A OG  1 
ATOM   1609  N  N   . VAL A 1  216  ? 102.925 62.124  -53.088 1.00 69.03  ? 216  VAL A N   1 
ATOM   1610  C  CA  . VAL A 1  216  ? 103.998 61.466  -52.362 1.00 71.52  ? 216  VAL A CA  1 
ATOM   1611  C  C   . VAL A 1  216  ? 104.684 62.477  -51.440 1.00 71.09  ? 216  VAL A C   1 
ATOM   1612  O  O   . VAL A 1  216  ? 104.769 62.278  -50.226 1.00 70.18  ? 216  VAL A O   1 
ATOM   1613  C  CB  . VAL A 1  216  ? 105.044 60.889  -53.351 1.00 73.67  ? 216  VAL A CB  1 
ATOM   1614  C  CG1 . VAL A 1  216  ? 105.873 59.810  -52.666 1.00 74.03  ? 216  VAL A CG1 1 
ATOM   1615  C  CG2 . VAL A 1  216  ? 104.345 60.349  -54.603 1.00 74.84  ? 216  VAL A CG2 1 
ATOM   1616  N  N   . LYS A 1  217  ? 105.171 63.566  -52.030 1.00 71.38  ? 217  LYS A N   1 
ATOM   1617  C  CA  . LYS A 1  217  ? 105.847 64.604  -51.265 1.00 71.40  ? 217  LYS A CA  1 
ATOM   1618  C  C   . LYS A 1  217  ? 104.890 65.241  -50.284 1.00 69.52  ? 217  LYS A C   1 
ATOM   1619  O  O   . LYS A 1  217  ? 105.316 65.829  -49.296 1.00 68.30  ? 217  LYS A O   1 
ATOM   1620  C  CB  . LYS A 1  217  ? 106.423 65.677  -52.195 1.00 74.20  ? 217  LYS A CB  1 
ATOM   1621  C  CG  . LYS A 1  217  ? 107.669 65.229  -52.942 1.00 78.92  ? 217  LYS A CG  1 
ATOM   1622  C  CD  . LYS A 1  217  ? 108.364 66.379  -53.668 1.00 80.21  ? 217  LYS A CD  1 
ATOM   1623  C  CE  . LYS A 1  217  ? 109.703 65.925  -54.259 1.00 80.04  ? 217  LYS A CE  1 
ATOM   1624  N  NZ  . LYS A 1  217  ? 110.422 67.014  -54.979 1.00 79.29  ? 217  LYS A NZ  1 
ATOM   1625  N  N   . ASP A 1  218  ? 103.596 65.125  -50.565 1.00 68.88  ? 218  ASP A N   1 
ATOM   1626  C  CA  . ASP A 1  218  ? 102.573 65.689  -49.696 1.00 67.64  ? 218  ASP A CA  1 
ATOM   1627  C  C   . ASP A 1  218  ? 102.371 64.782  -48.481 1.00 66.22  ? 218  ASP A C   1 
ATOM   1628  O  O   . ASP A 1  218  ? 102.083 65.256  -47.377 1.00 62.69  ? 218  ASP A O   1 
ATOM   1629  C  CB  . ASP A 1  218  ? 101.260 65.878  -50.469 1.00 70.33  ? 218  ASP A CB  1 
ATOM   1630  C  CG  . ASP A 1  218  ? 101.341 67.006  -51.504 1.00 71.79  ? 218  ASP A CG  1 
ATOM   1631  O  OD1 . ASP A 1  218  ? 101.965 68.046  -51.212 1.00 73.35  ? 218  ASP A OD1 1 
ATOM   1632  O  OD2 . ASP A 1  218  ? 100.765 66.869  -52.604 1.00 71.22  ? 218  ASP A OD2 1 
ATOM   1633  N  N   . PHE A 1  219  ? 102.512 63.475  -48.693 1.00 66.16  ? 219  PHE A N   1 
ATOM   1634  C  CA  . PHE A 1  219  ? 102.406 62.508  -47.602 1.00 65.25  ? 219  PHE A CA  1 
ATOM   1635  C  C   . PHE A 1  219  ? 103.434 63.037  -46.629 1.00 64.50  ? 219  PHE A C   1 
ATOM   1636  O  O   . PHE A 1  219  ? 103.139 63.742  -45.665 1.00 63.72  ? 219  PHE A O   1 
ATOM   1637  C  CB  . PHE A 1  219  ? 102.936 61.134  -48.019 1.00 67.41  ? 219  PHE A CB  1 
ATOM   1638  C  CG  . PHE A 1  219  ? 101.965 60.270  -48.737 1.00 69.03  ? 219  PHE A CG  1 
ATOM   1639  C  CD1 . PHE A 1  219  ? 102.420 59.116  -49.369 1.00 69.60  ? 219  PHE A CD1 1 
ATOM   1640  C  CD2 . PHE A 1  219  ? 100.609 60.564  -48.755 1.00 73.39  ? 219  PHE A CD2 1 
ATOM   1641  C  CE1 . PHE A 1  219  ? 101.544 58.259  -50.013 1.00 74.57  ? 219  PHE A CE1 1 
ATOM   1642  C  CE2 . PHE A 1  219  ? 99.707  59.711  -49.401 1.00 78.48  ? 219  PHE A CE2 1 
ATOM   1643  C  CZ  . PHE A 1  219  ? 100.178 58.553  -50.031 1.00 78.36  ? 219  PHE A CZ  1 
ATOM   1644  N  N   . THR A 1  220  ? 104.660 62.652  -46.969 1.00 62.29  ? 220  THR A N   1 
ATOM   1645  C  CA  . THR A 1  220  ? 105.899 62.952  -46.289 1.00 61.18  ? 220  THR A CA  1 
ATOM   1646  C  C   . THR A 1  220  ? 105.924 64.283  -45.571 1.00 63.13  ? 220  THR A C   1 
ATOM   1647  O  O   . THR A 1  220  ? 106.244 64.351  -44.387 1.00 64.32  ? 220  THR A O   1 
ATOM   1648  C  CB  . THR A 1  220  ? 107.023 62.951  -47.297 1.00 60.45  ? 220  THR A CB  1 
ATOM   1649  O  OG1 . THR A 1  220  ? 106.711 62.024  -48.344 1.00 59.25  ? 220  THR A OG1 1 
ATOM   1650  C  CG2 . THR A 1  220  ? 108.325 62.562  -46.625 1.00 63.69  ? 220  THR A CG2 1 
ATOM   1651  N  N   . SER A 1  221  ? 105.629 65.346  -46.310 1.00 65.64  ? 221  SER A N   1 
ATOM   1652  C  CA  . SER A 1  221  ? 105.605 66.689  -45.743 1.00 65.39  ? 221  SER A CA  1 
ATOM   1653  C  C   . SER A 1  221  ? 104.765 66.648  -44.462 1.00 63.28  ? 221  SER A C   1 
ATOM   1654  O  O   . SER A 1  221  ? 105.153 67.208  -43.433 1.00 59.78  ? 221  SER A O   1 
ATOM   1655  C  CB  . SER A 1  221  ? 105.025 67.664  -46.775 1.00 68.64  ? 221  SER A CB  1 
ATOM   1656  O  OG  . SER A 1  221  ? 104.021 67.036  -47.563 1.00 72.30  ? 221  SER A OG  1 
ATOM   1657  N  N   . LEU A 1  222  ? 103.614 65.979  -44.542 1.00 60.76  ? 222  LEU A N   1 
ATOM   1658  C  CA  . LEU A 1  222  ? 102.736 65.799  -43.394 1.00 57.99  ? 222  LEU A CA  1 
ATOM   1659  C  C   . LEU A 1  222  ? 103.355 64.615  -42.699 1.00 59.53  ? 222  LEU A C   1 
ATOM   1660  O  O   . LEU A 1  222  ? 104.035 63.825  -43.349 1.00 63.19  ? 222  LEU A O   1 
ATOM   1661  C  CB  . LEU A 1  222  ? 101.343 65.425  -43.851 1.00 54.15  ? 222  LEU A CB  1 
ATOM   1662  C  CG  . LEU A 1  222  ? 100.601 66.555  -44.534 1.00 53.49  ? 222  LEU A CG  1 
ATOM   1663  C  CD1 . LEU A 1  222  ? 99.344  66.027  -45.161 1.00 55.92  ? 222  LEU A CD1 1 
ATOM   1664  C  CD2 . LEU A 1  222  ? 100.277 67.624  -43.513 1.00 53.70  ? 222  LEU A CD2 1 
ATOM   1665  N  N   . GLY A 1  223  ? 103.127 64.461  -41.400 1.00 58.70  ? 223  GLY A N   1 
ATOM   1666  C  CA  . GLY A 1  223  ? 103.732 63.333  -40.701 1.00 59.55  ? 223  GLY A CA  1 
ATOM   1667  C  C   . GLY A 1  223  ? 103.384 61.939  -41.220 1.00 58.26  ? 223  GLY A C   1 
ATOM   1668  O  O   . GLY A 1  223  ? 102.634 61.228  -40.546 1.00 63.00  ? 223  GLY A O   1 
ATOM   1669  N  N   . PHE A 1  224  ? 103.921 61.539  -42.383 1.00 52.51  ? 224  PHE A N   1 
ATOM   1670  C  CA  . PHE A 1  224  ? 103.630 60.220  -42.963 1.00 49.18  ? 224  PHE A CA  1 
ATOM   1671  C  C   . PHE A 1  224  ? 104.805 59.484  -43.581 1.00 50.33  ? 224  PHE A C   1 
ATOM   1672  O  O   . PHE A 1  224  ? 105.939 59.954  -43.516 1.00 53.72  ? 224  PHE A O   1 
ATOM   1673  C  CB  . PHE A 1  224  ? 102.508 60.311  -44.003 1.00 45.02  ? 224  PHE A CB  1 
ATOM   1674  C  CG  . PHE A 1  224  ? 101.143 60.353  -43.396 1.00 42.47  ? 224  PHE A CG  1 
ATOM   1675  C  CD1 . PHE A 1  224  ? 100.572 61.557  -43.022 1.00 41.50  ? 224  PHE A CD1 1 
ATOM   1676  C  CD2 . PHE A 1  224  ? 100.472 59.179  -43.094 1.00 40.67  ? 224  PHE A CD2 1 
ATOM   1677  C  CE1 . PHE A 1  224  ? 99.355  61.592  -42.349 1.00 38.86  ? 224  PHE A CE1 1 
ATOM   1678  C  CE2 . PHE A 1  224  ? 99.255  59.211  -42.421 1.00 40.99  ? 224  PHE A CE2 1 
ATOM   1679  C  CZ  . PHE A 1  224  ? 98.700  60.421  -42.046 1.00 38.79  ? 224  PHE A CZ  1 
ATOM   1680  N  N   . ASN A 1  225  ? 104.513 58.321  -44.174 1.00 49.94  ? 225  ASN A N   1 
ATOM   1681  C  CA  . ASN A 1  225  ? 105.525 57.471  -44.810 1.00 48.52  ? 225  ASN A CA  1 
ATOM   1682  C  C   . ASN A 1  225  ? 105.046 56.731  -46.060 1.00 47.92  ? 225  ASN A C   1 
ATOM   1683  O  O   . ASN A 1  225  ? 104.103 55.942  -46.010 1.00 47.52  ? 225  ASN A O   1 
ATOM   1684  C  CB  . ASN A 1  225  ? 106.044 56.430  -43.831 1.00 47.82  ? 225  ASN A CB  1 
ATOM   1685  C  CG  . ASN A 1  225  ? 107.048 55.515  -44.470 1.00 48.57  ? 225  ASN A CG  1 
ATOM   1686  O  OD1 . ASN A 1  225  ? 108.218 55.868  -44.604 1.00 51.90  ? 225  ASN A OD1 1 
ATOM   1687  N  ND2 . ASN A 1  225  ? 106.597 54.344  -44.904 1.00 44.86  ? 225  ASN A ND2 1 
ATOM   1688  N  N   . GLU A 1  226  ? 105.745 56.957  -47.166 1.00 47.11  ? 226  GLU A N   1 
ATOM   1689  C  CA  . GLU A 1  226  ? 105.401 56.354  -48.446 1.00 46.27  ? 226  GLU A CA  1 
ATOM   1690  C  C   . GLU A 1  226  ? 105.266 54.839  -48.454 1.00 42.23  ? 226  GLU A C   1 
ATOM   1691  O  O   . GLU A 1  226  ? 104.574 54.286  -49.312 1.00 39.32  ? 226  GLU A O   1 
ATOM   1692  C  CB  . GLU A 1  226  ? 106.440 56.739  -49.500 1.00 51.11  ? 226  GLU A CB  1 
ATOM   1693  C  CG  . GLU A 1  226  ? 105.998 56.411  -50.918 1.00 62.61  ? 226  GLU A CG  1 
ATOM   1694  C  CD  . GLU A 1  226  ? 107.157 56.116  -51.860 1.00 67.91  ? 226  GLU A CD  1 
ATOM   1695  O  OE1 . GLU A 1  226  ? 108.242 56.724  -51.691 1.00 70.92  ? 226  GLU A OE1 1 
ATOM   1696  O  OE2 . GLU A 1  226  ? 106.969 55.281  -52.780 1.00 69.91  ? 226  GLU A OE2 1 
ATOM   1697  N  N   . VAL A 1  227  ? 105.907 54.165  -47.503 1.00 39.23  ? 227  VAL A N   1 
ATOM   1698  C  CA  . VAL A 1  227  ? 105.879 52.706  -47.498 1.00 38.58  ? 227  VAL A CA  1 
ATOM   1699  C  C   . VAL A 1  227  ? 105.132 51.987  -46.404 1.00 38.46  ? 227  VAL A C   1 
ATOM   1700  O  O   . VAL A 1  227  ? 104.418 51.028  -46.665 1.00 37.27  ? 227  VAL A O   1 
ATOM   1701  C  CB  . VAL A 1  227  ? 107.294 52.107  -47.457 1.00 38.92  ? 227  VAL A CB  1 
ATOM   1702  C  CG1 . VAL A 1  227  ? 107.261 50.715  -48.056 1.00 37.38  ? 227  VAL A CG1 1 
ATOM   1703  C  CG2 . VAL A 1  227  ? 108.283 52.999  -48.180 1.00 41.23  ? 227  VAL A CG2 1 
ATOM   1704  N  N   . PHE A 1  228  ? 105.316 52.429  -45.174 1.00 39.10  ? 228  PHE A N   1 
ATOM   1705  C  CA  . PHE A 1  228  ? 104.698 51.754  -44.049 1.00 40.70  ? 228  PHE A CA  1 
ATOM   1706  C  C   . PHE A 1  228  ? 103.373 52.307  -43.588 1.00 40.33  ? 228  PHE A C   1 
ATOM   1707  O  O   . PHE A 1  228  ? 102.565 51.561  -43.025 1.00 41.13  ? 228  PHE A O   1 
ATOM   1708  C  CB  . PHE A 1  228  ? 105.680 51.737  -42.877 1.00 42.77  ? 228  PHE A CB  1 
ATOM   1709  C  CG  . PHE A 1  228  ? 107.000 51.094  -43.208 1.00 43.71  ? 228  PHE A CG  1 
ATOM   1710  C  CD1 . PHE A 1  228  ? 108.045 51.095  -42.290 1.00 42.85  ? 228  PHE A CD1 1 
ATOM   1711  C  CD2 . PHE A 1  228  ? 107.194 50.474  -44.441 1.00 43.23  ? 228  PHE A CD2 1 
ATOM   1712  C  CE1 . PHE A 1  228  ? 109.256 50.488  -42.599 1.00 40.78  ? 228  PHE A CE1 1 
ATOM   1713  C  CE2 . PHE A 1  228  ? 108.394 49.870  -44.752 1.00 39.99  ? 228  PHE A CE2 1 
ATOM   1714  C  CZ  . PHE A 1  228  ? 109.428 49.877  -43.830 1.00 39.94  ? 228  PHE A CZ  1 
ATOM   1715  N  N   . SER A 1  229  ? 103.154 53.605  -43.822 1.00 39.64  ? 229  SER A N   1 
ATOM   1716  C  CA  . SER A 1  229  ? 101.917 54.264  -43.403 1.00 39.01  ? 229  SER A CA  1 
ATOM   1717  C  C   . SER A 1  229  ? 101.443 55.455  -44.236 1.00 38.65  ? 229  SER A C   1 
ATOM   1718  O  O   . SER A 1  229  ? 101.800 56.600  -43.962 1.00 35.49  ? 229  SER A O   1 
ATOM   1719  C  CB  . SER A 1  229  ? 102.024 54.710  -41.933 1.00 40.57  ? 229  SER A CB  1 
ATOM   1720  O  OG  . SER A 1  229  ? 103.010 55.716  -41.755 1.00 44.06  ? 229  SER A OG  1 
ATOM   1721  N  N   . ARG A 1  230  ? 100.636 55.178  -45.255 1.00 40.29  ? 230  ARG A N   1 
ATOM   1722  C  CA  . ARG A 1  230  ? 100.065 56.236  -46.077 1.00 42.66  ? 230  ARG A CA  1 
ATOM   1723  C  C   . ARG A 1  230  ? 98.812  56.641  -45.311 1.00 42.97  ? 230  ARG A C   1 
ATOM   1724  O  O   . ARG A 1  230  ? 98.280  55.852  -44.533 1.00 43.00  ? 230  ARG A O   1 
ATOM   1725  C  CB  . ARG A 1  230  ? 99.701  55.710  -47.458 1.00 42.91  ? 230  ARG A CB  1 
ATOM   1726  C  CG  . ARG A 1  230  ? 100.904 55.296  -48.272 1.00 44.89  ? 230  ARG A CG  1 
ATOM   1727  C  CD  . ARG A 1  230  ? 100.460 54.886  -49.638 1.00 48.99  ? 230  ARG A CD  1 
ATOM   1728  N  NE  . ARG A 1  230  ? 101.506 55.047  -50.633 1.00 55.30  ? 230  ARG A NE  1 
ATOM   1729  C  CZ  . ARG A 1  230  ? 101.265 55.123  -51.937 1.00 60.73  ? 230  ARG A CZ  1 
ATOM   1730  N  NH1 . ARG A 1  230  ? 100.014 55.052  -52.385 1.00 62.25  ? 230  ARG A NH1 1 
ATOM   1731  N  NH2 . ARG A 1  230  ? 102.267 55.278  -52.795 1.00 64.63  ? 230  ARG A NH2 1 
ATOM   1732  N  N   . PRO A 1  231  ? 98.319  57.869  -45.508 1.00 43.88  ? 231  PRO A N   1 
ATOM   1733  C  CA  . PRO A 1  231  ? 97.121  58.233  -44.749 1.00 45.39  ? 231  PRO A CA  1 
ATOM   1734  C  C   . PRO A 1  231  ? 95.945  57.416  -45.223 1.00 46.72  ? 231  PRO A C   1 
ATOM   1735  O  O   . PRO A 1  231  ? 95.081  57.023  -44.430 1.00 46.00  ? 231  PRO A O   1 
ATOM   1736  C  CB  . PRO A 1  231  ? 96.949  59.721  -45.056 1.00 44.91  ? 231  PRO A CB  1 
ATOM   1737  C  CG  . PRO A 1  231  ? 98.330  60.164  -45.506 1.00 46.04  ? 231  PRO A CG  1 
ATOM   1738  C  CD  . PRO A 1  231  ? 98.766  58.992  -46.341 1.00 46.02  ? 231  PRO A CD  1 
ATOM   1739  N  N   . GLU A 1  232  ? 95.935  57.146  -46.525 1.00 47.78  ? 232  GLU A N   1 
ATOM   1740  C  CA  . GLU A 1  232  ? 94.854  56.390  -47.115 1.00 50.07  ? 232  GLU A CA  1 
ATOM   1741  C  C   . GLU A 1  232  ? 94.582  55.095  -46.364 1.00 48.59  ? 232  GLU A C   1 
ATOM   1742  O  O   . GLU A 1  232  ? 93.575  54.433  -46.595 1.00 49.75  ? 232  GLU A O   1 
ATOM   1743  C  CB  . GLU A 1  232  ? 95.158  56.115  -48.584 1.00 53.50  ? 232  GLU A CB  1 
ATOM   1744  C  CG  . GLU A 1  232  ? 96.399  55.311  -48.845 1.00 60.34  ? 232  GLU A CG  1 
ATOM   1745  C  CD  . GLU A 1  232  ? 96.772  55.309  -50.323 1.00 65.62  ? 232  GLU A CD  1 
ATOM   1746  O  OE1 . GLU A 1  232  ? 97.410  56.292  -50.769 1.00 68.06  ? 232  GLU A OE1 1 
ATOM   1747  O  OE2 . GLU A 1  232  ? 96.417  54.338  -51.041 1.00 66.93  ? 232  GLU A OE2 1 
ATOM   1748  N  N   . TRP A 1  233  ? 95.462  54.747  -45.437 1.00 47.32  ? 233  TRP A N   1 
ATOM   1749  C  CA  . TRP A 1  233  ? 95.275  53.525  -44.682 1.00 48.20  ? 233  TRP A CA  1 
ATOM   1750  C  C   . TRP A 1  233  ? 94.716  53.725  -43.289 1.00 46.54  ? 233  TRP A C   1 
ATOM   1751  O  O   . TRP A 1  233  ? 94.758  52.806  -42.476 1.00 47.76  ? 233  TRP A O   1 
ATOM   1752  C  CB  . TRP A 1  233  ? 96.586  52.739  -44.598 1.00 52.67  ? 233  TRP A CB  1 
ATOM   1753  C  CG  . TRP A 1  233  ? 97.055  52.236  -45.924 1.00 54.71  ? 233  TRP A CG  1 
ATOM   1754  C  CD1 . TRP A 1  233  ? 96.276  51.772  -46.941 1.00 58.09  ? 233  TRP A CD1 1 
ATOM   1755  C  CD2 . TRP A 1  233  ? 98.407  52.150  -46.383 1.00 54.36  ? 233  TRP A CD2 1 
ATOM   1756  N  NE1 . TRP A 1  233  ? 97.058  51.400  -48.008 1.00 59.29  ? 233  TRP A NE1 1 
ATOM   1757  C  CE2 . TRP A 1  233  ? 98.368  51.614  -47.690 1.00 56.06  ? 233  TRP A CE2 1 
ATOM   1758  C  CE3 . TRP A 1  233  ? 99.642  52.458  -45.810 1.00 54.45  ? 233  TRP A CE3 1 
ATOM   1759  C  CZ2 . TRP A 1  233  ? 99.519  51.405  -48.444 1.00 56.49  ? 233  TRP A CZ2 1 
ATOM   1760  C  CZ3 . TRP A 1  233  ? 100.782 52.249  -46.557 1.00 58.47  ? 233  TRP A CZ3 1 
ATOM   1761  C  CH2 . TRP A 1  233  ? 100.714 51.717  -47.861 1.00 59.69  ? 233  TRP A CH2 1 
ATOM   1762  N  N   . MET A 1  234  ? 94.210  54.915  -42.988 1.00 43.90  ? 234  MET A N   1 
ATOM   1763  C  CA  . MET A 1  234  ? 93.625  55.134  -41.663 1.00 42.05  ? 234  MET A CA  1 
ATOM   1764  C  C   . MET A 1  234  ? 92.162  54.797  -41.812 1.00 42.15  ? 234  MET A C   1 
ATOM   1765  O  O   . MET A 1  234  ? 91.404  54.679  -40.844 1.00 43.65  ? 234  MET A O   1 
ATOM   1766  C  CB  . MET A 1  234  ? 93.789  56.580  -41.215 1.00 37.11  ? 234  MET A CB  1 
ATOM   1767  C  CG  . MET A 1  234  ? 95.216  56.924  -40.954 1.00 33.21  ? 234  MET A CG  1 
ATOM   1768  S  SD  . MET A 1  234  ? 95.376  58.550  -40.332 1.00 28.23  ? 234  MET A SD  1 
ATOM   1769  C  CE  . MET A 1  234  ? 95.549  59.412  -41.918 1.00 30.12  ? 234  MET A CE  1 
ATOM   1770  N  N   . ILE A 1  235  ? 91.784  54.641  -43.067 1.00 38.77  ? 235  ILE A N   1 
ATOM   1771  C  CA  . ILE A 1  235  ? 90.441  54.291  -43.406 1.00 36.39  ? 235  ILE A CA  1 
ATOM   1772  C  C   . ILE A 1  235  ? 90.504  52.809  -43.714 1.00 38.14  ? 235  ILE A C   1 
ATOM   1773  O  O   . ILE A 1  235  ? 91.216  52.390  -44.632 1.00 40.33  ? 235  ILE A O   1 
ATOM   1774  C  CB  . ILE A 1  235  ? 90.014  55.083  -44.609 1.00 35.73  ? 235  ILE A CB  1 
ATOM   1775  C  CG1 . ILE A 1  235  ? 89.784  56.526  -44.180 1.00 35.14  ? 235  ILE A CG1 1 
ATOM   1776  C  CG2 . ILE A 1  235  ? 88.780  54.487  -45.219 1.00 38.96  ? 235  ILE A CG2 1 
ATOM   1777  C  CD1 . ILE A 1  235  ? 89.484  57.449  -45.335 1.00 40.39  ? 235  ILE A CD1 1 
ATOM   1778  N  N   . LEU A 1  236  ? 89.776  52.026  -42.917 1.00 38.32  ? 236  LEU A N   1 
ATOM   1779  C  CA  . LEU A 1  236  ? 89.728  50.570  -43.042 1.00 38.86  ? 236  LEU A CA  1 
ATOM   1780  C  C   . LEU A 1  236  ? 88.931  50.107  -44.245 1.00 38.75  ? 236  LEU A C   1 
ATOM   1781  O  O   . LEU A 1  236  ? 87.817  50.568  -44.476 1.00 38.84  ? 236  LEU A O   1 
ATOM   1782  C  CB  . LEU A 1  236  ? 89.111  49.982  -41.786 1.00 38.85  ? 236  LEU A CB  1 
ATOM   1783  C  CG  . LEU A 1  236  ? 89.588  50.746  -40.560 1.00 37.55  ? 236  LEU A CG  1 
ATOM   1784  C  CD1 . LEU A 1  236  ? 88.902  50.229  -39.319 1.00 39.89  ? 236  LEU A CD1 1 
ATOM   1785  C  CD2 . LEU A 1  236  ? 91.089  50.606  -40.450 1.00 36.94  ? 236  LEU A CD2 1 
ATOM   1786  N  N   . THR A 1  237  ? 89.505  49.184  -45.004 1.00 38.73  ? 237  THR A N   1 
ATOM   1787  C  CA  . THR A 1  237  ? 88.844  48.655  -46.184 1.00 40.76  ? 237  THR A CA  1 
ATOM   1788  C  C   . THR A 1  237  ? 88.743  47.149  -46.065 1.00 41.52  ? 237  THR A C   1 
ATOM   1789  O  O   . THR A 1  237  ? 87.784  46.530  -46.541 1.00 42.94  ? 237  THR A O   1 
ATOM   1790  C  CB  . THR A 1  237  ? 89.632  48.990  -47.442 1.00 42.45  ? 237  THR A CB  1 
ATOM   1791  O  OG1 . THR A 1  237  ? 89.622  50.408  -47.631 1.00 43.77  ? 237  THR A OG1 1 
ATOM   1792  C  CG2 . THR A 1  237  ? 89.027  48.290  -48.665 1.00 45.06  ? 237  THR A CG2 1 
ATOM   1793  N  N   . CYS A 1  238  ? 89.754  46.565  -45.433 1.00 40.63  ? 238  CYS A N   1 
ATOM   1794  C  CA  . CYS A 1  238  ? 89.802  45.126  -45.226 1.00 38.47  ? 238  CYS A CA  1 
ATOM   1795  C  C   . CYS A 1  238  ? 90.166  44.883  -43.777 1.00 34.72  ? 238  CYS A C   1 
ATOM   1796  O  O   . CYS A 1  238  ? 91.257  45.233  -43.334 1.00 34.79  ? 238  CYS A O   1 
ATOM   1797  C  CB  . CYS A 1  238  ? 90.846  44.495  -46.127 1.00 40.20  ? 238  CYS A CB  1 
ATOM   1798  S  SG  . CYS A 1  238  ? 90.764  42.733  -46.029 1.00 46.19  ? 238  CYS A SG  1 
ATOM   1799  N  N   . LEU A 1  239  ? 89.262  44.266  -43.036 1.00 30.12  ? 239  LEU A N   1 
ATOM   1800  C  CA  . LEU A 1  239  ? 89.526  44.066  -41.631 1.00 25.37  ? 239  LEU A CA  1 
ATOM   1801  C  C   . LEU A 1  239  ? 90.239  42.797  -41.197 1.00 22.43  ? 239  LEU A C   1 
ATOM   1802  O  O   . LEU A 1  239  ? 89.718  41.686  -41.319 1.00 19.65  ? 239  LEU A O   1 
ATOM   1803  C  CB  . LEU A 1  239  ? 88.230  44.214  -40.840 1.00 25.44  ? 239  LEU A CB  1 
ATOM   1804  C  CG  . LEU A 1  239  ? 88.457  44.307  -39.334 1.00 24.54  ? 239  LEU A CG  1 
ATOM   1805  C  CD1 . LEU A 1  239  ? 89.397  45.455  -39.037 1.00 25.71  ? 239  LEU A CD1 1 
ATOM   1806  C  CD2 . LEU A 1  239  ? 87.136  44.512  -38.634 1.00 25.76  ? 239  LEU A CD2 1 
ATOM   1807  N  N   . PRO A 1  240  ? 91.463  42.952  -40.680 1.00 20.99  ? 240  PRO A N   1 
ATOM   1808  C  CA  . PRO A 1  240  ? 92.234  41.800  -40.214 1.00 20.65  ? 240  PRO A CA  1 
ATOM   1809  C  C   . PRO A 1  240  ? 91.512  41.135  -39.029 1.00 19.16  ? 240  PRO A C   1 
ATOM   1810  O  O   . PRO A 1  240  ? 91.202  41.803  -38.016 1.00 20.57  ? 240  PRO A O   1 
ATOM   1811  C  CB  . PRO A 1  240  ? 93.570  42.429  -39.804 1.00 21.53  ? 240  PRO A CB  1 
ATOM   1812  C  CG  . PRO A 1  240  ? 93.196  43.847  -39.435 1.00 18.63  ? 240  PRO A CG  1 
ATOM   1813  C  CD  . PRO A 1  240  ? 92.260  44.188  -40.569 1.00 18.05  ? 240  PRO A CD  1 
ATOM   1814  N  N   . VAL A 1  241  ? 91.247  39.831  -39.160 1.00 13.22  ? 241  VAL A N   1 
ATOM   1815  C  CA  . VAL A 1  241  ? 90.569  39.069  -38.106 1.00 7.09   ? 241  VAL A CA  1 
ATOM   1816  C  C   . VAL A 1  241  ? 91.519  38.209  -37.276 1.00 5.29   ? 241  VAL A C   1 
ATOM   1817  O  O   . VAL A 1  241  ? 91.965  37.146  -37.705 1.00 1.11   ? 241  VAL A O   1 
ATOM   1818  C  CB  . VAL A 1  241  ? 89.489  38.150  -38.679 1.00 4.97   ? 241  VAL A CB  1 
ATOM   1819  C  CG1 . VAL A 1  241  ? 88.559  37.701  -37.555 1.00 1.00   ? 241  VAL A CG1 1 
ATOM   1820  C  CG2 . VAL A 1  241  ? 88.728  38.864  -39.792 1.00 6.04   ? 241  VAL A CG2 1 
ATOM   1821  N  N   . PRO A 1  242  ? 91.823  38.658  -36.059 1.00 4.91   ? 242  PRO A N   1 
ATOM   1822  C  CA  . PRO A 1  242  ? 92.724  37.944  -35.150 1.00 5.59   ? 242  PRO A CA  1 
ATOM   1823  C  C   . PRO A 1  242  ? 92.268  36.535  -34.815 1.00 4.87   ? 242  PRO A C   1 
ATOM   1824  O  O   . PRO A 1  242  ? 91.102  36.304  -34.499 1.00 4.23   ? 242  PRO A O   1 
ATOM   1825  C  CB  . PRO A 1  242  ? 92.772  38.849  -33.926 1.00 5.11   ? 242  PRO A CB  1 
ATOM   1826  C  CG  . PRO A 1  242  ? 91.425  39.482  -33.944 1.00 9.24   ? 242  PRO A CG  1 
ATOM   1827  C  CD  . PRO A 1  242  ? 91.231  39.829  -35.395 1.00 5.73   ? 242  PRO A CD  1 
ATOM   1828  N  N   . PRO A 1  243  ? 93.199  35.570  -34.879 1.00 6.71   ? 243  PRO A N   1 
ATOM   1829  C  CA  . PRO A 1  243  ? 92.953  34.152  -34.597 1.00 10.75  ? 243  PRO A CA  1 
ATOM   1830  C  C   . PRO A 1  243  ? 92.880  33.777  -33.126 1.00 11.60  ? 243  PRO A C   1 
ATOM   1831  O  O   . PRO A 1  243  ? 93.561  34.349  -32.274 1.00 14.28  ? 243  PRO A O   1 
ATOM   1832  C  CB  . PRO A 1  243  ? 94.110  33.457  -35.299 1.00 9.84   ? 243  PRO A CB  1 
ATOM   1833  C  CG  . PRO A 1  243  ? 95.212  34.423  -35.020 1.00 12.24  ? 243  PRO A CG  1 
ATOM   1834  C  CD  . PRO A 1  243  ? 94.576  35.760  -35.362 1.00 6.69   ? 243  PRO A CD  1 
ATOM   1835  N  N   . PRO A 1  244  ? 92.068  32.763  -32.835 1.00 12.25  ? 244  PRO A N   1 
ATOM   1836  C  CA  . PRO A 1  244  ? 91.747  32.139  -31.557 1.00 15.08  ? 244  PRO A CA  1 
ATOM   1837  C  C   . PRO A 1  244  ? 92.620  32.455  -30.339 1.00 19.49  ? 244  PRO A C   1 
ATOM   1838  O  O   . PRO A 1  244  ? 92.128  32.950  -29.325 1.00 19.78  ? 244  PRO A O   1 
ATOM   1839  C  CB  . PRO A 1  244  ? 91.732  30.649  -31.907 1.00 11.74  ? 244  PRO A CB  1 
ATOM   1840  C  CG  . PRO A 1  244  ? 92.217  30.599  -33.378 1.00 11.06  ? 244  PRO A CG  1 
ATOM   1841  C  CD  . PRO A 1  244  ? 91.709  31.852  -33.926 1.00 9.96   ? 244  PRO A CD  1 
ATOM   1842  N  N   . PRO A 1  245  ? 93.924  32.181  -30.416 1.00 23.22  ? 245  PRO A N   1 
ATOM   1843  C  CA  . PRO A 1  245  ? 94.781  32.464  -29.261 1.00 23.54  ? 245  PRO A CA  1 
ATOM   1844  C  C   . PRO A 1  245  ? 94.634  33.880  -28.734 1.00 20.22  ? 245  PRO A C   1 
ATOM   1845  O  O   . PRO A 1  245  ? 95.070  34.185  -27.629 1.00 19.60  ? 245  PRO A O   1 
ATOM   1846  C  CB  . PRO A 1  245  ? 96.181  32.193  -29.795 1.00 28.20  ? 245  PRO A CB  1 
ATOM   1847  C  CG  . PRO A 1  245  ? 95.938  31.150  -30.844 1.00 29.21  ? 245  PRO A CG  1 
ATOM   1848  C  CD  . PRO A 1  245  ? 94.723  31.694  -31.549 1.00 25.02  ? 245  PRO A CD  1 
ATOM   1849  N  N   . VAL A 1  246  ? 94.020  34.739  -29.537 1.00 19.67  ? 246  VAL A N   1 
ATOM   1850  C  CA  . VAL A 1  246  ? 93.808  36.132  -29.162 1.00 25.34  ? 246  VAL A CA  1 
ATOM   1851  C  C   . VAL A 1  246  ? 92.472  36.261  -28.441 1.00 27.77  ? 246  VAL A C   1 
ATOM   1852  O  O   . VAL A 1  246  ? 92.345  37.001  -27.465 1.00 27.91  ? 246  VAL A O   1 
ATOM   1853  C  CB  . VAL A 1  246  ? 93.765  37.049  -30.400 1.00 27.03  ? 246  VAL A CB  1 
ATOM   1854  C  CG1 . VAL A 1  246  ? 93.855  38.496  -29.955 1.00 24.06  ? 246  VAL A CG1 1 
ATOM   1855  C  CG2 . VAL A 1  246  ? 94.888  36.693  -31.374 1.00 26.83  ? 246  VAL A CG2 1 
ATOM   1856  N  N   . ARG A 1  247  ? 91.477  35.538  -28.950 1.00 30.37  ? 247  ARG A N   1 
ATOM   1857  C  CA  . ARG A 1  247  ? 90.128  35.517  -28.388 1.00 32.95  ? 247  ARG A CA  1 
ATOM   1858  C  C   . ARG A 1  247  ? 89.745  34.057  -28.100 1.00 34.47  ? 247  ARG A C   1 
ATOM   1859  O  O   . ARG A 1  247  ? 88.763  33.535  -28.632 1.00 33.76  ? 247  ARG A O   1 
ATOM   1860  C  CB  . ARG A 1  247  ? 89.151  36.127  -29.386 1.00 33.27  ? 247  ARG A CB  1 
ATOM   1861  C  CG  . ARG A 1  247  ? 89.309  35.567  -30.772 1.00 35.26  ? 247  ARG A CG  1 
ATOM   1862  C  CD  . ARG A 1  247  ? 88.514  36.348  -31.771 1.00 38.55  ? 247  ARG A CD  1 
ATOM   1863  N  NE  . ARG A 1  247  ? 88.822  35.865  -33.104 1.00 44.69  ? 247  ARG A NE  1 
ATOM   1864  C  CZ  . ARG A 1  247  ? 88.356  34.727  -33.605 1.00 49.46  ? 247  ARG A CZ  1 
ATOM   1865  N  NH1 . ARG A 1  247  ? 87.547  33.970  -32.877 1.00 52.23  ? 247  ARG A NH1 1 
ATOM   1866  N  NH2 . ARG A 1  247  ? 88.722  34.330  -34.821 1.00 51.92  ? 247  ARG A NH2 1 
ATOM   1867  N  N   . PRO A 1  248  ? 90.511  33.390  -27.227 1.00 35.05  ? 248  PRO A N   1 
ATOM   1868  C  CA  . PRO A 1  248  ? 90.296  32.001  -26.849 1.00 38.61  ? 248  PRO A CA  1 
ATOM   1869  C  C   . PRO A 1  248  ? 88.966  31.788  -26.178 1.00 46.81  ? 248  PRO A C   1 
ATOM   1870  O  O   . PRO A 1  248  ? 88.483  32.673  -25.472 1.00 47.82  ? 248  PRO A O   1 
ATOM   1871  C  CB  . PRO A 1  248  ? 91.417  31.761  -25.873 1.00 36.23  ? 248  PRO A CB  1 
ATOM   1872  C  CG  . PRO A 1  248  ? 91.418  33.048  -25.123 1.00 32.06  ? 248  PRO A CG  1 
ATOM   1873  C  CD  . PRO A 1  248  ? 91.425  34.028  -26.265 1.00 34.54  ? 248  PRO A CD  1 
ATOM   1874  N  N   . SER A 1  249  ? 88.399  30.599  -26.376 1.00 56.66  ? 249  SER A N   1 
ATOM   1875  C  CA  . SER A 1  249  ? 87.131  30.230  -25.755 1.00 66.33  ? 249  SER A CA  1 
ATOM   1876  C  C   . SER A 1  249  ? 87.421  29.647  -24.368 1.00 76.03  ? 249  SER A C   1 
ATOM   1877  O  O   . SER A 1  249  ? 88.471  29.897  -23.779 1.00 79.03  ? 249  SER A O   1 
ATOM   1878  C  CB  . SER A 1  249  ? 86.417  29.183  -26.605 1.00 59.55  ? 249  SER A CB  1 
ATOM   1879  O  OG  . SER A 1  249  ? 87.262  28.072  -26.810 1.00 52.70  ? 249  SER A OG  1 
ATOM   1880  N  N   . ILE A 1  250  ? 86.478  28.881  -23.846 1.00 86.89  ? 250  ILE A N   1 
ATOM   1881  C  CA  . ILE A 1  250  ? 86.636  28.233  -22.549 1.00 99.00  ? 250  ILE A CA  1 
ATOM   1882  C  C   . ILE A 1  250  ? 85.614  27.095  -22.541 1.00 106.63 ? 250  ILE A C   1 
ATOM   1883  O  O   . ILE A 1  250  ? 84.405  27.340  -22.503 1.00 110.79 ? 250  ILE A O   1 
ATOM   1884  C  CB  . ILE A 1  250  ? 86.364  29.213  -21.346 1.00 99.29  ? 250  ILE A CB  1 
ATOM   1885  C  CG1 . ILE A 1  250  ? 87.546  30.171  -21.144 1.00 99.23  ? 250  ILE A CG1 1 
ATOM   1886  C  CG2 . ILE A 1  250  ? 86.178  28.422  -20.052 1.00 100.15 ? 250  ILE A CG2 1 
ATOM   1887  C  CD1 . ILE A 1  250  ? 87.487  30.967  -19.835 1.00 98.36  ? 250  ILE A CD1 1 
ATOM   1888  N  N   . SER A 1  251  ? 86.086  25.852  -22.591 1.00 113.62 ? 251  SER A N   1 
ATOM   1889  C  CA  . SER A 1  251  ? 85.164  24.719  -22.614 1.00 120.24 ? 251  SER A CA  1 
ATOM   1890  C  C   . SER A 1  251  ? 84.883  24.019  -21.279 1.00 124.68 ? 251  SER A C   1 
ATOM   1891  O  O   . SER A 1  251  ? 85.794  23.741  -20.485 1.00 126.71 ? 251  SER A O   1 
ATOM   1892  C  CB  . SER A 1  251  ? 85.630  23.683  -23.651 1.00 120.21 ? 251  SER A CB  1 
ATOM   1893  O  OG  . SER A 1  251  ? 86.959  23.246  -23.415 1.00 122.32 ? 251  SER A OG  1 
ATOM   1894  N  N   . PHE A 1  252  ? 83.602  23.754  -21.035 1.00 128.26 ? 252  PHE A N   1 
ATOM   1895  C  CA  . PHE A 1  252  ? 83.192  23.055  -19.828 1.00 131.81 ? 252  PHE A CA  1 
ATOM   1896  C  C   . PHE A 1  252  ? 82.939  21.625  -20.291 1.00 134.33 ? 252  PHE A C   1 
ATOM   1897  O  O   . PHE A 1  252  ? 81.799  21.155  -20.352 1.00 132.32 ? 252  PHE A O   1 
ATOM   1898  C  CB  . PHE A 1  252  ? 81.923  23.672  -19.235 1.00 132.10 ? 252  PHE A CB  1 
ATOM   1899  C  CG  . PHE A 1  252  ? 81.989  25.172  -19.074 1.00 132.58 ? 252  PHE A CG  1 
ATOM   1900  C  CD1 . PHE A 1  252  ? 81.389  26.010  -20.014 1.00 131.98 ? 252  PHE A CD1 1 
ATOM   1901  C  CD2 . PHE A 1  252  ? 82.639  25.748  -17.983 1.00 132.94 ? 252  PHE A CD2 1 
ATOM   1902  C  CE1 . PHE A 1  252  ? 81.432  27.398  -19.872 1.00 131.73 ? 252  PHE A CE1 1 
ATOM   1903  C  CE2 . PHE A 1  252  ? 82.689  27.138  -17.831 1.00 133.17 ? 252  PHE A CE2 1 
ATOM   1904  C  CZ  . PHE A 1  252  ? 82.081  27.963  -18.779 1.00 132.53 ? 252  PHE A CZ  1 
ATOM   1905  N  N   . ASN A 1  253  ? 84.042  20.965  -20.637 1.00 139.14 ? 253  ASN A N   1 
ATOM   1906  C  CA  . ASN A 1  253  ? 84.066  19.592  -21.130 1.00 143.70 ? 253  ASN A CA  1 
ATOM   1907  C  C   . ASN A 1  253  ? 83.542  19.527  -22.568 1.00 145.05 ? 253  ASN A C   1 
ATOM   1908  O  O   . ASN A 1  253  ? 84.213  19.972  -23.502 1.00 144.75 ? 253  ASN A O   1 
ATOM   1909  C  CB  . ASN A 1  253  ? 83.250  18.656  -20.217 1.00 146.30 ? 253  ASN A CB  1 
ATOM   1910  C  CG  . ASN A 1  253  ? 83.729  18.670  -18.761 1.00 147.41 ? 253  ASN A CG  1 
ATOM   1911  O  OD1 . ASN A 1  253  ? 84.927  18.772  -18.483 1.00 147.64 ? 253  ASN A OD1 1 
ATOM   1912  N  ND2 . ASN A 1  253  ? 82.785  18.547  -17.827 1.00 147.99 ? 253  ASN A ND2 1 
ATOM   1913  N  N   . GLU A 1  254  ? 82.346  18.979  -22.747 1.00 147.05 ? 254  GLU A N   1 
ATOM   1914  C  CA  . GLU A 1  254  ? 81.762  18.862  -24.076 1.00 148.50 ? 254  GLU A CA  1 
ATOM   1915  C  C   . GLU A 1  254  ? 80.350  19.444  -24.074 1.00 148.46 ? 254  GLU A C   1 
ATOM   1916  O  O   . GLU A 1  254  ? 79.720  19.545  -23.025 1.00 149.62 ? 254  GLU A O   1 
ATOM   1917  C  CB  . GLU A 1  254  ? 81.731  17.390  -24.498 1.00 150.66 ? 254  GLU A CB  1 
ATOM   1918  C  CG  . GLU A 1  254  ? 83.065  16.656  -24.316 1.00 155.20 ? 254  GLU A CG  1 
ATOM   1919  C  CD  . GLU A 1  254  ? 83.014  15.201  -24.774 1.00 157.81 ? 254  GLU A CD  1 
ATOM   1920  O  OE1 . GLU A 1  254  ? 82.105  14.469  -24.323 1.00 159.96 ? 254  GLU A OE1 1 
ATOM   1921  O  OE2 . GLU A 1  254  ? 83.884  14.787  -25.577 1.00 158.54 ? 254  GLU A OE2 1 
ATOM   1922  N  N   . SER A 1  255  ? 79.866  19.834  -25.250 1.00 147.32 ? 255  SER A N   1 
ATOM   1923  C  CA  . SER A 1  255  ? 78.531  20.416  -25.404 1.00 145.35 ? 255  SER A CA  1 
ATOM   1924  C  C   . SER A 1  255  ? 78.375  21.755  -24.666 1.00 143.40 ? 255  SER A C   1 
ATOM   1925  O  O   . SER A 1  255  ? 77.318  22.385  -24.725 1.00 142.58 ? 255  SER A O   1 
ATOM   1926  C  CB  . SER A 1  255  ? 77.448  19.423  -24.940 1.00 145.41 ? 255  SER A CB  1 
ATOM   1927  O  OG  . SER A 1  255  ? 77.341  19.357  -23.528 1.00 146.25 ? 255  SER A OG  1 
ATOM   1928  N  N   . GLN A 1  256  ? 79.431  22.185  -23.977 1.00 141.26 ? 256  GLN A N   1 
ATOM   1929  C  CA  . GLN A 1  256  ? 79.422  23.452  -23.244 1.00 138.78 ? 256  GLN A CA  1 
ATOM   1930  C  C   . GLN A 1  256  ? 80.597  24.345  -23.680 1.00 135.81 ? 256  GLN A C   1 
ATOM   1931  O  O   . GLN A 1  256  ? 81.742  24.132  -23.268 1.00 135.16 ? 256  GLN A O   1 
ATOM   1932  C  CB  . GLN A 1  256  ? 79.474  23.199  -21.722 1.00 140.36 ? 256  GLN A CB  1 
ATOM   1933  C  CG  . GLN A 1  256  ? 78.099  23.005  -21.056 1.00 140.33 ? 256  GLN A CG  1 
ATOM   1934  C  CD  . GLN A 1  256  ? 78.185  22.659  -19.569 1.00 141.55 ? 256  GLN A CD  1 
ATOM   1935  O  OE1 . GLN A 1  256  ? 78.852  23.344  -18.792 1.00 141.60 ? 256  GLN A OE1 1 
ATOM   1936  N  NE2 . GLN A 1  256  ? 77.494  21.596  -19.169 1.00 142.26 ? 256  GLN A NE2 1 
ATOM   1937  N  N   . ARG A 1  257  ? 80.298  25.337  -24.521 1.00 131.18 ? 257  ARG A N   1 
ATOM   1938  C  CA  . ARG A 1  257  ? 81.300  26.278  -25.032 1.00 125.59 ? 257  ARG A CA  1 
ATOM   1939  C  C   . ARG A 1  257  ? 81.020  27.717  -24.579 1.00 121.84 ? 257  ARG A C   1 
ATOM   1940  O  O   . ARG A 1  257  ? 79.876  28.178  -24.611 1.00 121.57 ? 257  ARG A O   1 
ATOM   1941  C  CB  . ARG A 1  257  ? 81.327  26.239  -26.563 1.00 125.44 ? 257  ARG A CB  1 
ATOM   1942  C  CG  . ARG A 1  257  ? 81.631  24.879  -27.160 1.00 127.52 ? 257  ARG A CG  1 
ATOM   1943  C  CD  . ARG A 1  257  ? 83.095  24.487  -26.993 1.00 130.28 ? 257  ARG A CD  1 
ATOM   1944  N  NE  . ARG A 1  257  ? 83.341  23.126  -27.474 1.00 133.22 ? 257  ARG A NE  1 
ATOM   1945  C  CZ  . ARG A 1  257  ? 84.529  22.522  -27.478 1.00 133.82 ? 257  ARG A CZ  1 
ATOM   1946  N  NH1 . ARG A 1  257  ? 85.607  23.152  -27.028 1.00 133.53 ? 257  ARG A NH1 1 
ATOM   1947  N  NH2 . ARG A 1  257  ? 84.638  21.276  -27.926 1.00 133.59 ? 257  ARG A NH2 1 
ATOM   1948  N  N   . GLY A 1  258  ? 82.076  28.417  -24.163 1.00 117.44 ? 258  GLY A N   1 
ATOM   1949  C  CA  . GLY A 1  258  ? 81.965  29.801  -23.713 1.00 110.45 ? 258  GLY A CA  1 
ATOM   1950  C  C   . GLY A 1  258  ? 83.006  30.666  -24.412 1.00 105.91 ? 258  GLY A C   1 
ATOM   1951  O  O   . GLY A 1  258  ? 84.165  30.732  -23.989 1.00 105.73 ? 258  GLY A O   1 
ATOM   1952  N  N   . GLU A 1  259  ? 82.579  31.343  -25.476 1.00 100.09 ? 259  GLU A N   1 
ATOM   1953  C  CA  . GLU A 1  259  ? 83.459  32.171  -26.295 1.00 93.77  ? 259  GLU A CA  1 
ATOM   1954  C  C   . GLU A 1  259  ? 83.836  33.524  -25.732 1.00 87.42  ? 259  GLU A C   1 
ATOM   1955  O  O   . GLU A 1  259  ? 83.278  33.970  -24.735 1.00 87.57  ? 259  GLU A O   1 
ATOM   1956  C  CB  . GLU A 1  259  ? 82.840  32.314  -27.674 1.00 97.30  ? 259  GLU A CB  1 
ATOM   1957  C  CG  . GLU A 1  259  ? 82.581  30.950  -28.281 1.00 106.14 ? 259  GLU A CG  1 
ATOM   1958  C  CD  . GLU A 1  259  ? 81.649  30.976  -29.466 1.00 110.22 ? 259  GLU A CD  1 
ATOM   1959  O  OE1 . GLU A 1  259  ? 80.507  31.482  -29.329 1.00 113.77 ? 259  GLU A OE1 1 
ATOM   1960  O  OE2 . GLU A 1  259  ? 82.065  30.473  -30.531 1.00 111.96 ? 259  GLU A OE2 1 
ATOM   1961  N  N   . ASP A 1  260  ? 84.793  34.174  -26.387 1.00 80.58  ? 260  ASP A N   1 
ATOM   1962  C  CA  . ASP A 1  260  ? 85.301  35.465  -25.930 1.00 73.82  ? 260  ASP A CA  1 
ATOM   1963  C  C   . ASP A 1  260  ? 84.608  36.674  -26.529 1.00 66.73  ? 260  ASP A C   1 
ATOM   1964  O  O   . ASP A 1  260  ? 84.189  36.661  -27.685 1.00 64.50  ? 260  ASP A O   1 
ATOM   1965  C  CB  . ASP A 1  260  ? 86.805  35.559  -26.214 1.00 79.14  ? 260  ASP A CB  1 
ATOM   1966  C  CG  . ASP A 1  260  ? 87.485  36.683  -25.442 1.00 81.57  ? 260  ASP A CG  1 
ATOM   1967  O  OD1 . ASP A 1  260  ? 87.181  37.868  -25.707 1.00 82.98  ? 260  ASP A OD1 1 
ATOM   1968  O  OD2 . ASP A 1  260  ? 88.326  36.375  -24.565 1.00 83.34  ? 260  ASP A OD2 1 
ATOM   1969  N  N   . ASP A 1  261  ? 84.505  37.723  -25.720 1.00 60.25  ? 261  ASP A N   1 
ATOM   1970  C  CA  . ASP A 1  261  ? 83.878  38.969  -26.131 1.00 55.40  ? 261  ASP A CA  1 
ATOM   1971  C  C   . ASP A 1  261  ? 84.252  39.307  -27.562 1.00 51.71  ? 261  ASP A C   1 
ATOM   1972  O  O   . ASP A 1  261  ? 83.393  39.370  -28.432 1.00 50.86  ? 261  ASP A O   1 
ATOM   1973  C  CB  . ASP A 1  261  ? 84.320  40.110  -25.211 1.00 57.03  ? 261  ASP A CB  1 
ATOM   1974  C  CG  . ASP A 1  261  ? 83.686  40.036  -23.830 1.00 59.20  ? 261  ASP A CG  1 
ATOM   1975  O  OD1 . ASP A 1  261  ? 82.624  40.667  -23.623 1.00 58.66  ? 261  ASP A OD1 1 
ATOM   1976  O  OD2 . ASP A 1  261  ? 84.247  39.344  -22.951 1.00 61.40  ? 261  ASP A OD2 1 
ATOM   1977  N  N   . LEU A 1  262  ? 85.542  39.517  -27.801 1.00 48.54  ? 262  LEU A N   1 
ATOM   1978  C  CA  . LEU A 1  262  ? 86.016  39.871  -29.133 1.00 46.38  ? 262  LEU A CA  1 
ATOM   1979  C  C   . LEU A 1  262  ? 85.374  39.043  -30.224 1.00 45.10  ? 262  LEU A C   1 
ATOM   1980  O  O   . LEU A 1  262  ? 84.932  39.578  -31.242 1.00 44.08  ? 262  LEU A O   1 
ATOM   1981  C  CB  . LEU A 1  262  ? 87.532  39.726  -29.226 1.00 46.26  ? 262  LEU A CB  1 
ATOM   1982  C  CG  . LEU A 1  262  ? 88.345  40.837  -28.568 1.00 48.67  ? 262  LEU A CG  1 
ATOM   1983  C  CD1 . LEU A 1  262  ? 89.824  40.527  -28.666 1.00 51.56  ? 262  LEU A CD1 1 
ATOM   1984  C  CD2 . LEU A 1  262  ? 88.044  42.151  -29.257 1.00 49.19  ? 262  LEU A CD2 1 
ATOM   1985  N  N   . THR A 1  263  ? 85.322  37.733  -30.015 1.00 44.12  ? 263  THR A N   1 
ATOM   1986  C  CA  . THR A 1  263  ? 84.732  36.856  -31.010 1.00 39.49  ? 263  THR A CA  1 
ATOM   1987  C  C   . THR A 1  263  ? 83.315  37.377  -31.294 1.00 40.97  ? 263  THR A C   1 
ATOM   1988  O  O   . THR A 1  263  ? 82.881  37.407  -32.445 1.00 42.70  ? 263  THR A O   1 
ATOM   1989  C  CB  . THR A 1  263  ? 84.723  35.365  -30.523 1.00 35.83  ? 263  THR A CB  1 
ATOM   1990  O  OG1 . THR A 1  263  ? 86.029  34.995  -30.052 1.00 27.29  ? 263  THR A OG1 1 
ATOM   1991  C  CG2 . THR A 1  263  ? 84.363  34.434  -31.673 1.00 31.76  ? 263  THR A CG2 1 
ATOM   1992  N  N   . PHE A 1  264  ? 82.615  37.829  -30.255 1.00 42.79  ? 264  PHE A N   1 
ATOM   1993  C  CA  . PHE A 1  264  ? 81.267  38.363  -30.429 1.00 46.99  ? 264  PHE A CA  1 
ATOM   1994  C  C   . PHE A 1  264  ? 81.228  39.623  -31.282 1.00 47.38  ? 264  PHE A C   1 
ATOM   1995  O  O   . PHE A 1  264  ? 80.510  39.662  -32.274 1.00 49.04  ? 264  PHE A O   1 
ATOM   1996  C  CB  . PHE A 1  264  ? 80.615  38.669  -29.077 1.00 53.16  ? 264  PHE A CB  1 
ATOM   1997  C  CG  . PHE A 1  264  ? 79.957  37.476  -28.423 1.00 58.55  ? 264  PHE A CG  1 
ATOM   1998  C  CD1 . PHE A 1  264  ? 79.430  37.579  -27.126 1.00 59.42  ? 264  PHE A CD1 1 
ATOM   1999  C  CD2 . PHE A 1  264  ? 79.852  36.256  -29.093 1.00 58.68  ? 264  PHE A CD2 1 
ATOM   2000  C  CE1 . PHE A 1  264  ? 78.810  36.486  -26.505 1.00 58.03  ? 264  PHE A CE1 1 
ATOM   2001  C  CE2 . PHE A 1  264  ? 79.232  35.155  -28.482 1.00 59.48  ? 264  PHE A CE2 1 
ATOM   2002  C  CZ  . PHE A 1  264  ? 78.711  35.273  -27.185 1.00 59.20  ? 264  PHE A CZ  1 
ATOM   2003  N  N   . LYS A 1  265  ? 81.978  40.658  -30.906 1.00 47.95  ? 265  LYS A N   1 
ATOM   2004  C  CA  . LYS A 1  265  ? 81.952  41.881  -31.701 1.00 51.22  ? 265  LYS A CA  1 
ATOM   2005  C  C   . LYS A 1  265  ? 82.123  41.507  -33.146 1.00 49.89  ? 265  LYS A C   1 
ATOM   2006  O  O   . LYS A 1  265  ? 81.227  41.731  -33.958 1.00 51.67  ? 265  LYS A O   1 
ATOM   2007  C  CB  . LYS A 1  265  ? 83.046  42.872  -31.292 1.00 56.33  ? 265  LYS A CB  1 
ATOM   2008  C  CG  . LYS A 1  265  ? 82.667  43.673  -30.077 1.00 66.84  ? 265  LYS A CG  1 
ATOM   2009  C  CD  . LYS A 1  265  ? 82.482  42.701  -28.917 1.00 80.36  ? 265  LYS A CD  1 
ATOM   2010  C  CE  . LYS A 1  265  ? 81.618  43.253  -27.790 1.00 87.02  ? 265  LYS A CE  1 
ATOM   2011  N  NZ  . LYS A 1  265  ? 81.499  42.297  -26.629 1.00 88.75  ? 265  LYS A NZ  1 
ATOM   2012  N  N   . LEU A 1  266  ? 83.265  40.919  -33.472 1.00 47.18  ? 266  LEU A N   1 
ATOM   2013  C  CA  . LEU A 1  266  ? 83.496  40.520  -34.842 1.00 42.70  ? 266  LEU A CA  1 
ATOM   2014  C  C   . LEU A 1  266  ? 82.163  40.032  -35.387 1.00 41.70  ? 266  LEU A C   1 
ATOM   2015  O  O   . LEU A 1  266  ? 81.664  40.575  -36.372 1.00 41.80  ? 266  LEU A O   1 
ATOM   2016  C  CB  . LEU A 1  266  ? 84.567  39.433  -34.901 1.00 40.60  ? 266  LEU A CB  1 
ATOM   2017  C  CG  . LEU A 1  266  ? 85.929  39.989  -34.470 1.00 38.69  ? 266  LEU A CG  1 
ATOM   2018  C  CD1 . LEU A 1  266  ? 86.966  38.887  -34.472 1.00 38.22  ? 266  LEU A CD1 1 
ATOM   2019  C  CD2 . LEU A 1  266  ? 86.344  41.118  -35.406 1.00 33.00  ? 266  LEU A CD2 1 
ATOM   2020  N  N   . ALA A 1  267  ? 81.562  39.049  -34.722 1.00 41.37  ? 267  ALA A N   1 
ATOM   2021  C  CA  . ALA A 1  267  ? 80.266  38.535  -35.160 1.00 41.60  ? 267  ALA A CA  1 
ATOM   2022  C  C   . ALA A 1  267  ? 79.370  39.699  -35.574 1.00 41.12  ? 267  ALA A C   1 
ATOM   2023  O  O   . ALA A 1  267  ? 79.054  39.866  -36.755 1.00 43.02  ? 267  ALA A O   1 
ATOM   2024  C  CB  . ALA A 1  267  ? 79.602  37.751  -34.039 1.00 44.10  ? 267  ALA A CB  1 
ATOM   2025  N  N   . ASP A 1  268  ? 78.974  40.505  -34.594 1.00 40.58  ? 268  ASP A N   1 
ATOM   2026  C  CA  . ASP A 1  268  ? 78.124  41.661  -34.844 1.00 42.13  ? 268  ASP A CA  1 
ATOM   2027  C  C   . ASP A 1  268  ? 78.653  42.479  -36.029 1.00 38.30  ? 268  ASP A C   1 
ATOM   2028  O  O   . ASP A 1  268  ? 77.881  42.905  -36.890 1.00 37.94  ? 268  ASP A O   1 
ATOM   2029  C  CB  . ASP A 1  268  ? 78.040  42.542  -33.586 1.00 50.32  ? 268  ASP A CB  1 
ATOM   2030  C  CG  . ASP A 1  268  ? 77.337  41.845  -32.412 1.00 57.47  ? 268  ASP A CG  1 
ATOM   2031  O  OD1 . ASP A 1  268  ? 76.157  41.448  -32.571 1.00 60.14  ? 268  ASP A OD1 1 
ATOM   2032  O  OD2 . ASP A 1  268  ? 77.961  41.702  -31.328 1.00 61.60  ? 268  ASP A OD2 1 
ATOM   2033  N  N   . ILE A 1  269  ? 79.966  42.696  -36.074 1.00 33.60  ? 269  ILE A N   1 
ATOM   2034  C  CA  . ILE A 1  269  ? 80.564  43.448  -37.175 1.00 29.98  ? 269  ILE A CA  1 
ATOM   2035  C  C   . ILE A 1  269  ? 80.259  42.714  -38.461 1.00 29.92  ? 269  ILE A C   1 
ATOM   2036  O  O   . ILE A 1  269  ? 79.898  43.315  -39.472 1.00 29.55  ? 269  ILE A O   1 
ATOM   2037  C  CB  . ILE A 1  269  ? 82.103  43.567  -37.048 1.00 27.80  ? 269  ILE A CB  1 
ATOM   2038  C  CG1 . ILE A 1  269  ? 82.465  44.681  -36.070 1.00 25.72  ? 269  ILE A CG1 1 
ATOM   2039  C  CG2 . ILE A 1  269  ? 82.719  43.872  -38.400 1.00 27.50  ? 269  ILE A CG2 1 
ATOM   2040  C  CD1 . ILE A 1  269  ? 83.941  44.936  -35.964 1.00 26.28  ? 269  ILE A CD1 1 
ATOM   2041  N  N   . LEU A 1  270  ? 80.408  41.401  -38.417 1.00 29.99  ? 270  LEU A N   1 
ATOM   2042  C  CA  . LEU A 1  270  ? 80.142  40.615  -39.589 1.00 33.01  ? 270  LEU A CA  1 
ATOM   2043  C  C   . LEU A 1  270  ? 78.669  40.736  -39.928 1.00 38.81  ? 270  LEU A C   1 
ATOM   2044  O  O   . LEU A 1  270  ? 78.338  41.144  -41.045 1.00 41.18  ? 270  LEU A O   1 
ATOM   2045  C  CB  . LEU A 1  270  ? 80.528  39.165  -39.358 1.00 33.75  ? 270  LEU A CB  1 
ATOM   2046  C  CG  . LEU A 1  270  ? 80.592  38.357  -40.655 1.00 36.91  ? 270  LEU A CG  1 
ATOM   2047  C  CD1 . LEU A 1  270  ? 80.829  39.283  -41.852 1.00 39.65  ? 270  LEU A CD1 1 
ATOM   2048  C  CD2 . LEU A 1  270  ? 81.701  37.305  -40.538 1.00 37.68  ? 270  LEU A CD2 1 
ATOM   2049  N  N   . LYS A 1  271  ? 77.792  40.396  -38.973 1.00 44.35  ? 271  LYS A N   1 
ATOM   2050  C  CA  . LYS A 1  271  ? 76.335  40.496  -39.180 1.00 48.00  ? 271  LYS A CA  1 
ATOM   2051  C  C   . LYS A 1  271  ? 76.049  41.817  -39.878 1.00 48.14  ? 271  LYS A C   1 
ATOM   2052  O  O   . LYS A 1  271  ? 75.565  41.862  -41.014 1.00 49.29  ? 271  LYS A O   1 
ATOM   2053  C  CB  . LYS A 1  271  ? 75.565  40.541  -37.855 1.00 50.25  ? 271  LYS A CB  1 
ATOM   2054  C  CG  . LYS A 1  271  ? 75.392  39.259  -37.066 1.00 55.84  ? 271  LYS A CG  1 
ATOM   2055  C  CD  . LYS A 1  271  ? 74.511  39.582  -35.842 1.00 61.09  ? 271  LYS A CD  1 
ATOM   2056  C  CE  . LYS A 1  271  ? 74.467  38.475  -34.790 1.00 63.74  ? 271  LYS A CE  1 
ATOM   2057  N  NZ  . LYS A 1  271  ? 73.688  38.892  -33.573 1.00 63.72  ? 271  LYS A NZ  1 
ATOM   2058  N  N   . ALA A 1  272  ? 76.352  42.892  -39.156 1.00 47.75  ? 272  ALA A N   1 
ATOM   2059  C  CA  . ALA A 1  272  ? 76.154  44.246  -39.634 1.00 48.75  ? 272  ALA A CA  1 
ATOM   2060  C  C   . ALA A 1  272  ? 76.653  44.402  -41.058 1.00 49.27  ? 272  ALA A C   1 
ATOM   2061  O  O   . ALA A 1  272  ? 75.967  44.962  -41.915 1.00 49.36  ? 272  ALA A O   1 
ATOM   2062  C  CB  . ALA A 1  272  ? 76.876  45.216  -38.724 1.00 49.50  ? 272  ALA A CB  1 
ATOM   2063  N  N   . ASN A 1  273  ? 77.853  43.904  -41.313 1.00 50.89  ? 273  ASN A N   1 
ATOM   2064  C  CA  . ASN A 1  273  ? 78.407  44.017  -42.641 1.00 53.00  ? 273  ASN A CA  1 
ATOM   2065  C  C   . ASN A 1  273  ? 77.447  43.411  -43.662 1.00 55.32  ? 273  ASN A C   1 
ATOM   2066  O  O   . ASN A 1  273  ? 76.940  44.117  -44.530 1.00 57.22  ? 273  ASN A O   1 
ATOM   2067  C  CB  . ASN A 1  273  ? 79.763  43.328  -42.715 1.00 51.01  ? 273  ASN A CB  1 
ATOM   2068  C  CG  . ASN A 1  273  ? 80.540  43.722  -43.951 1.00 50.10  ? 273  ASN A CG  1 
ATOM   2069  O  OD1 . ASN A 1  273  ? 80.950  44.879  -44.099 1.00 46.33  ? 273  ASN A OD1 1 
ATOM   2070  N  ND2 . ASN A 1  273  ? 80.739  42.765  -44.856 1.00 49.29  ? 273  ASN A ND2 1 
ATOM   2071  N  N   . ILE A 1  274  ? 77.174  42.117  -43.554 1.00 56.35  ? 274  ILE A N   1 
ATOM   2072  C  CA  . ILE A 1  274  ? 76.274  41.479  -44.505 1.00 59.11  ? 274  ILE A CA  1 
ATOM   2073  C  C   . ILE A 1  274  ? 75.004  42.290  -44.752 1.00 63.32  ? 274  ILE A C   1 
ATOM   2074  O  O   . ILE A 1  274  ? 74.755  42.717  -45.884 1.00 66.21  ? 274  ILE A O   1 
ATOM   2075  C  CB  . ILE A 1  274  ? 75.829  40.088  -44.044 1.00 57.45  ? 274  ILE A CB  1 
ATOM   2076  C  CG1 . ILE A 1  274  ? 77.038  39.256  -43.626 1.00 59.57  ? 274  ILE A CG1 1 
ATOM   2077  C  CG2 . ILE A 1  274  ? 75.101  39.388  -45.183 1.00 57.39  ? 274  ILE A CG2 1 
ATOM   2078  C  CD1 . ILE A 1  274  ? 76.682  37.846  -43.181 1.00 59.18  ? 274  ILE A CD1 1 
ATOM   2079  N  N   . SER A 1  275  ? 74.210  42.501  -43.696 1.00 66.01  ? 275  SER A N   1 
ATOM   2080  C  CA  . SER A 1  275  ? 72.944  43.239  -43.810 1.00 66.93  ? 275  SER A CA  1 
ATOM   2081  C  C   . SER A 1  275  ? 73.120  44.517  -44.606 1.00 67.97  ? 275  SER A C   1 
ATOM   2082  O  O   . SER A 1  275  ? 72.152  45.071  -45.121 1.00 68.81  ? 275  SER A O   1 
ATOM   2083  C  CB  . SER A 1  275  ? 72.368  43.584  -42.436 1.00 66.19  ? 275  SER A CB  1 
ATOM   2084  O  OG  . SER A 1  275  ? 72.833  44.847  -42.000 1.00 68.53  ? 275  SER A OG  1 
ATOM   2085  N  N   . LEU A 1  276  ? 74.359  44.987  -44.698 1.00 69.11  ? 276  LEU A N   1 
ATOM   2086  C  CA  . LEU A 1  276  ? 74.642  46.189  -45.459 1.00 70.89  ? 276  LEU A CA  1 
ATOM   2087  C  C   . LEU A 1  276  ? 74.788  45.846  -46.935 1.00 75.33  ? 276  LEU A C   1 
ATOM   2088  O  O   . LEU A 1  276  ? 74.117  46.431  -47.784 1.00 78.97  ? 276  LEU A O   1 
ATOM   2089  C  CB  . LEU A 1  276  ? 75.927  46.842  -44.990 1.00 65.27  ? 276  LEU A CB  1 
ATOM   2090  C  CG  . LEU A 1  276  ? 76.078  48.162  -45.731 1.00 60.91  ? 276  LEU A CG  1 
ATOM   2091  C  CD1 . LEU A 1  276  ? 75.338  49.214  -44.929 1.00 60.61  ? 276  LEU A CD1 1 
ATOM   2092  C  CD2 . LEU A 1  276  ? 77.534  48.533  -45.902 1.00 60.95  ? 276  LEU A CD2 1 
ATOM   2093  N  N   . GLU A 1  277  ? 75.675  44.904  -47.238 1.00 79.20  ? 277  GLU A N   1 
ATOM   2094  C  CA  . GLU A 1  277  ? 75.895  44.494  -48.617 1.00 85.12  ? 277  GLU A CA  1 
ATOM   2095  C  C   . GLU A 1  277  ? 74.581  44.111  -49.282 1.00 87.77  ? 277  GLU A C   1 
ATOM   2096  O  O   . GLU A 1  277  ? 74.259  44.588  -50.374 1.00 89.68  ? 277  GLU A O   1 
ATOM   2097  C  CB  . GLU A 1  277  ? 76.835  43.293  -48.693 1.00 88.01  ? 277  GLU A CB  1 
ATOM   2098  C  CG  . GLU A 1  277  ? 76.893  42.698  -50.102 1.00 94.09  ? 277  GLU A CG  1 
ATOM   2099  C  CD  . GLU A 1  277  ? 77.375  41.255  -50.135 1.00 96.78  ? 277  GLU A CD  1 
ATOM   2100  O  OE1 . GLU A 1  277  ? 76.898  40.442  -49.308 1.00 98.00  ? 277  GLU A OE1 1 
ATOM   2101  O  OE2 . GLU A 1  277  ? 78.216  40.932  -51.004 1.00 99.34  ? 277  GLU A OE2 1 
ATOM   2102  N  N   . THR A 1  278  ? 73.832  43.237  -48.618 1.00 89.06  ? 278  THR A N   1 
ATOM   2103  C  CA  . THR A 1  278  ? 72.557  42.769  -49.139 1.00 90.55  ? 278  THR A CA  1 
ATOM   2104  C  C   . THR A 1  278  ? 71.631  43.945  -49.497 1.00 92.66  ? 278  THR A C   1 
ATOM   2105  O  O   . THR A 1  278  ? 70.647  43.774  -50.220 1.00 94.52  ? 278  THR A O   1 
ATOM   2106  C  CB  . THR A 1  278  ? 71.871  41.823  -48.114 1.00 88.88  ? 278  THR A CB  1 
ATOM   2107  O  OG1 . THR A 1  278  ? 72.796  40.804  -47.719 1.00 86.92  ? 278  THR A OG1 1 
ATOM   2108  C  CG2 . THR A 1  278  ? 70.661  41.142  -48.727 1.00 90.22  ? 278  THR A CG2 1 
ATOM   2109  N  N   . LEU A 1  279  ? 71.957  45.142  -49.017 1.00 93.86  ? 279  LEU A N   1 
ATOM   2110  C  CA  . LEU A 1  279  ? 71.139  46.312  -49.309 1.00 96.72  ? 279  LEU A CA  1 
ATOM   2111  C  C   . LEU A 1  279  ? 71.563  47.087  -50.549 1.00 103.05 ? 279  LEU A C   1 
ATOM   2112  O  O   . LEU A 1  279  ? 70.916  48.063  -50.919 1.00 105.94 ? 279  LEU A O   1 
ATOM   2113  C  CB  . LEU A 1  279  ? 71.115  47.257  -48.113 1.00 89.69  ? 279  LEU A CB  1 
ATOM   2114  C  CG  . LEU A 1  279  ? 70.497  46.670  -46.850 1.00 86.40  ? 279  LEU A CG  1 
ATOM   2115  C  CD1 . LEU A 1  279  ? 70.316  47.759  -45.823 1.00 83.81  ? 279  LEU A CD1 1 
ATOM   2116  C  CD2 . LEU A 1  279  ? 69.163  46.041  -47.181 1.00 85.58  ? 279  LEU A CD2 1 
ATOM   2117  N  N   . GLU A 1  280  ? 72.646  46.667  -51.193 1.00 110.35 ? 280  GLU A N   1 
ATOM   2118  C  CA  . GLU A 1  280  ? 73.101  47.350  -52.398 1.00 117.71 ? 280  GLU A CA  1 
ATOM   2119  C  C   . GLU A 1  280  ? 72.957  46.454  -53.609 1.00 122.46 ? 280  GLU A C   1 
ATOM   2120  O  O   . GLU A 1  280  ? 73.404  46.795  -54.703 1.00 122.45 ? 280  GLU A O   1 
ATOM   2121  C  CB  . GLU A 1  280  ? 74.549  47.799  -52.250 1.00 117.66 ? 280  GLU A CB  1 
ATOM   2122  C  CG  . GLU A 1  280  ? 74.710  48.934  -51.268 1.00 121.14 ? 280  GLU A CG  1 
ATOM   2123  C  CD  . GLU A 1  280  ? 76.134  49.405  -51.170 1.00 122.75 ? 280  GLU A CD  1 
ATOM   2124  O  OE1 . GLU A 1  280  ? 77.001  48.573  -50.838 1.00 125.92 ? 280  GLU A OE1 1 
ATOM   2125  O  OE2 . GLU A 1  280  ? 76.387  50.601  -51.424 1.00 122.60 ? 280  GLU A OE2 1 
ATOM   2126  N  N   . HIS A 1  281  ? 72.329  45.302  -53.397 1.00 129.31 ? 281  HIS A N   1 
ATOM   2127  C  CA  . HIS A 1  281  ? 72.092  44.337  -54.463 1.00 136.49 ? 281  HIS A CA  1 
ATOM   2128  C  C   . HIS A 1  281  ? 70.632  43.905  -54.440 1.00 138.42 ? 281  HIS A C   1 
ATOM   2129  O  O   . HIS A 1  281  ? 70.252  42.895  -55.040 1.00 138.98 ? 281  HIS A O   1 
ATOM   2130  C  CB  . HIS A 1  281  ? 73.010  43.123  -54.308 1.00 141.18 ? 281  HIS A CB  1 
ATOM   2131  C  CG  . HIS A 1  281  ? 74.450  43.419  -54.598 1.00 147.08 ? 281  HIS A CG  1 
ATOM   2132  N  ND1 . HIS A 1  281  ? 74.881  43.883  -55.822 1.00 149.14 ? 281  HIS A ND1 1 
ATOM   2133  C  CD2 . HIS A 1  281  ? 75.555  43.326  -53.819 1.00 149.23 ? 281  HIS A CD2 1 
ATOM   2134  C  CE1 . HIS A 1  281  ? 76.190  44.065  -55.785 1.00 150.45 ? 281  HIS A CE1 1 
ATOM   2135  N  NE2 . HIS A 1  281  ? 76.623  43.734  -54.582 1.00 150.79 ? 281  HIS A NE2 1 
ATOM   2136  N  N   . ASN A 1  282  ? 69.827  44.687  -53.727 1.00 140.14 ? 282  ASN A N   1 
ATOM   2137  C  CA  . ASN A 1  282  ? 68.391  44.461  -53.609 1.00 141.79 ? 282  ASN A CA  1 
ATOM   2138  C  C   . ASN A 1  282  ? 67.688  45.821  -53.557 1.00 142.74 ? 282  ASN A C   1 
ATOM   2139  O  O   . ASN A 1  282  ? 68.254  46.834  -53.984 1.00 142.11 ? 282  ASN A O   1 
ATOM   2140  C  CB  . ASN A 1  282  ? 68.068  43.638  -52.351 1.00 140.97 ? 282  ASN A CB  1 
ATOM   2141  C  CG  . ASN A 1  282  ? 68.161  42.139  -52.594 1.00 140.53 ? 282  ASN A CG  1 
ATOM   2142  O  OD1 . ASN A 1  282  ? 67.488  41.598  -53.474 1.00 140.60 ? 282  ASN A OD1 1 
ATOM   2143  N  ND2 . ASN A 1  282  ? 68.993  41.461  -51.812 1.00 140.04 ? 282  ASN A ND2 1 
ATOM   2144  N  N   . GLY A 1  283  ? 66.457  45.841  -53.048 1.00 143.67 ? 283  GLY A N   1 
ATOM   2145  C  CA  . GLY A 1  283  ? 65.717  47.089  -52.957 1.00 142.41 ? 283  GLY A CA  1 
ATOM   2146  C  C   . GLY A 1  283  ? 66.492  48.094  -52.128 1.00 141.66 ? 283  GLY A C   1 
ATOM   2147  O  O   . GLY A 1  283  ? 66.316  48.165  -50.914 1.00 142.17 ? 283  GLY A O   1 
ATOM   2148  N  N   . ALA A 1  284  ? 67.349  48.868  -52.787 1.00 139.83 ? 284  ALA A N   1 
ATOM   2149  C  CA  . ALA A 1  284  ? 68.175  49.860  -52.112 1.00 138.80 ? 284  ALA A CA  1 
ATOM   2150  C  C   . ALA A 1  284  ? 67.469  51.198  -51.918 1.00 138.78 ? 284  ALA A C   1 
ATOM   2151  O  O   . ALA A 1  284  ? 67.485  52.040  -52.815 1.00 139.17 ? 284  ALA A O   1 
ATOM   2152  C  CB  . ALA A 1  284  ? 69.465  50.067  -52.899 1.00 137.56 ? 284  ALA A CB  1 
ATOM   2153  N  N   . PRO A 1  285  ? 66.840  51.415  -50.744 1.00 138.83 ? 285  PRO A N   1 
ATOM   2154  C  CA  . PRO A 1  285  ? 66.143  52.677  -50.480 1.00 139.97 ? 285  PRO A CA  1 
ATOM   2155  C  C   . PRO A 1  285  ? 67.141  53.802  -50.228 1.00 141.45 ? 285  PRO A C   1 
ATOM   2156  O  O   . PRO A 1  285  ? 67.209  54.360  -49.131 1.00 141.47 ? 285  PRO A O   1 
ATOM   2157  C  CB  . PRO A 1  285  ? 65.304  52.352  -49.249 1.00 138.84 ? 285  PRO A CB  1 
ATOM   2158  C  CG  . PRO A 1  285  ? 66.180  51.421  -48.511 1.00 138.19 ? 285  PRO A CG  1 
ATOM   2159  C  CD  . PRO A 1  285  ? 66.689  50.499  -49.600 1.00 138.03 ? 285  PRO A CD  1 
ATOM   2160  N  N   . HIS A 1  286  ? 67.909  54.108  -51.271 1.00 144.13 ? 286  HIS A N   1 
ATOM   2161  C  CA  . HIS A 1  286  ? 68.943  55.145  -51.282 1.00 145.63 ? 286  HIS A CA  1 
ATOM   2162  C  C   . HIS A 1  286  ? 69.487  55.626  -49.936 1.00 142.99 ? 286  HIS A C   1 
ATOM   2163  O  O   . HIS A 1  286  ? 70.595  55.256  -49.553 1.00 142.61 ? 286  HIS A O   1 
ATOM   2164  C  CB  . HIS A 1  286  ? 68.473  56.354  -52.113 1.00 150.55 ? 286  HIS A CB  1 
ATOM   2165  C  CG  . HIS A 1  286  ? 68.495  56.119  -53.597 1.00 154.88 ? 286  HIS A CG  1 
ATOM   2166  N  ND1 . HIS A 1  286  ? 69.650  55.819  -54.289 1.00 156.09 ? 286  HIS A ND1 1 
ATOM   2167  C  CD2 . HIS A 1  286  ? 67.502  56.151  -54.519 1.00 156.24 ? 286  HIS A CD2 1 
ATOM   2168  C  CE1 . HIS A 1  286  ? 69.368  55.675  -55.572 1.00 156.83 ? 286  HIS A CE1 1 
ATOM   2169  N  NE2 . HIS A 1  286  ? 68.073  55.872  -55.739 1.00 157.46 ? 286  HIS A NE2 1 
ATOM   2170  N  N   . HIS A 1  287  ? 68.726  56.445  -49.218 1.00 139.92 ? 287  HIS A N   1 
ATOM   2171  C  CA  . HIS A 1  287  ? 69.209  56.965  -47.944 1.00 135.78 ? 287  HIS A CA  1 
ATOM   2172  C  C   . HIS A 1  287  ? 68.582  56.337  -46.698 1.00 130.23 ? 287  HIS A C   1 
ATOM   2173  O  O   . HIS A 1  287  ? 68.232  57.024  -45.738 1.00 128.27 ? 287  HIS A O   1 
ATOM   2174  C  CB  . HIS A 1  287  ? 69.055  58.490  -47.919 1.00 141.06 ? 287  HIS A CB  1 
ATOM   2175  C  CG  . HIS A 1  287  ? 69.755  59.187  -49.052 1.00 145.53 ? 287  HIS A CG  1 
ATOM   2176  N  ND1 . HIS A 1  287  ? 71.090  58.994  -49.335 1.00 146.94 ? 287  HIS A ND1 1 
ATOM   2177  C  CD2 . HIS A 1  287  ? 69.302  60.080  -49.966 1.00 146.94 ? 287  HIS A CD2 1 
ATOM   2178  C  CE1 . HIS A 1  287  ? 71.430  59.737  -50.375 1.00 148.22 ? 287  HIS A CE1 1 
ATOM   2179  N  NE2 . HIS A 1  287  ? 70.364  60.405  -50.776 1.00 148.21 ? 287  HIS A NE2 1 
ATOM   2180  N  N   . ALA A 1  288  ? 68.450  55.017  -46.733 1.00 124.25 ? 288  ALA A N   1 
ATOM   2181  C  CA  . ALA A 1  288  ? 67.915  54.248  -45.619 1.00 117.82 ? 288  ALA A CA  1 
ATOM   2182  C  C   . ALA A 1  288  ? 69.021  53.241  -45.324 1.00 112.88 ? 288  ALA A C   1 
ATOM   2183  O  O   . ALA A 1  288  ? 68.958  52.452  -44.383 1.00 109.84 ? 288  ALA A O   1 
ATOM   2184  C  CB  . ALA A 1  288  ? 66.634  53.539  -46.032 1.00 119.38 ? 288  ALA A CB  1 
ATOM   2185  N  N   . ILE A 1  289  ? 70.039  53.305  -46.172 1.00 108.49 ? 289  ILE A N   1 
ATOM   2186  C  CA  . ILE A 1  289  ? 71.220  52.466  -46.096 1.00 105.50 ? 289  ILE A CA  1 
ATOM   2187  C  C   . ILE A 1  289  ? 72.176  53.088  -45.100 1.00 104.37 ? 289  ILE A C   1 
ATOM   2188  O  O   . ILE A 1  289  ? 72.566  52.462  -44.125 1.00 103.80 ? 289  ILE A O   1 
ATOM   2189  C  CB  . ILE A 1  289  ? 71.926  52.400  -47.463 1.00 105.84 ? 289  ILE A CB  1 
ATOM   2190  C  CG1 . ILE A 1  289  ? 71.269  51.337  -48.343 1.00 106.97 ? 289  ILE A CG1 1 
ATOM   2191  C  CG2 . ILE A 1  289  ? 73.408  52.146  -47.278 1.00 105.06 ? 289  ILE A CG2 1 
ATOM   2192  C  CD1 . ILE A 1  289  ? 71.914  51.189  -49.714 1.00 106.74 ? 289  ILE A CD1 1 
ATOM   2193  N  N   . GLU A 1  290  ? 72.558  54.331  -45.370 1.00 105.16 ? 290  GLU A N   1 
ATOM   2194  C  CA  . GLU A 1  290  ? 73.470  55.072  -44.508 1.00 106.91 ? 290  GLU A CA  1 
ATOM   2195  C  C   . GLU A 1  290  ? 73.005  55.010  -43.059 1.00 105.22 ? 290  GLU A C   1 
ATOM   2196  O  O   . GLU A 1  290  ? 73.622  55.594  -42.168 1.00 105.21 ? 290  GLU A O   1 
ATOM   2197  C  CB  . GLU A 1  290  ? 73.572  56.534  -44.982 1.00 110.86 ? 290  GLU A CB  1 
ATOM   2198  C  CG  . GLU A 1  290  ? 72.229  57.182  -45.371 1.00 116.97 ? 290  GLU A CG  1 
ATOM   2199  C  CD  . GLU A 1  290  ? 72.380  58.540  -46.070 1.00 119.38 ? 290  GLU A CD  1 
ATOM   2200  O  OE1 . GLU A 1  290  ? 73.175  58.642  -47.034 1.00 121.43 ? 290  GLU A OE1 1 
ATOM   2201  O  OE2 . GLU A 1  290  ? 71.690  59.504  -45.665 1.00 120.12 ? 290  GLU A OE2 1 
ATOM   2202  N  N   . GLU A 1  291  ? 71.911  54.291  -42.837 1.00 103.39 ? 291  GLU A N   1 
ATOM   2203  C  CA  . GLU A 1  291  ? 71.339  54.123  -41.512 1.00 101.98 ? 291  GLU A CA  1 
ATOM   2204  C  C   . GLU A 1  291  ? 71.881  52.842  -40.889 1.00 96.81  ? 291  GLU A C   1 
ATOM   2205  O  O   . GLU A 1  291  ? 71.695  52.585  -39.702 1.00 96.02  ? 291  GLU A O   1 
ATOM   2206  C  CB  . GLU A 1  291  ? 69.804  54.080  -41.610 1.00 107.95 ? 291  GLU A CB  1 
ATOM   2207  C  CG  . GLU A 1  291  ? 69.182  55.406  -42.112 1.00 114.36 ? 291  GLU A CG  1 
ATOM   2208  C  CD  . GLU A 1  291  ? 67.662  55.361  -42.287 1.00 116.25 ? 291  GLU A CD  1 
ATOM   2209  O  OE1 . GLU A 1  291  ? 66.968  54.892  -41.358 1.00 118.53 ? 291  GLU A OE1 1 
ATOM   2210  O  OE2 . GLU A 1  291  ? 67.162  55.812  -43.346 1.00 115.30 ? 291  GLU A OE2 1 
ATOM   2211  N  N   . ALA A 1  292  ? 72.557  52.044  -41.707 1.00 92.14  ? 292  ALA A N   1 
ATOM   2212  C  CA  . ALA A 1  292  ? 73.146  50.790  -41.254 1.00 88.50  ? 292  ALA A CA  1 
ATOM   2213  C  C   . ALA A 1  292  ? 74.626  50.801  -41.582 1.00 86.48  ? 292  ALA A C   1 
ATOM   2214  O  O   . ALA A 1  292  ? 75.357  49.882  -41.211 1.00 86.14  ? 292  ALA A O   1 
ATOM   2215  C  CB  . ALA A 1  292  ? 72.474  49.607  -41.930 1.00 87.42  ? 292  ALA A CB  1 
ATOM   2216  N  N   . GLU A 1  293  ? 75.057  51.839  -42.297 1.00 84.04  ? 293  GLU A N   1 
ATOM   2217  C  CA  . GLU A 1  293  ? 76.463  51.985  -42.652 1.00 82.11  ? 293  GLU A CA  1 
ATOM   2218  C  C   . GLU A 1  293  ? 77.116  52.518  -41.397 1.00 80.41  ? 293  GLU A C   1 
ATOM   2219  O  O   . GLU A 1  293  ? 78.299  52.298  -41.144 1.00 80.04  ? 293  GLU A O   1 
ATOM   2220  C  CB  . GLU A 1  293  ? 76.658  53.005  -43.775 1.00 83.69  ? 293  GLU A CB  1 
ATOM   2221  C  CG  . GLU A 1  293  ? 78.058  52.966  -44.401 1.00 85.88  ? 293  GLU A CG  1 
ATOM   2222  C  CD  . GLU A 1  293  ? 78.502  54.298  -44.994 1.00 87.24  ? 293  GLU A CD  1 
ATOM   2223  O  OE1 . GLU A 1  293  ? 78.801  55.217  -44.202 1.00 88.57  ? 293  GLU A OE1 1 
ATOM   2224  O  OE2 . GLU A 1  293  ? 78.556  54.427  -46.242 1.00 85.61  ? 293  GLU A OE2 1 
ATOM   2225  N  N   . SER A 1  294  ? 76.319  53.235  -40.616 1.00 78.23  ? 294  SER A N   1 
ATOM   2226  C  CA  . SER A 1  294  ? 76.784  53.810  -39.368 1.00 76.02  ? 294  SER A CA  1 
ATOM   2227  C  C   . SER A 1  294  ? 76.916  52.691  -38.344 1.00 72.58  ? 294  SER A C   1 
ATOM   2228  O  O   . SER A 1  294  ? 77.765  52.753  -37.453 1.00 72.94  ? 294  SER A O   1 
ATOM   2229  C  CB  . SER A 1  294  ? 75.790  54.852  -38.867 1.00 77.72  ? 294  SER A CB  1 
ATOM   2230  O  OG  . SER A 1  294  ? 74.545  54.240  -38.580 1.00 83.59  ? 294  SER A OG  1 
ATOM   2231  N  N   . LEU A 1  295  ? 76.072  51.668  -38.470 1.00 67.40  ? 295  LEU A N   1 
ATOM   2232  C  CA  . LEU A 1  295  ? 76.129  50.543  -37.548 1.00 62.90  ? 295  LEU A CA  1 
ATOM   2233  C  C   . LEU A 1  295  ? 77.476  49.843  -37.708 1.00 60.27  ? 295  LEU A C   1 
ATOM   2234  O  O   . LEU A 1  295  ? 78.140  49.504  -36.719 1.00 61.66  ? 295  LEU A O   1 
ATOM   2235  C  CB  . LEU A 1  295  ? 75.002  49.554  -37.823 1.00 62.67  ? 295  LEU A CB  1 
ATOM   2236  C  CG  . LEU A 1  295  ? 74.952  48.460  -36.756 1.00 63.78  ? 295  LEU A CG  1 
ATOM   2237  C  CD1 . LEU A 1  295  ? 74.646  49.077  -35.396 1.00 64.13  ? 295  LEU A CD1 1 
ATOM   2238  C  CD2 . LEU A 1  295  ? 73.900  47.439  -37.121 1.00 66.78  ? 295  LEU A CD2 1 
ATOM   2239  N  N   . LEU A 1  296  ? 77.873  49.628  -38.961 1.00 54.75  ? 296  LEU A N   1 
ATOM   2240  C  CA  . LEU A 1  296  ? 79.155  49.001  -39.253 1.00 48.54  ? 296  LEU A CA  1 
ATOM   2241  C  C   . LEU A 1  296  ? 80.184  49.853  -38.539 1.00 46.27  ? 296  LEU A C   1 
ATOM   2242  O  O   . LEU A 1  296  ? 80.806  49.423  -37.566 1.00 45.31  ? 296  LEU A O   1 
ATOM   2243  C  CB  . LEU A 1  296  ? 79.423  49.013  -40.759 1.00 44.82  ? 296  LEU A CB  1 
ATOM   2244  C  CG  . LEU A 1  296  ? 80.716  48.362  -41.253 1.00 42.40  ? 296  LEU A CG  1 
ATOM   2245  C  CD1 . LEU A 1  296  ? 80.794  46.937  -40.774 1.00 42.01  ? 296  LEU A CD1 1 
ATOM   2246  C  CD2 . LEU A 1  296  ? 80.751  48.383  -42.764 1.00 43.65  ? 296  LEU A CD2 1 
ATOM   2247  N  N   . GLN A 1  297  ? 80.324  51.083  -39.021 1.00 44.25  ? 297  GLN A N   1 
ATOM   2248  C  CA  . GLN A 1  297  ? 81.255  52.046  -38.450 1.00 43.09  ? 297  GLN A CA  1 
ATOM   2249  C  C   . GLN A 1  297  ? 81.249  51.968  -36.933 1.00 39.99  ? 297  GLN A C   1 
ATOM   2250  O  O   . GLN A 1  297  ? 82.298  52.012  -36.301 1.00 36.72  ? 297  GLN A O   1 
ATOM   2251  C  CB  . GLN A 1  297  ? 80.881  53.465  -38.894 1.00 45.94  ? 297  GLN A CB  1 
ATOM   2252  C  CG  . GLN A 1  297  ? 81.739  54.567  -38.282 1.00 47.40  ? 297  GLN A CG  1 
ATOM   2253  C  CD  . GLN A 1  297  ? 83.194  54.473  -38.694 1.00 48.18  ? 297  GLN A CD  1 
ATOM   2254  O  OE1 . GLN A 1  297  ? 83.556  54.784  -39.829 1.00 50.20  ? 297  GLN A OE1 1 
ATOM   2255  N  NE2 . GLN A 1  297  ? 84.038  54.030  -37.772 1.00 48.58  ? 297  GLN A NE2 1 
ATOM   2256  N  N   . PHE A 1  298  ? 80.063  51.844  -36.355 1.00 38.58  ? 298  PHE A N   1 
ATOM   2257  C  CA  . PHE A 1  298  ? 79.953  51.764  -34.914 1.00 40.16  ? 298  PHE A CA  1 
ATOM   2258  C  C   . PHE A 1  298  ? 80.651  50.550  -34.362 1.00 40.02  ? 298  PHE A C   1 
ATOM   2259  O  O   . PHE A 1  298  ? 81.493  50.649  -33.476 1.00 43.09  ? 298  PHE A O   1 
ATOM   2260  C  CB  . PHE A 1  298  ? 78.504  51.703  -34.476 1.00 42.89  ? 298  PHE A CB  1 
ATOM   2261  C  CG  . PHE A 1  298  ? 78.339  51.447  -33.004 1.00 44.92  ? 298  PHE A CG  1 
ATOM   2262  C  CD1 . PHE A 1  298  ? 78.963  52.269  -32.072 1.00 44.64  ? 298  PHE A CD1 1 
ATOM   2263  C  CD2 . PHE A 1  298  ? 77.552  50.398  -32.548 1.00 44.95  ? 298  PHE A CD2 1 
ATOM   2264  C  CE1 . PHE A 1  298  ? 78.804  52.057  -30.713 1.00 43.29  ? 298  PHE A CE1 1 
ATOM   2265  C  CE2 . PHE A 1  298  ? 77.386  50.179  -31.187 1.00 45.03  ? 298  PHE A CE2 1 
ATOM   2266  C  CZ  . PHE A 1  298  ? 78.016  51.013  -30.269 1.00 44.20  ? 298  PHE A CZ  1 
ATOM   2267  N  N   . HIS A 1  299  ? 80.281  49.387  -34.862 1.00 38.68  ? 299  HIS A N   1 
ATOM   2268  C  CA  . HIS A 1  299  ? 80.906  48.176  -34.378 1.00 41.46  ? 299  HIS A CA  1 
ATOM   2269  C  C   . HIS A 1  299  ? 82.397  48.163  -34.731 1.00 40.61  ? 299  HIS A C   1 
ATOM   2270  O  O   . HIS A 1  299  ? 83.256  48.048  -33.849 1.00 39.62  ? 299  HIS A O   1 
ATOM   2271  C  CB  . HIS A 1  299  ? 80.172  46.971  -34.959 1.00 46.21  ? 299  HIS A CB  1 
ATOM   2272  C  CG  . HIS A 1  299  ? 78.933  46.602  -34.201 1.00 49.46  ? 299  HIS A CG  1 
ATOM   2273  N  ND1 . HIS A 1  299  ? 77.790  46.140  -34.819 1.00 49.84  ? 299  HIS A ND1 1 
ATOM   2274  C  CD2 . HIS A 1  299  ? 78.675  46.583  -32.871 1.00 51.23  ? 299  HIS A CD2 1 
ATOM   2275  C  CE1 . HIS A 1  299  ? 76.882  45.852  -33.904 1.00 51.02  ? 299  HIS A CE1 1 
ATOM   2276  N  NE2 . HIS A 1  299  ? 77.394  46.112  -32.713 1.00 52.52  ? 299  HIS A NE2 1 
ATOM   2277  N  N   . VAL A 1  300  ? 82.699  48.309  -36.017 1.00 39.34  ? 300  VAL A N   1 
ATOM   2278  C  CA  . VAL A 1  300  ? 84.080  48.322  -36.483 1.00 37.61  ? 300  VAL A CA  1 
ATOM   2279  C  C   . VAL A 1  300  ? 84.900  49.311  -35.671 1.00 34.56  ? 300  VAL A C   1 
ATOM   2280  O  O   . VAL A 1  300  ? 86.123  49.286  -35.689 1.00 35.95  ? 300  VAL A O   1 
ATOM   2281  C  CB  . VAL A 1  300  ? 84.162  48.726  -37.968 1.00 38.90  ? 300  VAL A CB  1 
ATOM   2282  C  CG1 . VAL A 1  300  ? 85.602  48.687  -38.449 1.00 37.74  ? 300  VAL A CG1 1 
ATOM   2283  C  CG2 . VAL A 1  300  ? 83.298  47.800  -38.801 1.00 40.75  ? 300  VAL A CG2 1 
ATOM   2284  N  N   . ALA A 1  301  ? 84.217  50.185  -34.953 1.00 30.87  ? 301  ALA A N   1 
ATOM   2285  C  CA  . ALA A 1  301  ? 84.901  51.174  -34.154 1.00 29.73  ? 301  ALA A CA  1 
ATOM   2286  C  C   . ALA A 1  301  ? 84.843  50.809  -32.693 1.00 29.77  ? 301  ALA A C   1 
ATOM   2287  O  O   . ALA A 1  301  ? 85.840  50.834  -31.989 1.00 30.05  ? 301  ALA A O   1 
ATOM   2288  C  CB  . ALA A 1  301  ? 84.275  52.525  -34.364 1.00 28.78  ? 301  ALA A CB  1 
ATOM   2289  N  N   . THR A 1  302  ? 83.660  50.467  -32.230 1.00 31.38  ? 302  THR A N   1 
ATOM   2290  C  CA  . THR A 1  302  ? 83.510  50.124  -30.838 1.00 32.91  ? 302  THR A CA  1 
ATOM   2291  C  C   . THR A 1  302  ? 84.294  48.853  -30.496 1.00 33.33  ? 302  THR A C   1 
ATOM   2292  O  O   . THR A 1  302  ? 84.494  48.531  -29.327 1.00 33.88  ? 302  THR A O   1 
ATOM   2293  C  CB  . THR A 1  302  ? 82.029  49.934  -30.496 1.00 33.07  ? 302  THR A CB  1 
ATOM   2294  O  OG1 . THR A 1  302  ? 81.865  49.969  -29.072 1.00 34.78  ? 302  THR A OG1 1 
ATOM   2295  C  CG2 . THR A 1  302  ? 81.517  48.600  -31.065 1.00 35.10  ? 302  THR A CG2 1 
ATOM   2296  N  N   . TYR A 1  303  ? 84.750  48.142  -31.520 1.00 33.92  ? 303  TYR A N   1 
ATOM   2297  C  CA  . TYR A 1  303  ? 85.501  46.905  -31.317 1.00 35.32  ? 303  TYR A CA  1 
ATOM   2298  C  C   . TYR A 1  303  ? 86.914  47.170  -30.788 1.00 36.04  ? 303  TYR A C   1 
ATOM   2299  O  O   . TYR A 1  303  ? 87.376  46.508  -29.847 1.00 35.51  ? 303  TYR A O   1 
ATOM   2300  C  CB  . TYR A 1  303  ? 85.478  46.123  -32.648 1.00 34.32  ? 303  TYR A CB  1 
ATOM   2301  C  CG  . TYR A 1  303  ? 86.593  45.140  -32.983 1.00 29.17  ? 303  TYR A CG  1 
ATOM   2302  C  CD1 . TYR A 1  303  ? 87.160  44.294  -32.032 1.00 26.17  ? 303  TYR A CD1 1 
ATOM   2303  C  CD2 . TYR A 1  303  ? 87.018  45.015  -34.300 1.00 30.03  ? 303  TYR A CD2 1 
ATOM   2304  C  CE1 . TYR A 1  303  ? 88.121  43.349  -32.404 1.00 26.85  ? 303  TYR A CE1 1 
ATOM   2305  C  CE2 . TYR A 1  303  ? 87.959  44.088  -34.675 1.00 31.40  ? 303  TYR A CE2 1 
ATOM   2306  C  CZ  . TYR A 1  303  ? 88.512  43.261  -33.737 1.00 29.62  ? 303  TYR A CZ  1 
ATOM   2307  O  OH  . TYR A 1  303  ? 89.462  42.368  -34.177 1.00 30.43  ? 303  TYR A OH  1 
ATOM   2308  N  N   . MET A 1  304  ? 87.578  48.166  -31.370 1.00 36.97  ? 304  MET A N   1 
ATOM   2309  C  CA  . MET A 1  304  ? 88.929  48.528  -30.964 1.00 37.04  ? 304  MET A CA  1 
ATOM   2310  C  C   . MET A 1  304  ? 88.904  49.386  -29.722 1.00 37.84  ? 304  MET A C   1 
ATOM   2311  O  O   . MET A 1  304  ? 89.721  49.208  -28.825 1.00 37.58  ? 304  MET A O   1 
ATOM   2312  C  CB  . MET A 1  304  ? 89.630  49.253  -32.100 1.00 35.31  ? 304  MET A CB  1 
ATOM   2313  C  CG  . MET A 1  304  ? 89.578  48.440  -33.366 1.00 38.05  ? 304  MET A CG  1 
ATOM   2314  S  SD  . MET A 1  304  ? 90.833  48.852  -34.554 1.00 39.79  ? 304  MET A SD  1 
ATOM   2315  C  CE  . MET A 1  304  ? 89.832  49.313  -35.957 1.00 40.14  ? 304  MET A CE  1 
ATOM   2316  N  N   . ASP A 1  305  ? 87.953  50.311  -29.669 1.00 40.95  ? 305  ASP A N   1 
ATOM   2317  C  CA  . ASP A 1  305  ? 87.814  51.189  -28.519 1.00 45.88  ? 305  ASP A CA  1 
ATOM   2318  C  C   . ASP A 1  305  ? 86.368  51.206  -28.073 1.00 48.00  ? 305  ASP A C   1 
ATOM   2319  O  O   . ASP A 1  305  ? 85.457  51.107  -28.893 1.00 49.39  ? 305  ASP A O   1 
ATOM   2320  C  CB  . ASP A 1  305  ? 88.239  52.613  -28.865 1.00 49.83  ? 305  ASP A CB  1 
ATOM   2321  C  CG  . ASP A 1  305  ? 88.567  53.437  -27.628 1.00 54.80  ? 305  ASP A CG  1 
ATOM   2322  O  OD1 . ASP A 1  305  ? 87.952  53.183  -26.561 1.00 56.44  ? 305  ASP A OD1 1 
ATOM   2323  O  OD2 . ASP A 1  305  ? 89.436  54.338  -27.728 1.00 56.85  ? 305  ASP A OD2 1 
ATOM   2324  N  N   . ASN A 1  306  ? 86.157  51.337  -26.769 1.00 51.05  ? 306  ASN A N   1 
ATOM   2325  C  CA  . ASN A 1  306  ? 84.807  51.358  -26.246 1.00 55.24  ? 306  ASN A CA  1 
ATOM   2326  C  C   . ASN A 1  306  ? 84.620  52.423  -25.192 1.00 61.32  ? 306  ASN A C   1 
ATOM   2327  O  O   . ASN A 1  306  ? 83.531  52.577  -24.639 1.00 63.25  ? 306  ASN A O   1 
ATOM   2328  C  CB  . ASN A 1  306  ? 84.441  50.005  -25.659 1.00 50.47  ? 306  ASN A CB  1 
ATOM   2329  C  CG  . ASN A 1  306  ? 82.987  49.698  -25.838 1.00 49.46  ? 306  ASN A CG  1 
ATOM   2330  O  OD1 . ASN A 1  306  ? 82.273  50.451  -26.500 1.00 49.53  ? 306  ASN A OD1 1 
ATOM   2331  N  ND2 . ASN A 1  306  ? 82.532  48.590  -25.267 1.00 49.86  ? 306  ASN A ND2 1 
ATOM   2332  N  N   . ASP A 1  307  ? 85.690  53.157  -24.916 1.00 68.65  ? 307  ASP A N   1 
ATOM   2333  C  CA  . ASP A 1  307  ? 85.650  54.222  -23.926 1.00 76.03  ? 307  ASP A CA  1 
ATOM   2334  C  C   . ASP A 1  307  ? 85.772  55.574  -24.631 1.00 77.96  ? 307  ASP A C   1 
ATOM   2335  O  O   . ASP A 1  307  ? 86.780  56.269  -24.494 1.00 79.10  ? 307  ASP A O   1 
ATOM   2336  C  CB  . ASP A 1  307  ? 86.792  54.025  -22.926 1.00 81.42  ? 307  ASP A CB  1 
ATOM   2337  C  CG  . ASP A 1  307  ? 86.678  52.712  -22.159 1.00 85.80  ? 307  ASP A CG  1 
ATOM   2338  O  OD1 . ASP A 1  307  ? 85.807  52.618  -21.265 1.00 89.08  ? 307  ASP A OD1 1 
ATOM   2339  O  OD2 . ASP A 1  307  ? 87.453  51.774  -22.455 1.00 86.57  ? 307  ASP A OD2 1 
ATOM   2340  N  N   . ILE A 1  308  ? 84.735  55.936  -25.385 1.00 79.81  ? 308  ILE A N   1 
ATOM   2341  C  CA  . ILE A 1  308  ? 84.715  57.191  -26.138 1.00 81.99  ? 308  ILE A CA  1 
ATOM   2342  C  C   . ILE A 1  308  ? 83.857  58.269  -25.462 1.00 85.80  ? 308  ILE A C   1 
ATOM   2343  O  O   . ILE A 1  308  ? 83.315  58.054  -24.372 1.00 88.24  ? 308  ILE A O   1 
ATOM   2344  C  CB  . ILE A 1  308  ? 84.142  56.970  -27.554 1.00 78.40  ? 308  ILE A CB  1 
ATOM   2345  C  CG1 . ILE A 1  308  ? 84.326  55.518  -27.973 1.00 75.04  ? 308  ILE A CG1 1 
ATOM   2346  C  CG2 . ILE A 1  308  ? 84.840  57.881  -28.550 1.00 78.68  ? 308  ILE A CG2 1 
ATOM   2347  C  CD1 . ILE A 1  308  ? 83.653  55.197  -29.275 1.00 73.55  ? 308  ILE A CD1 1 
ATOM   2348  N  N   . ALA A 1  309  ? 83.748  59.428  -26.117 1.00 88.04  ? 309  ALA A N   1 
ATOM   2349  C  CA  . ALA A 1  309  ? 82.928  60.532  -25.623 1.00 90.82  ? 309  ALA A CA  1 
ATOM   2350  C  C   . ALA A 1  309  ? 81.500  60.351  -26.176 1.00 94.09  ? 309  ALA A C   1 
ATOM   2351  O  O   . ALA A 1  309  ? 80.523  60.786  -25.556 1.00 94.58  ? 309  ALA A O   1 
ATOM   2352  C  CB  . ALA A 1  309  ? 83.511  61.864  -26.075 1.00 88.45  ? 309  ALA A CB  1 
ATOM   2353  N  N   . GLY A 1  310  ? 81.398  59.698  -27.341 1.00 97.08  ? 310  GLY A N   1 
ATOM   2354  C  CA  . GLY A 1  310  ? 80.111  59.423  -27.976 1.00 95.78  ? 310  GLY A CA  1 
ATOM   2355  C  C   . GLY A 1  310  ? 79.397  58.322  -27.213 1.00 95.33  ? 310  GLY A C   1 
ATOM   2356  O  O   . GLY A 1  310  ? 79.189  57.216  -27.713 1.00 90.95  ? 310  GLY A O   1 
ATOM   2357  N  N   . GLN A 1  311  ? 79.049  58.677  -25.980 1.00 97.56  ? 311  GLN A N   1 
ATOM   2358  C  CA  . GLN A 1  311  ? 78.370  57.862  -24.974 1.00 102.59 ? 311  GLN A CA  1 
ATOM   2359  C  C   . GLN A 1  311  ? 78.029  56.385  -25.163 1.00 101.71 ? 311  GLN A C   1 
ATOM   2360  O  O   . GLN A 1  311  ? 78.528  55.544  -24.411 1.00 104.07 ? 311  GLN A O   1 
ATOM   2361  C  CB  . GLN A 1  311  ? 77.107  58.588  -24.507 1.00 107.87 ? 311  GLN A CB  1 
ATOM   2362  C  CG  . GLN A 1  311  ? 77.106  58.913  -23.014 1.00 114.65 ? 311  GLN A CG  1 
ATOM   2363  C  CD  . GLN A 1  311  ? 75.787  59.503  -22.539 1.00 117.77 ? 311  GLN A CD  1 
ATOM   2364  O  OE1 . GLN A 1  311  ? 75.320  60.519  -23.068 1.00 120.59 ? 311  GLN A OE1 1 
ATOM   2365  N  NE2 . GLN A 1  311  ? 75.179  58.869  -21.534 1.00 118.18 ? 311  GLN A NE2 1 
ATOM   2366  N  N   . PRO A 1  312  ? 77.155  56.044  -26.130 1.00 99.83  ? 312  PRO A N   1 
ATOM   2367  C  CA  . PRO A 1  312  ? 76.813  54.630  -26.315 1.00 97.77  ? 312  PRO A CA  1 
ATOM   2368  C  C   . PRO A 1  312  ? 77.959  53.680  -25.968 1.00 95.35  ? 312  PRO A C   1 
ATOM   2369  O  O   . PRO A 1  312  ? 78.935  53.570  -26.709 1.00 97.49  ? 312  PRO A O   1 
ATOM   2370  C  CB  . PRO A 1  312  ? 76.420  54.573  -27.785 1.00 98.55  ? 312  PRO A CB  1 
ATOM   2371  C  CG  . PRO A 1  312  ? 75.701  55.865  -27.959 1.00 99.07  ? 312  PRO A CG  1 
ATOM   2372  C  CD  . PRO A 1  312  ? 76.600  56.857  -27.230 1.00 99.49  ? 312  PRO A CD  1 
ATOM   2373  N  N   . GLN A 1  313  ? 77.843  53.004  -24.831 1.00 90.20  ? 313  GLN A N   1 
ATOM   2374  C  CA  . GLN A 1  313  ? 78.886  52.088  -24.406 1.00 87.26  ? 313  GLN A CA  1 
ATOM   2375  C  C   . GLN A 1  313  ? 78.884  50.770  -25.176 1.00 86.25  ? 313  GLN A C   1 
ATOM   2376  O  O   . GLN A 1  313  ? 79.707  49.895  -24.925 1.00 85.55  ? 313  GLN A O   1 
ATOM   2377  C  CB  . GLN A 1  313  ? 78.758  51.830  -22.908 1.00 87.70  ? 313  GLN A CB  1 
ATOM   2378  C  CG  . GLN A 1  313  ? 79.493  52.843  -22.041 1.00 87.24  ? 313  GLN A CG  1 
ATOM   2379  C  CD  . GLN A 1  313  ? 80.835  52.320  -21.541 1.00 87.58  ? 313  GLN A CD  1 
ATOM   2380  O  OE1 . GLN A 1  313  ? 80.893  51.380  -20.740 1.00 85.84  ? 313  GLN A OE1 1 
ATOM   2381  N  NE2 . GLN A 1  313  ? 81.920  52.926  -22.013 1.00 88.09  ? 313  GLN A NE2 1 
ATOM   2382  N  N   . ALA A 1  314  ? 77.967  50.629  -26.124 1.00 85.71  ? 314  ALA A N   1 
ATOM   2383  C  CA  . ALA A 1  314  ? 77.895  49.407  -26.913 1.00 86.84  ? 314  ALA A CA  1 
ATOM   2384  C  C   . ALA A 1  314  ? 77.794  48.206  -25.992 1.00 88.33  ? 314  ALA A C   1 
ATOM   2385  O  O   . ALA A 1  314  ? 78.469  47.203  -26.199 1.00 87.53  ? 314  ALA A O   1 
ATOM   2386  C  CB  . ALA A 1  314  ? 79.127  49.280  -27.784 1.00 85.08  ? 314  ALA A CB  1 
ATOM   2387  N  N   . LEU A 1  315  ? 76.951  48.316  -24.972 1.00 91.81  ? 315  LEU A N   1 
ATOM   2388  C  CA  . LEU A 1  315  ? 76.769  47.236  -24.014 1.00 96.44  ? 315  LEU A CA  1 
ATOM   2389  C  C   . LEU A 1  315  ? 76.411  45.908  -24.665 1.00 100.47 ? 315  LEU A C   1 
ATOM   2390  O  O   . LEU A 1  315  ? 75.891  45.865  -25.783 1.00 100.84 ? 315  LEU A O   1 
ATOM   2391  C  CB  . LEU A 1  315  ? 75.691  47.615  -23.001 1.00 95.94  ? 315  LEU A CB  1 
ATOM   2392  C  CG  . LEU A 1  315  ? 76.147  48.631  -21.958 1.00 98.03  ? 315  LEU A CG  1 
ATOM   2393  C  CD1 . LEU A 1  315  ? 74.964  49.182  -21.178 1.00 100.30 ? 315  LEU A CD1 1 
ATOM   2394  C  CD2 . LEU A 1  315  ? 77.133  47.951  -21.028 1.00 99.25  ? 315  LEU A CD2 1 
ATOM   2395  N  N   . GLN A 1  316  ? 76.711  44.825  -23.953 1.00 104.92 ? 316  GLN A N   1 
ATOM   2396  C  CA  . GLN A 1  316  ? 76.418  43.473  -24.417 1.00 109.35 ? 316  GLN A CA  1 
ATOM   2397  C  C   . GLN A 1  316  ? 75.428  42.879  -23.426 1.00 110.60 ? 316  GLN A C   1 
ATOM   2398  O  O   . GLN A 1  316  ? 75.736  42.773  -22.240 1.00 111.39 ? 316  GLN A O   1 
ATOM   2399  C  CB  . GLN A 1  316  ? 77.683  42.617  -24.428 1.00 111.25 ? 316  GLN A CB  1 
ATOM   2400  C  CG  . GLN A 1  316  ? 77.472  41.237  -25.024 1.00 116.43 ? 316  GLN A CG  1 
ATOM   2401  C  CD  . GLN A 1  316  ? 78.343  40.185  -24.370 1.00 118.50 ? 316  GLN A CD  1 
ATOM   2402  O  OE1 . GLN A 1  316  ? 79.555  40.362  -24.239 1.00 119.26 ? 316  GLN A OE1 1 
ATOM   2403  N  NE2 . GLN A 1  316  ? 77.728  39.078  -23.956 1.00 119.67 ? 316  GLN A NE2 1 
ATOM   2404  N  N   . LYS A 1  317  ? 74.251  42.496  -23.916 1.00 112.03 ? 317  LYS A N   1 
ATOM   2405  C  CA  . LYS A 1  317  ? 73.201  41.928  -23.074 1.00 112.41 ? 317  LYS A CA  1 
ATOM   2406  C  C   . LYS A 1  317  ? 73.700  41.477  -21.706 1.00 110.83 ? 317  LYS A C   1 
ATOM   2407  O  O   . LYS A 1  317  ? 74.647  40.696  -21.605 1.00 110.88 ? 317  LYS A O   1 
ATOM   2408  C  CB  . LYS A 1  317  ? 72.505  40.763  -23.793 1.00 115.71 ? 317  LYS A CB  1 
ATOM   2409  C  CG  . LYS A 1  317  ? 71.565  41.205  -24.917 1.00 119.88 ? 317  LYS A CG  1 
ATOM   2410  C  CD  . LYS A 1  317  ? 70.628  40.081  -25.372 1.00 122.75 ? 317  LYS A CD  1 
ATOM   2411  C  CE  . LYS A 1  317  ? 69.640  40.569  -26.439 1.00 123.75 ? 317  LYS A CE  1 
ATOM   2412  N  NZ  . LYS A 1  317  ? 68.695  39.503  -26.895 1.00 123.75 ? 317  LYS A NZ  1 
ATOM   2413  N  N   . SER A 1  318  ? 73.047  42.001  -20.670 1.00 108.67 ? 318  SER A N   1 
ATOM   2414  C  CA  . SER A 1  318  ? 73.339  41.735  -19.257 1.00 107.33 ? 318  SER A CA  1 
ATOM   2415  C  C   . SER A 1  318  ? 73.978  42.973  -18.641 1.00 107.65 ? 318  SER A C   1 
ATOM   2416  O  O   . SER A 1  318  ? 74.327  42.982  -17.462 1.00 108.54 ? 318  SER A O   1 
ATOM   2417  C  CB  . SER A 1  318  ? 74.281  40.536  -19.065 1.00 105.95 ? 318  SER A CB  1 
ATOM   2418  O  OG  . SER A 1  318  ? 75.644  40.915  -19.179 1.00 102.83 ? 318  SER A OG  1 
ATOM   2419  N  N   . GLY A 1  319  ? 74.127  44.020  -19.450 1.00 107.74 ? 319  GLY A N   1 
ATOM   2420  C  CA  . GLY A 1  319  ? 74.724  45.254  -18.968 1.00 106.48 ? 319  GLY A CA  1 
ATOM   2421  C  C   . GLY A 1  319  ? 76.242  45.245  -19.024 1.00 105.13 ? 319  GLY A C   1 
ATOM   2422  O  O   . GLY A 1  319  ? 76.891  46.238  -18.697 1.00 104.58 ? 319  GLY A O   1 
ATOM   2423  N  N   . ARG A 1  320  ? 76.814  44.120  -19.437 1.00 104.09 ? 320  ARG A N   1 
ATOM   2424  C  CA  . ARG A 1  320  ? 78.262  44.003  -19.530 1.00 102.14 ? 320  ARG A CA  1 
ATOM   2425  C  C   . ARG A 1  320  ? 78.801  44.964  -20.592 1.00 97.57  ? 320  ARG A C   1 
ATOM   2426  O  O   . ARG A 1  320  ? 78.467  44.855  -21.774 1.00 97.44  ? 320  ARG A O   1 
ATOM   2427  C  CB  . ARG A 1  320  ? 78.661  42.574  -19.893 1.00 106.70 ? 320  ARG A CB  1 
ATOM   2428  C  CG  . ARG A 1  320  ? 80.084  42.244  -19.505 1.00 111.82 ? 320  ARG A CG  1 
ATOM   2429  C  CD  . ARG A 1  320  ? 80.710  41.203  -20.417 1.00 114.60 ? 320  ARG A CD  1 
ATOM   2430  N  NE  . ARG A 1  320  ? 81.936  40.692  -19.816 1.00 118.42 ? 320  ARG A NE  1 
ATOM   2431  C  CZ  . ARG A 1  320  ? 81.969  39.985  -18.688 1.00 120.20 ? 320  ARG A CZ  1 
ATOM   2432  N  NH1 . ARG A 1  320  ? 80.841  39.698  -18.045 1.00 119.90 ? 320  ARG A NH1 1 
ATOM   2433  N  NH2 . ARG A 1  320  ? 83.132  39.585  -18.187 1.00 121.46 ? 320  ARG A NH2 1 
ATOM   2434  N  N   . PRO A 1  321  ? 79.654  45.913  -20.177 1.00 92.40  ? 321  PRO A N   1 
ATOM   2435  C  CA  . PRO A 1  321  ? 80.267  46.920  -21.049 1.00 86.36  ? 321  PRO A CA  1 
ATOM   2436  C  C   . PRO A 1  321  ? 80.752  46.426  -22.409 1.00 80.46  ? 321  PRO A C   1 
ATOM   2437  O  O   . PRO A 1  321  ? 80.212  46.819  -23.439 1.00 79.75  ? 321  PRO A O   1 
ATOM   2438  C  CB  . PRO A 1  321  ? 81.403  47.460  -20.190 1.00 88.90  ? 321  PRO A CB  1 
ATOM   2439  C  CG  . PRO A 1  321  ? 80.793  47.435  -18.823 1.00 91.93  ? 321  PRO A CG  1 
ATOM   2440  C  CD  . PRO A 1  321  ? 80.129  46.069  -18.789 1.00 92.26  ? 321  PRO A CD  1 
ATOM   2441  N  N   . VAL A 1  322  ? 81.771  45.570  -22.385 1.00 73.59  ? 322  VAL A N   1 
ATOM   2442  C  CA  . VAL A 1  322  ? 82.417  44.985  -23.566 1.00 66.39  ? 322  VAL A CA  1 
ATOM   2443  C  C   . VAL A 1  322  ? 83.899  45.273  -23.434 1.00 65.80  ? 322  VAL A C   1 
ATOM   2444  O  O   . VAL A 1  322  ? 84.285  46.295  -22.869 1.00 66.57  ? 322  VAL A O   1 
ATOM   2445  C  CB  . VAL A 1  322  ? 81.951  45.593  -24.889 1.00 61.16  ? 322  VAL A CB  1 
ATOM   2446  C  CG1 . VAL A 1  322  ? 82.979  45.323  -25.959 1.00 57.07  ? 322  VAL A CG1 1 
ATOM   2447  C  CG2 . VAL A 1  322  ? 80.632  44.995  -25.292 1.00 59.79  ? 322  VAL A CG2 1 
ATOM   2448  N  N   . LYS A 1  323  ? 84.734  44.390  -23.965 1.00 63.76  ? 323  LYS A N   1 
ATOM   2449  C  CA  . LYS A 1  323  ? 86.168  44.588  -23.841 1.00 63.01  ? 323  LYS A CA  1 
ATOM   2450  C  C   . LYS A 1  323  ? 86.861  44.964  -25.138 1.00 58.19  ? 323  LYS A C   1 
ATOM   2451  O  O   . LYS A 1  323  ? 87.293  44.102  -25.900 1.00 58.77  ? 323  LYS A O   1 
ATOM   2452  C  CB  . LYS A 1  323  ? 86.802  43.333  -23.225 1.00 69.05  ? 323  LYS A CB  1 
ATOM   2453  C  CG  . LYS A 1  323  ? 86.329  43.077  -21.787 1.00 75.04  ? 323  LYS A CG  1 
ATOM   2454  C  CD  . LYS A 1  323  ? 86.475  41.619  -21.346 1.00 78.86  ? 323  LYS A CD  1 
ATOM   2455  C  CE  . LYS A 1  323  ? 85.814  41.388  -19.977 1.00 80.25  ? 323  LYS A CE  1 
ATOM   2456  N  NZ  . LYS A 1  323  ? 85.812  39.955  -19.543 1.00 80.44  ? 323  LYS A NZ  1 
ATOM   2457  N  N   . SER A 1  324  ? 86.970  46.267  -25.375 1.00 51.37  ? 324  SER A N   1 
ATOM   2458  C  CA  . SER A 1  324  ? 87.618  46.785  -26.575 1.00 45.48  ? 324  SER A CA  1 
ATOM   2459  C  C   . SER A 1  324  ? 89.071  46.365  -26.589 1.00 40.84  ? 324  SER A C   1 
ATOM   2460  O  O   . SER A 1  324  ? 89.742  46.399  -25.558 1.00 41.74  ? 324  SER A O   1 
ATOM   2461  C  CB  . SER A 1  324  ? 87.563  48.306  -26.587 1.00 47.49  ? 324  SER A CB  1 
ATOM   2462  O  OG  . SER A 1  324  ? 88.274  48.825  -25.477 1.00 48.36  ? 324  SER A OG  1 
ATOM   2463  N  N   . ILE A 1  325  ? 89.562  45.976  -27.756 1.00 34.12  ? 325  ILE A N   1 
ATOM   2464  C  CA  . ILE A 1  325  ? 90.948  45.570  -27.854 1.00 27.28  ? 325  ILE A CA  1 
ATOM   2465  C  C   . ILE A 1  325  ? 91.799  46.501  -27.010 1.00 24.37  ? 325  ILE A C   1 
ATOM   2466  O  O   . ILE A 1  325  ? 92.567  46.058  -26.156 1.00 22.39  ? 325  ILE A O   1 
ATOM   2467  C  CB  . ILE A 1  325  ? 91.425  45.631  -29.286 1.00 25.91  ? 325  ILE A CB  1 
ATOM   2468  C  CG1 . ILE A 1  325  ? 90.604  44.643  -30.122 1.00 26.40  ? 325  ILE A CG1 1 
ATOM   2469  C  CG2 . ILE A 1  325  ? 92.919  45.374  -29.336 1.00 22.73  ? 325  ILE A CG2 1 
ATOM   2470  C  CD1 . ILE A 1  325  ? 91.023  44.541  -31.573 1.00 29.91  ? 325  ILE A CD1 1 
ATOM   2471  N  N   . ARG A 1  326  ? 91.633  47.799  -27.242 1.00 23.54  ? 326  ARG A N   1 
ATOM   2472  C  CA  . ARG A 1  326  ? 92.380  48.809  -26.498 1.00 25.03  ? 326  ARG A CA  1 
ATOM   2473  C  C   . ARG A 1  326  ? 92.281  48.515  -25.013 1.00 26.52  ? 326  ARG A C   1 
ATOM   2474  O  O   . ARG A 1  326  ? 93.282  48.465  -24.305 1.00 29.16  ? 326  ARG A O   1 
ATOM   2475  C  CB  . ARG A 1  326  ? 91.832  50.221  -26.780 1.00 23.91  ? 326  ARG A CB  1 
ATOM   2476  C  CG  . ARG A 1  326  ? 91.403  51.017  -25.524 1.00 24.36  ? 326  ARG A CG  1 
ATOM   2477  C  CD  . ARG A 1  326  ? 90.762  52.372  -25.871 1.00 26.10  ? 326  ARG A CD  1 
ATOM   2478  N  NE  . ARG A 1  326  ? 91.749  53.429  -26.079 1.00 26.28  ? 326  ARG A NE  1 
ATOM   2479  C  CZ  . ARG A 1  326  ? 92.129  54.283  -25.134 1.00 26.43  ? 326  ARG A CZ  1 
ATOM   2480  N  NH1 . ARG A 1  326  ? 91.585  54.205  -23.915 1.00 21.71  ? 326  ARG A NH1 1 
ATOM   2481  N  NH2 . ARG A 1  326  ? 93.075  55.187  -25.401 1.00 25.41  ? 326  ARG A NH2 1 
ATOM   2482  N  N   . ALA A 1  327  ? 91.061  48.310  -24.549 1.00 27.90  ? 327  ALA A N   1 
ATOM   2483  C  CA  . ALA A 1  327  ? 90.840  48.044  -23.144 1.00 28.78  ? 327  ALA A CA  1 
ATOM   2484  C  C   . ALA A 1  327  ? 91.843  47.047  -22.560 1.00 27.50  ? 327  ALA A C   1 
ATOM   2485  O  O   . ALA A 1  327  ? 92.103  47.058  -21.350 1.00 27.83  ? 327  ALA A O   1 
ATOM   2486  C  CB  . ALA A 1  327  ? 89.416  47.551  -22.937 1.00 31.91  ? 327  ALA A CB  1 
ATOM   2487  N  N   . ARG A 1  328  ? 92.418  46.206  -23.419 1.00 25.37  ? 328  ARG A N   1 
ATOM   2488  C  CA  . ARG A 1  328  ? 93.374  45.197  -22.971 1.00 27.71  ? 328  ARG A CA  1 
ATOM   2489  C  C   . ARG A 1  328  ? 94.787  45.664  -22.661 1.00 28.88  ? 328  ARG A C   1 
ATOM   2490  O  O   . ARG A 1  328  ? 95.441  45.128  -21.751 1.00 29.88  ? 328  ARG A O   1 
ATOM   2491  C  CB  . ARG A 1  328  ? 93.473  44.078  -23.994 1.00 29.49  ? 328  ARG A CB  1 
ATOM   2492  C  CG  . ARG A 1  328  ? 92.475  42.971  -23.800 1.00 33.60  ? 328  ARG A CG  1 
ATOM   2493  C  CD  . ARG A 1  328  ? 92.754  41.848  -24.766 1.00 34.55  ? 328  ARG A CD  1 
ATOM   2494  N  NE  . ARG A 1  328  ? 91.620  40.945  -24.848 1.00 39.79  ? 328  ARG A NE  1 
ATOM   2495  C  CZ  . ARG A 1  328  ? 91.429  40.104  -25.852 1.00 41.09  ? 328  ARG A CZ  1 
ATOM   2496  N  NH1 . ARG A 1  328  ? 92.308  40.070  -26.848 1.00 40.72  ? 328  ARG A NH1 1 
ATOM   2497  N  NH2 . ARG A 1  328  ? 90.365  39.307  -25.858 1.00 43.42  ? 328  ARG A NH2 1 
ATOM   2498  N  N   . LEU A 1  329  ? 95.256  46.642  -23.433 1.00 29.02  ? 329  LEU A N   1 
ATOM   2499  C  CA  . LEU A 1  329  ? 96.599  47.190  -23.288 1.00 28.87  ? 329  LEU A CA  1 
ATOM   2500  C  C   . LEU A 1  329  ? 96.679  48.286  -22.225 1.00 32.31  ? 329  LEU A C   1 
ATOM   2501  O  O   . LEU A 1  329  ? 97.707  48.439  -21.556 1.00 32.11  ? 329  LEU A O   1 
ATOM   2502  C  CB  . LEU A 1  329  ? 97.048  47.743  -24.633 1.00 23.40  ? 329  LEU A CB  1 
ATOM   2503  C  CG  . LEU A 1  329  ? 96.416  46.997  -25.808 1.00 21.13  ? 329  LEU A CG  1 
ATOM   2504  C  CD1 . LEU A 1  329  ? 96.963  47.520  -27.124 1.00 18.93  ? 329  LEU A CD1 1 
ATOM   2505  C  CD2 . LEU A 1  329  ? 96.695  45.529  -25.676 1.00 19.03  ? 329  LEU A CD2 1 
ATOM   2506  N  N   . LYS A 1  330  ? 95.585  49.032  -22.068 1.00 35.80  ? 330  LYS A N   1 
ATOM   2507  C  CA  . LYS A 1  330  ? 95.508  50.125  -21.106 1.00 40.14  ? 330  LYS A CA  1 
ATOM   2508  C  C   . LYS A 1  330  ? 96.169  49.769  -19.768 1.00 42.84  ? 330  LYS A C   1 
ATOM   2509  O  O   . LYS A 1  330  ? 95.738  48.865  -19.060 1.00 42.01  ? 330  LYS A O   1 
ATOM   2510  C  CB  . LYS A 1  330  ? 94.041  50.544  -20.914 1.00 42.00  ? 330  LYS A CB  1 
ATOM   2511  C  CG  . LYS A 1  330  ? 93.851  52.021  -20.524 1.00 47.93  ? 330  LYS A CG  1 
ATOM   2512  C  CD  . LYS A 1  330  ? 92.436  52.571  -20.849 1.00 54.23  ? 330  LYS A CD  1 
ATOM   2513  C  CE  . LYS A 1  330  ? 92.259  54.048  -20.386 1.00 60.30  ? 330  LYS A CE  1 
ATOM   2514  N  NZ  . LYS A 1  330  ? 90.955  54.734  -20.750 1.00 60.04  ? 330  LYS A NZ  1 
ATOM   2515  N  N   . GLY A 1  331  ? 97.232  50.509  -19.456 1.00 46.72  ? 331  GLY A N   1 
ATOM   2516  C  CA  . GLY A 1  331  ? 98.034  50.339  -18.247 1.00 48.95  ? 331  GLY A CA  1 
ATOM   2517  C  C   . GLY A 1  331  ? 97.499  49.792  -16.931 1.00 48.87  ? 331  GLY A C   1 
ATOM   2518  O  O   . GLY A 1  331  ? 96.352  50.029  -16.548 1.00 46.10  ? 331  GLY A O   1 
ATOM   2519  N  N   . LYS A 1  332  ? 98.391  49.092  -16.224 1.00 51.02  ? 332  LYS A N   1 
ATOM   2520  C  CA  . LYS A 1  332  ? 98.116  48.451  -14.936 1.00 51.34  ? 332  LYS A CA  1 
ATOM   2521  C  C   . LYS A 1  332  ? 97.041  47.407  -15.163 1.00 53.37  ? 332  LYS A C   1 
ATOM   2522  O  O   . LYS A 1  332  ? 95.990  47.724  -15.711 1.00 56.49  ? 332  LYS A O   1 
ATOM   2523  C  CB  . LYS A 1  332  ? 97.625  49.471  -13.907 1.00 48.66  ? 332  LYS A CB  1 
ATOM   2524  C  CG  . LYS A 1  332  ? 97.381  48.904  -12.509 1.00 47.97  ? 332  LYS A CG  1 
ATOM   2525  C  CD  . LYS A 1  332  ? 98.645  48.911  -11.644 1.00 46.37  ? 332  LYS A CD  1 
ATOM   2526  C  CE  . LYS A 1  332  ? 98.304  48.734  -10.147 1.00 44.43  ? 332  LYS A CE  1 
ATOM   2527  N  NZ  . LYS A 1  332  ? 99.457  48.958  -9.208  1.00 35.73  ? 332  LYS A NZ  1 
ATOM   2528  N  N   . GLU A 1  333  ? 97.291  46.163  -14.769 1.00 54.91  ? 333  GLU A N   1 
ATOM   2529  C  CA  . GLU A 1  333  ? 96.281  45.120  -14.951 1.00 59.64  ? 333  GLU A CA  1 
ATOM   2530  C  C   . GLU A 1  333  ? 96.056  44.770  -16.438 1.00 57.66  ? 333  GLU A C   1 
ATOM   2531  O  O   . GLU A 1  333  ? 95.155  43.991  -16.768 1.00 62.06  ? 333  GLU A O   1 
ATOM   2532  C  CB  . GLU A 1  333  ? 94.938  45.577  -14.344 1.00 64.53  ? 333  GLU A CB  1 
ATOM   2533  C  CG  . GLU A 1  333  ? 95.021  46.241  -12.963 1.00 71.37  ? 333  GLU A CG  1 
ATOM   2534  C  CD  . GLU A 1  333  ? 95.061  45.244  -11.812 1.00 74.71  ? 333  GLU A CD  1 
ATOM   2535  O  OE1 . GLU A 1  333  ? 94.055  44.524  -11.614 1.00 77.88  ? 333  GLU A OE1 1 
ATOM   2536  O  OE2 . GLU A 1  333  ? 96.095  45.184  -11.105 1.00 74.38  ? 333  GLU A OE2 1 
ATOM   2537  N  N   . GLY A 1  334  ? 96.859  45.336  -17.333 1.00 52.32  ? 334  GLY A N   1 
ATOM   2538  C  CA  . GLY A 1  334  ? 96.666  45.050  -18.742 1.00 42.21  ? 334  GLY A CA  1 
ATOM   2539  C  C   . GLY A 1  334  ? 97.937  44.794  -19.516 1.00 37.39  ? 334  GLY A C   1 
ATOM   2540  O  O   . GLY A 1  334  ? 99.022  45.220  -19.132 1.00 39.99  ? 334  GLY A O   1 
ATOM   2541  N  N   . ARG A 1  335  ? 97.774  44.108  -20.636 1.00 30.01  ? 335  ARG A N   1 
ATOM   2542  C  CA  . ARG A 1  335  ? 98.864  43.732  -21.529 1.00 22.86  ? 335  ARG A CA  1 
ATOM   2543  C  C   . ARG A 1  335  ? 100.220 44.407  -21.332 1.00 20.04  ? 335  ARG A C   1 
ATOM   2544  O  O   . ARG A 1  335  ? 101.151 43.768  -20.847 1.00 21.66  ? 335  ARG A O   1 
ATOM   2545  C  CB  . ARG A 1  335  ? 98.412  43.906  -22.982 1.00 19.55  ? 335  ARG A CB  1 
ATOM   2546  C  CG  . ARG A 1  335  ? 99.027  42.926  -24.001 1.00 16.77  ? 335  ARG A CG  1 
ATOM   2547  C  CD  . ARG A 1  335  ? 98.803  41.451  -23.642 1.00 10.44  ? 335  ARG A CD  1 
ATOM   2548  N  NE  . ARG A 1  335  ? 97.694  41.241  -22.713 1.00 13.74  ? 335  ARG A NE  1 
ATOM   2549  C  CZ  . ARG A 1  335  ? 96.444  40.965  -23.067 1.00 13.03  ? 335  ARG A CZ  1 
ATOM   2550  N  NH1 . ARG A 1  335  ? 96.125  40.853  -24.344 1.00 13.88  ? 335  ARG A NH1 1 
ATOM   2551  N  NH2 . ARG A 1  335  ? 95.504  40.817  -22.138 1.00 14.14  ? 335  ARG A NH2 1 
ATOM   2552  N  N   . ILE A 1  336  ? 100.352 45.686  -21.689 1.00 15.42  ? 336  ILE A N   1 
ATOM   2553  C  CA  . ILE A 1  336  ? 101.659 46.325  -21.566 1.00 10.25  ? 336  ILE A CA  1 
ATOM   2554  C  C   . ILE A 1  336  ? 102.196 46.396  -20.171 1.00 11.65  ? 336  ILE A C   1 
ATOM   2555  O  O   . ILE A 1  336  ? 103.252 45.838  -19.889 1.00 8.31   ? 336  ILE A O   1 
ATOM   2556  C  CB  . ILE A 1  336  ? 101.714 47.739  -22.159 1.00 7.08   ? 336  ILE A CB  1 
ATOM   2557  C  CG1 . ILE A 1  336  ? 101.318 47.701  -23.627 1.00 3.38   ? 336  ILE A CG1 1 
ATOM   2558  C  CG2 . ILE A 1  336  ? 103.153 48.244  -22.140 1.00 1.07   ? 336  ILE A CG2 1 
ATOM   2559  C  CD1 . ILE A 1  336  ? 102.191 46.801  -24.454 1.00 1.00   ? 336  ILE A CD1 1 
ATOM   2560  N  N   . ARG A 1  337  ? 101.491 47.056  -19.276 1.00 11.82  ? 337  ARG A N   1 
ATOM   2561  C  CA  . ARG A 1  337  ? 102.046 47.135  -17.942 1.00 15.98  ? 337  ARG A CA  1 
ATOM   2562  C  C   . ARG A 1  337  ? 101.774 45.919  -17.048 1.00 15.43  ? 337  ARG A C   1 
ATOM   2563  O  O   . ARG A 1  337  ? 102.508 45.671  -16.092 1.00 13.02  ? 337  ARG A O   1 
ATOM   2564  C  CB  . ARG A 1  337  ? 101.561 48.403  -17.238 1.00 18.78  ? 337  ARG A CB  1 
ATOM   2565  C  CG  . ARG A 1  337  ? 102.426 48.759  -16.032 1.00 27.85  ? 337  ARG A CG  1 
ATOM   2566  C  CD  . ARG A 1  337  ? 101.683 49.553  -14.981 1.00 33.18  ? 337  ARG A CD  1 
ATOM   2567  N  NE  . ARG A 1  337  ? 101.092 50.756  -15.541 1.00 42.92  ? 337  ARG A NE  1 
ATOM   2568  C  CZ  . ARG A 1  337  ? 100.462 51.674  -14.819 1.00 49.79  ? 337  ARG A CZ  1 
ATOM   2569  N  NH1 . ARG A 1  337  ? 100.347 51.519  -13.502 1.00 53.07  ? 337  ARG A NH1 1 
ATOM   2570  N  NH2 . ARG A 1  337  ? 99.952  52.751  -15.412 1.00 54.53  ? 337  ARG A NH2 1 
ATOM   2571  N  N   . GLY A 1  338  ? 100.736 45.152  -17.364 1.00 17.80  ? 338  GLY A N   1 
ATOM   2572  C  CA  . GLY A 1  338  ? 100.386 44.016  -16.526 1.00 18.67  ? 338  GLY A CA  1 
ATOM   2573  C  C   . GLY A 1  338  ? 100.917 42.627  -16.846 1.00 21.35  ? 338  GLY A C   1 
ATOM   2574  O  O   . GLY A 1  338  ? 100.960 41.762  -15.964 1.00 25.57  ? 338  GLY A O   1 
ATOM   2575  N  N   . ASN A 1  339  ? 101.309 42.389  -18.091 1.00 22.07  ? 339  ASN A N   1 
ATOM   2576  C  CA  . ASN A 1  339  ? 101.826 41.076  -18.463 1.00 22.62  ? 339  ASN A CA  1 
ATOM   2577  C  C   . ASN A 1  339  ? 103.309 41.124  -18.827 1.00 22.59  ? 339  ASN A C   1 
ATOM   2578  O  O   . ASN A 1  339  ? 104.039 40.170  -18.586 1.00 22.61  ? 339  ASN A O   1 
ATOM   2579  C  CB  . ASN A 1  339  ? 101.033 40.496  -19.646 1.00 23.64  ? 339  ASN A CB  1 
ATOM   2580  C  CG  . ASN A 1  339  ? 99.533  40.455  -19.388 1.00 24.20  ? 339  ASN A CG  1 
ATOM   2581  O  OD1 . ASN A 1  339  ? 99.090  40.151  -18.284 1.00 25.83  ? 339  ASN A OD1 1 
ATOM   2582  N  ND2 . ASN A 1  339  ? 98.745  40.745  -20.417 1.00 26.13  ? 339  ASN A ND2 1 
ATOM   2583  N  N   . LEU A 1  340  ? 103.748 42.245  -19.390 1.00 23.17  ? 340  LEU A N   1 
ATOM   2584  C  CA  . LEU A 1  340  ? 105.126 42.402  -19.822 1.00 23.00  ? 340  LEU A CA  1 
ATOM   2585  C  C   . LEU A 1  340  ? 106.080 43.027  -18.822 1.00 23.08  ? 340  LEU A C   1 
ATOM   2586  O  O   . LEU A 1  340  ? 107.124 42.455  -18.527 1.00 24.32  ? 340  LEU A O   1 
ATOM   2587  C  CB  . LEU A 1  340  ? 105.162 43.212  -21.114 1.00 25.06  ? 340  LEU A CB  1 
ATOM   2588  C  CG  . LEU A 1  340  ? 104.549 42.503  -22.314 1.00 26.63  ? 340  LEU A CG  1 
ATOM   2589  C  CD1 . LEU A 1  340  ? 104.314 43.461  -23.463 1.00 27.37  ? 340  LEU A CD1 1 
ATOM   2590  C  CD2 . LEU A 1  340  ? 105.484 41.402  -22.724 1.00 28.90  ? 340  LEU A CD2 1 
ATOM   2591  N  N   . MET A 1  341  ? 105.742 44.201  -18.305 1.00 21.34  ? 341  MET A N   1 
ATOM   2592  C  CA  . MET A 1  341  ? 106.640 44.868  -17.366 1.00 21.04  ? 341  MET A CA  1 
ATOM   2593  C  C   . MET A 1  341  ? 106.671 44.152  -16.015 1.00 19.44  ? 341  MET A C   1 
ATOM   2594  O  O   . MET A 1  341  ? 107.578 44.362  -15.204 1.00 20.58  ? 341  MET A O   1 
ATOM   2595  C  CB  . MET A 1  341  ? 106.227 46.336  -17.188 1.00 22.18  ? 341  MET A CB  1 
ATOM   2596  C  CG  . MET A 1  341  ? 106.082 47.134  -18.496 1.00 28.70  ? 341  MET A CG  1 
ATOM   2597  S  SD  . MET A 1  341  ? 107.568 47.287  -19.557 1.00 30.49  ? 341  MET A SD  1 
ATOM   2598  C  CE  . MET A 1  341  ? 108.691 48.146  -18.437 1.00 30.82  ? 341  MET A CE  1 
ATOM   2599  N  N   . GLY A 1  342  ? 105.674 43.297  -15.795 1.00 17.10  ? 342  GLY A N   1 
ATOM   2600  C  CA  . GLY A 1  342  ? 105.561 42.537  -14.560 1.00 10.95  ? 342  GLY A CA  1 
ATOM   2601  C  C   . GLY A 1  342  ? 104.760 41.290  -14.877 1.00 8.52   ? 342  GLY A C   1 
ATOM   2602  O  O   . GLY A 1  342  ? 103.624 41.367  -15.337 1.00 9.99   ? 342  GLY A O   1 
ATOM   2603  N  N   . LYS A 1  343  ? 105.371 40.135  -14.660 1.00 9.32   ? 343  LYS A N   1 
ATOM   2604  C  CA  . LYS A 1  343  ? 104.733 38.849  -14.924 1.00 10.15  ? 343  LYS A CA  1 
ATOM   2605  C  C   . LYS A 1  343  ? 104.588 38.128  -13.611 1.00 13.74  ? 343  LYS A C   1 
ATOM   2606  O  O   . LYS A 1  343  ? 105.199 38.505  -12.605 1.00 17.45  ? 343  LYS A O   1 
ATOM   2607  C  CB  . LYS A 1  343  ? 105.635 37.980  -15.799 1.00 5.76   ? 343  LYS A CB  1 
ATOM   2608  C  CG  . LYS A 1  343  ? 105.725 38.395  -17.216 1.00 3.75   ? 343  LYS A CG  1 
ATOM   2609  C  CD  . LYS A 1  343  ? 106.989 37.895  -17.839 1.00 2.31   ? 343  LYS A CD  1 
ATOM   2610  C  CE  . LYS A 1  343  ? 106.943 38.147  -19.322 1.00 5.26   ? 343  LYS A CE  1 
ATOM   2611  N  NZ  . LYS A 1  343  ? 108.293 38.341  -19.883 1.00 9.74   ? 343  LYS A NZ  1 
ATOM   2612  N  N   . ARG A 1  344  ? 103.752 37.109  -13.585 1.00 15.11  ? 344  ARG A N   1 
ATOM   2613  C  CA  . ARG A 1  344  ? 103.734 36.328  -12.372 1.00 21.19  ? 344  ARG A CA  1 
ATOM   2614  C  C   . ARG A 1  344  ? 104.887 35.373  -12.779 1.00 19.15  ? 344  ARG A C   1 
ATOM   2615  O  O   . ARG A 1  344  ? 105.225 35.277  -13.968 1.00 16.50  ? 344  ARG A O   1 
ATOM   2616  C  CB  . ARG A 1  344  ? 102.408 35.595  -12.216 1.00 28.30  ? 344  ARG A CB  1 
ATOM   2617  C  CG  . ARG A 1  344  ? 101.227 36.503  -12.027 1.00 37.94  ? 344  ARG A CG  1 
ATOM   2618  C  CD  . ARG A 1  344  ? 99.942  35.716  -12.176 1.00 47.08  ? 344  ARG A CD  1 
ATOM   2619  N  NE  . ARG A 1  344  ? 98.760  36.568  -12.100 1.00 56.52  ? 344  ARG A NE  1 
ATOM   2620  C  CZ  . ARG A 1  344  ? 98.339  37.174  -10.991 1.00 58.50  ? 344  ARG A CZ  1 
ATOM   2621  N  NH1 . ARG A 1  344  ? 99.004  37.019  -9.839  1.00 55.82  ? 344  ARG A NH1 1 
ATOM   2622  N  NH2 . ARG A 1  344  ? 97.257  37.950  -11.047 1.00 58.21  ? 344  ARG A NH2 1 
ATOM   2623  N  N   . VAL A 1  345  ? 105.515 34.681  -11.843 1.00 16.04  ? 345  VAL A N   1 
ATOM   2624  C  CA  . VAL A 1  345  ? 106.605 33.823  -12.263 1.00 13.93  ? 345  VAL A CA  1 
ATOM   2625  C  C   . VAL A 1  345  ? 106.672 32.492  -11.558 1.00 15.35  ? 345  VAL A C   1 
ATOM   2626  O  O   . VAL A 1  345  ? 106.134 32.332  -10.460 1.00 17.67  ? 345  VAL A O   1 
ATOM   2627  C  CB  . VAL A 1  345  ? 107.936 34.525  -12.062 1.00 11.29  ? 345  VAL A CB  1 
ATOM   2628  C  CG1 . VAL A 1  345  ? 107.998 35.729  -12.945 1.00 15.80  ? 345  VAL A CG1 1 
ATOM   2629  C  CG2 . VAL A 1  345  ? 108.097 34.925  -10.609 1.00 12.37  ? 345  VAL A CG2 1 
ATOM   2630  N  N   . ASP A 1  346  ? 107.346 31.540  -12.202 1.00 17.67  ? 346  ASP A N   1 
ATOM   2631  C  CA  . ASP A 1  346  ? 107.525 30.206  -11.647 1.00 19.51  ? 346  ASP A CA  1 
ATOM   2632  C  C   . ASP A 1  346  ? 108.768 30.269  -10.785 1.00 18.94  ? 346  ASP A C   1 
ATOM   2633  O  O   . ASP A 1  346  ? 109.577 31.170  -10.938 1.00 18.68  ? 346  ASP A O   1 
ATOM   2634  C  CB  . ASP A 1  346  ? 107.741 29.182  -12.759 1.00 24.87  ? 346  ASP A CB  1 
ATOM   2635  C  CG  . ASP A 1  346  ? 106.607 29.161  -13.777 1.00 30.73  ? 346  ASP A CG  1 
ATOM   2636  O  OD1 . ASP A 1  346  ? 105.423 29.166  -13.369 1.00 32.47  ? 346  ASP A OD1 1 
ATOM   2637  O  OD2 . ASP A 1  346  ? 106.907 29.120  -14.993 1.00 34.89  ? 346  ASP A OD2 1 
ATOM   2638  N  N   . PHE A 1  347  ? 108.923 29.308  -9.887  1.00 19.48  ? 347  PHE A N   1 
ATOM   2639  C  CA  . PHE A 1  347  ? 110.087 29.255  -8.999  1.00 21.80  ? 347  PHE A CA  1 
ATOM   2640  C  C   . PHE A 1  347  ? 110.121 30.444  -8.064  1.00 21.34  ? 347  PHE A C   1 
ATOM   2641  O  O   . PHE A 1  347  ? 111.140 31.118  -7.914  1.00 20.86  ? 347  PHE A O   1 
ATOM   2642  C  CB  . PHE A 1  347  ? 111.388 29.184  -9.806  1.00 21.23  ? 347  PHE A CB  1 
ATOM   2643  C  CG  . PHE A 1  347  ? 111.393 28.097  -10.835 1.00 23.84  ? 347  PHE A CG  1 
ATOM   2644  C  CD1 . PHE A 1  347  ? 110.739 28.277  -12.053 1.00 27.89  ? 347  PHE A CD1 1 
ATOM   2645  C  CD2 . PHE A 1  347  ? 112.023 26.887  -10.583 1.00 23.83  ? 347  PHE A CD2 1 
ATOM   2646  C  CE1 . PHE A 1  347  ? 110.715 27.270  -13.019 1.00 32.60  ? 347  PHE A CE1 1 
ATOM   2647  C  CE2 . PHE A 1  347  ? 112.008 25.872  -11.532 1.00 28.42  ? 347  PHE A CE2 1 
ATOM   2648  C  CZ  . PHE A 1  347  ? 111.349 26.065  -12.760 1.00 32.69  ? 347  PHE A CZ  1 
ATOM   2649  N  N   . SER A 1  348  ? 108.986 30.662  -7.421  1.00 20.53  ? 348  SER A N   1 
ATOM   2650  C  CA  . SER A 1  348  ? 108.800 31.757  -6.495  1.00 19.99  ? 348  SER A CA  1 
ATOM   2651  C  C   . SER A 1  348  ? 108.141 31.241  -5.218  1.00 18.08  ? 348  SER A C   1 
ATOM   2652  O  O   . SER A 1  348  ? 107.390 30.276  -5.261  1.00 18.43  ? 348  SER A O   1 
ATOM   2653  C  CB  . SER A 1  348  ? 107.923 32.802  -7.175  1.00 19.18  ? 348  SER A CB  1 
ATOM   2654  O  OG  . SER A 1  348  ? 107.021 32.180  -8.072  1.00 19.94  ? 348  SER A OG  1 
ATOM   2655  N  N   . ALA A 1  349  ? 108.408 31.877  -4.085  1.00 15.01  ? 349  ALA A N   1 
ATOM   2656  C  CA  . ALA A 1  349  ? 107.825 31.415  -2.833  1.00 10.97  ? 349  ALA A CA  1 
ATOM   2657  C  C   . ALA A 1  349  ? 107.501 32.570  -1.920  1.00 10.47  ? 349  ALA A C   1 
ATOM   2658  O  O   . ALA A 1  349  ? 107.981 33.671  -2.144  1.00 6.36   ? 349  ALA A O   1 
ATOM   2659  C  CB  . ALA A 1  349  ? 108.774 30.483  -2.149  1.00 13.38  ? 349  ALA A CB  1 
ATOM   2660  N  N   . ARG A 1  350  ? 106.734 32.321  -0.861  1.00 10.95  ? 350  ARG A N   1 
ATOM   2661  C  CA  . ARG A 1  350  ? 106.329 33.407  0.025   1.00 10.99  ? 350  ARG A CA  1 
ATOM   2662  C  C   . ARG A 1  350  ? 105.706 32.943  1.324   1.00 10.62  ? 350  ARG A C   1 
ATOM   2663  O  O   . ARG A 1  350  ? 104.784 32.153  1.302   1.00 13.13  ? 350  ARG A O   1 
ATOM   2664  C  CB  . ARG A 1  350  ? 105.316 34.261  -0.732  1.00 15.28  ? 350  ARG A CB  1 
ATOM   2665  C  CG  . ARG A 1  350  ? 104.477 35.202  0.108   1.00 18.90  ? 350  ARG A CG  1 
ATOM   2666  C  CD  . ARG A 1  350  ? 103.333 35.794  -0.734  1.00 26.19  ? 350  ARG A CD  1 
ATOM   2667  N  NE  . ARG A 1  350  ? 102.799 37.011  -0.125  1.00 31.23  ? 350  ARG A NE  1 
ATOM   2668  C  CZ  . ARG A 1  350  ? 103.485 38.146  -0.010  1.00 31.01  ? 350  ARG A CZ  1 
ATOM   2669  N  NH1 . ARG A 1  350  ? 104.726 38.219  -0.473  1.00 30.81  ? 350  ARG A NH1 1 
ATOM   2670  N  NH2 . ARG A 1  350  ? 102.946 39.200  0.593   1.00 33.41  ? 350  ARG A NH2 1 
ATOM   2671  N  N   . THR A 1  351  ? 106.185 33.425  2.459   1.00 11.76  ? 351  THR A N   1 
ATOM   2672  C  CA  . THR A 1  351  ? 105.588 33.023  3.736   1.00 14.96  ? 351  THR A CA  1 
ATOM   2673  C  C   . THR A 1  351  ? 105.854 34.054  4.805   1.00 18.77  ? 351  THR A C   1 
ATOM   2674  O  O   . THR A 1  351  ? 106.396 35.117  4.525   1.00 23.44  ? 351  THR A O   1 
ATOM   2675  C  CB  . THR A 1  351  ? 106.165 31.728  4.280   1.00 12.89  ? 351  THR A CB  1 
ATOM   2676  O  OG1 . THR A 1  351  ? 107.469 31.982  4.813   1.00 15.15  ? 351  THR A OG1 1 
ATOM   2677  C  CG2 . THR A 1  351  ? 106.263 30.686  3.191   1.00 15.25  ? 351  THR A CG2 1 
ATOM   2678  N  N   . VAL A 1  352  ? 105.479 33.743  6.039   1.00 18.48  ? 352  VAL A N   1 
ATOM   2679  C  CA  . VAL A 1  352  ? 105.726 34.667  7.130   1.00 18.07  ? 352  VAL A CA  1 
ATOM   2680  C  C   . VAL A 1  352  ? 107.197 34.566  7.493   1.00 16.97  ? 352  VAL A C   1 
ATOM   2681  O  O   . VAL A 1  352  ? 107.807 33.519  7.319   1.00 19.24  ? 352  VAL A O   1 
ATOM   2682  C  CB  . VAL A 1  352  ? 104.884 34.323  8.332   1.00 20.15  ? 352  VAL A CB  1 
ATOM   2683  C  CG1 . VAL A 1  352  ? 105.315 35.172  9.518   1.00 22.48  ? 352  VAL A CG1 1 
ATOM   2684  C  CG2 . VAL A 1  352  ? 103.418 34.537  7.992   1.00 22.52  ? 352  VAL A CG2 1 
ATOM   2685  N  N   . ILE A 1  353  ? 107.771 35.641  8.011   1.00 13.81  ? 353  ILE A N   1 
ATOM   2686  C  CA  . ILE A 1  353  ? 109.189 35.631  8.331   1.00 14.03  ? 353  ILE A CA  1 
ATOM   2687  C  C   . ILE A 1  353  ? 109.409 35.860  9.798   1.00 16.64  ? 353  ILE A C   1 
ATOM   2688  O  O   . ILE A 1  353  ? 108.511 36.348  10.479  1.00 18.64  ? 353  ILE A O   1 
ATOM   2689  C  CB  . ILE A 1  353  ? 109.911 36.744  7.570   1.00 12.09  ? 353  ILE A CB  1 
ATOM   2690  C  CG1 . ILE A 1  353  ? 109.782 38.069  8.328   1.00 10.22  ? 353  ILE A CG1 1 
ATOM   2691  C  CG2 . ILE A 1  353  ? 109.270 36.922  6.192   1.00 12.86  ? 353  ILE A CG2 1 
ATOM   2692  C  CD1 . ILE A 1  353  ? 110.453 39.232  7.632   1.00 6.70   ? 353  ILE A CD1 1 
ATOM   2693  N  N   . SER A 1  354  ? 110.610 35.527  10.273  1.00 18.47  ? 354  SER A N   1 
ATOM   2694  C  CA  . SER A 1  354  ? 110.962 35.715  11.682  1.00 19.45  ? 354  SER A CA  1 
ATOM   2695  C  C   . SER A 1  354  ? 112.456 35.955  11.893  1.00 21.58  ? 354  SER A C   1 
ATOM   2696  O  O   . SER A 1  354  ? 113.257 35.841  10.967  1.00 22.06  ? 354  SER A O   1 
ATOM   2697  C  CB  . SER A 1  354  ? 110.517 34.512  12.501  1.00 16.93  ? 354  SER A CB  1 
ATOM   2698  O  OG  . SER A 1  354  ? 109.652 33.701  11.727  1.00 13.14  ? 354  SER A OG  1 
ATOM   2699  N  N   . GLY A 1  355  ? 112.836 36.270  13.124  1.00 23.17  ? 355  GLY A N   1 
ATOM   2700  C  CA  . GLY A 1  355  ? 114.236 36.549  13.376  1.00 25.12  ? 355  GLY A CA  1 
ATOM   2701  C  C   . GLY A 1  355  ? 115.052 35.428  13.976  1.00 25.03  ? 355  GLY A C   1 
ATOM   2702  O  O   . GLY A 1  355  ? 114.619 34.797  14.945  1.00 25.43  ? 355  GLY A O   1 
ATOM   2703  N  N   . ASP A 1  356  ? 116.241 35.196  13.413  1.00 24.43  ? 356  ASP A N   1 
ATOM   2704  C  CA  . ASP A 1  356  ? 117.130 34.135  13.900  1.00 24.01  ? 356  ASP A CA  1 
ATOM   2705  C  C   . ASP A 1  356  ? 118.506 34.666  14.249  1.00 23.44  ? 356  ASP A C   1 
ATOM   2706  O  O   . ASP A 1  356  ? 119.368 34.823  13.389  1.00 23.11  ? 356  ASP A O   1 
ATOM   2707  C  CB  . ASP A 1  356  ? 117.287 33.028  12.850  1.00 27.86  ? 356  ASP A CB  1 
ATOM   2708  C  CG  . ASP A 1  356  ? 117.399 31.641  13.470  1.00 28.95  ? 356  ASP A CG  1 
ATOM   2709  O  OD1 . ASP A 1  356  ? 118.216 31.453  14.407  1.00 28.27  ? 356  ASP A OD1 1 
ATOM   2710  O  OD2 . ASP A 1  356  ? 116.662 30.743  13.003  1.00 28.38  ? 356  ASP A OD2 1 
ATOM   2711  N  N   . PRO A 1  357  ? 118.737 34.927  15.529  1.00 24.51  ? 357  PRO A N   1 
ATOM   2712  C  CA  . PRO A 1  357  ? 120.020 35.444  15.995  1.00 29.11  ? 357  PRO A CA  1 
ATOM   2713  C  C   . PRO A 1  357  ? 121.152 34.438  15.807  1.00 32.86  ? 357  PRO A C   1 
ATOM   2714  O  O   . PRO A 1  357  ? 122.239 34.580  16.387  1.00 33.68  ? 357  PRO A O   1 
ATOM   2715  C  CB  . PRO A 1  357  ? 119.745 35.741  17.463  1.00 29.08  ? 357  PRO A CB  1 
ATOM   2716  C  CG  . PRO A 1  357  ? 118.753 34.691  17.830  1.00 25.13  ? 357  PRO A CG  1 
ATOM   2717  C  CD  . PRO A 1  357  ? 117.817 34.703  16.652  1.00 23.57  ? 357  PRO A CD  1 
ATOM   2718  N  N   . ASN A 1  358  ? 120.900 33.423  14.989  1.00 35.81  ? 358  ASN A N   1 
ATOM   2719  C  CA  . ASN A 1  358  ? 121.901 32.398  14.768  1.00 39.37  ? 358  ASN A CA  1 
ATOM   2720  C  C   . ASN A 1  358  ? 122.267 32.185  13.320  1.00 38.29  ? 358  ASN A C   1 
ATOM   2721  O  O   . ASN A 1  358  ? 123.069 31.306  13.005  1.00 39.71  ? 358  ASN A O   1 
ATOM   2722  C  CB  . ASN A 1  358  ? 121.448 31.083  15.403  1.00 43.69  ? 358  ASN A CB  1 
ATOM   2723  C  CG  . ASN A 1  358  ? 121.567 31.105  16.917  1.00 48.10  ? 358  ASN A CG  1 
ATOM   2724  O  OD1 . ASN A 1  358  ? 122.655 31.315  17.457  1.00 49.63  ? 358  ASN A OD1 1 
ATOM   2725  N  ND2 . ASN A 1  358  ? 120.449 30.899  17.610  1.00 49.63  ? 358  ASN A ND2 1 
ATOM   2726  N  N   . LEU A 1  359  ? 121.688 32.975  12.428  1.00 35.05  ? 359  LEU A N   1 
ATOM   2727  C  CA  . LEU A 1  359  ? 122.042 32.829  11.028  1.00 33.21  ? 359  LEU A CA  1 
ATOM   2728  C  C   . LEU A 1  359  ? 123.039 33.930  10.711  1.00 33.45  ? 359  LEU A C   1 
ATOM   2729  O  O   . LEU A 1  359  ? 123.219 34.849  11.509  1.00 33.84  ? 359  LEU A O   1 
ATOM   2730  C  CB  . LEU A 1  359  ? 120.811 32.964  10.129  1.00 28.17  ? 359  LEU A CB  1 
ATOM   2731  C  CG  . LEU A 1  359  ? 119.659 31.981  10.322  1.00 25.49  ? 359  LEU A CG  1 
ATOM   2732  C  CD1 . LEU A 1  359  ? 118.756 32.002  9.090   1.00 19.87  ? 359  LEU A CD1 1 
ATOM   2733  C  CD2 . LEU A 1  359  ? 120.227 30.591  10.537  1.00 26.97  ? 359  LEU A CD2 1 
ATOM   2734  N  N   . GLU A 1  360  ? 123.711 33.823  9.569   1.00 33.47  ? 360  GLU A N   1 
ATOM   2735  C  CA  . GLU A 1  360  ? 124.658 34.854  9.163   1.00 30.56  ? 360  GLU A CA  1 
ATOM   2736  C  C   . GLU A 1  360  ? 123.819 35.915  8.494   1.00 25.25  ? 360  GLU A C   1 
ATOM   2737  O  O   . GLU A 1  360  ? 122.655 35.693  8.179   1.00 25.67  ? 360  GLU A O   1 
ATOM   2738  C  CB  . GLU A 1  360  ? 125.687 34.312  8.163   1.00 37.36  ? 360  GLU A CB  1 
ATOM   2739  C  CG  . GLU A 1  360  ? 126.474 33.143  8.694   1.00 48.20  ? 360  GLU A CG  1 
ATOM   2740  C  CD  . GLU A 1  360  ? 127.040 33.443  10.062  1.00 56.35  ? 360  GLU A CD  1 
ATOM   2741  O  OE1 . GLU A 1  360  ? 127.976 34.276  10.143  1.00 59.59  ? 360  GLU A OE1 1 
ATOM   2742  O  OE2 . GLU A 1  360  ? 126.535 32.860  11.053  1.00 60.24  ? 360  GLU A OE2 1 
ATOM   2743  N  N   . LEU A 1  361  ? 124.406 37.073  8.282   1.00 19.28  ? 361  LEU A N   1 
ATOM   2744  C  CA  . LEU A 1  361  ? 123.688 38.151  7.638   1.00 16.18  ? 361  LEU A CA  1 
ATOM   2745  C  C   . LEU A 1  361  ? 123.159 37.715  6.254   1.00 14.95  ? 361  LEU A C   1 
ATOM   2746  O  O   . LEU A 1  361  ? 121.950 37.777  5.981   1.00 12.30  ? 361  LEU A O   1 
ATOM   2747  C  CB  . LEU A 1  361  ? 124.634 39.343  7.496   1.00 13.97  ? 361  LEU A CB  1 
ATOM   2748  C  CG  . LEU A 1  361  ? 124.123 40.634  6.876   1.00 12.92  ? 361  LEU A CG  1 
ATOM   2749  C  CD1 . LEU A 1  361  ? 123.217 41.347  7.866   1.00 14.51  ? 361  LEU A CD1 1 
ATOM   2750  C  CD2 . LEU A 1  361  ? 125.315 41.498  6.520   1.00 13.79  ? 361  LEU A CD2 1 
ATOM   2751  N  N   . ASP A 1  362  ? 124.073 37.258  5.399   1.00 14.01  ? 362  ASP A N   1 
ATOM   2752  C  CA  . ASP A 1  362  ? 123.724 36.851  4.045   1.00 12.97  ? 362  ASP A CA  1 
ATOM   2753  C  C   . ASP A 1  362  ? 122.814 35.653  3.898   1.00 11.04  ? 362  ASP A C   1 
ATOM   2754  O  O   . ASP A 1  362  ? 122.312 35.406  2.805   1.00 10.56  ? 362  ASP A O   1 
ATOM   2755  C  CB  . ASP A 1  362  ? 124.987 36.637  3.169   1.00 18.10  ? 362  ASP A CB  1 
ATOM   2756  C  CG  . ASP A 1  362  ? 126.179 36.038  3.936   1.00 19.57  ? 362  ASP A CG  1 
ATOM   2757  O  OD1 . ASP A 1  362  ? 127.258 35.841  3.308   1.00 17.06  ? 362  ASP A OD1 1 
ATOM   2758  O  OD2 . ASP A 1  362  ? 126.048 35.773  5.154   1.00 23.59  ? 362  ASP A OD2 1 
ATOM   2759  N  N   . GLN A 1  363  ? 122.583 34.917  4.982   1.00 8.29   ? 363  GLN A N   1 
ATOM   2760  C  CA  . GLN A 1  363  ? 121.727 33.723  4.916   1.00 6.84   ? 363  GLN A CA  1 
ATOM   2761  C  C   . GLN A 1  363  ? 120.242 34.016  5.014   1.00 5.69   ? 363  GLN A C   1 
ATOM   2762  O  O   . GLN A 1  363  ? 119.824 35.103  5.438   1.00 6.18   ? 363  GLN A O   1 
ATOM   2763  C  CB  . GLN A 1  363  ? 122.068 32.738  6.034   1.00 11.06  ? 363  GLN A CB  1 
ATOM   2764  C  CG  . GLN A 1  363  ? 123.510 32.336  6.079   1.00 21.58  ? 363  GLN A CG  1 
ATOM   2765  C  CD  . GLN A 1  363  ? 123.769 31.267  7.113   1.00 28.24  ? 363  GLN A CD  1 
ATOM   2766  O  OE1 . GLN A 1  363  ? 123.322 31.368  8.267   1.00 28.79  ? 363  GLN A OE1 1 
ATOM   2767  N  NE2 . GLN A 1  363  ? 124.502 30.229  6.711   1.00 32.29  ? 363  GLN A NE2 1 
ATOM   2768  N  N   . VAL A 1  364  ? 119.452 33.031  4.611   1.00 1.00   ? 364  VAL A N   1 
ATOM   2769  C  CA  . VAL A 1  364  ? 118.008 33.119  4.683   1.00 1.00   ? 364  VAL A CA  1 
ATOM   2770  C  C   . VAL A 1  364  ? 117.526 31.703  4.919   1.00 1.00   ? 364  VAL A C   1 
ATOM   2771  O  O   . VAL A 1  364  ? 117.625 30.836  4.038   1.00 1.00   ? 364  VAL A O   1 
ATOM   2772  C  CB  . VAL A 1  364  ? 117.402 33.673  3.394   1.00 1.00   ? 364  VAL A CB  1 
ATOM   2773  C  CG1 . VAL A 1  364  ? 118.093 33.089  2.200   1.00 4.33   ? 364  VAL A CG1 1 
ATOM   2774  C  CG2 . VAL A 1  364  ? 115.921 33.374  3.359   1.00 1.00   ? 364  VAL A CG2 1 
ATOM   2775  N  N   . GLY A 1  365  ? 117.037 31.459  6.129   1.00 2.35   ? 365  GLY A N   1 
ATOM   2776  C  CA  . GLY A 1  365  ? 116.561 30.128  6.462   1.00 4.71   ? 365  GLY A CA  1 
ATOM   2777  C  C   . GLY A 1  365  ? 115.295 29.747  5.720   1.00 7.99   ? 365  GLY A C   1 
ATOM   2778  O  O   . GLY A 1  365  ? 114.215 30.261  6.016   1.00 9.06   ? 365  GLY A O   1 
ATOM   2779  N  N   . VAL A 1  366  ? 115.410 28.855  4.745   1.00 8.27   ? 366  VAL A N   1 
ATOM   2780  C  CA  . VAL A 1  366  ? 114.220 28.445  4.024   1.00 9.57   ? 366  VAL A CA  1 
ATOM   2781  C  C   . VAL A 1  366  ? 113.616 27.229  4.680   1.00 8.51   ? 366  VAL A C   1 
ATOM   2782  O  O   . VAL A 1  366  ? 114.330 26.352  5.169   1.00 7.15   ? 366  VAL A O   1 
ATOM   2783  C  CB  . VAL A 1  366  ? 114.502 28.021  2.601   1.00 9.54   ? 366  VAL A CB  1 
ATOM   2784  C  CG1 . VAL A 1  366  ? 113.171 27.798  1.888   1.00 7.48   ? 366  VAL A CG1 1 
ATOM   2785  C  CG2 . VAL A 1  366  ? 115.382 29.031  1.910   1.00 9.31   ? 366  VAL A CG2 1 
ATOM   2786  N  N   . PRO A 1  367  ? 112.287 27.165  4.734   1.00 8.80   ? 367  PRO A N   1 
ATOM   2787  C  CA  . PRO A 1  367  ? 111.837 25.938  5.370   1.00 9.55   ? 367  PRO A CA  1 
ATOM   2788  C  C   . PRO A 1  367  ? 111.873 24.842  4.301   1.00 11.34  ? 367  PRO A C   1 
ATOM   2789  O  O   . PRO A 1  367  ? 111.680 25.102  3.087   1.00 10.92  ? 367  PRO A O   1 
ATOM   2790  C  CB  . PRO A 1  367  ? 110.434 26.288  5.864   1.00 9.64   ? 367  PRO A CB  1 
ATOM   2791  C  CG  . PRO A 1  367  ? 109.975 27.323  4.907   1.00 12.19  ? 367  PRO A CG  1 
ATOM   2792  C  CD  . PRO A 1  367  ? 111.210 28.164  4.667   1.00 9.30   ? 367  PRO A CD  1 
ATOM   2793  N  N   . LYS A 1  368  ? 112.189 23.637  4.785   1.00 12.88  ? 368  LYS A N   1 
ATOM   2794  C  CA  . LYS A 1  368  ? 112.295 22.400  4.008   1.00 14.34  ? 368  LYS A CA  1 
ATOM   2795  C  C   . LYS A 1  368  ? 111.165 22.339  2.993   1.00 16.53  ? 368  LYS A C   1 
ATOM   2796  O  O   . LYS A 1  368  ? 111.399 22.249  1.788   1.00 16.29  ? 368  LYS A O   1 
ATOM   2797  C  CB  . LYS A 1  368  ? 112.220 21.217  4.985   1.00 11.68  ? 368  LYS A CB  1 
ATOM   2798  C  CG  . LYS A 1  368  ? 112.524 19.844  4.430   1.00 17.32  ? 368  LYS A CG  1 
ATOM   2799  C  CD  . LYS A 1  368  ? 112.853 18.849  5.578   1.00 26.21  ? 368  LYS A CD  1 
ATOM   2800  C  CE  . LYS A 1  368  ? 114.172 19.208  6.332   1.00 29.43  ? 368  LYS A CE  1 
ATOM   2801  N  NZ  . LYS A 1  368  ? 114.533 18.313  7.499   1.00 30.03  ? 368  LYS A NZ  1 
ATOM   2802  N  N   . SER A 1  369  ? 109.940 22.412  3.507   1.00 20.38  ? 369  SER A N   1 
ATOM   2803  C  CA  . SER A 1  369  ? 108.741 22.377  2.688   1.00 22.24  ? 369  SER A CA  1 
ATOM   2804  C  C   . SER A 1  369  ? 108.976 23.014  1.344   1.00 22.48  ? 369  SER A C   1 
ATOM   2805  O  O   . SER A 1  369  ? 108.620 22.457  0.312   1.00 26.30  ? 369  SER A O   1 
ATOM   2806  C  CB  . SER A 1  369  ? 107.591 23.124  3.366   1.00 24.38  ? 369  SER A CB  1 
ATOM   2807  O  OG  . SER A 1  369  ? 106.570 23.432  2.419   1.00 22.51  ? 369  SER A OG  1 
ATOM   2808  N  N   . ILE A 1  370  ? 109.583 24.190  1.360   1.00 21.57  ? 370  ILE A N   1 
ATOM   2809  C  CA  . ILE A 1  370  ? 109.819 24.908  0.123   1.00 20.44  ? 370  ILE A CA  1 
ATOM   2810  C  C   . ILE A 1  370  ? 110.988 24.309  -0.641  1.00 21.66  ? 370  ILE A C   1 
ATOM   2811  O  O   . ILE A 1  370  ? 110.889 24.029  -1.846  1.00 22.63  ? 370  ILE A O   1 
ATOM   2812  C  CB  . ILE A 1  370  ? 110.057 26.403  0.409   1.00 18.64  ? 370  ILE A CB  1 
ATOM   2813  C  CG1 . ILE A 1  370  ? 109.223 26.797  1.628   1.00 19.39  ? 370  ILE A CG1 1 
ATOM   2814  C  CG2 . ILE A 1  370  ? 109.653 27.246  -0.810  1.00 13.39  ? 370  ILE A CG2 1 
ATOM   2815  C  CD1 . ILE A 1  370  ? 109.081 28.247  1.833   1.00 23.42  ? 370  ILE A CD1 1 
ATOM   2816  N  N   . ALA A 1  371  ? 112.091 24.093  0.061   1.00 20.86  ? 371  ALA A N   1 
ATOM   2817  C  CA  . ALA A 1  371  ? 113.250 23.529  -0.593  1.00 20.95  ? 371  ALA A CA  1 
ATOM   2818  C  C   . ALA A 1  371  ? 112.803 22.357  -1.467  1.00 20.29  ? 371  ALA A C   1 
ATOM   2819  O  O   . ALA A 1  371  ? 113.175 22.284  -2.639  1.00 18.86  ? 371  ALA A O   1 
ATOM   2820  C  CB  . ALA A 1  371  ? 114.257 23.070  0.444   1.00 23.30  ? 371  ALA A CB  1 
ATOM   2821  N  N   . LYS A 1  372  ? 111.980 21.470  -0.893  1.00 17.70  ? 372  LYS A N   1 
ATOM   2822  C  CA  . LYS A 1  372  ? 111.489 20.282  -1.592  1.00 16.06  ? 372  LYS A CA  1 
ATOM   2823  C  C   . LYS A 1  372  ? 110.552 20.596  -2.725  1.00 13.29  ? 372  LYS A C   1 
ATOM   2824  O  O   . LYS A 1  372  ? 110.201 19.691  -3.478  1.00 14.91  ? 372  LYS A O   1 
ATOM   2825  C  CB  . LYS A 1  372  ? 110.756 19.324  -0.648  1.00 20.51  ? 372  LYS A CB  1 
ATOM   2826  C  CG  . LYS A 1  372  ? 111.612 18.708  0.448   1.00 28.50  ? 372  LYS A CG  1 
ATOM   2827  C  CD  . LYS A 1  372  ? 110.858 17.624  1.260   1.00 35.01  ? 372  LYS A CD  1 
ATOM   2828  C  CE  . LYS A 1  372  ? 109.477 18.080  1.768   1.00 38.75  ? 372  LYS A CE  1 
ATOM   2829  N  NZ  . LYS A 1  372  ? 108.784 17.025  2.567   1.00 38.78  ? 372  LYS A NZ  1 
ATOM   2830  N  N   . THR A 1  373  ? 110.136 21.856  -2.858  1.00 11.72  ? 373  THR A N   1 
ATOM   2831  C  CA  . THR A 1  373  ? 109.208 22.209  -3.934  1.00 12.09  ? 373  THR A CA  1 
ATOM   2832  C  C   . THR A 1  373  ? 109.848 22.997  -5.056  1.00 9.32   ? 373  THR A C   1 
ATOM   2833  O  O   . THR A 1  373  ? 109.403 22.936  -6.199  1.00 6.78   ? 373  THR A O   1 
ATOM   2834  C  CB  . THR A 1  373  ? 108.013 23.042  -3.434  1.00 13.70  ? 373  THR A CB  1 
ATOM   2835  O  OG1 . THR A 1  373  ? 107.437 22.445  -2.267  1.00 20.68  ? 373  THR A OG1 1 
ATOM   2836  C  CG2 . THR A 1  373  ? 106.952 23.083  -4.505  1.00 19.79  ? 373  THR A CG2 1 
ATOM   2837  N  N   . LEU A 1  374  ? 110.891 23.743  -4.711  1.00 8.81   ? 374  LEU A N   1 
ATOM   2838  C  CA  . LEU A 1  374  ? 111.623 24.578  -5.662  1.00 6.99   ? 374  LEU A CA  1 
ATOM   2839  C  C   . LEU A 1  374  ? 112.806 23.782  -6.214  1.00 9.44   ? 374  LEU A C   1 
ATOM   2840  O  O   . LEU A 1  374  ? 113.524 23.118  -5.480  1.00 11.47  ? 374  LEU A O   1 
ATOM   2841  C  CB  . LEU A 1  374  ? 112.104 25.856  -4.954  1.00 2.28   ? 374  LEU A CB  1 
ATOM   2842  C  CG  . LEU A 1  374  ? 111.050 26.793  -4.329  1.00 1.95   ? 374  LEU A CG  1 
ATOM   2843  C  CD1 . LEU A 1  374  ? 111.679 27.484  -3.130  1.00 1.46   ? 374  LEU A CD1 1 
ATOM   2844  C  CD2 . LEU A 1  374  ? 110.519 27.800  -5.361  1.00 1.00   ? 374  LEU A CD2 1 
ATOM   2845  N  N   . THR A 1  375  ? 113.028 23.865  -7.509  1.00 10.67  ? 375  THR A N   1 
ATOM   2846  C  CA  . THR A 1  375  ? 114.086 23.084  -8.090  1.00 14.45  ? 375  THR A CA  1 
ATOM   2847  C  C   . THR A 1  375  ? 115.073 23.853  -8.917  1.00 15.88  ? 375  THR A C   1 
ATOM   2848  O  O   . THR A 1  375  ? 114.686 24.651  -9.766  1.00 15.92  ? 375  THR A O   1 
ATOM   2849  C  CB  . THR A 1  375  ? 113.491 21.978  -8.998  1.00 19.23  ? 375  THR A CB  1 
ATOM   2850  O  OG1 . THR A 1  375  ? 114.155 21.995  -10.272 1.00 25.70  ? 375  THR A OG1 1 
ATOM   2851  C  CG2 . THR A 1  375  ? 111.988 22.202  -9.231  1.00 21.75  ? 375  THR A CG2 1 
ATOM   2852  N  N   . TYR A 1  376  ? 116.354 23.609  -8.686  1.00 16.88  ? 376  TYR A N   1 
ATOM   2853  C  CA  . TYR A 1  376  ? 117.356 24.255  -9.512  1.00 23.16  ? 376  TYR A CA  1 
ATOM   2854  C  C   . TYR A 1  376  ? 117.851 23.254  -10.544 1.00 27.22  ? 376  TYR A C   1 
ATOM   2855  O  O   . TYR A 1  376  ? 118.554 22.305  -10.201 1.00 29.43  ? 376  TYR A O   1 
ATOM   2856  C  CB  . TYR A 1  376  ? 118.557 24.709  -8.708  1.00 25.19  ? 376  TYR A CB  1 
ATOM   2857  C  CG  . TYR A 1  376  ? 119.671 25.177  -9.622  1.00 26.93  ? 376  TYR A CG  1 
ATOM   2858  C  CD1 . TYR A 1  376  ? 119.665 26.460  -10.158 1.00 27.68  ? 376  TYR A CD1 1 
ATOM   2859  C  CD2 . TYR A 1  376  ? 120.689 24.312  -10.011 1.00 26.96  ? 376  TYR A CD2 1 
ATOM   2860  C  CE1 . TYR A 1  376  ? 120.645 26.866  -11.058 1.00 29.11  ? 376  TYR A CE1 1 
ATOM   2861  C  CE2 . TYR A 1  376  ? 121.667 24.710  -10.909 1.00 27.49  ? 376  TYR A CE2 1 
ATOM   2862  C  CZ  . TYR A 1  376  ? 121.638 25.984  -11.429 1.00 27.61  ? 376  TYR A CZ  1 
ATOM   2863  O  OH  . TYR A 1  376  ? 122.597 26.370  -12.334 1.00 29.74  ? 376  TYR A OH  1 
ATOM   2864  N  N   . PRO A 1  377  ? 117.504 23.449  -11.820 1.00 29.96  ? 377  PRO A N   1 
ATOM   2865  C  CA  . PRO A 1  377  ? 117.956 22.514  -12.853 1.00 29.45  ? 377  PRO A CA  1 
ATOM   2866  C  C   . PRO A 1  377  ? 119.460 22.512  -13.026 1.00 27.94  ? 377  PRO A C   1 
ATOM   2867  O  O   . PRO A 1  377  ? 120.031 23.452  -13.577 1.00 24.11  ? 377  PRO A O   1 
ATOM   2868  C  CB  . PRO A 1  377  ? 117.223 22.991  -14.104 1.00 32.21  ? 377  PRO A CB  1 
ATOM   2869  C  CG  . PRO A 1  377  ? 117.035 24.444  -13.852 1.00 32.86  ? 377  PRO A CG  1 
ATOM   2870  C  CD  . PRO A 1  377  ? 116.634 24.482  -12.395 1.00 31.96  ? 377  PRO A CD  1 
ATOM   2871  N  N   . GLU A 1  378  ? 120.083 21.439  -12.539 1.00 28.54  ? 378  GLU A N   1 
ATOM   2872  C  CA  . GLU A 1  378  ? 121.524 21.258  -12.606 1.00 31.35  ? 378  GLU A CA  1 
ATOM   2873  C  C   . GLU A 1  378  ? 121.874 20.413  -13.802 1.00 31.90  ? 378  GLU A C   1 
ATOM   2874  O  O   . GLU A 1  378  ? 121.046 19.659  -14.291 1.00 31.52  ? 378  GLU A O   1 
ATOM   2875  C  CB  . GLU A 1  378  ? 122.038 20.587  -11.337 1.00 34.26  ? 378  GLU A CB  1 
ATOM   2876  C  CG  . GLU A 1  378  ? 123.548 20.443  -11.301 1.00 41.29  ? 378  GLU A CG  1 
ATOM   2877  C  CD  . GLU A 1  378  ? 124.135 20.729  -9.922  1.00 46.41  ? 378  GLU A CD  1 
ATOM   2878  O  OE1 . GLU A 1  378  ? 123.821 20.000  -8.954  1.00 48.80  ? 378  GLU A OE1 1 
ATOM   2879  O  OE2 . GLU A 1  378  ? 124.918 21.696  -9.801  1.00 51.00  ? 378  GLU A OE2 1 
ATOM   2880  N  N   . VAL A 1  379  ? 123.106 20.543  -14.275 1.00 34.24  ? 379  VAL A N   1 
ATOM   2881  C  CA  . VAL A 1  379  ? 123.545 19.786  -15.436 1.00 35.88  ? 379  VAL A CA  1 
ATOM   2882  C  C   . VAL A 1  379  ? 124.454 18.639  -15.042 1.00 35.91  ? 379  VAL A C   1 
ATOM   2883  O  O   . VAL A 1  379  ? 125.468 18.853  -14.373 1.00 38.61  ? 379  VAL A O   1 
ATOM   2884  C  CB  . VAL A 1  379  ? 124.336 20.643  -16.414 1.00 36.04  ? 379  VAL A CB  1 
ATOM   2885  C  CG1 . VAL A 1  379  ? 124.495 19.891  -17.716 1.00 39.28  ? 379  VAL A CG1 1 
ATOM   2886  C  CG2 . VAL A 1  379  ? 123.646 21.969  -16.629 1.00 41.27  ? 379  VAL A CG2 1 
ATOM   2887  N  N   . VAL A 1  380  ? 124.094 17.430  -15.472 1.00 32.95  ? 380  VAL A N   1 
ATOM   2888  C  CA  . VAL A 1  380  ? 124.875 16.240  -15.177 1.00 28.33  ? 380  VAL A CA  1 
ATOM   2889  C  C   . VAL A 1  380  ? 126.259 16.351  -15.764 1.00 29.34  ? 380  VAL A C   1 
ATOM   2890  O  O   . VAL A 1  380  ? 126.451 16.432  -16.985 1.00 28.37  ? 380  VAL A O   1 
ATOM   2891  C  CB  . VAL A 1  380  ? 124.220 15.010  -15.726 1.00 26.73  ? 380  VAL A CB  1 
ATOM   2892  C  CG1 . VAL A 1  380  ? 125.271 13.953  -15.993 1.00 30.01  ? 380  VAL A CG1 1 
ATOM   2893  C  CG2 . VAL A 1  380  ? 123.220 14.503  -14.726 1.00 24.28  ? 380  VAL A CG2 1 
ATOM   2894  N  N   . THR A 1  381  ? 127.224 16.307  -14.865 1.00 30.94  ? 381  THR A N   1 
ATOM   2895  C  CA  . THR A 1  381  ? 128.602 16.468  -15.240 1.00 34.60  ? 381  THR A CA  1 
ATOM   2896  C  C   . THR A 1  381  ? 129.498 15.641  -14.334 1.00 36.30  ? 381  THR A C   1 
ATOM   2897  O  O   . THR A 1  381  ? 129.204 15.458  -13.156 1.00 37.18  ? 381  THR A O   1 
ATOM   2898  C  CB  . THR A 1  381  ? 128.935 17.980  -15.170 1.00 35.80  ? 381  THR A CB  1 
ATOM   2899  O  OG1 . THR A 1  381  ? 128.785 18.548  -16.475 1.00 38.18  ? 381  THR A OG1 1 
ATOM   2900  C  CG2 . THR A 1  381  ? 130.320 18.235  -14.611 1.00 35.60  ? 381  THR A CG2 1 
ATOM   2901  N  N   . PRO A 1  382  ? 130.612 15.136  -14.879 1.00 38.50  ? 382  PRO A N   1 
ATOM   2902  C  CA  . PRO A 1  382  ? 131.546 14.321  -14.105 1.00 40.59  ? 382  PRO A CA  1 
ATOM   2903  C  C   . PRO A 1  382  ? 131.808 14.897  -12.732 1.00 41.98  ? 382  PRO A C   1 
ATOM   2904  O  O   . PRO A 1  382  ? 132.028 14.162  -11.776 1.00 45.28  ? 382  PRO A O   1 
ATOM   2905  C  CB  . PRO A 1  382  ? 132.795 14.310  -14.973 1.00 41.79  ? 382  PRO A CB  1 
ATOM   2906  C  CG  . PRO A 1  382  ? 132.710 15.613  -15.690 1.00 42.24  ? 382  PRO A CG  1 
ATOM   2907  C  CD  . PRO A 1  382  ? 131.269 15.645  -16.092 1.00 39.91  ? 382  PRO A CD  1 
ATOM   2908  N  N   . TYR A 1  383  ? 131.782 16.215  -12.627 1.00 41.86  ? 383  TYR A N   1 
ATOM   2909  C  CA  . TYR A 1  383  ? 132.021 16.843  -11.343 1.00 42.74  ? 383  TYR A CA  1 
ATOM   2910  C  C   . TYR A 1  383  ? 130.933 16.397  -10.369 1.00 41.93  ? 383  TYR A C   1 
ATOM   2911  O  O   . TYR A 1  383  ? 131.192 16.192  -9.186  1.00 41.64  ? 383  TYR A O   1 
ATOM   2912  C  CB  . TYR A 1  383  ? 131.994 18.373  -11.486 1.00 46.98  ? 383  TYR A CB  1 
ATOM   2913  C  CG  . TYR A 1  383  ? 132.873 18.914  -12.598 1.00 50.93  ? 383  TYR A CG  1 
ATOM   2914  C  CD1 . TYR A 1  383  ? 132.486 20.028  -13.345 1.00 51.69  ? 383  TYR A CD1 1 
ATOM   2915  C  CD2 . TYR A 1  383  ? 134.073 18.287  -12.933 1.00 54.06  ? 383  TYR A CD2 1 
ATOM   2916  C  CE1 . TYR A 1  383  ? 133.270 20.496  -14.412 1.00 53.08  ? 383  TYR A CE1 1 
ATOM   2917  C  CE2 . TYR A 1  383  ? 134.866 18.751  -13.994 1.00 55.12  ? 383  TYR A CE2 1 
ATOM   2918  C  CZ  . TYR A 1  383  ? 134.458 19.848  -14.730 1.00 53.78  ? 383  TYR A CZ  1 
ATOM   2919  O  OH  . TYR A 1  383  ? 135.226 20.267  -15.795 1.00 53.79  ? 383  TYR A OH  1 
ATOM   2920  N  N   . ASN A 1  384  ? 129.720 16.206  -10.879 1.00 42.04  ? 384  ASN A N   1 
ATOM   2921  C  CA  . ASN A 1  384  ? 128.593 15.846  -10.021 1.00 41.97  ? 384  ASN A CA  1 
ATOM   2922  C  C   . ASN A 1  384  ? 127.959 14.458  -10.082 1.00 41.91  ? 384  ASN A C   1 
ATOM   2923  O  O   . ASN A 1  384  ? 127.506 13.951  -9.054  1.00 41.98  ? 384  ASN A O   1 
ATOM   2924  C  CB  . ASN A 1  384  ? 127.477 16.875  -10.208 1.00 41.75  ? 384  ASN A CB  1 
ATOM   2925  C  CG  . ASN A 1  384  ? 127.104 17.074  -11.669 1.00 42.60  ? 384  ASN A CG  1 
ATOM   2926  O  OD1 . ASN A 1  384  ? 126.767 16.126  -12.387 1.00 41.35  ? 384  ASN A OD1 1 
ATOM   2927  N  ND2 . ASN A 1  384  ? 127.160 18.321  -12.115 1.00 44.64  ? 384  ASN A ND2 1 
ATOM   2928  N  N   . ILE A 1  385  ? 127.899 13.861  -11.269 1.00 43.41  ? 385  ILE A N   1 
ATOM   2929  C  CA  . ILE A 1  385  ? 127.270 12.551  -11.446 1.00 46.27  ? 385  ILE A CA  1 
ATOM   2930  C  C   . ILE A 1  385  ? 127.037 11.768  -10.161 1.00 48.08  ? 385  ILE A C   1 
ATOM   2931  O  O   . ILE A 1  385  ? 125.916 11.374  -9.863  1.00 48.86  ? 385  ILE A O   1 
ATOM   2932  C  CB  . ILE A 1  385  ? 128.064 11.670  -12.431 1.00 46.66  ? 385  ILE A CB  1 
ATOM   2933  C  CG1 . ILE A 1  385  ? 127.530 11.855  -13.855 1.00 47.43  ? 385  ILE A CG1 1 
ATOM   2934  C  CG2 . ILE A 1  385  ? 127.924 10.215  -12.052 1.00 49.55  ? 385  ILE A CG2 1 
ATOM   2935  C  CD1 . ILE A 1  385  ? 126.118 11.305  -14.068 1.00 43.93  ? 385  ILE A CD1 1 
ATOM   2936  N  N   . ASP A 1  386  ? 128.098 11.543  -9.400  1.00 52.09  ? 386  ASP A N   1 
ATOM   2937  C  CA  . ASP A 1  386  ? 127.998 10.799  -8.143  1.00 54.77  ? 386  ASP A CA  1 
ATOM   2938  C  C   . ASP A 1  386  ? 126.923 11.407  -7.245  1.00 52.15  ? 386  ASP A C   1 
ATOM   2939  O  O   . ASP A 1  386  ? 125.857 10.821  -7.022  1.00 49.32  ? 386  ASP A O   1 
ATOM   2940  C  CB  . ASP A 1  386  ? 129.341 10.843  -7.406  1.00 61.33  ? 386  ASP A CB  1 
ATOM   2941  C  CG  . ASP A 1  386  ? 130.529 10.603  -8.332  1.00 67.44  ? 386  ASP A CG  1 
ATOM   2942  O  OD1 . ASP A 1  386  ? 130.746 9.435   -8.738  1.00 71.43  ? 386  ASP A OD1 1 
ATOM   2943  O  OD2 . ASP A 1  386  ? 131.240 11.587  -8.658  1.00 69.14  ? 386  ASP A OD2 1 
ATOM   2944  N  N   . ARG A 1  387  ? 127.236 12.594  -6.736  1.00 48.70  ? 387  ARG A N   1 
ATOM   2945  C  CA  . ARG A 1  387  ? 126.361 13.343  -5.855  1.00 44.86  ? 387  ARG A CA  1 
ATOM   2946  C  C   . ARG A 1  387  ? 124.984 13.561  -6.472  1.00 38.78  ? 387  ARG A C   1 
ATOM   2947  O  O   . ARG A 1  387  ? 123.972 13.522  -5.777  1.00 39.90  ? 387  ARG A O   1 
ATOM   2948  C  CB  . ARG A 1  387  ? 127.021 14.683  -5.523  1.00 50.28  ? 387  ARG A CB  1 
ATOM   2949  C  CG  . ARG A 1  387  ? 126.230 15.585  -4.572  1.00 61.93  ? 387  ARG A CG  1 
ATOM   2950  C  CD  . ARG A 1  387  ? 127.010 16.887  -4.212  1.00 70.62  ? 387  ARG A CD  1 
ATOM   2951  N  NE  . ARG A 1  387  ? 127.312 17.770  -5.354  1.00 73.48  ? 387  ARG A NE  1 
ATOM   2952  C  CZ  . ARG A 1  387  ? 126.569 18.810  -5.748  1.00 74.42  ? 387  ARG A CZ  1 
ATOM   2953  N  NH1 . ARG A 1  387  ? 125.450 19.145  -5.105  1.00 71.28  ? 387  ARG A NH1 1 
ATOM   2954  N  NH2 . ARG A 1  387  ? 126.952 19.523  -6.800  1.00 75.75  ? 387  ARG A NH2 1 
ATOM   2955  N  N   . LEU A 1  388  ? 124.945 13.782  -7.779  1.00 31.89  ? 388  LEU A N   1 
ATOM   2956  C  CA  . LEU A 1  388  ? 123.677 14.000  -8.454  1.00 27.50  ? 388  LEU A CA  1 
ATOM   2957  C  C   . LEU A 1  388  ? 122.787 12.770  -8.413  1.00 28.39  ? 388  LEU A C   1 
ATOM   2958  O  O   . LEU A 1  388  ? 121.700 12.797  -7.831  1.00 27.81  ? 388  LEU A O   1 
ATOM   2959  C  CB  . LEU A 1  388  ? 123.912 14.409  -9.902  1.00 23.96  ? 388  LEU A CB  1 
ATOM   2960  C  CG  . LEU A 1  388  ? 123.645 15.884  -10.178 1.00 21.88  ? 388  LEU A CG  1 
ATOM   2961  C  CD1 . LEU A 1  388  ? 124.015 16.243  -11.615 1.00 25.53  ? 388  LEU A CD1 1 
ATOM   2962  C  CD2 . LEU A 1  388  ? 122.179 16.151  -9.908  1.00 19.51  ? 388  LEU A CD2 1 
ATOM   2963  N  N   . THR A 1  389  ? 123.249 11.690  -9.033  1.00 30.89  ? 389  THR A N   1 
ATOM   2964  C  CA  . THR A 1  389  ? 122.475 10.453  -9.065  1.00 34.46  ? 389  THR A CA  1 
ATOM   2965  C  C   . THR A 1  389  ? 121.940 10.208  -7.661  1.00 35.38  ? 389  THR A C   1 
ATOM   2966  O  O   . THR A 1  389  ? 120.774 9.835   -7.482  1.00 35.60  ? 389  THR A O   1 
ATOM   2967  C  CB  . THR A 1  389  ? 123.341 9.231   -9.486  1.00 34.07  ? 389  THR A CB  1 
ATOM   2968  O  OG1 . THR A 1  389  ? 124.321 9.637   -10.449 1.00 37.10  ? 389  THR A OG1 1 
ATOM   2969  C  CG2 . THR A 1  389  ? 122.462 8.150   -10.121 1.00 32.44  ? 389  THR A CG2 1 
ATOM   2970  N  N   . GLN A 1  390  ? 122.801 10.444  -6.673  1.00 36.23  ? 390  GLN A N   1 
ATOM   2971  C  CA  . GLN A 1  390  ? 122.440 10.250  -5.276  1.00 37.26  ? 390  GLN A CA  1 
ATOM   2972  C  C   . GLN A 1  390  ? 121.076 10.861  -4.987  1.00 33.72  ? 390  GLN A C   1 
ATOM   2973  O  O   . GLN A 1  390  ? 120.178 10.200  -4.454  1.00 32.98  ? 390  GLN A O   1 
ATOM   2974  C  CB  . GLN A 1  390  ? 123.496 10.873  -4.361  1.00 41.16  ? 390  GLN A CB  1 
ATOM   2975  C  CG  . GLN A 1  390  ? 123.196 10.718  -2.871  1.00 49.11  ? 390  GLN A CG  1 
ATOM   2976  C  CD  . GLN A 1  390  ? 123.119 9.260   -2.417  1.00 55.50  ? 390  GLN A CD  1 
ATOM   2977  O  OE1 . GLN A 1  390  ? 124.114 8.527   -2.456  1.00 59.30  ? 390  GLN A OE1 1 
ATOM   2978  N  NE2 . GLN A 1  390  ? 121.931 8.835   -1.983  1.00 56.61  ? 390  GLN A NE2 1 
ATOM   2979  N  N   . LEU A 1  391  ? 120.923 12.128  -5.344  1.00 29.47  ? 391  LEU A N   1 
ATOM   2980  C  CA  . LEU A 1  391  ? 119.659 12.806  -5.130  1.00 27.78  ? 391  LEU A CA  1 
ATOM   2981  C  C   . LEU A 1  391  ? 118.574 12.033  -5.867  1.00 29.31  ? 391  LEU A C   1 
ATOM   2982  O  O   . LEU A 1  391  ? 117.659 11.484  -5.243  1.00 29.63  ? 391  LEU A O   1 
ATOM   2983  C  CB  . LEU A 1  391  ? 119.735 14.244  -5.651  1.00 24.62  ? 391  LEU A CB  1 
ATOM   2984  C  CG  . LEU A 1  391  ? 120.726 15.185  -4.946  1.00 24.91  ? 391  LEU A CG  1 
ATOM   2985  C  CD1 . LEU A 1  391  ? 120.827 16.499  -5.698  1.00 25.60  ? 391  LEU A CD1 1 
ATOM   2986  C  CD2 . LEU A 1  391  ? 120.278 15.446  -3.527  1.00 26.86  ? 391  LEU A CD2 1 
ATOM   2987  N  N   . VAL A 1  392  ? 118.697 11.977  -7.192  1.00 30.19  ? 392  VAL A N   1 
ATOM   2988  C  CA  . VAL A 1  392  ? 117.733 11.279  -8.026  1.00 30.94  ? 392  VAL A CA  1 
ATOM   2989  C  C   . VAL A 1  392  ? 117.196 10.094  -7.255  1.00 36.09  ? 392  VAL A C   1 
ATOM   2990  O  O   . VAL A 1  392  ? 115.988 9.960   -7.066  1.00 34.28  ? 392  VAL A O   1 
ATOM   2991  C  CB  . VAL A 1  392  ? 118.372 10.764  -9.300  1.00 27.33  ? 392  VAL A CB  1 
ATOM   2992  C  CG1 . VAL A 1  392  ? 117.304 10.461  -10.305 1.00 27.19  ? 392  VAL A CG1 1 
ATOM   2993  C  CG2 . VAL A 1  392  ? 119.341 11.778  -9.840  1.00 28.00  ? 392  VAL A CG2 1 
ATOM   2994  N  N   . ARG A 1  393  ? 118.110 9.240   -6.802  1.00 43.73  ? 393  ARG A N   1 
ATOM   2995  C  CA  . ARG A 1  393  ? 117.739 8.065   -6.021  1.00 51.67  ? 393  ARG A CA  1 
ATOM   2996  C  C   . ARG A 1  393  ? 116.950 8.532   -4.812  1.00 50.46  ? 393  ARG A C   1 
ATOM   2997  O  O   . ARG A 1  393  ? 115.844 8.063   -4.569  1.00 51.77  ? 393  ARG A O   1 
ATOM   2998  C  CB  . ARG A 1  393  ? 118.975 7.303   -5.523  1.00 60.38  ? 393  ARG A CB  1 
ATOM   2999  C  CG  . ARG A 1  393  ? 119.516 6.176   -6.429  1.00 75.58  ? 393  ARG A CG  1 
ATOM   3000  C  CD  . ARG A 1  393  ? 120.618 5.370   -5.677  1.00 86.78  ? 393  ARG A CD  1 
ATOM   3001  N  NE  . ARG A 1  393  ? 121.530 4.607   -6.545  1.00 95.06  ? 393  ARG A NE  1 
ATOM   3002  C  CZ  . ARG A 1  393  ? 122.724 4.144   -6.158  1.00 97.54  ? 393  ARG A CZ  1 
ATOM   3003  N  NH1 . ARG A 1  393  ? 123.156 4.362   -4.916  1.00 99.88  ? 393  ARG A NH1 1 
ATOM   3004  N  NH2 . ARG A 1  393  ? 123.496 3.474   -7.013  1.00 97.82  ? 393  ARG A NH2 1 
ATOM   3005  N  N   . ASN A 1  394  ? 117.526 9.459   -4.056  1.00 48.60  ? 394  ASN A N   1 
ATOM   3006  C  CA  . ASN A 1  394  ? 116.879 9.975   -2.861  1.00 47.49  ? 394  ASN A CA  1 
ATOM   3007  C  C   . ASN A 1  394  ? 115.421 10.329  -3.035  1.00 47.62  ? 394  ASN A C   1 
ATOM   3008  O  O   . ASN A 1  394  ? 114.718 10.574  -2.053  1.00 46.75  ? 394  ASN A O   1 
ATOM   3009  C  CB  . ASN A 1  394  ? 117.633 11.181  -2.339  1.00 45.80  ? 394  ASN A CB  1 
ATOM   3010  C  CG  . ASN A 1  394  ? 118.669 10.802  -1.314  1.00 46.87  ? 394  ASN A CG  1 
ATOM   3011  O  OD1 . ASN A 1  394  ? 118.350 10.570  -0.147  1.00 45.22  ? 394  ASN A OD1 1 
ATOM   3012  N  ND2 . ASN A 1  394  ? 119.920 10.716  -1.746  1.00 48.61  ? 394  ASN A ND2 1 
ATOM   3013  N  N   . GLY A 1  395  ? 114.970 10.360  -4.285  1.00 49.21  ? 395  GLY A N   1 
ATOM   3014  C  CA  . GLY A 1  395  ? 113.577 10.671  -4.568  1.00 50.82  ? 395  GLY A CA  1 
ATOM   3015  C  C   . GLY A 1  395  ? 113.177 12.117  -4.327  1.00 49.59  ? 395  GLY A C   1 
ATOM   3016  O  O   . GLY A 1  395  ? 114.018 12.946  -3.991  1.00 54.94  ? 395  GLY A O   1 
ATOM   3017  N  N   . PRO A 1  396  ? 111.900 12.463  -4.519  1.00 44.77  ? 396  PRO A N   1 
ATOM   3018  C  CA  . PRO A 1  396  ? 111.512 13.843  -4.286  1.00 44.57  ? 396  PRO A CA  1 
ATOM   3019  C  C   . PRO A 1  396  ? 110.692 13.956  -3.030  1.00 47.09  ? 396  PRO A C   1 
ATOM   3020  O  O   . PRO A 1  396  ? 109.684 14.644  -3.014  1.00 50.56  ? 396  PRO A O   1 
ATOM   3021  C  CB  . PRO A 1  396  ? 110.695 14.159  -5.508  1.00 44.03  ? 396  PRO A CB  1 
ATOM   3022  C  CG  . PRO A 1  396  ? 109.915 12.919  -5.642  1.00 44.07  ? 396  PRO A CG  1 
ATOM   3023  C  CD  . PRO A 1  396  ? 110.954 11.832  -5.450  1.00 44.02  ? 396  PRO A CD  1 
ATOM   3024  N  N   . ASN A 1  397  ? 111.099 13.263  -1.980  1.00 51.41  ? 397  ASN A N   1 
ATOM   3025  C  CA  . ASN A 1  397  ? 110.365 13.353  -0.733  1.00 56.54  ? 397  ASN A CA  1 
ATOM   3026  C  C   . ASN A 1  397  ? 111.328 13.436  0.418   1.00 58.21  ? 397  ASN A C   1 
ATOM   3027  O  O   . ASN A 1  397  ? 111.019 14.035  1.450   1.00 58.54  ? 397  ASN A O   1 
ATOM   3028  C  CB  . ASN A 1  397  ? 109.422 12.173  -0.583  1.00 61.60  ? 397  ASN A CB  1 
ATOM   3029  C  CG  . ASN A 1  397  ? 108.142 12.368  -1.360  1.00 64.94  ? 397  ASN A CG  1 
ATOM   3030  O  OD1 . ASN A 1  397  ? 108.168 12.712  -2.545  1.00 65.97  ? 397  ASN A OD1 1 
ATOM   3031  N  ND2 . ASN A 1  397  ? 107.011 12.153  -0.700  1.00 67.46  ? 397  ASN A ND2 1 
ATOM   3032  N  N   . GLU A 1  398  ? 112.493 12.819  0.244   1.00 60.57  ? 398  GLU A N   1 
ATOM   3033  C  CA  . GLU A 1  398  ? 113.540 12.898  1.258   1.00 64.19  ? 398  GLU A CA  1 
ATOM   3034  C  C   . GLU A 1  398  ? 114.123 14.273  0.947   1.00 61.29  ? 398  GLU A C   1 
ATOM   3035  O  O   . GLU A 1  398  ? 114.081 14.683  -0.222  1.00 61.05  ? 398  GLU A O   1 
ATOM   3036  C  CB  . GLU A 1  398  ? 114.604 11.820  1.042   1.00 69.72  ? 398  GLU A CB  1 
ATOM   3037  C  CG  . GLU A 1  398  ? 114.403 10.566  1.878   1.00 77.99  ? 398  GLU A CG  1 
ATOM   3038  C  CD  . GLU A 1  398  ? 115.709 9.823   2.120   1.00 83.18  ? 398  GLU A CD  1 
ATOM   3039  O  OE1 . GLU A 1  398  ? 116.572 10.364  2.854   1.00 86.26  ? 398  GLU A OE1 1 
ATOM   3040  O  OE2 . GLU A 1  398  ? 115.874 8.705   1.574   1.00 85.57  ? 398  GLU A OE2 1 
ATOM   3041  N  N   . HIS A 1  399  ? 114.666 15.001  1.929   1.00 55.86  ? 399  HIS A N   1 
ATOM   3042  C  CA  . HIS A 1  399  ? 115.146 16.310  1.526   1.00 49.24  ? 399  HIS A CA  1 
ATOM   3043  C  C   . HIS A 1  399  ? 116.188 16.292  0.430   1.00 46.39  ? 399  HIS A C   1 
ATOM   3044  O  O   . HIS A 1  399  ? 115.832 16.270  -0.746  1.00 47.91  ? 399  HIS A O   1 
ATOM   3045  C  CB  . HIS A 1  399  ? 115.669 17.205  2.663   1.00 45.62  ? 399  HIS A CB  1 
ATOM   3046  C  CG  . HIS A 1  399  ? 116.217 18.513  2.149   1.00 41.21  ? 399  HIS A CG  1 
ATOM   3047  N  ND1 . HIS A 1  399  ? 115.552 19.275  1.203   1.00 35.64  ? 399  HIS A ND1 1 
ATOM   3048  C  CD2 . HIS A 1  399  ? 117.412 19.126  2.338   1.00 40.19  ? 399  HIS A CD2 1 
ATOM   3049  C  CE1 . HIS A 1  399  ? 116.314 20.286  0.828   1.00 31.55  ? 399  HIS A CE1 1 
ATOM   3050  N  NE2 . HIS A 1  399  ? 117.450 20.219  1.500   1.00 34.85  ? 399  HIS A NE2 1 
ATOM   3051  N  N   . PRO A 1  400  ? 117.480 16.258  0.793   1.00 41.57  ? 400  PRO A N   1 
ATOM   3052  C  CA  . PRO A 1  400  ? 118.491 16.267  -0.266  1.00 40.32  ? 400  PRO A CA  1 
ATOM   3053  C  C   . PRO A 1  400  ? 118.106 15.350  -1.416  1.00 41.74  ? 400  PRO A C   1 
ATOM   3054  O  O   . PRO A 1  400  ? 118.602 14.240  -1.499  1.00 47.37  ? 400  PRO A O   1 
ATOM   3055  C  CB  . PRO A 1  400  ? 119.752 15.806  0.458   1.00 39.44  ? 400  PRO A CB  1 
ATOM   3056  C  CG  . PRO A 1  400  ? 119.462 16.096  1.916   1.00 40.13  ? 400  PRO A CG  1 
ATOM   3057  C  CD  . PRO A 1  400  ? 118.039 15.703  2.037   1.00 38.84  ? 400  PRO A CD  1 
ATOM   3058  N  N   . GLY A 1  401  ? 117.228 15.809  -2.305  1.00 39.63  ? 401  GLY A N   1 
ATOM   3059  C  CA  . GLY A 1  401  ? 116.791 14.976  -3.415  1.00 35.22  ? 401  GLY A CA  1 
ATOM   3060  C  C   . GLY A 1  401  ? 116.538 15.740  -4.695  1.00 32.50  ? 401  GLY A C   1 
ATOM   3061  O  O   . GLY A 1  401  ? 117.105 16.801  -4.899  1.00 34.47  ? 401  GLY A O   1 
ATOM   3062  N  N   . ALA A 1  402  ? 115.684 15.212  -5.559  1.00 28.70  ? 402  ALA A N   1 
ATOM   3063  C  CA  . ALA A 1  402  ? 115.392 15.873  -6.825  1.00 26.43  ? 402  ALA A CA  1 
ATOM   3064  C  C   . ALA A 1  402  ? 114.001 15.483  -7.248  1.00 26.32  ? 402  ALA A C   1 
ATOM   3065  O  O   . ALA A 1  402  ? 113.380 14.654  -6.586  1.00 27.56  ? 402  ALA A O   1 
ATOM   3066  C  CB  . ALA A 1  402  ? 116.380 15.435  -7.872  1.00 28.72  ? 402  ALA A CB  1 
ATOM   3067  N  N   . LYS A 1  403  ? 113.504 16.051  -8.345  1.00 23.78  ? 403  LYS A N   1 
ATOM   3068  C  CA  . LYS A 1  403  ? 112.158 15.692  -8.772  1.00 25.20  ? 403  LYS A CA  1 
ATOM   3069  C  C   . LYS A 1  403  ? 111.870 15.736  -10.250 1.00 23.02  ? 403  LYS A C   1 
ATOM   3070  O  O   . LYS A 1  403  ? 110.736 15.955  -10.654 1.00 24.39  ? 403  LYS A O   1 
ATOM   3071  C  CB  . LYS A 1  403  ? 111.110 16.536  -8.042  1.00 28.86  ? 403  LYS A CB  1 
ATOM   3072  C  CG  . LYS A 1  403  ? 111.148 18.012  -8.362  1.00 33.42  ? 403  LYS A CG  1 
ATOM   3073  C  CD  . LYS A 1  403  ? 109.844 18.703  -7.984  1.00 37.52  ? 403  LYS A CD  1 
ATOM   3074  C  CE  . LYS A 1  403  ? 109.500 18.492  -6.523  1.00 41.08  ? 403  LYS A CE  1 
ATOM   3075  N  NZ  . LYS A 1  403  ? 108.292 19.286  -6.186  1.00 46.50  ? 403  LYS A NZ  1 
ATOM   3076  N  N   . TYR A 1  404  ? 112.897 15.510  -11.048 1.00 22.28  ? 404  TYR A N   1 
ATOM   3077  C  CA  . TYR A 1  404  ? 112.775 15.478  -12.497 1.00 22.99  ? 404  TYR A CA  1 
ATOM   3078  C  C   . TYR A 1  404  ? 114.180 15.305  -13.053 1.00 22.49  ? 404  TYR A C   1 
ATOM   3079  O  O   . TYR A 1  404  ? 115.143 15.819  -12.486 1.00 21.73  ? 404  TYR A O   1 
ATOM   3080  C  CB  . TYR A 1  404  ? 112.203 16.785  -13.046 1.00 27.65  ? 404  TYR A CB  1 
ATOM   3081  C  CG  . TYR A 1  404  ? 110.695 16.951  -13.035 1.00 34.92  ? 404  TYR A CG  1 
ATOM   3082  C  CD1 . TYR A 1  404  ? 110.117 18.115  -12.528 1.00 38.49  ? 404  TYR A CD1 1 
ATOM   3083  C  CD2 . TYR A 1  404  ? 109.849 15.977  -13.549 1.00 38.32  ? 404  TYR A CD2 1 
ATOM   3084  C  CE1 . TYR A 1  404  ? 108.732 18.310  -12.527 1.00 42.69  ? 404  TYR A CE1 1 
ATOM   3085  C  CE2 . TYR A 1  404  ? 108.450 16.164  -13.555 1.00 43.77  ? 404  TYR A CE2 1 
ATOM   3086  C  CZ  . TYR A 1  404  ? 107.901 17.336  -13.039 1.00 43.59  ? 404  TYR A CZ  1 
ATOM   3087  O  OH  . TYR A 1  404  ? 106.533 17.548  -13.016 1.00 46.58  ? 404  TYR A OH  1 
ATOM   3088  N  N   . VAL A 1  405  ? 114.302 14.574  -14.152 1.00 21.62  ? 405  VAL A N   1 
ATOM   3089  C  CA  . VAL A 1  405  ? 115.595 14.367  -14.794 1.00 20.10  ? 405  VAL A CA  1 
ATOM   3090  C  C   . VAL A 1  405  ? 115.291 14.600  -16.252 1.00 21.97  ? 405  VAL A C   1 
ATOM   3091  O  O   . VAL A 1  405  ? 114.197 14.282  -16.699 1.00 21.59  ? 405  VAL A O   1 
ATOM   3092  C  CB  . VAL A 1  405  ? 116.107 12.922  -14.601 1.00 16.77  ? 405  VAL A CB  1 
ATOM   3093  C  CG1 . VAL A 1  405  ? 117.340 12.681  -15.443 1.00 13.04  ? 405  VAL A CG1 1 
ATOM   3094  C  CG2 . VAL A 1  405  ? 116.436 12.682  -13.148 1.00 15.39  ? 405  VAL A CG2 1 
ATOM   3095  N  N   . ILE A 1  406  ? 116.219 15.164  -17.005 1.00 26.33  ? 406  ILE A N   1 
ATOM   3096  C  CA  . ILE A 1  406  ? 115.910 15.385  -18.400 1.00 33.69  ? 406  ILE A CA  1 
ATOM   3097  C  C   . ILE A 1  406  ? 117.008 15.057  -19.360 1.00 39.99  ? 406  ILE A C   1 
ATOM   3098  O  O   . ILE A 1  406  ? 118.148 15.500  -19.233 1.00 41.12  ? 406  ILE A O   1 
ATOM   3099  C  CB  . ILE A 1  406  ? 115.430 16.803  -18.647 1.00 32.23  ? 406  ILE A CB  1 
ATOM   3100  C  CG1 . ILE A 1  406  ? 115.917 17.717  -17.524 1.00 31.32  ? 406  ILE A CG1 1 
ATOM   3101  C  CG2 . ILE A 1  406  ? 113.915 16.802  -18.769 1.00 34.71  ? 406  ILE A CG2 1 
ATOM   3102  C  CD1 . ILE A 1  406  ? 115.296 19.103  -17.543 1.00 31.42  ? 406  ILE A CD1 1 
ATOM   3103  N  N   . ARG A 1  407  ? 116.614 14.270  -20.345 1.00 47.42  ? 407  ARG A N   1 
ATOM   3104  C  CA  . ARG A 1  407  ? 117.504 13.783  -21.369 1.00 57.30  ? 407  ARG A CA  1 
ATOM   3105  C  C   . ARG A 1  407  ? 117.601 14.749  -22.532 1.00 64.34  ? 407  ARG A C   1 
ATOM   3106  O  O   . ARG A 1  407  ? 116.741 15.608  -22.724 1.00 67.65  ? 407  ARG A O   1 
ATOM   3107  C  CB  . ARG A 1  407  ? 116.988 12.422  -21.854 1.00 57.62  ? 407  ARG A CB  1 
ATOM   3108  C  CG  . ARG A 1  407  ? 116.602 11.468  -20.707 1.00 58.47  ? 407  ARG A CG  1 
ATOM   3109  C  CD  . ARG A 1  407  ? 115.338 10.660  -21.007 1.00 59.79  ? 407  ARG A CD  1 
ATOM   3110  N  NE  . ARG A 1  407  ? 115.533 9.709   -22.099 1.00 63.14  ? 407  ARG A NE  1 
ATOM   3111  C  CZ  . ARG A 1  407  ? 114.544 9.104   -22.753 1.00 64.92  ? 407  ARG A CZ  1 
ATOM   3112  N  NH1 . ARG A 1  407  ? 113.280 9.353   -22.421 1.00 65.90  ? 407  ARG A NH1 1 
ATOM   3113  N  NH2 . ARG A 1  407  ? 114.818 8.263   -23.750 1.00 63.05  ? 407  ARG A NH2 1 
ATOM   3114  N  N   . ASP A 1  408  ? 118.674 14.588  -23.295 1.00 71.54  ? 408  ASP A N   1 
ATOM   3115  C  CA  . ASP A 1  408  ? 118.960 15.375  -24.485 1.00 78.14  ? 408  ASP A CA  1 
ATOM   3116  C  C   . ASP A 1  408  ? 117.773 15.359  -25.457 1.00 81.00  ? 408  ASP A C   1 
ATOM   3117  O  O   . ASP A 1  408  ? 117.554 16.311  -26.212 1.00 81.91  ? 408  ASP A O   1 
ATOM   3118  C  CB  . ASP A 1  408  ? 120.192 14.780  -25.165 1.00 82.17  ? 408  ASP A CB  1 
ATOM   3119  C  CG  . ASP A 1  408  ? 120.368 13.284  -24.852 1.00 86.41  ? 408  ASP A CG  1 
ATOM   3120  O  OD1 . ASP A 1  408  ? 119.408 12.498  -25.053 1.00 86.11  ? 408  ASP A OD1 1 
ATOM   3121  O  OD2 . ASP A 1  408  ? 121.470 12.895  -24.400 1.00 88.35  ? 408  ASP A OD2 1 
ATOM   3122  N  N   . SER A 1  409  ? 117.019 14.262  -25.434 1.00 82.50  ? 409  SER A N   1 
ATOM   3123  C  CA  . SER A 1  409  ? 115.855 14.090  -26.296 1.00 82.98  ? 409  SER A CA  1 
ATOM   3124  C  C   . SER A 1  409  ? 114.753 15.071  -25.918 1.00 83.83  ? 409  SER A C   1 
ATOM   3125  O  O   . SER A 1  409  ? 113.646 15.015  -26.453 1.00 85.05  ? 409  SER A O   1 
ATOM   3126  C  CB  . SER A 1  409  ? 115.326 12.662  -26.172 1.00 82.71  ? 409  SER A CB  1 
ATOM   3127  O  OG  . SER A 1  409  ? 114.908 12.400  -24.844 1.00 82.55  ? 409  SER A OG  1 
ATOM   3128  N  N   . GLY A 1  410  ? 115.060 15.968  -24.987 1.00 84.15  ? 410  GLY A N   1 
ATOM   3129  C  CA  . GLY A 1  410  ? 114.081 16.943  -24.557 1.00 84.98  ? 410  GLY A CA  1 
ATOM   3130  C  C   . GLY A 1  410  ? 112.788 16.272  -24.139 1.00 85.76  ? 410  GLY A C   1 
ATOM   3131  O  O   . GLY A 1  410  ? 111.787 16.319  -24.864 1.00 88.78  ? 410  GLY A O   1 
ATOM   3132  N  N   . ASP A 1  411  ? 112.818 15.630  -22.974 1.00 83.35  ? 411  ASP A N   1 
ATOM   3133  C  CA  . ASP A 1  411  ? 111.643 14.956  -22.431 1.00 80.88  ? 411  ASP A CA  1 
ATOM   3134  C  C   . ASP A 1  411  ? 111.782 14.832  -20.920 1.00 76.97  ? 411  ASP A C   1 
ATOM   3135  O  O   . ASP A 1  411  ? 112.860 14.509  -20.421 1.00 77.43  ? 411  ASP A O   1 
ATOM   3136  C  CB  . ASP A 1  411  ? 111.483 13.575  -23.061 1.00 83.74  ? 411  ASP A CB  1 
ATOM   3137  C  CG  . ASP A 1  411  ? 110.268 12.841  -22.539 1.00 85.20  ? 411  ASP A CG  1 
ATOM   3138  O  OD1 . ASP A 1  411  ? 109.198 13.485  -22.412 1.00 83.86  ? 411  ASP A OD1 1 
ATOM   3139  O  OD2 . ASP A 1  411  ? 110.387 11.624  -22.265 1.00 86.18  ? 411  ASP A OD2 1 
ATOM   3140  N  N   . ARG A 1  412  ? 110.693 15.079  -20.196 1.00 71.46  ? 412  ARG A N   1 
ATOM   3141  C  CA  . ARG A 1  412  ? 110.719 15.025  -18.734 1.00 66.01  ? 412  ARG A CA  1 
ATOM   3142  C  C   . ARG A 1  412  ? 110.573 13.627  -18.151 1.00 59.15  ? 412  ARG A C   1 
ATOM   3143  O  O   . ARG A 1  412  ? 109.965 12.749  -18.748 1.00 59.52  ? 412  ARG A O   1 
ATOM   3144  C  CB  . ARG A 1  412  ? 109.626 15.929  -18.163 1.00 70.70  ? 412  ARG A CB  1 
ATOM   3145  C  CG  . ARG A 1  412  ? 109.385 17.180  -19.002 1.00 77.18  ? 412  ARG A CG  1 
ATOM   3146  C  CD  . ARG A 1  412  ? 108.570 18.227  -18.251 1.00 79.82  ? 412  ARG A CD  1 
ATOM   3147  N  NE  . ARG A 1  412  ? 109.362 18.881  -17.208 1.00 80.36  ? 412  ARG A NE  1 
ATOM   3148  C  CZ  . ARG A 1  412  ? 110.445 19.623  -17.440 1.00 79.52  ? 412  ARG A CZ  1 
ATOM   3149  N  NH1 . ARG A 1  412  ? 110.875 19.818  -18.680 1.00 79.54  ? 412  ARG A NH1 1 
ATOM   3150  N  NH2 . ARG A 1  412  ? 111.107 20.166  -16.428 1.00 78.40  ? 412  ARG A NH2 1 
ATOM   3151  N  N   . ILE A 1  413  ? 111.144 13.430  -16.975 1.00 50.32  ? 413  ILE A N   1 
ATOM   3152  C  CA  . ILE A 1  413  ? 111.077 12.146  -16.308 1.00 45.21  ? 413  ILE A CA  1 
ATOM   3153  C  C   . ILE A 1  413  ? 110.539 12.431  -14.934 1.00 43.43  ? 413  ILE A C   1 
ATOM   3154  O  O   . ILE A 1  413  ? 111.275 12.866  -14.053 1.00 44.20  ? 413  ILE A O   1 
ATOM   3155  C  CB  . ILE A 1  413  ? 112.463 11.525  -16.188 1.00 43.47  ? 413  ILE A CB  1 
ATOM   3156  C  CG1 . ILE A 1  413  ? 113.016 11.266  -17.585 1.00 44.55  ? 413  ILE A CG1 1 
ATOM   3157  C  CG2 . ILE A 1  413  ? 112.398 10.240  -15.397 1.00 40.35  ? 413  ILE A CG2 1 
ATOM   3158  C  CD1 . ILE A 1  413  ? 114.374 10.607  -17.586 1.00 47.35  ? 413  ILE A CD1 1 
ATOM   3159  N  N   . ASP A 1  414  ? 109.252 12.181  -14.746 1.00 40.67  ? 414  ASP A N   1 
ATOM   3160  C  CA  . ASP A 1  414  ? 108.633 12.476  -13.470 1.00 37.62  ? 414  ASP A CA  1 
ATOM   3161  C  C   . ASP A 1  414  ? 109.078 11.582  -12.321 1.00 34.54  ? 414  ASP A C   1 
ATOM   3162  O  O   . ASP A 1  414  ? 108.373 10.671  -11.927 1.00 33.85  ? 414  ASP A O   1 
ATOM   3163  C  CB  . ASP A 1  414  ? 107.115 12.429  -13.610 1.00 40.13  ? 414  ASP A CB  1 
ATOM   3164  C  CG  . ASP A 1  414  ? 106.420 13.196  -12.508 1.00 40.39  ? 414  ASP A CG  1 
ATOM   3165  O  OD1 . ASP A 1  414  ? 107.062 13.371  -11.453 1.00 41.53  ? 414  ASP A OD1 1 
ATOM   3166  O  OD2 . ASP A 1  414  ? 105.252 13.616  -12.690 1.00 38.61  ? 414  ASP A OD2 1 
ATOM   3167  N  N   . LEU A 1  415  ? 110.239 11.869  -11.757 1.00 32.49  ? 415  LEU A N   1 
ATOM   3168  C  CA  . LEU A 1  415  ? 110.762 11.060  -10.668 1.00 30.00  ? 415  LEU A CA  1 
ATOM   3169  C  C   . LEU A 1  415  ? 109.786 10.644  -9.585  1.00 29.90  ? 415  LEU A C   1 
ATOM   3170  O  O   . LEU A 1  415  ? 110.096 9.764   -8.782  1.00 29.05  ? 415  LEU A O   1 
ATOM   3171  C  CB  . LEU A 1  415  ? 111.962 11.745  -10.022 1.00 28.02  ? 415  LEU A CB  1 
ATOM   3172  C  CG  . LEU A 1  415  ? 113.262 11.608  -10.817 1.00 25.43  ? 415  LEU A CG  1 
ATOM   3173  C  CD1 . LEU A 1  415  ? 114.392 12.282  -10.079 1.00 27.99  ? 415  LEU A CD1 1 
ATOM   3174  C  CD2 . LEU A 1  415  ? 113.593 10.156  -10.996 1.00 24.12  ? 415  LEU A CD2 1 
ATOM   3175  N  N   . ARG A 1  416  ? 108.612 11.250  -9.528  1.00 31.58  ? 416  ARG A N   1 
ATOM   3176  C  CA  . ARG A 1  416  ? 107.691 10.814  -8.494  1.00 38.19  ? 416  ARG A CA  1 
ATOM   3177  C  C   . ARG A 1  416  ? 106.839 9.632   -8.939  1.00 39.19  ? 416  ARG A C   1 
ATOM   3178  O  O   . ARG A 1  416  ? 106.188 8.997   -8.106  1.00 42.19  ? 416  ARG A O   1 
ATOM   3179  C  CB  . ARG A 1  416  ? 106.803 11.967  -8.000  1.00 42.03  ? 416  ARG A CB  1 
ATOM   3180  C  CG  . ARG A 1  416  ? 106.629 13.128  -8.959  1.00 48.02  ? 416  ARG A CG  1 
ATOM   3181  C  CD  . ARG A 1  416  ? 105.675 14.186  -8.404  1.00 51.02  ? 416  ARG A CD  1 
ATOM   3182  N  NE  . ARG A 1  416  ? 105.168 15.052  -9.466  1.00 54.40  ? 416  ARG A NE  1 
ATOM   3183  C  CZ  . ARG A 1  416  ? 103.985 15.658  -9.429  1.00 55.80  ? 416  ARG A CZ  1 
ATOM   3184  N  NH1 . ARG A 1  416  ? 103.190 15.492  -8.377  1.00 56.60  ? 416  ARG A NH1 1 
ATOM   3185  N  NH2 . ARG A 1  416  ? 103.587 16.410  -10.449 1.00 56.30  ? 416  ARG A NH2 1 
ATOM   3186  N  N   . TYR A 1  417  ? 106.858 9.339   -10.242 1.00 38.23  ? 417  TYR A N   1 
ATOM   3187  C  CA  . TYR A 1  417  ? 106.112 8.218   -10.831 1.00 37.60  ? 417  TYR A CA  1 
ATOM   3188  C  C   . TYR A 1  417  ? 107.086 7.397   -11.670 1.00 37.43  ? 417  TYR A C   1 
ATOM   3189  O  O   . TYR A 1  417  ? 107.963 6.731   -11.138 1.00 38.47  ? 417  TYR A O   1 
ATOM   3190  C  CB  . TYR A 1  417  ? 104.991 8.744   -11.719 1.00 39.29  ? 417  TYR A CB  1 
ATOM   3191  C  CG  . TYR A 1  417  ? 104.069 9.724   -11.023 1.00 47.20  ? 417  TYR A CG  1 
ATOM   3192  C  CD1 . TYR A 1  417  ? 103.239 10.579  -11.756 1.00 51.07  ? 417  TYR A CD1 1 
ATOM   3193  C  CD2 . TYR A 1  417  ? 104.007 9.786   -9.631  1.00 50.70  ? 417  TYR A CD2 1 
ATOM   3194  C  CE1 . TYR A 1  417  ? 102.371 11.467  -11.114 1.00 53.17  ? 417  TYR A CE1 1 
ATOM   3195  C  CE2 . TYR A 1  417  ? 103.149 10.663  -8.980  1.00 53.10  ? 417  TYR A CE2 1 
ATOM   3196  C  CZ  . TYR A 1  417  ? 102.334 11.498  -9.725  1.00 53.63  ? 417  TYR A CZ  1 
ATOM   3197  O  OH  . TYR A 1  417  ? 101.468 12.339  -9.066  1.00 56.65  ? 417  TYR A OH  1 
ATOM   3198  N  N   . SER A 1  418  ? 106.933 7.454   -12.984 1.00 39.49  ? 418  SER A N   1 
ATOM   3199  C  CA  . SER A 1  418  ? 107.826 6.748   -13.901 1.00 41.15  ? 418  SER A CA  1 
ATOM   3200  C  C   . SER A 1  418  ? 108.481 5.483   -13.380 1.00 41.32  ? 418  SER A C   1 
ATOM   3201  O  O   . SER A 1  418  ? 109.555 5.545   -12.768 1.00 36.16  ? 418  SER A O   1 
ATOM   3202  C  CB  . SER A 1  418  ? 108.941 7.677   -14.389 1.00 41.53  ? 418  SER A CB  1 
ATOM   3203  O  OG  . SER A 1  418  ? 109.861 6.975   -15.212 1.00 40.20  ? 418  SER A OG  1 
ATOM   3204  N  N   . LYS A 1  419  ? 107.835 4.350   -13.670 1.00 43.89  ? 419  LYS A N   1 
ATOM   3205  C  CA  . LYS A 1  419  ? 108.283 3.005   -13.291 1.00 45.29  ? 419  LYS A CA  1 
ATOM   3206  C  C   . LYS A 1  419  ? 109.785 2.893   -13.033 1.00 46.70  ? 419  LYS A C   1 
ATOM   3207  O  O   . LYS A 1  419  ? 110.209 2.314   -12.022 1.00 43.66  ? 419  LYS A O   1 
ATOM   3208  C  CB  . LYS A 1  419  ? 107.887 2.007   -14.387 1.00 43.79  ? 419  LYS A CB  1 
ATOM   3209  C  CG  . LYS A 1  419  ? 108.410 2.367   -15.768 1.00 45.44  ? 419  LYS A CG  1 
ATOM   3210  C  CD  . LYS A 1  419  ? 108.325 1.198   -16.717 1.00 50.81  ? 419  LYS A CD  1 
ATOM   3211  C  CE  . LYS A 1  419  ? 106.899 0.710   -16.869 1.00 54.83  ? 419  LYS A CE  1 
ATOM   3212  N  NZ  . LYS A 1  419  ? 106.166 1.419   -17.946 1.00 60.01  ? 419  LYS A NZ  1 
ATOM   3213  N  N   . ARG A 1  420  ? 110.575 3.448   -13.955 1.00 49.66  ? 420  ARG A N   1 
ATOM   3214  C  CA  . ARG A 1  420  ? 112.034 3.432   -13.871 1.00 51.87  ? 420  ARG A CA  1 
ATOM   3215  C  C   . ARG A 1  420  ? 112.549 4.490   -12.915 1.00 53.05  ? 420  ARG A C   1 
ATOM   3216  O  O   . ARG A 1  420  ? 113.647 5.000   -13.082 1.00 52.07  ? 420  ARG A O   1 
ATOM   3217  C  CB  . ARG A 1  420  ? 112.666 3.668   -15.247 1.00 49.30  ? 420  ARG A CB  1 
ATOM   3218  C  CG  . ARG A 1  420  ? 112.236 2.686   -16.317 1.00 47.99  ? 420  ARG A CG  1 
ATOM   3219  C  CD  . ARG A 1  420  ? 113.045 2.850   -17.590 1.00 45.14  ? 420  ARG A CD  1 
ATOM   3220  N  NE  . ARG A 1  420  ? 114.460 2.564   -17.375 1.00 44.88  ? 420  ARG A NE  1 
ATOM   3221  C  CZ  . ARG A 1  420  ? 115.363 2.491   -18.349 1.00 47.05  ? 420  ARG A CZ  1 
ATOM   3222  N  NH1 . ARG A 1  420  ? 115.000 2.680   -19.612 1.00 47.25  ? 420  ARG A NH1 1 
ATOM   3223  N  NH2 . ARG A 1  420  ? 116.634 2.237   -18.064 1.00 48.96  ? 420  ARG A NH2 1 
ATOM   3224  N  N   . ALA A 1  421  ? 111.752 4.827   -11.917 1.00 57.54  ? 421  ALA A N   1 
ATOM   3225  C  CA  . ALA A 1  421  ? 112.176 5.816   -10.950 1.00 63.71  ? 421  ALA A CA  1 
ATOM   3226  C  C   . ALA A 1  421  ? 113.521 5.392   -10.363 1.00 67.25  ? 421  ALA A C   1 
ATOM   3227  O  O   . ALA A 1  421  ? 114.541 6.017   -10.643 1.00 68.62  ? 421  ALA A O   1 
ATOM   3228  C  CB  . ALA A 1  421  ? 111.138 5.949   -9.848  1.00 68.40  ? 421  ALA A CB  1 
ATOM   3229  N  N   . GLY A 1  422  ? 113.519 4.319   -9.571  1.00 70.09  ? 422  GLY A N   1 
ATOM   3230  C  CA  . GLY A 1  422  ? 114.742 3.832   -8.940  1.00 72.31  ? 422  GLY A CA  1 
ATOM   3231  C  C   . GLY A 1  422  ? 115.876 3.451   -9.877  1.00 72.21  ? 422  GLY A C   1 
ATOM   3232  O  O   . GLY A 1  422  ? 117.051 3.467   -9.498  1.00 72.55  ? 422  GLY A O   1 
ATOM   3233  N  N   . ASP A 1  423  ? 115.513 3.098   -11.102 1.00 71.91  ? 423  ASP A N   1 
ATOM   3234  C  CA  . ASP A 1  423  ? 116.466 2.715   -12.136 1.00 73.29  ? 423  ASP A CA  1 
ATOM   3235  C  C   . ASP A 1  423  ? 117.382 3.911   -12.427 1.00 71.98  ? 423  ASP A C   1 
ATOM   3236  O  O   . ASP A 1  423  ? 118.074 4.424   -11.548 1.00 72.75  ? 423  ASP A O   1 
ATOM   3237  C  CB  . ASP A 1  423  ? 115.674 2.342   -13.397 1.00 77.95  ? 423  ASP A CB  1 
ATOM   3238  C  CG  . ASP A 1  423  ? 116.523 1.675   -14.464 1.00 81.62  ? 423  ASP A CG  1 
ATOM   3239  O  OD1 . ASP A 1  423  ? 117.622 2.179   -14.777 1.00 83.54  ? 423  ASP A OD1 1 
ATOM   3240  O  OD2 . ASP A 1  423  ? 116.072 0.644   -15.008 1.00 84.43  ? 423  ASP A OD2 1 
ATOM   3241  N  N   . ILE A 1  424  ? 117.375 4.323   -13.688 1.00 69.71  ? 424  ILE A N   1 
ATOM   3242  C  CA  . ILE A 1  424  ? 118.123 5.464   -14.190 1.00 66.82  ? 424  ILE A CA  1 
ATOM   3243  C  C   . ILE A 1  424  ? 119.609 5.605   -13.921 1.00 68.95  ? 424  ILE A C   1 
ATOM   3244  O  O   . ILE A 1  424  ? 120.067 5.638   -12.780 1.00 69.39  ? 424  ILE A O   1 
ATOM   3245  C  CB  . ILE A 1  424  ? 117.468 6.736   -13.737 1.00 62.74  ? 424  ILE A CB  1 
ATOM   3246  C  CG1 . ILE A 1  424  ? 115.961 6.571   -13.846 1.00 60.84  ? 424  ILE A CG1 1 
ATOM   3247  C  CG2 . ILE A 1  424  ? 117.925 7.878   -14.610 1.00 64.06  ? 424  ILE A CG2 1 
ATOM   3248  C  CD1 . ILE A 1  424  ? 115.198 7.692   -13.267 1.00 62.54  ? 424  ILE A CD1 1 
ATOM   3249  N  N   . GLN A 1  425  ? 120.347 5.712   -15.017 1.00 71.25  ? 425  GLN A N   1 
ATOM   3250  C  CA  . GLN A 1  425  ? 121.788 5.897   -14.997 1.00 72.95  ? 425  GLN A CA  1 
ATOM   3251  C  C   . GLN A 1  425  ? 121.935 7.249   -15.672 1.00 69.60  ? 425  GLN A C   1 
ATOM   3252  O  O   . GLN A 1  425  ? 121.694 7.373   -16.880 1.00 70.40  ? 425  GLN A O   1 
ATOM   3253  C  CB  . GLN A 1  425  ? 122.486 4.830   -15.846 1.00 81.88  ? 425  GLN A CB  1 
ATOM   3254  C  CG  . GLN A 1  425  ? 121.550 3.796   -16.486 1.00 93.61  ? 425  GLN A CG  1 
ATOM   3255  C  CD  . GLN A 1  425  ? 121.141 2.690   -15.518 1.00 100.09 ? 425  GLN A CD  1 
ATOM   3256  O  OE1 . GLN A 1  425  ? 120.579 2.954   -14.448 1.00 103.97 ? 425  GLN A OE1 1 
ATOM   3257  N  NE2 . GLN A 1  425  ? 121.424 1.442   -15.892 1.00 102.87 ? 425  GLN A NE2 1 
ATOM   3258  N  N   . LEU A 1  426  ? 122.313 8.264   -14.903 1.00 63.64  ? 426  LEU A N   1 
ATOM   3259  C  CA  . LEU A 1  426  ? 122.443 9.605   -15.458 1.00 58.78  ? 426  LEU A CA  1 
ATOM   3260  C  C   . LEU A 1  426  ? 123.405 9.714   -16.645 1.00 58.85  ? 426  LEU A C   1 
ATOM   3261  O  O   . LEU A 1  426  ? 124.137 8.776   -16.962 1.00 58.89  ? 426  LEU A O   1 
ATOM   3262  C  CB  . LEU A 1  426  ? 122.814 10.585  -14.344 1.00 50.94  ? 426  LEU A CB  1 
ATOM   3263  C  CG  . LEU A 1  426  ? 121.682 10.733  -13.320 1.00 44.34  ? 426  LEU A CG  1 
ATOM   3264  C  CD1 . LEU A 1  426  ? 122.057 11.759  -12.268 1.00 42.51  ? 426  LEU A CD1 1 
ATOM   3265  C  CD2 . LEU A 1  426  ? 120.400 11.155  -14.030 1.00 38.45  ? 426  LEU A CD2 1 
ATOM   3266  N  N   . GLN A 1  427  ? 123.391 10.858  -17.315 1.00 58.88  ? 427  GLN A N   1 
ATOM   3267  C  CA  . GLN A 1  427  ? 124.242 11.032  -18.478 1.00 60.53  ? 427  GLN A CA  1 
ATOM   3268  C  C   . GLN A 1  427  ? 124.844 12.416  -18.681 1.00 58.67  ? 427  GLN A C   1 
ATOM   3269  O  O   . GLN A 1  427  ? 124.189 13.441  -18.492 1.00 59.06  ? 427  GLN A O   1 
ATOM   3270  C  CB  . GLN A 1  427  ? 123.458 10.658  -19.725 1.00 67.42  ? 427  GLN A CB  1 
ATOM   3271  C  CG  . GLN A 1  427  ? 122.969 9.236   -19.743 1.00 77.22  ? 427  GLN A CG  1 
ATOM   3272  C  CD  . GLN A 1  427  ? 123.307 8.560   -21.048 1.00 83.31  ? 427  GLN A CD  1 
ATOM   3273  O  OE1 . GLN A 1  427  ? 124.478 8.285   -21.331 1.00 86.84  ? 427  GLN A OE1 1 
ATOM   3274  N  NE2 . GLN A 1  427  ? 122.287 8.301   -21.866 1.00 87.70  ? 427  GLN A NE2 1 
ATOM   3275  N  N   . TYR A 1  428  ? 126.100 12.436  -19.094 1.00 56.64  ? 428  TYR A N   1 
ATOM   3276  C  CA  . TYR A 1  428  ? 126.782 13.686  -19.354 1.00 57.04  ? 428  TYR A CA  1 
ATOM   3277  C  C   . TYR A 1  428  ? 125.984 14.508  -20.351 1.00 56.34  ? 428  TYR A C   1 
ATOM   3278  O  O   . TYR A 1  428  ? 125.907 14.154  -21.528 1.00 58.90  ? 428  TYR A O   1 
ATOM   3279  C  CB  . TYR A 1  428  ? 128.167 13.398  -19.921 1.00 61.38  ? 428  TYR A CB  1 
ATOM   3280  C  CG  . TYR A 1  428  ? 129.036 12.676  -18.937 1.00 64.68  ? 428  TYR A CG  1 
ATOM   3281  C  CD1 . TYR A 1  428  ? 128.983 11.291  -18.814 1.00 67.18  ? 428  TYR A CD1 1 
ATOM   3282  C  CD2 . TYR A 1  428  ? 129.845 13.387  -18.056 1.00 65.65  ? 428  TYR A CD2 1 
ATOM   3283  C  CE1 . TYR A 1  428  ? 129.712 10.635  -17.825 1.00 68.57  ? 428  TYR A CE1 1 
ATOM   3284  C  CE2 . TYR A 1  428  ? 130.570 12.750  -17.073 1.00 66.15  ? 428  TYR A CE2 1 
ATOM   3285  C  CZ  . TYR A 1  428  ? 130.503 11.379  -16.955 1.00 67.88  ? 428  TYR A CZ  1 
ATOM   3286  O  OH  . TYR A 1  428  ? 131.217 10.765  -15.951 1.00 69.38  ? 428  TYR A OH  1 
ATOM   3287  N  N   . GLY A 1  429  ? 125.384 15.600  -19.894 1.00 53.13  ? 429  GLY A N   1 
ATOM   3288  C  CA  . GLY A 1  429  ? 124.618 16.421  -20.815 1.00 51.15  ? 429  GLY A CA  1 
ATOM   3289  C  C   . GLY A 1  429  ? 123.155 16.430  -20.456 1.00 47.33  ? 429  GLY A C   1 
ATOM   3290  O  O   . GLY A 1  429  ? 122.333 17.096  -21.090 1.00 49.28  ? 429  GLY A O   1 
ATOM   3291  N  N   . TRP A 1  430  ? 122.831 15.661  -19.431 1.00 43.72  ? 430  TRP A N   1 
ATOM   3292  C  CA  . TRP A 1  430  ? 121.467 15.586  -18.960 1.00 40.32  ? 430  TRP A CA  1 
ATOM   3293  C  C   . TRP A 1  430  ? 121.386 16.607  -17.859 1.00 36.10  ? 430  TRP A C   1 
ATOM   3294  O  O   . TRP A 1  430  ? 122.404 17.171  -17.455 1.00 34.23  ? 430  TRP A O   1 
ATOM   3295  C  CB  . TRP A 1  430  ? 121.163 14.196  -18.398 1.00 42.54  ? 430  TRP A CB  1 
ATOM   3296  C  CG  . TRP A 1  430  ? 120.837 13.164  -19.434 1.00 43.70  ? 430  TRP A CG  1 
ATOM   3297  C  CD1 . TRP A 1  430  ? 121.125 13.212  -20.771 1.00 46.77  ? 430  TRP A CD1 1 
ATOM   3298  C  CD2 . TRP A 1  430  ? 120.157 11.929  -19.215 1.00 44.68  ? 430  TRP A CD2 1 
ATOM   3299  N  NE1 . TRP A 1  430  ? 120.661 12.082  -21.396 1.00 49.02  ? 430  TRP A NE1 1 
ATOM   3300  C  CE2 . TRP A 1  430  ? 120.064 11.277  -20.463 1.00 47.76  ? 430  TRP A CE2 1 
ATOM   3301  C  CE3 . TRP A 1  430  ? 119.618 11.308  -18.082 1.00 44.23  ? 430  TRP A CE3 1 
ATOM   3302  C  CZ2 . TRP A 1  430  ? 119.446 10.034  -20.611 1.00 49.97  ? 430  TRP A CZ2 1 
ATOM   3303  C  CZ3 . TRP A 1  430  ? 119.005 10.077  -18.228 1.00 45.34  ? 430  TRP A CZ3 1 
ATOM   3304  C  CH2 . TRP A 1  430  ? 118.926 9.450   -19.484 1.00 48.23  ? 430  TRP A CH2 1 
ATOM   3305  N  N   . LYS A 1  431  ? 120.172 16.845  -17.387 1.00 31.62  ? 431  LYS A N   1 
ATOM   3306  C  CA  . LYS A 1  431  ? 119.952 17.793  -16.315 1.00 29.52  ? 431  LYS A CA  1 
ATOM   3307  C  C   . LYS A 1  431  ? 119.075 17.140  -15.260 1.00 26.60  ? 431  LYS A C   1 
ATOM   3308  O  O   . LYS A 1  431  ? 118.306 16.223  -15.557 1.00 24.13  ? 431  LYS A O   1 
ATOM   3309  C  CB  . LYS A 1  431  ? 119.283 19.067  -16.854 1.00 33.53  ? 431  LYS A CB  1 
ATOM   3310  C  CG  . LYS A 1  431  ? 120.245 20.185  -17.289 1.00 36.64  ? 431  LYS A CG  1 
ATOM   3311  C  CD  . LYS A 1  431  ? 119.527 21.261  -18.130 1.00 42.99  ? 431  LYS A CD  1 
ATOM   3312  C  CE  . LYS A 1  431  ? 119.067 20.704  -19.497 1.00 48.35  ? 431  LYS A CE  1 
ATOM   3313  N  NZ  . LYS A 1  431  ? 118.275 21.669  -20.320 1.00 47.09  ? 431  LYS A NZ  1 
ATOM   3314  N  N   . VAL A 1  432  ? 119.203 17.615  -14.026 1.00 22.30  ? 432  VAL A N   1 
ATOM   3315  C  CA  . VAL A 1  432  ? 118.424 17.081  -12.930 1.00 16.88  ? 432  VAL A CA  1 
ATOM   3316  C  C   . VAL A 1  432  ? 117.802 18.144  -12.058 1.00 18.27  ? 432  VAL A C   1 
ATOM   3317  O  O   . VAL A 1  432  ? 118.430 18.590  -11.097 1.00 20.26  ? 432  VAL A O   1 
ATOM   3318  C  CB  . VAL A 1  432  ? 119.269 16.272  -12.008 1.00 13.13  ? 432  VAL A CB  1 
ATOM   3319  C  CG1 . VAL A 1  432  ? 118.380 15.468  -11.105 1.00 10.03  ? 432  VAL A CG1 1 
ATOM   3320  C  CG2 . VAL A 1  432  ? 120.196 15.419  -12.792 1.00 16.84  ? 432  VAL A CG2 1 
ATOM   3321  N  N   . GLU A 1  433  ? 116.577 18.555  -12.369 1.00 19.71  ? 433  GLU A N   1 
ATOM   3322  C  CA  . GLU A 1  433  ? 115.928 19.552  -11.536 1.00 20.02  ? 433  GLU A CA  1 
ATOM   3323  C  C   . GLU A 1  433  ? 115.944 18.973  -10.122 1.00 20.94  ? 433  GLU A C   1 
ATOM   3324  O  O   . GLU A 1  433  ? 115.223 18.016  -9.805  1.00 19.28  ? 433  GLU A O   1 
ATOM   3325  C  CB  . GLU A 1  433  ? 114.500 19.809  -12.008 1.00 23.27  ? 433  GLU A CB  1 
ATOM   3326  C  CG  . GLU A 1  433  ? 114.403 20.230  -13.464 1.00 25.06  ? 433  GLU A CG  1 
ATOM   3327  C  CD  . GLU A 1  433  ? 113.134 21.021  -13.772 1.00 29.14  ? 433  GLU A CD  1 
ATOM   3328  O  OE1 . GLU A 1  433  ? 112.238 21.097  -12.888 1.00 27.36  ? 433  GLU A OE1 1 
ATOM   3329  O  OE2 . GLU A 1  433  ? 113.043 21.561  -14.904 1.00 31.21  ? 433  GLU A OE2 1 
ATOM   3330  N  N   . ARG A 1  434  ? 116.789 19.564  -9.285  1.00 18.44  ? 434  ARG A N   1 
ATOM   3331  C  CA  . ARG A 1  434  ? 116.976 19.115  -7.921  1.00 15.70  ? 434  ARG A CA  1 
ATOM   3332  C  C   . ARG A 1  434  ? 116.413 20.042  -6.854  1.00 16.24  ? 434  ARG A C   1 
ATOM   3333  O  O   . ARG A 1  434  ? 116.026 21.177  -7.138  1.00 16.37  ? 434  ARG A O   1 
ATOM   3334  C  CB  . ARG A 1  434  ? 118.467 18.924  -7.685  1.00 13.55  ? 434  ARG A CB  1 
ATOM   3335  C  CG  . ARG A 1  434  ? 119.256 20.208  -7.697  1.00 12.56  ? 434  ARG A CG  1 
ATOM   3336  C  CD  . ARG A 1  434  ? 120.050 20.313  -6.393  1.00 18.99  ? 434  ARG A CD  1 
ATOM   3337  N  NE  . ARG A 1  434  ? 120.555 21.660  -6.084  1.00 23.69  ? 434  ARG A NE  1 
ATOM   3338  C  CZ  . ARG A 1  434  ? 121.580 22.265  -6.694  1.00 22.51  ? 434  ARG A CZ  1 
ATOM   3339  N  NH1 . ARG A 1  434  ? 122.250 21.664  -7.674  1.00 22.48  ? 434  ARG A NH1 1 
ATOM   3340  N  NH2 . ARG A 1  434  ? 121.945 23.480  -6.307  1.00 20.15  ? 434  ARG A NH2 1 
ATOM   3341  N  N   . HIS A 1  435  ? 116.377 19.553  -5.618  1.00 16.12  ? 435  HIS A N   1 
ATOM   3342  C  CA  . HIS A 1  435  ? 115.877 20.362  -4.513  1.00 16.04  ? 435  HIS A CA  1 
ATOM   3343  C  C   . HIS A 1  435  ? 116.904 21.434  -4.172  1.00 16.85  ? 435  HIS A C   1 
ATOM   3344  O  O   . HIS A 1  435  ? 118.118 21.243  -4.326  1.00 17.66  ? 435  HIS A O   1 
ATOM   3345  C  CB  . HIS A 1  435  ? 115.607 19.531  -3.244  1.00 15.73  ? 435  HIS A CB  1 
ATOM   3346  C  CG  . HIS A 1  435  ? 114.458 18.567  -3.351  1.00 19.00  ? 435  HIS A CG  1 
ATOM   3347  N  ND1 . HIS A 1  435  ? 113.196 18.940  -3.769  1.00 21.26  ? 435  HIS A ND1 1 
ATOM   3348  C  CD2 . HIS A 1  435  ? 114.369 17.252  -3.033  1.00 18.85  ? 435  HIS A CD2 1 
ATOM   3349  C  CE1 . HIS A 1  435  ? 112.383 17.900  -3.703  1.00 18.59  ? 435  HIS A CE1 1 
ATOM   3350  N  NE2 . HIS A 1  435  ? 113.071 16.863  -3.258  1.00 19.30  ? 435  HIS A NE2 1 
ATOM   3351  N  N   . ILE A 1  436  ? 116.392 22.570  -3.713  1.00 17.36  ? 436  ILE A N   1 
ATOM   3352  C  CA  . ILE A 1  436  ? 117.223 23.696  -3.323  1.00 18.39  ? 436  ILE A CA  1 
ATOM   3353  C  C   . ILE A 1  436  ? 117.954 23.198  -2.101  1.00 22.23  ? 436  ILE A C   1 
ATOM   3354  O  O   . ILE A 1  436  ? 117.328 22.661  -1.176  1.00 25.86  ? 436  ILE A O   1 
ATOM   3355  C  CB  . ILE A 1  436  ? 116.373 24.914  -2.894  1.00 16.53  ? 436  ILE A CB  1 
ATOM   3356  C  CG1 . ILE A 1  436  ? 115.306 25.232  -3.950  1.00 17.66  ? 436  ILE A CG1 1 
ATOM   3357  C  CG2 . ILE A 1  436  ? 117.281 26.081  -2.608  1.00 12.97  ? 436  ILE A CG2 1 
ATOM   3358  C  CD1 . ILE A 1  436  ? 115.794 25.173  -5.412  1.00 22.48  ? 436  ILE A CD1 1 
ATOM   3359  N  N   . MET A 1  437  ? 119.268 23.361  -2.082  1.00 24.18  ? 437  MET A N   1 
ATOM   3360  C  CA  . MET A 1  437  ? 120.016 22.893  -0.929  1.00 27.86  ? 437  MET A CA  1 
ATOM   3361  C  C   . MET A 1  437  ? 120.809 23.996  -0.278  1.00 28.19  ? 437  MET A C   1 
ATOM   3362  O  O   . MET A 1  437  ? 121.119 25.011  -0.906  1.00 27.63  ? 437  MET A O   1 
ATOM   3363  C  CB  . MET A 1  437  ? 120.968 21.780  -1.328  1.00 31.08  ? 437  MET A CB  1 
ATOM   3364  C  CG  . MET A 1  437  ? 120.556 21.043  -2.566  1.00 34.45  ? 437  MET A CG  1 
ATOM   3365  S  SD  . MET A 1  437  ? 121.541 19.570  -2.662  1.00 45.44  ? 437  MET A SD  1 
ATOM   3366  C  CE  . MET A 1  437  ? 123.222 20.246  -3.088  1.00 40.81  ? 437  MET A CE  1 
ATOM   3367  N  N   . ASP A 1  438  ? 121.138 23.777  0.989   1.00 28.66  ? 438  ASP A N   1 
ATOM   3368  C  CA  . ASP A 1  438  ? 121.906 24.737  1.742   1.00 29.12  ? 438  ASP A CA  1 
ATOM   3369  C  C   . ASP A 1  438  ? 122.875 25.455  0.824   1.00 29.12  ? 438  ASP A C   1 
ATOM   3370  O  O   . ASP A 1  438  ? 123.458 24.856  -0.075  1.00 27.92  ? 438  ASP A O   1 
ATOM   3371  C  CB  . ASP A 1  438  ? 122.660 24.027  2.856   1.00 33.81  ? 438  ASP A CB  1 
ATOM   3372  C  CG  . ASP A 1  438  ? 121.819 23.851  4.095   1.00 39.51  ? 438  ASP A CG  1 
ATOM   3373  O  OD1 . ASP A 1  438  ? 120.589 23.662  3.949   1.00 41.40  ? 438  ASP A OD1 1 
ATOM   3374  O  OD2 . ASP A 1  438  ? 122.388 23.892  5.213   1.00 44.02  ? 438  ASP A OD2 1 
ATOM   3375  N  N   . ASN A 1  439  ? 122.999 26.758  1.032   1.00 30.36  ? 439  ASN A N   1 
ATOM   3376  C  CA  . ASN A 1  439  ? 123.907 27.590  0.266   1.00 30.23  ? 439  ASN A CA  1 
ATOM   3377  C  C   . ASN A 1  439  ? 123.614 27.894  -1.183  1.00 29.61  ? 439  ASN A C   1 
ATOM   3378  O  O   . ASN A 1  439  ? 124.515 28.280  -1.922  1.00 31.27  ? 439  ASN A O   1 
ATOM   3379  C  CB  . ASN A 1  439  ? 125.317 27.041  0.385   1.00 30.94  ? 439  ASN A CB  1 
ATOM   3380  C  CG  . ASN A 1  439  ? 126.028 27.583  1.588   1.00 33.21  ? 439  ASN A CG  1 
ATOM   3381  O  OD1 . ASN A 1  439  ? 125.434 27.740  2.662   1.00 35.12  ? 439  ASN A OD1 1 
ATOM   3382  N  ND2 . ASN A 1  439  ? 127.310 27.879  1.425   1.00 37.29  ? 439  ASN A ND2 1 
ATOM   3383  N  N   . ASP A 1  440  ? 122.380 27.712  -1.625  1.00 28.33  ? 440  ASP A N   1 
ATOM   3384  C  CA  . ASP A 1  440  ? 122.103 28.095  -2.997  1.00 26.91  ? 440  ASP A CA  1 
ATOM   3385  C  C   . ASP A 1  440  ? 121.808 29.588  -2.871  1.00 22.15  ? 440  ASP A C   1 
ATOM   3386  O  O   . ASP A 1  440  ? 121.260 30.042  -1.861  1.00 22.35  ? 440  ASP A O   1 
ATOM   3387  C  CB  . ASP A 1  440  ? 120.898 27.346  -3.579  1.00 33.97  ? 440  ASP A CB  1 
ATOM   3388  C  CG  . ASP A 1  440  ? 121.209 25.890  -3.888  1.00 39.74  ? 440  ASP A CG  1 
ATOM   3389  O  OD1 . ASP A 1  440  ? 122.374 25.616  -4.263  1.00 40.04  ? 440  ASP A OD1 1 
ATOM   3390  O  OD2 . ASP A 1  440  ? 120.295 25.031  -3.770  1.00 43.23  ? 440  ASP A OD2 1 
ATOM   3391  N  N   . PRO A 1  441  ? 122.208 30.375  -3.873  1.00 16.45  ? 441  PRO A N   1 
ATOM   3392  C  CA  . PRO A 1  441  ? 121.999 31.822  -3.896  1.00 12.28  ? 441  PRO A CA  1 
ATOM   3393  C  C   . PRO A 1  441  ? 120.561 32.186  -4.263  1.00 9.37   ? 441  PRO A C   1 
ATOM   3394  O  O   . PRO A 1  441  ? 120.065 31.831  -5.332  1.00 9.67   ? 441  PRO A O   1 
ATOM   3395  C  CB  . PRO A 1  441  ? 123.004 32.278  -4.942  1.00 13.71  ? 441  PRO A CB  1 
ATOM   3396  C  CG  . PRO A 1  441  ? 122.941 31.175  -5.935  1.00 17.61  ? 441  PRO A CG  1 
ATOM   3397  C  CD  . PRO A 1  441  ? 122.980 29.940  -5.048  1.00 17.37  ? 441  PRO A CD  1 
ATOM   3398  N  N   . VAL A 1  442  ? 119.885 32.903  -3.382  1.00 5.51   ? 442  VAL A N   1 
ATOM   3399  C  CA  . VAL A 1  442  ? 118.513 33.266  -3.682  1.00 3.13   ? 442  VAL A CA  1 
ATOM   3400  C  C   . VAL A 1  442  ? 118.208 34.739  -3.632  1.00 1.93   ? 442  VAL A C   1 
ATOM   3401  O  O   . VAL A 1  442  ? 118.900 35.513  -2.958  1.00 1.00   ? 442  VAL A O   1 
ATOM   3402  C  CB  . VAL A 1  442  ? 117.550 32.593  -2.736  1.00 2.88   ? 442  VAL A CB  1 
ATOM   3403  C  CG1 . VAL A 1  442  ? 117.474 31.129  -3.067  1.00 1.00   ? 442  VAL A CG1 1 
ATOM   3404  C  CG2 . VAL A 1  442  ? 117.994 32.839  -1.285  1.00 4.08   ? 442  VAL A CG2 1 
ATOM   3405  N  N   . LEU A 1  443  ? 117.132 35.109  -4.320  1.00 1.00   ? 443  LEU A N   1 
ATOM   3406  C  CA  . LEU A 1  443  ? 116.720 36.497  -4.359  1.00 2.39   ? 443  LEU A CA  1 
ATOM   3407  C  C   . LEU A 1  443  ? 115.603 36.794  -3.359  1.00 5.91   ? 443  LEU A C   1 
ATOM   3408  O  O   . LEU A 1  443  ? 114.415 36.751  -3.682  1.00 6.83   ? 443  LEU A O   1 
ATOM   3409  C  CB  . LEU A 1  443  ? 116.288 36.845  -5.772  1.00 3.09   ? 443  LEU A CB  1 
ATOM   3410  C  CG  . LEU A 1  443  ? 116.551 38.310  -6.063  1.00 1.00   ? 443  LEU A CG  1 
ATOM   3411  C  CD1 . LEU A 1  443  ? 115.236 38.983  -6.363  1.00 1.00   ? 443  LEU A CD1 1 
ATOM   3412  C  CD2 . LEU A 1  443  ? 117.287 38.959  -4.881  1.00 2.29   ? 443  LEU A CD2 1 
ATOM   3413  N  N   . PHE A 1  444  ? 116.001 37.102  -2.133  1.00 9.69   ? 444  PHE A N   1 
ATOM   3414  C  CA  . PHE A 1  444  ? 115.041 37.371  -1.077  1.00 12.22  ? 444  PHE A CA  1 
ATOM   3415  C  C   . PHE A 1  444  ? 114.499 38.747  -1.245  1.00 13.47  ? 444  PHE A C   1 
ATOM   3416  O  O   . PHE A 1  444  ? 115.139 39.565  -1.900  1.00 16.51  ? 444  PHE A O   1 
ATOM   3417  C  CB  . PHE A 1  444  ? 115.706 37.286  0.269   1.00 12.95  ? 444  PHE A CB  1 
ATOM   3418  C  CG  . PHE A 1  444  ? 114.760 37.060  1.372   1.00 13.57  ? 444  PHE A CG  1 
ATOM   3419  C  CD1 . PHE A 1  444  ? 113.526 36.484  1.123   1.00 14.13  ? 444  PHE A CD1 1 
ATOM   3420  C  CD2 . PHE A 1  444  ? 115.126 37.349  2.677   1.00 17.72  ? 444  PHE A CD2 1 
ATOM   3421  C  CE1 . PHE A 1  444  ? 112.663 36.193  2.159   1.00 13.82  ? 444  PHE A CE1 1 
ATOM   3422  C  CE2 . PHE A 1  444  ? 114.275 37.064  3.732   1.00 16.83  ? 444  PHE A CE2 1 
ATOM   3423  C  CZ  . PHE A 1  444  ? 113.037 36.481  3.472   1.00 15.80  ? 444  PHE A CZ  1 
ATOM   3424  N  N   . ASN A 1  445  ? 113.344 39.028  -0.638  1.00 16.39  ? 445  ASN A N   1 
ATOM   3425  C  CA  . ASN A 1  445  ? 112.743 40.354  -0.783  1.00 18.01  ? 445  ASN A CA  1 
ATOM   3426  C  C   . ASN A 1  445  ? 111.402 40.594  -0.105  1.00 18.46  ? 445  ASN A C   1 
ATOM   3427  O  O   . ASN A 1  445  ? 110.620 39.673  0.143   1.00 14.14  ? 445  ASN A O   1 
ATOM   3428  C  CB  . ASN A 1  445  ? 112.690 40.701  -2.299  1.00 20.83  ? 445  ASN A CB  1 
ATOM   3429  C  CG  . ASN A 1  445  ? 111.324 41.154  -2.791  1.00 18.18  ? 445  ASN A CG  1 
ATOM   3430  O  OD1 . ASN A 1  445  ? 110.412 40.356  -2.965  1.00 18.10  ? 445  ASN A OD1 1 
ATOM   3431  N  ND2 . ASN A 1  445  ? 111.199 42.445  -3.052  1.00 15.51  ? 445  ASN A ND2 1 
ATOM   3432  N  N   . ARG A 1  446  ? 111.175 41.859  0.225   1.00 20.77  ? 446  ARG A N   1 
ATOM   3433  C  CA  . ARG A 1  446  ? 109.937 42.297  0.849   1.00 25.31  ? 446  ARG A CA  1 
ATOM   3434  C  C   . ARG A 1  446  ? 109.390 43.416  0.010   1.00 27.00  ? 446  ARG A C   1 
ATOM   3435  O  O   . ARG A 1  446  ? 110.136 44.165  -0.613  1.00 26.95  ? 446  ARG A O   1 
ATOM   3436  C  CB  . ARG A 1  446  ? 110.178 42.845  2.247   1.00 26.77  ? 446  ARG A CB  1 
ATOM   3437  C  CG  . ARG A 1  446  ? 108.933 43.389  2.945   1.00 31.67  ? 446  ARG A CG  1 
ATOM   3438  C  CD  . ARG A 1  446  ? 109.370 44.068  4.237   1.00 40.01  ? 446  ARG A CD  1 
ATOM   3439  N  NE  . ARG A 1  446  ? 108.325 44.268  5.249   1.00 46.06  ? 446  ARG A NE  1 
ATOM   3440  C  CZ  . ARG A 1  446  ? 107.357 45.181  5.177   1.00 49.52  ? 446  ARG A CZ  1 
ATOM   3441  N  NH1 . ARG A 1  446  ? 107.277 45.994  4.125   1.00 55.10  ? 446  ARG A NH1 1 
ATOM   3442  N  NH2 . ARG A 1  446  ? 106.487 45.305  6.176   1.00 48.22  ? 446  ARG A NH2 1 
ATOM   3443  N  N   . GLN A 1  447  ? 108.076 43.527  -0.010  1.00 31.67  ? 447  GLN A N   1 
ATOM   3444  C  CA  . GLN A 1  447  ? 107.455 44.594  -0.756  1.00 36.94  ? 447  GLN A CA  1 
ATOM   3445  C  C   . GLN A 1  447  ? 106.968 45.627  0.276   1.00 37.82  ? 447  GLN A C   1 
ATOM   3446  O  O   . GLN A 1  447  ? 106.835 45.326  1.465   1.00 39.77  ? 447  GLN A O   1 
ATOM   3447  C  CB  . GLN A 1  447  ? 106.287 44.051  -1.587  1.00 40.03  ? 447  GLN A CB  1 
ATOM   3448  C  CG  . GLN A 1  447  ? 106.674 43.024  -2.642  1.00 46.94  ? 447  GLN A CG  1 
ATOM   3449  C  CD  . GLN A 1  447  ? 105.457 42.387  -3.314  1.00 50.78  ? 447  GLN A CD  1 
ATOM   3450  O  OE1 . GLN A 1  447  ? 104.580 41.832  -2.641  1.00 53.03  ? 447  GLN A OE1 1 
ATOM   3451  N  NE2 . GLN A 1  447  ? 105.402 42.461  -4.644  1.00 51.88  ? 447  GLN A NE2 1 
ATOM   3452  N  N   . PRO A 1  448  ? 106.733 46.866  -0.164  1.00 37.01  ? 448  PRO A N   1 
ATOM   3453  C  CA  . PRO A 1  448  ? 106.938 47.245  -1.567  1.00 38.38  ? 448  PRO A CA  1 
ATOM   3454  C  C   . PRO A 1  448  ? 108.420 47.550  -1.869  1.00 40.86  ? 448  PRO A C   1 
ATOM   3455  O  O   . PRO A 1  448  ? 109.174 47.996  -0.988  1.00 40.50  ? 448  PRO A O   1 
ATOM   3456  C  CB  . PRO A 1  448  ? 105.988 48.429  -1.744  1.00 37.01  ? 448  PRO A CB  1 
ATOM   3457  C  CG  . PRO A 1  448  ? 105.903 49.007  -0.364  1.00 36.62  ? 448  PRO A CG  1 
ATOM   3458  C  CD  . PRO A 1  448  ? 105.870 47.824  0.542   1.00 34.88  ? 448  PRO A CD  1 
ATOM   3459  N  N   . SER A 1  449  ? 108.823 47.278  -3.113  1.00 40.47  ? 449  SER A N   1 
ATOM   3460  C  CA  . SER A 1  449  ? 110.205 47.453  -3.586  1.00 39.34  ? 449  SER A CA  1 
ATOM   3461  C  C   . SER A 1  449  ? 110.478 48.778  -4.273  1.00 40.20  ? 449  SER A C   1 
ATOM   3462  O  O   . SER A 1  449  ? 109.994 49.018  -5.383  1.00 43.80  ? 449  SER A O   1 
ATOM   3463  C  CB  . SER A 1  449  ? 110.555 46.346  -4.572  1.00 39.45  ? 449  SER A CB  1 
ATOM   3464  O  OG  . SER A 1  449  ? 110.030 45.103  -4.145  1.00 41.92  ? 449  SER A OG  1 
ATOM   3465  N  N   . LEU A 1  450  ? 111.301 49.607  -3.635  1.00 38.85  ? 450  LEU A N   1 
ATOM   3466  C  CA  . LEU A 1  450  ? 111.649 50.934  -4.148  1.00 37.92  ? 450  LEU A CA  1 
ATOM   3467  C  C   . LEU A 1  450  ? 113.085 51.223  -3.738  1.00 38.72  ? 450  LEU A C   1 
ATOM   3468  O  O   . LEU A 1  450  ? 113.544 52.353  -3.780  1.00 39.66  ? 450  LEU A O   1 
ATOM   3469  C  CB  . LEU A 1  450  ? 110.694 51.966  -3.525  1.00 34.43  ? 450  LEU A CB  1 
ATOM   3470  C  CG  . LEU A 1  450  ? 109.975 51.510  -2.233  1.00 31.34  ? 450  LEU A CG  1 
ATOM   3471  C  CD1 . LEU A 1  450  ? 110.975 51.332  -1.087  1.00 31.19  ? 450  LEU A CD1 1 
ATOM   3472  C  CD2 . LEU A 1  450  ? 108.904 52.510  -1.855  1.00 25.92  ? 450  LEU A CD2 1 
ATOM   3473  N  N   . HIS A 1  451  ? 113.793 50.164  -3.379  1.00 41.39  ? 451  HIS A N   1 
ATOM   3474  C  CA  . HIS A 1  451  ? 115.151 50.255  -2.883  1.00 43.90  ? 451  HIS A CA  1 
ATOM   3475  C  C   . HIS A 1  451  ? 116.005 49.136  -3.467  1.00 42.41  ? 451  HIS A C   1 
ATOM   3476  O  O   . HIS A 1  451  ? 115.541 48.006  -3.614  1.00 41.46  ? 451  HIS A O   1 
ATOM   3477  C  CB  . HIS A 1  451  ? 115.079 50.070  -1.376  1.00 52.65  ? 451  HIS A CB  1 
ATOM   3478  C  CG  . HIS A 1  451  ? 115.815 51.096  -0.587  1.00 62.65  ? 451  HIS A CG  1 
ATOM   3479  N  ND1 . HIS A 1  451  ? 115.649 51.228  0.775   1.00 67.00  ? 451  HIS A ND1 1 
ATOM   3480  C  CD2 . HIS A 1  451  ? 116.738 52.019  -0.947  1.00 66.98  ? 451  HIS A CD2 1 
ATOM   3481  C  CE1 . HIS A 1  451  ? 116.439 52.188  1.223   1.00 70.07  ? 451  HIS A CE1 1 
ATOM   3482  N  NE2 . HIS A 1  451  ? 117.111 52.685  0.198   1.00 70.96  ? 451  HIS A NE2 1 
ATOM   3483  N  N   . LYS A 1  452  ? 117.253 49.433  -3.797  1.00 42.89  ? 452  LYS A N   1 
ATOM   3484  C  CA  . LYS A 1  452  ? 118.129 48.375  -4.296  1.00 42.85  ? 452  LYS A CA  1 
ATOM   3485  C  C   . LYS A 1  452  ? 118.087 47.315  -3.194  1.00 40.98  ? 452  LYS A C   1 
ATOM   3486  O  O   . LYS A 1  452  ? 118.022 46.119  -3.453  1.00 39.74  ? 452  LYS A O   1 
ATOM   3487  C  CB  . LYS A 1  452  ? 119.577 48.883  -4.452  1.00 44.48  ? 452  LYS A CB  1 
ATOM   3488  C  CG  . LYS A 1  452  ? 120.017 49.197  -5.882  1.00 43.60  ? 452  LYS A CG  1 
ATOM   3489  C  CD  . LYS A 1  452  ? 121.445 49.732  -5.919  1.00 46.56  ? 452  LYS A CD  1 
ATOM   3490  C  CE  . LYS A 1  452  ? 122.451 48.745  -5.334  1.00 52.63  ? 452  LYS A CE  1 
ATOM   3491  N  NZ  . LYS A 1  452  ? 123.874 49.236  -5.373  1.00 59.26  ? 452  LYS A NZ  1 
ATOM   3492  N  N   . MET A 1  453  ? 118.090 47.797  -1.957  1.00 38.82  ? 453  MET A N   1 
ATOM   3493  C  CA  . MET A 1  453  ? 118.085 46.950  -0.784  1.00 35.58  ? 453  MET A CA  1 
ATOM   3494  C  C   . MET A 1  453  ? 116.734 46.401  -0.409  1.00 33.17  ? 453  MET A C   1 
ATOM   3495  O  O   . MET A 1  453  ? 116.421 46.262  0.762   1.00 34.48  ? 453  MET A O   1 
ATOM   3496  C  CB  . MET A 1  453  ? 118.656 47.713  0.403   1.00 38.89  ? 453  MET A CB  1 
ATOM   3497  C  CG  . MET A 1  453  ? 120.055 48.261  0.164   1.00 44.10  ? 453  MET A CG  1 
ATOM   3498  S  SD  . MET A 1  453  ? 120.075 50.041  0.022   1.00 48.42  ? 453  MET A SD  1 
ATOM   3499  C  CE  . MET A 1  453  ? 119.543 50.474  1.723   1.00 48.58  ? 453  MET A CE  1 
ATOM   3500  N  N   . SER A 1  454  ? 115.913 46.096  -1.393  1.00 31.14  ? 454  SER A N   1 
ATOM   3501  C  CA  . SER A 1  454  ? 114.615 45.526  -1.081  1.00 30.57  ? 454  SER A CA  1 
ATOM   3502  C  C   . SER A 1  454  ? 114.631 44.113  -1.654  1.00 28.39  ? 454  SER A C   1 
ATOM   3503  O  O   . SER A 1  454  ? 113.745 43.301  -1.387  1.00 28.28  ? 454  SER A O   1 
ATOM   3504  C  CB  . SER A 1  454  ? 113.499 46.357  -1.712  1.00 34.72  ? 454  SER A CB  1 
ATOM   3505  O  OG  . SER A 1  454  ? 112.440 46.554  -0.787  1.00 39.98  ? 454  SER A OG  1 
ATOM   3506  N  N   . MET A 1  455  ? 115.671 43.843  -2.440  1.00 25.79  ? 455  MET A N   1 
ATOM   3507  C  CA  . MET A 1  455  ? 115.889 42.556  -3.074  1.00 20.96  ? 455  MET A CA  1 
ATOM   3508  C  C   . MET A 1  455  ? 117.365 42.237  -3.052  1.00 18.00  ? 455  MET A C   1 
ATOM   3509  O  O   . MET A 1  455  ? 118.107 42.651  -3.942  1.00 17.51  ? 455  MET A O   1 
ATOM   3510  C  CB  . MET A 1  455  ? 115.453 42.585  -4.522  1.00 22.73  ? 455  MET A CB  1 
ATOM   3511  C  CG  . MET A 1  455  ? 114.082 43.076  -4.710  1.00 26.33  ? 455  MET A CG  1 
ATOM   3512  S  SD  . MET A 1  455  ? 113.516 42.563  -6.306  1.00 31.15  ? 455  MET A SD  1 
ATOM   3513  C  CE  . MET A 1  455  ? 112.044 41.714  -5.756  1.00 35.32  ? 455  MET A CE  1 
ATOM   3514  N  N   . MET A 1  456  ? 117.797 41.508  -2.037  1.00 14.12  ? 456  MET A N   1 
ATOM   3515  C  CA  . MET A 1  456  ? 119.194 41.122  -1.956  1.00 12.54  ? 456  MET A CA  1 
ATOM   3516  C  C   . MET A 1  456  ? 119.351 39.574  -2.011  1.00 12.88  ? 456  MET A C   1 
ATOM   3517  O  O   . MET A 1  456  ? 118.484 38.810  -1.549  1.00 11.38  ? 456  MET A O   1 
ATOM   3518  C  CB  . MET A 1  456  ? 119.800 41.705  -0.683  1.00 9.31   ? 456  MET A CB  1 
ATOM   3519  C  CG  . MET A 1  456  ? 119.341 43.122  -0.414  1.00 7.37   ? 456  MET A CG  1 
ATOM   3520  S  SD  . MET A 1  456  ? 120.226 43.891  0.964   1.00 11.31  ? 456  MET A SD  1 
ATOM   3521  C  CE  . MET A 1  456  ? 119.348 43.287  2.347   1.00 14.76  ? 456  MET A CE  1 
ATOM   3522  N  N   . ALA A 1  457  ? 120.442 39.118  -2.625  1.00 13.74  ? 457  ALA A N   1 
ATOM   3523  C  CA  . ALA A 1  457  ? 120.711 37.693  -2.730  1.00 13.72  ? 457  ALA A CA  1 
ATOM   3524  C  C   . ALA A 1  457  ? 121.078 37.211  -1.347  1.00 14.24  ? 457  ALA A C   1 
ATOM   3525  O  O   . ALA A 1  457  ? 121.555 37.984  -0.509  1.00 13.31  ? 457  ALA A O   1 
ATOM   3526  C  CB  . ALA A 1  457  ? 121.859 37.427  -3.693  1.00 16.92  ? 457  ALA A CB  1 
ATOM   3527  N  N   . HIS A 1  458  ? 120.853 35.926  -1.123  1.00 14.71  ? 458  HIS A N   1 
ATOM   3528  C  CA  . HIS A 1  458  ? 121.140 35.311  0.160   1.00 16.50  ? 458  HIS A CA  1 
ATOM   3529  C  C   . HIS A 1  458  ? 121.615 33.864  -0.016  1.00 19.03  ? 458  HIS A C   1 
ATOM   3530  O  O   . HIS A 1  458  ? 121.349 33.219  -1.052  1.00 18.44  ? 458  HIS A O   1 
ATOM   3531  C  CB  . HIS A 1  458  ? 119.878 35.303  1.038   1.00 11.40  ? 458  HIS A CB  1 
ATOM   3532  C  CG  . HIS A 1  458  ? 119.539 36.621  1.676   1.00 6.73   ? 458  HIS A CG  1 
ATOM   3533  N  ND1 . HIS A 1  458  ? 119.797 36.890  3.004   1.00 6.11   ? 458  HIS A ND1 1 
ATOM   3534  C  CD2 . HIS A 1  458  ? 118.851 37.691  1.204   1.00 4.55   ? 458  HIS A CD2 1 
ATOM   3535  C  CE1 . HIS A 1  458  ? 119.273 38.061  3.327   1.00 4.70   ? 458  HIS A CE1 1 
ATOM   3536  N  NE2 . HIS A 1  458  ? 118.693 38.564  2.253   1.00 1.00   ? 458  HIS A NE2 1 
ATOM   3537  N  N   . ARG A 1  459  ? 122.322 33.384  1.014   1.00 22.04  ? 459  ARG A N   1 
ATOM   3538  C  CA  . ARG A 1  459  ? 122.832 32.013  1.101   1.00 22.27  ? 459  ARG A CA  1 
ATOM   3539  C  C   . ARG A 1  459  ? 121.652 31.236  1.671   1.00 20.36  ? 459  ARG A C   1 
ATOM   3540  O  O   . ARG A 1  459  ? 121.151 31.561  2.757   1.00 18.85  ? 459  ARG A O   1 
ATOM   3541  C  CB  . ARG A 1  459  ? 124.003 31.908  2.092   1.00 22.23  ? 459  ARG A CB  1 
ATOM   3542  C  CG  . ARG A 1  459  ? 125.284 32.611  1.688   1.00 23.08  ? 459  ARG A CG  1 
ATOM   3543  C  CD  . ARG A 1  459  ? 126.183 32.752  2.904   1.00 24.86  ? 459  ARG A CD  1 
ATOM   3544  N  NE  . ARG A 1  459  ? 126.560 31.460  3.466   1.00 30.69  ? 459  ARG A NE  1 
ATOM   3545  C  CZ  . ARG A 1  459  ? 127.105 31.288  4.670   1.00 36.33  ? 459  ARG A CZ  1 
ATOM   3546  N  NH1 . ARG A 1  459  ? 127.335 32.327  5.462   1.00 37.68  ? 459  ARG A NH1 1 
ATOM   3547  N  NH2 . ARG A 1  459  ? 127.442 30.069  5.081   1.00 40.23  ? 459  ARG A NH2 1 
ATOM   3548  N  N   . VAL A 1  460  ? 121.198 30.226  0.939   1.00 18.54  ? 460  VAL A N   1 
ATOM   3549  C  CA  . VAL A 1  460  ? 120.074 29.442  1.399   1.00 19.92  ? 460  VAL A CA  1 
ATOM   3550  C  C   . VAL A 1  460  ? 120.475 28.641  2.611   1.00 21.48  ? 460  VAL A C   1 
ATOM   3551  O  O   . VAL A 1  460  ? 121.652 28.380  2.834   1.00 23.50  ? 460  VAL A O   1 
ATOM   3552  C  CB  . VAL A 1  460  ? 119.586 28.499  0.297   1.00 20.37  ? 460  VAL A CB  1 
ATOM   3553  C  CG1 . VAL A 1  460  ? 119.184 27.185  0.875   1.00 25.71  ? 460  VAL A CG1 1 
ATOM   3554  C  CG2 . VAL A 1  460  ? 118.391 29.092  -0.384  1.00 23.02  ? 460  VAL A CG2 1 
ATOM   3555  N  N   . LYS A 1  461  ? 119.506 28.267  3.421   1.00 22.66  ? 461  LYS A N   1 
ATOM   3556  C  CA  . LYS A 1  461  ? 119.844 27.453  4.567   1.00 25.03  ? 461  LYS A CA  1 
ATOM   3557  C  C   . LYS A 1  461  ? 118.581 26.743  4.994   1.00 25.34  ? 461  LYS A C   1 
ATOM   3558  O  O   . LYS A 1  461  ? 117.821 27.244  5.832   1.00 24.87  ? 461  LYS A O   1 
ATOM   3559  C  CB  . LYS A 1  461  ? 120.397 28.313  5.692   1.00 29.41  ? 461  LYS A CB  1 
ATOM   3560  C  CG  . LYS A 1  461  ? 121.362 27.583  6.599   1.00 33.17  ? 461  LYS A CG  1 
ATOM   3561  C  CD  . LYS A 1  461  ? 120.684 26.510  7.421   1.00 35.91  ? 461  LYS A CD  1 
ATOM   3562  C  CE  . LYS A 1  461  ? 121.661 25.947  8.440   1.00 39.62  ? 461  LYS A CE  1 
ATOM   3563  N  NZ  . LYS A 1  461  ? 122.069 26.976  9.455   1.00 41.51  ? 461  LYS A NZ  1 
ATOM   3564  N  N   . VAL A 1  462  ? 118.369 25.570  4.396   1.00 24.65  ? 462  VAL A N   1 
ATOM   3565  C  CA  . VAL A 1  462  ? 117.195 24.761  4.651   1.00 21.59  ? 462  VAL A CA  1 
ATOM   3566  C  C   . VAL A 1  462  ? 117.000 24.486  6.132   1.00 23.96  ? 462  VAL A C   1 
ATOM   3567  O  O   . VAL A 1  462  ? 117.930 24.065  6.826   1.00 23.74  ? 462  VAL A O   1 
ATOM   3568  C  CB  . VAL A 1  462  ? 117.277 23.448  3.912   1.00 17.71  ? 462  VAL A CB  1 
ATOM   3569  C  CG1 . VAL A 1  462  ? 115.897 22.866  3.829   1.00 21.33  ? 462  VAL A CG1 1 
ATOM   3570  C  CG2 . VAL A 1  462  ? 117.865 23.653  2.523   1.00 16.44  ? 462  VAL A CG2 1 
ATOM   3571  N  N   . ILE A 1  463  ? 115.778 24.720  6.606   1.00 24.54  ? 463  ILE A N   1 
ATOM   3572  C  CA  . ILE A 1  463  ? 115.448 24.543  8.015   1.00 23.92  ? 463  ILE A CA  1 
ATOM   3573  C  C   . ILE A 1  463  ? 114.010 24.104  8.209   1.00 25.91  ? 463  ILE A C   1 
ATOM   3574  O  O   . ILE A 1  463  ? 113.175 24.255  7.319   1.00 28.74  ? 463  ILE A O   1 
ATOM   3575  C  CB  . ILE A 1  463  ? 115.584 25.851  8.769   1.00 21.15  ? 463  ILE A CB  1 
ATOM   3576  C  CG1 . ILE A 1  463  ? 114.658 26.872  8.115   1.00 22.21  ? 463  ILE A CG1 1 
ATOM   3577  C  CG2 . ILE A 1  463  ? 117.022 26.328  8.759   1.00 22.12  ? 463  ILE A CG2 1 
ATOM   3578  C  CD1 . ILE A 1  463  ? 114.664 28.211  8.764   1.00 28.64  ? 463  ILE A CD1 1 
ATOM   3579  N  N   . PRO A 1  464  ? 113.700 23.588  9.404   1.00 27.18  ? 464  PRO A N   1 
ATOM   3580  C  CA  . PRO A 1  464  ? 112.389 23.100  9.829   1.00 27.98  ? 464  PRO A CA  1 
ATOM   3581  C  C   . PRO A 1  464  ? 111.413 24.245  10.023  1.00 29.13  ? 464  PRO A C   1 
ATOM   3582  O  O   . PRO A 1  464  ? 111.802 25.403  9.988   1.00 29.14  ? 464  PRO A O   1 
ATOM   3583  C  CB  . PRO A 1  464  ? 112.705 22.423  11.142  1.00 30.47  ? 464  PRO A CB  1 
ATOM   3584  C  CG  . PRO A 1  464  ? 113.737 23.336  11.703  1.00 31.77  ? 464  PRO A CG  1 
ATOM   3585  C  CD  . PRO A 1  464  ? 114.658 23.474  10.513  1.00 29.51  ? 464  PRO A CD  1 
ATOM   3586  N  N   . TYR A 1  465  ? 110.150 23.909  10.260  1.00 29.52  ? 465  TYR A N   1 
ATOM   3587  C  CA  . TYR A 1  465  ? 109.096 24.899  10.458  1.00 29.44  ? 465  TYR A CA  1 
ATOM   3588  C  C   . TYR A 1  465  ? 108.909 25.739  9.225   1.00 25.25  ? 465  TYR A C   1 
ATOM   3589  O  O   . TYR A 1  465  ? 109.839 25.965  8.460   1.00 26.32  ? 465  TYR A O   1 
ATOM   3590  C  CB  . TYR A 1  465  ? 109.395 25.754  11.663  1.00 35.46  ? 465  TYR A CB  1 
ATOM   3591  C  CG  . TYR A 1  465  ? 109.686 24.894  12.856  1.00 42.05  ? 465  TYR A CG  1 
ATOM   3592  C  CD1 . TYR A 1  465  ? 110.964 24.383  13.065  1.00 43.41  ? 465  TYR A CD1 1 
ATOM   3593  C  CD2 . TYR A 1  465  ? 108.672 24.548  13.753  1.00 44.19  ? 465  TYR A CD2 1 
ATOM   3594  C  CE1 . TYR A 1  465  ? 111.232 23.552  14.129  1.00 49.66  ? 465  TYR A CE1 1 
ATOM   3595  C  CE2 . TYR A 1  465  ? 108.923 23.718  14.826  1.00 49.32  ? 465  TYR A CE2 1 
ATOM   3596  C  CZ  . TYR A 1  465  ? 110.208 23.218  15.011  1.00 52.75  ? 465  TYR A CZ  1 
ATOM   3597  O  OH  . TYR A 1  465  ? 110.470 22.372  16.071  1.00 59.81  ? 465  TYR A OH  1 
ATOM   3598  N  N   . SER A 1  466  ? 107.694 26.222  9.053   1.00 20.43  ? 466  SER A N   1 
ATOM   3599  C  CA  . SER A 1  466  ? 107.322 26.944  7.846   1.00 18.52  ? 466  SER A CA  1 
ATOM   3600  C  C   . SER A 1  466  ? 107.589 28.452  7.647   1.00 18.85  ? 466  SER A C   1 
ATOM   3601  O  O   . SER A 1  466  ? 106.925 29.103  6.836   1.00 16.31  ? 466  SER A O   1 
ATOM   3602  C  CB  . SER A 1  466  ? 105.848 26.621  7.603   1.00 16.35  ? 466  SER A CB  1 
ATOM   3603  O  OG  . SER A 1  466  ? 105.335 25.878  8.710   1.00 12.20  ? 466  SER A OG  1 
ATOM   3604  N  N   . THR A 1  467  ? 108.578 29.006  8.337   1.00 21.71  ? 467  THR A N   1 
ATOM   3605  C  CA  . THR A 1  467  ? 108.854 30.434  8.195   1.00 24.81  ? 467  THR A CA  1 
ATOM   3606  C  C   . THR A 1  467  ? 110.246 30.797  7.707   1.00 25.10  ? 467  THR A C   1 
ATOM   3607  O  O   . THR A 1  467  ? 111.253 30.310  8.232   1.00 27.00  ? 467  THR A O   1 
ATOM   3608  C  CB  . THR A 1  467  ? 108.643 31.184  9.519   1.00 25.48  ? 467  THR A CB  1 
ATOM   3609  O  OG1 . THR A 1  467  ? 109.686 30.838  10.446  1.00 27.58  ? 467  THR A OG1 1 
ATOM   3610  C  CG2 . THR A 1  467  ? 107.297 30.824  10.105  1.00 28.70  ? 467  THR A CG2 1 
ATOM   3611  N  N   . PHE A 1  468  ? 110.284 31.661  6.695   1.00 22.31  ? 468  PHE A N   1 
ATOM   3612  C  CA  . PHE A 1  468  ? 111.530 32.162  6.146   1.00 17.29  ? 468  PHE A CA  1 
ATOM   3613  C  C   . PHE A 1  468  ? 112.267 32.828  7.318   1.00 15.43  ? 468  PHE A C   1 
ATOM   3614  O  O   . PHE A 1  468  ? 111.668 33.593  8.089   1.00 13.09  ? 468  PHE A O   1 
ATOM   3615  C  CB  . PHE A 1  468  ? 111.234 33.216  5.086   1.00 13.58  ? 468  PHE A CB  1 
ATOM   3616  C  CG  . PHE A 1  468  ? 110.836 32.663  3.760   1.00 9.32   ? 468  PHE A CG  1 
ATOM   3617  C  CD1 . PHE A 1  468  ? 109.659 33.082  3.146   1.00 6.58   ? 468  PHE A CD1 1 
ATOM   3618  C  CD2 . PHE A 1  468  ? 111.691 31.825  3.061   1.00 8.77   ? 468  PHE A CD2 1 
ATOM   3619  C  CE1 . PHE A 1  468  ? 109.338 32.683  1.836   1.00 4.87   ? 468  PHE A CE1 1 
ATOM   3620  C  CE2 . PHE A 1  468  ? 111.386 31.419  1.753   1.00 6.45   ? 468  PHE A CE2 1 
ATOM   3621  C  CZ  . PHE A 1  468  ? 110.206 31.854  1.139   1.00 4.86   ? 468  PHE A CZ  1 
ATOM   3622  N  N   . ARG A 1  469  ? 113.553 32.522  7.467   1.00 14.26  ? 469  ARG A N   1 
ATOM   3623  C  CA  . ARG A 1  469  ? 114.352 33.118  8.534   1.00 13.67  ? 469  ARG A CA  1 
ATOM   3624  C  C   . ARG A 1  469  ? 115.448 34.020  7.976   1.00 13.57  ? 469  ARG A C   1 
ATOM   3625  O  O   . ARG A 1  469  ? 116.128 33.691  6.989   1.00 15.51  ? 469  ARG A O   1 
ATOM   3626  C  CB  . ARG A 1  469  ? 114.984 32.050  9.439   1.00 14.06  ? 469  ARG A CB  1 
ATOM   3627  C  CG  . ARG A 1  469  ? 114.370 31.980  10.831  1.00 17.50  ? 469  ARG A CG  1 
ATOM   3628  C  CD  . ARG A 1  469  ? 113.494 30.744  10.989  1.00 15.47  ? 469  ARG A CD  1 
ATOM   3629  N  NE  . ARG A 1  469  ? 112.562 30.830  12.110  1.00 15.75  ? 469  ARG A NE  1 
ATOM   3630  C  CZ  . ARG A 1  469  ? 112.885 31.207  13.348  1.00 16.53  ? 469  ARG A CZ  1 
ATOM   3631  N  NH1 . ARG A 1  469  ? 114.128 31.549  13.669  1.00 10.94  ? 469  ARG A NH1 1 
ATOM   3632  N  NH2 . ARG A 1  469  ? 111.947 31.250  14.277  1.00 19.46  ? 469  ARG A NH2 1 
ATOM   3633  N  N   . LEU A 1  470  ? 115.594 35.170  8.636   1.00 12.35  ? 470  LEU A N   1 
ATOM   3634  C  CA  . LEU A 1  470  ? 116.574 36.189  8.288   1.00 11.55  ? 470  LEU A CA  1 
ATOM   3635  C  C   . LEU A 1  470  ? 117.204 36.748  9.553   1.00 11.90  ? 470  LEU A C   1 
ATOM   3636  O  O   . LEU A 1  470  ? 116.682 36.574  10.670  1.00 6.43   ? 470  LEU A O   1 
ATOM   3637  C  CB  . LEU A 1  470  ? 115.908 37.309  7.491   1.00 8.93   ? 470  LEU A CB  1 
ATOM   3638  C  CG  . LEU A 1  470  ? 114.629 37.871  8.108   1.00 7.40   ? 470  LEU A CG  1 
ATOM   3639  C  CD1 . LEU A 1  470  ? 114.948 38.886  9.217   1.00 5.82   ? 470  LEU A CD1 1 
ATOM   3640  C  CD2 . LEU A 1  470  ? 113.809 38.476  6.992   1.00 4.87   ? 470  LEU A CD2 1 
ATOM   3641  N  N   . ASN A 1  471  ? 118.339 37.410  9.355   1.00 17.28  ? 471  ASN A N   1 
ATOM   3642  C  CA  . ASN A 1  471  ? 119.098 37.999  10.448  1.00 23.33  ? 471  ASN A CA  1 
ATOM   3643  C  C   . ASN A 1  471  ? 118.577 39.390  10.797  1.00 26.21  ? 471  ASN A C   1 
ATOM   3644  O  O   . ASN A 1  471  ? 118.297 40.188  9.901   1.00 31.17  ? 471  ASN A O   1 
ATOM   3645  C  CB  . ASN A 1  471  ? 120.567 38.081  10.055  1.00 20.77  ? 471  ASN A CB  1 
ATOM   3646  C  CG  . ASN A 1  471  ? 121.412 38.617  11.163  1.00 20.49  ? 471  ASN A CG  1 
ATOM   3647  O  OD1 . ASN A 1  471  ? 120.928 38.810  12.287  1.00 17.14  ? 471  ASN A OD1 1 
ATOM   3648  N  ND2 . ASN A 1  471  ? 122.683 38.857  10.871  1.00 20.32  ? 471  ASN A ND2 1 
ATOM   3649  N  N   . LEU A 1  472  ? 118.451 39.697  12.085  1.00 26.00  ? 472  LEU A N   1 
ATOM   3650  C  CA  . LEU A 1  472  ? 117.931 41.003  12.472  1.00 26.48  ? 472  LEU A CA  1 
ATOM   3651  C  C   . LEU A 1  472  ? 118.557 42.177  11.743  1.00 26.85  ? 472  LEU A C   1 
ATOM   3652  O  O   . LEU A 1  472  ? 117.864 42.967  11.114  1.00 30.26  ? 472  LEU A O   1 
ATOM   3653  C  CB  . LEU A 1  472  ? 118.108 41.205  13.950  1.00 27.74  ? 472  LEU A CB  1 
ATOM   3654  C  CG  . LEU A 1  472  ? 117.314 40.154  14.681  1.00 29.74  ? 472  LEU A CG  1 
ATOM   3655  C  CD1 . LEU A 1  472  ? 117.953 39.967  16.013  1.00 32.31  ? 472  LEU A CD1 1 
ATOM   3656  C  CD2 . LEU A 1  472  ? 115.857 40.555  14.779  1.00 26.70  ? 472  LEU A CD2 1 
ATOM   3657  N  N   . SER A 1  473  ? 119.875 42.284  11.829  1.00 27.64  ? 473  SER A N   1 
ATOM   3658  C  CA  . SER A 1  473  ? 120.592 43.374  11.195  1.00 30.19  ? 473  SER A CA  1 
ATOM   3659  C  C   . SER A 1  473  ? 120.340 43.544  9.705   1.00 30.01  ? 473  SER A C   1 
ATOM   3660  O  O   . SER A 1  473  ? 120.945 44.396  9.071   1.00 32.53  ? 473  SER A O   1 
ATOM   3661  C  CB  . SER A 1  473  ? 122.082 43.221  11.455  1.00 31.91  ? 473  SER A CB  1 
ATOM   3662  O  OG  . SER A 1  473  ? 122.321 43.228  12.850  1.00 37.23  ? 473  SER A OG  1 
ATOM   3663  N  N   . VAL A 1  474  ? 119.468 42.734  9.127   1.00 28.75  ? 474  VAL A N   1 
ATOM   3664  C  CA  . VAL A 1  474  ? 119.164 42.907  7.719   1.00 26.78  ? 474  VAL A CA  1 
ATOM   3665  C  C   . VAL A 1  474  ? 117.674 43.109  7.658   1.00 26.36  ? 474  VAL A C   1 
ATOM   3666  O  O   . VAL A 1  474  ? 117.026 42.807  6.658   1.00 26.35  ? 474  VAL A O   1 
ATOM   3667  C  CB  . VAL A 1  474  ? 119.559 41.690  6.869   1.00 27.97  ? 474  VAL A CB  1 
ATOM   3668  C  CG1 . VAL A 1  474  ? 118.722 40.480  7.246   1.00 27.69  ? 474  VAL A CG1 1 
ATOM   3669  C  CG2 . VAL A 1  474  ? 119.383 42.020  5.396   1.00 30.15  ? 474  VAL A CG2 1 
ATOM   3670  N  N   . THR A 1  475  ? 117.141 43.625  8.760   1.00 29.29  ? 475  THR A N   1 
ATOM   3671  C  CA  . THR A 1  475  ? 115.720 43.909  8.890   1.00 32.45  ? 475  THR A CA  1 
ATOM   3672  C  C   . THR A 1  475  ? 115.364 45.231  8.211   1.00 34.76  ? 475  THR A C   1 
ATOM   3673  O  O   . THR A 1  475  ? 114.439 45.287  7.397   1.00 36.35  ? 475  THR A O   1 
ATOM   3674  C  CB  . THR A 1  475  ? 115.294 43.991  10.378  1.00 32.00  ? 475  THR A CB  1 
ATOM   3675  O  OG1 . THR A 1  475  ? 113.882 44.222  10.454  1.00 30.94  ? 475  THR A OG1 1 
ATOM   3676  C  CG2 . THR A 1  475  ? 116.026 45.127  11.099  1.00 31.52  ? 475  THR A CG2 1 
ATOM   3677  N  N   . SER A 1  476  ? 116.107 46.287  8.546   1.00 37.07  ? 476  SER A N   1 
ATOM   3678  C  CA  . SER A 1  476  ? 115.870 47.610  7.983   1.00 39.87  ? 476  SER A CA  1 
ATOM   3679  C  C   . SER A 1  476  ? 116.010 47.665  6.465   1.00 40.61  ? 476  SER A C   1 
ATOM   3680  O  O   . SER A 1  476  ? 115.171 48.242  5.790   1.00 42.82  ? 476  SER A O   1 
ATOM   3681  C  CB  . SER A 1  476  ? 116.796 48.650  8.631   1.00 40.99  ? 476  SER A CB  1 
ATOM   3682  O  OG  . SER A 1  476  ? 118.164 48.286  8.529   1.00 45.55  ? 476  SER A OG  1 
ATOM   3683  N  N   . PRO A 1  477  ? 117.064 47.069  5.899   1.00 41.51  ? 477  PRO A N   1 
ATOM   3684  C  CA  . PRO A 1  477  ? 117.146 47.156  4.440   1.00 41.68  ? 477  PRO A CA  1 
ATOM   3685  C  C   . PRO A 1  477  ? 115.834 46.720  3.795   1.00 41.84  ? 477  PRO A C   1 
ATOM   3686  O  O   . PRO A 1  477  ? 115.412 47.271  2.778   1.00 43.82  ? 477  PRO A O   1 
ATOM   3687  C  CB  . PRO A 1  477  ? 118.303 46.225  4.108   1.00 41.84  ? 477  PRO A CB  1 
ATOM   3688  C  CG  . PRO A 1  477  ? 119.178 46.346  5.313   1.00 41.57  ? 477  PRO A CG  1 
ATOM   3689  C  CD  . PRO A 1  477  ? 118.188 46.294  6.444   1.00 42.14  ? 477  PRO A CD  1 
ATOM   3690  N  N   . TYR A 1  478  ? 115.190 45.725  4.396   1.00 40.70  ? 478  TYR A N   1 
ATOM   3691  C  CA  . TYR A 1  478  ? 113.917 45.224  3.889   1.00 40.33  ? 478  TYR A CA  1 
ATOM   3692  C  C   . TYR A 1  478  ? 112.813 46.037  4.544   1.00 42.58  ? 478  TYR A C   1 
ATOM   3693  O  O   . TYR A 1  478  ? 111.694 46.150  4.029   1.00 43.33  ? 478  TYR A O   1 
ATOM   3694  C  CB  . TYR A 1  478  ? 113.754 43.729  4.225   1.00 35.53  ? 478  TYR A CB  1 
ATOM   3695  C  CG  . TYR A 1  478  ? 114.637 42.851  3.384   1.00 28.91  ? 478  TYR A CG  1 
ATOM   3696  C  CD1 . TYR A 1  478  ? 115.790 42.274  3.912   1.00 25.94  ? 478  TYR A CD1 1 
ATOM   3697  C  CD2 . TYR A 1  478  ? 114.381 42.702  2.023   1.00 28.54  ? 478  TYR A CD2 1 
ATOM   3698  C  CE1 . TYR A 1  478  ? 116.666 41.587  3.103   1.00 25.49  ? 478  TYR A CE1 1 
ATOM   3699  C  CE2 . TYR A 1  478  ? 115.246 42.022  1.207   1.00 29.47  ? 478  TYR A CE2 1 
ATOM   3700  C  CZ  . TYR A 1  478  ? 116.388 41.470  1.744   1.00 28.53  ? 478  TYR A CZ  1 
ATOM   3701  O  OH  . TYR A 1  478  ? 117.260 40.832  0.899   1.00 32.38  ? 478  TYR A OH  1 
ATOM   3702  N  N   . ASN A 1  479  ? 113.167 46.633  5.676   1.00 44.94  ? 479  ASN A N   1 
ATOM   3703  C  CA  . ASN A 1  479  ? 112.235 47.427  6.453   1.00 48.38  ? 479  ASN A CA  1 
ATOM   3704  C  C   . ASN A 1  479  ? 111.079 46.504  6.729   1.00 47.97  ? 479  ASN A C   1 
ATOM   3705  O  O   . ASN A 1  479  ? 109.991 46.679  6.199   1.00 48.41  ? 479  ASN A O   1 
ATOM   3706  C  CB  . ASN A 1  479  ? 111.761 48.659  5.672   1.00 53.13  ? 479  ASN A CB  1 
ATOM   3707  C  CG  . ASN A 1  479  ? 110.729 49.477  6.439   1.00 56.91  ? 479  ASN A CG  1 
ATOM   3708  O  OD1 . ASN A 1  479  ? 109.528 49.236  6.318   1.00 59.45  ? 479  ASN A OD1 1 
ATOM   3709  N  ND2 . ASN A 1  479  ? 111.196 50.438  7.245   1.00 57.82  ? 479  ASN A ND2 1 
ATOM   3710  N  N   . ALA A 1  480  ? 111.335 45.493  7.545   1.00 48.53  ? 480  ALA A N   1 
ATOM   3711  C  CA  . ALA A 1  480  ? 110.303 44.539  7.881   1.00 49.77  ? 480  ALA A CA  1 
ATOM   3712  C  C   . ALA A 1  480  ? 110.320 44.251  9.363   1.00 51.75  ? 480  ALA A C   1 
ATOM   3713  O  O   . ALA A 1  480  ? 111.340 44.408  10.037  1.00 51.34  ? 480  ALA A O   1 
ATOM   3714  C  CB  . ALA A 1  480  ? 110.516 43.263  7.113   1.00 47.76  ? 480  ALA A CB  1 
ATOM   3715  N  N   . ASP A 1  481  ? 109.166 43.841  9.867   1.00 54.30  ? 481  ASP A N   1 
ATOM   3716  C  CA  . ASP A 1  481  ? 109.025 43.479  11.265  1.00 54.59  ? 481  ASP A CA  1 
ATOM   3717  C  C   . ASP A 1  481  ? 108.436 42.065  11.266  1.00 51.71  ? 481  ASP A C   1 
ATOM   3718  O  O   . ASP A 1  481  ? 107.922 41.575  10.253  1.00 51.00  ? 481  ASP A O   1 
ATOM   3719  C  CB  . ASP A 1  481  ? 108.107 44.472  11.998  1.00 59.03  ? 481  ASP A CB  1 
ATOM   3720  C  CG  . ASP A 1  481  ? 107.476 45.500  11.057  1.00 63.13  ? 481  ASP A CG  1 
ATOM   3721  O  OD1 . ASP A 1  481  ? 106.803 45.093  10.081  1.00 67.94  ? 481  ASP A OD1 1 
ATOM   3722  O  OD2 . ASP A 1  481  ? 107.646 46.717  11.292  1.00 63.48  ? 481  ASP A OD2 1 
ATOM   3723  N  N   . PHE A 1  482  ? 108.517 41.398  12.398  1.00 47.79  ? 482  PHE A N   1 
ATOM   3724  C  CA  . PHE A 1  482  ? 108.013 40.051  12.452  1.00 46.49  ? 482  PHE A CA  1 
ATOM   3725  C  C   . PHE A 1  482  ? 106.613 39.993  13.033  1.00 47.73  ? 482  PHE A C   1 
ATOM   3726  O  O   . PHE A 1  482  ? 106.288 39.117  13.835  1.00 51.59  ? 482  PHE A O   1 
ATOM   3727  C  CB  . PHE A 1  482  ? 109.006 39.223  13.244  1.00 43.23  ? 482  PHE A CB  1 
ATOM   3728  C  CG  . PHE A 1  482  ? 110.400 39.357  12.734  1.00 36.24  ? 482  PHE A CG  1 
ATOM   3729  C  CD1 . PHE A 1  482  ? 111.418 39.792  13.560  1.00 35.34  ? 482  PHE A CD1 1 
ATOM   3730  C  CD2 . PHE A 1  482  ? 110.683 39.079  11.401  1.00 34.02  ? 482  PHE A CD2 1 
ATOM   3731  C  CE1 . PHE A 1  482  ? 112.703 39.947  13.066  1.00 36.44  ? 482  PHE A CE1 1 
ATOM   3732  C  CE2 . PHE A 1  482  ? 111.960 39.229  10.897  1.00 33.77  ? 482  PHE A CE2 1 
ATOM   3733  C  CZ  . PHE A 1  482  ? 112.974 39.665  11.728  1.00 35.28  ? 482  PHE A CZ  1 
ATOM   3734  N  N   . ASP A 1  483  ? 105.782 40.944  12.621  1.00 46.94  ? 483  ASP A N   1 
ATOM   3735  C  CA  . ASP A 1  483  ? 104.408 40.985  13.089  1.00 47.76  ? 483  ASP A CA  1 
ATOM   3736  C  C   . ASP A 1  483  ? 103.531 40.264  12.066  1.00 46.62  ? 483  ASP A C   1 
ATOM   3737  O  O   . ASP A 1  483  ? 102.360 40.600  11.863  1.00 47.03  ? 483  ASP A O   1 
ATOM   3738  C  CB  . ASP A 1  483  ? 103.938 42.444  13.325  1.00 52.07  ? 483  ASP A CB  1 
ATOM   3739  C  CG  . ASP A 1  483  ? 103.615 43.219  12.024  1.00 55.94  ? 483  ASP A CG  1 
ATOM   3740  O  OD1 . ASP A 1  483  ? 103.109 44.364  12.137  1.00 57.86  ? 483  ASP A OD1 1 
ATOM   3741  O  OD2 . ASP A 1  483  ? 103.857 42.713  10.904  1.00 56.07  ? 483  ASP A OD2 1 
ATOM   3742  N  N   . GLY A 1  484  ? 104.112 39.258  11.421  1.00 44.42  ? 484  GLY A N   1 
ATOM   3743  C  CA  . GLY A 1  484  ? 103.364 38.505  10.437  1.00 43.61  ? 484  GLY A CA  1 
ATOM   3744  C  C   . GLY A 1  484  ? 103.605 39.066  9.061   1.00 42.47  ? 484  GLY A C   1 
ATOM   3745  O  O   . GLY A 1  484  ? 102.714 39.066  8.209   1.00 40.82  ? 484  GLY A O   1 
ATOM   3746  N  N   . ASP A 1  485  ? 104.830 39.531  8.848   1.00 41.89  ? 485  ASP A N   1 
ATOM   3747  C  CA  . ASP A 1  485  ? 105.216 40.131  7.578   1.00 41.36  ? 485  ASP A CA  1 
ATOM   3748  C  C   . ASP A 1  485  ? 105.612 39.110  6.509   1.00 40.82  ? 485  ASP A C   1 
ATOM   3749  O  O   . ASP A 1  485  ? 106.634 38.439  6.636   1.00 41.74  ? 485  ASP A O   1 
ATOM   3750  C  CB  . ASP A 1  485  ? 106.376 41.112  7.820   1.00 42.96  ? 485  ASP A CB  1 
ATOM   3751  C  CG  . ASP A 1  485  ? 105.907 42.545  8.161   1.00 45.38  ? 485  ASP A CG  1 
ATOM   3752  O  OD1 . ASP A 1  485  ? 104.794 42.722  8.717   1.00 45.26  ? 485  ASP A OD1 1 
ATOM   3753  O  OD2 . ASP A 1  485  ? 106.677 43.500  7.878   1.00 45.40  ? 485  ASP A OD2 1 
ATOM   3754  N  N   . GLU A 1  486  ? 104.808 38.995  5.455   1.00 40.25  ? 486  GLU A N   1 
ATOM   3755  C  CA  . GLU A 1  486  ? 105.116 38.066  4.362   1.00 39.52  ? 486  GLU A CA  1 
ATOM   3756  C  C   . GLU A 1  486  ? 106.212 38.631  3.446   1.00 36.45  ? 486  GLU A C   1 
ATOM   3757  O  O   . GLU A 1  486  ? 106.177 39.802  3.069   1.00 37.55  ? 486  GLU A O   1 
ATOM   3758  C  CB  . GLU A 1  486  ? 103.865 37.766  3.515   1.00 43.59  ? 486  GLU A CB  1 
ATOM   3759  C  CG  . GLU A 1  486  ? 103.025 36.564  3.975   1.00 50.24  ? 486  GLU A CG  1 
ATOM   3760  C  CD  . GLU A 1  486  ? 101.831 36.259  3.048   1.00 56.05  ? 486  GLU A CD  1 
ATOM   3761  O  OE1 . GLU A 1  486  ? 100.811 36.987  3.104   1.00 59.20  ? 486  GLU A OE1 1 
ATOM   3762  O  OE2 . GLU A 1  486  ? 101.908 35.290  2.256   1.00 56.84  ? 486  GLU A OE2 1 
ATOM   3763  N  N   . MET A 1  487  ? 107.180 37.790  3.092   1.00 30.59  ? 487  MET A N   1 
ATOM   3764  C  CA  . MET A 1  487  ? 108.287 38.172  2.218   1.00 25.23  ? 487  MET A CA  1 
ATOM   3765  C  C   . MET A 1  487  ? 108.295 37.239  1.020   1.00 24.70  ? 487  MET A C   1 
ATOM   3766  O  O   . MET A 1  487  ? 107.701 36.173  1.080   1.00 27.77  ? 487  MET A O   1 
ATOM   3767  C  CB  . MET A 1  487  ? 109.592 38.019  2.970   1.00 18.98  ? 487  MET A CB  1 
ATOM   3768  C  CG  . MET A 1  487  ? 109.799 39.052  4.028   1.00 15.25  ? 487  MET A CG  1 
ATOM   3769  S  SD  . MET A 1  487  ? 111.273 39.954  3.576   1.00 18.71  ? 487  MET A SD  1 
ATOM   3770  C  CE  . MET A 1  487  ? 112.240 39.765  4.979   1.00 12.78  ? 487  MET A CE  1 
ATOM   3771  N  N   . ASN A 1  488  ? 108.953 37.611  -0.068  1.00 20.71  ? 488  ASN A N   1 
ATOM   3772  C  CA  . ASN A 1  488  ? 108.980 36.709  -1.214  1.00 20.64  ? 488  ASN A CA  1 
ATOM   3773  C  C   . ASN A 1  488  ? 110.308 36.003  -1.373  1.00 21.49  ? 488  ASN A C   1 
ATOM   3774  O  O   . ASN A 1  488  ? 111.152 36.046  -0.480  1.00 27.28  ? 488  ASN A O   1 
ATOM   3775  C  CB  . ASN A 1  488  ? 108.682 37.446  -2.500  1.00 23.57  ? 488  ASN A CB  1 
ATOM   3776  C  CG  . ASN A 1  488  ? 107.275 37.922  -2.566  1.00 27.07  ? 488  ASN A CG  1 
ATOM   3777  O  OD1 . ASN A 1  488  ? 106.359 37.224  -2.145  1.00 30.05  ? 488  ASN A OD1 1 
ATOM   3778  N  ND2 . ASN A 1  488  ? 107.079 39.115  -3.113  1.00 31.53  ? 488  ASN A ND2 1 
ATOM   3779  N  N   . LEU A 1  489  ? 110.494 35.351  -2.517  1.00 16.24  ? 489  LEU A N   1 
ATOM   3780  C  CA  . LEU A 1  489  ? 111.736 34.647  -2.801  1.00 11.80  ? 489  LEU A CA  1 
ATOM   3781  C  C   . LEU A 1  489  ? 111.699 34.046  -4.177  1.00 11.79  ? 489  LEU A C   1 
ATOM   3782  O  O   . LEU A 1  489  ? 110.800 33.279  -4.509  1.00 12.97  ? 489  LEU A O   1 
ATOM   3783  C  CB  . LEU A 1  489  ? 111.998 33.546  -1.761  1.00 9.63   ? 489  LEU A CB  1 
ATOM   3784  C  CG  . LEU A 1  489  ? 113.006 32.412  -2.022  1.00 5.35   ? 489  LEU A CG  1 
ATOM   3785  C  CD1 . LEU A 1  489  ? 114.073 32.828  -3.019  1.00 11.15  ? 489  LEU A CD1 1 
ATOM   3786  C  CD2 . LEU A 1  489  ? 113.637 31.997  -0.696  1.00 6.33   ? 489  LEU A CD2 1 
ATOM   3787  N  N   . HIS A 1  490  ? 112.694 34.409  -4.974  1.00 11.76  ? 490  HIS A N   1 
ATOM   3788  C  CA  . HIS A 1  490  ? 112.828 33.907  -6.332  1.00 11.67  ? 490  HIS A CA  1 
ATOM   3789  C  C   . HIS A 1  490  ? 114.139 33.138  -6.404  1.00 10.80  ? 490  HIS A C   1 
ATOM   3790  O  O   . HIS A 1  490  ? 115.157 33.541  -5.807  1.00 13.50  ? 490  HIS A O   1 
ATOM   3791  C  CB  . HIS A 1  490  ? 112.829 35.067  -7.309  1.00 10.55  ? 490  HIS A CB  1 
ATOM   3792  C  CG  . HIS A 1  490  ? 111.654 35.975  -7.141  1.00 14.22  ? 490  HIS A CG  1 
ATOM   3793  N  ND1 . HIS A 1  490  ? 110.485 35.815  -7.849  1.00 17.25  ? 490  HIS A ND1 1 
ATOM   3794  C  CD2 . HIS A 1  490  ? 111.451 37.027  -6.310  1.00 15.29  ? 490  HIS A CD2 1 
ATOM   3795  C  CE1 . HIS A 1  490  ? 109.611 36.731  -7.464  1.00 14.54  ? 490  HIS A CE1 1 
ATOM   3796  N  NE2 . HIS A 1  490  ? 110.173 37.479  -6.531  1.00 14.20  ? 490  HIS A NE2 1 
ATOM   3797  N  N   . VAL A 1  491  ? 114.102 32.019  -7.123  1.00 9.19   ? 491  VAL A N   1 
ATOM   3798  C  CA  . VAL A 1  491  ? 115.262 31.157  -7.254  1.00 3.23   ? 491  VAL A CA  1 
ATOM   3799  C  C   . VAL A 1  491  ? 115.890 31.281  -8.603  1.00 3.13   ? 491  VAL A C   1 
ATOM   3800  O  O   . VAL A 1  491  ? 115.208 31.156  -9.609  1.00 1.81   ? 491  VAL A O   1 
ATOM   3801  C  CB  . VAL A 1  491  ? 114.886 29.701  -7.056  1.00 1.30   ? 491  VAL A CB  1 
ATOM   3802  C  CG1 . VAL A 1  491  ? 115.988 28.815  -7.586  1.00 3.44   ? 491  VAL A CG1 1 
ATOM   3803  C  CG2 . VAL A 1  491  ? 114.642 29.437  -5.584  1.00 3.77   ? 491  VAL A CG2 1 
ATOM   3804  N  N   . PRO A 1  492  ? 117.208 31.522  -8.641  1.00 4.83   ? 492  PRO A N   1 
ATOM   3805  C  CA  . PRO A 1  492  ? 117.952 31.662  -9.895  1.00 7.62   ? 492  PRO A CA  1 
ATOM   3806  C  C   . PRO A 1  492  ? 117.772 30.377  -10.695 1.00 12.49  ? 492  PRO A C   1 
ATOM   3807  O  O   . PRO A 1  492  ? 117.304 29.372  -10.151 1.00 13.41  ? 492  PRO A O   1 
ATOM   3808  C  CB  . PRO A 1  492  ? 119.382 31.869  -9.421  1.00 5.31   ? 492  PRO A CB  1 
ATOM   3809  C  CG  . PRO A 1  492  ? 119.406 31.114  -8.114  1.00 3.79   ? 492  PRO A CG  1 
ATOM   3810  C  CD  . PRO A 1  492  ? 118.115 31.530  -7.483  1.00 3.86   ? 492  PRO A CD  1 
ATOM   3811  N  N   . GLN A 1  493  ? 118.152 30.391  -11.970 1.00 15.79  ? 493  GLN A N   1 
ATOM   3812  C  CA  . GLN A 1  493  ? 117.961 29.210  -12.805 1.00 18.82  ? 493  GLN A CA  1 
ATOM   3813  C  C   . GLN A 1  493  ? 119.161 28.750  -13.648 1.00 23.10  ? 493  GLN A C   1 
ATOM   3814  O  O   . GLN A 1  493  ? 119.308 27.555  -13.933 1.00 22.72  ? 493  GLN A O   1 
ATOM   3815  C  CB  . GLN A 1  493  ? 116.752 29.444  -13.707 1.00 17.49  ? 493  GLN A CB  1 
ATOM   3816  C  CG  . GLN A 1  493  ? 115.838 28.255  -13.845 1.00 15.24  ? 493  GLN A CG  1 
ATOM   3817  C  CD  . GLN A 1  493  ? 115.193 27.847  -12.531 1.00 14.14  ? 493  GLN A CD  1 
ATOM   3818  O  OE1 . GLN A 1  493  ? 114.445 26.870  -12.485 1.00 18.72  ? 493  GLN A OE1 1 
ATOM   3819  N  NE2 . GLN A 1  493  ? 115.477 28.584  -11.462 1.00 11.15  ? 493  GLN A NE2 1 
ATOM   3820  N  N   . SER A 1  494  ? 120.003 29.682  -14.079 1.00 26.49  ? 494  SER A N   1 
ATOM   3821  C  CA  . SER A 1  494  ? 121.179 29.302  -14.854 1.00 31.00  ? 494  SER A CA  1 
ATOM   3822  C  C   . SER A 1  494  ? 122.333 29.320  -13.882 1.00 29.10  ? 494  SER A C   1 
ATOM   3823  O  O   . SER A 1  494  ? 122.138 29.433  -12.673 1.00 26.67  ? 494  SER A O   1 
ATOM   3824  C  CB  . SER A 1  494  ? 121.466 30.297  -15.994 1.00 35.54  ? 494  SER A CB  1 
ATOM   3825  O  OG  . SER A 1  494  ? 120.604 30.114  -17.107 1.00 42.71  ? 494  SER A OG  1 
ATOM   3826  N  N   . GLU A 1  495  ? 123.539 29.201  -14.414 1.00 29.78  ? 495  GLU A N   1 
ATOM   3827  C  CA  . GLU A 1  495  ? 124.722 29.241  -13.579 1.00 31.47  ? 495  GLU A CA  1 
ATOM   3828  C  C   . GLU A 1  495  ? 125.164 30.720  -13.578 1.00 31.48  ? 495  GLU A C   1 
ATOM   3829  O  O   . GLU A 1  495  ? 125.637 31.246  -12.559 1.00 27.37  ? 495  GLU A O   1 
ATOM   3830  C  CB  . GLU A 1  495  ? 125.805 28.318  -14.167 1.00 33.54  ? 495  GLU A CB  1 
ATOM   3831  C  CG  . GLU A 1  495  ? 126.907 27.925  -13.183 1.00 40.23  ? 495  GLU A CG  1 
ATOM   3832  C  CD  . GLU A 1  495  ? 126.376 27.164  -11.963 1.00 46.12  ? 495  GLU A CD  1 
ATOM   3833  O  OE1 . GLU A 1  495  ? 125.701 26.127  -12.168 1.00 48.94  ? 495  GLU A OE1 1 
ATOM   3834  O  OE2 . GLU A 1  495  ? 126.632 27.596  -10.805 1.00 47.61  ? 495  GLU A OE2 1 
ATOM   3835  N  N   . GLU A 1  496  ? 124.970 31.380  -14.728 1.00 31.90  ? 496  GLU A N   1 
ATOM   3836  C  CA  . GLU A 1  496  ? 125.320 32.792  -14.926 1.00 31.12  ? 496  GLU A CA  1 
ATOM   3837  C  C   . GLU A 1  496  ? 124.364 33.667  -14.145 1.00 28.19  ? 496  GLU A C   1 
ATOM   3838  O  O   . GLU A 1  496  ? 124.751 34.701  -13.616 1.00 30.05  ? 496  GLU A O   1 
ATOM   3839  C  CB  . GLU A 1  496  ? 125.249 33.157  -16.408 1.00 34.59  ? 496  GLU A CB  1 
ATOM   3840  C  CG  . GLU A 1  496  ? 123.913 32.852  -17.036 1.00 43.40  ? 496  GLU A CG  1 
ATOM   3841  C  CD  . GLU A 1  496  ? 123.889 33.127  -18.531 1.00 48.99  ? 496  GLU A CD  1 
ATOM   3842  O  OE1 . GLU A 1  496  ? 122.844 32.836  -19.171 1.00 50.50  ? 496  GLU A OE1 1 
ATOM   3843  O  OE2 . GLU A 1  496  ? 124.912 33.633  -19.059 1.00 50.43  ? 496  GLU A OE2 1 
ATOM   3844  N  N   . THR A 1  497  ? 123.110 33.240  -14.091 1.00 26.09  ? 497  THR A N   1 
ATOM   3845  C  CA  . THR A 1  497  ? 122.076 33.940  -13.352 1.00 25.10  ? 497  THR A CA  1 
ATOM   3846  C  C   . THR A 1  497  ? 122.429 33.968  -11.876 1.00 26.55  ? 497  THR A C   1 
ATOM   3847  O  O   . THR A 1  497  ? 122.535 35.025  -11.266 1.00 25.62  ? 497  THR A O   1 
ATOM   3848  C  CB  . THR A 1  497  ? 120.740 33.238  -13.519 1.00 23.10  ? 497  THR A CB  1 
ATOM   3849  O  OG1 . THR A 1  497  ? 120.153 33.663  -14.752 1.00 23.11  ? 497  THR A OG1 1 
ATOM   3850  C  CG2 . THR A 1  497  ? 119.814 33.526  -12.331 1.00 22.28  ? 497  THR A CG2 1 
ATOM   3851  N  N   . ARG A 1  498  ? 122.605 32.795  -11.295 1.00 27.71  ? 498  ARG A N   1 
ATOM   3852  C  CA  . ARG A 1  498  ? 122.959 32.721  -9.889  1.00 29.07  ? 498  ARG A CA  1 
ATOM   3853  C  C   . ARG A 1  498  ? 124.250 33.485  -9.604  1.00 28.23  ? 498  ARG A C   1 
ATOM   3854  O  O   . ARG A 1  498  ? 124.543 33.814  -8.453  1.00 28.48  ? 498  ARG A O   1 
ATOM   3855  C  CB  . ARG A 1  498  ? 123.116 31.265  -9.467  1.00 31.39  ? 498  ARG A CB  1 
ATOM   3856  C  CG  . ARG A 1  498  ? 123.631 30.353  -10.564 1.00 38.13  ? 498  ARG A CG  1 
ATOM   3857  C  CD  . ARG A 1  498  ? 124.063 29.037  -9.971  1.00 44.54  ? 498  ARG A CD  1 
ATOM   3858  N  NE  . ARG A 1  498  ? 123.125 28.592  -8.947  1.00 47.04  ? 498  ARG A NE  1 
ATOM   3859  C  CZ  . ARG A 1  498  ? 123.501 28.046  -7.797  1.00 47.73  ? 498  ARG A CZ  1 
ATOM   3860  N  NH1 . ARG A 1  498  ? 124.800 27.884  -7.546  1.00 47.50  ? 498  ARG A NH1 1 
ATOM   3861  N  NH2 . ARG A 1  498  ? 122.586 27.680  -6.899  1.00 46.44  ? 498  ARG A NH2 1 
ATOM   3862  N  N   . ALA A 1  499  ? 125.019 33.764  -10.655 1.00 27.75  ? 499  ALA A N   1 
ATOM   3863  C  CA  . ALA A 1  499  ? 126.283 34.491  -10.515 1.00 25.65  ? 499  ALA A CA  1 
ATOM   3864  C  C   . ALA A 1  499  ? 126.036 36.000  -10.392 1.00 23.90  ? 499  ALA A C   1 
ATOM   3865  O  O   . ALA A 1  499  ? 126.795 36.720  -9.719  1.00 20.48  ? 499  ALA A O   1 
ATOM   3866  C  CB  . ALA A 1  499  ? 127.189 34.191  -11.710 1.00 28.95  ? 499  ALA A CB  1 
ATOM   3867  N  N   . GLU A 1  500  ? 124.974 36.458  -11.058 1.00 23.60  ? 500  GLU A N   1 
ATOM   3868  C  CA  . GLU A 1  500  ? 124.560 37.856  -11.039 1.00 25.15  ? 500  GLU A CA  1 
ATOM   3869  C  C   . GLU A 1  500  ? 123.986 38.161  -9.661  1.00 25.39  ? 500  GLU A C   1 
ATOM   3870  O  O   . GLU A 1  500  ? 123.957 39.309  -9.224  1.00 27.46  ? 500  GLU A O   1 
ATOM   3871  C  CB  . GLU A 1  500  ? 123.491 38.120  -12.101 1.00 24.56  ? 500  GLU A CB  1 
ATOM   3872  C  CG  . GLU A 1  500  ? 123.991 38.820  -13.338 1.00 24.31  ? 500  GLU A CG  1 
ATOM   3873  C  CD  . GLU A 1  500  ? 122.928 38.930  -14.421 1.00 25.70  ? 500  GLU A CD  1 
ATOM   3874  O  OE1 . GLU A 1  500  ? 121.746 39.163  -14.090 1.00 23.90  ? 500  GLU A OE1 1 
ATOM   3875  O  OE2 . GLU A 1  500  ? 123.280 38.796  -15.612 1.00 25.46  ? 500  GLU A OE2 1 
ATOM   3876  N  N   . LEU A 1  501  ? 123.513 37.138  -8.971  1.00 21.23  ? 501  LEU A N   1 
ATOM   3877  C  CA  . LEU A 1  501  ? 122.976 37.383  -7.658  1.00 17.58  ? 501  LEU A CA  1 
ATOM   3878  C  C   . LEU A 1  501  ? 124.099 37.331  -6.648  1.00 16.99  ? 501  LEU A C   1 
ATOM   3879  O  O   . LEU A 1  501  ? 124.135 38.102  -5.696  1.00 15.67  ? 501  LEU A O   1 
ATOM   3880  C  CB  . LEU A 1  501  ? 121.915 36.346  -7.313  1.00 13.85  ? 501  LEU A CB  1 
ATOM   3881  C  CG  . LEU A 1  501  ? 120.478 36.726  -7.656  1.00 12.23  ? 501  LEU A CG  1 
ATOM   3882  C  CD1 . LEU A 1  501  ? 119.938 35.861  -8.780  1.00 10.07  ? 501  LEU A CD1 1 
ATOM   3883  C  CD2 . LEU A 1  501  ? 119.638 36.574  -6.409  1.00 13.15  ? 501  LEU A CD2 1 
ATOM   3884  N  N   . SER A 1  502  ? 125.038 36.430  -6.883  1.00 17.76  ? 502  SER A N   1 
ATOM   3885  C  CA  . SER A 1  502  ? 126.161 36.219  -5.973  1.00 18.47  ? 502  SER A CA  1 
ATOM   3886  C  C   . SER A 1  502  ? 127.174 37.344  -5.948  1.00 18.06  ? 502  SER A C   1 
ATOM   3887  O  O   . SER A 1  502  ? 127.595 37.802  -4.876  1.00 16.22  ? 502  SER A O   1 
ATOM   3888  C  CB  . SER A 1  502  ? 126.888 34.931  -6.358  1.00 20.23  ? 502  SER A CB  1 
ATOM   3889  O  OG  . SER A 1  502  ? 127.409 35.033  -7.681  1.00 26.10  ? 502  SER A OG  1 
ATOM   3890  N  N   . GLN A 1  503  ? 127.572 37.761  -7.147  1.00 19.49  ? 503  GLN A N   1 
ATOM   3891  C  CA  . GLN A 1  503  ? 128.572 38.805  -7.326  1.00 20.25  ? 503  GLN A CA  1 
ATOM   3892  C  C   . GLN A 1  503  ? 128.037 40.253  -7.333  1.00 20.05  ? 503  GLN A C   1 
ATOM   3893  O  O   . GLN A 1  503  ? 128.818 41.219  -7.279  1.00 20.43  ? 503  GLN A O   1 
ATOM   3894  C  CB  . GLN A 1  503  ? 129.377 38.494  -8.602  1.00 20.80  ? 503  GLN A CB  1 
ATOM   3895  C  CG  . GLN A 1  503  ? 130.649 37.632  -8.373  1.00 21.40  ? 503  GLN A CG  1 
ATOM   3896  C  CD  . GLN A 1  503  ? 130.705 36.930  -7.002  1.00 22.52  ? 503  GLN A CD  1 
ATOM   3897  O  OE1 . GLN A 1  503  ? 129.771 36.233  -6.615  1.00 22.14  ? 503  GLN A OE1 1 
ATOM   3898  N  NE2 . GLN A 1  503  ? 131.815 37.109  -6.277  1.00 21.02  ? 503  GLN A NE2 1 
ATOM   3899  N  N   . LEU A 1  504  ? 126.711 40.398  -7.373  1.00 17.10  ? 504  LEU A N   1 
ATOM   3900  C  CA  . LEU A 1  504  ? 126.091 41.714  -7.379  1.00 13.68  ? 504  LEU A CA  1 
ATOM   3901  C  C   . LEU A 1  504  ? 125.068 41.970  -6.285  1.00 12.08  ? 504  LEU A C   1 
ATOM   3902  O  O   . LEU A 1  504  ? 125.311 42.794  -5.423  1.00 11.90  ? 504  LEU A O   1 
ATOM   3903  C  CB  . LEU A 1  504  ? 125.441 41.991  -8.729  1.00 14.71  ? 504  LEU A CB  1 
ATOM   3904  C  CG  . LEU A 1  504  ? 126.350 42.458  -9.863  1.00 13.21  ? 504  LEU A CG  1 
ATOM   3905  C  CD1 . LEU A 1  504  ? 127.502 41.508  -10.053 1.00 15.33  ? 504  LEU A CD1 1 
ATOM   3906  C  CD2 . LEU A 1  504  ? 125.533 42.564  -11.134 1.00 13.15  ? 504  LEU A CD2 1 
ATOM   3907  N  N   . CYS A 1  505  ? 123.941 41.267  -6.290  1.00 9.15   ? 505  CYS A N   1 
ATOM   3908  C  CA  . CYS A 1  505  ? 122.906 41.549  -5.297  1.00 8.54   ? 505  CYS A CA  1 
ATOM   3909  C  C   . CYS A 1  505  ? 123.046 40.933  -3.923  1.00 7.03   ? 505  CYS A C   1 
ATOM   3910  O  O   . CYS A 1  505  ? 122.077 40.827  -3.191  1.00 11.19  ? 505  CYS A O   1 
ATOM   3911  C  CB  . CYS A 1  505  ? 121.554 41.163  -5.858  1.00 8.70   ? 505  CYS A CB  1 
ATOM   3912  S  SG  . CYS A 1  505  ? 121.528 41.348  -7.611  1.00 18.28  ? 505  CYS A SG  1 
ATOM   3913  N  N   . ALA A 1  506  ? 124.250 40.576  -3.533  1.00 4.87   ? 506  ALA A N   1 
ATOM   3914  C  CA  . ALA A 1  506  ? 124.424 39.935  -2.246  1.00 1.00   ? 506  ALA A CA  1 
ATOM   3915  C  C   . ALA A 1  506  ? 124.437 40.807  -1.012  1.00 1.00   ? 506  ALA A C   1 
ATOM   3916  O  O   . ALA A 1  506  ? 125.316 41.629  -0.850  1.00 1.00   ? 506  ALA A O   1 
ATOM   3917  C  CB  . ALA A 1  506  ? 125.679 39.128  -2.284  1.00 3.32   ? 506  ALA A CB  1 
ATOM   3918  N  N   . VAL A 1  507  ? 123.501 40.577  -0.110  1.00 2.17   ? 507  VAL A N   1 
ATOM   3919  C  CA  . VAL A 1  507  ? 123.423 41.340  1.128   1.00 6.39   ? 507  VAL A CA  1 
ATOM   3920  C  C   . VAL A 1  507  ? 124.673 42.068  1.629   1.00 5.59   ? 507  VAL A C   1 
ATOM   3921  O  O   . VAL A 1  507  ? 124.599 43.247  1.970   1.00 6.94   ? 507  VAL A O   1 
ATOM   3922  C  CB  . VAL A 1  507  ? 122.883 40.461  2.286   1.00 6.75   ? 507  VAL A CB  1 
ATOM   3923  C  CG1 . VAL A 1  507  ? 123.257 41.036  3.661   1.00 4.67   ? 507  VAL A CG1 1 
ATOM   3924  C  CG2 . VAL A 1  507  ? 121.382 40.370  2.168   1.00 6.90   ? 507  VAL A CG2 1 
ATOM   3925  N  N   . PRO A 1  508  ? 125.830 41.395  1.687   1.00 6.03   ? 508  PRO A N   1 
ATOM   3926  C  CA  . PRO A 1  508  ? 127.034 42.083  2.176   1.00 4.65   ? 508  PRO A CA  1 
ATOM   3927  C  C   . PRO A 1  508  ? 127.542 43.137  1.202   1.00 6.75   ? 508  PRO A C   1 
ATOM   3928  O  O   . PRO A 1  508  ? 128.115 44.149  1.603   1.00 8.41   ? 508  PRO A O   1 
ATOM   3929  C  CB  . PRO A 1  508  ? 128.029 40.949  2.368   1.00 5.10   ? 508  PRO A CB  1 
ATOM   3930  C  CG  . PRO A 1  508  ? 127.152 39.752  2.541   1.00 7.63   ? 508  PRO A CG  1 
ATOM   3931  C  CD  . PRO A 1  508  ? 126.109 39.973  1.486   1.00 5.35   ? 508  PRO A CD  1 
ATOM   3932  N  N   . LEU A 1  509  ? 127.343 42.886  -0.082  1.00 7.86   ? 509  LEU A N   1 
ATOM   3933  C  CA  . LEU A 1  509  ? 127.732 43.846  -1.094  1.00 9.64   ? 509  LEU A CA  1 
ATOM   3934  C  C   . LEU A 1  509  ? 126.890 45.117  -0.946  1.00 9.05   ? 509  LEU A C   1 
ATOM   3935  O  O   . LEU A 1  509  ? 127.236 46.166  -1.488  1.00 11.76  ? 509  LEU A O   1 
ATOM   3936  C  CB  . LEU A 1  509  ? 127.472 43.281  -2.483  1.00 15.09  ? 509  LEU A CB  1 
ATOM   3937  C  CG  . LEU A 1  509  ? 128.417 42.268  -3.118  1.00 21.17  ? 509  LEU A CG  1 
ATOM   3938  C  CD1 . LEU A 1  509  ? 127.801 41.759  -4.421  1.00 23.96  ? 509  LEU A CD1 1 
ATOM   3939  C  CD2 . LEU A 1  509  ? 129.773 42.928  -3.387  1.00 25.86  ? 509  LEU A CD2 1 
ATOM   3940  N  N   . GLN A 1  510  ? 125.791 45.029  -0.204  1.00 7.71   ? 510  GLN A N   1 
ATOM   3941  C  CA  . GLN A 1  510  ? 124.886 46.155  -0.049  1.00 7.82   ? 510  GLN A CA  1 
ATOM   3942  C  C   . GLN A 1  510  ? 124.965 47.010  1.204   1.00 8.67   ? 510  GLN A C   1 
ATOM   3943  O  O   . GLN A 1  510  ? 124.183 47.953  1.334   1.00 3.70   ? 510  GLN A O   1 
ATOM   3944  C  CB  . GLN A 1  510  ? 123.469 45.643  -0.192  1.00 9.97   ? 510  GLN A CB  1 
ATOM   3945  C  CG  . GLN A 1  510  ? 123.229 44.989  -1.523  1.00 15.40  ? 510  GLN A CG  1 
ATOM   3946  C  CD  . GLN A 1  510  ? 123.535 45.927  -2.668  1.00 19.02  ? 510  GLN A CD  1 
ATOM   3947  O  OE1 . GLN A 1  510  ? 123.252 47.125  -2.583  1.00 22.00  ? 510  GLN A OE1 1 
ATOM   3948  N  NE2 . GLN A 1  510  ? 124.100 45.396  -3.752  1.00 19.52  ? 510  GLN A NE2 1 
ATOM   3949  N  N   . ILE A 1  511  ? 125.907 46.703  2.098   1.00 10.86  ? 511  ILE A N   1 
ATOM   3950  C  CA  . ILE A 1  511  ? 126.061 47.405  3.381   1.00 13.47  ? 511  ILE A CA  1 
ATOM   3951  C  C   . ILE A 1  511  ? 126.193 48.933  3.380   1.00 18.51  ? 511  ILE A C   1 
ATOM   3952  O  O   . ILE A 1  511  ? 125.769 49.585  4.337   1.00 19.33  ? 511  ILE A O   1 
ATOM   3953  C  CB  . ILE A 1  511  ? 127.223 46.788  4.184   1.00 10.12  ? 511  ILE A CB  1 
ATOM   3954  C  CG1 . ILE A 1  511  ? 126.949 45.295  4.361   1.00 9.46   ? 511  ILE A CG1 1 
ATOM   3955  C  CG2 . ILE A 1  511  ? 127.341 47.445  5.566   1.00 5.75   ? 511  ILE A CG2 1 
ATOM   3956  C  CD1 . ILE A 1  511  ? 128.057 44.544  5.036   1.00 13.56  ? 511  ILE A CD1 1 
ATOM   3957  N  N   . VAL A 1  512  ? 126.773 49.502  2.326   1.00 23.57  ? 512  VAL A N   1 
ATOM   3958  C  CA  . VAL A 1  512  ? 126.913 50.958  2.214   1.00 26.36  ? 512  VAL A CA  1 
ATOM   3959  C  C   . VAL A 1  512  ? 125.942 51.457  1.148   1.00 26.59  ? 512  VAL A C   1 
ATOM   3960  O  O   . VAL A 1  512  ? 126.032 51.051  -0.016  1.00 28.27  ? 512  VAL A O   1 
ATOM   3961  C  CB  . VAL A 1  512  ? 128.342 51.341  1.819   1.00 28.72  ? 512  VAL A CB  1 
ATOM   3962  C  CG1 . VAL A 1  512  ? 128.387 52.746  1.278   1.00 27.86  ? 512  VAL A CG1 1 
ATOM   3963  C  CG2 . VAL A 1  512  ? 129.226 51.247  3.028   1.00 35.35  ? 512  VAL A CG2 1 
ATOM   3964  N  N   . SER A 1  513  ? 125.017 52.330  1.545   1.00 27.33  ? 513  SER A N   1 
ATOM   3965  C  CA  . SER A 1  513  ? 124.015 52.841  0.612   1.00 27.47  ? 513  SER A CA  1 
ATOM   3966  C  C   . SER A 1  513  ? 124.412 54.027  -0.221  1.00 27.79  ? 513  SER A C   1 
ATOM   3967  O  O   . SER A 1  513  ? 124.768 55.075  0.296   1.00 29.79  ? 513  SER A O   1 
ATOM   3968  C  CB  . SER A 1  513  ? 122.729 53.222  1.324   1.00 28.97  ? 513  SER A CB  1 
ATOM   3969  O  OG  . SER A 1  513  ? 121.871 53.871  0.398   1.00 22.57  ? 513  SER A OG  1 
ATOM   3970  N  N   . PRO A 1  514  ? 124.281 53.897  -1.535  1.00 28.55  ? 514  PRO A N   1 
ATOM   3971  C  CA  . PRO A 1  514  ? 124.635 54.975  -2.445  1.00 30.25  ? 514  PRO A CA  1 
ATOM   3972  C  C   . PRO A 1  514  ? 123.758 56.221  -2.246  1.00 31.94  ? 514  PRO A C   1 
ATOM   3973  O  O   . PRO A 1  514  ? 124.208 57.343  -2.463  1.00 36.98  ? 514  PRO A O   1 
ATOM   3974  C  CB  . PRO A 1  514  ? 124.425 54.334  -3.804  1.00 29.62  ? 514  PRO A CB  1 
ATOM   3975  C  CG  . PRO A 1  514  ? 123.185 53.578  -3.557  1.00 31.02  ? 514  PRO A CG  1 
ATOM   3976  C  CD  . PRO A 1  514  ? 123.494 52.880  -2.241  1.00 30.57  ? 514  PRO A CD  1 
ATOM   3977  N  N   . GLN A 1  515  ? 122.508 56.052  -1.838  1.00 31.51  ? 515  GLN A N   1 
ATOM   3978  C  CA  . GLN A 1  515  ? 121.668 57.229  -1.661  1.00 32.64  ? 515  GLN A CA  1 
ATOM   3979  C  C   . GLN A 1  515  ? 121.789 57.799  -0.251  1.00 29.52  ? 515  GLN A C   1 
ATOM   3980  O  O   . GLN A 1  515  ? 120.795 58.048  0.431   1.00 30.29  ? 515  GLN A O   1 
ATOM   3981  C  CB  . GLN A 1  515  ? 120.207 56.901  -1.976  1.00 37.93  ? 515  GLN A CB  1 
ATOM   3982  C  CG  . GLN A 1  515  ? 119.532 55.969  -0.980  1.00 38.30  ? 515  GLN A CG  1 
ATOM   3983  C  CD  . GLN A 1  515  ? 118.126 56.418  -0.651  1.00 37.51  ? 515  GLN A CD  1 
ATOM   3984  O  OE1 . GLN A 1  515  ? 117.258 56.457  -1.526  1.00 35.61  ? 515  GLN A OE1 1 
ATOM   3985  N  NE2 . GLN A 1  515  ? 117.895 56.770  0.615   1.00 35.75  ? 515  GLN A NE2 1 
ATOM   3986  N  N   . SER A 1  516  ? 123.020 57.998  0.188   1.00 25.17  ? 516  SER A N   1 
ATOM   3987  C  CA  . SER A 1  516  ? 123.267 58.553  1.501   1.00 24.12  ? 516  SER A CA  1 
ATOM   3988  C  C   . SER A 1  516  ? 124.663 58.178  1.909   1.00 23.35  ? 516  SER A C   1 
ATOM   3989  O  O   . SER A 1  516  ? 125.004 58.191  3.092   1.00 21.96  ? 516  SER A O   1 
ATOM   3990  C  CB  . SER A 1  516  ? 122.305 57.993  2.522   1.00 27.18  ? 516  SER A CB  1 
ATOM   3991  O  OG  . SER A 1  516  ? 122.686 56.671  2.827   1.00 32.99  ? 516  SER A OG  1 
ATOM   3992  N  N   . ASN A 1  517  ? 125.458 57.821  0.911   1.00 25.01  ? 517  ASN A N   1 
ATOM   3993  C  CA  . ASN A 1  517  ? 126.846 57.460  1.123   1.00 29.08  ? 517  ASN A CA  1 
ATOM   3994  C  C   . ASN A 1  517  ? 127.157 57.094  2.581   1.00 32.78  ? 517  ASN A C   1 
ATOM   3995  O  O   . ASN A 1  517  ? 127.940 57.758  3.274   1.00 36.17  ? 517  ASN A O   1 
ATOM   3996  C  CB  . ASN A 1  517  ? 127.723 58.613  0.641   1.00 26.40  ? 517  ASN A CB  1 
ATOM   3997  C  CG  . ASN A 1  517  ? 127.133 59.963  0.996   1.00 24.85  ? 517  ASN A CG  1 
ATOM   3998  O  OD1 . ASN A 1  517  ? 127.046 60.329  2.181   1.00 23.08  ? 517  ASN A OD1 1 
ATOM   3999  N  ND2 . ASN A 1  517  ? 126.700 60.708  -0.026  1.00 22.16  ? 517  ASN A ND2 1 
ATOM   4000  N  N   . LYS A 1  518  ? 126.504 56.028  3.033   1.00 35.31  ? 518  LYS A N   1 
ATOM   4001  C  CA  . LYS A 1  518  ? 126.699 55.504  4.372   1.00 34.29  ? 518  LYS A CA  1 
ATOM   4002  C  C   . LYS A 1  518  ? 126.068 54.117  4.546   1.00 31.90  ? 518  LYS A C   1 
ATOM   4003  O  O   . LYS A 1  518  ? 125.243 53.666  3.744   1.00 30.02  ? 518  LYS A O   1 
ATOM   4004  C  CB  . LYS A 1  518  ? 126.120 56.461  5.406   1.00 35.99  ? 518  LYS A CB  1 
ATOM   4005  C  CG  . LYS A 1  518  ? 124.631 56.375  5.533   1.00 38.79  ? 518  LYS A CG  1 
ATOM   4006  C  CD  . LYS A 1  518  ? 124.190 57.077  6.792   1.00 45.65  ? 518  LYS A CD  1 
ATOM   4007  C  CE  . LYS A 1  518  ? 123.189 56.230  7.555   1.00 51.57  ? 518  LYS A CE  1 
ATOM   4008  N  NZ  . LYS A 1  518  ? 122.008 55.862  6.709   1.00 57.08  ? 518  LYS A NZ  1 
ATOM   4009  N  N   . PRO A 1  519  ? 126.464 53.421  5.611   1.00 30.56  ? 519  PRO A N   1 
ATOM   4010  C  CA  . PRO A 1  519  ? 125.951 52.091  5.915   1.00 30.36  ? 519  PRO A CA  1 
ATOM   4011  C  C   . PRO A 1  519  ? 124.428 52.093  6.078   1.00 29.81  ? 519  PRO A C   1 
ATOM   4012  O  O   . PRO A 1  519  ? 123.880 52.994  6.710   1.00 30.32  ? 519  PRO A O   1 
ATOM   4013  C  CB  . PRO A 1  519  ? 126.666 51.758  7.219   1.00 32.53  ? 519  PRO A CB  1 
ATOM   4014  C  CG  . PRO A 1  519  ? 126.828 53.084  7.859   1.00 31.64  ? 519  PRO A CG  1 
ATOM   4015  C  CD  . PRO A 1  519  ? 127.325 53.900  6.706   1.00 31.06  ? 519  PRO A CD  1 
ATOM   4016  N  N   . CYS A 1  520  ? 123.759 51.080  5.524   1.00 29.51  ? 520  CYS A N   1 
ATOM   4017  C  CA  . CYS A 1  520  ? 122.301 50.962  5.613   1.00 29.89  ? 520  CYS A CA  1 
ATOM   4018  C  C   . CYS A 1  520  ? 121.867 49.783  6.464   1.00 30.17  ? 520  CYS A C   1 
ATOM   4019  O  O   . CYS A 1  520  ? 120.703 49.387  6.445   1.00 29.06  ? 520  CYS A O   1 
ATOM   4020  C  CB  . CYS A 1  520  ? 121.692 50.792  4.229   1.00 31.76  ? 520  CYS A CB  1 
ATOM   4021  S  SG  . CYS A 1  520  ? 122.289 49.338  3.386   1.00 36.33  ? 520  CYS A SG  1 
ATOM   4022  N  N   . MET A 1  521  ? 122.808 49.217  7.204   1.00 31.14  ? 521  MET A N   1 
ATOM   4023  C  CA  . MET A 1  521  ? 122.516 48.082  8.062   1.00 31.72  ? 521  MET A CA  1 
ATOM   4024  C  C   . MET A 1  521  ? 123.204 48.302  9.394   1.00 31.66  ? 521  MET A C   1 
ATOM   4025  O  O   . MET A 1  521  ? 124.393 48.612  9.430   1.00 28.54  ? 521  MET A O   1 
ATOM   4026  C  CB  . MET A 1  521  ? 123.028 46.795  7.408   1.00 34.41  ? 521  MET A CB  1 
ATOM   4027  C  CG  . MET A 1  521  ? 122.342 46.459  6.096   1.00 34.54  ? 521  MET A CG  1 
ATOM   4028  S  SD  . MET A 1  521  ? 122.751 44.830  5.484   1.00 34.63  ? 521  MET A SD  1 
ATOM   4029  C  CE  . MET A 1  521  ? 122.627 45.084  3.714   1.00 36.10  ? 521  MET A CE  1 
ATOM   4030  N  N   . GLY A 1  522  ? 122.472 48.128  10.488  1.00 31.31  ? 522  GLY A N   1 
ATOM   4031  C  CA  . GLY A 1  522  ? 123.084 48.365  11.783  1.00 30.98  ? 522  GLY A CA  1 
ATOM   4032  C  C   . GLY A 1  522  ? 123.278 47.212  12.743  1.00 27.89  ? 522  GLY A C   1 
ATOM   4033  O  O   . GLY A 1  522  ? 123.950 46.231  12.445  1.00 29.55  ? 522  GLY A O   1 
ATOM   4034  N  N   . ILE A 1  523  ? 122.705 47.377  13.925  1.00 24.45  ? 523  ILE A N   1 
ATOM   4035  C  CA  . ILE A 1  523  ? 122.755 46.406  15.000  1.00 20.32  ? 523  ILE A CA  1 
ATOM   4036  C  C   . ILE A 1  523  ? 121.636 46.873  15.895  1.00 22.12  ? 523  ILE A C   1 
ATOM   4037  O  O   . ILE A 1  523  ? 121.685 47.985  16.409  1.00 22.61  ? 523  ILE A O   1 
ATOM   4038  C  CB  . ILE A 1  523  ? 124.085 46.469  15.754  1.00 15.14  ? 523  ILE A CB  1 
ATOM   4039  C  CG1 . ILE A 1  523  ? 125.104 45.601  15.033  1.00 11.93  ? 523  ILE A CG1 1 
ATOM   4040  C  CG2 . ILE A 1  523  ? 123.903 46.038  17.199  1.00 12.32  ? 523  ILE A CG2 1 
ATOM   4041  C  CD1 . ILE A 1  523  ? 126.080 44.921  15.949  1.00 12.13  ? 523  ILE A CD1 1 
ATOM   4042  N  N   . VAL A 1  524  ? 120.631 46.032  16.097  1.00 22.45  ? 524  VAL A N   1 
ATOM   4043  C  CA  . VAL A 1  524  ? 119.497 46.454  16.895  1.00 24.36  ? 524  VAL A CA  1 
ATOM   4044  C  C   . VAL A 1  524  ? 119.154 45.670  18.141  1.00 24.57  ? 524  VAL A C   1 
ATOM   4045  O  O   . VAL A 1  524  ? 119.850 44.746  18.555  1.00 24.24  ? 524  VAL A O   1 
ATOM   4046  C  CB  . VAL A 1  524  ? 118.232 46.502  16.026  1.00 25.69  ? 524  VAL A CB  1 
ATOM   4047  C  CG1 . VAL A 1  524  ? 117.338 47.661  16.456  1.00 27.66  ? 524  VAL A CG1 1 
ATOM   4048  C  CG2 . VAL A 1  524  ? 118.620 46.631  14.566  1.00 27.94  ? 524  VAL A CG2 1 
ATOM   4049  N  N   . GLN A 1  525  ? 118.038 46.095  18.717  1.00 26.66  ? 525  GLN A N   1 
ATOM   4050  C  CA  . GLN A 1  525  ? 117.437 45.538  19.915  1.00 30.15  ? 525  GLN A CA  1 
ATOM   4051  C  C   . GLN A 1  525  ? 118.445 44.875  20.825  1.00 29.60  ? 525  GLN A C   1 
ATOM   4052  O  O   . GLN A 1  525  ? 119.525 45.401  21.058  1.00 28.66  ? 525  GLN A O   1 
ATOM   4053  C  CB  . GLN A 1  525  ? 116.363 44.519  19.528  1.00 32.21  ? 525  GLN A CB  1 
ATOM   4054  C  CG  . GLN A 1  525  ? 115.609 44.829  18.234  1.00 37.63  ? 525  GLN A CG  1 
ATOM   4055  C  CD  . GLN A 1  525  ? 114.320 45.617  18.442  1.00 41.09  ? 525  GLN A CD  1 
ATOM   4056  O  OE1 . GLN A 1  525  ? 113.453 45.228  19.236  1.00 44.62  ? 525  GLN A OE1 1 
ATOM   4057  N  NE2 . GLN A 1  525  ? 114.180 46.722  17.706  1.00 41.28  ? 525  GLN A NE2 1 
ATOM   4058  N  N   . ASP A 1  526  ? 118.060 43.712  21.337  1.00 30.01  ? 526  ASP A N   1 
ATOM   4059  C  CA  . ASP A 1  526  ? 118.896 42.922  22.226  1.00 31.06  ? 526  ASP A CA  1 
ATOM   4060  C  C   . ASP A 1  526  ? 120.379 43.170  21.984  1.00 30.80  ? 526  ASP A C   1 
ATOM   4061  O  O   . ASP A 1  526  ? 121.041 43.807  22.802  1.00 34.79  ? 526  ASP A O   1 
ATOM   4062  C  CB  . ASP A 1  526  ? 118.608 41.419  22.046  1.00 34.19  ? 526  ASP A CB  1 
ATOM   4063  C  CG  . ASP A 1  526  ? 117.196 41.023  22.467  1.00 36.63  ? 526  ASP A CG  1 
ATOM   4064  O  OD1 . ASP A 1  526  ? 116.227 41.619  21.945  1.00 39.39  ? 526  ASP A OD1 1 
ATOM   4065  O  OD2 . ASP A 1  526  ? 117.056 40.106  23.312  1.00 36.84  ? 526  ASP A OD2 1 
ATOM   4066  N  N   . THR A 1  527  ? 120.883 42.671  20.856  1.00 28.16  ? 527  THR A N   1 
ATOM   4067  C  CA  . THR A 1  527  ? 122.294 42.791  20.496  1.00 28.88  ? 527  THR A CA  1 
ATOM   4068  C  C   . THR A 1  527  ? 122.895 44.131  20.855  1.00 29.00  ? 527  THR A C   1 
ATOM   4069  O  O   . THR A 1  527  ? 123.940 44.214  21.509  1.00 29.89  ? 527  THR A O   1 
ATOM   4070  C  CB  . THR A 1  527  ? 122.496 42.608  19.004  1.00 32.02  ? 527  THR A CB  1 
ATOM   4071  O  OG1 . THR A 1  527  ? 121.722 41.487  18.548  1.00 34.94  ? 527  THR A OG1 1 
ATOM   4072  C  CG2 . THR A 1  527  ? 123.988 42.389  18.707  1.00 31.81  ? 527  THR A CG2 1 
ATOM   4073  N  N   . LEU A 1  528  ? 122.218 45.175  20.393  1.00 29.47  ? 528  LEU A N   1 
ATOM   4074  C  CA  . LEU A 1  528  ? 122.603 46.565  20.613  1.00 28.91  ? 528  LEU A CA  1 
ATOM   4075  C  C   . LEU A 1  528  ? 122.427 46.975  22.082  1.00 26.82  ? 528  LEU A C   1 
ATOM   4076  O  O   . LEU A 1  528  ? 123.378 47.349  22.765  1.00 22.35  ? 528  LEU A O   1 
ATOM   4077  C  CB  . LEU A 1  528  ? 121.736 47.438  19.719  1.00 32.90  ? 528  LEU A CB  1 
ATOM   4078  C  CG  . LEU A 1  528  ? 121.990 48.918  19.908  1.00 34.69  ? 528  LEU A CG  1 
ATOM   4079  C  CD1 . LEU A 1  528  ? 123.440 49.180  19.592  1.00 38.10  ? 528  LEU A CD1 1 
ATOM   4080  C  CD2 . LEU A 1  528  ? 121.076 49.730  19.005  1.00 37.98  ? 528  LEU A CD2 1 
ATOM   4081  N  N   . CYS A 1  529  ? 121.184 46.903  22.539  1.00 27.10  ? 529  CYS A N   1 
ATOM   4082  C  CA  . CYS A 1  529  ? 120.824 47.212  23.908  1.00 27.82  ? 529  CYS A CA  1 
ATOM   4083  C  C   . CYS A 1  529  ? 121.742 46.464  24.877  1.00 27.11  ? 529  CYS A C   1 
ATOM   4084  O  O   . CYS A 1  529  ? 121.987 46.914  25.998  1.00 29.72  ? 529  CYS A O   1 
ATOM   4085  C  CB  . CYS A 1  529  ? 119.371 46.796  24.141  1.00 26.33  ? 529  CYS A CB  1 
ATOM   4086  S  SG  . CYS A 1  529  ? 118.854 46.762  25.871  1.00 28.79  ? 529  CYS A SG  1 
ATOM   4087  N  N   . GLY A 1  530  ? 122.253 45.322  24.432  1.00 25.38  ? 530  GLY A N   1 
ATOM   4088  C  CA  . GLY A 1  530  ? 123.122 44.518  25.270  1.00 24.21  ? 530  GLY A CA  1 
ATOM   4089  C  C   . GLY A 1  530  ? 124.610 44.773  25.114  1.00 27.08  ? 530  GLY A C   1 
ATOM   4090  O  O   . GLY A 1  530  ? 125.334 44.829  26.112  1.00 28.36  ? 530  GLY A O   1 
ATOM   4091  N  N   . ILE A 1  531  ? 125.076 44.925  23.877  1.00 29.94  ? 531  ILE A N   1 
ATOM   4092  C  CA  . ILE A 1  531  ? 126.495 45.169  23.631  1.00 34.61  ? 531  ILE A CA  1 
ATOM   4093  C  C   . ILE A 1  531  ? 126.995 46.313  24.496  1.00 39.24  ? 531  ILE A C   1 
ATOM   4094  O  O   . ILE A 1  531  ? 128.194 46.465  24.721  1.00 43.72  ? 531  ILE A O   1 
ATOM   4095  C  CB  . ILE A 1  531  ? 126.772 45.538  22.169  1.00 33.08  ? 531  ILE A CB  1 
ATOM   4096  C  CG1 . ILE A 1  531  ? 128.279 45.740  21.964  1.00 29.53  ? 531  ILE A CG1 1 
ATOM   4097  C  CG2 . ILE A 1  531  ? 126.015 46.800  21.810  1.00 32.94  ? 531  ILE A CG2 1 
ATOM   4098  C  CD1 . ILE A 1  531  ? 128.696 45.906  20.531  1.00 24.88  ? 531  ILE A CD1 1 
ATOM   4099  N  N   . ARG A 1  532  ? 126.071 47.138  24.962  1.00 41.42  ? 532  ARG A N   1 
ATOM   4100  C  CA  . ARG A 1  532  ? 126.448 48.241  25.818  1.00 43.14  ? 532  ARG A CA  1 
ATOM   4101  C  C   . ARG A 1  532  ? 126.615 47.732  27.251  1.00 42.56  ? 532  ARG A C   1 
ATOM   4102  O  O   . ARG A 1  532  ? 127.670 47.919  27.867  1.00 42.44  ? 532  ARG A O   1 
ATOM   4103  C  CB  . ARG A 1  532  ? 125.385 49.342  25.775  1.00 48.01  ? 532  ARG A CB  1 
ATOM   4104  C  CG  . ARG A 1  532  ? 125.364 50.164  27.050  1.00 52.75  ? 532  ARG A CG  1 
ATOM   4105  C  CD  . ARG A 1  532  ? 124.430 51.358  27.025  1.00 55.83  ? 532  ARG A CD  1 
ATOM   4106  N  NE  . ARG A 1  532  ? 124.160 51.747  28.403  1.00 55.91  ? 532  ARG A NE  1 
ATOM   4107  C  CZ  . ARG A 1  532  ? 123.299 51.106  29.186  1.00 57.16  ? 532  ARG A CZ  1 
ATOM   4108  N  NH1 . ARG A 1  532  ? 122.622 50.070  28.706  1.00 54.75  ? 532  ARG A NH1 1 
ATOM   4109  N  NH2 . ARG A 1  532  ? 123.151 51.466  30.456  1.00 56.63  ? 532  ARG A NH2 1 
ATOM   4110  N  N   . LYS A 1  533  ? 125.577 47.082  27.775  1.00 40.48  ? 533  LYS A N   1 
ATOM   4111  C  CA  . LYS A 1  533  ? 125.623 46.578  29.141  1.00 39.83  ? 533  LYS A CA  1 
ATOM   4112  C  C   . LYS A 1  533  ? 126.859 45.742  29.299  1.00 39.63  ? 533  LYS A C   1 
ATOM   4113  O  O   . LYS A 1  533  ? 127.451 45.692  30.371  1.00 40.96  ? 533  LYS A O   1 
ATOM   4114  C  CB  . LYS A 1  533  ? 124.387 45.739  29.468  1.00 38.54  ? 533  LYS A CB  1 
ATOM   4115  C  CG  . LYS A 1  533  ? 123.073 46.469  29.213  1.00 41.87  ? 533  LYS A CG  1 
ATOM   4116  C  CD  . LYS A 1  533  ? 121.930 45.959  30.083  1.00 38.94  ? 533  LYS A CD  1 
ATOM   4117  C  CE  . LYS A 1  533  ? 122.196 46.234  31.551  1.00 39.94  ? 533  LYS A CE  1 
ATOM   4118  N  NZ  . LYS A 1  533  ? 121.082 45.748  32.409  1.00 38.65  ? 533  LYS A NZ  1 
ATOM   4119  N  N   . LEU A 1  534  ? 127.255 45.098  28.211  1.00 41.31  ? 534  LEU A N   1 
ATOM   4120  C  CA  . LEU A 1  534  ? 128.434 44.252  28.220  1.00 44.10  ? 534  LEU A CA  1 
ATOM   4121  C  C   . LEU A 1  534  ? 129.731 45.058  28.215  1.00 47.81  ? 534  LEU A C   1 
ATOM   4122  O  O   . LEU A 1  534  ? 130.752 44.602  28.726  1.00 51.21  ? 534  LEU A O   1 
ATOM   4123  C  CB  . LEU A 1  534  ? 128.425 43.324  27.007  1.00 41.35  ? 534  LEU A CB  1 
ATOM   4124  C  CG  . LEU A 1  534  ? 129.666 42.435  26.904  1.00 40.85  ? 534  LEU A CG  1 
ATOM   4125  C  CD1 . LEU A 1  534  ? 129.522 41.236  27.832  1.00 39.18  ? 534  LEU A CD1 1 
ATOM   4126  C  CD2 . LEU A 1  534  ? 129.850 41.982  25.468  1.00 44.25  ? 534  LEU A CD2 1 
ATOM   4127  N  N   . THR A 1  535  ? 129.689 46.260  27.650  1.00 50.51  ? 535  THR A N   1 
ATOM   4128  C  CA  . THR A 1  535  ? 130.883 47.087  27.552  1.00 53.68  ? 535  THR A CA  1 
ATOM   4129  C  C   . THR A 1  535  ? 131.375 47.812  28.808  1.00 57.06  ? 535  THR A C   1 
ATOM   4130  O  O   . THR A 1  535  ? 132.569 47.770  29.109  1.00 61.82  ? 535  THR A O   1 
ATOM   4131  C  CB  . THR A 1  535  ? 130.724 48.110  26.434  1.00 52.27  ? 535  THR A CB  1 
ATOM   4132  O  OG1 . THR A 1  535  ? 130.848 47.452  25.170  1.00 51.30  ? 535  THR A OG1 1 
ATOM   4133  C  CG2 . THR A 1  535  ? 131.783 49.174  26.544  1.00 54.15  ? 535  THR A CG2 1 
ATOM   4134  N  N   . LEU A 1  536  ? 130.471 48.481  29.519  1.00 57.08  ? 536  LEU A N   1 
ATOM   4135  C  CA  . LEU A 1  536  ? 130.790 49.235  30.743  1.00 57.88  ? 536  LEU A CA  1 
ATOM   4136  C  C   . LEU A 1  536  ? 132.070 48.850  31.488  1.00 60.95  ? 536  LEU A C   1 
ATOM   4137  O  O   . LEU A 1  536  ? 132.506 47.704  31.443  1.00 65.71  ? 536  LEU A O   1 
ATOM   4138  C  CB  . LEU A 1  536  ? 129.621 49.116  31.702  1.00 54.29  ? 536  LEU A CB  1 
ATOM   4139  C  CG  . LEU A 1  536  ? 128.335 49.260  30.901  1.00 54.05  ? 536  LEU A CG  1 
ATOM   4140  C  CD1 . LEU A 1  536  ? 127.149 48.794  31.701  1.00 56.40  ? 536  LEU A CD1 1 
ATOM   4141  C  CD2 . LEU A 1  536  ? 128.182 50.698  30.493  1.00 58.10  ? 536  LEU A CD2 1 
ATOM   4142  N  N   . ARG A 1  537  ? 132.681 49.805  32.179  1.00 61.23  ? 537  ARG A N   1 
ATOM   4143  C  CA  . ARG A 1  537  ? 133.886 49.485  32.934  1.00 61.52  ? 537  ARG A CA  1 
ATOM   4144  C  C   . ARG A 1  537  ? 133.430 48.600  34.087  1.00 60.05  ? 537  ARG A C   1 
ATOM   4145  O  O   . ARG A 1  537  ? 134.140 47.707  34.525  1.00 57.98  ? 537  ARG A O   1 
ATOM   4146  C  CB  . ARG A 1  537  ? 134.516 50.725  33.563  1.00 65.97  ? 537  ARG A CB  1 
ATOM   4147  C  CG  . ARG A 1  537  ? 134.827 51.919  32.681  1.00 71.07  ? 537  ARG A CG  1 
ATOM   4148  C  CD  . ARG A 1  537  ? 135.338 53.034  33.606  1.00 74.34  ? 537  ARG A CD  1 
ATOM   4149  N  NE  . ARG A 1  537  ? 135.577 54.304  32.938  1.00 78.13  ? 537  ARG A NE  1 
ATOM   4150  C  CZ  . ARG A 1  537  ? 136.673 54.583  32.245  1.00 80.95  ? 537  ARG A CZ  1 
ATOM   4151  N  NH1 . ARG A 1  537  ? 137.640 53.682  32.129  1.00 81.61  ? 537  ARG A NH1 1 
ATOM   4152  N  NH2 . ARG A 1  537  ? 136.800 55.767  31.668  1.00 83.42  ? 537  ARG A NH2 1 
ATOM   4153  N  N   . ASP A 1  538  ? 132.231 48.885  34.575  1.00 61.77  ? 538  ASP A N   1 
ATOM   4154  C  CA  . ASP A 1  538  ? 131.625 48.182  35.703  1.00 66.26  ? 538  ASP A CA  1 
ATOM   4155  C  C   . ASP A 1  538  ? 131.217 46.743  35.373  1.00 67.21  ? 538  ASP A C   1 
ATOM   4156  O  O   . ASP A 1  538  ? 130.640 46.047  36.215  1.00 67.30  ? 538  ASP A O   1 
ATOM   4157  C  CB  . ASP A 1  538  ? 130.385 48.961  36.173  1.00 71.37  ? 538  ASP A CB  1 
ATOM   4158  C  CG  . ASP A 1  538  ? 130.044 48.721  37.638  1.00 74.18  ? 538  ASP A CG  1 
ATOM   4159  O  OD1 . ASP A 1  538  ? 128.835 48.659  37.960  1.00 76.10  ? 538  ASP A OD1 1 
ATOM   4160  O  OD2 . ASP A 1  538  ? 130.976 48.619  38.467  1.00 75.49  ? 538  ASP A OD2 1 
ATOM   4161  N  N   . THR A 1  539  ? 131.501 46.297  34.152  1.00 67.64  ? 539  THR A N   1 
ATOM   4162  C  CA  . THR A 1  539  ? 131.142 44.939  33.744  1.00 67.25  ? 539  THR A CA  1 
ATOM   4163  C  C   . THR A 1  539  ? 132.336 43.993  33.622  1.00 67.76  ? 539  THR A C   1 
ATOM   4164  O  O   . THR A 1  539  ? 133.154 44.097  32.697  1.00 65.89  ? 539  THR A O   1 
ATOM   4165  C  CB  . THR A 1  539  ? 130.355 44.945  32.412  1.00 66.30  ? 539  THR A CB  1 
ATOM   4166  O  OG1 . THR A 1  539  ? 129.025 45.421  32.649  1.00 67.58  ? 539  THR A OG1 1 
ATOM   4167  C  CG2 . THR A 1  539  ? 130.280 43.553  31.826  1.00 67.12  ? 539  THR A CG2 1 
ATOM   4168  N  N   . PHE A 1  540  ? 132.412 43.064  34.574  1.00 69.21  ? 540  PHE A N   1 
ATOM   4169  C  CA  . PHE A 1  540  ? 133.474 42.066  34.628  1.00 70.05  ? 540  PHE A CA  1 
ATOM   4170  C  C   . PHE A 1  540  ? 132.936 40.644  34.473  1.00 70.80  ? 540  PHE A C   1 
ATOM   4171  O  O   . PHE A 1  540  ? 131.915 40.280  35.070  1.00 71.72  ? 540  PHE A O   1 
ATOM   4172  C  CB  . PHE A 1  540  ? 134.227 42.160  35.954  1.00 70.44  ? 540  PHE A CB  1 
ATOM   4173  C  CG  . PHE A 1  540  ? 135.059 43.398  36.093  1.00 69.98  ? 540  PHE A CG  1 
ATOM   4174  C  CD1 . PHE A 1  540  ? 134.594 44.490  36.817  1.00 69.09  ? 540  PHE A CD1 1 
ATOM   4175  C  CD2 . PHE A 1  540  ? 136.320 43.467  35.509  1.00 70.36  ? 540  PHE A CD2 1 
ATOM   4176  C  CE1 . PHE A 1  540  ? 135.374 45.632  36.952  1.00 68.38  ? 540  PHE A CE1 1 
ATOM   4177  C  CE2 . PHE A 1  540  ? 137.107 44.605  35.638  1.00 68.70  ? 540  PHE A CE2 1 
ATOM   4178  C  CZ  . PHE A 1  540  ? 136.636 45.688  36.363  1.00 67.65  ? 540  PHE A CZ  1 
ATOM   4179  N  N   . ILE A 1  541  ? 133.640 39.841  33.681  1.00 70.08  ? 541  ILE A N   1 
ATOM   4180  C  CA  . ILE A 1  541  ? 133.243 38.463  33.443  1.00 68.77  ? 541  ILE A CA  1 
ATOM   4181  C  C   . ILE A 1  541  ? 134.308 37.507  33.955  1.00 71.09  ? 541  ILE A C   1 
ATOM   4182  O  O   . ILE A 1  541  ? 135.497 37.707  33.693  1.00 71.23  ? 541  ILE A O   1 
ATOM   4183  C  CB  . ILE A 1  541  ? 133.041 38.218  31.960  1.00 65.38  ? 541  ILE A CB  1 
ATOM   4184  C  CG1 . ILE A 1  541  ? 131.975 39.171  31.436  1.00 63.40  ? 541  ILE A CG1 1 
ATOM   4185  C  CG2 . ILE A 1  541  ? 132.627 36.786  31.729  1.00 64.81  ? 541  ILE A CG2 1 
ATOM   4186  C  CD1 . ILE A 1  541  ? 131.741 39.056  29.966  1.00 62.36  ? 541  ILE A CD1 1 
ATOM   4187  N  N   . GLU A 1  542  ? 133.880 36.471  34.680  1.00 72.54  ? 542  GLU A N   1 
ATOM   4188  C  CA  . GLU A 1  542  ? 134.805 35.480  35.236  1.00 73.17  ? 542  GLU A CA  1 
ATOM   4189  C  C   . GLU A 1  542  ? 135.082 34.306  34.293  1.00 70.34  ? 542  GLU A C   1 
ATOM   4190  O  O   . GLU A 1  542  ? 134.363 34.102  33.313  1.00 71.63  ? 542  GLU A O   1 
ATOM   4191  C  CB  . GLU A 1  542  ? 134.283 34.985  36.581  1.00 76.87  ? 542  GLU A CB  1 
ATOM   4192  C  CG  . GLU A 1  542  ? 132.794 34.734  36.599  1.00 84.59  ? 542  GLU A CG  1 
ATOM   4193  C  CD  . GLU A 1  542  ? 132.219 34.768  38.006  1.00 89.16  ? 542  GLU A CD  1 
ATOM   4194  O  OE1 . GLU A 1  542  ? 132.845 34.184  38.922  1.00 90.47  ? 542  GLU A OE1 1 
ATOM   4195  O  OE2 . GLU A 1  542  ? 131.135 35.373  38.190  1.00 91.32  ? 542  GLU A OE2 1 
ATOM   4196  N  N   . LEU A 1  543  ? 136.123 33.533  34.600  1.00 65.72  ? 543  LEU A N   1 
ATOM   4197  C  CA  . LEU A 1  543  ? 136.542 32.416  33.749  1.00 61.27  ? 543  LEU A CA  1 
ATOM   4198  C  C   . LEU A 1  543  ? 135.489 31.589  33.032  1.00 60.69  ? 543  LEU A C   1 
ATOM   4199  O  O   . LEU A 1  543  ? 135.293 31.736  31.826  1.00 59.77  ? 543  LEU A O   1 
ATOM   4200  C  CB  . LEU A 1  543  ? 137.446 31.457  34.520  1.00 57.64  ? 543  LEU A CB  1 
ATOM   4201  C  CG  . LEU A 1  543  ? 137.903 30.260  33.677  1.00 51.59  ? 543  LEU A CG  1 
ATOM   4202  C  CD1 . LEU A 1  543  ? 138.530 30.723  32.371  1.00 47.75  ? 543  LEU A CD1 1 
ATOM   4203  C  CD2 . LEU A 1  543  ? 138.886 29.449  34.481  1.00 51.89  ? 543  LEU A CD2 1 
ATOM   4204  N  N   . ASP A 1  544  ? 134.838 30.700  33.772  1.00 62.21  ? 544  ASP A N   1 
ATOM   4205  C  CA  . ASP A 1  544  ? 133.827 29.826  33.195  1.00 65.62  ? 544  ASP A CA  1 
ATOM   4206  C  C   . ASP A 1  544  ? 133.140 30.437  31.969  1.00 63.82  ? 544  ASP A C   1 
ATOM   4207  O  O   . ASP A 1  544  ? 133.243 29.901  30.865  1.00 62.46  ? 544  ASP A O   1 
ATOM   4208  C  CB  . ASP A 1  544  ? 132.785 29.455  34.253  1.00 73.07  ? 544  ASP A CB  1 
ATOM   4209  C  CG  . ASP A 1  544  ? 131.965 30.640  34.697  1.00 79.46  ? 544  ASP A CG  1 
ATOM   4210  O  OD1 . ASP A 1  544  ? 132.578 31.618  35.180  1.00 83.81  ? 544  ASP A OD1 1 
ATOM   4211  O  OD2 . ASP A 1  544  ? 130.717 30.594  34.559  1.00 82.22  ? 544  ASP A OD2 1 
ATOM   4212  N  N   . GLN A 1  545  ? 132.460 31.563  32.160  1.00 61.98  ? 545  GLN A N   1 
ATOM   4213  C  CA  . GLN A 1  545  ? 131.763 32.224  31.064  1.00 60.25  ? 545  GLN A CA  1 
ATOM   4214  C  C   . GLN A 1  545  ? 132.701 32.744  29.983  1.00 57.14  ? 545  GLN A C   1 
ATOM   4215  O  O   . GLN A 1  545  ? 132.489 32.493  28.797  1.00 57.54  ? 545  GLN A O   1 
ATOM   4216  C  CB  . GLN A 1  545  ? 130.912 33.377  31.591  1.00 64.80  ? 545  GLN A CB  1 
ATOM   4217  C  CG  . GLN A 1  545  ? 129.418 33.106  31.548  1.00 72.92  ? 545  GLN A CG  1 
ATOM   4218  C  CD  . GLN A 1  545  ? 128.594 34.313  31.980  1.00 79.07  ? 545  GLN A CD  1 
ATOM   4219  O  OE1 . GLN A 1  545  ? 128.572 35.348  31.304  1.00 80.69  ? 545  GLN A OE1 1 
ATOM   4220  N  NE2 . GLN A 1  545  ? 127.914 34.187  33.118  1.00 82.34  ? 545  GLN A NE2 1 
ATOM   4221  N  N   . VAL A 1  546  ? 133.733 33.474  30.387  1.00 53.41  ? 546  VAL A N   1 
ATOM   4222  C  CA  . VAL A 1  546  ? 134.691 34.021  29.431  1.00 49.35  ? 546  VAL A CA  1 
ATOM   4223  C  C   . VAL A 1  546  ? 135.012 33.001  28.347  1.00 47.03  ? 546  VAL A C   1 
ATOM   4224  O  O   . VAL A 1  546  ? 135.175 33.338  27.175  1.00 48.37  ? 546  VAL A O   1 
ATOM   4225  C  CB  . VAL A 1  546  ? 136.003 34.435  30.129  1.00 48.37  ? 546  VAL A CB  1 
ATOM   4226  C  CG1 . VAL A 1  546  ? 137.054 34.767  29.096  1.00 46.55  ? 546  VAL A CG1 1 
ATOM   4227  C  CG2 . VAL A 1  546  ? 135.761 35.643  31.017  1.00 48.49  ? 546  VAL A CG2 1 
ATOM   4228  N  N   . LEU A 1  547  ? 135.087 31.744  28.751  1.00 45.19  ? 547  LEU A N   1 
ATOM   4229  C  CA  . LEU A 1  547  ? 135.393 30.681  27.819  1.00 46.77  ? 547  LEU A CA  1 
ATOM   4230  C  C   . LEU A 1  547  ? 134.268 30.450  26.821  1.00 46.02  ? 547  LEU A C   1 
ATOM   4231  O  O   . LEU A 1  547  ? 134.457 30.643  25.620  1.00 47.24  ? 547  LEU A O   1 
ATOM   4232  C  CB  . LEU A 1  547  ? 135.703 29.403  28.594  1.00 50.38  ? 547  LEU A CB  1 
ATOM   4233  C  CG  . LEU A 1  547  ? 136.933 29.572  29.496  1.00 54.91  ? 547  LEU A CG  1 
ATOM   4234  C  CD1 . LEU A 1  547  ? 137.097 28.360  30.392  1.00 57.32  ? 547  LEU A CD1 1 
ATOM   4235  C  CD2 . LEU A 1  547  ? 138.176 29.781  28.635  1.00 54.78  ? 547  LEU A CD2 1 
ATOM   4236  N  N   . ASN A 1  548  ? 133.098 30.049  27.310  1.00 44.51  ? 548  ASN A N   1 
ATOM   4237  C  CA  . ASN A 1  548  ? 131.964 29.794  26.426  1.00 41.42  ? 548  ASN A CA  1 
ATOM   4238  C  C   . ASN A 1  548  ? 131.826 30.871  25.372  1.00 38.89  ? 548  ASN A C   1 
ATOM   4239  O  O   . ASN A 1  548  ? 131.540 30.568  24.217  1.00 40.08  ? 548  ASN A O   1 
ATOM   4240  C  CB  . ASN A 1  548  ? 130.665 29.693  27.215  1.00 43.38  ? 548  ASN A CB  1 
ATOM   4241  C  CG  . ASN A 1  548  ? 130.649 28.502  28.148  1.00 46.78  ? 548  ASN A CG  1 
ATOM   4242  O  OD1 . ASN A 1  548  ? 131.012 27.387  27.758  1.00 47.55  ? 548  ASN A OD1 1 
ATOM   4243  N  ND2 . ASN A 1  548  ? 130.220 28.726  29.386  1.00 48.41  ? 548  ASN A ND2 1 
ATOM   4244  N  N   . MET A 1  549  ? 132.032 32.126  25.770  1.00 35.27  ? 549  MET A N   1 
ATOM   4245  C  CA  . MET A 1  549  ? 131.943 33.243  24.832  1.00 33.88  ? 549  MET A CA  1 
ATOM   4246  C  C   . MET A 1  549  ? 133.016 33.076  23.780  1.00 32.93  ? 549  MET A C   1 
ATOM   4247  O  O   . MET A 1  549  ? 132.733 32.971  22.575  1.00 33.20  ? 549  MET A O   1 
ATOM   4248  C  CB  . MET A 1  549  ? 132.125 34.569  25.563  1.00 32.94  ? 549  MET A CB  1 
ATOM   4249  C  CG  . MET A 1  549  ? 131.067 34.745  26.618  1.00 39.72  ? 549  MET A CG  1 
ATOM   4250  S  SD  . MET A 1  549  ? 130.685 36.435  27.119  1.00 47.23  ? 549  MET A SD  1 
ATOM   4251  C  CE  . MET A 1  549  ? 130.338 36.155  28.890  1.00 48.94  ? 549  MET A CE  1 
ATOM   4252  N  N   . LEU A 1  550  ? 134.257 33.052  24.244  1.00 30.91  ? 550  LEU A N   1 
ATOM   4253  C  CA  . LEU A 1  550  ? 135.369 32.856  23.347  1.00 30.21  ? 550  LEU A CA  1 
ATOM   4254  C  C   . LEU A 1  550  ? 134.969 31.811  22.323  1.00 32.34  ? 550  LEU A C   1 
ATOM   4255  O  O   . LEU A 1  550  ? 135.039 32.052  21.114  1.00 33.04  ? 550  LEU A O   1 
ATOM   4256  C  CB  . LEU A 1  550  ? 136.565 32.345  24.119  1.00 28.38  ? 550  LEU A CB  1 
ATOM   4257  C  CG  . LEU A 1  550  ? 137.517 33.409  24.610  1.00 26.98  ? 550  LEU A CG  1 
ATOM   4258  C  CD1 . LEU A 1  550  ? 138.478 32.785  25.596  1.00 29.05  ? 550  LEU A CD1 1 
ATOM   4259  C  CD2 . LEU A 1  550  ? 138.247 34.004  23.427  1.00 24.58  ? 550  LEU A CD2 1 
ATOM   4260  N  N   . TYR A 1  551  ? 134.522 30.657  22.822  1.00 33.99  ? 551  TYR A N   1 
ATOM   4261  C  CA  . TYR A 1  551  ? 134.138 29.551  21.951  1.00 35.37  ? 551  TYR A CA  1 
ATOM   4262  C  C   . TYR A 1  551  ? 133.110 29.937  20.902  1.00 36.17  ? 551  TYR A C   1 
ATOM   4263  O  O   . TYR A 1  551  ? 133.287 29.644  19.719  1.00 36.86  ? 551  TYR A O   1 
ATOM   4264  C  CB  . TYR A 1  551  ? 133.615 28.340  22.752  1.00 35.08  ? 551  TYR A CB  1 
ATOM   4265  C  CG  . TYR A 1  551  ? 133.528 27.096  21.876  1.00 37.11  ? 551  TYR A CG  1 
ATOM   4266  C  CD1 . TYR A 1  551  ? 134.409 26.941  20.800  1.00 39.74  ? 551  TYR A CD1 1 
ATOM   4267  C  CD2 . TYR A 1  551  ? 132.559 26.104  22.082  1.00 37.28  ? 551  TYR A CD2 1 
ATOM   4268  C  CE1 . TYR A 1  551  ? 134.336 25.849  19.939  1.00 40.57  ? 551  TYR A CE1 1 
ATOM   4269  C  CE2 . TYR A 1  551  ? 132.478 24.988  21.217  1.00 37.14  ? 551  TYR A CE2 1 
ATOM   4270  C  CZ  . TYR A 1  551  ? 133.378 24.880  20.139  1.00 39.19  ? 551  TYR A CZ  1 
ATOM   4271  O  OH  . TYR A 1  551  ? 133.335 23.851  19.218  1.00 36.69  ? 551  TYR A OH  1 
ATOM   4272  N  N   . TRP A 1  552  ? 132.043 30.590  21.347  1.00 35.77  ? 552  TRP A N   1 
ATOM   4273  C  CA  . TRP A 1  552  ? 130.974 31.024  20.470  1.00 35.68  ? 552  TRP A CA  1 
ATOM   4274  C  C   . TRP A 1  552  ? 131.456 31.726  19.226  1.00 37.15  ? 552  TRP A C   1 
ATOM   4275  O  O   . TRP A 1  552  ? 130.819 31.656  18.167  1.00 38.00  ? 552  TRP A O   1 
ATOM   4276  C  CB  . TRP A 1  552  ? 130.081 31.959  21.214  1.00 34.90  ? 552  TRP A CB  1 
ATOM   4277  C  CG  . TRP A 1  552  ? 128.936 31.297  21.759  1.00 36.79  ? 552  TRP A CG  1 
ATOM   4278  C  CD1 . TRP A 1  552  ? 128.749 30.906  23.046  1.00 39.01  ? 552  TRP A CD1 1 
ATOM   4279  C  CD2 . TRP A 1  552  ? 127.735 31.021  21.065  1.00 37.73  ? 552  TRP A CD2 1 
ATOM   4280  N  NE1 . TRP A 1  552  ? 127.482 30.410  23.205  1.00 40.79  ? 552  TRP A NE1 1 
ATOM   4281  C  CE2 . TRP A 1  552  ? 126.836 30.470  21.999  1.00 40.37  ? 552  TRP A CE2 1 
ATOM   4282  C  CE3 . TRP A 1  552  ? 127.324 31.193  19.740  1.00 39.00  ? 552  TRP A CE3 1 
ATOM   4283  C  CZ2 . TRP A 1  552  ? 125.543 30.089  21.654  1.00 43.05  ? 552  TRP A CZ2 1 
ATOM   4284  C  CZ3 . TRP A 1  552  ? 126.045 30.819  19.392  1.00 42.39  ? 552  TRP A CZ3 1 
ATOM   4285  C  CH2 . TRP A 1  552  ? 125.164 30.271  20.347  1.00 44.46  ? 552  TRP A CH2 1 
ATOM   4286  N  N   . VAL A 1  553  ? 132.569 32.431  19.362  1.00 36.33  ? 553  VAL A N   1 
ATOM   4287  C  CA  . VAL A 1  553  ? 133.129 33.129  18.227  1.00 37.64  ? 553  VAL A CA  1 
ATOM   4288  C  C   . VAL A 1  553  ? 133.927 32.170  17.363  1.00 38.83  ? 553  VAL A C   1 
ATOM   4289  O  O   . VAL A 1  553  ? 135.017 31.723  17.723  1.00 37.81  ? 553  VAL A O   1 
ATOM   4290  C  CB  . VAL A 1  553  ? 134.018 34.259  18.667  1.00 38.40  ? 553  VAL A CB  1 
ATOM   4291  C  CG1 . VAL A 1  553  ? 134.403 35.101  17.459  1.00 40.22  ? 553  VAL A CG1 1 
ATOM   4292  C  CG2 . VAL A 1  553  ? 133.293 35.083  19.699  1.00 38.88  ? 553  VAL A CG2 1 
ATOM   4293  N  N   . PRO A 1  554  ? 133.376 31.844  16.201  1.00 40.36  ? 554  PRO A N   1 
ATOM   4294  C  CA  . PRO A 1  554  ? 133.914 30.946  15.188  1.00 45.10  ? 554  PRO A CA  1 
ATOM   4295  C  C   . PRO A 1  554  ? 135.316 31.191  14.659  1.00 49.76  ? 554  PRO A C   1 
ATOM   4296  O  O   . PRO A 1  554  ? 135.906 30.288  14.068  1.00 52.12  ? 554  PRO A O   1 
ATOM   4297  C  CB  . PRO A 1  554  ? 132.867 31.014  14.086  1.00 44.71  ? 554  PRO A CB  1 
ATOM   4298  C  CG  . PRO A 1  554  ? 132.278 32.360  14.272  1.00 46.09  ? 554  PRO A CG  1 
ATOM   4299  C  CD  . PRO A 1  554  ? 132.106 32.419  15.747  1.00 41.51  ? 554  PRO A CD  1 
ATOM   4300  N  N   . ASP A 1  555  ? 135.869 32.381  14.848  1.00 54.66  ? 555  ASP A N   1 
ATOM   4301  C  CA  . ASP A 1  555  ? 137.215 32.614  14.331  1.00 59.91  ? 555  ASP A CA  1 
ATOM   4302  C  C   . ASP A 1  555  ? 138.228 32.774  15.432  1.00 58.63  ? 555  ASP A C   1 
ATOM   4303  O  O   . ASP A 1  555  ? 139.409 33.016  15.178  1.00 56.23  ? 555  ASP A O   1 
ATOM   4304  C  CB  . ASP A 1  555  ? 137.225 33.837  13.428  1.00 67.36  ? 555  ASP A CB  1 
ATOM   4305  C  CG  . ASP A 1  555  ? 136.300 33.676  12.244  1.00 74.26  ? 555  ASP A CG  1 
ATOM   4306  O  OD1 . ASP A 1  555  ? 136.547 32.770  11.411  1.00 78.10  ? 555  ASP A OD1 1 
ATOM   4307  O  OD2 . ASP A 1  555  ? 135.320 34.448  12.156  1.00 77.14  ? 555  ASP A OD2 1 
ATOM   4308  N  N   . TRP A 1  556  ? 137.750 32.625  16.659  1.00 59.16  ? 556  TRP A N   1 
ATOM   4309  C  CA  . TRP A 1  556  ? 138.606 32.751  17.816  1.00 59.86  ? 556  TRP A CA  1 
ATOM   4310  C  C   . TRP A 1  556  ? 139.886 31.975  17.591  1.00 60.63  ? 556  TRP A C   1 
ATOM   4311  O  O   . TRP A 1  556  ? 139.871 30.752  17.491  1.00 60.87  ? 556  TRP A O   1 
ATOM   4312  C  CB  . TRP A 1  556  ? 137.894 32.236  19.063  1.00 57.35  ? 556  TRP A CB  1 
ATOM   4313  C  CG  . TRP A 1  556  ? 138.790 32.183  20.229  1.00 54.29  ? 556  TRP A CG  1 
ATOM   4314  C  CD1 . TRP A 1  556  ? 139.691 33.126  20.610  1.00 53.80  ? 556  TRP A CD1 1 
ATOM   4315  C  CD2 . TRP A 1  556  ? 138.891 31.126  21.170  1.00 54.34  ? 556  TRP A CD2 1 
ATOM   4316  N  NE1 . TRP A 1  556  ? 140.354 32.722  21.733  1.00 53.29  ? 556  TRP A NE1 1 
ATOM   4317  C  CE2 . TRP A 1  556  ? 139.881 31.492  22.102  1.00 55.06  ? 556  TRP A CE2 1 
ATOM   4318  C  CE3 . TRP A 1  556  ? 138.241 29.897  21.320  1.00 56.48  ? 556  TRP A CE3 1 
ATOM   4319  C  CZ2 . TRP A 1  556  ? 140.242 30.670  23.177  1.00 59.19  ? 556  TRP A CZ2 1 
ATOM   4320  C  CZ3 . TRP A 1  556  ? 138.598 29.076  22.390  1.00 58.08  ? 556  TRP A CZ3 1 
ATOM   4321  C  CH2 . TRP A 1  556  ? 139.590 29.467  23.303  1.00 58.81  ? 556  TRP A CH2 1 
ATOM   4322  N  N   . ASP A 1  557  ? 140.994 32.699  17.499  1.00 62.05  ? 557  ASP A N   1 
ATOM   4323  C  CA  . ASP A 1  557  ? 142.291 32.081  17.288  1.00 62.80  ? 557  ASP A CA  1 
ATOM   4324  C  C   . ASP A 1  557  ? 142.580 31.034  18.362  1.00 61.14  ? 557  ASP A C   1 
ATOM   4325  O  O   . ASP A 1  557  ? 143.676 30.475  18.412  1.00 61.95  ? 557  ASP A O   1 
ATOM   4326  C  CB  . ASP A 1  557  ? 143.391 33.155  17.260  1.00 67.89  ? 557  ASP A CB  1 
ATOM   4327  C  CG  . ASP A 1  557  ? 143.345 34.090  18.473  1.00 73.37  ? 557  ASP A CG  1 
ATOM   4328  O  OD1 . ASP A 1  557  ? 142.257 34.629  18.784  1.00 75.69  ? 557  ASP A OD1 1 
ATOM   4329  O  OD2 . ASP A 1  557  ? 144.404 34.299  19.110  1.00 76.77  ? 557  ASP A OD2 1 
ATOM   4330  N  N   . GLY A 1  558  ? 141.594 30.768  19.217  1.00 57.94  ? 558  GLY A N   1 
ATOM   4331  C  CA  . GLY A 1  558  ? 141.769 29.767  20.253  1.00 54.49  ? 558  GLY A CA  1 
ATOM   4332  C  C   . GLY A 1  558  ? 142.875 30.136  21.212  1.00 51.43  ? 558  GLY A C   1 
ATOM   4333  O  O   . GLY A 1  558  ? 143.702 29.306  21.592  1.00 51.53  ? 558  GLY A O   1 
ATOM   4334  N  N   . VAL A 1  559  ? 142.885 31.400  21.602  1.00 48.24  ? 559  VAL A N   1 
ATOM   4335  C  CA  . VAL A 1  559  ? 143.885 31.904  22.520  1.00 45.73  ? 559  VAL A CA  1 
ATOM   4336  C  C   . VAL A 1  559  ? 143.186 32.597  23.666  1.00 44.64  ? 559  VAL A C   1 
ATOM   4337  O  O   . VAL A 1  559  ? 142.781 33.741  23.522  1.00 47.70  ? 559  VAL A O   1 
ATOM   4338  C  CB  . VAL A 1  559  ? 144.794 32.927  21.820  1.00 44.73  ? 559  VAL A CB  1 
ATOM   4339  C  CG1 . VAL A 1  559  ? 145.633 33.661  22.840  1.00 46.86  ? 559  VAL A CG1 1 
ATOM   4340  C  CG2 . VAL A 1  559  ? 145.683 32.225  20.816  1.00 44.94  ? 559  VAL A CG2 1 
ATOM   4341  N  N   . ILE A 1  560  ? 143.014 31.921  24.794  1.00 42.02  ? 560  ILE A N   1 
ATOM   4342  C  CA  . ILE A 1  560  ? 142.367 32.589  25.914  1.00 43.61  ? 560  ILE A CA  1 
ATOM   4343  C  C   . ILE A 1  560  ? 143.204 33.839  26.176  1.00 44.65  ? 560  ILE A C   1 
ATOM   4344  O  O   . ILE A 1  560  ? 144.396 33.737  26.466  1.00 48.34  ? 560  ILE A O   1 
ATOM   4345  C  CB  . ILE A 1  560  ? 142.363 31.721  27.182  1.00 44.91  ? 560  ILE A CB  1 
ATOM   4346  C  CG1 . ILE A 1  560  ? 143.284 30.516  26.983  1.00 49.13  ? 560  ILE A CG1 1 
ATOM   4347  C  CG2 . ILE A 1  560  ? 140.945 31.294  27.517  1.00 43.16  ? 560  ILE A CG2 1 
ATOM   4348  C  CD1 . ILE A 1  560  ? 143.437 29.644  28.222  1.00 53.79  ? 560  ILE A CD1 1 
ATOM   4349  N  N   . PRO A 1  561  ? 142.598 35.039  26.059  1.00 44.02  ? 561  PRO A N   1 
ATOM   4350  C  CA  . PRO A 1  561  ? 143.310 36.301  26.284  1.00 41.99  ? 561  PRO A CA  1 
ATOM   4351  C  C   . PRO A 1  561  ? 143.569 36.583  27.751  1.00 41.64  ? 561  PRO A C   1 
ATOM   4352  O  O   . PRO A 1  561  ? 142.688 36.425  28.599  1.00 40.18  ? 561  PRO A O   1 
ATOM   4353  C  CB  . PRO A 1  561  ? 142.377 37.326  25.662  1.00 42.10  ? 561  PRO A CB  1 
ATOM   4354  C  CG  . PRO A 1  561  ? 141.034 36.776  26.019  1.00 41.44  ? 561  PRO A CG  1 
ATOM   4355  C  CD  . PRO A 1  561  ? 141.197 35.302  25.678  1.00 43.08  ? 561  PRO A CD  1 
ATOM   4356  N  N   . THR A 1  562  ? 144.787 37.019  28.032  1.00 42.75  ? 562  THR A N   1 
ATOM   4357  C  CA  . THR A 1  562  ? 145.200 37.323  29.391  1.00 47.78  ? 562  THR A CA  1 
ATOM   4358  C  C   . THR A 1  562  ? 144.250 38.313  30.066  1.00 48.79  ? 562  THR A C   1 
ATOM   4359  O  O   . THR A 1  562  ? 144.096 39.447  29.612  1.00 49.08  ? 562  THR A O   1 
ATOM   4360  C  CB  . THR A 1  562  ? 146.613 37.894  29.388  1.00 50.36  ? 562  THR A CB  1 
ATOM   4361  O  OG1 . THR A 1  562  ? 147.334 37.371  28.256  1.00 51.28  ? 562  THR A OG1 1 
ATOM   4362  C  CG2 . THR A 1  562  ? 147.330 37.515  30.689  1.00 51.42  ? 562  THR A CG2 1 
ATOM   4363  N  N   . PRO A 1  563  ? 143.625 37.899  31.183  1.00 50.12  ? 563  PRO A N   1 
ATOM   4364  C  CA  . PRO A 1  563  ? 142.666 38.672  31.985  1.00 50.94  ? 563  PRO A CA  1 
ATOM   4365  C  C   . PRO A 1  563  ? 143.072 40.110  32.275  1.00 52.94  ? 563  PRO A C   1 
ATOM   4366  O  O   . PRO A 1  563  ? 144.229 40.384  32.605  1.00 53.85  ? 563  PRO A O   1 
ATOM   4367  C  CB  . PRO A 1  563  ? 142.551 37.861  33.271  1.00 49.31  ? 563  PRO A CB  1 
ATOM   4368  C  CG  . PRO A 1  563  ? 142.866 36.488  32.840  1.00 50.52  ? 563  PRO A CG  1 
ATOM   4369  C  CD  . PRO A 1  563  ? 144.029 36.687  31.911  1.00 50.28  ? 563  PRO A CD  1 
ATOM   4370  N  N   . ALA A 1  564  ? 142.115 41.025  32.153  1.00 53.50  ? 564  ALA A N   1 
ATOM   4371  C  CA  . ALA A 1  564  ? 142.382 42.425  32.431  1.00 53.68  ? 564  ALA A CA  1 
ATOM   4372  C  C   . ALA A 1  564  ? 142.888 42.449  33.860  1.00 53.96  ? 564  ALA A C   1 
ATOM   4373  O  O   . ALA A 1  564  ? 143.899 43.069  34.173  1.00 56.86  ? 564  ALA A O   1 
ATOM   4374  C  CB  . ALA A 1  564  ? 141.113 43.230  32.308  1.00 53.45  ? 564  ALA A CB  1 
ATOM   4375  N  N   . ILE A 1  565  ? 142.182 41.739  34.725  1.00 53.20  ? 565  ILE A N   1 
ATOM   4376  C  CA  . ILE A 1  565  ? 142.569 41.661  36.115  1.00 53.62  ? 565  ILE A CA  1 
ATOM   4377  C  C   . ILE A 1  565  ? 143.140 40.274  36.426  1.00 56.28  ? 565  ILE A C   1 
ATOM   4378  O  O   . ILE A 1  565  ? 142.807 39.300  35.755  1.00 57.30  ? 565  ILE A O   1 
ATOM   4379  C  CB  . ILE A 1  565  ? 141.367 41.951  36.998  1.00 51.03  ? 565  ILE A CB  1 
ATOM   4380  C  CG1 . ILE A 1  565  ? 140.869 43.359  36.698  1.00 47.50  ? 565  ILE A CG1 1 
ATOM   4381  C  CG2 . ILE A 1  565  ? 141.737 41.791  38.457  1.00 53.11  ? 565  ILE A CG2 1 
ATOM   4382  C  CD1 . ILE A 1  565  ? 139.817 43.845  37.657  1.00 49.62  ? 565  ILE A CD1 1 
ATOM   4383  N  N   . ILE A 1  566  ? 144.012 40.195  37.432  1.00 58.29  ? 566  ILE A N   1 
ATOM   4384  C  CA  . ILE A 1  566  ? 144.636 38.933  37.837  1.00 59.89  ? 566  ILE A CA  1 
ATOM   4385  C  C   . ILE A 1  566  ? 144.693 38.788  39.355  1.00 66.48  ? 566  ILE A C   1 
ATOM   4386  O  O   . ILE A 1  566  ? 144.353 37.734  39.892  1.00 68.46  ? 566  ILE A O   1 
ATOM   4387  C  CB  . ILE A 1  566  ? 146.071 38.820  37.299  1.00 52.29  ? 566  ILE A CB  1 
ATOM   4388  C  CG1 . ILE A 1  566  ? 146.048 38.873  35.778  1.00 48.76  ? 566  ILE A CG1 1 
ATOM   4389  C  CG2 . ILE A 1  566  ? 146.708 37.532  37.776  1.00 48.28  ? 566  ILE A CG2 1 
ATOM   4390  C  CD1 . ILE A 1  566  ? 147.389 38.695  35.158  1.00 47.28  ? 566  ILE A CD1 1 
ATOM   4391  N  N   . LYS A 1  567  ? 145.128 39.856  40.023  1.00 72.67  ? 567  LYS A N   1 
ATOM   4392  C  CA  . LYS A 1  567  ? 145.265 39.915  41.479  1.00 77.83  ? 567  LYS A CA  1 
ATOM   4393  C  C   . LYS A 1  567  ? 144.637 38.738  42.240  1.00 78.46  ? 567  LYS A C   1 
ATOM   4394  O  O   . LYS A 1  567  ? 145.122 37.616  42.102  1.00 79.20  ? 567  LYS A O   1 
ATOM   4395  C  CB  . LYS A 1  567  ? 144.754 41.269  41.990  1.00 82.98  ? 567  LYS A CB  1 
ATOM   4396  C  CG  . LYS A 1  567  ? 143.379 41.717  41.475  1.00 90.81  ? 567  LYS A CG  1 
ATOM   4397  C  CD  . LYS A 1  567  ? 142.822 42.856  42.358  1.00 95.69  ? 567  LYS A CD  1 
ATOM   4398  C  CE  . LYS A 1  567  ? 141.430 43.326  41.926  1.00 98.61  ? 567  LYS A CE  1 
ATOM   4399  N  NZ  . LYS A 1  567  ? 140.895 44.415  42.806  1.00 100.13 ? 567  LYS A NZ  1 
ATOM   4400  N  N   . PRO A 1  568  ? 143.587 38.947  43.067  1.00 79.22  ? 568  PRO A N   1 
ATOM   4401  C  CA  . PRO A 1  568  ? 143.170 37.676  43.668  1.00 81.12  ? 568  PRO A CA  1 
ATOM   4402  C  C   . PRO A 1  568  ? 142.398 36.741  42.730  1.00 81.22  ? 568  PRO A C   1 
ATOM   4403  O  O   . PRO A 1  568  ? 142.736 35.557  42.592  1.00 82.50  ? 568  PRO A O   1 
ATOM   4404  C  CB  . PRO A 1  568  ? 142.331 38.122  44.870  1.00 81.87  ? 568  PRO A CB  1 
ATOM   4405  C  CG  . PRO A 1  568  ? 141.785 39.445  44.426  1.00 79.95  ? 568  PRO A CG  1 
ATOM   4406  C  CD  . PRO A 1  568  ? 143.010 40.065  43.838  1.00 78.83  ? 568  PRO A CD  1 
ATOM   4407  N  N   . LYS A 1  569  ? 141.364 37.282  42.093  1.00 78.61  ? 569  LYS A N   1 
ATOM   4408  C  CA  . LYS A 1  569  ? 140.515 36.519  41.184  1.00 73.51  ? 569  LYS A CA  1 
ATOM   4409  C  C   . LYS A 1  569  ? 140.667 37.077  39.778  1.00 70.58  ? 569  LYS A C   1 
ATOM   4410  O  O   . LYS A 1  569  ? 140.372 38.240  39.527  1.00 73.36  ? 569  LYS A O   1 
ATOM   4411  C  CB  . LYS A 1  569  ? 139.057 36.622  41.651  1.00 71.42  ? 569  LYS A CB  1 
ATOM   4412  C  CG  . LYS A 1  569  ? 138.028 35.930  40.783  1.00 68.89  ? 569  LYS A CG  1 
ATOM   4413  C  CD  . LYS A 1  569  ? 136.637 36.085  41.399  1.00 69.97  ? 569  LYS A CD  1 
ATOM   4414  C  CE  . LYS A 1  569  ? 135.559 35.349  40.599  1.00 71.27  ? 569  LYS A CE  1 
ATOM   4415  N  NZ  . LYS A 1  569  ? 134.202 35.412  41.230  1.00 68.84  ? 569  LYS A NZ  1 
ATOM   4416  N  N   . PRO A 1  570  ? 141.153 36.258  38.844  1.00 66.57  ? 570  PRO A N   1 
ATOM   4417  C  CA  . PRO A 1  570  ? 141.331 36.714  37.466  1.00 62.88  ? 570  PRO A CA  1 
ATOM   4418  C  C   . PRO A 1  570  ? 140.020 36.917  36.704  1.00 59.56  ? 570  PRO A C   1 
ATOM   4419  O  O   . PRO A 1  570  ? 139.248 35.969  36.515  1.00 57.99  ? 570  PRO A O   1 
ATOM   4420  C  CB  . PRO A 1  570  ? 142.199 35.617  36.859  1.00 63.52  ? 570  PRO A CB  1 
ATOM   4421  C  CG  . PRO A 1  570  ? 141.744 34.408  37.588  1.00 64.72  ? 570  PRO A CG  1 
ATOM   4422  C  CD  . PRO A 1  570  ? 141.689 34.900  39.014  1.00 66.24  ? 570  PRO A CD  1 
ATOM   4423  N  N   . LEU A 1  571  ? 139.782 38.158  36.274  1.00 55.19  ? 571  LEU A N   1 
ATOM   4424  C  CA  . LEU A 1  571  ? 138.587 38.516  35.518  1.00 50.80  ? 571  LEU A CA  1 
ATOM   4425  C  C   . LEU A 1  571  ? 138.918 39.095  34.156  1.00 50.40  ? 571  LEU A C   1 
ATOM   4426  O  O   . LEU A 1  571  ? 140.074 39.391  33.849  1.00 50.33  ? 571  LEU A O   1 
ATOM   4427  C  CB  . LEU A 1  571  ? 137.748 39.544  36.269  1.00 47.95  ? 571  LEU A CB  1 
ATOM   4428  C  CG  . LEU A 1  571  ? 136.827 39.037  37.370  1.00 47.96  ? 571  LEU A CG  1 
ATOM   4429  C  CD1 . LEU A 1  571  ? 137.647 38.365  38.452  1.00 50.08  ? 571  LEU A CD1 1 
ATOM   4430  C  CD2 . LEU A 1  571  ? 136.034 40.195  37.942  1.00 48.88  ? 571  LEU A CD2 1 
ATOM   4431  N  N   . TRP A 1  572  ? 137.877 39.253  33.346  1.00 48.95  ? 572  TRP A N   1 
ATOM   4432  C  CA  . TRP A 1  572  ? 137.989 39.820  32.004  1.00 45.57  ? 572  TRP A CA  1 
ATOM   4433  C  C   . TRP A 1  572  ? 136.898 40.883  31.873  1.00 45.39  ? 572  TRP A C   1 
ATOM   4434  O  O   . TRP A 1  572  ? 135.809 40.744  32.443  1.00 44.49  ? 572  TRP A O   1 
ATOM   4435  C  CB  . TRP A 1  572  ? 137.767 38.744  30.932  1.00 42.93  ? 572  TRP A CB  1 
ATOM   4436  C  CG  . TRP A 1  572  ? 138.842 37.681  30.825  1.00 37.82  ? 572  TRP A CG  1 
ATOM   4437  C  CD1 . TRP A 1  572  ? 139.776 37.545  29.829  1.00 35.45  ? 572  TRP A CD1 1 
ATOM   4438  C  CD2 . TRP A 1  572  ? 139.037 36.574  31.705  1.00 34.50  ? 572  TRP A CD2 1 
ATOM   4439  N  NE1 . TRP A 1  572  ? 140.530 36.419  30.036  1.00 31.65  ? 572  TRP A NE1 1 
ATOM   4440  C  CE2 . TRP A 1  572  ? 140.096 35.805  31.181  1.00 32.11  ? 572  TRP A CE2 1 
ATOM   4441  C  CE3 . TRP A 1  572  ? 138.416 36.155  32.887  1.00 32.13  ? 572  TRP A CE3 1 
ATOM   4442  C  CZ2 . TRP A 1  572  ? 140.543 34.642  31.799  1.00 32.00  ? 572  TRP A CZ2 1 
ATOM   4443  C  CZ3 . TRP A 1  572  ? 138.864 35.001  33.500  1.00 31.57  ? 572  TRP A CZ3 1 
ATOM   4444  C  CH2 . TRP A 1  572  ? 139.917 34.257  32.956  1.00 30.74  ? 572  TRP A CH2 1 
ATOM   4445  N  N   . SER A 1  573  ? 137.180 41.940  31.123  1.00 45.37  ? 573  SER A N   1 
ATOM   4446  C  CA  . SER A 1  573  ? 136.194 42.995  30.956  1.00 48.45  ? 573  SER A CA  1 
ATOM   4447  C  C   . SER A 1  573  ? 135.340 42.724  29.742  1.00 47.20  ? 573  SER A C   1 
ATOM   4448  O  O   . SER A 1  573  ? 135.805 42.152  28.751  1.00 44.17  ? 573  SER A O   1 
ATOM   4449  C  CB  . SER A 1  573  ? 136.859 44.348  30.768  1.00 52.03  ? 573  SER A CB  1 
ATOM   4450  O  OG  . SER A 1  573  ? 137.177 44.552  29.402  1.00 57.48  ? 573  SER A OG  1 
ATOM   4451  N  N   . GLY A 1  574  ? 134.091 43.160  29.824  1.00 46.76  ? 574  GLY A N   1 
ATOM   4452  C  CA  . GLY A 1  574  ? 133.181 42.956  28.722  1.00 46.60  ? 574  GLY A CA  1 
ATOM   4453  C  C   . GLY A 1  574  ? 133.853 43.413  27.455  1.00 45.77  ? 574  GLY A C   1 
ATOM   4454  O  O   . GLY A 1  574  ? 133.892 42.698  26.449  1.00 45.91  ? 574  GLY A O   1 
ATOM   4455  N  N   . LYS A 1  575  ? 134.403 44.617  27.515  1.00 45.22  ? 575  LYS A N   1 
ATOM   4456  C  CA  . LYS A 1  575  ? 135.083 45.182  26.363  1.00 44.19  ? 575  LYS A CA  1 
ATOM   4457  C  C   . LYS A 1  575  ? 136.110 44.170  25.870  1.00 42.03  ? 575  LYS A C   1 
ATOM   4458  O  O   . LYS A 1  575  ? 136.185 43.872  24.678  1.00 42.56  ? 575  LYS A O   1 
ATOM   4459  C  CB  . LYS A 1  575  ? 135.794 46.494  26.741  1.00 45.58  ? 575  LYS A CB  1 
ATOM   4460  C  CG  . LYS A 1  575  ? 134.948 47.497  27.530  1.00 44.99  ? 575  LYS A CG  1 
ATOM   4461  C  CD  . LYS A 1  575  ? 135.601 48.875  27.547  1.00 44.30  ? 575  LYS A CD  1 
ATOM   4462  C  CE  . LYS A 1  575  ? 134.753 49.887  28.314  1.00 46.53  ? 575  LYS A CE  1 
ATOM   4463  N  NZ  . LYS A 1  575  ? 135.190 51.311  28.096  1.00 47.23  ? 575  LYS A NZ  1 
ATOM   4464  N  N   . GLN A 1  576  ? 136.870 43.622  26.811  1.00 39.47  ? 576  GLN A N   1 
ATOM   4465  C  CA  . GLN A 1  576  ? 137.919 42.676  26.488  1.00 38.46  ? 576  GLN A CA  1 
ATOM   4466  C  C   . GLN A 1  576  ? 137.533 41.574  25.519  1.00 36.91  ? 576  GLN A C   1 
ATOM   4467  O  O   . GLN A 1  576  ? 138.103 41.476  24.430  1.00 38.37  ? 576  GLN A O   1 
ATOM   4468  C  CB  . GLN A 1  576  ? 138.492 42.058  27.763  1.00 40.76  ? 576  GLN A CB  1 
ATOM   4469  C  CG  . GLN A 1  576  ? 139.998 42.260  27.867  1.00 41.00  ? 576  GLN A CG  1 
ATOM   4470  C  CD  . GLN A 1  576  ? 140.607 41.656  29.114  1.00 41.25  ? 576  GLN A CD  1 
ATOM   4471  O  OE1 . GLN A 1  576  ? 139.976 41.604  30.178  1.00 39.32  ? 576  GLN A OE1 1 
ATOM   4472  N  NE2 . GLN A 1  576  ? 141.855 41.214  28.994  1.00 40.92  ? 576  GLN A NE2 1 
ATOM   4473  N  N   . ILE A 1  577  ? 136.574 40.740  25.899  1.00 34.45  ? 577  ILE A N   1 
ATOM   4474  C  CA  . ILE A 1  577  ? 136.193 39.652  25.015  1.00 33.74  ? 577  ILE A CA  1 
ATOM   4475  C  C   . ILE A 1  577  ? 135.448 40.126  23.778  1.00 33.58  ? 577  ILE A C   1 
ATOM   4476  O  O   . ILE A 1  577  ? 135.713 39.636  22.682  1.00 33.77  ? 577  ILE A O   1 
ATOM   4477  C  CB  . ILE A 1  577  ? 135.373 38.577  25.758  1.00 33.13  ? 577  ILE A CB  1 
ATOM   4478  C  CG1 . ILE A 1  577  ? 134.134 39.195  26.383  1.00 34.40  ? 577  ILE A CG1 1 
ATOM   4479  C  CG2 . ILE A 1  577  ? 136.227 37.935  26.842  1.00 30.89  ? 577  ILE A CG2 1 
ATOM   4480  C  CD1 . ILE A 1  577  ? 133.397 38.236  27.270  1.00 36.81  ? 577  ILE A CD1 1 
ATOM   4481  N  N   . LEU A 1  578  ? 134.533 41.080  23.929  1.00 32.08  ? 578  LEU A N   1 
ATOM   4482  C  CA  . LEU A 1  578  ? 133.815 41.566  22.758  1.00 32.07  ? 578  LEU A CA  1 
ATOM   4483  C  C   . LEU A 1  578  ? 134.840 41.890  21.688  1.00 31.95  ? 578  LEU A C   1 
ATOM   4484  O  O   . LEU A 1  578  ? 134.613 41.708  20.490  1.00 31.98  ? 578  LEU A O   1 
ATOM   4485  C  CB  . LEU A 1  578  ? 133.020 42.827  23.075  1.00 32.45  ? 578  LEU A CB  1 
ATOM   4486  C  CG  . LEU A 1  578  ? 132.550 43.551  21.802  1.00 33.90  ? 578  LEU A CG  1 
ATOM   4487  C  CD1 . LEU A 1  578  ? 131.760 42.600  20.899  1.00 33.99  ? 578  LEU A CD1 1 
ATOM   4488  C  CD2 . LEU A 1  578  ? 131.702 44.753  22.184  1.00 33.92  ? 578  LEU A CD2 1 
ATOM   4489  N  N   . SER A 1  579  ? 135.984 42.366  22.151  1.00 32.33  ? 579  SER A N   1 
ATOM   4490  C  CA  . SER A 1  579  ? 137.074 42.737  21.271  1.00 33.90  ? 579  SER A CA  1 
ATOM   4491  C  C   . SER A 1  579  ? 137.516 41.563  20.401  1.00 32.32  ? 579  SER A C   1 
ATOM   4492  O  O   . SER A 1  579  ? 138.045 41.737  19.297  1.00 31.80  ? 579  SER A O   1 
ATOM   4493  C  CB  . SER A 1  579  ? 138.239 43.240  22.121  1.00 37.83  ? 579  SER A CB  1 
ATOM   4494  O  OG  . SER A 1  579  ? 137.782 44.206  23.056  1.00 41.04  ? 579  SER A OG  1 
ATOM   4495  N  N   . VAL A 1  580  ? 137.297 40.360  20.906  1.00 30.15  ? 580  VAL A N   1 
ATOM   4496  C  CA  . VAL A 1  580  ? 137.676 39.176  20.168  1.00 30.87  ? 580  VAL A CA  1 
ATOM   4497  C  C   . VAL A 1  580  ? 136.901 39.102  18.866  1.00 32.43  ? 580  VAL A C   1 
ATOM   4498  O  O   . VAL A 1  580  ? 137.311 38.405  17.929  1.00 34.05  ? 580  VAL A O   1 
ATOM   4499  C  CB  . VAL A 1  580  ? 137.387 37.914  20.967  1.00 28.75  ? 580  VAL A CB  1 
ATOM   4500  C  CG1 . VAL A 1  580  ? 137.784 36.702  20.158  1.00 28.27  ? 580  VAL A CG1 1 
ATOM   4501  C  CG2 . VAL A 1  580  ? 138.138 37.960  22.278  1.00 31.00  ? 580  VAL A CG2 1 
ATOM   4502  N  N   . ALA A 1  581  ? 135.784 39.826  18.816  1.00 32.46  ? 581  ALA A N   1 
ATOM   4503  C  CA  . ALA A 1  581  ? 134.920 39.841  17.639  1.00 32.26  ? 581  ALA A CA  1 
ATOM   4504  C  C   . ALA A 1  581  ? 135.446 40.787  16.580  1.00 32.69  ? 581  ALA A C   1 
ATOM   4505  O  O   . ALA A 1  581  ? 135.129 40.667  15.392  1.00 32.16  ? 581  ALA A O   1 
ATOM   4506  C  CB  . ALA A 1  581  ? 133.523 40.249  18.040  1.00 30.87  ? 581  ALA A CB  1 
ATOM   4507  N  N   . ILE A 1  582  ? 136.262 41.728  17.033  1.00 34.76  ? 582  ILE A N   1 
ATOM   4508  C  CA  . ILE A 1  582  ? 136.843 42.737  16.167  1.00 35.53  ? 582  ILE A CA  1 
ATOM   4509  C  C   . ILE A 1  582  ? 138.188 42.282  15.639  1.00 37.85  ? 582  ILE A C   1 
ATOM   4510  O  O   . ILE A 1  582  ? 139.165 42.166  16.391  1.00 37.82  ? 582  ILE A O   1 
ATOM   4511  C  CB  . ILE A 1  582  ? 136.990 44.047  16.934  1.00 34.33  ? 582  ILE A CB  1 
ATOM   4512  C  CG1 . ILE A 1  582  ? 135.647 44.390  17.587  1.00 32.41  ? 582  ILE A CG1 1 
ATOM   4513  C  CG2 . ILE A 1  582  ? 137.418 45.145  15.993  1.00 36.00  ? 582  ILE A CG2 1 
ATOM   4514  C  CD1 . ILE A 1  582  ? 135.689 45.541  18.528  1.00 30.78  ? 582  ILE A CD1 1 
ATOM   4515  N  N   . PRO A 1  583  ? 138.253 42.023  14.328  1.00 39.27  ? 583  PRO A N   1 
ATOM   4516  C  CA  . PRO A 1  583  ? 139.463 41.567  13.643  1.00 43.13  ? 583  PRO A CA  1 
ATOM   4517  C  C   . PRO A 1  583  ? 140.673 42.393  14.011  1.00 47.36  ? 583  PRO A C   1 
ATOM   4518  O  O   . PRO A 1  583  ? 140.600 43.260  14.869  1.00 50.31  ? 583  PRO A O   1 
ATOM   4519  C  CB  . PRO A 1  583  ? 139.092 41.686  12.168  1.00 40.37  ? 583  PRO A CB  1 
ATOM   4520  C  CG  . PRO A 1  583  ? 138.086 42.776  12.170  1.00 39.34  ? 583  PRO A CG  1 
ATOM   4521  C  CD  . PRO A 1  583  ? 137.239 42.449  13.356  1.00 37.17  ? 583  PRO A CD  1 
ATOM   4522  N  N   . ASN A 1  584  ? 141.800 42.112  13.376  1.00 53.24  ? 584  ASN A N   1 
ATOM   4523  C  CA  . ASN A 1  584  ? 143.003 42.868  13.668  1.00 59.77  ? 584  ASN A CA  1 
ATOM   4524  C  C   . ASN A 1  584  ? 143.207 43.900  12.570  1.00 61.84  ? 584  ASN A C   1 
ATOM   4525  O  O   . ASN A 1  584  ? 142.706 43.736  11.453  1.00 62.85  ? 584  ASN A O   1 
ATOM   4526  C  CB  . ASN A 1  584  ? 144.211 41.934  13.756  1.00 63.24  ? 584  ASN A CB  1 
ATOM   4527  C  CG  . ASN A 1  584  ? 143.981 40.781  14.713  1.00 66.72  ? 584  ASN A CG  1 
ATOM   4528  O  OD1 . ASN A 1  584  ? 143.721 40.982  15.906  1.00 68.38  ? 584  ASN A OD1 1 
ATOM   4529  N  ND2 . ASN A 1  584  ? 144.070 39.559  14.192  1.00 67.59  ? 584  ASN A ND2 1 
ATOM   4530  N  N   . GLY A 1  585  ? 143.927 44.969  12.902  1.00 64.00  ? 585  GLY A N   1 
ATOM   4531  C  CA  . GLY A 1  585  ? 144.185 46.022  11.934  1.00 67.31  ? 585  GLY A CA  1 
ATOM   4532  C  C   . GLY A 1  585  ? 143.106 47.090  11.936  1.00 68.26  ? 585  GLY A C   1 
ATOM   4533  O  O   . GLY A 1  585  ? 143.103 48.003  11.095  1.00 70.55  ? 585  GLY A O   1 
ATOM   4534  N  N   . ILE A 1  586  ? 142.176 46.963  12.877  1.00 66.77  ? 586  ILE A N   1 
ATOM   4535  C  CA  . ILE A 1  586  ? 141.101 47.923  13.005  1.00 65.78  ? 586  ILE A CA  1 
ATOM   4536  C  C   . ILE A 1  586  ? 141.582 49.089  13.857  1.00 69.55  ? 586  ILE A C   1 
ATOM   4537  O  O   . ILE A 1  586  ? 142.309 48.910  14.842  1.00 70.05  ? 586  ILE A O   1 
ATOM   4538  C  CB  . ILE A 1  586  ? 139.854 47.268  13.626  1.00 60.63  ? 586  ILE A CB  1 
ATOM   4539  C  CG1 . ILE A 1  586  ? 139.061 46.566  12.530  1.00 59.63  ? 586  ILE A CG1 1 
ATOM   4540  C  CG2 . ILE A 1  586  ? 138.990 48.294  14.321  1.00 58.22  ? 586  ILE A CG2 1 
ATOM   4541  C  CD1 . ILE A 1  586  ? 138.622 47.478  11.404  1.00 58.69  ? 586  ILE A CD1 1 
ATOM   4542  N  N   . HIS A 1  587  ? 141.198 50.292  13.447  1.00 72.75  ? 587  HIS A N   1 
ATOM   4543  C  CA  . HIS A 1  587  ? 141.580 51.490  14.165  1.00 76.73  ? 587  HIS A CA  1 
ATOM   4544  C  C   . HIS A 1  587  ? 140.408 52.448  14.175  1.00 73.65  ? 587  HIS A C   1 
ATOM   4545  O  O   . HIS A 1  587  ? 139.831 52.731  13.132  1.00 71.64  ? 587  HIS A O   1 
ATOM   4546  C  CB  . HIS A 1  587  ? 142.766 52.158  13.487  1.00 88.24  ? 587  HIS A CB  1 
ATOM   4547  C  CG  . HIS A 1  587  ? 143.474 53.149  14.361  1.00 103.30 ? 587  HIS A CG  1 
ATOM   4548  N  ND1 . HIS A 1  587  ? 142.813 54.142  15.060  1.00 108.45 ? 587  HIS A ND1 1 
ATOM   4549  C  CD2 . HIS A 1  587  ? 144.784 53.290  14.667  1.00 109.79 ? 587  HIS A CD2 1 
ATOM   4550  C  CE1 . HIS A 1  587  ? 143.688 54.847  15.757  1.00 111.22 ? 587  HIS A CE1 1 
ATOM   4551  N  NE2 . HIS A 1  587  ? 144.895 54.351  15.538  1.00 113.35 ? 587  HIS A NE2 1 
ATOM   4552  N  N   . LEU A 1  588  ? 140.062 52.960  15.348  1.00 72.55  ? 588  LEU A N   1 
ATOM   4553  C  CA  . LEU A 1  588  ? 138.939 53.872  15.424  1.00 73.28  ? 588  LEU A CA  1 
ATOM   4554  C  C   . LEU A 1  588  ? 138.985 54.864  16.580  1.00 75.07  ? 588  LEU A C   1 
ATOM   4555  O  O   . LEU A 1  588  ? 138.962 54.462  17.747  1.00 76.08  ? 588  LEU A O   1 
ATOM   4556  C  CB  . LEU A 1  588  ? 137.654 53.069  15.512  1.00 71.89  ? 588  LEU A CB  1 
ATOM   4557  C  CG  . LEU A 1  588  ? 136.405 53.882  15.203  1.00 72.50  ? 588  LEU A CG  1 
ATOM   4558  C  CD1 . LEU A 1  588  ? 136.460 54.341  13.756  1.00 73.27  ? 588  LEU A CD1 1 
ATOM   4559  C  CD2 . LEU A 1  588  ? 135.165 53.042  15.447  1.00 74.22  ? 588  LEU A CD2 1 
ATOM   4560  N  N   . GLN A 1  589  ? 139.039 56.156  16.244  1.00 76.30  ? 589  GLN A N   1 
ATOM   4561  C  CA  . GLN A 1  589  ? 139.064 57.237  17.237  1.00 76.68  ? 589  GLN A CA  1 
ATOM   4562  C  C   . GLN A 1  589  ? 137.745 57.984  17.184  1.00 74.95  ? 589  GLN A C   1 
ATOM   4563  O  O   . GLN A 1  589  ? 137.238 58.287  16.107  1.00 73.28  ? 589  GLN A O   1 
ATOM   4564  C  CB  . GLN A 1  589  ? 140.227 58.208  16.978  1.00 81.18  ? 589  GLN A CB  1 
ATOM   4565  C  CG  . GLN A 1  589  ? 141.543 57.826  17.687  1.00 86.93  ? 589  GLN A CG  1 
ATOM   4566  C  CD  . GLN A 1  589  ? 142.685 58.813  17.433  1.00 89.33  ? 589  GLN A CD  1 
ATOM   4567  O  OE1 . GLN A 1  589  ? 142.497 60.030  17.517  1.00 91.74  ? 589  GLN A OE1 1 
ATOM   4568  N  NE2 . GLN A 1  589  ? 143.877 58.286  17.136  1.00 89.17  ? 589  GLN A NE2 1 
ATOM   4569  N  N   . ARG A 1  590  ? 137.205 58.298  18.354  1.00 74.96  ? 590  ARG A N   1 
ATOM   4570  C  CA  . ARG A 1  590  ? 135.916 58.960  18.425  1.00 79.14  ? 590  ARG A CA  1 
ATOM   4571  C  C   . ARG A 1  590  ? 135.863 60.348  19.065  1.00 81.55  ? 590  ARG A C   1 
ATOM   4572  O  O   . ARG A 1  590  ? 135.918 61.360  18.369  1.00 83.40  ? 590  ARG A O   1 
ATOM   4573  C  CB  . ARG A 1  590  ? 134.943 58.037  19.146  1.00 81.64  ? 590  ARG A CB  1 
ATOM   4574  C  CG  . ARG A 1  590  ? 133.543 58.571  19.236  1.00 85.84  ? 590  ARG A CG  1 
ATOM   4575  C  CD  . ARG A 1  590  ? 132.615 57.541  19.852  1.00 91.11  ? 590  ARG A CD  1 
ATOM   4576  N  NE  . ARG A 1  590  ? 131.268 57.740  19.349  1.00 95.71  ? 590  ARG A NE  1 
ATOM   4577  C  CZ  . ARG A 1  590  ? 130.973 57.764  18.053  1.00 99.55  ? 590  ARG A CZ  1 
ATOM   4578  N  NH1 . ARG A 1  590  ? 131.930 57.595  17.146  1.00 100.55 ? 590  ARG A NH1 1 
ATOM   4579  N  NH2 . ARG A 1  590  ? 129.731 57.980  17.656  1.00 102.88 ? 590  ARG A NH2 1 
ATOM   4580  N  N   . PHE A 1  591  ? 135.732 60.379  20.391  1.00 84.13  ? 591  PHE A N   1 
ATOM   4581  C  CA  . PHE A 1  591  ? 135.630 61.610  21.185  1.00 86.18  ? 591  PHE A CA  1 
ATOM   4582  C  C   . PHE A 1  591  ? 134.232 62.234  21.125  1.00 87.85  ? 591  PHE A C   1 
ATOM   4583  O  O   . PHE A 1  591  ? 133.926 63.013  20.220  1.00 87.83  ? 591  PHE A O   1 
ATOM   4584  C  CB  . PHE A 1  591  ? 136.660 62.658  20.747  1.00 86.27  ? 591  PHE A CB  1 
ATOM   4585  C  CG  . PHE A 1  591  ? 138.083 62.309  21.092  1.00 87.58  ? 591  PHE A CG  1 
ATOM   4586  C  CD1 . PHE A 1  591  ? 138.827 61.460  20.273  1.00 88.49  ? 591  PHE A CD1 1 
ATOM   4587  C  CD2 . PHE A 1  591  ? 138.684 62.838  22.230  1.00 88.28  ? 591  PHE A CD2 1 
ATOM   4588  C  CE1 . PHE A 1  591  ? 140.154 61.149  20.579  1.00 88.07  ? 591  PHE A CE1 1 
ATOM   4589  C  CE2 . PHE A 1  591  ? 140.009 62.533  22.548  1.00 89.99  ? 591  PHE A CE2 1 
ATOM   4590  C  CZ  . PHE A 1  591  ? 140.745 61.685  21.720  1.00 88.86  ? 591  PHE A CZ  1 
ATOM   4591  N  N   . ASP A 1  592  ? 133.381 61.876  22.084  1.00 90.69  ? 592  ASP A N   1 
ATOM   4592  C  CA  . ASP A 1  592  ? 132.029 62.428  22.148  1.00 93.41  ? 592  ASP A CA  1 
ATOM   4593  C  C   . ASP A 1  592  ? 132.170 63.825  22.761  1.00 93.33  ? 592  ASP A C   1 
ATOM   4594  O  O   . ASP A 1  592  ? 132.762 64.712  22.147  1.00 93.39  ? 592  ASP A O   1 
ATOM   4595  C  CB  . ASP A 1  592  ? 131.104 61.551  23.023  1.00 95.90  ? 592  ASP A CB  1 
ATOM   4596  C  CG  . ASP A 1  592  ? 130.641 60.267  22.317  1.00 96.40  ? 592  ASP A CG  1 
ATOM   4597  O  OD1 . ASP A 1  592  ? 130.283 60.336  21.120  1.00 96.57  ? 592  ASP A OD1 1 
ATOM   4598  O  OD2 . ASP A 1  592  ? 130.614 59.194  22.966  1.00 95.30  ? 592  ASP A OD2 1 
ATOM   4599  N  N   . GLU A 1  593  ? 131.633 64.023  23.962  1.00 92.80  ? 593  GLU A N   1 
ATOM   4600  C  CA  . GLU A 1  593  ? 131.754 65.310  24.626  1.00 92.49  ? 593  GLU A CA  1 
ATOM   4601  C  C   . GLU A 1  593  ? 132.971 65.281  25.531  1.00 90.55  ? 593  GLU A C   1 
ATOM   4602  O  O   . GLU A 1  593  ? 134.095 65.256  25.039  1.00 91.07  ? 593  GLU A O   1 
ATOM   4603  C  CB  . GLU A 1  593  ? 130.492 65.642  25.423  1.00 96.39  ? 593  GLU A CB  1 
ATOM   4604  C  CG  . GLU A 1  593  ? 129.420 66.321  24.572  1.00 104.29 ? 593  GLU A CG  1 
ATOM   4605  C  CD  . GLU A 1  593  ? 128.173 66.709  25.361  1.00 109.29 ? 593  GLU A CD  1 
ATOM   4606  O  OE1 . GLU A 1  593  ? 128.298 67.453  26.361  1.00 111.20 ? 593  GLU A OE1 1 
ATOM   4607  O  OE2 . GLU A 1  593  ? 127.063 66.274  24.975  1.00 112.35 ? 593  GLU A OE2 1 
ATOM   4608  N  N   . GLY A 1  594  ? 132.764 65.276  26.842  1.00 88.31  ? 594  GLY A N   1 
ATOM   4609  C  CA  . GLY A 1  594  ? 133.900 65.251  27.749  1.00 85.88  ? 594  GLY A CA  1 
ATOM   4610  C  C   . GLY A 1  594  ? 134.822 64.067  27.507  1.00 84.18  ? 594  GLY A C   1 
ATOM   4611  O  O   . GLY A 1  594  ? 134.891 63.149  28.322  1.00 86.85  ? 594  GLY A O   1 
ATOM   4612  N  N   . THR A 1  595  ? 135.542 64.080  26.392  1.00 79.84  ? 595  THR A N   1 
ATOM   4613  C  CA  . THR A 1  595  ? 136.438 62.983  26.062  1.00 76.73  ? 595  THR A CA  1 
ATOM   4614  C  C   . THR A 1  595  ? 137.869 63.458  26.147  1.00 76.86  ? 595  THR A C   1 
ATOM   4615  O  O   . THR A 1  595  ? 138.191 64.517  25.621  1.00 77.92  ? 595  THR A O   1 
ATOM   4616  C  CB  . THR A 1  595  ? 136.176 62.474  24.650  1.00 75.66  ? 595  THR A CB  1 
ATOM   4617  O  OG1 . THR A 1  595  ? 134.811 62.052  24.541  1.00 73.16  ? 595  THR A OG1 1 
ATOM   4618  C  CG2 . THR A 1  595  ? 137.086 61.313  24.344  1.00 75.14  ? 595  THR A CG2 1 
ATOM   4619  N  N   . THR A 1  596  ? 138.730 62.676  26.793  1.00 76.80  ? 596  THR A N   1 
ATOM   4620  C  CA  . THR A 1  596  ? 140.130 63.066  26.952  1.00 78.65  ? 596  THR A CA  1 
ATOM   4621  C  C   . THR A 1  596  ? 141.141 61.934  27.113  1.00 76.42  ? 596  THR A C   1 
ATOM   4622  O  O   . THR A 1  596  ? 141.899 61.926  28.077  1.00 77.05  ? 596  THR A O   1 
ATOM   4623  C  CB  . THR A 1  596  ? 140.312 64.011  28.179  1.00 82.04  ? 596  THR A CB  1 
ATOM   4624  O  OG1 . THR A 1  596  ? 139.246 63.800  29.118  1.00 83.66  ? 596  THR A OG1 1 
ATOM   4625  C  CG2 . THR A 1  596  ? 140.355 65.475  27.742  1.00 84.28  ? 596  THR A CG2 1 
ATOM   4626  N  N   . LEU A 1  597  ? 141.176 60.990  26.181  1.00 75.45  ? 597  LEU A N   1 
ATOM   4627  C  CA  . LEU A 1  597  ? 142.132 59.885  26.277  1.00 75.29  ? 597  LEU A CA  1 
ATOM   4628  C  C   . LEU A 1  597  ? 142.240 59.367  27.713  1.00 74.48  ? 597  LEU A C   1 
ATOM   4629  O  O   . LEU A 1  597  ? 143.295 58.906  28.154  1.00 73.54  ? 597  LEU A O   1 
ATOM   4630  C  CB  . LEU A 1  597  ? 143.510 60.339  25.800  1.00 76.14  ? 597  LEU A CB  1 
ATOM   4631  C  CG  . LEU A 1  597  ? 143.557 61.034  24.440  1.00 77.62  ? 597  LEU A CG  1 
ATOM   4632  C  CD1 . LEU A 1  597  ? 143.085 62.487  24.575  1.00 77.46  ? 597  LEU A CD1 1 
ATOM   4633  C  CD2 . LEU A 1  597  ? 144.982 60.985  23.908  1.00 78.10  ? 597  LEU A CD2 1 
ATOM   4634  N  N   . LEU A 1  598  ? 141.130 59.459  28.431  1.00 73.31  ? 598  LEU A N   1 
ATOM   4635  C  CA  . LEU A 1  598  ? 141.040 59.022  29.813  1.00 71.52  ? 598  LEU A CA  1 
ATOM   4636  C  C   . LEU A 1  598  ? 139.579 59.257  30.164  1.00 71.54  ? 598  LEU A C   1 
ATOM   4637  O  O   . LEU A 1  598  ? 139.177 59.216  31.324  1.00 69.55  ? 598  LEU A O   1 
ATOM   4638  C  CB  . LEU A 1  598  ? 141.953 59.878  30.689  1.00 70.58  ? 598  LEU A CB  1 
ATOM   4639  C  CG  . LEU A 1  598  ? 142.558 59.206  31.920  1.00 71.08  ? 598  LEU A CG  1 
ATOM   4640  C  CD1 . LEU A 1  598  ? 143.593 60.115  32.550  1.00 71.72  ? 598  LEU A CD1 1 
ATOM   4641  C  CD2 . LEU A 1  598  ? 141.476 58.881  32.911  1.00 71.38  ? 598  LEU A CD2 1 
ATOM   4642  N  N   . SER A 1  599  ? 138.798 59.500  29.113  1.00 73.35  ? 599  SER A N   1 
ATOM   4643  C  CA  . SER A 1  599  ? 137.367 59.765  29.202  1.00 74.92  ? 599  SER A CA  1 
ATOM   4644  C  C   . SER A 1  599  ? 136.742 59.254  30.480  1.00 74.65  ? 599  SER A C   1 
ATOM   4645  O  O   . SER A 1  599  ? 136.371 58.096  30.585  1.00 73.27  ? 599  SER A O   1 
ATOM   4646  C  CB  . SER A 1  599  ? 136.646 59.163  27.992  1.00 77.30  ? 599  SER A CB  1 
ATOM   4647  O  OG  . SER A 1  599  ? 137.075 57.837  27.749  1.00 77.62  ? 599  SER A OG  1 
ATOM   4648  N  N   . PRO A 1  600  ? 136.612 60.132  31.473  1.00 76.87  ? 600  PRO A N   1 
ATOM   4649  C  CA  . PRO A 1  600  ? 136.030 59.786  32.769  1.00 79.54  ? 600  PRO A CA  1 
ATOM   4650  C  C   . PRO A 1  600  ? 134.626 59.212  32.645  1.00 81.05  ? 600  PRO A C   1 
ATOM   4651  O  O   . PRO A 1  600  ? 134.296 58.223  33.300  1.00 82.21  ? 600  PRO A O   1 
ATOM   4652  C  CB  . PRO A 1  600  ? 136.063 61.112  33.526  1.00 80.96  ? 600  PRO A CB  1 
ATOM   4653  C  CG  . PRO A 1  600  ? 135.944 62.130  32.434  1.00 80.71  ? 600  PRO A CG  1 
ATOM   4654  C  CD  . PRO A 1  600  ? 136.863 61.579  31.376  1.00 78.65  ? 600  PRO A CD  1 
ATOM   4655  N  N   . LYS A 1  601  ? 133.802 59.832  31.807  1.00 81.95  ? 601  LYS A N   1 
ATOM   4656  C  CA  . LYS A 1  601  ? 132.439 59.351  31.607  1.00 83.36  ? 601  LYS A CA  1 
ATOM   4657  C  C   . LYS A 1  601  ? 132.442 58.127  30.687  1.00 82.33  ? 601  LYS A C   1 
ATOM   4658  O  O   . LYS A 1  601  ? 131.387 57.561  30.388  1.00 83.35  ? 601  LYS A O   1 
ATOM   4659  C  CB  . LYS A 1  601  ? 131.559 60.450  30.991  1.00 86.46  ? 601  LYS A CB  1 
ATOM   4660  C  CG  . LYS A 1  601  ? 131.028 61.498  31.968  1.00 90.23  ? 601  LYS A CG  1 
ATOM   4661  C  CD  . LYS A 1  601  ? 130.050 62.448  31.266  1.00 94.65  ? 601  LYS A CD  1 
ATOM   4662  C  CE  . LYS A 1  601  ? 129.397 63.429  32.244  1.00 97.90  ? 601  LYS A CE  1 
ATOM   4663  N  NZ  . LYS A 1  601  ? 128.395 64.314  31.571  1.00 101.61 ? 601  LYS A NZ  1 
ATOM   4664  N  N   . ASP A 1  602  ? 133.633 57.715  30.258  1.00 79.55  ? 602  ASP A N   1 
ATOM   4665  C  CA  . ASP A 1  602  ? 133.782 56.577  29.351  1.00 76.02  ? 602  ASP A CA  1 
ATOM   4666  C  C   . ASP A 1  602  ? 133.019 56.957  28.077  1.00 74.43  ? 602  ASP A C   1 
ATOM   4667  O  O   . ASP A 1  602  ? 132.176 56.216  27.572  1.00 73.31  ? 602  ASP A O   1 
ATOM   4668  C  CB  . ASP A 1  602  ? 133.224 55.287  29.994  1.00 73.74  ? 602  ASP A CB  1 
ATOM   4669  C  CG  . ASP A 1  602  ? 133.931 54.012  29.499  1.00 70.81  ? 602  ASP A CG  1 
ATOM   4670  O  OD1 . ASP A 1  602  ? 135.178 54.016  29.362  1.00 67.87  ? 602  ASP A OD1 1 
ATOM   4671  O  OD2 . ASP A 1  602  ? 133.241 52.996  29.264  1.00 67.73  ? 602  ASP A OD2 1 
ATOM   4672  N  N   . ASN A 1  603  ? 133.322 58.151  27.580  1.00 72.93  ? 603  ASN A N   1 
ATOM   4673  C  CA  . ASN A 1  603  ? 132.699 58.664  26.376  1.00 72.06  ? 603  ASN A CA  1 
ATOM   4674  C  C   . ASN A 1  603  ? 133.504 58.231  25.187  1.00 70.00  ? 603  ASN A C   1 
ATOM   4675  O  O   . ASN A 1  603  ? 134.481 57.500  25.314  1.00 69.15  ? 603  ASN A O   1 
ATOM   4676  C  CB  . ASN A 1  603  ? 132.652 60.192  26.388  1.00 75.13  ? 603  ASN A CB  1 
ATOM   4677  C  CG  . ASN A 1  603  ? 131.508 60.738  27.222  1.00 80.78  ? 603  ASN A CG  1 
ATOM   4678  O  OD1 . ASN A 1  603  ? 130.346 60.376  27.016  1.00 84.09  ? 603  ASN A OD1 1 
ATOM   4679  N  ND2 . ASN A 1  603  ? 131.829 61.624  28.163  1.00 83.48  ? 603  ASN A ND2 1 
ATOM   4680  N  N   . GLY A 1  604  ? 133.084 58.715  24.027  1.00 69.32  ? 604  GLY A N   1 
ATOM   4681  C  CA  . GLY A 1  604  ? 133.770 58.405  22.788  1.00 69.03  ? 604  GLY A CA  1 
ATOM   4682  C  C   . GLY A 1  604  ? 134.212 56.966  22.696  1.00 66.04  ? 604  GLY A C   1 
ATOM   4683  O  O   . GLY A 1  604  ? 133.488 56.075  23.138  1.00 67.82  ? 604  GLY A O   1 
ATOM   4684  N  N   . MET A 1  605  ? 135.390 56.736  22.120  1.00 61.03  ? 605  MET A N   1 
ATOM   4685  C  CA  . MET A 1  605  ? 135.903 55.384  21.999  1.00 56.36  ? 605  MET A CA  1 
ATOM   4686  C  C   . MET A 1  605  ? 137.152 55.194  21.180  1.00 54.60  ? 605  MET A C   1 
ATOM   4687  O  O   . MET A 1  605  ? 137.268 55.723  20.072  1.00 54.46  ? 605  MET A O   1 
ATOM   4688  C  CB  . MET A 1  605  ? 134.861 54.466  21.410  1.00 54.46  ? 605  MET A CB  1 
ATOM   4689  C  CG  . MET A 1  605  ? 135.380 53.076  21.298  1.00 54.13  ? 605  MET A CG  1 
ATOM   4690  S  SD  . MET A 1  605  ? 134.050 52.077  20.836  1.00 59.32  ? 605  MET A SD  1 
ATOM   4691  C  CE  . MET A 1  605  ? 132.899 52.459  22.144  1.00 57.20  ? 605  MET A CE  1 
ATOM   4692  N  N   . LEU A 1  606  ? 138.068 54.397  21.723  1.00 52.77  ? 606  LEU A N   1 
ATOM   4693  C  CA  . LEU A 1  606  ? 139.306 54.094  21.035  1.00 52.16  ? 606  LEU A CA  1 
ATOM   4694  C  C   . LEU A 1  606  ? 139.380 52.605  20.802  1.00 53.03  ? 606  LEU A C   1 
ATOM   4695  O  O   . LEU A 1  606  ? 139.117 51.815  21.709  1.00 54.50  ? 606  LEU A O   1 
ATOM   4696  C  CB  . LEU A 1  606  ? 140.516 54.537  21.853  1.00 49.20  ? 606  LEU A CB  1 
ATOM   4697  C  CG  . LEU A 1  606  ? 141.902 54.255  21.261  1.00 48.33  ? 606  LEU A CG  1 
ATOM   4698  C  CD1 . LEU A 1  606  ? 141.948 54.620  19.786  1.00 49.16  ? 606  LEU A CD1 1 
ATOM   4699  C  CD2 . LEU A 1  606  ? 142.942 55.040  22.038  1.00 48.24  ? 606  LEU A CD2 1 
ATOM   4700  N  N   . ILE A 1  607  ? 139.718 52.237  19.571  1.00 52.67  ? 607  ILE A N   1 
ATOM   4701  C  CA  . ILE A 1  607  ? 139.866 50.842  19.183  1.00 50.53  ? 607  ILE A CA  1 
ATOM   4702  C  C   . ILE A 1  607  ? 141.152 50.727  18.388  1.00 51.03  ? 607  ILE A C   1 
ATOM   4703  O  O   . ILE A 1  607  ? 141.290 51.317  17.318  1.00 50.21  ? 607  ILE A O   1 
ATOM   4704  C  CB  . ILE A 1  607  ? 138.701 50.366  18.318  1.00 48.52  ? 607  ILE A CB  1 
ATOM   4705  C  CG1 . ILE A 1  607  ? 137.439 50.250  19.173  1.00 47.15  ? 607  ILE A CG1 1 
ATOM   4706  C  CG2 . ILE A 1  607  ? 139.051 49.035  17.676  1.00 47.51  ? 607  ILE A CG2 1 
ATOM   4707  C  CD1 . ILE A 1  607  ? 136.231 49.807  18.393  1.00 44.97  ? 607  ILE A CD1 1 
ATOM   4708  N  N   . ILE A 1  608  ? 142.088 49.956  18.920  1.00 53.18  ? 608  ILE A N   1 
ATOM   4709  C  CA  . ILE A 1  608  ? 143.385 49.785  18.287  1.00 56.35  ? 608  ILE A CA  1 
ATOM   4710  C  C   . ILE A 1  608  ? 143.753 48.336  17.953  1.00 56.94  ? 608  ILE A C   1 
ATOM   4711  O  O   . ILE A 1  608  ? 143.604 47.434  18.787  1.00 56.71  ? 608  ILE A O   1 
ATOM   4712  C  CB  . ILE A 1  608  ? 144.476 50.405  19.186  1.00 57.57  ? 608  ILE A CB  1 
ATOM   4713  C  CG1 . ILE A 1  608  ? 144.494 51.924  18.981  1.00 56.61  ? 608  ILE A CG1 1 
ATOM   4714  C  CG2 . ILE A 1  608  ? 145.823 49.748  18.922  1.00 60.71  ? 608  ILE A CG2 1 
ATOM   4715  C  CD1 . ILE A 1  608  ? 145.692 52.622  19.590  1.00 57.99  ? 608  ILE A CD1 1 
ATOM   4716  N  N   . ASP A 1  609  ? 144.259 48.126  16.737  1.00 56.95  ? 609  ASP A N   1 
ATOM   4717  C  CA  . ASP A 1  609  ? 144.639 46.787  16.292  1.00 58.27  ? 609  ASP A CA  1 
ATOM   4718  C  C   . ASP A 1  609  ? 143.518 45.865  16.743  1.00 58.02  ? 609  ASP A C   1 
ATOM   4719  O  O   . ASP A 1  609  ? 143.753 44.847  17.394  1.00 57.89  ? 609  ASP A O   1 
ATOM   4720  C  CB  . ASP A 1  609  ? 145.972 46.351  16.931  1.00 60.06  ? 609  ASP A CB  1 
ATOM   4721  C  CG  . ASP A 1  609  ? 146.550 45.069  16.305  1.00 61.81  ? 609  ASP A CG  1 
ATOM   4722  O  OD1 . ASP A 1  609  ? 146.792 45.039  15.072  1.00 61.09  ? 609  ASP A OD1 1 
ATOM   4723  O  OD2 . ASP A 1  609  ? 146.776 44.092  17.057  1.00 61.22  ? 609  ASP A OD2 1 
ATOM   4724  N  N   . GLY A 1  610  ? 142.292 46.270  16.428  1.00 58.45  ? 610  GLY A N   1 
ATOM   4725  C  CA  . GLY A 1  610  ? 141.122 45.486  16.781  1.00 59.39  ? 610  GLY A CA  1 
ATOM   4726  C  C   . GLY A 1  610  ? 140.822 45.227  18.249  1.00 58.03  ? 610  GLY A C   1 
ATOM   4727  O  O   . GLY A 1  610  ? 140.269 44.176  18.584  1.00 58.12  ? 610  GLY A O   1 
ATOM   4728  N  N   . GLN A 1  611  ? 141.167 46.166  19.124  1.00 56.63  ? 611  GLN A N   1 
ATOM   4729  C  CA  . GLN A 1  611  ? 140.894 45.993  20.546  1.00 55.37  ? 611  GLN A CA  1 
ATOM   4730  C  C   . GLN A 1  611  ? 140.367 47.271  21.192  1.00 52.61  ? 611  GLN A C   1 
ATOM   4731  O  O   . GLN A 1  611  ? 140.998 48.325  21.132  1.00 52.55  ? 611  GLN A O   1 
ATOM   4732  C  CB  . GLN A 1  611  ? 142.151 45.524  21.280  1.00 58.83  ? 611  GLN A CB  1 
ATOM   4733  C  CG  . GLN A 1  611  ? 142.753 44.237  20.722  1.00 67.40  ? 611  GLN A CG  1 
ATOM   4734  C  CD  . GLN A 1  611  ? 141.836 43.022  20.869  1.00 70.72  ? 611  GLN A CD  1 
ATOM   4735  O  OE1 . GLN A 1  611  ? 141.367 42.718  21.972  1.00 71.75  ? 611  GLN A OE1 1 
ATOM   4736  N  NE2 . GLN A 1  611  ? 141.589 42.312  19.756  1.00 70.59  ? 611  GLN A NE2 1 
ATOM   4737  N  N   . ILE A 1  612  ? 139.189 47.166  21.792  1.00 48.87  ? 612  ILE A N   1 
ATOM   4738  C  CA  . ILE A 1  612  ? 138.570 48.285  22.477  1.00 44.45  ? 612  ILE A CA  1 
ATOM   4739  C  C   . ILE A 1  612  ? 139.523 48.731  23.568  1.00 44.02  ? 612  ILE A C   1 
ATOM   4740  O  O   . ILE A 1  612  ? 139.737 48.012  24.539  1.00 44.72  ? 612  ILE A O   1 
ATOM   4741  C  CB  . ILE A 1  612  ? 137.243 47.853  23.128  1.00 42.74  ? 612  ILE A CB  1 
ATOM   4742  C  CG1 . ILE A 1  612  ? 136.160 47.784  22.065  1.00 43.22  ? 612  ILE A CG1 1 
ATOM   4743  C  CG2 . ILE A 1  612  ? 136.849 48.801  24.252  1.00 42.03  ? 612  ILE A CG2 1 
ATOM   4744  C  CD1 . ILE A 1  612  ? 134.842 47.283  22.593  1.00 43.37  ? 612  ILE A CD1 1 
ATOM   4745  N  N   . ILE A 1  613  ? 140.115 49.906  23.407  1.00 43.35  ? 613  ILE A N   1 
ATOM   4746  C  CA  . ILE A 1  613  ? 141.018 50.399  24.432  1.00 43.11  ? 613  ILE A CA  1 
ATOM   4747  C  C   . ILE A 1  613  ? 140.184 51.064  25.502  1.00 42.54  ? 613  ILE A C   1 
ATOM   4748  O  O   . ILE A 1  613  ? 140.372 50.806  26.688  1.00 43.53  ? 613  ILE A O   1 
ATOM   4749  C  CB  . ILE A 1  613  ? 142.021 51.399  23.877  1.00 44.11  ? 613  ILE A CB  1 
ATOM   4750  C  CG1 . ILE A 1  613  ? 142.911 50.697  22.842  1.00 45.74  ? 613  ILE A CG1 1 
ATOM   4751  C  CG2 . ILE A 1  613  ? 142.849 51.970  25.018  1.00 41.99  ? 613  ILE A CG2 1 
ATOM   4752  C  CD1 . ILE A 1  613  ? 143.926 51.593  22.167  1.00 46.31  ? 613  ILE A CD1 1 
ATOM   4753  N  N   . PHE A 1  614  ? 139.258 51.922  25.084  1.00 42.11  ? 614  PHE A N   1 
ATOM   4754  C  CA  . PHE A 1  614  ? 138.375 52.580  26.041  1.00 41.26  ? 614  PHE A CA  1 
ATOM   4755  C  C   . PHE A 1  614  ? 137.084 53.055  25.395  1.00 41.16  ? 614  PHE A C   1 
ATOM   4756  O  O   . PHE A 1  614  ? 137.005 53.209  24.165  1.00 42.01  ? 614  PHE A O   1 
ATOM   4757  C  CB  . PHE A 1  614  ? 139.086 53.766  26.708  1.00 41.03  ? 614  PHE A CB  1 
ATOM   4758  C  CG  . PHE A 1  614  ? 139.176 54.999  25.837  1.00 39.83  ? 614  PHE A CG  1 
ATOM   4759  C  CD1 . PHE A 1  614  ? 138.149 55.950  25.839  1.00 38.26  ? 614  PHE A CD1 1 
ATOM   4760  C  CD2 . PHE A 1  614  ? 140.279 55.208  25.014  1.00 38.53  ? 614  PHE A CD2 1 
ATOM   4761  C  CE1 . PHE A 1  614  ? 138.218 57.084  25.040  1.00 35.66  ? 614  PHE A CE1 1 
ATOM   4762  C  CE2 . PHE A 1  614  ? 140.357 56.340  24.213  1.00 38.59  ? 614  PHE A CE2 1 
ATOM   4763  C  CZ  . PHE A 1  614  ? 139.325 57.277  24.225  1.00 38.45  ? 614  PHE A CZ  1 
ATOM   4764  N  N   . GLY A 1  615  ? 136.072 53.259  26.238  1.00 39.48  ? 615  GLY A N   1 
ATOM   4765  C  CA  . GLY A 1  615  ? 134.795 53.761  25.763  1.00 37.87  ? 615  GLY A CA  1 
ATOM   4766  C  C   . GLY A 1  615  ? 133.654 52.797  25.552  1.00 34.32  ? 615  GLY A C   1 
ATOM   4767  O  O   . GLY A 1  615  ? 133.818 51.781  24.901  1.00 33.57  ? 615  GLY A O   1 
ATOM   4768  N  N   . VAL A 1  616  ? 132.491 53.153  26.087  1.00 33.17  ? 616  VAL A N   1 
ATOM   4769  C  CA  . VAL A 1  616  ? 131.275 52.363  25.983  1.00 35.27  ? 616  VAL A CA  1 
ATOM   4770  C  C   . VAL A 1  616  ? 130.737 52.234  24.560  1.00 38.26  ? 616  VAL A C   1 
ATOM   4771  O  O   . VAL A 1  616  ? 130.474 53.226  23.883  1.00 38.07  ? 616  VAL A O   1 
ATOM   4772  C  CB  . VAL A 1  616  ? 130.177 52.969  26.841  1.00 36.04  ? 616  VAL A CB  1 
ATOM   4773  C  CG1 . VAL A 1  616  ? 128.894 52.163  26.696  1.00 36.64  ? 616  VAL A CG1 1 
ATOM   4774  C  CG2 . VAL A 1  616  ? 130.639 53.029  28.278  1.00 38.44  ? 616  VAL A CG2 1 
ATOM   4775  N  N   . VAL A 1  617  ? 130.547 50.992  24.129  1.00 42.11  ? 617  VAL A N   1 
ATOM   4776  C  CA  . VAL A 1  617  ? 130.051 50.695  22.793  1.00 42.27  ? 617  VAL A CA  1 
ATOM   4777  C  C   . VAL A 1  617  ? 128.536 50.809  22.728  1.00 42.62  ? 617  VAL A C   1 
ATOM   4778  O  O   . VAL A 1  617  ? 127.822 50.311  23.608  1.00 42.35  ? 617  VAL A O   1 
ATOM   4779  C  CB  . VAL A 1  617  ? 130.411 49.250  22.349  1.00 42.44  ? 617  VAL A CB  1 
ATOM   4780  C  CG1 . VAL A 1  617  ? 130.116 49.090  20.873  1.00 45.62  ? 617  VAL A CG1 1 
ATOM   4781  C  CG2 . VAL A 1  617  ? 131.863 48.934  22.633  1.00 40.92  ? 617  VAL A CG2 1 
ATOM   4782  N  N   . GLU A 1  618  ? 128.053 51.461  21.674  1.00 41.50  ? 618  GLU A N   1 
ATOM   4783  C  CA  . GLU A 1  618  ? 126.622 51.613  21.457  1.00 41.72  ? 618  GLU A CA  1 
ATOM   4784  C  C   . GLU A 1  618  ? 126.341 52.259  20.092  1.00 39.83  ? 618  GLU A C   1 
ATOM   4785  O  O   . GLU A 1  618  ? 127.262 52.670  19.382  1.00 37.76  ? 618  GLU A O   1 
ATOM   4786  C  CB  . GLU A 1  618  ? 125.987 52.403  22.611  1.00 42.71  ? 618  GLU A CB  1 
ATOM   4787  C  CG  . GLU A 1  618  ? 126.648 53.718  22.847  1.00 48.49  ? 618  GLU A CG  1 
ATOM   4788  C  CD  . GLU A 1  618  ? 126.716 54.505  21.566  1.00 52.89  ? 618  GLU A CD  1 
ATOM   4789  O  OE1 . GLU A 1  618  ? 125.634 54.835  21.030  1.00 55.97  ? 618  GLU A OE1 1 
ATOM   4790  O  OE2 . GLU A 1  618  ? 127.841 54.765  21.081  1.00 55.67  ? 618  GLU A OE2 1 
ATOM   4791  N  N   . LYS A 1  619  ? 125.062 52.342  19.745  1.00 39.35  ? 619  LYS A N   1 
ATOM   4792  C  CA  . LYS A 1  619  ? 124.600 52.871  18.465  1.00 40.91  ? 619  LYS A CA  1 
ATOM   4793  C  C   . LYS A 1  619  ? 125.615 53.666  17.656  1.00 40.80  ? 619  LYS A C   1 
ATOM   4794  O  O   . LYS A 1  619  ? 125.938 53.315  16.529  1.00 40.19  ? 619  LYS A O   1 
ATOM   4795  C  CB  . LYS A 1  619  ? 123.327 53.700  18.676  1.00 43.67  ? 619  LYS A CB  1 
ATOM   4796  C  CG  . LYS A 1  619  ? 122.468 53.856  17.416  1.00 49.65  ? 619  LYS A CG  1 
ATOM   4797  C  CD  . LYS A 1  619  ? 121.035 54.283  17.758  1.00 54.55  ? 619  LYS A CD  1 
ATOM   4798  C  CE  . LYS A 1  619  ? 120.160 54.403  16.504  1.00 58.42  ? 619  LYS A CE  1 
ATOM   4799  N  NZ  . LYS A 1  619  ? 118.742 54.808  16.797  1.00 60.85  ? 619  LYS A NZ  1 
ATOM   4800  N  N   . LYS A 1  620  ? 126.125 54.737  18.233  1.00 43.72  ? 620  LYS A N   1 
ATOM   4801  C  CA  . LYS A 1  620  ? 127.089 55.571  17.531  1.00 47.04  ? 620  LYS A CA  1 
ATOM   4802  C  C   . LYS A 1  620  ? 128.257 54.750  17.001  1.00 44.63  ? 620  LYS A C   1 
ATOM   4803  O  O   . LYS A 1  620  ? 128.685 54.913  15.864  1.00 45.78  ? 620  LYS A O   1 
ATOM   4804  C  CB  . LYS A 1  620  ? 127.622 56.665  18.468  1.00 52.02  ? 620  LYS A CB  1 
ATOM   4805  C  CG  . LYS A 1  620  ? 126.629 57.778  18.847  1.00 60.27  ? 620  LYS A CG  1 
ATOM   4806  C  CD  . LYS A 1  620  ? 127.190 58.662  19.989  1.00 66.44  ? 620  LYS A CD  1 
ATOM   4807  C  CE  . LYS A 1  620  ? 126.174 59.704  20.502  1.00 69.85  ? 620  LYS A CE  1 
ATOM   4808  N  NZ  . LYS A 1  620  ? 126.651 60.428  21.728  1.00 69.75  ? 620  LYS A NZ  1 
ATOM   4809  N  N   . THR A 1  621  ? 128.757 53.854  17.832  1.00 42.29  ? 621  THR A N   1 
ATOM   4810  C  CA  . THR A 1  621  ? 129.905 53.048  17.470  1.00 42.50  ? 621  THR A CA  1 
ATOM   4811  C  C   . THR A 1  621  ? 129.627 51.864  16.568  1.00 43.52  ? 621  THR A C   1 
ATOM   4812  O  O   . THR A 1  621  ? 130.390 51.568  15.646  1.00 43.47  ? 621  THR A O   1 
ATOM   4813  C  CB  . THR A 1  621  ? 130.564 52.483  18.716  1.00 42.03  ? 621  THR A CB  1 
ATOM   4814  O  OG1 . THR A 1  621  ? 130.628 53.493  19.728  1.00 42.26  ? 621  THR A OG1 1 
ATOM   4815  C  CG2 . THR A 1  621  ? 131.950 52.001  18.382  1.00 42.32  ? 621  THR A CG2 1 
ATOM   4816  N  N   . VAL A 1  622  ? 128.521 51.191  16.849  1.00 45.41  ? 622  VAL A N   1 
ATOM   4817  C  CA  . VAL A 1  622  ? 128.151 49.974  16.146  1.00 46.10  ? 622  VAL A CA  1 
ATOM   4818  C  C   . VAL A 1  622  ? 126.862 50.054  15.300  1.00 46.72  ? 622  VAL A C   1 
ATOM   4819  O  O   . VAL A 1  622  ? 126.310 49.035  14.885  1.00 43.87  ? 622  VAL A O   1 
ATOM   4820  C  CB  . VAL A 1  622  ? 128.056 48.846  17.212  1.00 44.20  ? 622  VAL A CB  1 
ATOM   4821  C  CG1 . VAL A 1  622  ? 126.781 48.989  18.024  1.00 41.72  ? 622  VAL A CG1 1 
ATOM   4822  C  CG2 . VAL A 1  622  ? 128.166 47.503  16.571  1.00 47.68  ? 622  VAL A CG2 1 
ATOM   4823  N  N   . GLY A 1  623  ? 126.396 51.267  15.028  1.00 49.19  ? 623  GLY A N   1 
ATOM   4824  C  CA  . GLY A 1  623  ? 125.175 51.429  14.256  1.00 51.63  ? 623  GLY A CA  1 
ATOM   4825  C  C   . GLY A 1  623  ? 125.421 51.718  12.793  1.00 53.46  ? 623  GLY A C   1 
ATOM   4826  O  O   . GLY A 1  623  ? 126.544 51.552  12.306  1.00 53.80  ? 623  GLY A O   1 
ATOM   4827  N  N   . SER A 1  624  ? 124.376 52.152  12.090  1.00 54.92  ? 624  SER A N   1 
ATOM   4828  C  CA  . SER A 1  624  ? 124.496 52.459  10.666  1.00 55.18  ? 624  SER A CA  1 
ATOM   4829  C  C   . SER A 1  624  ? 125.068 53.847  10.460  1.00 56.61  ? 624  SER A C   1 
ATOM   4830  O  O   . SER A 1  624  ? 124.859 54.450  9.409   1.00 55.20  ? 624  SER A O   1 
ATOM   4831  C  CB  . SER A 1  624  ? 123.135 52.354  9.953   1.00 54.46  ? 624  SER A CB  1 
ATOM   4832  O  OG  . SER A 1  624  ? 122.221 53.354  10.369  1.00 52.64  ? 624  SER A OG  1 
ATOM   4833  N  N   . SER A 1  625  ? 125.787 54.345  11.471  1.00 60.18  ? 625  SER A N   1 
ATOM   4834  C  CA  . SER A 1  625  ? 126.416 55.672  11.423  1.00 63.94  ? 625  SER A CA  1 
ATOM   4835  C  C   . SER A 1  625  ? 127.533 55.662  10.375  1.00 64.27  ? 625  SER A C   1 
ATOM   4836  O  O   . SER A 1  625  ? 127.975 54.591  9.965   1.00 66.83  ? 625  SER A O   1 
ATOM   4837  C  CB  . SER A 1  625  ? 127.010 56.036  12.789  1.00 65.27  ? 625  SER A CB  1 
ATOM   4838  O  OG  . SER A 1  625  ? 128.331 55.536  12.922  1.00 66.85  ? 625  SER A OG  1 
ATOM   4839  N  N   . ASN A 1  626  ? 127.993 56.836  9.945   1.00 64.44  ? 626  ASN A N   1 
ATOM   4840  C  CA  . ASN A 1  626  ? 129.049 56.894  8.937   1.00 64.74  ? 626  ASN A CA  1 
ATOM   4841  C  C   . ASN A 1  626  ? 130.325 56.241  9.439   1.00 61.45  ? 626  ASN A C   1 
ATOM   4842  O  O   . ASN A 1  626  ? 130.472 55.040  9.346   1.00 63.28  ? 626  ASN A O   1 
ATOM   4843  C  CB  . ASN A 1  626  ? 129.344 58.334  8.527   1.00 72.63  ? 626  ASN A CB  1 
ATOM   4844  C  CG  . ASN A 1  626  ? 129.241 58.544  7.020   1.00 78.85  ? 626  ASN A CG  1 
ATOM   4845  O  OD1 . ASN A 1  626  ? 129.663 57.690  6.227   1.00 78.40  ? 626  ASN A OD1 1 
ATOM   4846  N  ND2 . ASN A 1  626  ? 128.684 59.691  6.617   1.00 81.74  ? 626  ASN A ND2 1 
ATOM   4847  N  N   . GLY A 1  627  ? 131.253 57.022  9.972   1.00 57.58  ? 627  GLY A N   1 
ATOM   4848  C  CA  . GLY A 1  627  ? 132.484 56.435  10.470  1.00 53.16  ? 627  GLY A CA  1 
ATOM   4849  C  C   . GLY A 1  627  ? 132.275 55.520  11.670  1.00 50.53  ? 627  GLY A C   1 
ATOM   4850  O  O   . GLY A 1  627  ? 132.932 55.685  12.696  1.00 49.67  ? 627  GLY A O   1 
ATOM   4851  N  N   . GLY A 1  628  ? 131.357 54.561  11.544  1.00 49.05  ? 628  GLY A N   1 
ATOM   4852  C  CA  . GLY A 1  628  ? 131.079 53.613  12.618  1.00 44.91  ? 628  GLY A CA  1 
ATOM   4853  C  C   . GLY A 1  628  ? 131.965 52.385  12.498  1.00 40.68  ? 628  GLY A C   1 
ATOM   4854  O  O   . GLY A 1  628  ? 132.778 52.320  11.582  1.00 40.21  ? 628  GLY A O   1 
ATOM   4855  N  N   . LEU A 1  629  ? 131.825 51.407  13.392  1.00 37.27  ? 629  LEU A N   1 
ATOM   4856  C  CA  . LEU A 1  629  ? 132.688 50.230  13.300  1.00 34.85  ? 629  LEU A CA  1 
ATOM   4857  C  C   . LEU A 1  629  ? 132.499 49.536  11.969  1.00 37.12  ? 629  LEU A C   1 
ATOM   4858  O  O   . LEU A 1  629  ? 133.466 49.183  11.286  1.00 40.33  ? 629  LEU A O   1 
ATOM   4859  C  CB  . LEU A 1  629  ? 132.412 49.225  14.419  1.00 28.45  ? 629  LEU A CB  1 
ATOM   4860  C  CG  . LEU A 1  629  ? 133.696 48.567  14.951  1.00 23.50  ? 629  LEU A CG  1 
ATOM   4861  C  CD1 . LEU A 1  629  ? 133.322 47.409  15.828  1.00 23.00  ? 629  LEU A CD1 1 
ATOM   4862  C  CD2 . LEU A 1  629  ? 134.586 48.089  13.826  1.00 16.46  ? 629  LEU A CD2 1 
ATOM   4863  N  N   . ILE A 1  630  ? 131.243 49.344  11.600  1.00 35.43  ? 630  ILE A N   1 
ATOM   4864  C  CA  . ILE A 1  630  ? 130.947 48.692  10.350  1.00 32.38  ? 630  ILE A CA  1 
ATOM   4865  C  C   . ILE A 1  630  ? 131.569 49.416  9.158   1.00 34.73  ? 630  ILE A C   1 
ATOM   4866  O  O   . ILE A 1  630  ? 132.388 48.827  8.444   1.00 31.76  ? 630  ILE A O   1 
ATOM   4867  C  CB  . ILE A 1  630  ? 129.455 48.583  10.179  1.00 28.59  ? 630  ILE A CB  1 
ATOM   4868  C  CG1 . ILE A 1  630  ? 128.888 47.898  11.415  1.00 27.48  ? 630  ILE A CG1 1 
ATOM   4869  C  CG2 . ILE A 1  630  ? 129.126 47.822  8.911   1.00 26.83  ? 630  ILE A CG2 1 
ATOM   4870  C  CD1 . ILE A 1  630  ? 127.451 47.521  11.298  1.00 30.13  ? 630  ILE A CD1 1 
ATOM   4871  N  N   . HIS A 1  631  ? 131.200 50.686  8.958   1.00 36.26  ? 631  HIS A N   1 
ATOM   4872  C  CA  . HIS A 1  631  ? 131.712 51.487  7.831   1.00 38.30  ? 631  HIS A CA  1 
ATOM   4873  C  C   . HIS A 1  631  ? 133.194 51.234  7.616   1.00 36.31  ? 631  HIS A C   1 
ATOM   4874  O  O   . HIS A 1  631  ? 133.665 51.128  6.484   1.00 35.11  ? 631  HIS A O   1 
ATOM   4875  C  CB  . HIS A 1  631  ? 131.523 52.993  8.082   1.00 45.61  ? 631  HIS A CB  1 
ATOM   4876  C  CG  . HIS A 1  631  ? 131.407 53.826  6.831   1.00 53.83  ? 631  HIS A CG  1 
ATOM   4877  N  ND1 . HIS A 1  631  ? 131.879 53.413  5.601   1.00 58.52  ? 631  HIS A ND1 1 
ATOM   4878  C  CD2 . HIS A 1  631  ? 130.852 55.050  6.624   1.00 56.70  ? 631  HIS A CD2 1 
ATOM   4879  C  CE1 . HIS A 1  631  ? 131.615 54.337  4.691   1.00 59.83  ? 631  HIS A CE1 1 
ATOM   4880  N  NE2 . HIS A 1  631  ? 130.990 55.342  5.288   1.00 59.68  ? 631  HIS A NE2 1 
ATOM   4881  N  N   . VAL A 1  632  ? 133.925 51.145  8.720   1.00 34.25  ? 632  VAL A N   1 
ATOM   4882  C  CA  . VAL A 1  632  ? 135.357 50.928  8.661   1.00 32.55  ? 632  VAL A CA  1 
ATOM   4883  C  C   . VAL A 1  632  ? 135.680 49.571  8.095   1.00 34.47  ? 632  VAL A C   1 
ATOM   4884  O  O   . VAL A 1  632  ? 136.210 49.443  6.989   1.00 37.89  ? 632  VAL A O   1 
ATOM   4885  C  CB  . VAL A 1  632  ? 135.990 50.972  10.032  1.00 28.99  ? 632  VAL A CB  1 
ATOM   4886  C  CG1 . VAL A 1  632  ? 137.475 51.168  9.868   1.00 30.80  ? 632  VAL A CG1 1 
ATOM   4887  C  CG2 . VAL A 1  632  ? 135.371 52.060  10.871  1.00 26.24  ? 632  VAL A CG2 1 
ATOM   4888  N  N   . VAL A 1  633  ? 135.369 48.561  8.898   1.00 34.43  ? 633  VAL A N   1 
ATOM   4889  C  CA  . VAL A 1  633  ? 135.595 47.169  8.552   1.00 39.33  ? 633  VAL A CA  1 
ATOM   4890  C  C   . VAL A 1  633  ? 135.267 46.882  7.084   1.00 42.93  ? 633  VAL A C   1 
ATOM   4891  O  O   . VAL A 1  633  ? 136.061 46.269  6.367   1.00 44.21  ? 633  VAL A O   1 
ATOM   4892  C  CB  . VAL A 1  633  ? 134.742 46.277  9.462   1.00 37.15  ? 633  VAL A CB  1 
ATOM   4893  C  CG1 . VAL A 1  633  ? 135.100 44.821  9.269   1.00 36.15  ? 633  VAL A CG1 1 
ATOM   4894  C  CG2 . VAL A 1  633  ? 134.957 46.690  10.896  1.00 39.34  ? 633  VAL A CG2 1 
ATOM   4895  N  N   . THR A 1  634  ? 134.105 47.337  6.635   1.00 44.01  ? 634  THR A N   1 
ATOM   4896  C  CA  . THR A 1  634  ? 133.700 47.110  5.259   1.00 44.68  ? 634  THR A CA  1 
ATOM   4897  C  C   . THR A 1  634  ? 134.703 47.718  4.286   1.00 45.96  ? 634  THR A C   1 
ATOM   4898  O  O   . THR A 1  634  ? 135.071 47.102  3.282   1.00 45.48  ? 634  THR A O   1 
ATOM   4899  C  CB  . THR A 1  634  ? 132.335 47.733  4.987   1.00 44.48  ? 634  THR A CB  1 
ATOM   4900  O  OG1 . THR A 1  634  ? 131.470 47.491  6.102   1.00 45.59  ? 634  THR A OG1 1 
ATOM   4901  C  CG2 . THR A 1  634  ? 131.722 47.122  3.737   1.00 47.78  ? 634  THR A CG2 1 
ATOM   4902  N  N   . ARG A 1  635  ? 135.139 48.938  4.582   1.00 49.12  ? 635  ARG A N   1 
ATOM   4903  C  CA  . ARG A 1  635  ? 136.090 49.629  3.717   1.00 54.46  ? 635  ARG A CA  1 
ATOM   4904  C  C   . ARG A 1  635  ? 137.522 49.183  3.966   1.00 54.90  ? 635  ARG A C   1 
ATOM   4905  O  O   . ARG A 1  635  ? 138.347 49.187  3.051   1.00 58.50  ? 635  ARG A O   1 
ATOM   4906  C  CB  . ARG A 1  635  ? 135.984 51.160  3.893   1.00 57.30  ? 635  ARG A CB  1 
ATOM   4907  C  CG  . ARG A 1  635  ? 134.816 51.834  3.138   1.00 61.48  ? 635  ARG A CG  1 
ATOM   4908  C  CD  . ARG A 1  635  ? 135.083 51.984  1.629   1.00 64.50  ? 635  ARG A CD  1 
ATOM   4909  N  NE  . ARG A 1  635  ? 133.850 52.005  0.831   1.00 69.27  ? 635  ARG A NE  1 
ATOM   4910  C  CZ  . ARG A 1  635  ? 133.183 50.920  0.424   1.00 71.00  ? 635  ARG A CZ  1 
ATOM   4911  N  NH1 . ARG A 1  635  ? 133.622 49.701  0.728   1.00 72.12  ? 635  ARG A NH1 1 
ATOM   4912  N  NH2 . ARG A 1  635  ? 132.067 51.050  -0.289  1.00 70.24  ? 635  ARG A NH2 1 
ATOM   4913  N  N   . GLU A 1  636  ? 137.819 48.781  5.194   1.00 54.60  ? 636  GLU A N   1 
ATOM   4914  C  CA  . GLU A 1  636  ? 139.171 48.360  5.520   1.00 57.55  ? 636  GLU A CA  1 
ATOM   4915  C  C   . GLU A 1  636  ? 139.471 46.886  5.202   1.00 55.96  ? 636  GLU A C   1 
ATOM   4916  O  O   . GLU A 1  636  ? 140.497 46.581  4.586   1.00 54.81  ? 636  GLU A O   1 
ATOM   4917  C  CB  . GLU A 1  636  ? 139.464 48.654  7.001   1.00 63.81  ? 636  GLU A CB  1 
ATOM   4918  C  CG  . GLU A 1  636  ? 140.935 48.475  7.413   1.00 73.12  ? 636  GLU A CG  1 
ATOM   4919  C  CD  . GLU A 1  636  ? 141.875 49.506  6.787   1.00 78.82  ? 636  GLU A CD  1 
ATOM   4920  O  OE1 . GLU A 1  636  ? 143.108 49.278  6.804   1.00 80.46  ? 636  GLU A OE1 1 
ATOM   4921  O  OE2 . GLU A 1  636  ? 141.386 50.548  6.287   1.00 83.22  ? 636  GLU A OE2 1 
ATOM   4922  N  N   . LYS A 1  637  ? 138.573 45.981  5.595   1.00 54.80  ? 637  LYS A N   1 
ATOM   4923  C  CA  . LYS A 1  637  ? 138.782 44.546  5.384   1.00 55.03  ? 637  LYS A CA  1 
ATOM   4924  C  C   . LYS A 1  637  ? 138.122 43.878  4.172   1.00 55.50  ? 637  LYS A C   1 
ATOM   4925  O  O   . LYS A 1  637  ? 138.726 43.030  3.518   1.00 56.42  ? 637  LYS A O   1 
ATOM   4926  C  CB  . LYS A 1  637  ? 138.384 43.789  6.653   1.00 53.48  ? 637  LYS A CB  1 
ATOM   4927  C  CG  . LYS A 1  637  ? 139.352 43.964  7.828   1.00 52.99  ? 637  LYS A CG  1 
ATOM   4928  C  CD  . LYS A 1  637  ? 140.743 43.418  7.497   1.00 52.29  ? 637  LYS A CD  1 
ATOM   4929  C  CE  . LYS A 1  637  ? 141.632 43.329  8.728   1.00 50.98  ? 637  LYS A CE  1 
ATOM   4930  N  NZ  . LYS A 1  637  ? 143.015 42.920  8.359   1.00 51.49  ? 637  LYS A NZ  1 
ATOM   4931  N  N   . GLY A 1  638  ? 136.886 44.244  3.872   1.00 56.34  ? 638  GLY A N   1 
ATOM   4932  C  CA  . GLY A 1  638  ? 136.210 43.633  2.739   1.00 57.96  ? 638  GLY A CA  1 
ATOM   4933  C  C   . GLY A 1  638  ? 134.750 43.373  3.062   1.00 59.56  ? 638  GLY A C   1 
ATOM   4934  O  O   . GLY A 1  638  ? 134.414 43.144  4.225   1.00 63.17  ? 638  GLY A O   1 
ATOM   4935  N  N   . PRO A 1  639  ? 133.853 43.386  2.062   1.00 58.38  ? 639  PRO A N   1 
ATOM   4936  C  CA  . PRO A 1  639  ? 132.446 43.139  2.381   1.00 56.59  ? 639  PRO A CA  1 
ATOM   4937  C  C   . PRO A 1  639  ? 132.341 41.852  3.182   1.00 57.06  ? 639  PRO A C   1 
ATOM   4938  O  O   . PRO A 1  639  ? 131.659 41.789  4.206   1.00 56.99  ? 639  PRO A O   1 
ATOM   4939  C  CB  . PRO A 1  639  ? 131.798 43.037  1.007   1.00 55.96  ? 639  PRO A CB  1 
ATOM   4940  C  CG  . PRO A 1  639  ? 132.887 42.435  0.181   1.00 58.40  ? 639  PRO A CG  1 
ATOM   4941  C  CD  . PRO A 1  639  ? 134.100 43.213  0.620   1.00 59.32  ? 639  PRO A CD  1 
ATOM   4942  N  N   . GLN A 1  640  ? 133.046 40.831  2.716   1.00 57.23  ? 640  GLN A N   1 
ATOM   4943  C  CA  . GLN A 1  640  ? 133.049 39.551  3.395   1.00 58.05  ? 640  GLN A CA  1 
ATOM   4944  C  C   . GLN A 1  640  ? 133.242 39.749  4.894   1.00 53.52  ? 640  GLN A C   1 
ATOM   4945  O  O   . GLN A 1  640  ? 132.278 39.720  5.662   1.00 53.60  ? 640  GLN A O   1 
ATOM   4946  C  CB  . GLN A 1  640  ? 134.156 38.670  2.815   1.00 65.13  ? 640  GLN A CB  1 
ATOM   4947  C  CG  . GLN A 1  640  ? 133.756 38.028  1.497   1.00 76.66  ? 640  GLN A CG  1 
ATOM   4948  C  CD  . GLN A 1  640  ? 132.726 36.914  1.685   1.00 83.81  ? 640  GLN A CD  1 
ATOM   4949  O  OE1 . GLN A 1  640  ? 131.948 36.921  2.652   1.00 87.48  ? 640  GLN A OE1 1 
ATOM   4950  N  NE2 . GLN A 1  640  ? 132.708 35.955  0.755   1.00 87.92  ? 640  GLN A NE2 1 
ATOM   4951  N  N   . VAL A 1  641  ? 134.489 39.979  5.289   1.00 48.35  ? 641  VAL A N   1 
ATOM   4952  C  CA  . VAL A 1  641  ? 134.861 40.179  6.688   1.00 42.71  ? 641  VAL A CA  1 
ATOM   4953  C  C   . VAL A 1  641  ? 133.789 40.871  7.514   1.00 38.27  ? 641  VAL A C   1 
ATOM   4954  O  O   . VAL A 1  641  ? 133.559 40.533  8.678   1.00 36.08  ? 641  VAL A O   1 
ATOM   4955  C  CB  . VAL A 1  641  ? 136.144 41.028  6.806   1.00 42.75  ? 641  VAL A CB  1 
ATOM   4956  C  CG1 . VAL A 1  641  ? 136.776 40.824  8.180   1.00 41.88  ? 641  VAL A CG1 1 
ATOM   4957  C  CG2 . VAL A 1  641  ? 137.113 40.675  5.688   1.00 43.49  ? 641  VAL A CG2 1 
ATOM   4958  N  N   . CYS A 1  642  ? 133.133 41.844  6.903   1.00 35.36  ? 642  CYS A N   1 
ATOM   4959  C  CA  . CYS A 1  642  ? 132.115 42.604  7.602   1.00 35.51  ? 642  CYS A CA  1 
ATOM   4960  C  C   . CYS A 1  642  ? 130.939 41.741  8.021   1.00 36.42  ? 642  CYS A C   1 
ATOM   4961  O  O   . CYS A 1  642  ? 130.708 41.521  9.206   1.00 37.09  ? 642  CYS A O   1 
ATOM   4962  C  CB  . CYS A 1  642  ? 131.626 43.765  6.729   1.00 34.50  ? 642  CYS A CB  1 
ATOM   4963  S  SG  . CYS A 1  642  ? 130.872 45.130  7.670   1.00 34.55  ? 642  CYS A SG  1 
ATOM   4964  N  N   . ALA A 1  643  ? 130.186 41.261  7.044   1.00 39.31  ? 643  ALA A N   1 
ATOM   4965  C  CA  . ALA A 1  643  ? 129.030 40.432  7.334   1.00 42.56  ? 643  ALA A CA  1 
ATOM   4966  C  C   . ALA A 1  643  ? 129.396 39.472  8.460   1.00 43.44  ? 643  ALA A C   1 
ATOM   4967  O  O   . ALA A 1  643  ? 128.698 39.370  9.476   1.00 39.79  ? 643  ALA A O   1 
ATOM   4968  C  CB  . ALA A 1  643  ? 128.630 39.665  6.082   1.00 44.93  ? 643  ALA A CB  1 
ATOM   4969  N  N   . LYS A 1  644  ? 130.524 38.796  8.269   1.00 46.45  ? 644  LYS A N   1 
ATOM   4970  C  CA  . LYS A 1  644  ? 131.014 37.836  9.238   1.00 48.54  ? 644  LYS A CA  1 
ATOM   4971  C  C   . LYS A 1  644  ? 131.180 38.513  10.585  1.00 46.82  ? 644  LYS A C   1 
ATOM   4972  O  O   . LYS A 1  644  ? 131.154 37.853  11.618  1.00 52.39  ? 644  LYS A O   1 
ATOM   4973  C  CB  . LYS A 1  644  ? 132.346 37.229  8.775   1.00 53.10  ? 644  LYS A CB  1 
ATOM   4974  C  CG  . LYS A 1  644  ? 132.672 35.898  9.446   1.00 60.71  ? 644  LYS A CG  1 
ATOM   4975  C  CD  . LYS A 1  644  ? 133.706 35.087  8.657   1.00 68.77  ? 644  LYS A CD  1 
ATOM   4976  C  CE  . LYS A 1  644  ? 133.675 33.598  9.072   1.00 73.43  ? 644  LYS A CE  1 
ATOM   4977  N  NZ  . LYS A 1  644  ? 134.661 32.718  8.350   1.00 75.62  ? 644  LYS A NZ  1 
ATOM   4978  N  N   . LEU A 1  645  ? 131.337 39.830  10.584  1.00 41.79  ? 645  LEU A N   1 
ATOM   4979  C  CA  . LEU A 1  645  ? 131.484 40.549  11.841  1.00 37.16  ? 645  LEU A CA  1 
ATOM   4980  C  C   . LEU A 1  645  ? 130.181 40.637  12.636  1.00 34.32  ? 645  LEU A C   1 
ATOM   4981  O  O   . LEU A 1  645  ? 130.169 40.372  13.842  1.00 33.71  ? 645  LEU A O   1 
ATOM   4982  C  CB  . LEU A 1  645  ? 132.021 41.961  11.611  1.00 35.81  ? 645  LEU A CB  1 
ATOM   4983  C  CG  . LEU A 1  645  ? 131.906 42.887  12.830  1.00 30.47  ? 645  LEU A CG  1 
ATOM   4984  C  CD1 . LEU A 1  645  ? 132.639 42.299  14.023  1.00 32.10  ? 645  LEU A CD1 1 
ATOM   4985  C  CD2 . LEU A 1  645  ? 132.472 44.236  12.478  1.00 28.97  ? 645  LEU A CD2 1 
ATOM   4986  N  N   . PHE A 1  646  ? 129.090 41.021  11.979  1.00 31.57  ? 646  PHE A N   1 
ATOM   4987  C  CA  . PHE A 1  646  ? 127.820 41.125  12.688  1.00 29.88  ? 646  PHE A CA  1 
ATOM   4988  C  C   . PHE A 1  646  ? 127.694 39.879  13.539  1.00 30.01  ? 646  PHE A C   1 
ATOM   4989  O  O   . PHE A 1  646  ? 127.578 39.938  14.767  1.00 33.55  ? 646  PHE A O   1 
ATOM   4990  C  CB  . PHE A 1  646  ? 126.627 41.124  11.736  1.00 30.74  ? 646  PHE A CB  1 
ATOM   4991  C  CG  . PHE A 1  646  ? 126.497 42.346  10.880  1.00 30.65  ? 646  PHE A CG  1 
ATOM   4992  C  CD1 . PHE A 1  646  ? 127.282 42.507  9.744   1.00 31.65  ? 646  PHE A CD1 1 
ATOM   4993  C  CD2 . PHE A 1  646  ? 125.507 43.286  11.149  1.00 29.36  ? 646  PHE A CD2 1 
ATOM   4994  C  CE1 . PHE A 1  646  ? 127.070 43.581  8.884   1.00 31.43  ? 646  PHE A CE1 1 
ATOM   4995  C  CE2 . PHE A 1  646  ? 125.289 44.357  10.298  1.00 25.80  ? 646  PHE A CE2 1 
ATOM   4996  C  CZ  . PHE A 1  646  ? 126.069 44.505  9.163   1.00 29.01  ? 646  PHE A CZ  1 
ATOM   4997  N  N   . GLY A 1  647  ? 127.721 38.745  12.846  1.00 29.18  ? 647  GLY A N   1 
ATOM   4998  C  CA  . GLY A 1  647  ? 127.586 37.459  13.500  1.00 28.20  ? 647  GLY A CA  1 
ATOM   4999  C  C   . GLY A 1  647  ? 128.238 37.481  14.850  1.00 26.24  ? 647  GLY A C   1 
ATOM   5000  O  O   . GLY A 1  647  ? 127.588 37.657  15.882  1.00 27.12  ? 647  GLY A O   1 
ATOM   5001  N  N   . ASN A 1  648  ? 129.546 37.316  14.817  1.00 24.44  ? 648  ASN A N   1 
ATOM   5002  C  CA  . ASN A 1  648  ? 130.347 37.317  16.010  1.00 26.63  ? 648  ASN A CA  1 
ATOM   5003  C  C   . ASN A 1  648  ? 129.758 38.239  17.057  1.00 25.61  ? 648  ASN A C   1 
ATOM   5004  O  O   . ASN A 1  648  ? 129.206 37.765  18.054  1.00 28.20  ? 648  ASN A O   1 
ATOM   5005  C  CB  . ASN A 1  648  ? 131.754 37.719  15.628  1.00 28.19  ? 648  ASN A CB  1 
ATOM   5006  C  CG  . ASN A 1  648  ? 132.166 37.084  14.322  1.00 32.78  ? 648  ASN A CG  1 
ATOM   5007  O  OD1 . ASN A 1  648  ? 131.526 36.128  13.868  1.00 31.80  ? 648  ASN A OD1 1 
ATOM   5008  N  ND2 . ASN A 1  648  ? 133.224 37.602  13.701  1.00 36.78  ? 648  ASN A ND2 1 
ATOM   5009  N  N   . ILE A 1  649  ? 129.838 39.546  16.835  1.00 21.84  ? 649  ILE A N   1 
ATOM   5010  C  CA  . ILE A 1  649  ? 129.291 40.485  17.814  1.00 19.24  ? 649  ILE A CA  1 
ATOM   5011  C  C   . ILE A 1  649  ? 127.992 39.897  18.352  1.00 18.93  ? 649  ILE A C   1 
ATOM   5012  O  O   . ILE A 1  649  ? 127.904 39.529  19.528  1.00 21.76  ? 649  ILE A O   1 
ATOM   5013  C  CB  . ILE A 1  649  ? 129.011 41.871  17.184  1.00 16.61  ? 649  ILE A CB  1 
ATOM   5014  C  CG1 . ILE A 1  649  ? 130.283 42.402  16.520  1.00 17.42  ? 649  ILE A CG1 1 
ATOM   5015  C  CG2 . ILE A 1  649  ? 128.552 42.853  18.256  1.00 15.77  ? 649  ILE A CG2 1 
ATOM   5016  C  CD1 . ILE A 1  649  ? 130.143 43.771  15.912  1.00 16.98  ? 649  ILE A CD1 1 
ATOM   5017  N  N   . GLN A 1  650  ? 127.008 39.773  17.466  1.00 18.66  ? 650  GLN A N   1 
ATOM   5018  C  CA  . GLN A 1  650  ? 125.705 39.224  17.809  1.00 20.39  ? 650  GLN A CA  1 
ATOM   5019  C  C   . GLN A 1  650  ? 125.772 38.010  18.708  1.00 21.14  ? 650  GLN A C   1 
ATOM   5020  O  O   . GLN A 1  650  ? 125.231 38.003  19.816  1.00 24.25  ? 650  GLN A O   1 
ATOM   5021  C  CB  . GLN A 1  650  ? 124.968 38.847  16.544  1.00 21.26  ? 650  GLN A CB  1 
ATOM   5022  C  CG  . GLN A 1  650  ? 124.379 40.025  15.869  1.00 25.39  ? 650  GLN A CG  1 
ATOM   5023  C  CD  . GLN A 1  650  ? 123.629 39.639  14.639  1.00 27.03  ? 650  GLN A CD  1 
ATOM   5024  O  OE1 . GLN A 1  650  ? 124.215 39.476  13.572  1.00 28.68  ? 650  GLN A OE1 1 
ATOM   5025  N  NE2 . GLN A 1  650  ? 122.315 39.467  14.778  1.00 29.82  ? 650  GLN A NE2 1 
ATOM   5026  N  N   . LYS A 1  651  ? 126.431 36.971  18.213  1.00 20.48  ? 651  LYS A N   1 
ATOM   5027  C  CA  . LYS A 1  651  ? 126.561 35.749  18.974  1.00 22.75  ? 651  LYS A CA  1 
ATOM   5028  C  C   . LYS A 1  651  ? 127.155 36.059  20.339  1.00 21.65  ? 651  LYS A C   1 
ATOM   5029  O  O   . LYS A 1  651  ? 126.502 35.832  21.355  1.00 24.72  ? 651  LYS A O   1 
ATOM   5030  C  CB  . LYS A 1  651  ? 127.432 34.750  18.216  1.00 26.62  ? 651  LYS A CB  1 
ATOM   5031  C  CG  . LYS A 1  651  ? 126.940 34.465  16.805  1.00 32.81  ? 651  LYS A CG  1 
ATOM   5032  C  CD  . LYS A 1  651  ? 127.924 33.591  16.040  1.00 36.70  ? 651  LYS A CD  1 
ATOM   5033  C  CE  . LYS A 1  651  ? 127.590 33.537  14.549  1.00 40.06  ? 651  LYS A CE  1 
ATOM   5034  N  NZ  . LYS A 1  651  ? 126.243 32.947  14.290  1.00 43.27  ? 651  LYS A NZ  1 
ATOM   5035  N  N   . VAL A 1  652  ? 128.369 36.603  20.375  1.00 18.40  ? 652  VAL A N   1 
ATOM   5036  C  CA  . VAL A 1  652  ? 128.990 36.900  21.664  1.00 15.62  ? 652  VAL A CA  1 
ATOM   5037  C  C   . VAL A 1  652  ? 128.008 37.636  22.558  1.00 15.46  ? 652  VAL A C   1 
ATOM   5038  O  O   . VAL A 1  652  ? 127.582 37.128  23.604  1.00 19.65  ? 652  VAL A O   1 
ATOM   5039  C  CB  . VAL A 1  652  ? 130.226 37.792  21.541  1.00 11.62  ? 652  VAL A CB  1 
ATOM   5040  C  CG1 . VAL A 1  652  ? 131.112 37.594  22.773  1.00 10.12  ? 652  VAL A CG1 1 
ATOM   5041  C  CG2 . VAL A 1  652  ? 130.968 37.484  20.277  1.00 13.34  ? 652  VAL A CG2 1 
ATOM   5042  N  N   . VAL A 1  653  ? 127.659 38.842  22.129  1.00 12.02  ? 653  VAL A N   1 
ATOM   5043  C  CA  . VAL A 1  653  ? 126.729 39.690  22.845  1.00 14.01  ? 653  VAL A CA  1 
ATOM   5044  C  C   . VAL A 1  653  ? 125.467 38.950  23.266  1.00 14.13  ? 653  VAL A C   1 
ATOM   5045  O  O   . VAL A 1  653  ? 125.256 38.682  24.452  1.00 16.90  ? 653  VAL A O   1 
ATOM   5046  C  CB  . VAL A 1  653  ? 126.330 40.852  21.959  1.00 15.93  ? 653  VAL A CB  1 
ATOM   5047  C  CG1 . VAL A 1  653  ? 125.533 41.877  22.759  1.00 19.01  ? 653  VAL A CG1 1 
ATOM   5048  C  CG2 . VAL A 1  653  ? 127.579 41.455  21.345  1.00 20.53  ? 653  VAL A CG2 1 
ATOM   5049  N  N   . ASN A 1  654  ? 124.632 38.636  22.280  1.00 17.50  ? 654  ASN A N   1 
ATOM   5050  C  CA  . ASN A 1  654  ? 123.378 37.931  22.498  1.00 22.33  ? 654  ASN A CA  1 
ATOM   5051  C  C   . ASN A 1  654  ? 123.480 36.925  23.617  1.00 25.18  ? 654  ASN A C   1 
ATOM   5052  O  O   . ASN A 1  654  ? 122.602 36.858  24.484  1.00 26.42  ? 654  ASN A O   1 
ATOM   5053  C  CB  . ASN A 1  654  ? 122.971 37.203  21.232  1.00 25.06  ? 654  ASN A CB  1 
ATOM   5054  C  CG  . ASN A 1  654  ? 122.289 38.102  20.257  1.00 27.93  ? 654  ASN A CG  1 
ATOM   5055  O  OD1 . ASN A 1  654  ? 121.312 38.760  20.611  1.00 30.11  ? 654  ASN A OD1 1 
ATOM   5056  N  ND2 . ASN A 1  654  ? 122.783 38.141  19.017  1.00 26.23  ? 654  ASN A ND2 1 
ATOM   5057  N  N   . PHE A 1  655  ? 124.556 36.136  23.572  1.00 28.24  ? 655  PHE A N   1 
ATOM   5058  C  CA  . PHE A 1  655  ? 124.818 35.101  24.567  1.00 29.95  ? 655  PHE A CA  1 
ATOM   5059  C  C   . PHE A 1  655  ? 124.942 35.746  25.936  1.00 28.38  ? 655  PHE A C   1 
ATOM   5060  O  O   . PHE A 1  655  ? 124.176 35.431  26.848  1.00 29.26  ? 655  PHE A O   1 
ATOM   5061  C  CB  . PHE A 1  655  ? 126.096 34.302  24.210  1.00 31.59  ? 655  PHE A CB  1 
ATOM   5062  C  CG  . PHE A 1  655  ? 126.532 33.306  25.280  1.00 35.69  ? 655  PHE A CG  1 
ATOM   5063  C  CD1 . PHE A 1  655  ? 125.594 32.648  26.076  1.00 38.00  ? 655  PHE A CD1 1 
ATOM   5064  C  CD2 . PHE A 1  655  ? 127.886 33.049  25.507  1.00 37.49  ? 655  PHE A CD2 1 
ATOM   5065  C  CE1 . PHE A 1  655  ? 125.996 31.760  27.087  1.00 39.53  ? 655  PHE A CE1 1 
ATOM   5066  C  CE2 . PHE A 1  655  ? 128.299 32.160  26.516  1.00 38.40  ? 655  PHE A CE2 1 
ATOM   5067  C  CZ  . PHE A 1  655  ? 127.351 31.521  27.305  1.00 39.47  ? 655  PHE A CZ  1 
ATOM   5068  N  N   . TRP A 1  656  ? 125.883 36.667  26.082  1.00 28.40  ? 656  TRP A N   1 
ATOM   5069  C  CA  . TRP A 1  656  ? 126.043 37.303  27.371  1.00 30.51  ? 656  TRP A CA  1 
ATOM   5070  C  C   . TRP A 1  656  ? 124.699 37.883  27.860  1.00 29.45  ? 656  TRP A C   1 
ATOM   5071  O  O   . TRP A 1  656  ? 124.339 37.736  29.037  1.00 28.34  ? 656  TRP A O   1 
ATOM   5072  C  CB  . TRP A 1  656  ? 127.130 38.384  27.303  1.00 33.09  ? 656  TRP A CB  1 
ATOM   5073  C  CG  . TRP A 1  656  ? 127.357 39.025  28.635  1.00 37.68  ? 656  TRP A CG  1 
ATOM   5074  C  CD1 . TRP A 1  656  ? 128.159 38.574  29.654  1.00 39.58  ? 656  TRP A CD1 1 
ATOM   5075  C  CD2 . TRP A 1  656  ? 126.667 40.166  29.145  1.00 37.51  ? 656  TRP A CD2 1 
ATOM   5076  N  NE1 . TRP A 1  656  ? 127.999 39.366  30.771  1.00 39.28  ? 656  TRP A NE1 1 
ATOM   5077  C  CE2 . TRP A 1  656  ? 127.088 40.349  30.482  1.00 38.44  ? 656  TRP A CE2 1 
ATOM   5078  C  CE3 . TRP A 1  656  ? 125.723 41.049  28.602  1.00 35.20  ? 656  TRP A CE3 1 
ATOM   5079  C  CZ2 . TRP A 1  656  ? 126.597 41.378  31.277  1.00 38.62  ? 656  TRP A CZ2 1 
ATOM   5080  C  CZ3 . TRP A 1  656  ? 125.237 42.065  29.386  1.00 34.52  ? 656  TRP A CZ3 1 
ATOM   5081  C  CH2 . TRP A 1  656  ? 125.672 42.226  30.712  1.00 38.31  ? 656  TRP A CH2 1 
ATOM   5082  N  N   . LEU A 1  657  ? 123.951 38.518  26.959  1.00 28.62  ? 657  LEU A N   1 
ATOM   5083  C  CA  . LEU A 1  657  ? 122.658 39.090  27.329  1.00 28.92  ? 657  LEU A CA  1 
ATOM   5084  C  C   . LEU A 1  657  ? 121.738 37.992  27.850  1.00 30.84  ? 657  LEU A C   1 
ATOM   5085  O  O   . LEU A 1  657  ? 121.102 38.147  28.889  1.00 32.13  ? 657  LEU A O   1 
ATOM   5086  C  CB  . LEU A 1  657  ? 121.999 39.789  26.129  1.00 29.02  ? 657  LEU A CB  1 
ATOM   5087  C  CG  . LEU A 1  657  ? 120.563 40.313  26.333  1.00 27.62  ? 657  LEU A CG  1 
ATOM   5088  C  CD1 . LEU A 1  657  ? 120.527 41.235  27.529  1.00 28.15  ? 657  LEU A CD1 1 
ATOM   5089  C  CD2 . LEU A 1  657  ? 120.065 41.046  25.101  1.00 28.85  ? 657  LEU A CD2 1 
ATOM   5090  N  N   . LEU A 1  658  ? 121.670 36.884  27.120  1.00 33.40  ? 658  LEU A N   1 
ATOM   5091  C  CA  . LEU A 1  658  ? 120.837 35.753  27.515  1.00 36.29  ? 658  LEU A CA  1 
ATOM   5092  C  C   . LEU A 1  658  ? 121.025 35.423  28.993  1.00 37.99  ? 658  LEU A C   1 
ATOM   5093  O  O   . LEU A 1  658  ? 120.083 35.022  29.675  1.00 38.52  ? 658  LEU A O   1 
ATOM   5094  C  CB  . LEU A 1  658  ? 121.200 34.518  26.692  1.00 36.72  ? 658  LEU A CB  1 
ATOM   5095  C  CG  . LEU A 1  658  ? 120.492 33.223  27.100  1.00 37.36  ? 658  LEU A CG  1 
ATOM   5096  C  CD1 . LEU A 1  658  ? 119.071 33.228  26.562  1.00 35.05  ? 658  LEU A CD1 1 
ATOM   5097  C  CD2 . LEU A 1  658  ? 121.253 32.025  26.560  1.00 37.57  ? 658  LEU A CD2 1 
ATOM   5098  N  N   . HIS A 1  659  ? 122.248 35.595  29.482  1.00 39.86  ? 659  HIS A N   1 
ATOM   5099  C  CA  . HIS A 1  659  ? 122.547 35.301  30.876  1.00 44.04  ? 659  HIS A CA  1 
ATOM   5100  C  C   . HIS A 1  659  ? 122.528 36.487  31.848  1.00 46.17  ? 659  HIS A C   1 
ATOM   5101  O  O   . HIS A 1  659  ? 122.377 36.286  33.063  1.00 49.64  ? 659  HIS A O   1 
ATOM   5102  C  CB  . HIS A 1  659  ? 123.881 34.570  30.971  1.00 44.69  ? 659  HIS A CB  1 
ATOM   5103  C  CG  . HIS A 1  659  ? 123.813 33.146  30.521  1.00 43.34  ? 659  HIS A CG  1 
ATOM   5104  N  ND1 . HIS A 1  659  ? 123.241 32.772  29.326  1.00 42.66  ? 659  HIS A ND1 1 
ATOM   5105  C  CD2 . HIS A 1  659  ? 124.277 32.007  31.093  1.00 42.79  ? 659  HIS A CD2 1 
ATOM   5106  C  CE1 . HIS A 1  659  ? 123.357 31.463  29.175  1.00 44.53  ? 659  HIS A CE1 1 
ATOM   5107  N  NE2 . HIS A 1  659  ? 123.983 30.977  30.235  1.00 44.02  ? 659  HIS A NE2 1 
ATOM   5108  N  N   . ASN A 1  660  ? 122.694 37.712  31.346  1.00 44.67  ? 660  ASN A N   1 
ATOM   5109  C  CA  . ASN A 1  660  ? 122.623 38.874  32.237  1.00 42.62  ? 660  ASN A CA  1 
ATOM   5110  C  C   . ASN A 1  660  ? 121.137 39.235  32.358  1.00 41.25  ? 660  ASN A C   1 
ATOM   5111  O  O   . ASN A 1  660  ? 120.675 39.770  33.378  1.00 42.04  ? 660  ASN A O   1 
ATOM   5112  C  CB  . ASN A 1  660  ? 123.400 40.065  31.668  1.00 42.69  ? 660  ASN A CB  1 
ATOM   5113  C  CG  . ASN A 1  660  ? 123.500 41.225  32.660  1.00 41.59  ? 660  ASN A CG  1 
ATOM   5114  O  OD1 . ASN A 1  660  ? 124.165 41.124  33.696  1.00 42.04  ? 660  ASN A OD1 1 
ATOM   5115  N  ND2 . ASN A 1  660  ? 122.832 42.328  32.346  1.00 39.24  ? 660  ASN A ND2 1 
ATOM   5116  N  N   . GLY A 1  661  ? 120.400 38.913  31.296  1.00 39.24  ? 661  GLY A N   1 
ATOM   5117  C  CA  . GLY A 1  661  ? 118.973 39.169  31.242  1.00 35.69  ? 661  GLY A CA  1 
ATOM   5118  C  C   . GLY A 1  661  ? 118.639 40.642  31.126  1.00 34.34  ? 661  GLY A C   1 
ATOM   5119  O  O   . GLY A 1  661  ? 119.428 41.499  31.526  1.00 34.11  ? 661  GLY A O   1 
ATOM   5120  N  N   . PHE A 1  662  ? 117.475 40.943  30.560  1.00 32.62  ? 662  PHE A N   1 
ATOM   5121  C  CA  . PHE A 1  662  ? 117.051 42.324  30.436  1.00 30.92  ? 662  PHE A CA  1 
ATOM   5122  C  C   . PHE A 1  662  ? 115.541 42.436  30.448  1.00 32.22  ? 662  PHE A C   1 
ATOM   5123  O  O   . PHE A 1  662  ? 114.860 41.616  29.832  1.00 33.09  ? 662  PHE A O   1 
ATOM   5124  C  CB  . PHE A 1  662  ? 117.579 42.937  29.157  1.00 30.91  ? 662  PHE A CB  1 
ATOM   5125  C  CG  . PHE A 1  662  ? 117.217 44.377  29.013  1.00 31.86  ? 662  PHE A CG  1 
ATOM   5126  C  CD1 . PHE A 1  662  ? 117.447 45.262  30.059  1.00 30.81  ? 662  PHE A CD1 1 
ATOM   5127  C  CD2 . PHE A 1  662  ? 116.629 44.852  27.847  1.00 31.64  ? 662  PHE A CD2 1 
ATOM   5128  C  CE1 . PHE A 1  662  ? 117.090 46.584  29.947  1.00 32.11  ? 662  PHE A CE1 1 
ATOM   5129  C  CE2 . PHE A 1  662  ? 116.269 46.178  27.727  1.00 29.66  ? 662  PHE A CE2 1 
ATOM   5130  C  CZ  . PHE A 1  662  ? 116.501 47.047  28.778  1.00 30.92  ? 662  PHE A CZ  1 
ATOM   5131  N  N   . SER A 1  663  ? 115.012 43.447  31.136  1.00 33.31  ? 663  SER A N   1 
ATOM   5132  C  CA  . SER A 1  663  ? 113.560 43.603  31.187  1.00 38.67  ? 663  SER A CA  1 
ATOM   5133  C  C   . SER A 1  663  ? 113.039 45.050  31.045  1.00 40.36  ? 663  SER A C   1 
ATOM   5134  O  O   . SER A 1  663  ? 113.787 45.951  30.650  1.00 40.75  ? 663  SER A O   1 
ATOM   5135  C  CB  . SER A 1  663  ? 113.022 42.965  32.479  1.00 42.14  ? 663  SER A CB  1 
ATOM   5136  O  OG  . SER A 1  663  ? 111.629 42.681  32.377  1.00 45.43  ? 663  SER A OG  1 
ATOM   5137  N  N   . THR A 1  664  ? 111.750 45.241  31.357  1.00 41.43  ? 664  THR A N   1 
ATOM   5138  C  CA  . THR A 1  664  ? 111.049 46.533  31.289  1.00 42.75  ? 664  THR A CA  1 
ATOM   5139  C  C   . THR A 1  664  ? 109.713 46.439  32.011  1.00 42.82  ? 664  THR A C   1 
ATOM   5140  O  O   . THR A 1  664  ? 109.003 45.449  31.856  1.00 44.87  ? 664  THR A O   1 
ATOM   5141  C  CB  . THR A 1  664  ? 110.745 46.929  29.841  1.00 44.93  ? 664  THR A CB  1 
ATOM   5142  O  OG1 . THR A 1  664  ? 111.936 47.442  29.238  1.00 50.03  ? 664  THR A OG1 1 
ATOM   5143  C  CG2 . THR A 1  664  ? 109.625 47.975  29.784  1.00 43.11  ? 664  THR A CG2 1 
ATOM   5144  N  N   . GLY A 1  665  ? 109.358 47.468  32.775  1.00 43.46  ? 665  GLY A N   1 
ATOM   5145  C  CA  . GLY A 1  665  ? 108.094 47.437  33.496  1.00 44.15  ? 665  GLY A CA  1 
ATOM   5146  C  C   . GLY A 1  665  ? 107.662 48.752  34.119  1.00 43.25  ? 665  GLY A C   1 
ATOM   5147  O  O   . GLY A 1  665  ? 108.457 49.679  34.235  1.00 45.97  ? 665  GLY A O   1 
ATOM   5148  N  N   . ILE A 1  666  ? 106.402 48.834  34.531  1.00 40.34  ? 666  ILE A N   1 
ATOM   5149  C  CA  . ILE A 1  666  ? 105.882 50.053  35.135  1.00 37.38  ? 666  ILE A CA  1 
ATOM   5150  C  C   . ILE A 1  666  ? 106.853 50.743  36.086  1.00 38.47  ? 666  ILE A C   1 
ATOM   5151  O  O   . ILE A 1  666  ? 106.847 51.969  36.192  1.00 40.35  ? 666  ILE A O   1 
ATOM   5152  C  CB  . ILE A 1  666  ? 104.579 49.788  35.897  1.00 32.64  ? 666  ILE A CB  1 
ATOM   5153  C  CG1 . ILE A 1  666  ? 104.646 48.408  36.553  1.00 33.07  ? 666  ILE A CG1 1 
ATOM   5154  C  CG2 . ILE A 1  666  ? 103.387 49.936  34.962  1.00 29.61  ? 666  ILE A CG2 1 
ATOM   5155  C  CD1 . ILE A 1  666  ? 105.836 48.204  37.510  1.00 31.70  ? 666  ILE A CD1 1 
ATOM   5156  N  N   . GLY A 1  667  ? 107.684 49.971  36.778  1.00 37.98  ? 667  GLY A N   1 
ATOM   5157  C  CA  . GLY A 1  667  ? 108.628 50.573  37.700  1.00 40.56  ? 667  GLY A CA  1 
ATOM   5158  C  C   . GLY A 1  667  ? 109.568 51.546  37.006  1.00 42.43  ? 667  GLY A C   1 
ATOM   5159  O  O   . GLY A 1  667  ? 110.122 52.461  37.624  1.00 43.33  ? 667  GLY A O   1 
ATOM   5160  N  N   . ASP A 1  668  ? 109.751 51.351  35.709  1.00 43.13  ? 668  ASP A N   1 
ATOM   5161  C  CA  . ASP A 1  668  ? 110.630 52.216  34.945  1.00 45.75  ? 668  ASP A CA  1 
ATOM   5162  C  C   . ASP A 1  668  ? 109.919 53.505  34.507  1.00 47.78  ? 668  ASP A C   1 
ATOM   5163  O  O   . ASP A 1  668  ? 110.524 54.365  33.862  1.00 47.50  ? 668  ASP A O   1 
ATOM   5164  C  CB  . ASP A 1  668  ? 111.174 51.475  33.708  1.00 48.45  ? 668  ASP A CB  1 
ATOM   5165  C  CG  . ASP A 1  668  ? 112.034 50.245  34.061  1.00 47.01  ? 668  ASP A CG  1 
ATOM   5166  O  OD1 . ASP A 1  668  ? 112.929 50.353  34.932  1.00 45.77  ? 668  ASP A OD1 1 
ATOM   5167  O  OD2 . ASP A 1  668  ? 111.824 49.172  33.442  1.00 46.47  ? 668  ASP A OD2 1 
ATOM   5168  N  N   . THR A 1  669  ? 108.638 53.637  34.849  1.00 49.96  ? 669  THR A N   1 
ATOM   5169  C  CA  . THR A 1  669  ? 107.879 54.835  34.480  1.00 53.07  ? 669  THR A CA  1 
ATOM   5170  C  C   . THR A 1  669  ? 107.498 55.697  35.686  1.00 56.85  ? 669  THR A C   1 
ATOM   5171  O  O   . THR A 1  669  ? 106.990 56.810  35.534  1.00 54.21  ? 669  THR A O   1 
ATOM   5172  C  CB  . THR A 1  669  ? 106.576 54.486  33.704  1.00 50.84  ? 669  THR A CB  1 
ATOM   5173  O  OG1 . THR A 1  669  ? 105.731 53.663  34.515  1.00 47.93  ? 669  THR A OG1 1 
ATOM   5174  C  CG2 . THR A 1  669  ? 106.900 53.776  32.400  1.00 49.88  ? 669  THR A CG2 1 
ATOM   5175  N  N   . ILE A 1  670  ? 107.746 55.183  36.884  1.00 62.68  ? 670  ILE A N   1 
ATOM   5176  C  CA  . ILE A 1  670  ? 107.423 55.928  38.090  1.00 68.74  ? 670  ILE A CA  1 
ATOM   5177  C  C   . ILE A 1  670  ? 108.670 56.628  38.595  1.00 72.21  ? 670  ILE A C   1 
ATOM   5178  O  O   . ILE A 1  670  ? 109.698 55.982  38.838  1.00 70.68  ? 670  ILE A O   1 
ATOM   5179  C  CB  . ILE A 1  670  ? 106.904 55.012  39.202  1.00 68.63  ? 670  ILE A CB  1 
ATOM   5180  C  CG1 . ILE A 1  670  ? 106.043 53.902  38.601  1.00 68.83  ? 670  ILE A CG1 1 
ATOM   5181  C  CG2 . ILE A 1  670  ? 106.068 55.829  40.183  1.00 71.45  ? 670  ILE A CG2 1 
ATOM   5182  C  CD1 . ILE A 1  670  ? 105.502 52.935  39.625  1.00 68.64  ? 670  ILE A CD1 1 
ATOM   5183  N  N   . ALA A 1  671  ? 108.569 57.948  38.758  1.00 76.12  ? 671  ALA A N   1 
ATOM   5184  C  CA  . ALA A 1  671  ? 109.695 58.748  39.222  1.00 80.12  ? 671  ALA A CA  1 
ATOM   5185  C  C   . ALA A 1  671  ? 109.570 59.245  40.663  1.00 82.80  ? 671  ALA A C   1 
ATOM   5186  O  O   . ALA A 1  671  ? 108.467 59.391  41.203  1.00 81.80  ? 671  ALA A O   1 
ATOM   5187  C  CB  . ALA A 1  671  ? 109.917 59.925  38.280  1.00 79.75  ? 671  ALA A CB  1 
ATOM   5188  N  N   . ASP A 1  672  ? 110.738 59.487  41.257  1.00 86.24  ? 672  ASP A N   1 
ATOM   5189  C  CA  . ASP A 1  672  ? 110.926 59.973  42.627  1.00 88.75  ? 672  ASP A CA  1 
ATOM   5190  C  C   . ASP A 1  672  ? 109.783 60.876  43.129  1.00 89.99  ? 672  ASP A C   1 
ATOM   5191  O  O   . ASP A 1  672  ? 109.580 61.971  42.598  1.00 92.54  ? 672  ASP A O   1 
ATOM   5192  C  CB  . ASP A 1  672  ? 112.262 60.732  42.671  1.00 89.85  ? 672  ASP A CB  1 
ATOM   5193  C  CG  . ASP A 1  672  ? 112.954 60.648  44.015  1.00 90.90  ? 672  ASP A CG  1 
ATOM   5194  O  OD1 . ASP A 1  672  ? 113.152 59.520  44.516  1.00 91.14  ? 672  ASP A OD1 1 
ATOM   5195  O  OD2 . ASP A 1  672  ? 113.316 61.714  44.560  1.00 91.11  ? 672  ASP A OD2 1 
ATOM   5196  N  N   . GLY A 1  673  ? 109.056 60.423  44.153  1.00 89.03  ? 673  GLY A N   1 
ATOM   5197  C  CA  . GLY A 1  673  ? 107.947 61.198  44.715  1.00 87.71  ? 673  GLY A CA  1 
ATOM   5198  C  C   . GLY A 1  673  ? 108.002 62.716  44.558  1.00 85.55  ? 673  GLY A C   1 
ATOM   5199  O  O   . GLY A 1  673  ? 107.083 63.323  44.003  1.00 85.48  ? 673  GLY A O   1 
ATOM   5200  N  N   . PRO A 1  674  ? 109.057 63.366  45.068  1.00 83.93  ? 674  PRO A N   1 
ATOM   5201  C  CA  . PRO A 1  674  ? 109.180 64.817  44.944  1.00 83.12  ? 674  PRO A CA  1 
ATOM   5202  C  C   . PRO A 1  674  ? 109.209 65.293  43.491  1.00 82.23  ? 674  PRO A C   1 
ATOM   5203  O  O   . PRO A 1  674  ? 108.568 66.284  43.139  1.00 80.23  ? 674  PRO A O   1 
ATOM   5204  C  CB  . PRO A 1  674  ? 110.488 65.114  45.686  1.00 84.14  ? 674  PRO A CB  1 
ATOM   5205  C  CG  . PRO A 1  674  ? 111.232 63.807  45.659  1.00 82.00  ? 674  PRO A CG  1 
ATOM   5206  C  CD  . PRO A 1  674  ? 110.127 62.834  45.925  1.00 83.23  ? 674  PRO A CD  1 
ATOM   5207  N  N   . THR A 1  675  ? 109.951 64.586  42.648  1.00 81.49  ? 675  THR A N   1 
ATOM   5208  C  CA  . THR A 1  675  ? 110.043 64.959  41.247  1.00 83.96  ? 675  THR A CA  1 
ATOM   5209  C  C   . THR A 1  675  ? 108.670 64.941  40.588  1.00 86.30  ? 675  THR A C   1 
ATOM   5210  O  O   . THR A 1  675  ? 108.511 65.399  39.458  1.00 87.43  ? 675  THR A O   1 
ATOM   5211  C  CB  . THR A 1  675  ? 110.999 64.025  40.485  1.00 83.53  ? 675  THR A CB  1 
ATOM   5212  O  OG1 . THR A 1  675  ? 112.283 64.052  41.121  1.00 83.87  ? 675  THR A OG1 1 
ATOM   5213  C  CG2 . THR A 1  675  ? 111.152 64.470  39.022  1.00 83.01  ? 675  THR A CG2 1 
ATOM   5214  N  N   . MET A 1  676  ? 107.678 64.404  41.290  1.00 89.20  ? 676  MET A N   1 
ATOM   5215  C  CA  . MET A 1  676  ? 106.324 64.382  40.756  1.00 93.98  ? 676  MET A CA  1 
ATOM   5216  C  C   . MET A 1  676  ? 105.700 65.733  41.095  1.00 96.42  ? 676  MET A C   1 
ATOM   5217  O  O   . MET A 1  676  ? 105.215 66.439  40.208  1.00 99.63  ? 676  MET A O   1 
ATOM   5218  C  CB  . MET A 1  676  ? 105.495 63.245  41.371  1.00 95.76  ? 676  MET A CB  1 
ATOM   5219  C  CG  . MET A 1  676  ? 105.581 61.890  40.637  1.00 100.01 ? 676  MET A CG  1 
ATOM   5220  S  SD  . MET A 1  676  ? 104.738 61.786  39.000  1.00 104.54 ? 676  MET A SD  1 
ATOM   5221  C  CE  . MET A 1  676  ? 103.188 60.903  39.413  1.00 103.44 ? 676  MET A CE  1 
ATOM   5222  N  N   . ARG A 1  677  ? 105.724 66.101  42.375  1.00 97.04  ? 677  ARG A N   1 
ATOM   5223  C  CA  . ARG A 1  677  ? 105.165 67.382  42.793  1.00 96.98  ? 677  ARG A CA  1 
ATOM   5224  C  C   . ARG A 1  677  ? 105.932 68.463  42.050  1.00 94.83  ? 677  ARG A C   1 
ATOM   5225  O  O   . ARG A 1  677  ? 105.336 69.315  41.386  1.00 94.64  ? 677  ARG A O   1 
ATOM   5226  C  CB  . ARG A 1  677  ? 105.334 67.590  44.297  1.00 102.07 ? 677  ARG A CB  1 
ATOM   5227  C  CG  . ARG A 1  677  ? 104.512 68.750  44.858  1.00 108.78 ? 677  ARG A CG  1 
ATOM   5228  C  CD  . ARG A 1  677  ? 104.956 69.148  46.271  1.00 115.20 ? 677  ARG A CD  1 
ATOM   5229  N  NE  . ARG A 1  677  ? 105.173 67.996  47.149  1.00 121.10 ? 677  ARG A NE  1 
ATOM   5230  C  CZ  . ARG A 1  677  ? 106.371 67.580  47.562  1.00 123.14 ? 677  ARG A CZ  1 
ATOM   5231  N  NH1 . ARG A 1  677  ? 107.469 68.227  47.181  1.00 124.05 ? 677  ARG A NH1 1 
ATOM   5232  N  NH2 . ARG A 1  677  ? 106.473 66.514  48.353  1.00 122.98 ? 677  ARG A NH2 1 
ATOM   5233  N  N   . GLU A 1  678  ? 107.259 68.408  42.163  1.00 90.82  ? 678  GLU A N   1 
ATOM   5234  C  CA  . GLU A 1  678  ? 108.139 69.367  41.506  1.00 87.80  ? 678  GLU A CA  1 
ATOM   5235  C  C   . GLU A 1  678  ? 107.701 69.577  40.067  1.00 85.81  ? 678  GLU A C   1 
ATOM   5236  O  O   . GLU A 1  678  ? 107.940 70.626  39.481  1.00 84.26  ? 678  GLU A O   1 
ATOM   5237  C  CB  . GLU A 1  678  ? 109.588 68.879  41.564  1.00 87.27  ? 678  GLU A CB  1 
ATOM   5238  C  CG  . GLU A 1  678  ? 110.571 69.725  40.766  1.00 89.56  ? 678  GLU A CG  1 
ATOM   5239  C  CD  . GLU A 1  678  ? 111.990 69.682  41.330  1.00 90.54  ? 678  GLU A CD  1 
ATOM   5240  O  OE1 . GLU A 1  678  ? 112.938 70.044  40.597  1.00 91.93  ? 678  GLU A OE1 1 
ATOM   5241  O  OE2 . GLU A 1  678  ? 112.158 69.301  42.509  1.00 89.08  ? 678  GLU A OE2 1 
ATOM   5242  N  N   . ILE A 1  679  ? 107.052 68.569  39.503  1.00 85.46  ? 679  ILE A N   1 
ATOM   5243  C  CA  . ILE A 1  679  ? 106.550 68.667  38.144  1.00 86.06  ? 679  ILE A CA  1 
ATOM   5244  C  C   . ILE A 1  679  ? 105.181 69.333  38.190  1.00 87.24  ? 679  ILE A C   1 
ATOM   5245  O  O   . ILE A 1  679  ? 104.926 70.300  37.473  1.00 88.41  ? 679  ILE A O   1 
ATOM   5246  C  CB  . ILE A 1  679  ? 106.432 67.274  37.473  1.00 83.68  ? 679  ILE A CB  1 
ATOM   5247  C  CG1 . ILE A 1  679  ? 107.817 66.808  37.015  1.00 83.09  ? 679  ILE A CG1 1 
ATOM   5248  C  CG2 . ILE A 1  679  ? 105.465 67.332  36.299  1.00 83.31  ? 679  ILE A CG2 1 
ATOM   5249  C  CD1 . ILE A 1  679  ? 107.817 65.530  36.215  1.00 81.00  ? 679  ILE A CD1 1 
ATOM   5250  N  N   . THR A 1  680  ? 104.308 68.822  39.050  1.00 88.22  ? 680  THR A N   1 
ATOM   5251  C  CA  . THR A 1  680  ? 102.971 69.377  39.182  1.00 90.92  ? 680  THR A CA  1 
ATOM   5252  C  C   . THR A 1  680  ? 103.039 70.898  39.192  1.00 93.25  ? 680  THR A C   1 
ATOM   5253  O  O   . THR A 1  680  ? 102.434 71.562  38.347  1.00 94.74  ? 680  THR A O   1 
ATOM   5254  C  CB  . THR A 1  680  ? 102.301 68.933  40.483  1.00 90.40  ? 680  THR A CB  1 
ATOM   5255  O  OG1 . THR A 1  680  ? 102.624 67.564  40.746  1.00 89.06  ? 680  THR A OG1 1 
ATOM   5256  C  CG2 . THR A 1  680  ? 100.788 69.075  40.364  1.00 90.10  ? 680  THR A CG2 1 
ATOM   5257  N  N   . GLU A 1  681  ? 103.785 71.446  40.148  1.00 94.84  ? 681  GLU A N   1 
ATOM   5258  C  CA  . GLU A 1  681  ? 103.910 72.891  40.253  1.00 96.99  ? 681  GLU A CA  1 
ATOM   5259  C  C   . GLU A 1  681  ? 104.608 73.490  39.038  1.00 95.06  ? 681  GLU A C   1 
ATOM   5260  O  O   . GLU A 1  681  ? 104.298 74.617  38.640  1.00 96.20  ? 681  GLU A O   1 
ATOM   5261  C  CB  . GLU A 1  681  ? 104.638 73.286  41.549  1.00 101.44 ? 681  GLU A CB  1 
ATOM   5262  C  CG  . GLU A 1  681  ? 106.045 72.722  41.724  1.00 107.56 ? 681  GLU A CG  1 
ATOM   5263  C  CD  . GLU A 1  681  ? 106.674 73.102  43.072  1.00 110.31 ? 681  GLU A CD  1 
ATOM   5264  O  OE1 . GLU A 1  681  ? 106.071 72.797  44.129  1.00 110.72 ? 681  GLU A OE1 1 
ATOM   5265  O  OE2 . GLU A 1  681  ? 107.775 73.700  43.072  1.00 111.32 ? 681  GLU A OE2 1 
ATOM   5266  N  N   . THR A 1  682  ? 105.540 72.747  38.443  1.00 90.65  ? 682  THR A N   1 
ATOM   5267  C  CA  . THR A 1  682  ? 106.228 73.249  37.260  1.00 86.59  ? 682  THR A CA  1 
ATOM   5268  C  C   . THR A 1  682  ? 105.205 73.366  36.139  1.00 87.23  ? 682  THR A C   1 
ATOM   5269  O  O   . THR A 1  682  ? 105.428 74.062  35.153  1.00 88.83  ? 682  THR A O   1 
ATOM   5270  C  CB  . THR A 1  682  ? 107.387 72.328  36.827  1.00 82.83  ? 682  THR A CB  1 
ATOM   5271  O  OG1 . THR A 1  682  ? 108.399 72.346  37.835  1.00 79.24  ? 682  THR A OG1 1 
ATOM   5272  C  CG2 . THR A 1  682  ? 108.006 72.810  35.529  1.00 81.20  ? 682  THR A CG2 1 
ATOM   5273  N  N   . ILE A 1  683  ? 104.074 72.689  36.300  1.00 86.83  ? 683  ILE A N   1 
ATOM   5274  C  CA  . ILE A 1  683  ? 103.011 72.757  35.307  1.00 88.67  ? 683  ILE A CA  1 
ATOM   5275  C  C   . ILE A 1  683  ? 102.135 73.949  35.682  1.00 92.21  ? 683  ILE A C   1 
ATOM   5276  O  O   . ILE A 1  683  ? 101.881 74.836  34.864  1.00 93.24  ? 683  ILE A O   1 
ATOM   5277  C  CB  . ILE A 1  683  ? 102.158 71.479  35.309  1.00 86.29  ? 683  ILE A CB  1 
ATOM   5278  C  CG1 . ILE A 1  683  ? 103.060 70.266  35.110  1.00 85.52  ? 683  ILE A CG1 1 
ATOM   5279  C  CG2 . ILE A 1  683  ? 101.121 71.532  34.192  1.00 84.67  ? 683  ILE A CG2 1 
ATOM   5280  C  CD1 . ILE A 1  683  ? 102.346 68.946  35.262  1.00 87.29  ? 683  ILE A CD1 1 
ATOM   5281  N  N   . ALA A 1  684  ? 101.692 73.970  36.935  1.00 95.69  ? 684  ALA A N   1 
ATOM   5282  C  CA  . ALA A 1  684  ? 100.851 75.053  37.433  1.00 98.93  ? 684  ALA A CA  1 
ATOM   5283  C  C   . ALA A 1  684  ? 101.475 76.413  37.140  1.00 100.57 ? 684  ALA A C   1 
ATOM   5284  O  O   . ALA A 1  684  ? 100.817 77.290  36.577  1.00 102.02 ? 684  ALA A O   1 
ATOM   5285  C  CB  . ALA A 1  684  ? 100.628 74.897  38.932  1.00 98.84  ? 684  ALA A CB  1 
ATOM   5286  N  N   . GLU A 1  685  ? 102.739 76.589  37.519  1.00 101.31 ? 685  GLU A N   1 
ATOM   5287  C  CA  . GLU A 1  685  ? 103.406 77.858  37.279  1.00 102.75 ? 685  GLU A CA  1 
ATOM   5288  C  C   . GLU A 1  685  ? 103.262 78.227  35.804  1.00 101.31 ? 685  GLU A C   1 
ATOM   5289  O  O   . GLU A 1  685  ? 103.080 79.397  35.460  1.00 101.85 ? 685  GLU A O   1 
ATOM   5290  C  CB  . GLU A 1  685  ? 104.892 77.788  37.654  1.00 106.72 ? 685  GLU A CB  1 
ATOM   5291  C  CG  . GLU A 1  685  ? 105.781 77.134  36.601  1.00 114.96 ? 685  GLU A CG  1 
ATOM   5292  C  CD  . GLU A 1  685  ? 107.198 77.705  36.581  1.00 119.04 ? 685  GLU A CD  1 
ATOM   5293  O  OE1 . GLU A 1  685  ? 107.843 77.749  37.655  1.00 120.86 ? 685  GLU A OE1 1 
ATOM   5294  O  OE2 . GLU A 1  685  ? 107.666 78.105  35.486  1.00 120.76 ? 685  GLU A OE2 1 
ATOM   5295  N  N   . ALA A 1  686  ? 103.327 77.226  34.932  1.00 97.93  ? 686  ALA A N   1 
ATOM   5296  C  CA  . ALA A 1  686  ? 103.201 77.477  33.508  1.00 96.22  ? 686  ALA A CA  1 
ATOM   5297  C  C   . ALA A 1  686  ? 101.756 77.757  33.120  1.00 96.04  ? 686  ALA A C   1 
ATOM   5298  O  O   . ALA A 1  686  ? 101.476 78.111  31.979  1.00 97.50  ? 686  ALA A O   1 
ATOM   5299  C  CB  . ALA A 1  686  ? 103.734 76.304  32.723  1.00 95.38  ? 686  ALA A CB  1 
ATOM   5300  N  N   . LYS A 1  687  ? 100.832 77.591  34.058  1.00 95.59  ? 687  LYS A N   1 
ATOM   5301  C  CA  . LYS A 1  687  ? 99.435  77.871  33.762  1.00 96.82  ? 687  LYS A CA  1 
ATOM   5302  C  C   . LYS A 1  687  ? 99.172  79.352  33.979  1.00 97.99  ? 687  LYS A C   1 
ATOM   5303  O  O   . LYS A 1  687  ? 98.493  79.996  33.177  1.00 98.54  ? 687  LYS A O   1 
ATOM   5304  C  CB  . LYS A 1  687  ? 98.512  77.040  34.647  1.00 96.97  ? 687  LYS A CB  1 
ATOM   5305  C  CG  . LYS A 1  687  ? 98.354  75.598  34.189  1.00 98.22  ? 687  LYS A CG  1 
ATOM   5306  C  CD  . LYS A 1  687  ? 97.230  74.912  34.958  1.00 100.00 ? 687  LYS A CD  1 
ATOM   5307  C  CE  . LYS A 1  687  ? 96.974  73.491  34.472  1.00 99.55  ? 687  LYS A CE  1 
ATOM   5308  N  NZ  . LYS A 1  687  ? 95.827  72.856  35.193  1.00 99.81  ? 687  LYS A NZ  1 
ATOM   5309  N  N   . LYS A 1  688  ? 99.712  79.890  35.070  1.00 98.97  ? 688  LYS A N   1 
ATOM   5310  C  CA  . LYS A 1  688  ? 99.558  81.307  35.367  1.00 99.31  ? 688  LYS A CA  1 
ATOM   5311  C  C   . LYS A 1  688  ? 100.308 82.099  34.313  1.00 97.46  ? 688  LYS A C   1 
ATOM   5312  O  O   . LYS A 1  688  ? 99.771  83.055  33.758  1.00 96.97  ? 688  LYS A O   1 
ATOM   5313  C  CB  . LYS A 1  688  ? 100.106 81.639  36.754  1.00 101.70 ? 688  LYS A CB  1 
ATOM   5314  C  CG  . LYS A 1  688  ? 99.214  81.166  37.878  1.00 104.84 ? 688  LYS A CG  1 
ATOM   5315  C  CD  . LYS A 1  688  ? 99.743  81.611  39.227  1.00 107.44 ? 688  LYS A CD  1 
ATOM   5316  C  CE  . LYS A 1  688  ? 98.866  81.078  40.352  1.00 109.58 ? 688  LYS A CE  1 
ATOM   5317  N  NZ  . LYS A 1  688  ? 99.412  81.405  41.702  1.00 110.25 ? 688  LYS A NZ  1 
ATOM   5318  N  N   . LYS A 1  689  ? 101.545 81.696  34.027  1.00 95.01  ? 689  LYS A N   1 
ATOM   5319  C  CA  . LYS A 1  689  ? 102.335 82.386  33.013  1.00 94.30  ? 689  LYS A CA  1 
ATOM   5320  C  C   . LYS A 1  689  ? 101.497 82.443  31.733  1.00 93.37  ? 689  LYS A C   1 
ATOM   5321  O  O   . LYS A 1  689  ? 101.858 83.118  30.769  1.00 94.34  ? 689  LYS A O   1 
ATOM   5322  C  CB  . LYS A 1  689  ? 103.672 81.666  32.759  1.00 94.40  ? 689  LYS A CB  1 
ATOM   5323  C  CG  . LYS A 1  689  ? 104.667 82.490  31.925  1.00 96.19  ? 689  LYS A CG  1 
ATOM   5324  C  CD  . LYS A 1  689  ? 106.048 81.836  31.795  1.00 98.14  ? 689  LYS A CD  1 
ATOM   5325  C  CE  . LYS A 1  689  ? 107.046 82.778  31.100  1.00 99.61  ? 689  LYS A CE  1 
ATOM   5326  N  NZ  . LYS A 1  689  ? 108.382 82.171  30.794  1.00 98.41  ? 689  LYS A NZ  1 
ATOM   5327  N  N   . VAL A 1  690  ? 100.379 81.717  31.737  1.00 91.17  ? 690  VAL A N   1 
ATOM   5328  C  CA  . VAL A 1  690  ? 99.448  81.704  30.615  1.00 89.02  ? 690  VAL A CA  1 
ATOM   5329  C  C   . VAL A 1  690  ? 98.305  82.619  31.015  1.00 89.69  ? 690  VAL A C   1 
ATOM   5330  O  O   . VAL A 1  690  ? 97.984  83.579  30.312  1.00 90.78  ? 690  VAL A O   1 
ATOM   5331  C  CB  . VAL A 1  690  ? 98.879  80.290  30.337  1.00 86.32  ? 690  VAL A CB  1 
ATOM   5332  C  CG1 . VAL A 1  690  ? 97.511  80.392  29.692  1.00 85.05  ? 690  VAL A CG1 1 
ATOM   5333  C  CG2 . VAL A 1  690  ? 99.803  79.538  29.408  1.00 85.41  ? 690  VAL A CG2 1 
ATOM   5334  N  N   . LEU A 1  691  ? 97.704  82.318  32.162  1.00 89.64  ? 691  LEU A N   1 
ATOM   5335  C  CA  . LEU A 1  691  ? 96.594  83.103  32.685  1.00 90.10  ? 691  LEU A CA  1 
ATOM   5336  C  C   . LEU A 1  691  ? 96.918  84.592  32.608  1.00 89.89  ? 691  LEU A C   1 
ATOM   5337  O  O   . LEU A 1  691  ? 96.083  85.401  32.189  1.00 89.10  ? 691  LEU A O   1 
ATOM   5338  C  CB  . LEU A 1  691  ? 96.316  82.704  34.135  1.00 91.05  ? 691  LEU A CB  1 
ATOM   5339  C  CG  . LEU A 1  691  ? 95.127  83.374  34.827  1.00 92.41  ? 691  LEU A CG  1 
ATOM   5340  C  CD1 . LEU A 1  691  ? 93.869  83.210  33.987  1.00 93.69  ? 691  LEU A CD1 1 
ATOM   5341  C  CD2 . LEU A 1  691  ? 94.938  82.758  36.204  1.00 92.80  ? 691  LEU A CD2 1 
ATOM   5342  N  N   . ASP A 1  692  ? 98.136  84.940  33.019  1.00 89.30  ? 692  ASP A N   1 
ATOM   5343  C  CA  . ASP A 1  692  ? 98.609  86.323  32.993  1.00 88.38  ? 692  ASP A CA  1 
ATOM   5344  C  C   . ASP A 1  692  ? 98.406  86.881  31.593  1.00 86.65  ? 692  ASP A C   1 
ATOM   5345  O  O   . ASP A 1  692  ? 97.757  87.912  31.403  1.00 87.88  ? 692  ASP A O   1 
ATOM   5346  C  CB  . ASP A 1  692  ? 100.099 86.385  33.356  1.00 87.58  ? 692  ASP A CB  1 
ATOM   5347  C  CG  . ASP A 1  692  ? 100.350 86.254  34.851  1.00 87.24  ? 692  ASP A CG  1 
ATOM   5348  O  OD1 . ASP A 1  692  ? 99.496  85.685  35.565  1.00 86.40  ? 692  ASP A OD1 1 
ATOM   5349  O  OD2 . ASP A 1  692  ? 101.416 86.713  35.309  1.00 85.74  ? 692  ASP A OD2 1 
ATOM   5350  N  N   . VAL A 1  693  ? 98.968  86.180  30.617  1.00 82.89  ? 693  VAL A N   1 
ATOM   5351  C  CA  . VAL A 1  693  ? 98.860  86.583  29.232  1.00 79.58  ? 693  VAL A CA  1 
ATOM   5352  C  C   . VAL A 1  693  ? 97.420  86.447  28.757  1.00 77.43  ? 693  VAL A C   1 
ATOM   5353  O  O   . VAL A 1  693  ? 97.084  86.881  27.661  1.00 78.08  ? 693  VAL A O   1 
ATOM   5354  C  CB  . VAL A 1  693  ? 99.789  85.735  28.351  1.00 79.44  ? 693  VAL A CB  1 
ATOM   5355  C  CG1 . VAL A 1  693  ? 99.741  86.219  26.917  1.00 80.79  ? 693  VAL A CG1 1 
ATOM   5356  C  CG2 . VAL A 1  693  ? 101.210 85.820  28.883  1.00 80.24  ? 693  VAL A CG2 1 
ATOM   5357  N  N   . THR A 1  694  ? 96.567  85.847  29.585  1.00 75.42  ? 694  THR A N   1 
ATOM   5358  C  CA  . THR A 1  694  ? 95.160  85.694  29.229  1.00 74.17  ? 694  THR A CA  1 
ATOM   5359  C  C   . THR A 1  694  ? 94.431  87.006  29.482  1.00 75.52  ? 694  THR A C   1 
ATOM   5360  O  O   . THR A 1  694  ? 93.858  87.586  28.564  1.00 76.16  ? 694  THR A O   1 
ATOM   5361  C  CB  . THR A 1  694  ? 94.475  84.586  30.040  1.00 72.07  ? 694  THR A CB  1 
ATOM   5362  O  OG1 . THR A 1  694  ? 94.993  83.315  29.635  1.00 72.25  ? 694  THR A OG1 1 
ATOM   5363  C  CG2 . THR A 1  694  ? 92.973  84.610  29.810  1.00 70.32  ? 694  THR A CG2 1 
ATOM   5364  N  N   . LYS A 1  695  ? 94.450  87.481  30.722  1.00 77.05  ? 695  LYS A N   1 
ATOM   5365  C  CA  . LYS A 1  695  ? 93.792  88.745  31.028  1.00 78.80  ? 695  LYS A CA  1 
ATOM   5366  C  C   . LYS A 1  695  ? 94.551  89.895  30.358  1.00 77.59  ? 695  LYS A C   1 
ATOM   5367  O  O   . LYS A 1  695  ? 93.946  90.813  29.805  1.00 76.34  ? 695  LYS A O   1 
ATOM   5368  C  CB  . LYS A 1  695  ? 93.681  88.936  32.552  1.00 80.95  ? 695  LYS A CB  1 
ATOM   5369  C  CG  . LYS A 1  695  ? 92.668  87.958  33.173  1.00 85.46  ? 695  LYS A CG  1 
ATOM   5370  C  CD  . LYS A 1  695  ? 92.189  88.317  34.587  1.00 86.71  ? 695  LYS A CD  1 
ATOM   5371  C  CE  . LYS A 1  695  ? 90.939  87.484  34.962  1.00 86.51  ? 695  LYS A CE  1 
ATOM   5372  N  NZ  . LYS A 1  695  ? 90.366  87.753  36.321  1.00 83.74  ? 695  LYS A NZ  1 
ATOM   5373  N  N   . GLU A 1  696  ? 95.879  89.819  30.377  1.00 76.64  ? 696  GLU A N   1 
ATOM   5374  C  CA  . GLU A 1  696  ? 96.709  90.838  29.753  1.00 76.04  ? 696  GLU A CA  1 
ATOM   5375  C  C   . GLU A 1  696  ? 96.360  90.959  28.269  1.00 74.48  ? 696  GLU A C   1 
ATOM   5376  O  O   . GLU A 1  696  ? 96.977  91.732  27.547  1.00 76.23  ? 696  GLU A O   1 
ATOM   5377  C  CB  . GLU A 1  696  ? 98.194  90.487  29.919  1.00 79.20  ? 696  GLU A CB  1 
ATOM   5378  C  CG  . GLU A 1  696  ? 99.165  91.501  29.302  1.00 87.54  ? 696  GLU A CG  1 
ATOM   5379  C  CD  . GLU A 1  696  ? 100.637 91.105  29.451  1.00 91.60  ? 696  GLU A CD  1 
ATOM   5380  O  OE1 . GLU A 1  696  ? 101.097 90.941  30.605  1.00 94.31  ? 696  GLU A OE1 1 
ATOM   5381  O  OE2 . GLU A 1  696  ? 101.332 90.967  28.414  1.00 93.23  ? 696  GLU A OE2 1 
ATOM   5382  N  N   . ALA A 1  697  ? 95.374  90.192  27.815  1.00 72.82  ? 697  ALA A N   1 
ATOM   5383  C  CA  . ALA A 1  697  ? 94.947  90.236  26.418  1.00 72.72  ? 697  ALA A CA  1 
ATOM   5384  C  C   . ALA A 1  697  ? 93.445  90.434  26.372  1.00 72.56  ? 697  ALA A C   1 
ATOM   5385  O  O   . ALA A 1  697  ? 92.860  90.653  25.302  1.00 71.54  ? 697  ALA A O   1 
ATOM   5386  C  CB  . ALA A 1  697  ? 95.318  88.952  25.708  1.00 73.65  ? 697  ALA A CB  1 
ATOM   5387  N  N   . GLN A 1  698  ? 92.830  90.319  27.548  1.00 71.68  ? 698  GLN A N   1 
ATOM   5388  C  CA  . GLN A 1  698  ? 91.395  90.512  27.702  1.00 72.01  ? 698  GLN A CA  1 
ATOM   5389  C  C   . GLN A 1  698  ? 91.231  91.966  28.130  1.00 71.72  ? 698  GLN A C   1 
ATOM   5390  O  O   . GLN A 1  698  ? 90.116  92.492  28.182  1.00 70.08  ? 698  GLN A O   1 
ATOM   5391  C  CB  . GLN A 1  698  ? 90.821  89.585  28.785  1.00 73.43  ? 698  GLN A CB  1 
ATOM   5392  C  CG  . GLN A 1  698  ? 90.943  88.082  28.505  1.00 75.80  ? 698  GLN A CG  1 
ATOM   5393  C  CD  . GLN A 1  698  ? 90.171  87.210  29.506  1.00 76.78  ? 698  GLN A CD  1 
ATOM   5394  O  OE1 . GLN A 1  698  ? 90.366  87.302  30.723  1.00 76.44  ? 698  GLN A OE1 1 
ATOM   5395  N  NE2 . GLN A 1  698  ? 89.295  86.354  28.987  1.00 77.03  ? 698  GLN A NE2 1 
ATOM   5396  N  N   . ALA A 1  699  ? 92.368  92.597  28.438  1.00 71.57  ? 699  ALA A N   1 
ATOM   5397  C  CA  . ALA A 1  699  ? 92.432  93.998  28.856  1.00 71.25  ? 699  ALA A CA  1 
ATOM   5398  C  C   . ALA A 1  699  ? 93.160  94.815  27.785  1.00 71.60  ? 699  ALA A C   1 
ATOM   5399  O  O   . ALA A 1  699  ? 93.666  95.900  28.041  1.00 71.88  ? 699  ALA A O   1 
ATOM   5400  C  CB  . ALA A 1  699  ? 93.158  94.113  30.188  1.00 67.89  ? 699  ALA A CB  1 
ATOM   5401  N  N   . ASN A 1  700  ? 93.214  94.258  26.583  1.00 73.24  ? 700  ASN A N   1 
ATOM   5402  C  CA  . ASN A 1  700  ? 93.844  94.889  25.437  1.00 74.08  ? 700  ASN A CA  1 
ATOM   5403  C  C   . ASN A 1  700  ? 95.218  95.495  25.729  1.00 73.77  ? 700  ASN A C   1 
ATOM   5404  O  O   . ASN A 1  700  ? 95.480  96.631  25.364  1.00 73.78  ? 700  ASN A O   1 
ATOM   5405  C  CB  . ASN A 1  700  ? 92.890  95.948  24.869  1.00 76.19  ? 700  ASN A CB  1 
ATOM   5406  C  CG  . ASN A 1  700  ? 93.154  96.253  23.404  1.00 79.08  ? 700  ASN A CG  1 
ATOM   5407  O  OD1 . ASN A 1  700  ? 93.263  95.349  22.582  1.00 81.70  ? 700  ASN A OD1 1 
ATOM   5408  N  ND2 . ASN A 1  700  ? 93.243  97.534  23.070  1.00 81.19  ? 700  ASN A ND2 1 
ATOM   5409  N  N   . LEU A 1  701  ? 96.096  94.736  26.381  1.00 74.56  ? 701  LEU A N   1 
ATOM   5410  C  CA  . LEU A 1  701  ? 97.450  95.211  26.690  1.00 76.45  ? 701  LEU A CA  1 
ATOM   5411  C  C   . LEU A 1  701  ? 98.488  94.327  26.019  1.00 78.64  ? 701  LEU A C   1 
ATOM   5412  O  O   . LEU A 1  701  ? 99.609  94.182  26.517  1.00 77.15  ? 701  LEU A O   1 
ATOM   5413  C  CB  . LEU A 1  701  ? 97.725  95.180  28.187  1.00 75.61  ? 701  LEU A CB  1 
ATOM   5414  C  CG  . LEU A 1  701  ? 96.639  95.710  29.099  1.00 77.20  ? 701  LEU A CG  1 
ATOM   5415  C  CD1 . LEU A 1  701  ? 97.216  95.872  30.489  1.00 79.00  ? 701  LEU A CD1 1 
ATOM   5416  C  CD2 . LEU A 1  701  ? 96.135  97.027  28.572  1.00 79.74  ? 701  LEU A CD2 1 
ATOM   5417  N  N   . LEU A 1  702  ? 98.112  93.729  24.895  1.00 81.82  ? 702  LEU A N   1 
ATOM   5418  C  CA  . LEU A 1  702  ? 99.022  92.850  24.185  1.00 85.02  ? 702  LEU A CA  1 
ATOM   5419  C  C   . LEU A 1  702  ? 99.553  93.372  22.872  1.00 86.90  ? 702  LEU A C   1 
ATOM   5420  O  O   . LEU A 1  702  ? 98.806  93.612  21.919  1.00 87.31  ? 702  LEU A O   1 
ATOM   5421  C  CB  . LEU A 1  702  ? 98.381  91.486  23.952  1.00 84.98  ? 702  LEU A CB  1 
ATOM   5422  C  CG  . LEU A 1  702  ? 98.746  90.446  25.007  1.00 85.81  ? 702  LEU A CG  1 
ATOM   5423  C  CD1 . LEU A 1  702  ? 98.377  89.076  24.481  1.00 85.03  ? 702  LEU A CD1 1 
ATOM   5424  C  CD2 . LEU A 1  702  ? 100.247 90.509  25.316  1.00 86.55  ? 702  LEU A CD2 1 
ATOM   5425  N  N   . THR A 1  703  ? 100.869 93.517  22.840  1.00 88.98  ? 703  THR A N   1 
ATOM   5426  C  CA  . THR A 1  703  ? 101.575 93.994  21.669  1.00 91.58  ? 703  THR A CA  1 
ATOM   5427  C  C   . THR A 1  703  ? 101.256 93.078  20.500  1.00 89.96  ? 703  THR A C   1 
ATOM   5428  O  O   . THR A 1  703  ? 101.556 91.888  20.535  1.00 87.92  ? 703  THR A O   1 
ATOM   5429  C  CB  . THR A 1  703  ? 103.095 93.978  21.921  1.00 94.78  ? 703  THR A CB  1 
ATOM   5430  O  OG1 . THR A 1  703  ? 103.357 94.443  23.253  1.00 96.06  ? 703  THR A OG1 1 
ATOM   5431  C  CG2 . THR A 1  703  ? 103.819 94.879  20.916  1.00 97.68  ? 703  THR A CG2 1 
ATOM   5432  N  N   . ALA A 1  704  ? 100.637 93.632  19.467  1.00 90.05  ? 704  ALA A N   1 
ATOM   5433  C  CA  . ALA A 1  704  ? 100.300 92.841  18.304  1.00 91.63  ? 704  ALA A CA  1 
ATOM   5434  C  C   . ALA A 1  704  ? 101.478 91.933  17.947  1.00 92.90  ? 704  ALA A C   1 
ATOM   5435  O  O   . ALA A 1  704  ? 101.306 90.730  17.795  1.00 93.78  ? 704  ALA A O   1 
ATOM   5436  C  CB  . ALA A 1  704  ? 99.946  93.754  17.133  1.00 90.03  ? 704  ALA A CB  1 
ATOM   5437  N  N   . LYS A 1  705  ? 102.677 92.500  17.845  1.00 94.76  ? 705  LYS A N   1 
ATOM   5438  C  CA  . LYS A 1  705  ? 103.868 91.726  17.492  1.00 96.37  ? 705  LYS A CA  1 
ATOM   5439  C  C   . LYS A 1  705  ? 103.896 91.450  15.998  1.00 94.99  ? 705  LYS A C   1 
ATOM   5440  O  O   . LYS A 1  705  ? 102.855 91.310  15.359  1.00 95.13  ? 705  LYS A O   1 
ATOM   5441  C  CB  . LYS A 1  705  ? 103.905 90.391  18.241  1.00 98.79  ? 705  LYS A CB  1 
ATOM   5442  C  CG  . LYS A 1  705  ? 104.090 90.521  19.736  1.00 106.98 ? 705  LYS A CG  1 
ATOM   5443  C  CD  . LYS A 1  705  ? 105.498 90.992  20.134  1.00 112.61 ? 705  LYS A CD  1 
ATOM   5444  C  CE  . LYS A 1  705  ? 105.576 91.117  21.666  1.00 114.78 ? 705  LYS A CE  1 
ATOM   5445  N  NZ  . LYS A 1  705  ? 106.954 91.317  22.205  1.00 114.11 ? 705  LYS A NZ  1 
ATOM   5446  N  N   . HIS A 1  706  ? 105.099 91.374  15.445  1.00 94.67  ? 706  HIS A N   1 
ATOM   5447  C  CA  . HIS A 1  706  ? 105.269 91.111  14.026  1.00 96.21  ? 706  HIS A CA  1 
ATOM   5448  C  C   . HIS A 1  706  ? 104.416 89.893  13.733  1.00 97.89  ? 706  HIS A C   1 
ATOM   5449  O  O   . HIS A 1  706  ? 104.011 89.655  12.597  1.00 96.72  ? 706  HIS A O   1 
ATOM   5450  C  CB  . HIS A 1  706  ? 106.729 90.776  13.734  1.00 97.94  ? 706  HIS A CB  1 
ATOM   5451  C  CG  . HIS A 1  706  ? 107.706 91.496  14.624  1.00 99.71  ? 706  HIS A CG  1 
ATOM   5452  N  ND1 . HIS A 1  706  ? 108.281 92.700  14.274  1.00 100.74 ? 706  HIS A ND1 1 
ATOM   5453  C  CD2 . HIS A 1  706  ? 108.197 91.172  15.839  1.00 99.82  ? 706  HIS A CD2 1 
ATOM   5454  C  CE1 . HIS A 1  706  ? 109.089 93.090  15.247  1.00 100.76 ? 706  HIS A CE1 1 
ATOM   5455  N  NE2 . HIS A 1  706  ? 109.059 92.191  16.208  1.00 100.05 ? 706  HIS A NE2 1 
ATOM   5456  N  N   . GLY A 1  707  ? 104.159 89.137  14.801  1.00 101.64 ? 707  GLY A N   1 
ATOM   5457  C  CA  . GLY A 1  707  ? 103.379 87.907  14.746  1.00 104.63 ? 707  GLY A CA  1 
ATOM   5458  C  C   . GLY A 1  707  ? 102.016 88.004  14.100  1.00 105.34 ? 707  GLY A C   1 
ATOM   5459  O  O   . GLY A 1  707  ? 101.282 87.013  14.057  1.00 105.29 ? 707  GLY A O   1 
ATOM   5460  N  N   . MET A 1  708  ? 101.684 89.203  13.622  1.00 105.25 ? 708  MET A N   1 
ATOM   5461  C  CA  . MET A 1  708  ? 100.427 89.477  12.941  1.00 105.00 ? 708  MET A CA  1 
ATOM   5462  C  C   . MET A 1  708  ? 99.229  89.072  13.806  1.00 103.55 ? 708  MET A C   1 
ATOM   5463  O  O   . MET A 1  708  ? 99.332  88.169  14.625  1.00 103.53 ? 708  MET A O   1 
ATOM   5464  C  CB  . MET A 1  708  ? 100.441 88.730  11.604  1.00 107.90 ? 708  MET A CB  1 
ATOM   5465  C  CG  . MET A 1  708  ? 101.864 88.597  11.040  1.00 111.97 ? 708  MET A CG  1 
ATOM   5466  S  SD  . MET A 1  708  ? 102.062 87.615  9.543   1.00 117.06 ? 708  MET A SD  1 
ATOM   5467  C  CE  . MET A 1  708  ? 101.300 86.117  10.039  1.00 117.70 ? 708  MET A CE  1 
ATOM   5468  N  N   . THR A 1  709  ? 98.098  89.749  13.633  1.00 101.53 ? 709  THR A N   1 
ATOM   5469  C  CA  . THR A 1  709  ? 96.895  89.445  14.410  1.00 99.86  ? 709  THR A CA  1 
ATOM   5470  C  C   . THR A 1  709  ? 97.175  89.358  15.902  1.00 97.98  ? 709  THR A C   1 
ATOM   5471  O  O   . THR A 1  709  ? 98.085  88.667  16.334  1.00 93.21  ? 709  THR A O   1 
ATOM   5472  C  CB  . THR A 1  709  ? 96.253  88.109  13.976  1.00 101.11 ? 709  THR A CB  1 
ATOM   5473  O  OG1 . THR A 1  709  ? 95.776  88.218  12.628  1.00 103.79 ? 709  THR A OG1 1 
ATOM   5474  C  CG2 . THR A 1  709  ? 95.087  87.753  14.893  1.00 99.84  ? 709  THR A CG2 1 
ATOM   5475  N  N   . LEU A 1  710  ? 96.376  90.057  16.695  1.00 99.35  ? 710  LEU A N   1 
ATOM   5476  C  CA  . LEU A 1  710  ? 96.565  90.029  18.137  1.00 98.59  ? 710  LEU A CA  1 
ATOM   5477  C  C   . LEU A 1  710  ? 96.300  88.614  18.615  1.00 96.79  ? 710  LEU A C   1 
ATOM   5478  O  O   . LEU A 1  710  ? 97.122  88.014  19.301  1.00 96.48  ? 710  LEU A O   1 
ATOM   5479  C  CB  . LEU A 1  710  ? 95.609  91.000  18.844  1.00 100.43 ? 710  LEU A CB  1 
ATOM   5480  C  CG  . LEU A 1  710  ? 95.729  92.506  18.585  1.00 103.26 ? 710  LEU A CG  1 
ATOM   5481  C  CD1 . LEU A 1  710  ? 95.040  92.889  17.268  1.00 106.15 ? 710  LEU A CD1 1 
ATOM   5482  C  CD2 . LEU A 1  710  ? 95.089  93.244  19.746  1.00 103.34 ? 710  LEU A CD2 1 
ATOM   5483  N  N   . ARG A 1  711  ? 95.144  88.082  18.241  1.00 95.50  ? 711  ARG A N   1 
ATOM   5484  C  CA  . ARG A 1  711  ? 94.784  86.734  18.630  1.00 94.00  ? 711  ARG A CA  1 
ATOM   5485  C  C   . ARG A 1  711  ? 95.889  85.767  18.227  1.00 94.14  ? 711  ARG A C   1 
ATOM   5486  O  O   . ARG A 1  711  ? 96.419  85.050  19.075  1.00 91.06  ? 711  ARG A O   1 
ATOM   5487  C  CB  . ARG A 1  711  ? 93.451  86.356  17.988  1.00 95.23  ? 711  ARG A CB  1 
ATOM   5488  C  CG  . ARG A 1  711  ? 92.261  86.619  18.893  1.00 94.30  ? 711  ARG A CG  1 
ATOM   5489  C  CD  . ARG A 1  711  ? 90.969  86.746  18.116  1.00 96.65  ? 711  ARG A CD  1 
ATOM   5490  N  NE  . ARG A 1  711  ? 89.803  86.635  18.987  1.00 97.17  ? 711  ARG A NE  1 
ATOM   5491  C  CZ  . ARG A 1  711  ? 88.545  86.773  18.576  1.00 99.54  ? 711  ARG A CZ  1 
ATOM   5492  N  NH1 . ARG A 1  711  ? 88.271  87.039  17.300  1.00 100.44 ? 711  ARG A NH1 1 
ATOM   5493  N  NH2 . ARG A 1  711  ? 87.553  86.614  19.442  1.00 100.44 ? 711  ARG A NH2 1 
ATOM   5494  N  N   . GLU A 1  712  ? 96.251  85.759  16.943  1.00 95.13  ? 712  GLU A N   1 
ATOM   5495  C  CA  . GLU A 1  712  ? 97.313  84.876  16.464  1.00 94.16  ? 712  GLU A CA  1 
ATOM   5496  C  C   . GLU A 1  712  ? 98.540  85.040  17.346  1.00 92.91  ? 712  GLU A C   1 
ATOM   5497  O  O   . GLU A 1  712  ? 99.226  84.074  17.675  1.00 94.70  ? 712  GLU A O   1 
ATOM   5498  C  CB  . GLU A 1  712  ? 97.706  85.204  15.019  1.00 92.84  ? 712  GLU A CB  1 
ATOM   5499  C  CG  . GLU A 1  712  ? 96.737  84.709  13.975  1.00 91.87  ? 712  GLU A CG  1 
ATOM   5500  C  CD  . GLU A 1  712  ? 97.385  84.545  12.614  1.00 91.76  ? 712  GLU A CD  1 
ATOM   5501  O  OE1 . GLU A 1  712  ? 97.824  85.550  12.024  1.00 90.76  ? 712  GLU A OE1 1 
ATOM   5502  O  OE2 . GLU A 1  712  ? 97.459  83.399  12.130  1.00 92.71  ? 712  GLU A OE2 1 
ATOM   5503  N  N   . SER A 1  713  ? 98.806  86.277  17.733  1.00 89.57  ? 713  SER A N   1 
ATOM   5504  C  CA  . SER A 1  713  ? 99.956  86.574  18.562  1.00 84.68  ? 713  SER A CA  1 
ATOM   5505  C  C   . SER A 1  713  ? 99.747  86.117  19.996  1.00 78.96  ? 713  SER A C   1 
ATOM   5506  O  O   . SER A 1  713  ? 100.700 85.988  20.753  1.00 73.17  ? 713  SER A O   1 
ATOM   5507  C  CB  . SER A 1  713  ? 100.236 88.074  18.519  1.00 88.56  ? 713  SER A CB  1 
ATOM   5508  O  OG  . SER A 1  713  ? 100.307 88.534  17.177  1.00 91.87  ? 713  SER A OG  1 
ATOM   5509  N  N   . PHE A 1  714  ? 98.497  85.875  20.369  1.00 76.72  ? 714  PHE A N   1 
ATOM   5510  C  CA  . PHE A 1  714  ? 98.192  85.427  21.724  1.00 76.30  ? 714  PHE A CA  1 
ATOM   5511  C  C   . PHE A 1  714  ? 98.633  83.994  21.882  1.00 78.68  ? 714  PHE A C   1 
ATOM   5512  O  O   . PHE A 1  714  ? 99.447  83.675  22.747  1.00 78.45  ? 714  PHE A O   1 
ATOM   5513  C  CB  . PHE A 1  714  ? 96.689  85.524  22.004  1.00 71.78  ? 714  PHE A CB  1 
ATOM   5514  C  CG  . PHE A 1  714  ? 96.258  84.875  23.304  1.00 64.71  ? 714  PHE A CG  1 
ATOM   5515  C  CD1 . PHE A 1  714  ? 97.133  84.750  24.375  1.00 60.56  ? 714  PHE A CD1 1 
ATOM   5516  C  CD2 . PHE A 1  714  ? 94.949  84.441  23.470  1.00 62.82  ? 714  PHE A CD2 1 
ATOM   5517  C  CE1 . PHE A 1  714  ? 96.701  84.206  25.586  1.00 56.58  ? 714  PHE A CE1 1 
ATOM   5518  C  CE2 . PHE A 1  714  ? 94.513  83.899  24.674  1.00 57.00  ? 714  PHE A CE2 1 
ATOM   5519  C  CZ  . PHE A 1  714  ? 95.389  83.782  25.733  1.00 54.84  ? 714  PHE A CZ  1 
ATOM   5520  N  N   . GLU A 1  715  ? 98.068  83.137  21.036  1.00 81.80  ? 715  GLU A N   1 
ATOM   5521  C  CA  . GLU A 1  715  ? 98.356  81.707  21.018  1.00 81.76  ? 715  GLU A CA  1 
ATOM   5522  C  C   . GLU A 1  715  ? 99.849  81.453  21.058  1.00 80.31  ? 715  GLU A C   1 
ATOM   5523  O  O   . GLU A 1  715  ? 100.368 80.902  22.023  1.00 77.52  ? 715  GLU A O   1 
ATOM   5524  C  CB  . GLU A 1  715  ? 97.794  81.083  19.740  1.00 84.82  ? 715  GLU A CB  1 
ATOM   5525  C  CG  . GLU A 1  715  ? 96.307  81.271  19.565  1.00 88.36  ? 715  GLU A CG  1 
ATOM   5526  C  CD  . GLU A 1  715  ? 95.509  80.281  20.377  1.00 89.33  ? 715  GLU A CD  1 
ATOM   5527  O  OE1 . GLU A 1  715  ? 95.328  79.142  19.898  1.00 91.77  ? 715  GLU A OE1 1 
ATOM   5528  O  OE2 . GLU A 1  715  ? 95.074  80.636  21.494  1.00 87.99  ? 715  GLU A OE2 1 
ATOM   5529  N  N   . ASP A 1  716  ? 100.529 81.870  19.994  1.00 80.77  ? 716  ASP A N   1 
ATOM   5530  C  CA  . ASP A 1  716  ? 101.963 81.674  19.868  1.00 81.28  ? 716  ASP A CA  1 
ATOM   5531  C  C   . ASP A 1  716  ? 102.704 81.888  21.169  1.00 79.78  ? 716  ASP A C   1 
ATOM   5532  O  O   . ASP A 1  716  ? 103.838 81.450  21.315  1.00 79.80  ? 716  ASP A O   1 
ATOM   5533  C  CB  . ASP A 1  716  ? 102.543 82.595  18.800  1.00 85.06  ? 716  ASP A CB  1 
ATOM   5534  C  CG  . ASP A 1  716  ? 104.009 82.309  18.528  1.00 87.95  ? 716  ASP A CG  1 
ATOM   5535  O  OD1 . ASP A 1  716  ? 104.846 82.500  19.441  1.00 85.31  ? 716  ASP A OD1 1 
ATOM   5536  O  OD2 . ASP A 1  716  ? 104.322 81.883  17.395  1.00 92.83  ? 716  ASP A OD2 1 
ATOM   5537  N  N   . ASN A 1  717  ? 102.075 82.575  22.112  1.00 79.18  ? 717  ASN A N   1 
ATOM   5538  C  CA  . ASN A 1  717  ? 102.702 82.806  23.401  1.00 78.66  ? 717  ASN A CA  1 
ATOM   5539  C  C   . ASN A 1  717  ? 102.274 81.706  24.356  1.00 74.99  ? 717  ASN A C   1 
ATOM   5540  O  O   . ASN A 1  717  ? 103.104 81.143  25.042  1.00 74.82  ? 717  ASN A O   1 
ATOM   5541  C  CB  . ASN A 1  717  ? 102.316 84.185  23.971  1.00 83.20  ? 717  ASN A CB  1 
ATOM   5542  C  CG  . ASN A 1  717  ? 103.320 85.289  23.602  1.00 87.22  ? 717  ASN A CG  1 
ATOM   5543  O  OD1 . ASN A 1  717  ? 104.441 85.336  24.128  1.00 88.86  ? 717  ASN A OD1 1 
ATOM   5544  N  ND2 . ASN A 1  717  ? 102.915 86.180  22.695  1.00 89.20  ? 717  ASN A ND2 1 
ATOM   5545  N  N   . VAL A 1  718  ? 100.983 81.386  24.377  1.00 73.01  ? 718  VAL A N   1 
ATOM   5546  C  CA  . VAL A 1  718  ? 100.444 80.347  25.265  1.00 71.65  ? 718  VAL A CA  1 
ATOM   5547  C  C   . VAL A 1  718  ? 101.064 78.983  24.988  1.00 70.63  ? 718  VAL A C   1 
ATOM   5548  O  O   . VAL A 1  718  ? 101.624 78.344  25.879  1.00 68.07  ? 718  VAL A O   1 
ATOM   5549  C  CB  . VAL A 1  718  ? 98.934  80.182  25.087  1.00 72.74  ? 718  VAL A CB  1 
ATOM   5550  C  CG1 . VAL A 1  718  ? 98.318  79.717  26.392  1.00 71.01  ? 718  VAL A CG1 1 
ATOM   5551  C  CG2 . VAL A 1  718  ? 98.319  81.475  24.591  1.00 75.06  ? 718  VAL A CG2 1 
ATOM   5552  N  N   . VAL A 1  719  ? 100.909 78.530  23.747  1.00 70.03  ? 719  VAL A N   1 
ATOM   5553  C  CA  . VAL A 1  719  ? 101.470 77.267  23.287  1.00 65.04  ? 719  VAL A CA  1 
ATOM   5554  C  C   . VAL A 1  719  ? 102.914 77.262  23.788  1.00 64.78  ? 719  VAL A C   1 
ATOM   5555  O  O   . VAL A 1  719  ? 103.255 76.565  24.742  1.00 60.38  ? 719  VAL A O   1 
ATOM   5556  C  CB  . VAL A 1  719  ? 101.428 77.208  21.729  1.00 62.76  ? 719  VAL A CB  1 
ATOM   5557  C  CG1 . VAL A 1  719  ? 102.244 76.054  21.208  1.00 63.92  ? 719  VAL A CG1 1 
ATOM   5558  C  CG2 . VAL A 1  719  ? 99.997  77.080  21.260  1.00 59.75  ? 719  VAL A CG2 1 
ATOM   5559  N  N   . ARG A 1  720  ? 103.738 78.088  23.155  1.00 67.10  ? 720  ARG A N   1 
ATOM   5560  C  CA  . ARG A 1  720  ? 105.152 78.238  23.492  1.00 69.22  ? 720  ARG A CA  1 
ATOM   5561  C  C   . ARG A 1  720  ? 105.412 78.187  24.996  1.00 66.86  ? 720  ARG A C   1 
ATOM   5562  O  O   . ARG A 1  720  ? 106.526 77.915  25.427  1.00 64.63  ? 720  ARG A O   1 
ATOM   5563  C  CB  . ARG A 1  720  ? 105.675 79.575  22.937  1.00 73.22  ? 720  ARG A CB  1 
ATOM   5564  C  CG  . ARG A 1  720  ? 107.122 79.555  22.448  1.00 77.10  ? 720  ARG A CG  1 
ATOM   5565  C  CD  . ARG A 1  720  ? 107.676 80.954  22.168  1.00 78.60  ? 720  ARG A CD  1 
ATOM   5566  N  NE  . ARG A 1  720  ? 107.995 81.671  23.401  1.00 84.14  ? 720  ARG A NE  1 
ATOM   5567  C  CZ  . ARG A 1  720  ? 107.330 82.735  23.846  1.00 88.43  ? 720  ARG A CZ  1 
ATOM   5568  N  NH1 . ARG A 1  720  ? 106.302 83.212  23.156  1.00 91.34  ? 720  ARG A NH1 1 
ATOM   5569  N  NH2 . ARG A 1  720  ? 107.693 83.329  24.980  1.00 90.85  ? 720  ARG A NH2 1 
ATOM   5570  N  N   . PHE A 1  721  ? 104.387 78.461  25.794  1.00 68.29  ? 721  PHE A N   1 
ATOM   5571  C  CA  . PHE A 1  721  ? 104.532 78.458  27.248  1.00 70.45  ? 721  PHE A CA  1 
ATOM   5572  C  C   . PHE A 1  721  ? 104.311 77.077  27.841  1.00 68.51  ? 721  PHE A C   1 
ATOM   5573  O  O   . PHE A 1  721  ? 105.017 76.676  28.762  1.00 66.86  ? 721  PHE A O   1 
ATOM   5574  C  CB  . PHE A 1  721  ? 103.556 79.465  27.899  1.00 75.03  ? 721  PHE A CB  1 
ATOM   5575  C  CG  . PHE A 1  721  ? 104.053 80.903  27.899  1.00 77.67  ? 721  PHE A CG  1 
ATOM   5576  C  CD1 . PHE A 1  721  ? 103.195 81.956  27.568  1.00 78.38  ? 721  PHE A CD1 1 
ATOM   5577  C  CD2 . PHE A 1  721  ? 105.384 81.198  28.203  1.00 78.11  ? 721  PHE A CD2 1 
ATOM   5578  C  CE1 . PHE A 1  721  ? 103.659 83.272  27.530  1.00 79.92  ? 721  PHE A CE1 1 
ATOM   5579  C  CE2 . PHE A 1  721  ? 105.854 82.511  28.168  1.00 79.56  ? 721  PHE A CE2 1 
ATOM   5580  C  CZ  . PHE A 1  721  ? 104.990 83.549  27.831  1.00 80.37  ? 721  PHE A CZ  1 
ATOM   5581  N  N   . LEU A 1  722  ? 103.331 76.354  27.309  1.00 67.66  ? 722  LEU A N   1 
ATOM   5582  C  CA  . LEU A 1  722  ? 103.019 75.017  27.797  1.00 67.55  ? 722  LEU A CA  1 
ATOM   5583  C  C   . LEU A 1  722  ? 104.021 74.001  27.280  1.00 69.02  ? 722  LEU A C   1 
ATOM   5584  O  O   . LEU A 1  722  ? 104.491 73.157  28.039  1.00 68.15  ? 722  LEU A O   1 
ATOM   5585  C  CB  . LEU A 1  722  ? 101.614 74.621  27.371  1.00 66.23  ? 722  LEU A CB  1 
ATOM   5586  C  CG  . LEU A 1  722  ? 100.531 75.555  27.904  1.00 66.09  ? 722  LEU A CG  1 
ATOM   5587  C  CD1 . LEU A 1  722  ? 99.636  76.005  26.760  1.00 67.25  ? 722  LEU A CD1 1 
ATOM   5588  C  CD2 . LEU A 1  722  ? 99.737  74.853  28.991  1.00 63.10  ? 722  LEU A CD2 1 
ATOM   5589  N  N   . ASN A 1  723  ? 104.340 74.064  25.990  1.00 71.84  ? 723  ASN A N   1 
ATOM   5590  C  CA  . ASN A 1  723  ? 105.321 73.140  25.439  1.00 74.10  ? 723  ASN A CA  1 
ATOM   5591  C  C   . ASN A 1  723  ? 106.551 73.301  26.309  1.00 75.89  ? 723  ASN A C   1 
ATOM   5592  O  O   . ASN A 1  723  ? 107.026 72.351  26.919  1.00 77.54  ? 723  ASN A O   1 
ATOM   5593  C  CB  . ASN A 1  723  ? 105.699 73.495  23.998  1.00 73.39  ? 723  ASN A CB  1 
ATOM   5594  C  CG  . ASN A 1  723  ? 104.627 73.131  23.004  1.00 72.63  ? 723  ASN A CG  1 
ATOM   5595  O  OD1 . ASN A 1  723  ? 103.942 72.124  23.163  1.00 73.66  ? 723  ASN A OD1 1 
ATOM   5596  N  ND2 . ASN A 1  723  ? 104.488 73.938  21.955  1.00 69.84  ? 723  ASN A ND2 1 
ATOM   5597  N  N   . GLU A 1  724  ? 107.053 74.526  26.366  1.00 78.29  ? 724  GLU A N   1 
ATOM   5598  C  CA  . GLU A 1  724  ? 108.229 74.848  27.157  1.00 80.74  ? 724  GLU A CA  1 
ATOM   5599  C  C   . GLU A 1  724  ? 108.178 74.120  28.500  1.00 79.23  ? 724  GLU A C   1 
ATOM   5600  O  O   . GLU A 1  724  ? 109.208 73.716  29.035  1.00 78.85  ? 724  GLU A O   1 
ATOM   5601  C  CB  . GLU A 1  724  ? 108.283 76.361  27.378  1.00 85.57  ? 724  GLU A CB  1 
ATOM   5602  C  CG  . GLU A 1  724  ? 109.680 76.966  27.348  1.00 92.34  ? 724  GLU A CG  1 
ATOM   5603  C  CD  . GLU A 1  724  ? 109.645 78.474  27.162  1.00 95.31  ? 724  GLU A CD  1 
ATOM   5604  O  OE1 . GLU A 1  724  ? 109.141 79.176  28.071  1.00 97.08  ? 724  GLU A OE1 1 
ATOM   5605  O  OE2 . GLU A 1  724  ? 110.112 78.951  26.101  1.00 97.12  ? 724  GLU A OE2 1 
ATOM   5606  N  N   . ALA A 1  725  ? 106.967 73.945  29.023  1.00 78.36  ? 725  ALA A N   1 
ATOM   5607  C  CA  . ALA A 1  725  ? 106.744 73.279  30.305  1.00 76.02  ? 725  ALA A CA  1 
ATOM   5608  C  C   . ALA A 1  725  ? 106.874 71.770  30.235  1.00 75.59  ? 725  ALA A C   1 
ATOM   5609  O  O   . ALA A 1  725  ? 107.475 71.167  31.110  1.00 73.92  ? 725  ALA A O   1 
ATOM   5610  C  CB  . ALA A 1  725  ? 105.377 73.639  30.841  1.00 75.95  ? 725  ALA A CB  1 
ATOM   5611  N  N   . ARG A 1  726  ? 106.287 71.157  29.211  1.00 77.80  ? 726  ARG A N   1 
ATOM   5612  C  CA  . ARG A 1  726  ? 106.364 69.703  29.049  1.00 79.34  ? 726  ARG A CA  1 
ATOM   5613  C  C   . ARG A 1  726  ? 107.813 69.287  28.922  1.00 77.78  ? 726  ARG A C   1 
ATOM   5614  O  O   . ARG A 1  726  ? 108.385 68.684  29.825  1.00 76.80  ? 726  ARG A O   1 
ATOM   5615  C  CB  . ARG A 1  726  ? 105.633 69.239  27.784  1.00 82.76  ? 726  ARG A CB  1 
ATOM   5616  C  CG  . ARG A 1  726  ? 105.835 67.752  27.498  1.00 84.45  ? 726  ARG A CG  1 
ATOM   5617  C  CD  . ARG A 1  726  ? 105.333 67.342  26.125  1.00 87.03  ? 726  ARG A CD  1 
ATOM   5618  N  NE  . ARG A 1  726  ? 106.200 67.796  25.045  1.00 89.81  ? 726  ARG A NE  1 
ATOM   5619  C  CZ  . ARG A 1  726  ? 105.988 67.523  23.762  1.00 93.02  ? 726  ARG A CZ  1 
ATOM   5620  N  NH1 . ARG A 1  726  ? 104.939 66.795  23.400  1.00 93.89  ? 726  ARG A NH1 1 
ATOM   5621  N  NH2 . ARG A 1  726  ? 106.818 67.984  22.837  1.00 96.01  ? 726  ARG A NH2 1 
ATOM   5622  N  N   . ASP A 1  727  ? 108.383 69.602  27.767  1.00 78.25  ? 727  ASP A N   1 
ATOM   5623  C  CA  . ASP A 1  727  ? 109.765 69.290  27.478  1.00 78.62  ? 727  ASP A CA  1 
ATOM   5624  C  C   . ASP A 1  727  ? 110.541 69.384  28.781  1.00 77.05  ? 727  ASP A C   1 
ATOM   5625  O  O   . ASP A 1  727  ? 111.207 68.439  29.185  1.00 74.08  ? 727  ASP A O   1 
ATOM   5626  C  CB  . ASP A 1  727  ? 110.338 70.289  26.458  1.00 83.48  ? 727  ASP A CB  1 
ATOM   5627  C  CG  . ASP A 1  727  ? 109.764 70.112  25.044  1.00 85.38  ? 727  ASP A CG  1 
ATOM   5628  O  OD1 . ASP A 1  727  ? 108.536 70.241  24.847  1.00 87.09  ? 727  ASP A OD1 1 
ATOM   5629  O  OD2 . ASP A 1  727  ? 110.558 69.856  24.117  1.00 86.11  ? 727  ASP A OD2 1 
ATOM   5630  N  N   . LYS A 1  728  ? 110.414 70.522  29.455  1.00 78.65  ? 728  LYS A N   1 
ATOM   5631  C  CA  . LYS A 1  728  ? 111.124 70.761  30.709  1.00 81.20  ? 728  LYS A CA  1 
ATOM   5632  C  C   . LYS A 1  728  ? 110.572 70.019  31.923  1.00 78.27  ? 728  LYS A C   1 
ATOM   5633  O  O   . LYS A 1  728  ? 111.315 69.691  32.848  1.00 76.34  ? 728  LYS A O   1 
ATOM   5634  C  CB  . LYS A 1  728  ? 111.187 72.271  30.993  1.00 87.08  ? 728  LYS A CB  1 
ATOM   5635  C  CG  . LYS A 1  728  ? 110.439 72.753  32.239  1.00 93.97  ? 728  LYS A CG  1 
ATOM   5636  C  CD  . LYS A 1  728  ? 110.823 74.206  32.568  1.00 99.79  ? 728  LYS A CD  1 
ATOM   5637  C  CE  . LYS A 1  728  ? 110.236 74.697  33.899  1.00 101.63 ? 728  LYS A CE  1 
ATOM   5638  N  NZ  . LYS A 1  728  ? 110.712 76.075  34.259  1.00 101.33 ? 728  LYS A NZ  1 
ATOM   5639  N  N   . ALA A 1  729  ? 109.270 69.767  31.934  1.00 75.96  ? 729  ALA A N   1 
ATOM   5640  C  CA  . ALA A 1  729  ? 108.671 69.048  33.048  1.00 72.08  ? 729  ALA A CA  1 
ATOM   5641  C  C   . ALA A 1  729  ? 109.331 67.690  33.031  1.00 70.80  ? 729  ALA A C   1 
ATOM   5642  O  O   . ALA A 1  729  ? 109.586 67.088  34.069  1.00 67.11  ? 729  ALA A O   1 
ATOM   5643  C  CB  . ALA A 1  729  ? 107.174 68.902  32.842  1.00 71.86  ? 729  ALA A CB  1 
ATOM   5644  N  N   . GLY A 1  730  ? 109.615 67.228  31.820  1.00 72.95  ? 730  GLY A N   1 
ATOM   5645  C  CA  . GLY A 1  730  ? 110.242 65.937  31.639  1.00 76.18  ? 730  GLY A CA  1 
ATOM   5646  C  C   . GLY A 1  730  ? 111.718 65.975  31.949  1.00 78.79  ? 730  GLY A C   1 
ATOM   5647  O  O   . GLY A 1  730  ? 112.231 65.081  32.620  1.00 76.06  ? 730  GLY A O   1 
ATOM   5648  N  N   . ARG A 1  731  ? 112.402 67.012  31.468  1.00 84.53  ? 731  ARG A N   1 
ATOM   5649  C  CA  . ARG A 1  731  ? 113.840 67.152  31.702  1.00 89.26  ? 731  ARG A CA  1 
ATOM   5650  C  C   . ARG A 1  731  ? 114.140 66.893  33.167  1.00 88.24  ? 731  ARG A C   1 
ATOM   5651  O  O   . ARG A 1  731  ? 115.299 66.750  33.558  1.00 87.20  ? 731  ARG A O   1 
ATOM   5652  C  CB  . ARG A 1  731  ? 114.340 68.560  31.346  1.00 93.97  ? 731  ARG A CB  1 
ATOM   5653  C  CG  . ARG A 1  731  ? 114.190 68.996  29.885  1.00 99.38  ? 731  ARG A CG  1 
ATOM   5654  C  CD  . ARG A 1  731  ? 114.856 70.369  29.695  1.00 101.86 ? 731  ARG A CD  1 
ATOM   5655  N  NE  . ARG A 1  731  ? 114.218 71.191  28.667  1.00 103.41 ? 731  ARG A NE  1 
ATOM   5656  C  CZ  . ARG A 1  731  ? 114.404 72.505  28.542  1.00 104.02 ? 731  ARG A CZ  1 
ATOM   5657  N  NH1 . ARG A 1  731  ? 115.213 73.148  29.378  1.00 102.25 ? 731  ARG A NH1 1 
ATOM   5658  N  NH2 . ARG A 1  731  ? 113.767 73.181  27.594  1.00 104.92 ? 731  ARG A NH2 1 
ATOM   5659  N  N   . LEU A 1  732  ? 113.081 66.853  33.970  1.00 87.77  ? 732  LEU A N   1 
ATOM   5660  C  CA  . LEU A 1  732  ? 113.195 66.608  35.397  1.00 87.81  ? 732  LEU A CA  1 
ATOM   5661  C  C   . LEU A 1  732  ? 113.215 65.113  35.647  1.00 85.94  ? 732  LEU A C   1 
ATOM   5662  O  O   . LEU A 1  732  ? 114.123 64.587  36.291  1.00 86.85  ? 732  LEU A O   1 
ATOM   5663  C  CB  . LEU A 1  732  ? 112.014 67.240  36.131  1.00 89.29  ? 732  LEU A CB  1 
ATOM   5664  C  CG  . LEU A 1  732  ? 111.833 68.736  35.875  1.00 91.01  ? 732  LEU A CG  1 
ATOM   5665  C  CD1 . LEU A 1  732  ? 110.655 69.232  36.690  1.00 91.85  ? 732  LEU A CD1 1 
ATOM   5666  C  CD2 . LEU A 1  732  ? 113.103 69.498  36.245  1.00 90.61  ? 732  LEU A CD2 1 
ATOM   5667  N  N   . ALA A 1  733  ? 112.207 64.425  35.134  1.00 83.07  ? 733  ALA A N   1 
ATOM   5668  C  CA  . ALA A 1  733  ? 112.145 62.992  35.304  1.00 81.48  ? 733  ALA A CA  1 
ATOM   5669  C  C   . ALA A 1  733  ? 113.352 62.343  34.630  1.00 81.85  ? 733  ALA A C   1 
ATOM   5670  O  O   . ALA A 1  733  ? 114.023 61.515  35.238  1.00 81.05  ? 733  ALA A O   1 
ATOM   5671  C  CB  . ALA A 1  733  ? 110.869 62.462  34.715  1.00 82.75  ? 733  ALA A CB  1 
ATOM   5672  N  N   . GLU A 1  734  ? 113.633 62.731  33.387  1.00 82.52  ? 734  GLU A N   1 
ATOM   5673  C  CA  . GLU A 1  734  ? 114.761 62.177  32.631  1.00 84.85  ? 734  GLU A CA  1 
ATOM   5674  C  C   . GLU A 1  734  ? 116.050 62.139  33.439  1.00 86.76  ? 734  GLU A C   1 
ATOM   5675  O  O   . GLU A 1  734  ? 116.848 61.215  33.310  1.00 87.29  ? 734  GLU A O   1 
ATOM   5676  C  CB  . GLU A 1  734  ? 114.989 62.982  31.344  1.00 86.05  ? 734  GLU A CB  1 
ATOM   5677  C  CG  . GLU A 1  734  ? 116.442 63.438  31.099  1.00 89.99  ? 734  GLU A CG  1 
ATOM   5678  C  CD  . GLU A 1  734  ? 117.206 62.582  30.090  1.00 91.22  ? 734  GLU A CD  1 
ATOM   5679  O  OE1 . GLU A 1  734  ? 116.818 62.563  28.900  1.00 93.17  ? 734  GLU A OE1 1 
ATOM   5680  O  OE2 . GLU A 1  734  ? 118.202 61.934  30.484  1.00 90.49  ? 734  GLU A OE2 1 
ATOM   5681  N  N   . VAL A 1  735  ? 116.257 63.143  34.279  1.00 89.56  ? 735  VAL A N   1 
ATOM   5682  C  CA  . VAL A 1  735  ? 117.475 63.185  35.074  1.00 90.98  ? 735  VAL A CA  1 
ATOM   5683  C  C   . VAL A 1  735  ? 117.327 62.507  36.428  1.00 88.98  ? 735  VAL A C   1 
ATOM   5684  O  O   . VAL A 1  735  ? 118.317 62.217  37.100  1.00 88.41  ? 735  VAL A O   1 
ATOM   5685  C  CB  . VAL A 1  735  ? 117.941 64.630  35.299  1.00 93.07  ? 735  VAL A CB  1 
ATOM   5686  C  CG1 . VAL A 1  735  ? 119.309 64.625  35.975  1.00 95.33  ? 735  VAL A CG1 1 
ATOM   5687  C  CG2 . VAL A 1  735  ? 117.999 65.374  33.964  1.00 93.88  ? 735  VAL A CG2 1 
ATOM   5688  N  N   . ASN A 1  736  ? 116.089 62.245  36.824  1.00 87.59  ? 736  ASN A N   1 
ATOM   5689  C  CA  . ASN A 1  736  ? 115.840 61.599  38.102  1.00 87.11  ? 736  ASN A CA  1 
ATOM   5690  C  C   . ASN A 1  736  ? 115.757 60.076  37.965  1.00 86.67  ? 736  ASN A C   1 
ATOM   5691  O  O   . ASN A 1  736  ? 115.734 59.354  38.964  1.00 86.03  ? 736  ASN A O   1 
ATOM   5692  C  CB  . ASN A 1  736  ? 114.556 62.157  38.720  1.00 87.05  ? 736  ASN A CB  1 
ATOM   5693  C  CG  . ASN A 1  736  ? 114.277 61.588  40.096  1.00 87.08  ? 736  ASN A CG  1 
ATOM   5694  O  OD1 . ASN A 1  736  ? 113.906 60.421  40.237  1.00 85.32  ? 736  ASN A OD1 1 
ATOM   5695  N  ND2 . ASN A 1  736  ? 114.464 62.410  41.124  1.00 87.65  ? 736  ASN A ND2 1 
ATOM   5696  N  N   . LEU A 1  737  ? 115.715 59.592  36.727  1.00 86.13  ? 737  LEU A N   1 
ATOM   5697  C  CA  . LEU A 1  737  ? 115.660 58.158  36.470  1.00 85.30  ? 737  LEU A CA  1 
ATOM   5698  C  C   . LEU A 1  737  ? 117.062 57.585  36.463  1.00 85.21  ? 737  LEU A C   1 
ATOM   5699  O  O   . LEU A 1  737  ? 117.789 57.693  35.475  1.00 86.08  ? 737  LEU A O   1 
ATOM   5700  C  CB  . LEU A 1  737  ? 114.982 57.871  35.134  1.00 85.53  ? 737  LEU A CB  1 
ATOM   5701  C  CG  . LEU A 1  737  ? 113.473 58.101  35.155  1.00 86.33  ? 737  LEU A CG  1 
ATOM   5702  C  CD1 . LEU A 1  737  ? 112.889 57.662  33.825  1.00 87.46  ? 737  LEU A CD1 1 
ATOM   5703  C  CD2 . LEU A 1  737  ? 112.839 57.323  36.306  1.00 86.58  ? 737  LEU A CD2 1 
ATOM   5704  N  N   . LYS A 1  738  ? 117.415 56.976  37.591  1.00 84.79  ? 738  LYS A N   1 
ATOM   5705  C  CA  . LYS A 1  738  ? 118.718 56.358  37.837  1.00 85.37  ? 738  LYS A CA  1 
ATOM   5706  C  C   . LYS A 1  738  ? 119.288 55.612  36.649  1.00 84.21  ? 738  LYS A C   1 
ATOM   5707  O  O   . LYS A 1  738  ? 118.559 55.234  35.737  1.00 86.04  ? 738  LYS A O   1 
ATOM   5708  C  CB  . LYS A 1  738  ? 118.590 55.399  39.009  1.00 86.26  ? 738  LYS A CB  1 
ATOM   5709  C  CG  . LYS A 1  738  ? 117.341 55.662  39.794  1.00 88.48  ? 738  LYS A CG  1 
ATOM   5710  C  CD  . LYS A 1  738  ? 117.319 54.887  41.062  1.00 90.32  ? 738  LYS A CD  1 
ATOM   5711  C  CE  . LYS A 1  738  ? 116.114 55.307  41.857  1.00 93.86  ? 738  LYS A CE  1 
ATOM   5712  N  NZ  . LYS A 1  738  ? 116.102 54.632  43.167  1.00 97.35  ? 738  LYS A NZ  1 
ATOM   5713  N  N   . ASP A 1  739  ? 120.595 55.379  36.667  1.00 81.46  ? 739  ASP A N   1 
ATOM   5714  C  CA  . ASP A 1  739  ? 121.219 54.674  35.561  1.00 79.64  ? 739  ASP A CA  1 
ATOM   5715  C  C   . ASP A 1  739  ? 120.931 53.173  35.548  1.00 75.93  ? 739  ASP A C   1 
ATOM   5716  O  O   . ASP A 1  739  ? 121.640 52.404  34.899  1.00 76.70  ? 739  ASP A O   1 
ATOM   5717  C  CB  . ASP A 1  739  ? 122.730 54.926  35.559  1.00 82.81  ? 739  ASP A CB  1 
ATOM   5718  C  CG  . ASP A 1  739  ? 123.122 56.075  34.646  1.00 84.22  ? 739  ASP A CG  1 
ATOM   5719  O  OD1 . ASP A 1  739  ? 122.771 57.235  34.962  1.00 84.78  ? 739  ASP A OD1 1 
ATOM   5720  O  OD2 . ASP A 1  739  ? 123.770 55.811  33.606  1.00 84.29  ? 739  ASP A OD2 1 
ATOM   5721  N  N   . LEU A 1  740  ? 119.877 52.762  36.246  1.00 71.08  ? 740  LEU A N   1 
ATOM   5722  C  CA  . LEU A 1  740  ? 119.499 51.350  36.313  1.00 66.98  ? 740  LEU A CA  1 
ATOM   5723  C  C   . LEU A 1  740  ? 118.064 51.154  35.833  1.00 61.56  ? 740  LEU A C   1 
ATOM   5724  O  O   . LEU A 1  740  ? 117.467 50.086  35.986  1.00 58.87  ? 740  LEU A O   1 
ATOM   5725  C  CB  . LEU A 1  740  ? 119.653 50.832  37.752  1.00 70.71  ? 740  LEU A CB  1 
ATOM   5726  C  CG  . LEU A 1  740  ? 118.807 51.491  38.846  1.00 73.25  ? 740  LEU A CG  1 
ATOM   5727  C  CD1 . LEU A 1  740  ? 117.772 50.487  39.352  1.00 71.88  ? 740  LEU A CD1 1 
ATOM   5728  C  CD2 . LEU A 1  740  ? 119.709 51.982  39.989  1.00 73.62  ? 740  LEU A CD2 1 
ATOM   5729  N  N   . ASN A 1  741  ? 117.516 52.206  35.246  1.00 55.37  ? 741  ASN A N   1 
ATOM   5730  C  CA  . ASN A 1  741  ? 116.163 52.154  34.741  1.00 51.13  ? 741  ASN A CA  1 
ATOM   5731  C  C   . ASN A 1  741  ? 116.170 51.664  33.311  1.00 51.28  ? 741  ASN A C   1 
ATOM   5732  O  O   . ASN A 1  741  ? 116.595 52.376  32.397  1.00 53.46  ? 741  ASN A O   1 
ATOM   5733  C  CB  . ASN A 1  741  ? 115.527 53.527  34.781  1.00 48.58  ? 741  ASN A CB  1 
ATOM   5734  C  CG  . ASN A 1  741  ? 114.151 53.527  34.191  1.00 45.76  ? 741  ASN A CG  1 
ATOM   5735  O  OD1 . ASN A 1  741  ? 113.159 53.523  34.918  1.00 44.18  ? 741  ASN A OD1 1 
ATOM   5736  N  ND2 . ASN A 1  741  ? 114.074 53.509  32.860  1.00 45.78  ? 741  ASN A ND2 1 
ATOM   5737  N  N   . ASN A 1  742  ? 115.682 50.443  33.134  1.00 48.62  ? 742  ASN A N   1 
ATOM   5738  C  CA  . ASN A 1  742  ? 115.610 49.797  31.834  1.00 45.47  ? 742  ASN A CA  1 
ATOM   5739  C  C   . ASN A 1  742  ? 115.288 50.768  30.699  1.00 42.65  ? 742  ASN A C   1 
ATOM   5740  O  O   . ASN A 1  742  ? 116.083 50.921  29.767  1.00 41.17  ? 742  ASN A O   1 
ATOM   5741  C  CB  . ASN A 1  742  ? 114.568 48.679  31.891  1.00 47.11  ? 742  ASN A CB  1 
ATOM   5742  C  CG  . ASN A 1  742  ? 114.776 47.752  33.089  1.00 49.74  ? 742  ASN A CG  1 
ATOM   5743  O  OD1 . ASN A 1  742  ? 115.728 46.958  33.135  1.00 50.54  ? 742  ASN A OD1 1 
ATOM   5744  N  ND2 . ASN A 1  742  ? 113.887 47.859  34.072  1.00 49.89  ? 742  ASN A ND2 1 
ATOM   5745  N  N   . VAL A 1  743  ? 114.139 51.436  30.781  1.00 39.99  ? 743  VAL A N   1 
ATOM   5746  C  CA  . VAL A 1  743  ? 113.748 52.375  29.733  1.00 37.63  ? 743  VAL A CA  1 
ATOM   5747  C  C   . VAL A 1  743  ? 114.908 53.266  29.347  1.00 38.21  ? 743  VAL A C   1 
ATOM   5748  O  O   . VAL A 1  743  ? 115.245 53.378  28.172  1.00 38.99  ? 743  VAL A O   1 
ATOM   5749  C  CB  . VAL A 1  743  ? 112.589 53.281  30.160  1.00 34.75  ? 743  VAL A CB  1 
ATOM   5750  C  CG1 . VAL A 1  743  ? 112.117 54.088  28.968  1.00 32.79  ? 743  VAL A CG1 1 
ATOM   5751  C  CG2 . VAL A 1  743  ? 111.458 52.447  30.709  1.00 34.89  ? 743  VAL A CG2 1 
ATOM   5752  N  N   . LYS A 1  744  ? 115.524 53.889  30.343  1.00 39.30  ? 744  LYS A N   1 
ATOM   5753  C  CA  . LYS A 1  744  ? 116.648 54.770  30.081  1.00 43.55  ? 744  LYS A CA  1 
ATOM   5754  C  C   . LYS A 1  744  ? 117.750 54.012  29.368  1.00 41.58  ? 744  LYS A C   1 
ATOM   5755  O  O   . LYS A 1  744  ? 118.390 54.531  28.448  1.00 41.54  ? 744  LYS A O   1 
ATOM   5756  C  CB  . LYS A 1  744  ? 117.195 55.359  31.389  1.00 49.50  ? 744  LYS A CB  1 
ATOM   5757  C  CG  . LYS A 1  744  ? 118.400 56.280  31.173  1.00 58.14  ? 744  LYS A CG  1 
ATOM   5758  C  CD  . LYS A 1  744  ? 118.748 57.136  32.397  1.00 65.14  ? 744  LYS A CD  1 
ATOM   5759  C  CE  . LYS A 1  744  ? 119.887 58.122  32.063  1.00 70.06  ? 744  LYS A CE  1 
ATOM   5760  N  NZ  . LYS A 1  744  ? 120.283 59.036  33.187  1.00 73.84  ? 744  LYS A NZ  1 
ATOM   5761  N  N   . GLN A 1  745  ? 117.957 52.775  29.797  1.00 39.49  ? 745  GLN A N   1 
ATOM   5762  C  CA  . GLN A 1  745  ? 118.995 51.941  29.220  1.00 40.94  ? 745  GLN A CA  1 
ATOM   5763  C  C   . GLN A 1  745  ? 118.789 51.653  27.756  1.00 41.16  ? 745  GLN A C   1 
ATOM   5764  O  O   . GLN A 1  745  ? 119.742 51.647  26.971  1.00 40.89  ? 745  GLN A O   1 
ATOM   5765  C  CB  . GLN A 1  745  ? 119.117 50.647  30.009  1.00 40.41  ? 745  GLN A CB  1 
ATOM   5766  C  CG  . GLN A 1  745  ? 119.985 50.835  31.219  1.00 43.86  ? 745  GLN A CG  1 
ATOM   5767  C  CD  . GLN A 1  745  ? 119.884 49.705  32.186  1.00 44.59  ? 745  GLN A CD  1 
ATOM   5768  O  OE1 . GLN A 1  745  ? 118.824 49.473  32.768  1.00 45.86  ? 745  GLN A OE1 1 
ATOM   5769  N  NE2 . GLN A 1  745  ? 120.988 48.985  32.376  1.00 45.06  ? 745  GLN A NE2 1 
ATOM   5770  N  N   . MET A 1  746  ? 117.543 51.412  27.381  1.00 41.07  ? 746  MET A N   1 
ATOM   5771  C  CA  . MET A 1  746  ? 117.260 51.145  25.987  1.00 40.67  ? 746  MET A CA  1 
ATOM   5772  C  C   . MET A 1  746  ? 117.529 52.437  25.225  1.00 41.59  ? 746  MET A C   1 
ATOM   5773  O  O   . MET A 1  746  ? 117.965 52.430  24.068  1.00 43.92  ? 746  MET A O   1 
ATOM   5774  C  CB  . MET A 1  746  ? 115.808 50.689  25.820  1.00 38.28  ? 746  MET A CB  1 
ATOM   5775  C  CG  . MET A 1  746  ? 115.544 49.347  26.477  1.00 37.19  ? 746  MET A CG  1 
ATOM   5776  S  SD  . MET A 1  746  ? 113.997 48.566  26.020  1.00 39.68  ? 746  MET A SD  1 
ATOM   5777  C  CE  . MET A 1  746  ? 112.970 49.167  27.335  1.00 36.44  ? 746  MET A CE  1 
ATOM   5778  N  N   . VAL A 1  747  ? 117.296 53.553  25.904  1.00 40.34  ? 747  VAL A N   1 
ATOM   5779  C  CA  . VAL A 1  747  ? 117.501 54.846  25.295  1.00 40.92  ? 747  VAL A CA  1 
ATOM   5780  C  C   . VAL A 1  747  ? 118.982 55.133  25.182  1.00 41.75  ? 747  VAL A C   1 
ATOM   5781  O  O   . VAL A 1  747  ? 119.465 55.494  24.114  1.00 42.46  ? 747  VAL A O   1 
ATOM   5782  C  CB  . VAL A 1  747  ? 116.828 55.941  26.111  1.00 40.28  ? 747  VAL A CB  1 
ATOM   5783  C  CG1 . VAL A 1  747  ? 116.808 57.222  25.314  1.00 43.76  ? 747  VAL A CG1 1 
ATOM   5784  C  CG2 . VAL A 1  747  ? 115.412 55.523  26.464  1.00 41.12  ? 747  VAL A CG2 1 
ATOM   5785  N  N   . MET A 1  748  ? 119.710 54.972  26.279  1.00 45.19  ? 748  MET A N   1 
ATOM   5786  C  CA  . MET A 1  748  ? 121.139 55.225  26.229  1.00 49.93  ? 748  MET A CA  1 
ATOM   5787  C  C   . MET A 1  748  ? 121.762 54.427  25.099  1.00 49.99  ? 748  MET A C   1 
ATOM   5788  O  O   . MET A 1  748  ? 122.367 54.999  24.195  1.00 51.99  ? 748  MET A O   1 
ATOM   5789  C  CB  . MET A 1  748  ? 121.799 54.868  27.551  1.00 53.12  ? 748  MET A CB  1 
ATOM   5790  C  CG  . MET A 1  748  ? 121.426 55.809  28.660  1.00 58.92  ? 748  MET A CG  1 
ATOM   5791  S  SD  . MET A 1  748  ? 122.560 55.617  30.020  1.00 69.02  ? 748  MET A SD  1 
ATOM   5792  C  CE  . MET A 1  748  ? 121.454 55.055  31.303  1.00 66.54  ? 748  MET A CE  1 
ATOM   5793  N  N   . ALA A 1  749  ? 121.604 53.108  25.138  1.00 49.09  ? 749  ALA A N   1 
ATOM   5794  C  CA  . ALA A 1  749  ? 122.155 52.257  24.089  1.00 49.16  ? 749  ALA A CA  1 
ATOM   5795  C  C   . ALA A 1  749  ? 121.542 52.674  22.759  1.00 48.29  ? 749  ALA A C   1 
ATOM   5796  O  O   . ALA A 1  749  ? 122.089 52.401  21.687  1.00 49.19  ? 749  ALA A O   1 
ATOM   5797  C  CB  . ALA A 1  749  ? 121.839 50.800  24.380  1.00 51.36  ? 749  ALA A CB  1 
ATOM   5798  N  N   . GLY A 1  750  ? 120.398 53.342  22.851  1.00 46.38  ? 750  GLY A N   1 
ATOM   5799  C  CA  . GLY A 1  750  ? 119.708 53.811  21.665  1.00 43.71  ? 750  GLY A CA  1 
ATOM   5800  C  C   . GLY A 1  750  ? 118.979 52.715  20.918  1.00 40.72  ? 750  GLY A C   1 
ATOM   5801  O  O   . GLY A 1  750  ? 118.523 52.926  19.795  1.00 40.67  ? 750  GLY A O   1 
ATOM   5802  N  N   . SER A 1  751  ? 118.866 51.544  21.539  1.00 38.67  ? 751  SER A N   1 
ATOM   5803  C  CA  . SER A 1  751  ? 118.194 50.414  20.913  1.00 37.99  ? 751  SER A CA  1 
ATOM   5804  C  C   . SER A 1  751  ? 116.766 50.800  20.608  1.00 38.65  ? 751  SER A C   1 
ATOM   5805  O  O   . SER A 1  751  ? 116.249 50.499  19.538  1.00 42.43  ? 751  SER A O   1 
ATOM   5806  C  CB  . SER A 1  751  ? 118.230 49.180  21.826  1.00 35.41  ? 751  SER A CB  1 
ATOM   5807  O  OG  . SER A 1  751  ? 117.615 49.432  23.072  1.00 35.29  ? 751  SER A OG  1 
ATOM   5808  N  N   . LYS A 1  752  ? 116.134 51.474  21.556  1.00 39.74  ? 752  LYS A N   1 
ATOM   5809  C  CA  . LYS A 1  752  ? 114.767 51.928  21.381  1.00 43.68  ? 752  LYS A CA  1 
ATOM   5810  C  C   . LYS A 1  752  ? 114.431 53.004  22.371  1.00 47.12  ? 752  LYS A C   1 
ATOM   5811  O  O   . LYS A 1  752  ? 114.811 52.943  23.545  1.00 47.25  ? 752  LYS A O   1 
ATOM   5812  C  CB  . LYS A 1  752  ? 113.767 50.792  21.556  1.00 44.47  ? 752  LYS A CB  1 
ATOM   5813  C  CG  . LYS A 1  752  ? 113.443 50.040  20.293  1.00 49.22  ? 752  LYS A CG  1 
ATOM   5814  C  CD  . LYS A 1  752  ? 112.425 50.759  19.434  1.00 53.31  ? 752  LYS A CD  1 
ATOM   5815  C  CE  . LYS A 1  752  ? 111.997 49.878  18.264  1.00 57.03  ? 752  LYS A CE  1 
ATOM   5816  N  NZ  . LYS A 1  752  ? 110.872 50.478  17.498  1.00 62.41  ? 752  LYS A NZ  1 
ATOM   5817  N  N   . GLY A 1  753  ? 113.710 54.001  21.879  1.00 51.60  ? 753  GLY A N   1 
ATOM   5818  C  CA  . GLY A 1  753  ? 113.290 55.086  22.734  1.00 53.95  ? 753  GLY A CA  1 
ATOM   5819  C  C   . GLY A 1  753  ? 114.061 56.385  22.680  1.00 54.40  ? 753  GLY A C   1 
ATOM   5820  O  O   . GLY A 1  753  ? 115.276 56.427  22.436  1.00 55.29  ? 753  GLY A O   1 
ATOM   5821  N  N   . SER A 1  754  ? 113.300 57.449  22.922  1.00 55.17  ? 754  SER A N   1 
ATOM   5822  C  CA  . SER A 1  754  ? 113.786 58.820  22.957  1.00 57.87  ? 754  SER A CA  1 
ATOM   5823  C  C   . SER A 1  754  ? 113.363 59.403  24.304  1.00 57.87  ? 754  SER A C   1 
ATOM   5824  O  O   . SER A 1  754  ? 112.436 58.899  24.942  1.00 59.18  ? 754  SER A O   1 
ATOM   5825  C  CB  . SER A 1  754  ? 113.193 59.628  21.793  1.00 61.13  ? 754  SER A CB  1 
ATOM   5826  O  OG  . SER A 1  754  ? 112.006 59.032  21.276  1.00 64.41  ? 754  SER A OG  1 
ATOM   5827  N  N   . PHE A 1  755  ? 114.022 60.455  24.755  1.00 56.40  ? 755  PHE A N   1 
ATOM   5828  C  CA  . PHE A 1  755  ? 113.645 60.969  26.056  1.00 55.64  ? 755  PHE A CA  1 
ATOM   5829  C  C   . PHE A 1  755  ? 112.190 61.441  26.088  1.00 50.14  ? 755  PHE A C   1 
ATOM   5830  O  O   . PHE A 1  755  ? 111.534 61.424  27.128  1.00 44.67  ? 755  PHE A O   1 
ATOM   5831  C  CB  . PHE A 1  755  ? 114.591 62.079  26.448  1.00 64.00  ? 755  PHE A CB  1 
ATOM   5832  C  CG  . PHE A 1  755  ? 114.252 63.378  25.845  1.00 72.59  ? 755  PHE A CG  1 
ATOM   5833  C  CD1 . PHE A 1  755  ? 113.611 64.343  26.609  1.00 73.25  ? 755  PHE A CD1 1 
ATOM   5834  C  CD2 . PHE A 1  755  ? 114.568 63.647  24.513  1.00 77.57  ? 755  PHE A CD2 1 
ATOM   5835  C  CE1 . PHE A 1  755  ? 113.285 65.563  26.073  1.00 76.51  ? 755  PHE A CE1 1 
ATOM   5836  C  CE2 . PHE A 1  755  ? 114.249 64.873  23.947  1.00 78.68  ? 755  PHE A CE2 1 
ATOM   5837  C  CZ  . PHE A 1  755  ? 113.603 65.841  24.734  1.00 79.30  ? 755  PHE A CZ  1 
ATOM   5838  N  N   . ILE A 1  756  ? 111.688 61.861  24.939  1.00 46.59  ? 756  ILE A N   1 
ATOM   5839  C  CA  . ILE A 1  756  ? 110.308 62.308  24.847  1.00 43.13  ? 756  ILE A CA  1 
ATOM   5840  C  C   . ILE A 1  756  ? 109.393 61.266  25.459  1.00 44.59  ? 756  ILE A C   1 
ATOM   5841  O  O   . ILE A 1  756  ? 108.523 61.578  26.282  1.00 44.01  ? 756  ILE A O   1 
ATOM   5842  C  CB  . ILE A 1  756  ? 109.874 62.414  23.414  1.00 40.40  ? 756  ILE A CB  1 
ATOM   5843  C  CG1 . ILE A 1  756  ? 110.920 63.160  22.619  1.00 37.62  ? 756  ILE A CG1 1 
ATOM   5844  C  CG2 . ILE A 1  756  ? 108.518 63.060  23.335  1.00 38.49  ? 756  ILE A CG2 1 
ATOM   5845  C  CD1 . ILE A 1  756  ? 110.564 63.222  21.191  1.00 37.34  ? 756  ILE A CD1 1 
ATOM   5846  N  N   . ASN A 1  757  ? 109.601 60.030  24.992  1.00 46.63  ? 757  ASN A N   1 
ATOM   5847  C  CA  . ASN A 1  757  ? 108.848 58.843  25.391  1.00 46.89  ? 757  ASN A CA  1 
ATOM   5848  C  C   . ASN A 1  757  ? 108.887 58.707  26.887  1.00 45.47  ? 757  ASN A C   1 
ATOM   5849  O  O   . ASN A 1  757  ? 108.022 58.082  27.486  1.00 46.55  ? 757  ASN A O   1 
ATOM   5850  C  CB  . ASN A 1  757  ? 109.440 57.579  24.750  1.00 50.97  ? 757  ASN A CB  1 
ATOM   5851  C  CG  . ASN A 1  757  ? 109.275 57.548  23.234  1.00 58.61  ? 757  ASN A CG  1 
ATOM   5852  O  OD1 . ASN A 1  757  ? 108.170 57.717  22.712  1.00 63.03  ? 757  ASN A OD1 1 
ATOM   5853  N  ND2 . ASN A 1  757  ? 110.376 57.318  22.520  1.00 61.91  ? 757  ASN A ND2 1 
ATOM   5854  N  N   . ILE A 1  758  ? 109.898 59.302  27.497  1.00 43.99  ? 758  ILE A N   1 
ATOM   5855  C  CA  . ILE A 1  758  ? 110.008 59.225  28.933  1.00 41.67  ? 758  ILE A CA  1 
ATOM   5856  C  C   . ILE A 1  758  ? 109.054 60.216  29.530  1.00 41.95  ? 758  ILE A C   1 
ATOM   5857  O  O   . ILE A 1  758  ? 108.276 59.895  30.429  1.00 39.99  ? 758  ILE A O   1 
ATOM   5858  C  CB  . ILE A 1  758  ? 111.391 59.561  29.366  1.00 40.19  ? 758  ILE A CB  1 
ATOM   5859  C  CG1 . ILE A 1  758  ? 112.358 58.817  28.453  1.00 40.79  ? 758  ILE A CG1 1 
ATOM   5860  C  CG2 . ILE A 1  758  ? 111.557 59.229  30.834  1.00 35.70  ? 758  ILE A CG2 1 
ATOM   5861  C  CD1 . ILE A 1  758  ? 113.769 58.821  28.907  1.00 43.93  ? 758  ILE A CD1 1 
ATOM   5862  N  N   . ALA A 1  759  ? 109.114 61.433  29.009  1.00 43.14  ? 759  ALA A N   1 
ATOM   5863  C  CA  . ALA A 1  759  ? 108.246 62.490  29.483  1.00 42.21  ? 759  ALA A CA  1 
ATOM   5864  C  C   . ALA A 1  759  ? 106.824 61.992  29.415  1.00 41.29  ? 759  ALA A C   1 
ATOM   5865  O  O   . ALA A 1  759  ? 106.223 61.655  30.432  1.00 40.54  ? 759  ALA A O   1 
ATOM   5866  C  CB  . ALA A 1  759  ? 108.398 63.723  28.616  1.00 43.15  ? 759  ALA A CB  1 
ATOM   5867  N  N   . GLN A 1  760  ? 106.307 61.927  28.197  1.00 42.38  ? 760  GLN A N   1 
ATOM   5868  C  CA  . GLN A 1  760  ? 104.945 61.493  27.962  1.00 46.73  ? 760  GLN A CA  1 
ATOM   5869  C  C   . GLN A 1  760  ? 104.475 60.270  28.765  1.00 46.48  ? 760  GLN A C   1 
ATOM   5870  O  O   . GLN A 1  760  ? 103.278 59.966  28.812  1.00 48.55  ? 760  GLN A O   1 
ATOM   5871  C  CB  . GLN A 1  760  ? 104.743 61.261  26.465  1.00 50.23  ? 760  GLN A CB  1 
ATOM   5872  C  CG  . GLN A 1  760  ? 104.764 62.541  25.653  1.00 54.91  ? 760  GLN A CG  1 
ATOM   5873  C  CD  . GLN A 1  760  ? 104.484 62.316  24.173  1.00 58.77  ? 760  GLN A CD  1 
ATOM   5874  O  OE1 . GLN A 1  760  ? 105.309 61.748  23.452  1.00 60.99  ? 760  GLN A OE1 1 
ATOM   5875  N  NE2 . GLN A 1  760  ? 103.313 62.764  23.713  1.00 62.07  ? 760  GLN A NE2 1 
ATOM   5876  N  N   . MET A 1  761  ? 105.389 59.566  29.415  1.00 44.05  ? 761  MET A N   1 
ATOM   5877  C  CA  . MET A 1  761  ? 104.955 58.411  30.180  1.00 42.51  ? 761  MET A CA  1 
ATOM   5878  C  C   . MET A 1  761  ? 104.935 58.678  31.671  1.00 40.67  ? 761  MET A C   1 
ATOM   5879  O  O   . MET A 1  761  ? 103.954 58.392  32.359  1.00 37.54  ? 761  MET A O   1 
ATOM   5880  C  CB  . MET A 1  761  ? 105.857 57.204  29.899  1.00 45.70  ? 761  MET A CB  1 
ATOM   5881  C  CG  . MET A 1  761  ? 105.643 56.529  28.541  1.00 45.85  ? 761  MET A CG  1 
ATOM   5882  S  SD  . MET A 1  761  ? 106.185 54.797  28.572  1.00 45.41  ? 761  MET A SD  1 
ATOM   5883  C  CE  . MET A 1  761  ? 107.947 54.986  29.017  1.00 37.38  ? 761  MET A CE  1 
ATOM   5884  N  N   . SER A 1  762  ? 106.026 59.251  32.153  1.00 41.17  ? 762  SER A N   1 
ATOM   5885  C  CA  . SER A 1  762  ? 106.199 59.525  33.569  1.00 44.23  ? 762  SER A CA  1 
ATOM   5886  C  C   . SER A 1  762  ? 106.028 60.976  34.051  1.00 46.42  ? 762  SER A C   1 
ATOM   5887  O  O   . SER A 1  762  ? 105.827 61.209  35.253  1.00 49.81  ? 762  SER A O   1 
ATOM   5888  C  CB  . SER A 1  762  ? 107.568 59.008  33.962  1.00 44.18  ? 762  SER A CB  1 
ATOM   5889  O  OG  . SER A 1  762  ? 108.312 58.772  32.778  1.00 47.32  ? 762  SER A OG  1 
ATOM   5890  N  N   . ALA A 1  763  ? 106.099 61.942  33.132  1.00 46.03  ? 763  ALA A N   1 
ATOM   5891  C  CA  . ALA A 1  763  ? 105.955 63.359  33.484  1.00 45.20  ? 763  ALA A CA  1 
ATOM   5892  C  C   . ALA A 1  763  ? 104.628 63.972  33.017  1.00 45.61  ? 763  ALA A C   1 
ATOM   5893  O  O   . ALA A 1  763  ? 103.745 64.286  33.823  1.00 45.24  ? 763  ALA A O   1 
ATOM   5894  C  CB  . ALA A 1  763  ? 107.118 64.145  32.906  1.00 46.27  ? 763  ALA A CB  1 
ATOM   5895  N  N   . CYS A 1  764  ? 104.499 64.162  31.712  1.00 46.48  ? 764  CYS A N   1 
ATOM   5896  C  CA  . CYS A 1  764  ? 103.275 64.723  31.175  1.00 48.32  ? 764  CYS A CA  1 
ATOM   5897  C  C   . CYS A 1  764  ? 103.169 64.666  29.658  1.00 47.62  ? 764  CYS A C   1 
ATOM   5898  O  O   . CYS A 1  764  ? 104.083 65.071  28.935  1.00 48.36  ? 764  CYS A O   1 
ATOM   5899  C  CB  . CYS A 1  764  ? 103.098 66.164  31.629  1.00 48.83  ? 764  CYS A CB  1 
ATOM   5900  S  SG  . CYS A 1  764  ? 101.729 66.954  30.772  1.00 56.76  ? 764  CYS A SG  1 
ATOM   5901  N  N   . VAL A 1  765  ? 102.024 64.169  29.201  1.00 44.51  ? 765  VAL A N   1 
ATOM   5902  C  CA  . VAL A 1  765  ? 101.725 64.028  27.791  1.00 42.12  ? 765  VAL A CA  1 
ATOM   5903  C  C   . VAL A 1  765  ? 102.025 65.280  27.002  1.00 42.43  ? 765  VAL A C   1 
ATOM   5904  O  O   . VAL A 1  765  ? 103.062 65.368  26.363  1.00 45.92  ? 765  VAL A O   1 
ATOM   5905  C  CB  . VAL A 1  765  ? 100.271 63.697  27.599  1.00 41.44  ? 765  VAL A CB  1 
ATOM   5906  C  CG1 . VAL A 1  765  ? 100.002 63.406  26.134  1.00 44.56  ? 765  VAL A CG1 1 
ATOM   5907  C  CG2 . VAL A 1  765  ? 99.905  62.530  28.491  1.00 42.03  ? 765  VAL A CG2 1 
ATOM   5908  N  N   . GLY A 1  766  ? 101.114 66.247  27.033  1.00 41.67  ? 766  GLY A N   1 
ATOM   5909  C  CA  . GLY A 1  766  ? 101.345 67.475  26.291  1.00 42.23  ? 766  GLY A CA  1 
ATOM   5910  C  C   . GLY A 1  766  ? 100.116 68.039  25.605  1.00 43.48  ? 766  GLY A C   1 
ATOM   5911  O  O   . GLY A 1  766  ? 99.022  67.478  25.714  1.00 44.89  ? 766  GLY A O   1 
ATOM   5912  N  N   . GLN A 1  767  ? 100.300 69.151  24.896  1.00 42.94  ? 767  GLN A N   1 
ATOM   5913  C  CA  . GLN A 1  767  ? 99.204  69.814  24.192  1.00 43.15  ? 767  GLN A CA  1 
ATOM   5914  C  C   . GLN A 1  767  ? 98.977  69.173  22.822  1.00 42.35  ? 767  GLN A C   1 
ATOM   5915  O  O   . GLN A 1  767  ? 99.907  69.054  22.018  1.00 44.24  ? 767  GLN A O   1 
ATOM   5916  C  CB  . GLN A 1  767  ? 99.521  71.307  24.042  1.00 43.37  ? 767  GLN A CB  1 
ATOM   5917  C  CG  . GLN A 1  767  ? 98.490  72.154  23.280  1.00 46.81  ? 767  GLN A CG  1 
ATOM   5918  C  CD  . GLN A 1  767  ? 97.294  72.580  24.124  1.00 50.25  ? 767  GLN A CD  1 
ATOM   5919  O  OE1 . GLN A 1  767  ? 97.392  72.737  25.341  1.00 50.83  ? 767  GLN A OE1 1 
ATOM   5920  N  NE2 . GLN A 1  767  ? 96.161  72.797  23.467  1.00 54.60  ? 767  GLN A NE2 1 
ATOM   5921  N  N   . GLN A 1  768  ? 97.739  68.757  22.569  1.00 39.00  ? 768  GLN A N   1 
ATOM   5922  C  CA  . GLN A 1  768  ? 97.378  68.124  21.308  1.00 38.60  ? 768  GLN A CA  1 
ATOM   5923  C  C   . GLN A 1  768  ? 97.183  69.176  20.222  1.00 40.29  ? 768  GLN A C   1 
ATOM   5924  O  O   . GLN A 1  768  ? 97.331  70.359  20.498  1.00 41.36  ? 768  GLN A O   1 
ATOM   5925  C  CB  . GLN A 1  768  ? 96.115  67.292  21.507  1.00 38.86  ? 768  GLN A CB  1 
ATOM   5926  C  CG  . GLN A 1  768  ? 96.362  65.785  21.688  1.00 36.04  ? 768  GLN A CG  1 
ATOM   5927  C  CD  . GLN A 1  768  ? 97.475  65.460  22.662  1.00 33.72  ? 768  GLN A CD  1 
ATOM   5928  O  OE1 . GLN A 1  768  ? 97.459  65.894  23.813  1.00 33.67  ? 768  GLN A OE1 1 
ATOM   5929  N  NE2 . GLN A 1  768  ? 98.450  64.678  22.202  1.00 32.59  ? 768  GLN A NE2 1 
ATOM   5930  N  N   . SER A 1  769  ? 96.832  68.771  19.002  1.00 43.10  ? 769  SER A N   1 
ATOM   5931  C  CA  . SER A 1  769  ? 96.694  69.753  17.928  1.00 46.94  ? 769  SER A CA  1 
ATOM   5932  C  C   . SER A 1  769  ? 96.056  69.325  16.610  1.00 47.55  ? 769  SER A C   1 
ATOM   5933  O  O   . SER A 1  769  ? 96.145  68.180  16.202  1.00 47.29  ? 769  SER A O   1 
ATOM   5934  C  CB  . SER A 1  769  ? 98.074  70.314  17.627  1.00 50.35  ? 769  SER A CB  1 
ATOM   5935  O  OG  . SER A 1  769  ? 99.028  69.263  17.601  1.00 53.51  ? 769  SER A OG  1 
ATOM   5936  N  N   . VAL A 1  770  ? 95.451  70.278  15.918  1.00 49.25  ? 770  VAL A N   1 
ATOM   5937  C  CA  . VAL A 1  770  ? 94.813  69.989  14.646  1.00 53.43  ? 770  VAL A CA  1 
ATOM   5938  C  C   . VAL A 1  770  ? 95.116  71.066  13.613  1.00 57.61  ? 770  VAL A C   1 
ATOM   5939  O  O   . VAL A 1  770  ? 94.443  72.089  13.566  1.00 57.79  ? 770  VAL A O   1 
ATOM   5940  C  CB  . VAL A 1  770  ? 93.302  69.909  14.808  1.00 52.34  ? 770  VAL A CB  1 
ATOM   5941  C  CG1 . VAL A 1  770  ? 92.693  69.258  13.580  1.00 54.46  ? 770  VAL A CG1 1 
ATOM   5942  C  CG2 . VAL A 1  770  ? 92.955  69.158  16.080  1.00 50.88  ? 770  VAL A CG2 1 
ATOM   5943  N  N   . GLU A 1  771  ? 96.115  70.816  12.774  1.00 64.01  ? 771  GLU A N   1 
ATOM   5944  C  CA  . GLU A 1  771  ? 96.536  71.760  11.740  1.00 69.80  ? 771  GLU A CA  1 
ATOM   5945  C  C   . GLU A 1  771  ? 97.355  72.855  12.413  1.00 68.91  ? 771  GLU A C   1 
ATOM   5946  O  O   . GLU A 1  771  ? 97.568  73.921  11.843  1.00 71.57  ? 771  GLU A O   1 
ATOM   5947  C  CB  . GLU A 1  771  ? 95.323  72.376  11.026  1.00 75.21  ? 771  GLU A CB  1 
ATOM   5948  C  CG  . GLU A 1  771  ? 94.369  71.358  10.399  1.00 84.45  ? 771  GLU A CG  1 
ATOM   5949  C  CD  . GLU A 1  771  ? 93.046  71.972  9.924   1.00 89.43  ? 771  GLU A CD  1 
ATOM   5950  O  OE1 . GLU A 1  771  ? 93.066  72.857  9.034   1.00 92.77  ? 771  GLU A OE1 1 
ATOM   5951  O  OE2 . GLU A 1  771  ? 91.980  71.562  10.443  1.00 90.47  ? 771  GLU A OE2 1 
ATOM   5952  N  N   . GLY A 1  772  ? 97.808  72.581  13.634  1.00 66.09  ? 772  GLY A N   1 
ATOM   5953  C  CA  . GLY A 1  772  ? 98.604  73.543  14.372  1.00 63.35  ? 772  GLY A CA  1 
ATOM   5954  C  C   . GLY A 1  772  ? 97.816  74.160  15.506  1.00 64.18  ? 772  GLY A C   1 
ATOM   5955  O  O   . GLY A 1  772  ? 98.111  73.952  16.684  1.00 63.75  ? 772  GLY A O   1 
ATOM   5956  N  N   . LYS A 1  773  ? 96.793  74.920  15.139  1.00 66.07  ? 773  LYS A N   1 
ATOM   5957  C  CA  . LYS A 1  773  ? 95.925  75.599  16.103  1.00 66.86  ? 773  LYS A CA  1 
ATOM   5958  C  C   . LYS A 1  773  ? 95.323  74.625  17.131  1.00 64.58  ? 773  LYS A C   1 
ATOM   5959  O  O   . LYS A 1  773  ? 94.435  73.835  16.801  1.00 67.61  ? 773  LYS A O   1 
ATOM   5960  C  CB  . LYS A 1  773  ? 94.791  76.324  15.348  1.00 68.92  ? 773  LYS A CB  1 
ATOM   5961  C  CG  . LYS A 1  773  ? 95.246  77.143  14.129  1.00 69.79  ? 773  LYS A CG  1 
ATOM   5962  C  CD  . LYS A 1  773  ? 94.078  77.451  13.187  1.00 73.06  ? 773  LYS A CD  1 
ATOM   5963  C  CE  . LYS A 1  773  ? 94.555  77.982  11.827  1.00 76.19  ? 773  LYS A CE  1 
ATOM   5964  N  NZ  . LYS A 1  773  ? 93.466  78.067  10.790  1.00 75.43  ? 773  LYS A NZ  1 
ATOM   5965  N  N   . ARG A 1  774  ? 95.799  74.683  18.371  1.00 57.83  ? 774  ARG A N   1 
ATOM   5966  C  CA  . ARG A 1  774  ? 95.275  73.808  19.412  1.00 52.61  ? 774  ARG A CA  1 
ATOM   5967  C  C   . ARG A 1  774  ? 93.758  73.625  19.300  1.00 49.89  ? 774  ARG A C   1 
ATOM   5968  O  O   . ARG A 1  774  ? 93.063  74.466  18.737  1.00 48.52  ? 774  ARG A O   1 
ATOM   5969  C  CB  . ARG A 1  774  ? 95.646  74.365  20.779  1.00 53.17  ? 774  ARG A CB  1 
ATOM   5970  C  CG  . ARG A 1  774  ? 95.660  75.872  20.826  1.00 54.17  ? 774  ARG A CG  1 
ATOM   5971  C  CD  . ARG A 1  774  ? 96.633  76.373  21.896  1.00 57.74  ? 774  ARG A CD  1 
ATOM   5972  N  NE  . ARG A 1  774  ? 96.074  76.360  23.251  1.00 57.57  ? 774  ARG A NE  1 
ATOM   5973  C  CZ  . ARG A 1  774  ? 95.617  77.440  23.884  1.00 56.43  ? 774  ARG A CZ  1 
ATOM   5974  N  NH1 . ARG A 1  774  ? 95.650  78.628  23.287  1.00 56.19  ? 774  ARG A NH1 1 
ATOM   5975  N  NH2 . ARG A 1  774  ? 95.131  77.336  25.115  1.00 53.17  ? 774  ARG A NH2 1 
ATOM   5976  N  N   . ILE A 1  775  ? 93.263  72.509  19.830  1.00 46.98  ? 775  ILE A N   1 
ATOM   5977  C  CA  . ILE A 1  775  ? 91.843  72.160  19.791  1.00 44.40  ? 775  ILE A CA  1 
ATOM   5978  C  C   . ILE A 1  775  ? 90.969  73.369  19.526  1.00 45.42  ? 775  ILE A C   1 
ATOM   5979  O  O   . ILE A 1  775  ? 91.017  74.334  20.275  1.00 44.18  ? 775  ILE A O   1 
ATOM   5980  C  CB  . ILE A 1  775  ? 91.394  71.520  21.116  1.00 42.21  ? 775  ILE A CB  1 
ATOM   5981  C  CG1 . ILE A 1  775  ? 92.340  70.387  21.497  1.00 39.96  ? 775  ILE A CG1 1 
ATOM   5982  C  CG2 . ILE A 1  775  ? 90.003  70.929  20.964  1.00 42.24  ? 775  ILE A CG2 1 
ATOM   5983  C  CD1 . ILE A 1  775  ? 92.220  69.175  20.606  1.00 41.73  ? 775  ILE A CD1 1 
ATOM   5984  N  N   . ALA A 1  776  ? 90.164  73.305  18.469  1.00 49.96  ? 776  ALA A N   1 
ATOM   5985  C  CA  . ALA A 1  776  ? 89.285  74.415  18.093  1.00 54.65  ? 776  ALA A CA  1 
ATOM   5986  C  C   . ALA A 1  776  ? 87.915  74.503  18.793  1.00 57.24  ? 776  ALA A C   1 
ATOM   5987  O  O   . ALA A 1  776  ? 87.678  73.891  19.842  1.00 56.17  ? 776  ALA A O   1 
ATOM   5988  C  CB  . ALA A 1  776  ? 89.083  74.408  16.580  1.00 57.53  ? 776  ALA A CB  1 
ATOM   5989  N  N   . PHE A 1  777  ? 87.024  75.295  18.196  1.00 60.93  ? 777  PHE A N   1 
ATOM   5990  C  CA  . PHE A 1  777  ? 85.672  75.508  18.712  1.00 65.14  ? 777  PHE A CA  1 
ATOM   5991  C  C   . PHE A 1  777  ? 84.634  74.994  17.722  1.00 66.89  ? 777  PHE A C   1 
ATOM   5992  O  O   . PHE A 1  777  ? 84.098  75.761  16.910  1.00 68.75  ? 777  PHE A O   1 
ATOM   5993  C  CB  . PHE A 1  777  ? 85.421  77.005  18.975  1.00 66.62  ? 777  PHE A CB  1 
ATOM   5994  C  CG  . PHE A 1  777  ? 86.040  77.523  20.254  1.00 68.38  ? 777  PHE A CG  1 
ATOM   5995  C  CD1 . PHE A 1  777  ? 86.078  78.882  20.523  1.00 68.90  ? 777  PHE A CD1 1 
ATOM   5996  C  CD2 . PHE A 1  777  ? 86.560  76.652  21.205  1.00 69.19  ? 777  PHE A CD2 1 
ATOM   5997  C  CE1 . PHE A 1  777  ? 86.623  79.361  21.726  1.00 68.40  ? 777  PHE A CE1 1 
ATOM   5998  C  CE2 . PHE A 1  777  ? 87.108  77.129  22.413  1.00 67.28  ? 777  PHE A CE2 1 
ATOM   5999  C  CZ  . PHE A 1  777  ? 87.137  78.478  22.669  1.00 65.76  ? 777  PHE A CZ  1 
ATOM   6000  N  N   . GLY A 1  778  ? 84.370  73.691  17.778  1.00 66.31  ? 778  GLY A N   1 
ATOM   6001  C  CA  . GLY A 1  778  ? 83.376  73.104  16.897  1.00 65.08  ? 778  GLY A CA  1 
ATOM   6002  C  C   . GLY A 1  778  ? 82.076  73.326  17.628  1.00 62.86  ? 778  GLY A C   1 
ATOM   6003  O  O   . GLY A 1  778  ? 80.989  73.430  17.041  1.00 62.79  ? 778  GLY A O   1 
ATOM   6004  N  N   . PHE A 1  779  ? 82.223  73.416  18.944  1.00 59.39  ? 779  PHE A N   1 
ATOM   6005  C  CA  . PHE A 1  779  ? 81.104  73.652  19.825  1.00 57.97  ? 779  PHE A CA  1 
ATOM   6006  C  C   . PHE A 1  779  ? 80.922  75.146  20.119  1.00 58.92  ? 779  PHE A C   1 
ATOM   6007  O  O   . PHE A 1  779  ? 81.324  75.648  21.175  1.00 61.06  ? 779  PHE A O   1 
ATOM   6008  C  CB  . PHE A 1  779  ? 81.291  72.850  21.113  1.00 54.33  ? 779  PHE A CB  1 
ATOM   6009  C  CG  . PHE A 1  779  ? 80.621  71.505  21.082  1.00 51.77  ? 779  PHE A CG  1 
ATOM   6010  C  CD1 . PHE A 1  779  ? 80.642  70.671  22.194  1.00 49.13  ? 779  PHE A CD1 1 
ATOM   6011  C  CD2 . PHE A 1  779  ? 79.924  71.089  19.945  1.00 52.66  ? 779  PHE A CD2 1 
ATOM   6012  C  CE1 . PHE A 1  779  ? 79.975  69.450  22.168  1.00 49.59  ? 779  PHE A CE1 1 
ATOM   6013  C  CE2 . PHE A 1  779  ? 79.256  69.867  19.916  1.00 51.59  ? 779  PHE A CE2 1 
ATOM   6014  C  CZ  . PHE A 1  779  ? 79.280  69.048  21.030  1.00 50.34  ? 779  PHE A CZ  1 
ATOM   6015  N  N   . VAL A 1  780  ? 80.313  75.839  19.152  1.00 58.01  ? 780  VAL A N   1 
ATOM   6016  C  CA  . VAL A 1  780  ? 80.030  77.271  19.227  1.00 52.65  ? 780  VAL A CA  1 
ATOM   6017  C  C   . VAL A 1  780  ? 80.661  77.958  20.430  1.00 49.13  ? 780  VAL A C   1 
ATOM   6018  O  O   . VAL A 1  780  ? 80.110  77.972  21.534  1.00 44.01  ? 780  VAL A O   1 
ATOM   6019  C  CB  . VAL A 1  780  ? 78.499  77.514  19.193  1.00 52.86  ? 780  VAL A CB  1 
ATOM   6020  C  CG1 . VAL A 1  780  ? 78.158  78.891  19.701  1.00 50.10  ? 780  VAL A CG1 1 
ATOM   6021  C  CG2 . VAL A 1  780  ? 77.999  77.348  17.761  1.00 52.96  ? 780  VAL A CG2 1 
ATOM   6022  N  N   . ASP A 1  781  ? 81.847  78.502  20.182  1.00 48.92  ? 781  ASP A N   1 
ATOM   6023  C  CA  . ASP A 1  781  ? 82.629  79.224  21.176  1.00 50.64  ? 781  ASP A CA  1 
ATOM   6024  C  C   . ASP A 1  781  ? 83.071  78.399  22.391  1.00 48.59  ? 781  ASP A C   1 
ATOM   6025  O  O   . ASP A 1  781  ? 82.979  78.855  23.527  1.00 49.43  ? 781  ASP A O   1 
ATOM   6026  C  CB  . ASP A 1  781  ? 81.875  80.498  21.624  1.00 57.19  ? 781  ASP A CB  1 
ATOM   6027  C  CG  . ASP A 1  781  ? 82.100  81.716  20.669  1.00 62.59  ? 781  ASP A CG  1 
ATOM   6028  O  OD1 . ASP A 1  781  ? 83.179  82.364  20.721  1.00 64.39  ? 781  ASP A OD1 1 
ATOM   6029  O  OD2 . ASP A 1  781  ? 81.191  82.032  19.866  1.00 65.90  ? 781  ASP A OD2 1 
ATOM   6030  N  N   . ARG A 1  782  ? 83.556  77.185  22.136  1.00 48.04  ? 782  ARG A N   1 
ATOM   6031  C  CA  . ARG A 1  782  ? 84.076  76.283  23.177  1.00 47.07  ? 782  ARG A CA  1 
ATOM   6032  C  C   . ARG A 1  782  ? 84.449  74.886  22.621  1.00 48.79  ? 782  ARG A C   1 
ATOM   6033  O  O   . ARG A 1  782  ? 84.234  74.584  21.427  1.00 48.26  ? 782  ARG A O   1 
ATOM   6034  C  CB  . ARG A 1  782  ? 83.102  76.146  24.357  1.00 41.29  ? 782  ARG A CB  1 
ATOM   6035  C  CG  . ARG A 1  782  ? 81.733  75.666  23.969  1.00 38.07  ? 782  ARG A CG  1 
ATOM   6036  C  CD  . ARG A 1  782  ? 80.884  75.326  25.175  1.00 33.65  ? 782  ARG A CD  1 
ATOM   6037  N  NE  . ARG A 1  782  ? 79.537  74.956  24.750  1.00 30.58  ? 782  ARG A NE  1 
ATOM   6038  C  CZ  . ARG A 1  782  ? 78.604  74.462  25.555  1.00 29.03  ? 782  ARG A CZ  1 
ATOM   6039  N  NH1 . ARG A 1  782  ? 78.862  74.275  26.847  1.00 23.05  ? 782  ARG A NH1 1 
ATOM   6040  N  NH2 . ARG A 1  782  ? 77.417  74.144  25.056  1.00 28.71  ? 782  ARG A NH2 1 
ATOM   6041  N  N   . THR A 1  783  ? 85.019  74.043  23.489  1.00 48.81  ? 783  THR A N   1 
ATOM   6042  C  CA  . THR A 1  783  ? 85.472  72.711  23.088  1.00 46.85  ? 783  THR A CA  1 
ATOM   6043  C  C   . THR A 1  783  ? 84.493  71.559  23.286  1.00 49.93  ? 783  THR A C   1 
ATOM   6044  O  O   . THR A 1  783  ? 84.117  70.871  22.331  1.00 51.50  ? 783  THR A O   1 
ATOM   6045  C  CB  . THR A 1  783  ? 86.755  72.332  23.811  1.00 41.82  ? 783  THR A CB  1 
ATOM   6046  O  OG1 . THR A 1  783  ? 87.732  73.359  23.635  1.00 37.59  ? 783  THR A OG1 1 
ATOM   6047  C  CG2 . THR A 1  783  ? 87.296  71.067  23.225  1.00 39.76  ? 783  THR A CG2 1 
ATOM   6048  N  N   . LEU A 1  784  ? 84.112  71.322  24.534  1.00 51.01  ? 784  LEU A N   1 
ATOM   6049  C  CA  . LEU A 1  784  ? 83.175  70.250  24.833  1.00 52.51  ? 784  LEU A CA  1 
ATOM   6050  C  C   . LEU A 1  784  ? 82.013  70.854  25.586  1.00 54.41  ? 784  LEU A C   1 
ATOM   6051  O  O   . LEU A 1  784  ? 82.183  71.824  26.318  1.00 56.09  ? 784  LEU A O   1 
ATOM   6052  C  CB  . LEU A 1  784  ? 83.855  69.173  25.677  1.00 50.59  ? 784  LEU A CB  1 
ATOM   6053  C  CG  . LEU A 1  784  ? 85.149  68.666  25.043  1.00 48.87  ? 784  LEU A CG  1 
ATOM   6054  C  CD1 . LEU A 1  784  ? 85.750  67.585  25.919  1.00 46.21  ? 784  LEU A CD1 1 
ATOM   6055  C  CD2 . LEU A 1  784  ? 84.865  68.160  23.630  1.00 49.17  ? 784  LEU A CD2 1 
ATOM   6056  N  N   . PRO A 1  785  ? 80.817  70.276  25.438  1.00 54.84  ? 785  PRO A N   1 
ATOM   6057  C  CA  . PRO A 1  785  ? 79.678  70.849  26.147  1.00 54.59  ? 785  PRO A CA  1 
ATOM   6058  C  C   . PRO A 1  785  ? 79.883  70.889  27.656  1.00 54.56  ? 785  PRO A C   1 
ATOM   6059  O  O   . PRO A 1  785  ? 79.037  71.405  28.380  1.00 54.47  ? 785  PRO A O   1 
ATOM   6060  C  CB  . PRO A 1  785  ? 78.523  69.953  25.711  1.00 53.97  ? 785  PRO A CB  1 
ATOM   6061  C  CG  . PRO A 1  785  ? 79.163  68.634  25.625  1.00 54.36  ? 785  PRO A CG  1 
ATOM   6062  C  CD  . PRO A 1  785  ? 80.510  68.912  24.981  1.00 55.56  ? 785  PRO A CD  1 
ATOM   6063  N  N   . HIS A 1  786  ? 81.017  70.358  28.115  1.00 55.88  ? 786  HIS A N   1 
ATOM   6064  C  CA  . HIS A 1  786  ? 81.352  70.341  29.541  1.00 58.41  ? 786  HIS A CA  1 
ATOM   6065  C  C   . HIS A 1  786  ? 82.204  71.564  29.835  1.00 60.53  ? 786  HIS A C   1 
ATOM   6066  O  O   . HIS A 1  786  ? 83.001  71.558  30.776  1.00 59.18  ? 786  HIS A O   1 
ATOM   6067  C  CB  . HIS A 1  786  ? 82.182  69.114  29.911  1.00 59.00  ? 786  HIS A CB  1 
ATOM   6068  C  CG  . HIS A 1  786  ? 81.836  67.879  29.141  1.00 63.22  ? 786  HIS A CG  1 
ATOM   6069  N  ND1 . HIS A 1  786  ? 82.425  66.660  29.400  1.00 64.98  ? 786  HIS A ND1 1 
ATOM   6070  C  CD2 . HIS A 1  786  ? 80.973  67.670  28.119  1.00 64.25  ? 786  HIS A CD2 1 
ATOM   6071  C  CE1 . HIS A 1  786  ? 81.938  65.753  28.573  1.00 65.34  ? 786  HIS A CE1 1 
ATOM   6072  N  NE2 . HIS A 1  786  ? 81.055  66.339  27.785  1.00 66.02  ? 786  HIS A NE2 1 
ATOM   6073  N  N   . PHE A 1  787  ? 82.031  72.601  29.020  1.00 63.59  ? 787  PHE A N   1 
ATOM   6074  C  CA  . PHE A 1  787  ? 82.793  73.840  29.148  1.00 65.43  ? 787  PHE A CA  1 
ATOM   6075  C  C   . PHE A 1  787  ? 81.964  75.105  28.970  1.00 65.79  ? 787  PHE A C   1 
ATOM   6076  O  O   . PHE A 1  787  ? 80.968  75.118  28.237  1.00 63.60  ? 787  PHE A O   1 
ATOM   6077  C  CB  . PHE A 1  787  ? 83.919  73.851  28.116  1.00 68.86  ? 787  PHE A CB  1 
ATOM   6078  C  CG  . PHE A 1  787  ? 85.111  73.032  28.504  1.00 70.28  ? 787  PHE A CG  1 
ATOM   6079  C  CD1 . PHE A 1  787  ? 86.007  72.598  27.533  1.00 71.10  ? 787  PHE A CD1 1 
ATOM   6080  C  CD2 . PHE A 1  787  ? 85.370  72.737  29.842  1.00 70.11  ? 787  PHE A CD2 1 
ATOM   6081  C  CE1 . PHE A 1  787  ? 87.146  71.886  27.892  1.00 72.88  ? 787  PHE A CE1 1 
ATOM   6082  C  CE2 . PHE A 1  787  ? 86.506  72.026  30.212  1.00 69.50  ? 787  PHE A CE2 1 
ATOM   6083  C  CZ  . PHE A 1  787  ? 87.396  71.600  29.238  1.00 71.12  ? 787  PHE A CZ  1 
ATOM   6084  N  N   . SER A 1  788  ? 82.414  76.171  29.630  1.00 67.73  ? 788  SER A N   1 
ATOM   6085  C  CA  . SER A 1  788  ? 81.759  77.478  29.574  1.00 70.63  ? 788  SER A CA  1 
ATOM   6086  C  C   . SER A 1  788  ? 82.227  78.285  28.353  1.00 68.04  ? 788  SER A C   1 
ATOM   6087  O  O   . SER A 1  788  ? 83.432  78.473  28.139  1.00 66.72  ? 788  SER A O   1 
ATOM   6088  C  CB  . SER A 1  788  ? 82.047  78.260  30.864  1.00 75.07  ? 788  SER A CB  1 
ATOM   6089  O  OG  . SER A 1  788  ? 81.547  77.575  32.006  1.00 81.57  ? 788  SER A OG  1 
ATOM   6090  N  N   . LYS A 1  789  ? 81.266  78.761  27.560  1.00 65.01  ? 789  LYS A N   1 
ATOM   6091  C  CA  . LYS A 1  789  ? 81.580  79.519  26.357  1.00 62.13  ? 789  LYS A CA  1 
ATOM   6092  C  C   . LYS A 1  789  ? 82.752  80.467  26.559  1.00 60.15  ? 789  LYS A C   1 
ATOM   6093  O  O   . LYS A 1  789  ? 83.024  80.930  27.663  1.00 58.74  ? 789  LYS A O   1 
ATOM   6094  C  CB  . LYS A 1  789  ? 80.335  80.266  25.850  1.00 61.45  ? 789  LYS A CB  1 
ATOM   6095  C  CG  . LYS A 1  789  ? 79.376  79.363  25.078  1.00 61.47  ? 789  LYS A CG  1 
ATOM   6096  C  CD  . LYS A 1  789  ? 78.092  80.053  24.661  1.00 65.39  ? 789  LYS A CD  1 
ATOM   6097  C  CE  . LYS A 1  789  ? 77.207  79.118  23.827  1.00 70.15  ? 789  LYS A CE  1 
ATOM   6098  N  NZ  . LYS A 1  789  ? 75.785  79.591  23.656  1.00 73.33  ? 789  LYS A NZ  1 
ATOM   6099  N  N   . ASP A 1  790  ? 83.464  80.724  25.474  1.00 60.32  ? 790  ASP A N   1 
ATOM   6100  C  CA  . ASP A 1  790  ? 84.627  81.585  25.504  1.00 60.81  ? 790  ASP A CA  1 
ATOM   6101  C  C   . ASP A 1  790  ? 85.565  81.314  26.689  1.00 61.56  ? 790  ASP A C   1 
ATOM   6102  O  O   . ASP A 1  790  ? 85.770  82.161  27.555  1.00 59.84  ? 790  ASP A O   1 
ATOM   6103  C  CB  . ASP A 1  790  ? 84.207  83.061  25.459  1.00 60.51  ? 790  ASP A CB  1 
ATOM   6104  C  CG  . ASP A 1  790  ? 83.528  83.442  24.138  1.00 61.01  ? 790  ASP A CG  1 
ATOM   6105  O  OD1 . ASP A 1  790  ? 82.285  83.344  24.056  1.00 62.66  ? 790  ASP A OD1 1 
ATOM   6106  O  OD2 . ASP A 1  790  ? 84.235  83.832  23.176  1.00 60.26  ? 790  ASP A OD2 1 
ATOM   6107  N  N   . ASP A 1  791  ? 86.104  80.098  26.724  1.00 65.06  ? 791  ASP A N   1 
ATOM   6108  C  CA  . ASP A 1  791  ? 87.087  79.691  27.729  1.00 66.81  ? 791  ASP A CA  1 
ATOM   6109  C  C   . ASP A 1  791  ? 88.320  79.412  26.879  1.00 67.95  ? 791  ASP A C   1 
ATOM   6110  O  O   . ASP A 1  791  ? 88.327  78.450  26.104  1.00 70.14  ? 791  ASP A O   1 
ATOM   6111  C  CB  . ASP A 1  791  ? 86.691  78.392  28.438  1.00 67.49  ? 791  ASP A CB  1 
ATOM   6112  C  CG  . ASP A 1  791  ? 87.862  77.763  29.217  1.00 66.86  ? 791  ASP A CG  1 
ATOM   6113  O  OD1 . ASP A 1  791  ? 88.995  77.755  28.693  1.00 63.61  ? 791  ASP A OD1 1 
ATOM   6114  O  OD2 . ASP A 1  791  ? 87.654  77.259  30.345  1.00 65.99  ? 791  ASP A OD2 1 
ATOM   6115  N  N   . TYR A 1  792  ? 89.347  80.248  27.007  1.00 66.05  ? 792  TYR A N   1 
ATOM   6116  C  CA  . TYR A 1  792  ? 90.571  80.077  26.231  1.00 62.60  ? 792  TYR A CA  1 
ATOM   6117  C  C   . TYR A 1  792  ? 91.685  79.413  27.032  1.00 62.05  ? 792  TYR A C   1 
ATOM   6118  O  O   . TYR A 1  792  ? 92.797  79.237  26.534  1.00 61.33  ? 792  TYR A O   1 
ATOM   6119  C  CB  . TYR A 1  792  ? 91.040  81.432  25.680  1.00 59.19  ? 792  TYR A CB  1 
ATOM   6120  C  CG  . TYR A 1  792  ? 90.492  81.743  24.308  1.00 57.01  ? 792  TYR A CG  1 
ATOM   6121  C  CD1 . TYR A 1  792  ? 89.119  81.886  24.091  1.00 54.49  ? 792  TYR A CD1 1 
ATOM   6122  C  CD2 . TYR A 1  792  ? 91.344  81.808  23.210  1.00 58.78  ? 792  TYR A CD2 1 
ATOM   6123  C  CE1 . TYR A 1  792  ? 88.610  82.072  22.808  1.00 58.29  ? 792  TYR A CE1 1 
ATOM   6124  C  CE2 . TYR A 1  792  ? 90.851  81.992  21.923  1.00 63.30  ? 792  TYR A CE2 1 
ATOM   6125  C  CZ  . TYR A 1  792  ? 89.484  82.117  21.721  1.00 63.63  ? 792  TYR A CZ  1 
ATOM   6126  O  OH  . TYR A 1  792  ? 89.009  82.225  20.425  1.00 67.39  ? 792  TYR A OH  1 
ATOM   6127  N  N   . SER A 1  793  ? 91.373  79.033  28.269  1.00 63.15  ? 793  SER A N   1 
ATOM   6128  C  CA  . SER A 1  793  ? 92.336  78.375  29.155  1.00 65.13  ? 793  SER A CA  1 
ATOM   6129  C  C   . SER A 1  793  ? 92.911  77.151  28.455  1.00 66.46  ? 793  SER A C   1 
ATOM   6130  O  O   . SER A 1  793  ? 92.313  76.648  27.509  1.00 70.80  ? 793  SER A O   1 
ATOM   6131  C  CB  . SER A 1  793  ? 91.647  77.945  30.456  1.00 66.10  ? 793  SER A CB  1 
ATOM   6132  O  OG  . SER A 1  793  ? 90.602  77.011  30.220  1.00 62.38  ? 793  SER A OG  1 
ATOM   6133  N  N   . PRO A 1  794  ? 94.074  76.649  28.908  1.00 66.06  ? 794  PRO A N   1 
ATOM   6134  C  CA  . PRO A 1  794  ? 94.693  75.469  28.281  1.00 67.41  ? 794  PRO A CA  1 
ATOM   6135  C  C   . PRO A 1  794  ? 93.931  74.138  28.372  1.00 67.82  ? 794  PRO A C   1 
ATOM   6136  O  O   . PRO A 1  794  ? 93.863  73.378  27.395  1.00 67.58  ? 794  PRO A O   1 
ATOM   6137  C  CB  . PRO A 1  794  ? 96.072  75.399  28.946  1.00 65.85  ? 794  PRO A CB  1 
ATOM   6138  C  CG  . PRO A 1  794  ? 95.896  76.120  30.226  1.00 64.08  ? 794  PRO A CG  1 
ATOM   6139  C  CD  . PRO A 1  794  ? 94.980  77.260  29.892  1.00 64.28  ? 794  PRO A CD  1 
ATOM   6140  N  N   . GLU A 1  795  ? 93.355  73.870  29.540  1.00 67.98  ? 795  GLU A N   1 
ATOM   6141  C  CA  . GLU A 1  795  ? 92.606  72.638  29.780  1.00 68.52  ? 795  GLU A CA  1 
ATOM   6142  C  C   . GLU A 1  795  ? 91.407  72.526  28.867  1.00 65.36  ? 795  GLU A C   1 
ATOM   6143  O  O   . GLU A 1  795  ? 90.568  71.654  29.056  1.00 64.35  ? 795  GLU A O   1 
ATOM   6144  C  CB  . GLU A 1  795  ? 92.093  72.576  31.221  1.00 73.93  ? 795  GLU A CB  1 
ATOM   6145  C  CG  . GLU A 1  795  ? 93.075  73.055  32.266  1.00 81.73  ? 795  GLU A CG  1 
ATOM   6146  C  CD  . GLU A 1  795  ? 93.495  74.495  32.047  1.00 85.41  ? 795  GLU A CD  1 
ATOM   6147  O  OE1 . GLU A 1  795  ? 92.616  75.388  32.072  1.00 87.71  ? 795  GLU A OE1 1 
ATOM   6148  O  OE2 . GLU A 1  795  ? 94.704  74.724  31.845  1.00 85.63  ? 795  GLU A OE2 1 
ATOM   6149  N  N   . SER A 1  796  ? 91.297  73.413  27.894  1.00 61.51  ? 796  SER A N   1 
ATOM   6150  C  CA  . SER A 1  796  ? 90.160  73.332  27.017  1.00 60.66  ? 796  SER A CA  1 
ATOM   6151  C  C   . SER A 1  796  ? 90.556  73.443  25.585  1.00 61.58  ? 796  SER A C   1 
ATOM   6152  O  O   . SER A 1  796  ? 89.834  72.989  24.707  1.00 62.34  ? 796  SER A O   1 
ATOM   6153  C  CB  . SER A 1  796  ? 89.150  74.415  27.327  1.00 59.77  ? 796  SER A CB  1 
ATOM   6154  O  OG  . SER A 1  796  ? 88.067  74.306  26.421  1.00 61.81  ? 796  SER A OG  1 
ATOM   6155  N  N   . LYS A 1  797  ? 91.691  74.074  25.334  1.00 63.61  ? 797  LYS A N   1 
ATOM   6156  C  CA  . LYS A 1  797  ? 92.144  74.193  23.962  1.00 65.16  ? 797  LYS A CA  1 
ATOM   6157  C  C   . LYS A 1  797  ? 92.937  72.926  23.652  1.00 63.46  ? 797  LYS A C   1 
ATOM   6158  O  O   . LYS A 1  797  ? 93.541  72.799  22.583  1.00 64.25  ? 797  LYS A O   1 
ATOM   6159  C  CB  . LYS A 1  797  ? 92.971  75.477  23.757  1.00 67.57  ? 797  LYS A CB  1 
ATOM   6160  C  CG  . LYS A 1  797  ? 92.124  76.737  23.398  1.00 68.74  ? 797  LYS A CG  1 
ATOM   6161  C  CD  . LYS A 1  797  ? 91.590  76.682  21.952  1.00 73.45  ? 797  LYS A CD  1 
ATOM   6162  C  CE  . LYS A 1  797  ? 90.806  77.941  21.539  1.00 75.48  ? 797  LYS A CE  1 
ATOM   6163  N  NZ  . LYS A 1  797  ? 90.537  78.049  20.049  1.00 76.92  ? 797  LYS A NZ  1 
ATOM   6164  N  N   . GLY A 1  798  ? 92.915  71.995  24.612  1.00 59.34  ? 798  GLY A N   1 
ATOM   6165  C  CA  . GLY A 1  798  ? 93.563  70.705  24.439  1.00 55.33  ? 798  GLY A CA  1 
ATOM   6166  C  C   . GLY A 1  798  ? 94.927  70.446  25.032  1.00 52.90  ? 798  GLY A C   1 
ATOM   6167  O  O   . GLY A 1  798  ? 95.872  70.147  24.306  1.00 53.05  ? 798  GLY A O   1 
ATOM   6168  N  N   . PHE A 1  799  ? 95.045  70.524  26.346  1.00 50.38  ? 799  PHE A N   1 
ATOM   6169  C  CA  . PHE A 1  799  ? 96.337  70.279  26.965  1.00 49.03  ? 799  PHE A CA  1 
ATOM   6170  C  C   . PHE A 1  799  ? 96.255  69.125  27.949  1.00 48.03  ? 799  PHE A C   1 
ATOM   6171  O  O   . PHE A 1  799  ? 95.585  69.236  28.974  1.00 48.82  ? 799  PHE A O   1 
ATOM   6172  C  CB  . PHE A 1  799  ? 96.809  71.524  27.698  1.00 50.51  ? 799  PHE A CB  1 
ATOM   6173  C  CG  . PHE A 1  799  ? 98.056  71.321  28.503  1.00 50.13  ? 799  PHE A CG  1 
ATOM   6174  C  CD1 . PHE A 1  799  ? 99.307  71.433  27.912  1.00 50.89  ? 799  PHE A CD1 1 
ATOM   6175  C  CD2 . PHE A 1  799  ? 97.976  71.014  29.863  1.00 49.49  ? 799  PHE A CD2 1 
ATOM   6176  C  CE1 . PHE A 1  799  ? 100.464 71.265  28.669  1.00 50.66  ? 799  PHE A CE1 1 
ATOM   6177  C  CE2 . PHE A 1  799  ? 99.124  70.842  30.629  1.00 46.97  ? 799  PHE A CE2 1 
ATOM   6178  C  CZ  . PHE A 1  799  ? 100.372 70.961  30.031  1.00 47.55  ? 799  PHE A CZ  1 
ATOM   6179  N  N   . VAL A 1  800  ? 96.943  68.025  27.649  1.00 47.29  ? 800  VAL A N   1 
ATOM   6180  C  CA  . VAL A 1  800  ? 96.924  66.861  28.531  1.00 47.23  ? 800  VAL A CA  1 
ATOM   6181  C  C   . VAL A 1  800  ? 98.013  66.961  29.575  1.00 48.64  ? 800  VAL A C   1 
ATOM   6182  O  O   . VAL A 1  800  ? 99.178  66.691  29.298  1.00 49.18  ? 800  VAL A O   1 
ATOM   6183  C  CB  . VAL A 1  800  ? 97.134  65.558  27.777  1.00 45.36  ? 800  VAL A CB  1 
ATOM   6184  C  CG1 . VAL A 1  800  ? 97.032  64.416  28.748  1.00 46.20  ? 800  VAL A CG1 1 
ATOM   6185  C  CG2 . VAL A 1  800  ? 96.101  65.401  26.688  1.00 45.99  ? 800  VAL A CG2 1 
ATOM   6186  N  N   . GLU A 1  801  ? 97.603  67.318  30.784  1.00 51.18  ? 801  GLU A N   1 
ATOM   6187  C  CA  . GLU A 1  801  ? 98.503  67.515  31.914  1.00 54.43  ? 801  GLU A CA  1 
ATOM   6188  C  C   . GLU A 1  801  ? 99.028  66.238  32.596  1.00 51.63  ? 801  GLU A C   1 
ATOM   6189  O  O   . GLU A 1  801  ? 100.133 66.212  33.161  1.00 48.56  ? 801  GLU A O   1 
ATOM   6190  C  CB  . GLU A 1  801  ? 97.790  68.409  32.940  1.00 60.73  ? 801  GLU A CB  1 
ATOM   6191  C  CG  . GLU A 1  801  ? 98.674  68.906  34.078  1.00 68.45  ? 801  GLU A CG  1 
ATOM   6192  C  CD  . GLU A 1  801  ? 97.880  69.553  35.200  1.00 70.60  ? 801  GLU A CD  1 
ATOM   6193  O  OE1 . GLU A 1  801  ? 98.493  69.892  36.240  1.00 72.49  ? 801  GLU A OE1 1 
ATOM   6194  O  OE2 . GLU A 1  801  ? 96.648  69.717  35.037  1.00 71.28  ? 801  GLU A OE2 1 
ATOM   6195  N  N   . ASN A 1  802  ? 98.235  65.181  32.557  1.00 49.81  ? 802  ASN A N   1 
ATOM   6196  C  CA  . ASN A 1  802  ? 98.649  63.938  33.177  1.00 50.85  ? 802  ASN A CA  1 
ATOM   6197  C  C   . ASN A 1  802  ? 99.678  63.200  32.352  1.00 53.23  ? 802  ASN A C   1 
ATOM   6198  O  O   . ASN A 1  802  ? 99.769  63.371  31.133  1.00 56.86  ? 802  ASN A O   1 
ATOM   6199  C  CB  . ASN A 1  802  ? 97.457  63.021  33.357  1.00 50.38  ? 802  ASN A CB  1 
ATOM   6200  C  CG  . ASN A 1  802  ? 96.507  63.527  34.371  1.00 49.83  ? 802  ASN A CG  1 
ATOM   6201  O  OD1 . ASN A 1  802  ? 96.901  63.789  35.505  1.00 50.52  ? 802  ASN A OD1 1 
ATOM   6202  N  ND2 . ASN A 1  802  ? 95.237  63.670  33.988  1.00 48.62  ? 802  ASN A ND2 1 
ATOM   6203  N  N   . SER A 1  803  ? 100.449 62.363  33.032  1.00 52.37  ? 803  SER A N   1 
ATOM   6204  C  CA  . SER A 1  803  ? 101.451 61.542  32.376  1.00 49.89  ? 803  SER A CA  1 
ATOM   6205  C  C   . SER A 1  803  ? 100.734 60.249  31.994  1.00 47.90  ? 803  SER A C   1 
ATOM   6206  O  O   . SER A 1  803  ? 99.762  59.864  32.646  1.00 49.78  ? 803  SER A O   1 
ATOM   6207  C  CB  . SER A 1  803  ? 102.596 61.254  33.346  1.00 51.90  ? 803  SER A CB  1 
ATOM   6208  O  OG  . SER A 1  803  ? 102.109 60.942  34.645  1.00 53.14  ? 803  SER A OG  1 
ATOM   6209  N  N   . TYR A 1  804  ? 101.188 59.580  30.944  1.00 44.62  ? 804  TYR A N   1 
ATOM   6210  C  CA  . TYR A 1  804  ? 100.541 58.343  30.528  1.00 41.96  ? 804  TYR A CA  1 
ATOM   6211  C  C   . TYR A 1  804  ? 100.387 57.348  31.681  1.00 41.98  ? 804  TYR A C   1 
ATOM   6212  O  O   . TYR A 1  804  ? 99.651  56.358  31.584  1.00 40.51  ? 804  TYR A O   1 
ATOM   6213  C  CB  . TYR A 1  804  ? 101.343 57.719  29.407  1.00 39.08  ? 804  TYR A CB  1 
ATOM   6214  C  CG  . TYR A 1  804  ? 100.940 58.189  28.045  1.00 35.79  ? 804  TYR A CG  1 
ATOM   6215  C  CD1 . TYR A 1  804  ? 101.901 58.424  27.076  1.00 36.69  ? 804  TYR A CD1 1 
ATOM   6216  C  CD2 . TYR A 1  804  ? 99.599  58.327  27.697  1.00 33.47  ? 804  TYR A CD2 1 
ATOM   6217  C  CE1 . TYR A 1  804  ? 101.554 58.780  25.793  1.00 39.69  ? 804  TYR A CE1 1 
ATOM   6218  C  CE2 . TYR A 1  804  ? 99.234  58.683  26.408  1.00 36.33  ? 804  TYR A CE2 1 
ATOM   6219  C  CZ  . TYR A 1  804  ? 100.227 58.906  25.459  1.00 40.16  ? 804  TYR A CZ  1 
ATOM   6220  O  OH  . TYR A 1  804  ? 99.931  59.250  24.161  1.00 45.38  ? 804  TYR A OH  1 
ATOM   6221  N  N   . LEU A 1  805  ? 101.085 57.638  32.775  1.00 41.05  ? 805  LEU A N   1 
ATOM   6222  C  CA  . LEU A 1  805  ? 101.081 56.816  33.975  1.00 40.75  ? 805  LEU A CA  1 
ATOM   6223  C  C   . LEU A 1  805  ? 99.851  57.040  34.861  1.00 43.01  ? 805  LEU A C   1 
ATOM   6224  O  O   . LEU A 1  805  ? 99.302  56.101  35.443  1.00 38.73  ? 805  LEU A O   1 
ATOM   6225  C  CB  . LEU A 1  805  ? 102.348 57.112  34.759  1.00 36.53  ? 805  LEU A CB  1 
ATOM   6226  C  CG  . LEU A 1  805  ? 102.482 56.384  36.081  1.00 36.11  ? 805  LEU A CG  1 
ATOM   6227  C  CD1 . LEU A 1  805  ? 102.291 54.906  35.867  1.00 36.78  ? 805  LEU A CD1 1 
ATOM   6228  C  CD2 . LEU A 1  805  ? 103.845 56.660  36.658  1.00 36.83  ? 805  LEU A CD2 1 
ATOM   6229  N  N   . ARG A 1  806  ? 99.440  58.299  34.967  1.00 49.57  ? 806  ARG A N   1 
ATOM   6230  C  CA  . ARG A 1  806  ? 98.272  58.687  35.755  1.00 55.40  ? 806  ARG A CA  1 
ATOM   6231  C  C   . ARG A 1  806  ? 97.028  58.441  34.916  1.00 53.82  ? 806  ARG A C   1 
ATOM   6232  O  O   . ARG A 1  806  ? 95.996  58.028  35.439  1.00 54.34  ? 806  ARG A O   1 
ATOM   6233  C  CB  . ARG A 1  806  ? 98.323  60.175  36.111  1.00 63.75  ? 806  ARG A CB  1 
ATOM   6234  C  CG  . ARG A 1  806  ? 99.279  60.588  37.227  1.00 74.64  ? 806  ARG A CG  1 
ATOM   6235  C  CD  . ARG A 1  806  ? 99.465  62.110  37.176  1.00 83.10  ? 806  ARG A CD  1 
ATOM   6236  N  NE  . ARG A 1  806  ? 99.869  62.699  38.452  1.00 89.27  ? 806  ARG A NE  1 
ATOM   6237  C  CZ  . ARG A 1  806  ? 100.145 63.991  38.617  1.00 91.32  ? 806  ARG A CZ  1 
ATOM   6238  N  NH1 . ARG A 1  806  ? 100.067 64.825  37.582  1.00 93.14  ? 806  ARG A NH1 1 
ATOM   6239  N  NH2 . ARG A 1  806  ? 100.486 64.451  39.817  1.00 91.39  ? 806  ARG A NH2 1 
ATOM   6240  N  N   . GLY A 1  807  ? 97.131  58.735  33.620  1.00 51.43  ? 807  GLY A N   1 
ATOM   6241  C  CA  . GLY A 1  807  ? 96.022  58.523  32.705  1.00 48.30  ? 807  GLY A CA  1 
ATOM   6242  C  C   . GLY A 1  807  ? 95.094  59.690  32.434  1.00 46.27  ? 807  GLY A C   1 
ATOM   6243  O  O   . GLY A 1  807  ? 94.539  60.286  33.350  1.00 47.80  ? 807  GLY A O   1 
ATOM   6244  N  N   . LEU A 1  808  ? 94.907  59.998  31.159  1.00 44.18  ? 808  LEU A N   1 
ATOM   6245  C  CA  . LEU A 1  808  ? 94.039  61.093  30.751  1.00 42.95  ? 808  LEU A CA  1 
ATOM   6246  C  C   . LEU A 1  808  ? 92.645  61.090  31.367  1.00 42.41  ? 808  LEU A C   1 
ATOM   6247  O  O   . LEU A 1  808  ? 92.209  60.111  31.983  1.00 42.14  ? 808  LEU A O   1 
ATOM   6248  C  CB  . LEU A 1  808  ? 93.881  61.105  29.236  1.00 42.01  ? 808  LEU A CB  1 
ATOM   6249  C  CG  . LEU A 1  808  ? 95.123  61.455  28.437  1.00 40.95  ? 808  LEU A CG  1 
ATOM   6250  C  CD1 . LEU A 1  808  ? 96.269  60.510  28.788  1.00 39.42  ? 808  LEU A CD1 1 
ATOM   6251  C  CD2 . LEU A 1  808  ? 94.770  61.388  26.969  1.00 42.79  ? 808  LEU A CD2 1 
ATOM   6252  N  N   . THR A 1  809  ? 91.958  62.214  31.162  1.00 40.66  ? 809  THR A N   1 
ATOM   6253  C  CA  . THR A 1  809  ? 90.602  62.447  31.638  1.00 35.94  ? 809  THR A CA  1 
ATOM   6254  C  C   . THR A 1  809  ? 89.726  62.515  30.396  1.00 33.90  ? 809  THR A C   1 
ATOM   6255  O  O   . THR A 1  809  ? 90.203  62.800  29.303  1.00 34.09  ? 809  THR A O   1 
ATOM   6256  C  CB  . THR A 1  809  ? 90.496  63.783  32.362  1.00 35.67  ? 809  THR A CB  1 
ATOM   6257  O  OG1 . THR A 1  809  ? 90.578  64.843  31.398  1.00 37.64  ? 809  THR A OG1 1 
ATOM   6258  C  CG2 . THR A 1  809  ? 91.630  63.927  33.376  1.00 35.01  ? 809  THR A CG2 1 
ATOM   6259  N  N   . PRO A 1  810  ? 88.427  62.282  30.560  1.00 31.89  ? 810  PRO A N   1 
ATOM   6260  C  CA  . PRO A 1  810  ? 87.448  62.299  29.470  1.00 32.95  ? 810  PRO A CA  1 
ATOM   6261  C  C   . PRO A 1  810  ? 87.831  63.269  28.391  1.00 34.02  ? 810  PRO A C   1 
ATOM   6262  O  O   . PRO A 1  810  ? 87.973  62.914  27.222  1.00 35.09  ? 810  PRO A O   1 
ATOM   6263  C  CB  . PRO A 1  810  ? 86.171  62.722  30.166  1.00 33.04  ? 810  PRO A CB  1 
ATOM   6264  C  CG  . PRO A 1  810  ? 86.323  62.070  31.499  1.00 36.28  ? 810  PRO A CG  1 
ATOM   6265  C  CD  . PRO A 1  810  ? 87.756  62.359  31.866  1.00 33.22  ? 810  PRO A CD  1 
ATOM   6266  N  N   . GLN A 1  811  ? 88.003  64.510  28.815  1.00 36.64  ? 811  GLN A N   1 
ATOM   6267  C  CA  . GLN A 1  811  ? 88.359  65.589  27.916  1.00 38.98  ? 811  GLN A CA  1 
ATOM   6268  C  C   . GLN A 1  811  ? 89.737  65.334  27.334  1.00 36.76  ? 811  GLN A C   1 
ATOM   6269  O  O   . GLN A 1  811  ? 89.884  65.206  26.115  1.00 37.85  ? 811  GLN A O   1 
ATOM   6270  C  CB  . GLN A 1  811  ? 88.315  66.921  28.668  1.00 43.64  ? 811  GLN A CB  1 
ATOM   6271  C  CG  . GLN A 1  811  ? 87.019  67.132  29.463  1.00 52.68  ? 811  GLN A CG  1 
ATOM   6272  C  CD  . GLN A 1  811  ? 87.175  66.824  30.947  1.00 56.47  ? 811  GLN A CD  1 
ATOM   6273  O  OE1 . GLN A 1  811  ? 87.849  65.868  31.325  1.00 60.59  ? 811  GLN A OE1 1 
ATOM   6274  N  NE2 . GLN A 1  811  ? 86.545  67.633  31.792  1.00 58.77  ? 811  GLN A NE2 1 
ATOM   6275  N  N   . GLU A 1  812  ? 90.746  65.244  28.195  1.00 33.28  ? 812  GLU A N   1 
ATOM   6276  C  CA  . GLU A 1  812  ? 92.088  64.988  27.701  1.00 33.46  ? 812  GLU A CA  1 
ATOM   6277  C  C   . GLU A 1  812  ? 91.989  63.880  26.657  1.00 32.00  ? 812  GLU A C   1 
ATOM   6278  O  O   . GLU A 1  812  ? 92.244  64.104  25.466  1.00 33.28  ? 812  GLU A O   1 
ATOM   6279  C  CB  . GLU A 1  812  ? 93.008  64.550  28.834  1.00 34.47  ? 812  GLU A CB  1 
ATOM   6280  C  CG  . GLU A 1  812  ? 93.138  65.563  29.936  1.00 39.54  ? 812  GLU A CG  1 
ATOM   6281  C  CD  . GLU A 1  812  ? 94.265  65.226  30.888  1.00 42.74  ? 812  GLU A CD  1 
ATOM   6282  O  OE1 . GLU A 1  812  ? 94.165  64.201  31.609  1.00 42.79  ? 812  GLU A OE1 1 
ATOM   6283  O  OE2 . GLU A 1  812  ? 95.259  65.988  30.905  1.00 45.94  ? 812  GLU A OE2 1 
ATOM   6284  N  N   . PHE A 1  813  ? 91.587  62.696  27.115  1.00 28.17  ? 813  PHE A N   1 
ATOM   6285  C  CA  . PHE A 1  813  ? 91.438  61.537  26.247  1.00 25.81  ? 813  PHE A CA  1 
ATOM   6286  C  C   . PHE A 1  813  ? 90.847  61.929  24.894  1.00 24.35  ? 813  PHE A C   1 
ATOM   6287  O  O   . PHE A 1  813  ? 91.481  61.714  23.859  1.00 25.57  ? 813  PHE A O   1 
ATOM   6288  C  CB  . PHE A 1  813  ? 90.551  60.472  26.929  1.00 28.51  ? 813  PHE A CB  1 
ATOM   6289  C  CG  . PHE A 1  813  ? 90.450  59.151  26.163  1.00 31.11  ? 813  PHE A CG  1 
ATOM   6290  C  CD1 . PHE A 1  813  ? 91.557  58.301  26.044  1.00 31.38  ? 813  PHE A CD1 1 
ATOM   6291  C  CD2 . PHE A 1  813  ? 89.255  58.779  25.534  1.00 30.92  ? 813  PHE A CD2 1 
ATOM   6292  C  CE1 . PHE A 1  813  ? 91.478  57.115  25.309  1.00 29.46  ? 813  PHE A CE1 1 
ATOM   6293  C  CE2 . PHE A 1  813  ? 89.168  57.600  24.800  1.00 29.01  ? 813  PHE A CE2 1 
ATOM   6294  C  CZ  . PHE A 1  813  ? 90.283  56.767  24.688  1.00 29.47  ? 813  PHE A CZ  1 
ATOM   6295  N  N   . PHE A 1  814  ? 89.658  62.532  24.899  1.00 22.38  ? 814  PHE A N   1 
ATOM   6296  C  CA  . PHE A 1  814  ? 89.015  62.895  23.645  1.00 23.36  ? 814  PHE A CA  1 
ATOM   6297  C  C   . PHE A 1  814  ? 89.831  63.771  22.697  1.00 27.40  ? 814  PHE A C   1 
ATOM   6298  O  O   . PHE A 1  814  ? 89.923  63.474  21.500  1.00 28.10  ? 814  PHE A O   1 
ATOM   6299  C  CB  . PHE A 1  814  ? 87.667  63.567  23.872  1.00 18.75  ? 814  PHE A CB  1 
ATOM   6300  C  CG  . PHE A 1  814  ? 86.873  63.705  22.613  1.00 17.83  ? 814  PHE A CG  1 
ATOM   6301  C  CD1 . PHE A 1  814  ? 85.792  62.882  22.368  1.00 18.42  ? 814  PHE A CD1 1 
ATOM   6302  C  CD2 . PHE A 1  814  ? 87.287  64.571  21.608  1.00 15.85  ? 814  PHE A CD2 1 
ATOM   6303  C  CE1 . PHE A 1  814  ? 85.129  62.923  21.147  1.00 18.60  ? 814  PHE A CE1 1 
ATOM   6304  C  CE2 . PHE A 1  814  ? 86.629  64.616  20.385  1.00 17.29  ? 814  PHE A CE2 1 
ATOM   6305  C  CZ  . PHE A 1  814  ? 85.554  63.784  20.152  1.00 17.74  ? 814  PHE A CZ  1 
ATOM   6306  N  N   . PHE A 1  815  ? 90.395  64.864  23.207  1.00 31.55  ? 815  PHE A N   1 
ATOM   6307  C  CA  . PHE A 1  815  ? 91.196  65.753  22.362  1.00 35.17  ? 815  PHE A CA  1 
ATOM   6308  C  C   . PHE A 1  815  ? 92.351  64.951  21.810  1.00 35.98  ? 815  PHE A C   1 
ATOM   6309  O  O   . PHE A 1  815  ? 92.541  64.870  20.586  1.00 36.03  ? 815  PHE A O   1 
ATOM   6310  C  CB  . PHE A 1  815  ? 91.760  66.912  23.170  1.00 37.28  ? 815  PHE A CB  1 
ATOM   6311  C  CG  . PHE A 1  815  ? 90.721  67.730  23.853  1.00 42.05  ? 815  PHE A CG  1 
ATOM   6312  C  CD1 . PHE A 1  815  ? 91.074  68.568  24.908  1.00 44.03  ? 815  PHE A CD1 1 
ATOM   6313  C  CD2 . PHE A 1  815  ? 89.384  67.637  23.480  1.00 42.92  ? 815  PHE A CD2 1 
ATOM   6314  C  CE1 . PHE A 1  815  ? 90.109  69.298  25.589  1.00 44.96  ? 815  PHE A CE1 1 
ATOM   6315  C  CE2 . PHE A 1  815  ? 88.413  68.358  24.152  1.00 45.20  ? 815  PHE A CE2 1 
ATOM   6316  C  CZ  . PHE A 1  815  ? 88.772  69.191  25.213  1.00 45.29  ? 815  PHE A CZ  1 
ATOM   6317  N  N   . HIS A 1  816  ? 93.116  64.373  22.742  1.00 35.17  ? 816  HIS A N   1 
ATOM   6318  C  CA  . HIS A 1  816  ? 94.270  63.539  22.429  1.00 36.40  ? 816  HIS A CA  1 
ATOM   6319  C  C   . HIS A 1  816  ? 93.974  62.771  21.161  1.00 37.23  ? 816  HIS A C   1 
ATOM   6320  O  O   . HIS A 1  816  ? 94.775  62.744  20.224  1.00 39.58  ? 816  HIS A O   1 
ATOM   6321  C  CB  . HIS A 1  816  ? 94.525  62.535  23.544  1.00 37.15  ? 816  HIS A CB  1 
ATOM   6322  C  CG  . HIS A 1  816  ? 95.822  61.805  23.401  1.00 39.80  ? 816  HIS A CG  1 
ATOM   6323  N  ND1 . HIS A 1  816  ? 96.582  61.861  22.252  1.00 40.92  ? 816  HIS A ND1 1 
ATOM   6324  C  CD2 . HIS A 1  816  ? 96.514  61.033  24.273  1.00 39.95  ? 816  HIS A CD2 1 
ATOM   6325  C  CE1 . HIS A 1  816  ? 97.688  61.160  22.423  1.00 40.34  ? 816  HIS A CE1 1 
ATOM   6326  N  NE2 . HIS A 1  816  ? 97.671  60.647  23.642  1.00 38.92  ? 816  HIS A NE2 1 
ATOM   6327  N  N   . ALA A 1  817  ? 92.805  62.144  21.156  1.00 36.67  ? 817  ALA A N   1 
ATOM   6328  C  CA  . ALA A 1  817  ? 92.347  61.374  20.019  1.00 35.83  ? 817  ALA A CA  1 
ATOM   6329  C  C   . ALA A 1  817  ? 92.424  62.226  18.761  1.00 34.75  ? 817  ALA A C   1 
ATOM   6330  O  O   . ALA A 1  817  ? 93.297  62.028  17.913  1.00 34.68  ? 817  ALA A O   1 
ATOM   6331  C  CB  . ALA A 1  817  ? 90.920  60.922  20.251  1.00 37.36  ? 817  ALA A CB  1 
ATOM   6332  N  N   . MET A 1  818  ? 91.501  63.174  18.652  1.00 33.40  ? 818  MET A N   1 
ATOM   6333  C  CA  . MET A 1  818  ? 91.434  64.069  17.506  1.00 33.16  ? 818  MET A CA  1 
ATOM   6334  C  C   . MET A 1  818  ? 92.838  64.327  17.002  1.00 31.13  ? 818  MET A C   1 
ATOM   6335  O  O   . MET A 1  818  ? 93.101  64.287  15.795  1.00 28.83  ? 818  MET A O   1 
ATOM   6336  C  CB  . MET A 1  818  ? 90.794  65.381  17.939  1.00 35.25  ? 818  MET A CB  1 
ATOM   6337  C  CG  . MET A 1  818  ? 89.559  65.182  18.799  1.00 36.64  ? 818  MET A CG  1 
ATOM   6338  S  SD  . MET A 1  818  ? 89.035  66.686  19.606  1.00 36.55  ? 818  MET A SD  1 
ATOM   6339  C  CE  . MET A 1  818  ? 88.363  67.558  18.185  1.00 39.11  ? 818  MET A CE  1 
ATOM   6340  N  N   . GLY A 1  819  ? 93.728  64.567  17.964  1.00 30.74  ? 819  GLY A N   1 
ATOM   6341  C  CA  . GLY A 1  819  ? 95.125  64.858  17.687  1.00 33.21  ? 819  GLY A CA  1 
ATOM   6342  C  C   . GLY A 1  819  ? 95.914  63.782  16.977  1.00 34.05  ? 819  GLY A C   1 
ATOM   6343  O  O   . GLY A 1  819  ? 96.557  64.053  15.955  1.00 34.32  ? 819  GLY A O   1 
ATOM   6344  N  N   . GLY A 1  820  ? 95.880  62.569  17.528  1.00 35.53  ? 820  GLY A N   1 
ATOM   6345  C  CA  . GLY A 1  820  ? 96.589  61.446  16.930  1.00 34.50  ? 820  GLY A CA  1 
ATOM   6346  C  C   . GLY A 1  820  ? 95.987  61.092  15.584  1.00 33.87  ? 820  GLY A C   1 
ATOM   6347  O  O   . GLY A 1  820  ? 96.659  61.167  14.548  1.00 33.71  ? 820  GLY A O   1 
ATOM   6348  N  N   . ARG A 1  821  ? 94.709  60.720  15.612  1.00 32.68  ? 821  ARG A N   1 
ATOM   6349  C  CA  . ARG A 1  821  ? 93.952  60.361  14.418  1.00 31.49  ? 821  ARG A CA  1 
ATOM   6350  C  C   . ARG A 1  821  ? 94.336  61.212  13.213  1.00 29.90  ? 821  ARG A C   1 
ATOM   6351  O  O   . ARG A 1  821  ? 93.940  60.925  12.091  1.00 30.61  ? 821  ARG A O   1 
ATOM   6352  C  CB  . ARG A 1  821  ? 92.445  60.495  14.703  1.00 32.78  ? 821  ARG A CB  1 
ATOM   6353  C  CG  . ARG A 1  821  ? 91.590  61.045  13.536  1.00 31.92  ? 821  ARG A CG  1 
ATOM   6354  C  CD  . ARG A 1  821  ? 90.966  59.963  12.645  1.00 30.44  ? 821  ARG A CD  1 
ATOM   6355  N  NE  . ARG A 1  821  ? 89.528  59.804  12.867  1.00 25.96  ? 821  ARG A NE  1 
ATOM   6356  C  CZ  . ARG A 1  821  ? 88.992  59.404  14.015  1.00 25.73  ? 821  ARG A CZ  1 
ATOM   6357  N  NH1 . ARG A 1  821  ? 89.776  59.117  15.054  1.00 20.31  ? 821  ARG A NH1 1 
ATOM   6358  N  NH2 . ARG A 1  821  ? 87.673  59.300  14.125  1.00 26.46  ? 821  ARG A NH2 1 
ATOM   6359  N  N   . GLU A 1  822  ? 95.114  62.259  13.434  1.00 30.38  ? 822  GLU A N   1 
ATOM   6360  C  CA  . GLU A 1  822  ? 95.492  63.092  12.321  1.00 33.77  ? 822  GLU A CA  1 
ATOM   6361  C  C   . GLU A 1  822  ? 96.445  62.381  11.380  1.00 30.36  ? 822  GLU A C   1 
ATOM   6362  O  O   . GLU A 1  822  ? 96.123  62.179  10.207  1.00 29.90  ? 822  GLU A O   1 
ATOM   6363  C  CB  . GLU A 1  822  ? 96.106  64.413  12.792  1.00 42.63  ? 822  GLU A CB  1 
ATOM   6364  C  CG  . GLU A 1  822  ? 95.826  65.546  11.774  1.00 56.49  ? 822  GLU A CG  1 
ATOM   6365  C  CD  . GLU A 1  822  ? 96.536  66.859  12.069  1.00 62.97  ? 822  GLU A CD  1 
ATOM   6366  O  OE1 . GLU A 1  822  ? 96.422  67.366  13.215  1.00 65.76  ? 822  GLU A OE1 1 
ATOM   6367  O  OE2 . GLU A 1  822  ? 97.196  67.382  11.136  1.00 68.13  ? 822  GLU A OE2 1 
ATOM   6368  N  N   . GLY A 1  823  ? 97.614  62.002  11.884  1.00 28.55  ? 823  GLY A N   1 
ATOM   6369  C  CA  . GLY A 1  823  ? 98.580  61.311  11.038  1.00 29.59  ? 823  GLY A CA  1 
ATOM   6370  C  C   . GLY A 1  823  ? 97.933  60.231  10.180  1.00 28.38  ? 823  GLY A C   1 
ATOM   6371  O  O   . GLY A 1  823  ? 98.075  60.190  8.949   1.00 26.32  ? 823  GLY A O   1 
ATOM   6372  N  N   . LEU A 1  824  ? 97.211  59.353  10.868  1.00 30.06  ? 824  LEU A N   1 
ATOM   6373  C  CA  . LEU A 1  824  ? 96.476  58.254  10.271  1.00 31.58  ? 824  LEU A CA  1 
ATOM   6374  C  C   . LEU A 1  824  ? 95.655  58.715  9.072   1.00 33.26  ? 824  LEU A C   1 
ATOM   6375  O  O   . LEU A 1  824  ? 95.006  57.898  8.422   1.00 32.44  ? 824  LEU A O   1 
ATOM   6376  C  CB  . LEU A 1  824  ? 95.538  57.651  11.318  1.00 34.13  ? 824  LEU A CB  1 
ATOM   6377  C  CG  . LEU A 1  824  ? 96.223  57.055  12.550  1.00 37.15  ? 824  LEU A CG  1 
ATOM   6378  C  CD1 . LEU A 1  824  ? 95.223  56.788  13.671  1.00 38.86  ? 824  LEU A CD1 1 
ATOM   6379  C  CD2 . LEU A 1  824  ? 96.905  55.762  12.131  1.00 41.75  ? 824  LEU A CD2 1 
ATOM   6380  N  N   . ILE A 1  825  ? 95.672  60.019  8.788   1.00 36.17  ? 825  ILE A N   1 
ATOM   6381  C  CA  . ILE A 1  825  ? 94.911  60.556  7.667   1.00 38.63  ? 825  ILE A CA  1 
ATOM   6382  C  C   . ILE A 1  825  ? 95.814  61.082  6.573   1.00 45.32  ? 825  ILE A C   1 
ATOM   6383  O  O   . ILE A 1  825  ? 95.702  60.674  5.412   1.00 46.55  ? 825  ILE A O   1 
ATOM   6384  C  CB  . ILE A 1  825  ? 93.965  61.682  8.105   1.00 32.71  ? 825  ILE A CB  1 
ATOM   6385  C  CG1 . ILE A 1  825  ? 93.317  61.316  9.438   1.00 33.78  ? 825  ILE A CG1 1 
ATOM   6386  C  CG2 . ILE A 1  825  ? 92.878  61.858  7.066   1.00 28.07  ? 825  ILE A CG2 1 
ATOM   6387  C  CD1 . ILE A 1  825  ? 92.313  62.307  9.962   1.00 33.53  ? 825  ILE A CD1 1 
ATOM   6388  N  N   . ASP A 1  826  ? 96.714  61.991  6.928   1.00 53.06  ? 826  ASP A N   1 
ATOM   6389  C  CA  . ASP A 1  826  ? 97.617  62.520  5.916   1.00 61.18  ? 826  ASP A CA  1 
ATOM   6390  C  C   . ASP A 1  826  ? 98.513  61.381  5.447   1.00 60.38  ? 826  ASP A C   1 
ATOM   6391  O  O   . ASP A 1  826  ? 99.520  61.610  4.779   1.00 63.27  ? 826  ASP A O   1 
ATOM   6392  C  CB  . ASP A 1  826  ? 98.466  63.668  6.468   1.00 71.35  ? 826  ASP A CB  1 
ATOM   6393  C  CG  . ASP A 1  826  ? 99.159  63.304  7.751   1.00 81.66  ? 826  ASP A CG  1 
ATOM   6394  O  OD1 . ASP A 1  826  ? 99.533  62.118  7.883   1.00 86.49  ? 826  ASP A OD1 1 
ATOM   6395  O  OD2 . ASP A 1  826  ? 99.336  64.198  8.616   1.00 88.88  ? 826  ASP A OD2 1 
ATOM   6396  N  N   . THR A 1  827  ? 98.136  60.159  5.830   1.00 57.72  ? 827  THR A N   1 
ATOM   6397  C  CA  . THR A 1  827  ? 98.843  58.938  5.459   1.00 54.26  ? 827  THR A CA  1 
ATOM   6398  C  C   . THR A 1  827  ? 97.924  58.223  4.489   1.00 54.28  ? 827  THR A C   1 
ATOM   6399  O  O   . THR A 1  827  ? 98.366  57.434  3.665   1.00 56.98  ? 827  THR A O   1 
ATOM   6400  C  CB  . THR A 1  827  ? 99.082  58.008  6.677   1.00 52.24  ? 827  THR A CB  1 
ATOM   6401  O  OG1 . THR A 1  827  ? 99.976  58.638  7.602   1.00 50.14  ? 827  THR A OG1 1 
ATOM   6402  C  CG2 . THR A 1  827  ? 99.681  56.686  6.232   1.00 51.67  ? 827  THR A CG2 1 
ATOM   6403  N  N   . ALA A 1  828  ? 96.634  58.510  4.594   1.00 53.90  ? 828  ALA A N   1 
ATOM   6404  C  CA  . ALA A 1  828  ? 95.654  57.884  3.722   1.00 55.06  ? 828  ALA A CA  1 
ATOM   6405  C  C   . ALA A 1  828  ? 95.609  58.603  2.387   1.00 55.30  ? 828  ALA A C   1 
ATOM   6406  O  O   . ALA A 1  828  ? 95.220  58.039  1.359   1.00 56.10  ? 828  ALA A O   1 
ATOM   6407  C  CB  . ALA A 1  828  ? 94.286  57.916  4.378   1.00 54.99  ? 828  ALA A CB  1 
ATOM   6408  N  N   . VAL A 1  829  ? 96.033  59.853  2.402   1.00 55.06  ? 829  VAL A N   1 
ATOM   6409  C  CA  . VAL A 1  829  ? 96.007  60.648  1.195   1.00 56.70  ? 829  VAL A CA  1 
ATOM   6410  C  C   . VAL A 1  829  ? 97.415  60.749  0.595   1.00 54.66  ? 829  VAL A C   1 
ATOM   6411  O  O   . VAL A 1  829  ? 97.615  60.639  -0.627  1.00 49.60  ? 829  VAL A O   1 
ATOM   6412  C  CB  . VAL A 1  829  ? 95.446  62.035  1.537   1.00 59.15  ? 829  VAL A CB  1 
ATOM   6413  C  CG1 . VAL A 1  829  ? 94.889  62.697  0.295   1.00 63.19  ? 829  VAL A CG1 1 
ATOM   6414  C  CG2 . VAL A 1  829  ? 94.377  61.898  2.617   1.00 53.60  ? 829  VAL A CG2 1 
ATOM   6415  N  N   . LYS A 1  830  ? 98.385  60.955  1.476   1.00 52.46  ? 830  LYS A N   1 
ATOM   6416  C  CA  . LYS A 1  830  ? 99.774  61.059  1.075   1.00 52.92  ? 830  LYS A CA  1 
ATOM   6417  C  C   . LYS A 1  830  ? 100.086 59.844  0.225   1.00 56.96  ? 830  LYS A C   1 
ATOM   6418  O  O   . LYS A 1  830  ? 100.658 59.956  -0.864  1.00 59.53  ? 830  LYS A O   1 
ATOM   6419  C  CB  . LYS A 1  830  ? 100.651 61.119  2.334   1.00 49.93  ? 830  LYS A CB  1 
ATOM   6420  C  CG  . LYS A 1  830  ? 101.773 60.103  2.497   1.00 47.08  ? 830  LYS A CG  1 
ATOM   6421  C  CD  . LYS A 1  830  ? 102.360 60.281  3.900   1.00 50.06  ? 830  LYS A CD  1 
ATOM   6422  C  CE  . LYS A 1  830  ? 103.041 59.035  4.455   1.00 51.99  ? 830  LYS A CE  1 
ATOM   6423  N  NZ  . LYS A 1  830  ? 103.246 59.154  5.940   1.00 54.04  ? 830  LYS A NZ  1 
ATOM   6424  N  N   . THR A 1  831  ? 99.646  58.693  0.736   1.00 61.54  ? 831  THR A N   1 
ATOM   6425  C  CA  . THR A 1  831  ? 99.828  57.364  0.132   1.00 61.72  ? 831  THR A CA  1 
ATOM   6426  C  C   . THR A 1  831  ? 99.290  57.304  -1.294  1.00 58.33  ? 831  THR A C   1 
ATOM   6427  O  O   . THR A 1  831  ? 99.835  56.618  -2.158  1.00 57.67  ? 831  THR A O   1 
ATOM   6428  C  CB  . THR A 1  831  ? 99.147  56.263  1.040   1.00 63.89  ? 831  THR A CB  1 
ATOM   6429  O  OG1 . THR A 1  831  ? 100.145 55.341  1.519   1.00 65.43  ? 831  THR A OG1 1 
ATOM   6430  C  CG2 . THR A 1  831  ? 98.037  55.521  0.288   1.00 62.70  ? 831  THR A CG2 1 
ATOM   6431  N  N   . ALA A 1  832  ? 98.228  58.053  -1.532  1.00 55.89  ? 832  ALA A N   1 
ATOM   6432  C  CA  . ALA A 1  832  ? 97.613  58.101  -2.840  1.00 56.04  ? 832  ALA A CA  1 
ATOM   6433  C  C   . ALA A 1  832  ? 98.514  58.777  -3.887  1.00 54.50  ? 832  ALA A C   1 
ATOM   6434  O  O   . ALA A 1  832  ? 98.681  58.267  -4.996  1.00 51.33  ? 832  ALA A O   1 
ATOM   6435  C  CB  . ALA A 1  832  ? 96.269  58.830  -2.736  1.00 59.37  ? 832  ALA A CB  1 
ATOM   6436  N  N   . GLU A 1  833  ? 99.096  59.921  -3.537  1.00 54.34  ? 833  GLU A N   1 
ATOM   6437  C  CA  . GLU A 1  833  ? 99.952  60.644  -4.481  1.00 53.77  ? 833  GLU A CA  1 
ATOM   6438  C  C   . GLU A 1  833  ? 101.399 60.185  -4.419  1.00 47.56  ? 833  GLU A C   1 
ATOM   6439  O  O   . GLU A 1  833  ? 102.091 60.170  -5.435  1.00 44.68  ? 833  GLU A O   1 
ATOM   6440  C  CB  . GLU A 1  833  ? 99.875  62.163  -4.230  1.00 62.47  ? 833  GLU A CB  1 
ATOM   6441  C  CG  . GLU A 1  833  ? 99.219  62.993  -5.366  1.00 69.77  ? 833  GLU A CG  1 
ATOM   6442  C  CD  . GLU A 1  833  ? 98.208  64.032  -4.848  1.00 73.70  ? 833  GLU A CD  1 
ATOM   6443  O  OE1 . GLU A 1  833  ? 98.592  64.890  -4.018  1.00 77.26  ? 833  GLU A OE1 1 
ATOM   6444  O  OE2 . GLU A 1  833  ? 97.028  63.991  -5.271  1.00 72.93  ? 833  GLU A OE2 1 
ATOM   6445  N  N   . THR A 1  834  ? 101.854 59.825  -3.222  1.00 43.45  ? 834  THR A N   1 
ATOM   6446  C  CA  . THR A 1  834  ? 103.221 59.351  -3.037  1.00 41.97  ? 834  THR A CA  1 
ATOM   6447  C  C   . THR A 1  834  ? 103.544 58.406  -4.186  1.00 40.10  ? 834  THR A C   1 
ATOM   6448  O  O   . THR A 1  834  ? 104.386 58.688  -5.040  1.00 37.70  ? 834  THR A O   1 
ATOM   6449  C  CB  . THR A 1  834  ? 103.377 58.558  -1.703  1.00 43.22  ? 834  THR A CB  1 
ATOM   6450  O  OG1 . THR A 1  834  ? 103.437 59.461  -0.590  1.00 44.10  ? 834  THR A OG1 1 
ATOM   6451  C  CG2 . THR A 1  834  ? 104.632 57.703  -1.737  1.00 44.36  ? 834  THR A CG2 1 
ATOM   6452  N  N   . GLY A 1  835  ? 102.838 57.282  -4.189  1.00 40.24  ? 835  GLY A N   1 
ATOM   6453  C  CA  . GLY A 1  835  ? 103.026 56.264  -5.200  1.00 39.81  ? 835  GLY A CA  1 
ATOM   6454  C  C   . GLY A 1  835  ? 103.279 56.802  -6.588  1.00 38.52  ? 835  GLY A C   1 
ATOM   6455  O  O   . GLY A 1  835  ? 104.304 56.495  -7.199  1.00 39.76  ? 835  GLY A O   1 
ATOM   6456  N  N   . TYR A 1  836  ? 102.348 57.604  -7.087  1.00 36.56  ? 836  TYR A N   1 
ATOM   6457  C  CA  . TYR A 1  836  ? 102.478 58.172  -8.419  1.00 33.27  ? 836  TYR A CA  1 
ATOM   6458  C  C   . TYR A 1  836  ? 103.824 58.871  -8.622  1.00 29.92  ? 836  TYR A C   1 
ATOM   6459  O  O   . TYR A 1  836  ? 104.499 58.614  -9.612  1.00 31.62  ? 836  TYR A O   1 
ATOM   6460  C  CB  . TYR A 1  836  ? 101.322 59.132  -8.683  1.00 37.65  ? 836  TYR A CB  1 
ATOM   6461  C  CG  . TYR A 1  836  ? 101.280 59.724  -10.079 1.00 39.23  ? 836  TYR A CG  1 
ATOM   6462  C  CD1 . TYR A 1  836  ? 101.398 58.918  -11.214 1.00 40.18  ? 836  TYR A CD1 1 
ATOM   6463  C  CD2 . TYR A 1  836  ? 101.073 61.092  -10.264 1.00 39.23  ? 836  TYR A CD2 1 
ATOM   6464  C  CE1 . TYR A 1  836  ? 101.308 59.467  -12.500 1.00 39.53  ? 836  TYR A CE1 1 
ATOM   6465  C  CE2 . TYR A 1  836  ? 100.981 61.646  -11.536 1.00 38.15  ? 836  TYR A CE2 1 
ATOM   6466  C  CZ  . TYR A 1  836  ? 101.099 60.834  -12.645 1.00 38.94  ? 836  TYR A CZ  1 
ATOM   6467  O  OH  . TYR A 1  836  ? 101.014 61.402  -13.894 1.00 39.07  ? 836  TYR A OH  1 
ATOM   6468  N  N   . ILE A 1  837  ? 104.223 59.746  -7.700  1.00 24.33  ? 837  ILE A N   1 
ATOM   6469  C  CA  . ILE A 1  837  ? 105.515 60.430  -7.835  1.00 19.37  ? 837  ILE A CA  1 
ATOM   6470  C  C   . ILE A 1  837  ? 106.584 59.375  -8.047  1.00 18.33  ? 837  ILE A C   1 
ATOM   6471  O  O   . ILE A 1  837  ? 107.253 59.316  -9.086  1.00 17.04  ? 837  ILE A O   1 
ATOM   6472  C  CB  . ILE A 1  837  ? 105.903 61.199  -6.555  1.00 18.74  ? 837  ILE A CB  1 
ATOM   6473  C  CG1 . ILE A 1  837  ? 105.102 62.488  -6.447  1.00 19.52  ? 837  ILE A CG1 1 
ATOM   6474  C  CG2 . ILE A 1  837  ? 107.397 61.521  -6.557  1.00 17.32  ? 837  ILE A CG2 1 
ATOM   6475  C  CD1 . ILE A 1  837  ? 105.455 63.264  -5.198  1.00 20.83  ? 837  ILE A CD1 1 
ATOM   6476  N  N   . GLN A 1  838  ? 106.729 58.552  -7.019  1.00 19.93  ? 838  GLN A N   1 
ATOM   6477  C  CA  . GLN A 1  838  ? 107.687 57.468  -7.000  1.00 23.80  ? 838  GLN A CA  1 
ATOM   6478  C  C   . GLN A 1  838  ? 107.849 56.831  -8.378  1.00 19.27  ? 838  GLN A C   1 
ATOM   6479  O  O   . GLN A 1  838  ? 108.951 56.723  -8.898  1.00 18.10  ? 838  GLN A O   1 
ATOM   6480  C  CB  . GLN A 1  838  ? 107.222 56.436  -5.979  1.00 31.29  ? 838  GLN A CB  1 
ATOM   6481  C  CG  . GLN A 1  838  ? 108.344 55.692  -5.299  1.00 39.66  ? 838  GLN A CG  1 
ATOM   6482  C  CD  . GLN A 1  838  ? 109.105 54.825  -6.264  1.00 42.94  ? 838  GLN A CD  1 
ATOM   6483  O  OE1 . GLN A 1  838  ? 108.507 54.220  -7.164  1.00 42.82  ? 838  GLN A OE1 1 
ATOM   6484  N  NE2 . GLN A 1  838  ? 110.428 54.740  -6.083  1.00 43.41  ? 838  GLN A NE2 1 
ATOM   6485  N  N   . ARG A 1  839  ? 106.748 56.418  -8.977  1.00 17.76  ? 839  ARG A N   1 
ATOM   6486  C  CA  . ARG A 1  839  ? 106.835 55.816  -10.287 1.00 20.84  ? 839  ARG A CA  1 
ATOM   6487  C  C   . ARG A 1  839  ? 107.415 56.719  -11.386 1.00 21.79  ? 839  ARG A C   1 
ATOM   6488  O  O   . ARG A 1  839  ? 108.392 56.356  -12.049 1.00 22.15  ? 839  ARG A O   1 
ATOM   6489  C  CB  . ARG A 1  839  ? 105.469 55.323  -10.740 1.00 21.66  ? 839  ARG A CB  1 
ATOM   6490  C  CG  . ARG A 1  839  ? 105.485 55.021  -12.218 1.00 25.90  ? 839  ARG A CG  1 
ATOM   6491  C  CD  . ARG A 1  839  ? 104.382 54.117  -12.679 1.00 30.13  ? 839  ARG A CD  1 
ATOM   6492  N  NE  . ARG A 1  839  ? 104.581 53.820  -14.095 1.00 37.84  ? 839  ARG A NE  1 
ATOM   6493  C  CZ  . ARG A 1  839  ? 103.629 53.377  -14.906 1.00 41.96  ? 839  ARG A CZ  1 
ATOM   6494  N  NH1 . ARG A 1  839  ? 102.414 53.183  -14.421 1.00 46.57  ? 839  ARG A NH1 1 
ATOM   6495  N  NH2 . ARG A 1  839  ? 103.880 53.153  -16.195 1.00 42.61  ? 839  ARG A NH2 1 
ATOM   6496  N  N   . ARG A 1  840  ? 106.789 57.879  -11.592 1.00 23.55  ? 840  ARG A N   1 
ATOM   6497  C  CA  . ARG A 1  840  ? 107.196 58.844  -12.628 1.00 21.10  ? 840  ARG A CA  1 
ATOM   6498  C  C   . ARG A 1  840  ? 108.704 59.055  -12.652 1.00 19.02  ? 840  ARG A C   1 
ATOM   6499  O  O   . ARG A 1  840  ? 109.345 58.869  -13.690 1.00 20.72  ? 840  ARG A O   1 
ATOM   6500  C  CB  . ARG A 1  840  ? 106.508 60.194  -12.402 1.00 21.30  ? 840  ARG A CB  1 
ATOM   6501  C  CG  . ARG A 1  840  ? 105.026 60.102  -12.107 1.00 27.45  ? 840  ARG A CG  1 
ATOM   6502  C  CD  . ARG A 1  840  ? 104.633 61.076  -10.993 1.00 32.67  ? 840  ARG A CD  1 
ATOM   6503  N  NE  . ARG A 1  840  ? 104.390 62.441  -11.467 1.00 34.96  ? 840  ARG A NE  1 
ATOM   6504  C  CZ  . ARG A 1  840  ? 104.092 63.471  -10.675 1.00 34.44  ? 840  ARG A CZ  1 
ATOM   6505  N  NH1 . ARG A 1  840  ? 104.005 63.308  -9.355  1.00 33.08  ? 840  ARG A NH1 1 
ATOM   6506  N  NH2 . ARG A 1  840  ? 103.855 64.660  -11.210 1.00 30.34  ? 840  ARG A NH2 1 
ATOM   6507  N  N   . LEU A 1  841  ? 109.256 59.462  -11.509 1.00 16.75  ? 841  LEU A N   1 
ATOM   6508  C  CA  . LEU A 1  841  ? 110.693 59.680  -11.387 1.00 16.19  ? 841  LEU A CA  1 
ATOM   6509  C  C   . LEU A 1  841  ? 111.373 58.524  -12.108 1.00 13.89  ? 841  LEU A C   1 
ATOM   6510  O  O   . LEU A 1  841  ? 112.095 58.692  -13.104 1.00 13.62  ? 841  LEU A O   1 
ATOM   6511  C  CB  . LEU A 1  841  ? 111.105 59.647  -9.910  1.00 19.84  ? 841  LEU A CB  1 
ATOM   6512  C  CG  . LEU A 1  841  ? 110.677 60.773  -8.963  1.00 22.36  ? 841  LEU A CG  1 
ATOM   6513  C  CD1 . LEU A 1  841  ? 111.159 60.525  -7.511  1.00 24.17  ? 841  LEU A CD1 1 
ATOM   6514  C  CD2 . LEU A 1  841  ? 111.269 62.066  -9.501  1.00 23.00  ? 841  LEU A CD2 1 
ATOM   6515  N  N   . VAL A 1  842  ? 111.088 57.344  -11.565 1.00 11.22  ? 842  VAL A N   1 
ATOM   6516  C  CA  . VAL A 1  842  ? 111.590 56.059  -12.021 1.00 9.74   ? 842  VAL A CA  1 
ATOM   6517  C  C   . VAL A 1  842  ? 111.367 55.805  -13.492 1.00 8.40   ? 842  VAL A C   1 
ATOM   6518  O  O   . VAL A 1  842  ? 112.275 55.412  -14.213 1.00 9.58   ? 842  VAL A O   1 
ATOM   6519  C  CB  . VAL A 1  842  ? 110.924 54.937  -11.225 1.00 8.12   ? 842  VAL A CB  1 
ATOM   6520  C  CG1 . VAL A 1  842  ? 111.419 53.594  -11.697 1.00 3.90   ? 842  VAL A CG1 1 
ATOM   6521  C  CG2 . VAL A 1  842  ? 111.215 55.130  -9.753  1.00 12.59  ? 842  VAL A CG2 1 
ATOM   6522  N  N   . LYS A 1  843  ? 110.150 56.018  -13.940 1.00 7.04   ? 843  LYS A N   1 
ATOM   6523  C  CA  . LYS A 1  843  ? 109.862 55.798  -15.329 1.00 8.39   ? 843  LYS A CA  1 
ATOM   6524  C  C   . LYS A 1  843  ? 110.552 56.863  -16.215 1.00 10.98  ? 843  LYS A C   1 
ATOM   6525  O  O   . LYS A 1  843  ? 110.634 56.722  -17.443 1.00 9.54   ? 843  LYS A O   1 
ATOM   6526  C  CB  . LYS A 1  843  ? 108.348 55.810  -15.504 1.00 6.38   ? 843  LYS A CB  1 
ATOM   6527  C  CG  . LYS A 1  843  ? 107.858 54.905  -16.621 1.00 7.79   ? 843  LYS A CG  1 
ATOM   6528  C  CD  . LYS A 1  843  ? 108.428 53.497  -16.508 1.00 4.72   ? 843  LYS A CD  1 
ATOM   6529  C  CE  . LYS A 1  843  ? 107.882 52.620  -17.609 1.00 9.80   ? 843  LYS A CE  1 
ATOM   6530  N  NZ  . LYS A 1  843  ? 108.519 51.289  -17.583 1.00 13.66  ? 843  LYS A NZ  1 
ATOM   6531  N  N   . ALA A 1  844  ? 111.083 57.910  -15.587 1.00 12.26  ? 844  ALA A N   1 
ATOM   6532  C  CA  . ALA A 1  844  ? 111.725 59.001  -16.321 1.00 11.09  ? 844  ALA A CA  1 
ATOM   6533  C  C   . ALA A 1  844  ? 113.225 58.831  -16.526 1.00 13.17  ? 844  ALA A C   1 
ATOM   6534  O  O   . ALA A 1  844  ? 113.797 59.274  -17.533 1.00 13.62  ? 844  ALA A O   1 
ATOM   6535  C  CB  . ALA A 1  844  ? 111.459 60.305  -15.598 1.00 10.39  ? 844  ALA A CB  1 
ATOM   6536  N  N   . LEU A 1  845  ? 113.855 58.178  -15.560 1.00 14.40  ? 845  LEU A N   1 
ATOM   6537  C  CA  . LEU A 1  845  ? 115.292 57.972  -15.583 1.00 16.53  ? 845  LEU A CA  1 
ATOM   6538  C  C   . LEU A 1  845  ? 115.710 56.513  -15.803 1.00 20.64  ? 845  LEU A C   1 
ATOM   6539  O  O   . LEU A 1  845  ? 116.853 56.138  -15.511 1.00 26.63  ? 845  LEU A O   1 
ATOM   6540  C  CB  . LEU A 1  845  ? 115.857 58.477  -14.267 1.00 10.99  ? 845  LEU A CB  1 
ATOM   6541  C  CG  . LEU A 1  845  ? 114.948 59.564  -13.712 1.00 10.08  ? 845  LEU A CG  1 
ATOM   6542  C  CD1 . LEU A 1  845  ? 115.334 59.872  -12.289 1.00 14.72  ? 845  LEU A CD1 1 
ATOM   6543  C  CD2 . LEU A 1  845  ? 115.039 60.787  -14.584 1.00 5.93   ? 845  LEU A CD2 1 
ATOM   6544  N  N   . GLU A 1  846  ? 114.794 55.690  -16.308 1.00 20.38  ? 846  GLU A N   1 
ATOM   6545  C  CA  . GLU A 1  846  ? 115.110 54.294  -16.550 1.00 21.36  ? 846  GLU A CA  1 
ATOM   6546  C  C   . GLU A 1  846  ? 116.448 54.243  -17.260 1.00 23.73  ? 846  GLU A C   1 
ATOM   6547  O  O   . GLU A 1  846  ? 117.502 54.064  -16.648 1.00 25.03  ? 846  GLU A O   1 
ATOM   6548  C  CB  . GLU A 1  846  ? 114.069 53.670  -17.457 1.00 23.92  ? 846  GLU A CB  1 
ATOM   6549  C  CG  . GLU A 1  846  ? 112.654 53.823  -16.996 1.00 32.22  ? 846  GLU A CG  1 
ATOM   6550  C  CD  . GLU A 1  846  ? 111.690 53.119  -17.935 1.00 37.91  ? 846  GLU A CD  1 
ATOM   6551  O  OE1 . GLU A 1  846  ? 111.631 51.872  -17.904 1.00 40.72  ? 846  GLU A OE1 1 
ATOM   6552  O  OE2 . GLU A 1  846  ? 111.001 53.807  -18.721 1.00 39.36  ? 846  GLU A OE2 1 
ATOM   6553  N  N   . ASP A 1  847  ? 116.372 54.428  -18.568 1.00 25.05  ? 847  ASP A N   1 
ATOM   6554  C  CA  . ASP A 1  847  ? 117.508 54.407  -19.476 1.00 28.65  ? 847  ASP A CA  1 
ATOM   6555  C  C   . ASP A 1  847  ? 118.795 55.144  -19.089 1.00 25.60  ? 847  ASP A C   1 
ATOM   6556  O  O   . ASP A 1  847  ? 119.786 55.071  -19.815 1.00 29.99  ? 847  ASP A O   1 
ATOM   6557  C  CB  . ASP A 1  847  ? 117.041 54.939  -20.823 1.00 36.24  ? 847  ASP A CB  1 
ATOM   6558  C  CG  . ASP A 1  847  ? 116.286 56.247  -20.683 1.00 44.10  ? 847  ASP A CG  1 
ATOM   6559  O  OD1 . ASP A 1  847  ? 116.119 56.702  -19.522 1.00 48.45  ? 847  ASP A OD1 1 
ATOM   6560  O  OD2 . ASP A 1  847  ? 115.860 56.817  -21.718 1.00 47.32  ? 847  ASP A OD2 1 
ATOM   6561  N  N   . ILE A 1  848  ? 118.818 55.841  -17.967 1.00 20.03  ? 848  ILE A N   1 
ATOM   6562  C  CA  . ILE A 1  848  ? 120.032 56.572  -17.639 1.00 20.20  ? 848  ILE A CA  1 
ATOM   6563  C  C   . ILE A 1  848  ? 121.102 55.747  -16.904 1.00 23.41  ? 848  ILE A C   1 
ATOM   6564  O  O   . ILE A 1  848  ? 120.924 55.343  -15.747 1.00 26.05  ? 848  ILE A O   1 
ATOM   6565  C  CB  . ILE A 1  848  ? 119.679 57.861  -16.839 1.00 22.08  ? 848  ILE A CB  1 
ATOM   6566  C  CG1 . ILE A 1  848  ? 118.522 58.589  -17.531 1.00 22.35  ? 848  ILE A CG1 1 
ATOM   6567  C  CG2 . ILE A 1  848  ? 120.864 58.835  -16.812 1.00 21.64  ? 848  ILE A CG2 1 
ATOM   6568  C  CD1 . ILE A 1  848  ? 117.944 59.747  -16.723 1.00 27.46  ? 848  ILE A CD1 1 
ATOM   6569  N  N   . MET A 1  849  ? 122.212 55.497  -17.603 1.00 24.04  ? 849  MET A N   1 
ATOM   6570  C  CA  . MET A 1  849  ? 123.337 54.751  -17.039 1.00 25.66  ? 849  MET A CA  1 
ATOM   6571  C  C   . MET A 1  849  ? 124.686 55.271  -17.525 1.00 24.53  ? 849  MET A C   1 
ATOM   6572  O  O   . MET A 1  849  ? 124.839 55.679  -18.678 1.00 24.80  ? 849  MET A O   1 
ATOM   6573  C  CB  . MET A 1  849  ? 123.246 53.254  -17.379 1.00 29.28  ? 849  MET A CB  1 
ATOM   6574  C  CG  . MET A 1  849  ? 123.634 52.875  -18.823 1.00 33.64  ? 849  MET A CG  1 
ATOM   6575  S  SD  . MET A 1  849  ? 124.085 51.108  -19.019 1.00 41.37  ? 849  MET A SD  1 
ATOM   6576  C  CE  . MET A 1  849  ? 125.792 51.121  -18.559 1.00 36.68  ? 849  MET A CE  1 
ATOM   6577  N  N   . VAL A 1  850  ? 125.662 55.228  -16.630 1.00 24.10  ? 850  VAL A N   1 
ATOM   6578  C  CA  . VAL A 1  850  ? 127.020 55.664  -16.907 1.00 23.63  ? 850  VAL A CA  1 
ATOM   6579  C  C   . VAL A 1  850  ? 127.658 54.868  -18.023 1.00 24.33  ? 850  VAL A C   1 
ATOM   6580  O  O   . VAL A 1  850  ? 128.038 53.740  -17.785 1.00 25.35  ? 850  VAL A O   1 
ATOM   6581  C  CB  . VAL A 1  850  ? 127.891 55.419  -15.704 1.00 22.81  ? 850  VAL A CB  1 
ATOM   6582  C  CG1 . VAL A 1  850  ? 129.264 55.942  -15.961 1.00 22.69  ? 850  VAL A CG1 1 
ATOM   6583  C  CG2 . VAL A 1  850  ? 127.264 56.022  -14.482 1.00 27.02  ? 850  VAL A CG2 1 
ATOM   6584  N  N   . HIS A 1  851  ? 127.816 55.408  -19.222 1.00 25.00  ? 851  HIS A N   1 
ATOM   6585  C  CA  . HIS A 1  851  ? 128.452 54.592  -20.244 1.00 27.33  ? 851  HIS A CA  1 
ATOM   6586  C  C   . HIS A 1  851  ? 129.938 54.418  -20.061 1.00 28.24  ? 851  HIS A C   1 
ATOM   6587  O  O   . HIS A 1  851  ? 130.497 54.846  -19.056 1.00 30.18  ? 851  HIS A O   1 
ATOM   6588  C  CB  . HIS A 1  851  ? 128.169 55.117  -21.624 1.00 30.92  ? 851  HIS A CB  1 
ATOM   6589  C  CG  . HIS A 1  851  ? 126.768 54.878  -22.046 1.00 38.46  ? 851  HIS A CG  1 
ATOM   6590  N  ND1 . HIS A 1  851  ? 126.418 54.603  -23.349 1.00 43.53  ? 851  HIS A ND1 1 
ATOM   6591  C  CD2 . HIS A 1  851  ? 125.620 54.850  -21.328 1.00 43.32  ? 851  HIS A CD2 1 
ATOM   6592  C  CE1 . HIS A 1  851  ? 125.111 54.412  -23.416 1.00 47.11  ? 851  HIS A CE1 1 
ATOM   6593  N  NE2 . HIS A 1  851  ? 124.603 54.555  -22.203 1.00 47.10  ? 851  HIS A NE2 1 
ATOM   6594  N  N   . TYR A 1  852  ? 130.575 53.785  -21.042 1.00 27.25  ? 852  TYR A N   1 
ATOM   6595  C  CA  . TYR A 1  852  ? 132.004 53.501  -20.971 1.00 26.33  ? 852  TYR A CA  1 
ATOM   6596  C  C   . TYR A 1  852  ? 132.968 54.679  -21.091 1.00 27.96  ? 852  TYR A C   1 
ATOM   6597  O  O   . TYR A 1  852  ? 134.119 54.566  -20.652 1.00 30.73  ? 852  TYR A O   1 
ATOM   6598  C  CB  . TYR A 1  852  ? 132.370 52.405  -21.987 1.00 23.44  ? 852  TYR A CB  1 
ATOM   6599  C  CG  . TYR A 1  852  ? 132.410 51.009  -21.369 1.00 21.38  ? 852  TYR A CG  1 
ATOM   6600  C  CD1 . TYR A 1  852  ? 132.070 49.864  -22.113 1.00 21.43  ? 852  TYR A CD1 1 
ATOM   6601  C  CD2 . TYR A 1  852  ? 132.745 50.841  -20.024 1.00 20.73  ? 852  TYR A CD2 1 
ATOM   6602  C  CE1 . TYR A 1  852  ? 132.053 48.585  -21.515 1.00 19.56  ? 852  TYR A CE1 1 
ATOM   6603  C  CE2 . TYR A 1  852  ? 132.733 49.573  -19.421 1.00 21.20  ? 852  TYR A CE2 1 
ATOM   6604  C  CZ  . TYR A 1  852  ? 132.385 48.450  -20.164 1.00 19.38  ? 852  TYR A CZ  1 
ATOM   6605  O  OH  . TYR A 1  852  ? 132.342 47.217  -19.536 1.00 15.32  ? 852  TYR A OH  1 
ATOM   6606  N  N   . ASP A 1  853  ? 132.515 55.797  -21.667 1.00 27.08  ? 853  ASP A N   1 
ATOM   6607  C  CA  . ASP A 1  853  ? 133.356 56.995  -21.808 1.00 25.15  ? 853  ASP A CA  1 
ATOM   6608  C  C   . ASP A 1  853  ? 133.302 57.782  -20.494 1.00 23.91  ? 853  ASP A C   1 
ATOM   6609  O  O   . ASP A 1  853  ? 133.997 58.772  -20.326 1.00 21.78  ? 853  ASP A O   1 
ATOM   6610  C  CB  . ASP A 1  853  ? 132.849 57.884  -22.948 1.00 24.44  ? 853  ASP A CB  1 
ATOM   6611  C  CG  . ASP A 1  853  ? 131.471 58.419  -22.676 1.00 26.00  ? 853  ASP A CG  1 
ATOM   6612  O  OD1 . ASP A 1  853  ? 131.225 58.750  -21.508 1.00 26.69  ? 853  ASP A OD1 1 
ATOM   6613  O  OD2 . ASP A 1  853  ? 130.643 58.515  -23.604 1.00 25.30  ? 853  ASP A OD2 1 
ATOM   6614  N  N   . ASN A 1  854  ? 132.458 57.320  -19.579 1.00 25.06  ? 854  ASN A N   1 
ATOM   6615  C  CA  . ASN A 1  854  ? 132.257 57.930  -18.270 1.00 28.27  ? 854  ASN A CA  1 
ATOM   6616  C  C   . ASN A 1  854  ? 131.272 59.074  -18.320 1.00 28.00  ? 854  ASN A C   1 
ATOM   6617  O  O   . ASN A 1  854  ? 131.153 59.877  -17.389 1.00 26.99  ? 854  ASN A O   1 
ATOM   6618  C  CB  . ASN A 1  854  ? 133.573 58.383  -17.664 1.00 31.85  ? 854  ASN A CB  1 
ATOM   6619  C  CG  . ASN A 1  854  ? 133.911 57.605  -16.414 1.00 39.16  ? 854  ASN A CG  1 
ATOM   6620  O  OD1 . ASN A 1  854  ? 133.340 57.839  -15.331 1.00 41.35  ? 854  ASN A OD1 1 
ATOM   6621  N  ND2 . ASN A 1  854  ? 134.827 56.645  -16.555 1.00 41.97  ? 854  ASN A ND2 1 
ATOM   6622  N  N   . THR A 1  855  ? 130.554 59.102  -19.432 1.00 27.41  ? 855  THR A N   1 
ATOM   6623  C  CA  . THR A 1  855  ? 129.517 60.066  -19.713 1.00 26.22  ? 855  THR A CA  1 
ATOM   6624  C  C   . THR A 1  855  ? 128.320 59.519  -18.939 1.00 27.25  ? 855  THR A C   1 
ATOM   6625  O  O   . THR A 1  855  ? 128.469 58.559  -18.200 1.00 32.36  ? 855  THR A O   1 
ATOM   6626  C  CB  . THR A 1  855  ? 129.230 60.058  -21.210 1.00 23.64  ? 855  THR A CB  1 
ATOM   6627  O  OG1 . THR A 1  855  ? 128.731 61.324  -21.601 1.00 30.02  ? 855  THR A OG1 1 
ATOM   6628  C  CG2 . THR A 1  855  ? 128.229 59.004  -21.563 1.00 21.78  ? 855  THR A CG2 1 
ATOM   6629  N  N   . THR A 1  856  ? 127.142 60.106  -19.084 1.00 24.13  ? 856  THR A N   1 
ATOM   6630  C  CA  . THR A 1  856  ? 125.983 59.593  -18.374 1.00 22.29  ? 856  THR A CA  1 
ATOM   6631  C  C   . THR A 1  856  ? 124.844 59.831  -19.297 1.00 19.72  ? 856  THR A C   1 
ATOM   6632  O  O   . THR A 1  856  ? 124.172 60.828  -19.177 1.00 18.65  ? 856  THR A O   1 
ATOM   6633  C  CB  . THR A 1  856  ? 125.706 60.355  -17.052 1.00 22.99  ? 856  THR A CB  1 
ATOM   6634  O  OG1 . THR A 1  856  ? 126.713 60.038  -16.090 1.00 29.43  ? 856  THR A OG1 1 
ATOM   6635  C  CG2 . THR A 1  856  ? 124.365 59.970  -16.479 1.00 24.50  ? 856  THR A CG2 1 
ATOM   6636  N  N   . ARG A 1  857  ? 124.613 58.930  -20.233 1.00 20.72  ? 857  ARG A N   1 
ATOM   6637  C  CA  . ARG A 1  857  ? 123.514 59.155  -21.159 1.00 25.48  ? 857  ARG A CA  1 
ATOM   6638  C  C   . ARG A 1  857  ? 122.271 58.289  -20.993 1.00 29.32  ? 857  ARG A C   1 
ATOM   6639  O  O   . ARG A 1  857  ? 122.193 57.424  -20.112 1.00 33.75  ? 857  ARG A O   1 
ATOM   6640  C  CB  . ARG A 1  857  ? 124.020 59.020  -22.570 1.00 22.35  ? 857  ARG A CB  1 
ATOM   6641  C  CG  . ARG A 1  857  ? 125.408 59.473  -22.659 1.00 20.98  ? 857  ARG A CG  1 
ATOM   6642  C  CD  . ARG A 1  857  ? 125.827 59.462  -24.054 1.00 18.20  ? 857  ARG A CD  1 
ATOM   6643  N  NE  . ARG A 1  857  ? 127.260 59.580  -24.131 1.00 14.13  ? 857  ARG A NE  1 
ATOM   6644  C  CZ  . ARG A 1  857  ? 127.908 59.699  -25.271 1.00 15.15  ? 857  ARG A CZ  1 
ATOM   6645  N  NH1 . ARG A 1  857  ? 127.234 59.720  -26.417 1.00 14.07  ? 857  ARG A NH1 1 
ATOM   6646  N  NH2 . ARG A 1  857  ? 129.227 59.779  -25.263 1.00 19.46  ? 857  ARG A NH2 1 
ATOM   6647  N  N   . ASN A 1  858  ? 121.294 58.542  -21.861 1.00 31.23  ? 858  ASN A N   1 
ATOM   6648  C  CA  . ASN A 1  858  ? 120.039 57.810  -21.843 1.00 31.41  ? 858  ASN A CA  1 
ATOM   6649  C  C   . ASN A 1  858  ? 119.899 57.012  -23.126 1.00 31.43  ? 858  ASN A C   1 
ATOM   6650  O  O   . ASN A 1  858  ? 120.733 57.118  -24.025 1.00 34.53  ? 858  ASN A O   1 
ATOM   6651  C  CB  . ASN A 1  858  ? 118.862 58.774  -21.714 1.00 33.15  ? 858  ASN A CB  1 
ATOM   6652  C  CG  . ASN A 1  858  ? 118.634 59.598  -22.975 1.00 33.97  ? 858  ASN A CG  1 
ATOM   6653  O  OD1 . ASN A 1  858  ? 117.756 60.469  -23.008 1.00 36.08  ? 858  ASN A OD1 1 
ATOM   6654  N  ND2 . ASN A 1  858  ? 119.419 59.328  -24.018 1.00 33.84  ? 858  ASN A ND2 1 
ATOM   6655  N  N   . SER A 1  859  ? 118.821 56.240  -23.202 1.00 31.88  ? 859  SER A N   1 
ATOM   6656  C  CA  . SER A 1  859  ? 118.518 55.388  -24.348 1.00 34.91  ? 859  SER A CA  1 
ATOM   6657  C  C   . SER A 1  859  ? 118.764 55.992  -25.741 1.00 35.23  ? 859  SER A C   1 
ATOM   6658  O  O   . SER A 1  859  ? 118.773 55.282  -26.759 1.00 35.01  ? 859  SER A O   1 
ATOM   6659  C  CB  . SER A 1  859  ? 117.067 54.902  -24.253 1.00 35.13  ? 859  SER A CB  1 
ATOM   6660  O  OG  . SER A 1  859  ? 116.157 55.982  -24.183 1.00 36.61  ? 859  SER A OG  1 
ATOM   6661  N  N   . LEU A 1  860  ? 118.969 57.295  -25.810 1.00 34.90  ? 860  LEU A N   1 
ATOM   6662  C  CA  . LEU A 1  860  ? 119.198 57.878  -27.108 1.00 35.66  ? 860  LEU A CA  1 
ATOM   6663  C  C   . LEU A 1  860  ? 120.684 58.007  -27.403 1.00 34.90  ? 860  LEU A C   1 
ATOM   6664  O  O   . LEU A 1  860  ? 121.195 57.361  -28.321 1.00 38.63  ? 860  LEU A O   1 
ATOM   6665  C  CB  . LEU A 1  860  ? 118.493 59.227  -27.183 1.00 38.26  ? 860  LEU A CB  1 
ATOM   6666  C  CG  . LEU A 1  860  ? 116.966 59.119  -27.263 1.00 37.88  ? 860  LEU A CG  1 
ATOM   6667  C  CD1 . LEU A 1  860  ? 116.322 60.457  -26.895 1.00 39.57  ? 860  LEU A CD1 1 
ATOM   6668  C  CD2 . LEU A 1  860  ? 116.568 58.673  -28.671 1.00 34.02  ? 860  LEU A CD2 1 
ATOM   6669  N  N   . GLY A 1  861  ? 121.366 58.822  -26.605 1.00 31.51  ? 861  GLY A N   1 
ATOM   6670  C  CA  . GLY A 1  861  ? 122.785 59.053  -26.780 1.00 30.26  ? 861  GLY A CA  1 
ATOM   6671  C  C   . GLY A 1  861  ? 123.047 60.404  -26.170 1.00 31.68  ? 861  GLY A C   1 
ATOM   6672  O  O   . GLY A 1  861  ? 124.187 60.823  -25.987 1.00 34.66  ? 861  GLY A O   1 
ATOM   6673  N  N   . ASN A 1  862  ? 121.951 61.081  -25.849 1.00 30.36  ? 862  ASN A N   1 
ATOM   6674  C  CA  . ASN A 1  862  ? 121.989 62.401  -25.244 1.00 29.86  ? 862  ASN A CA  1 
ATOM   6675  C  C   . ASN A 1  862  ? 122.714 62.367  -23.912 1.00 26.08  ? 862  ASN A C   1 
ATOM   6676  O  O   . ASN A 1  862  ? 122.429 61.530  -23.054 1.00 21.77  ? 862  ASN A O   1 
ATOM   6677  C  CB  . ASN A 1  862  ? 120.568 62.916  -25.010 1.00 34.63  ? 862  ASN A CB  1 
ATOM   6678  C  CG  . ASN A 1  862  ? 119.647 62.642  -26.182 1.00 39.54  ? 862  ASN A CG  1 
ATOM   6679  O  OD1 . ASN A 1  862  ? 120.109 62.440  -27.321 1.00 38.03  ? 862  ASN A OD1 1 
ATOM   6680  N  ND2 . ASN A 1  862  ? 118.328 62.649  -25.917 1.00 41.20  ? 862  ASN A ND2 1 
ATOM   6681  N  N   . VAL A 1  863  ? 123.649 63.287  -23.738 1.00 21.74  ? 863  VAL A N   1 
ATOM   6682  C  CA  . VAL A 1  863  ? 124.389 63.354  -22.495 1.00 20.38  ? 863  VAL A CA  1 
ATOM   6683  C  C   . VAL A 1  863  ? 123.480 63.897  -21.419 1.00 20.83  ? 863  VAL A C   1 
ATOM   6684  O  O   . VAL A 1  863  ? 122.411 64.387  -21.709 1.00 23.90  ? 863  VAL A O   1 
ATOM   6685  C  CB  . VAL A 1  863  ? 125.554 64.273  -22.641 1.00 18.46  ? 863  VAL A CB  1 
ATOM   6686  C  CG1 . VAL A 1  863  ? 126.421 64.210  -21.387 1.00 16.32  ? 863  VAL A CG1 1 
ATOM   6687  C  CG2 . VAL A 1  863  ? 126.298 63.921  -23.923 1.00 15.75  ? 863  VAL A CG2 1 
ATOM   6688  N  N   . ILE A 1  864  ? 123.883 63.811  -20.171 1.00 19.40  ? 864  ILE A N   1 
ATOM   6689  C  CA  . ILE A 1  864  ? 123.038 64.334  -19.122 1.00 22.12  ? 864  ILE A CA  1 
ATOM   6690  C  C   . ILE A 1  864  ? 123.941 64.631  -17.950 1.00 25.88  ? 864  ILE A C   1 
ATOM   6691  O  O   . ILE A 1  864  ? 123.518 65.040  -16.877 1.00 30.58  ? 864  ILE A O   1 
ATOM   6692  C  CB  . ILE A 1  864  ? 121.951 63.332  -18.718 1.00 19.17  ? 864  ILE A CB  1 
ATOM   6693  C  CG1 . ILE A 1  864  ? 121.078 62.997  -19.922 1.00 16.43  ? 864  ILE A CG1 1 
ATOM   6694  C  CG2 . ILE A 1  864  ? 121.078 63.923  -17.625 1.00 22.52  ? 864  ILE A CG2 1 
ATOM   6695  C  CD1 . ILE A 1  864  ? 119.717 62.414  -19.565 1.00 15.23  ? 864  ILE A CD1 1 
ATOM   6696  N  N   . GLN A 1  865  ? 125.214 64.414  -18.195 1.00 26.04  ? 865  GLN A N   1 
ATOM   6697  C  CA  . GLN A 1  865  ? 126.269 64.659  -17.244 1.00 24.36  ? 865  GLN A CA  1 
ATOM   6698  C  C   . GLN A 1  865  ? 127.385 64.151  -18.097 1.00 21.82  ? 865  GLN A C   1 
ATOM   6699  O  O   . GLN A 1  865  ? 127.212 63.180  -18.811 1.00 23.32  ? 865  GLN A O   1 
ATOM   6700  C  CB  . GLN A 1  865  ? 126.102 63.827  -15.971 1.00 22.94  ? 865  GLN A CB  1 
ATOM   6701  C  CG  . GLN A 1  865  ? 125.072 64.406  -15.018 1.00 22.92  ? 865  GLN A CG  1 
ATOM   6702  C  CD  . GLN A 1  865  ? 124.997 63.667  -13.711 1.00 25.07  ? 865  GLN A CD  1 
ATOM   6703  O  OE1 . GLN A 1  865  ? 125.277 62.481  -13.658 1.00 27.71  ? 865  GLN A OE1 1 
ATOM   6704  N  NE2 . GLN A 1  865  ? 124.598 64.357  -12.648 1.00 25.87  ? 865  GLN A NE2 1 
ATOM   6705  N  N   . PHE A 1  866  ? 128.504 64.838  -18.110 1.00 17.80  ? 866  PHE A N   1 
ATOM   6706  C  CA  . PHE A 1  866  ? 129.565 64.342  -18.923 1.00 17.72  ? 866  PHE A CA  1 
ATOM   6707  C  C   . PHE A 1  866  ? 130.391 63.533  -17.959 1.00 21.96  ? 866  PHE A C   1 
ATOM   6708  O  O   . PHE A 1  866  ? 131.360 62.886  -18.339 1.00 28.70  ? 866  PHE A O   1 
ATOM   6709  C  CB  . PHE A 1  866  ? 130.325 65.495  -19.565 1.00 14.23  ? 866  PHE A CB  1 
ATOM   6710  C  CG  . PHE A 1  866  ? 129.540 66.213  -20.654 1.00 11.54  ? 866  PHE A CG  1 
ATOM   6711  C  CD1 . PHE A 1  866  ? 128.563 67.150  -20.329 1.00 10.74  ? 866  PHE A CD1 1 
ATOM   6712  C  CD2 . PHE A 1  866  ? 129.804 65.965  -22.005 1.00 5.74   ? 866  PHE A CD2 1 
ATOM   6713  C  CE1 . PHE A 1  866  ? 127.868 67.827  -21.333 1.00 9.64   ? 866  PHE A CE1 1 
ATOM   6714  C  CE2 . PHE A 1  866  ? 129.116 66.634  -23.022 1.00 1.00   ? 866  PHE A CE2 1 
ATOM   6715  C  CZ  . PHE A 1  866  ? 128.151 67.565  -22.687 1.00 6.57   ? 866  PHE A CZ  1 
ATOM   6716  N  N   . ILE A 1  867  ? 129.967 63.560  -16.700 1.00 22.23  ? 867  ILE A N   1 
ATOM   6717  C  CA  . ILE A 1  867  ? 130.601 62.800  -15.633 1.00 21.93  ? 867  ILE A CA  1 
ATOM   6718  C  C   . ILE A 1  867  ? 129.549 62.615  -14.555 1.00 21.30  ? 867  ILE A C   1 
ATOM   6719  O  O   . ILE A 1  867  ? 129.010 63.583  -14.029 1.00 20.10  ? 867  ILE A O   1 
ATOM   6720  C  CB  . ILE A 1  867  ? 131.842 63.525  -15.044 1.00 23.73  ? 867  ILE A CB  1 
ATOM   6721  C  CG1 . ILE A 1  867  ? 133.068 63.273  -15.929 1.00 29.47  ? 867  ILE A CG1 1 
ATOM   6722  C  CG2 . ILE A 1  867  ? 132.148 63.025  -13.659 1.00 19.87  ? 867  ILE A CG2 1 
ATOM   6723  C  CD1 . ILE A 1  867  ? 133.251 64.259  -17.116 1.00 37.33  ? 867  ILE A CD1 1 
ATOM   6724  N  N   . TYR A 1  868  ? 129.229 61.363  -14.252 1.00 20.98  ? 868  TYR A N   1 
ATOM   6725  C  CA  . TYR A 1  868  ? 128.234 61.069  -13.225 1.00 21.91  ? 868  TYR A CA  1 
ATOM   6726  C  C   . TYR A 1  868  ? 128.479 61.963  -11.994 1.00 21.41  ? 868  TYR A C   1 
ATOM   6727  O  O   . TYR A 1  868  ? 129.588 62.016  -11.464 1.00 24.29  ? 868  TYR A O   1 
ATOM   6728  C  CB  . TYR A 1  868  ? 128.307 59.574  -12.835 1.00 22.64  ? 868  TYR A CB  1 
ATOM   6729  C  CG  . TYR A 1  868  ? 127.382 59.151  -11.701 1.00 24.17  ? 868  TYR A CG  1 
ATOM   6730  C  CD1 . TYR A 1  868  ? 126.010 59.227  -11.839 1.00 24.32  ? 868  TYR A CD1 1 
ATOM   6731  C  CD2 . TYR A 1  868  ? 127.890 58.723  -10.473 1.00 24.72  ? 868  TYR A CD2 1 
ATOM   6732  C  CE1 . TYR A 1  868  ? 125.174 58.904  -10.793 1.00 24.94  ? 868  TYR A CE1 1 
ATOM   6733  C  CE2 . TYR A 1  868  ? 127.043 58.390  -9.415  1.00 24.47  ? 868  TYR A CE2 1 
ATOM   6734  C  CZ  . TYR A 1  868  ? 125.683 58.488  -9.587  1.00 24.64  ? 868  TYR A CZ  1 
ATOM   6735  O  OH  . TYR A 1  868  ? 124.812 58.192  -8.565  1.00 25.42  ? 868  TYR A OH  1 
ATOM   6736  N  N   . GLY A 1  869  ? 127.454 62.685  -11.556 1.00 18.85  ? 869  GLY A N   1 
ATOM   6737  C  CA  . GLY A 1  869  ? 127.615 63.528  -10.386 1.00 21.41  ? 869  GLY A CA  1 
ATOM   6738  C  C   . GLY A 1  869  ? 128.652 64.627  -10.541 1.00 21.72  ? 869  GLY A C   1 
ATOM   6739  O  O   . GLY A 1  869  ? 129.038 65.291  -9.564  1.00 20.94  ? 869  GLY A O   1 
ATOM   6740  N  N   . GLU A 1  870  ? 129.104 64.827  -11.774 1.00 22.76  ? 870  GLU A N   1 
ATOM   6741  C  CA  . GLU A 1  870  ? 130.089 65.861  -12.053 1.00 24.60  ? 870  GLU A CA  1 
ATOM   6742  C  C   . GLU A 1  870  ? 131.407 65.496  -11.378 1.00 24.62  ? 870  GLU A C   1 
ATOM   6743  O  O   . GLU A 1  870  ? 132.220 66.383  -11.113 1.00 27.86  ? 870  GLU A O   1 
ATOM   6744  C  CB  . GLU A 1  870  ? 129.589 67.224  -11.519 1.00 23.14  ? 870  GLU A CB  1 
ATOM   6745  C  CG  . GLU A 1  870  ? 128.401 67.835  -12.279 1.00 23.80  ? 870  GLU A CG  1 
ATOM   6746  C  CD  . GLU A 1  870  ? 127.574 68.819  -11.450 1.00 22.84  ? 870  GLU A CD  1 
ATOM   6747  O  OE1 . GLU A 1  870  ? 128.157 69.590  -10.657 1.00 20.54  ? 870  GLU A OE1 1 
ATOM   6748  O  OE2 . GLU A 1  870  ? 126.332 68.827  -11.610 1.00 23.01  ? 870  GLU A OE2 1 
ATOM   6749  N  N   . ASP A 1  871  ? 131.622 64.206  -11.101 1.00 22.13  ? 871  ASP A N   1 
ATOM   6750  C  CA  . ASP A 1  871  ? 132.852 63.775  -10.426 1.00 23.34  ? 871  ASP A CA  1 
ATOM   6751  C  C   . ASP A 1  871  ? 133.231 62.323  -10.638 1.00 23.69  ? 871  ASP A C   1 
ATOM   6752  O  O   . ASP A 1  871  ? 134.246 61.866  -10.110 1.00 22.56  ? 871  ASP A O   1 
ATOM   6753  C  CB  . ASP A 1  871  ? 132.730 63.998  -8.922  1.00 24.45  ? 871  ASP A CB  1 
ATOM   6754  C  CG  . ASP A 1  871  ? 131.918 62.920  -8.246  1.00 26.65  ? 871  ASP A CG  1 
ATOM   6755  O  OD1 . ASP A 1  871  ? 131.123 62.257  -8.946  1.00 21.79  ? 871  ASP A OD1 1 
ATOM   6756  O  OD2 . ASP A 1  871  ? 132.068 62.745  -7.018  1.00 31.61  ? 871  ASP A OD2 1 
ATOM   6757  N  N   . GLY A 1  872  ? 132.397 61.596  -11.372 1.00 26.64  ? 872  GLY A N   1 
ATOM   6758  C  CA  . GLY A 1  872  ? 132.654 60.192  -11.641 1.00 28.74  ? 872  GLY A CA  1 
ATOM   6759  C  C   . GLY A 1  872  ? 132.966 59.352  -10.414 1.00 28.70  ? 872  GLY A C   1 
ATOM   6760  O  O   . GLY A 1  872  ? 133.824 58.481  -10.476 1.00 32.44  ? 872  GLY A O   1 
ATOM   6761  N  N   . MET A 1  873  ? 132.288 59.598  -9.301  1.00 27.22  ? 873  MET A N   1 
ATOM   6762  C  CA  . MET A 1  873  ? 132.537 58.812  -8.097  1.00 27.92  ? 873  MET A CA  1 
ATOM   6763  C  C   . MET A 1  873  ? 131.289 57.989  -7.773  1.00 27.04  ? 873  MET A C   1 
ATOM   6764  O  O   . MET A 1  873  ? 130.181 58.409  -8.090  1.00 27.30  ? 873  MET A O   1 
ATOM   6765  C  CB  . MET A 1  873  ? 132.862 59.742  -6.922  1.00 31.24  ? 873  MET A CB  1 
ATOM   6766  C  CG  . MET A 1  873  ? 134.194 59.474  -6.236  1.00 32.46  ? 873  MET A CG  1 
ATOM   6767  S  SD  . MET A 1  873  ? 135.539 59.467  -7.431  1.00 39.33  ? 873  MET A SD  1 
ATOM   6768  C  CE  . MET A 1  873  ? 135.777 61.242  -7.775  1.00 39.07  ? 873  MET A CE  1 
ATOM   6769  N  N   . ASP A 1  874  ? 131.449 56.814  -7.168  1.00 25.23  ? 874  ASP A N   1 
ATOM   6770  C  CA  . ASP A 1  874  ? 130.274 56.037  -6.817  1.00 22.99  ? 874  ASP A CA  1 
ATOM   6771  C  C   . ASP A 1  874  ? 129.876 56.295  -5.384  1.00 21.63  ? 874  ASP A C   1 
ATOM   6772  O  O   . ASP A 1  874  ? 130.639 56.072  -4.447  1.00 20.60  ? 874  ASP A O   1 
ATOM   6773  C  CB  . ASP A 1  874  ? 130.482 54.543  -7.027  1.00 25.19  ? 874  ASP A CB  1 
ATOM   6774  C  CG  . ASP A 1  874  ? 129.253 53.727  -6.619  1.00 31.24  ? 874  ASP A CG  1 
ATOM   6775  O  OD1 . ASP A 1  874  ? 128.134 54.307  -6.538  1.00 30.42  ? 874  ASP A OD1 1 
ATOM   6776  O  OD2 . ASP A 1  874  ? 129.404 52.502  -6.387  1.00 35.44  ? 874  ASP A OD2 1 
ATOM   6777  N  N   . ALA A 1  875  ? 128.650 56.774  -5.250  1.00 22.72  ? 875  ALA A N   1 
ATOM   6778  C  CA  . ALA A 1  875  ? 128.045 57.121  -3.978  1.00 23.13  ? 875  ALA A CA  1 
ATOM   6779  C  C   . ALA A 1  875  ? 128.506 56.286  -2.797  1.00 22.47  ? 875  ALA A C   1 
ATOM   6780  O  O   . ALA A 1  875  ? 128.639 56.788  -1.678  1.00 17.86  ? 875  ALA A O   1 
ATOM   6781  C  CB  . ALA A 1  875  ? 126.545 57.036  -4.115  1.00 24.02  ? 875  ALA A CB  1 
ATOM   6782  N  N   . ALA A 1  876  ? 128.745 55.010  -3.061  1.00 24.21  ? 876  ALA A N   1 
ATOM   6783  C  CA  . ALA A 1  876  ? 129.175 54.073  -2.037  1.00 27.59  ? 876  ALA A CA  1 
ATOM   6784  C  C   . ALA A 1  876  ? 130.452 54.488  -1.315  1.00 31.18  ? 876  ALA A C   1 
ATOM   6785  O  O   . ALA A 1  876  ? 130.591 54.279  -0.101  1.00 34.11  ? 876  ALA A O   1 
ATOM   6786  C  CB  . ALA A 1  876  ? 129.360 52.710  -2.659  1.00 29.25  ? 876  ALA A CB  1 
ATOM   6787  N  N   . HIS A 1  877  ? 131.378 55.076  -2.071  1.00 33.73  ? 877  HIS A N   1 
ATOM   6788  C  CA  . HIS A 1  877  ? 132.670 55.519  -1.540  1.00 37.86  ? 877  HIS A CA  1 
ATOM   6789  C  C   . HIS A 1  877  ? 132.725 57.026  -1.241  1.00 38.93  ? 877  HIS A C   1 
ATOM   6790  O  O   . HIS A 1  877  ? 133.440 57.751  -1.936  1.00 43.26  ? 877  HIS A O   1 
ATOM   6791  C  CB  . HIS A 1  877  ? 133.781 55.196  -2.549  1.00 38.21  ? 877  HIS A CB  1 
ATOM   6792  C  CG  . HIS A 1  877  ? 133.639 53.857  -3.203  1.00 39.53  ? 877  HIS A CG  1 
ATOM   6793  N  ND1 . HIS A 1  877  ? 133.963 52.679  -2.565  1.00 40.18  ? 877  HIS A ND1 1 
ATOM   6794  C  CD2 . HIS A 1  877  ? 133.177 53.512  -4.427  1.00 41.13  ? 877  HIS A CD2 1 
ATOM   6795  C  CE1 . HIS A 1  877  ? 133.706 51.663  -3.371  1.00 42.27  ? 877  HIS A CE1 1 
ATOM   6796  N  NE2 . HIS A 1  877  ? 133.229 52.140  -4.506  1.00 43.82  ? 877  HIS A NE2 1 
ATOM   6797  N  N   . ILE A 1  878  ? 131.991 57.508  -0.232  1.00 37.36  ? 878  ILE A N   1 
ATOM   6798  C  CA  . ILE A 1  878  ? 132.016 58.938  0.098   1.00 33.58  ? 878  ILE A CA  1 
ATOM   6799  C  C   . ILE A 1  878  ? 131.598 59.242  1.534   1.00 36.75  ? 878  ILE A C   1 
ATOM   6800  O  O   . ILE A 1  878  ? 130.777 58.532  2.110   1.00 38.13  ? 878  ILE A O   1 
ATOM   6801  C  CB  . ILE A 1  878  ? 131.116 59.729  -0.836  1.00 28.92  ? 878  ILE A CB  1 
ATOM   6802  C  CG1 . ILE A 1  878  ? 131.397 59.332  -2.284  1.00 26.10  ? 878  ILE A CG1 1 
ATOM   6803  C  CG2 . ILE A 1  878  ? 131.390 61.186  -0.661  1.00 27.97  ? 878  ILE A CG2 1 
ATOM   6804  C  CD1 . ILE A 1  878  ? 130.622 60.077  -3.312  1.00 29.32  ? 878  ILE A CD1 1 
ATOM   6805  N  N   . GLU A 1  879  ? 132.177 60.288  2.119   1.00 38.97  ? 879  GLU A N   1 
ATOM   6806  C  CA  . GLU A 1  879  ? 131.849 60.670  3.490   1.00 42.79  ? 879  GLU A CA  1 
ATOM   6807  C  C   . GLU A 1  879  ? 132.118 62.138  3.766   1.00 45.66  ? 879  GLU A C   1 
ATOM   6808  O  O   . GLU A 1  879  ? 132.741 62.844  2.972   1.00 44.54  ? 879  GLU A O   1 
ATOM   6809  C  CB  . GLU A 1  879  ? 132.647 59.851  4.498   1.00 42.84  ? 879  GLU A CB  1 
ATOM   6810  C  CG  . GLU A 1  879  ? 133.292 58.618  3.929   1.00 49.35  ? 879  GLU A CG  1 
ATOM   6811  C  CD  . GLU A 1  879  ? 134.248 57.975  4.909   1.00 52.13  ? 879  GLU A CD  1 
ATOM   6812  O  OE1 . GLU A 1  879  ? 135.007 57.070  4.489   1.00 55.57  ? 879  GLU A OE1 1 
ATOM   6813  O  OE2 . GLU A 1  879  ? 134.235 58.374  6.098   1.00 52.49  ? 879  GLU A OE2 1 
ATOM   6814  N  N   . LYS A 1  880  ? 131.651 62.583  4.924   1.00 52.04  ? 880  LYS A N   1 
ATOM   6815  C  CA  . LYS A 1  880  ? 131.817 63.963  5.327   1.00 58.62  ? 880  LYS A CA  1 
ATOM   6816  C  C   . LYS A 1  880  ? 133.186 64.248  5.905   1.00 59.32  ? 880  LYS A C   1 
ATOM   6817  O  O   . LYS A 1  880  ? 133.399 64.143  7.113   1.00 62.64  ? 880  LYS A O   1 
ATOM   6818  C  CB  . LYS A 1  880  ? 130.740 64.368  6.344   1.00 63.16  ? 880  LYS A CB  1 
ATOM   6819  C  CG  . LYS A 1  880  ? 129.557 65.091  5.708   1.00 70.47  ? 880  LYS A CG  1 
ATOM   6820  C  CD  . LYS A 1  880  ? 128.480 65.478  6.725   1.00 75.54  ? 880  LYS A CD  1 
ATOM   6821  C  CE  . LYS A 1  880  ? 127.217 66.001  6.007   1.00 78.20  ? 880  LYS A CE  1 
ATOM   6822  N  NZ  . LYS A 1  880  ? 126.033 66.207  6.906   1.00 77.15  ? 880  LYS A NZ  1 
ATOM   6823  N  N   . GLN A 1  881  ? 134.118 64.594  5.029   1.00 57.73  ? 881  GLN A N   1 
ATOM   6824  C  CA  . GLN A 1  881  ? 135.451 64.948  5.471   1.00 59.38  ? 881  GLN A CA  1 
ATOM   6825  C  C   . GLN A 1  881  ? 135.435 66.475  5.500   1.00 62.26  ? 881  GLN A C   1 
ATOM   6826  O  O   . GLN A 1  881  ? 134.564 67.090  4.881   1.00 64.87  ? 881  GLN A O   1 
ATOM   6827  C  CB  . GLN A 1  881  ? 136.484 64.463  4.469   1.00 57.58  ? 881  GLN A CB  1 
ATOM   6828  C  CG  . GLN A 1  881  ? 136.307 63.033  4.047   1.00 53.65  ? 881  GLN A CG  1 
ATOM   6829  C  CD  . GLN A 1  881  ? 137.575 62.465  3.452   1.00 51.57  ? 881  GLN A CD  1 
ATOM   6830  O  OE1 . GLN A 1  881  ? 138.626 62.457  4.103   1.00 48.16  ? 881  GLN A OE1 1 
ATOM   6831  N  NE2 . GLN A 1  881  ? 137.489 61.988  2.211   1.00 47.10  ? 881  GLN A NE2 1 
ATOM   6832  N  N   . SER A 1  882  ? 136.381 67.094  6.205   1.00 64.22  ? 882  SER A N   1 
ATOM   6833  C  CA  . SER A 1  882  ? 136.420 68.557  6.281   1.00 62.69  ? 882  SER A CA  1 
ATOM   6834  C  C   . SER A 1  882  ? 137.538 69.194  5.462   1.00 59.69  ? 882  SER A C   1 
ATOM   6835  O  O   . SER A 1  882  ? 138.630 68.637  5.315   1.00 59.47  ? 882  SER A O   1 
ATOM   6836  C  CB  . SER A 1  882  ? 136.554 69.011  7.737   1.00 64.50  ? 882  SER A CB  1 
ATOM   6837  O  OG  . SER A 1  882  ? 137.743 68.499  8.319   1.00 69.21  ? 882  SER A OG  1 
ATOM   6838  N  N   . LEU A 1  883  ? 137.238 70.370  4.925   1.00 54.69  ? 883  LEU A N   1 
ATOM   6839  C  CA  . LEU A 1  883  ? 138.191 71.138  4.147   1.00 52.52  ? 883  LEU A CA  1 
ATOM   6840  C  C   . LEU A 1  883  ? 138.870 72.128  5.103   1.00 56.58  ? 883  LEU A C   1 
ATOM   6841  O  O   . LEU A 1  883  ? 138.455 73.286  5.203   1.00 60.17  ? 883  LEU A O   1 
ATOM   6842  C  CB  . LEU A 1  883  ? 137.445 71.883  3.051   1.00 43.18  ? 883  LEU A CB  1 
ATOM   6843  C  CG  . LEU A 1  883  ? 136.881 70.930  2.020   1.00 36.67  ? 883  LEU A CG  1 
ATOM   6844  C  CD1 . LEU A 1  883  ? 136.093 71.658  0.960   1.00 33.83  ? 883  LEU A CD1 1 
ATOM   6845  C  CD2 . LEU A 1  883  ? 138.049 70.221  1.403   1.00 35.10  ? 883  LEU A CD2 1 
ATOM   6846  N  N   . ASP A 1  884  ? 139.901 71.673  5.815   1.00 57.73  ? 884  ASP A N   1 
ATOM   6847  C  CA  . ASP A 1  884  ? 140.616 72.519  6.776   1.00 56.61  ? 884  ASP A CA  1 
ATOM   6848  C  C   . ASP A 1  884  ? 140.992 73.886  6.192   1.00 55.48  ? 884  ASP A C   1 
ATOM   6849  O  O   . ASP A 1  884  ? 140.943 74.900  6.892   1.00 56.05  ? 884  ASP A O   1 
ATOM   6850  C  CB  . ASP A 1  884  ? 141.896 71.823  7.256   1.00 59.25  ? 884  ASP A CB  1 
ATOM   6851  C  CG  . ASP A 1  884  ? 141.639 70.459  7.881   1.00 59.77  ? 884  ASP A CG  1 
ATOM   6852  O  OD1 . ASP A 1  884  ? 140.923 70.378  8.906   1.00 61.86  ? 884  ASP A OD1 1 
ATOM   6853  O  OD2 . ASP A 1  884  ? 142.172 69.463  7.345   1.00 59.50  ? 884  ASP A OD2 1 
ATOM   6854  N  N   . THR A 1  885  ? 141.376 73.895  4.914   1.00 52.46  ? 885  THR A N   1 
ATOM   6855  C  CA  . THR A 1  885  ? 141.775 75.114  4.212   1.00 50.62  ? 885  THR A CA  1 
ATOM   6856  C  C   . THR A 1  885  ? 140.755 76.245  4.289   1.00 51.19  ? 885  THR A C   1 
ATOM   6857  O  O   . THR A 1  885  ? 141.127 77.372  4.570   1.00 54.05  ? 885  THR A O   1 
ATOM   6858  C  CB  . THR A 1  885  ? 142.098 74.829  2.708   1.00 51.07  ? 885  THR A CB  1 
ATOM   6859  O  OG1 . THR A 1  885  ? 143.397 74.234  2.600   1.00 51.43  ? 885  THR A OG1 1 
ATOM   6860  C  CG2 . THR A 1  885  ? 142.080 76.110  1.883   1.00 48.90  ? 885  THR A CG2 1 
ATOM   6861  N  N   . ILE A 1  886  ? 139.477 75.970  4.056   1.00 51.01  ? 886  ILE A N   1 
ATOM   6862  C  CA  . ILE A 1  886  ? 138.485 77.040  4.100   1.00 52.29  ? 886  ILE A CA  1 
ATOM   6863  C  C   . ILE A 1  886  ? 138.325 77.766  5.440   1.00 57.64  ? 886  ILE A C   1 
ATOM   6864  O  O   . ILE A 1  886  ? 138.757 78.911  5.580   1.00 56.37  ? 886  ILE A O   1 
ATOM   6865  C  CB  . ILE A 1  886  ? 137.106 76.545  3.608   1.00 47.83  ? 886  ILE A CB  1 
ATOM   6866  C  CG1 . ILE A 1  886  ? 137.055 76.640  2.083   1.00 44.52  ? 886  ILE A CG1 1 
ATOM   6867  C  CG2 . ILE A 1  886  ? 135.988 77.373  4.210   1.00 49.75  ? 886  ILE A CG2 1 
ATOM   6868  C  CD1 . ILE A 1  886  ? 135.673 76.535  1.495   1.00 38.32  ? 886  ILE A CD1 1 
ATOM   6869  N  N   . GLY A 1  887  ? 137.707 77.119  6.421   1.00 63.61  ? 887  GLY A N   1 
ATOM   6870  C  CA  . GLY A 1  887  ? 137.513 77.772  7.706   1.00 70.04  ? 887  GLY A CA  1 
ATOM   6871  C  C   . GLY A 1  887  ? 138.793 78.277  8.353   1.00 73.32  ? 887  GLY A C   1 
ATOM   6872  O  O   . GLY A 1  887  ? 139.895 77.879  7.963   1.00 75.12  ? 887  GLY A O   1 
ATOM   6873  N  N   . GLY A 1  888  ? 138.649 79.165  9.336   1.00 74.42  ? 888  GLY A N   1 
ATOM   6874  C  CA  . GLY A 1  888  ? 139.809 79.691  10.041  1.00 74.78  ? 888  GLY A CA  1 
ATOM   6875  C  C   . GLY A 1  888  ? 140.314 81.051  9.592   1.00 74.98  ? 888  GLY A C   1 
ATOM   6876  O  O   . GLY A 1  888  ? 140.156 81.429  8.434   1.00 75.61  ? 888  GLY A O   1 
ATOM   6877  N  N   . SER A 1  889  ? 140.938 81.773  10.522  1.00 73.74  ? 889  SER A N   1 
ATOM   6878  C  CA  . SER A 1  889  ? 141.487 83.111  10.277  1.00 71.94  ? 889  SER A CA  1 
ATOM   6879  C  C   . SER A 1  889  ? 142.789 83.117  9.468   1.00 69.44  ? 889  SER A C   1 
ATOM   6880  O  O   . SER A 1  889  ? 143.616 82.218  9.610   1.00 72.15  ? 889  SER A O   1 
ATOM   6881  C  CB  . SER A 1  889  ? 141.738 83.808  11.619  1.00 73.17  ? 889  SER A CB  1 
ATOM   6882  O  OG  . SER A 1  889  ? 142.518 82.990  12.479  1.00 73.78  ? 889  SER A OG  1 
ATOM   6883  N  N   . ASP A 1  890  ? 142.975 84.133  8.630   1.00 63.42  ? 890  ASP A N   1 
ATOM   6884  C  CA  . ASP A 1  890  ? 144.195 84.243  7.838   1.00 59.50  ? 890  ASP A CA  1 
ATOM   6885  C  C   . ASP A 1  890  ? 145.404 84.073  8.763   1.00 57.23  ? 890  ASP A C   1 
ATOM   6886  O  O   . ASP A 1  890  ? 146.505 83.762  8.321   1.00 55.23  ? 890  ASP A O   1 
ATOM   6887  C  CB  . ASP A 1  890  ? 144.259 85.617  7.165   1.00 61.50  ? 890  ASP A CB  1 
ATOM   6888  C  CG  . ASP A 1  890  ? 144.013 85.558  5.663   1.00 63.79  ? 890  ASP A CG  1 
ATOM   6889  O  OD1 . ASP A 1  890  ? 144.829 84.940  4.938   1.00 65.29  ? 890  ASP A OD1 1 
ATOM   6890  O  OD2 . ASP A 1  890  ? 143.006 86.142  5.205   1.00 63.34  ? 890  ASP A OD2 1 
ATOM   6891  N  N   . ALA A 1  891  ? 145.175 84.273  10.056  1.00 56.83  ? 891  ALA A N   1 
ATOM   6892  C  CA  . ALA A 1  891  ? 146.217 84.177  11.077  1.00 57.33  ? 891  ALA A CA  1 
ATOM   6893  C  C   . ALA A 1  891  ? 146.691 82.764  11.384  1.00 57.74  ? 891  ALA A C   1 
ATOM   6894  O  O   . ALA A 1  891  ? 147.891 82.497  11.385  1.00 57.45  ? 891  ALA A O   1 
ATOM   6895  C  CB  . ALA A 1  891  ? 145.732 84.838  12.365  1.00 57.27  ? 891  ALA A CB  1 
ATOM   6896  N  N   . ALA A 1  892  ? 145.743 81.874  11.673  1.00 58.85  ? 892  ALA A N   1 
ATOM   6897  C  CA  . ALA A 1  892  ? 146.048 80.482  11.996  1.00 58.19  ? 892  ALA A CA  1 
ATOM   6898  C  C   . ALA A 1  892  ? 146.481 79.728  10.753  1.00 56.80  ? 892  ALA A C   1 
ATOM   6899  O  O   . ALA A 1  892  ? 147.434 78.955  10.792  1.00 58.08  ? 892  ALA A O   1 
ATOM   6900  C  CB  . ALA A 1  892  ? 144.832 79.806  12.612  1.00 58.14  ? 892  ALA A CB  1 
ATOM   6901  N  N   . PHE A 1  893  ? 145.774 79.951  9.654   1.00 53.55  ? 893  PHE A N   1 
ATOM   6902  C  CA  . PHE A 1  893  ? 146.109 79.295  8.411   1.00 53.15  ? 893  PHE A CA  1 
ATOM   6903  C  C   . PHE A 1  893  ? 147.608 79.360  8.179   1.00 56.16  ? 893  PHE A C   1 
ATOM   6904  O  O   . PHE A 1  893  ? 148.224 78.376  7.786   1.00 56.43  ? 893  PHE A O   1 
ATOM   6905  C  CB  . PHE A 1  893  ? 145.397 79.966  7.259   1.00 50.11  ? 893  PHE A CB  1 
ATOM   6906  C  CG  . PHE A 1  893  ? 145.783 79.424  5.926   1.00 50.59  ? 893  PHE A CG  1 
ATOM   6907  C  CD1 . PHE A 1  893  ? 144.926 78.600  5.224   1.00 52.00  ? 893  PHE A CD1 1 
ATOM   6908  C  CD2 . PHE A 1  893  ? 146.993 79.762  5.348   1.00 52.73  ? 893  PHE A CD2 1 
ATOM   6909  C  CE1 . PHE A 1  893  ? 145.273 78.112  3.954   1.00 52.00  ? 893  PHE A CE1 1 
ATOM   6910  C  CE2 . PHE A 1  893  ? 147.347 79.279  4.080   1.00 53.34  ? 893  PHE A CE2 1 
ATOM   6911  C  CZ  . PHE A 1  893  ? 146.481 78.459  3.382   1.00 50.23  ? 893  PHE A CZ  1 
ATOM   6912  N  N   . GLU A 1  894  ? 148.199 80.524  8.415   1.00 60.41  ? 894  GLU A N   1 
ATOM   6913  C  CA  . GLU A 1  894  ? 149.636 80.684  8.227   1.00 65.14  ? 894  GLU A CA  1 
ATOM   6914  C  C   . GLU A 1  894  ? 150.381 79.850  9.281   1.00 67.18  ? 894  GLU A C   1 
ATOM   6915  O  O   . GLU A 1  894  ? 151.316 79.117  8.957   1.00 67.38  ? 894  GLU A O   1 
ATOM   6916  C  CB  . GLU A 1  894  ? 150.024 82.168  8.344   1.00 68.07  ? 894  GLU A CB  1 
ATOM   6917  C  CG  . GLU A 1  894  ? 151.352 82.544  7.672   1.00 73.76  ? 894  GLU A CG  1 
ATOM   6918  C  CD  . GLU A 1  894  ? 151.756 84.004  7.890   1.00 76.93  ? 894  GLU A CD  1 
ATOM   6919  O  OE1 . GLU A 1  894  ? 152.108 84.373  9.036   1.00 79.17  ? 894  GLU A OE1 1 
ATOM   6920  O  OE2 . GLU A 1  894  ? 151.720 84.782  6.911   1.00 78.41  ? 894  GLU A OE2 1 
ATOM   6921  N  N   . LYS A 1  895  ? 149.952 79.950  10.538  1.00 70.38  ? 895  LYS A N   1 
ATOM   6922  C  CA  . LYS A 1  895  ? 150.586 79.205  11.630  1.00 73.07  ? 895  LYS A CA  1 
ATOM   6923  C  C   . LYS A 1  895  ? 150.459 77.703  11.422  1.00 71.90  ? 895  LYS A C   1 
ATOM   6924  O  O   . LYS A 1  895  ? 150.846 76.915  12.289  1.00 74.36  ? 895  LYS A O   1 
ATOM   6925  C  CB  . LYS A 1  895  ? 149.955 79.570  12.994  1.00 75.74  ? 895  LYS A CB  1 
ATOM   6926  C  CG  . LYS A 1  895  ? 150.583 78.828  14.206  1.00 79.68  ? 895  LYS A CG  1 
ATOM   6927  C  CD  . LYS A 1  895  ? 149.926 79.162  15.559  1.00 82.25  ? 895  LYS A CD  1 
ATOM   6928  C  CE  . LYS A 1  895  ? 150.582 78.383  16.716  1.00 83.60  ? 895  LYS A CE  1 
ATOM   6929  N  NZ  . LYS A 1  895  ? 149.969 78.641  18.060  1.00 83.13  ? 895  LYS A NZ  1 
ATOM   6930  N  N   . ARG A 1  896  ? 149.939 77.295  10.271  1.00 68.23  ? 896  ARG A N   1 
ATOM   6931  C  CA  . ARG A 1  896  ? 149.756 75.878  10.044  1.00 64.97  ? 896  ARG A CA  1 
ATOM   6932  C  C   . ARG A 1  896  ? 150.414 75.311  8.809   1.00 61.07  ? 896  ARG A C   1 
ATOM   6933  O  O   . ARG A 1  896  ? 151.139 74.337  8.907   1.00 61.41  ? 896  ARG A O   1 
ATOM   6934  C  CB  . ARG A 1  896  ? 148.267 75.569  10.018  1.00 67.55  ? 896  ARG A CB  1 
ATOM   6935  C  CG  . ARG A 1  896  ? 147.911 74.109  10.169  1.00 70.94  ? 896  ARG A CG  1 
ATOM   6936  C  CD  . ARG A 1  896  ? 146.394 73.980  10.196  1.00 74.10  ? 896  ARG A CD  1 
ATOM   6937  N  NE  . ARG A 1  896  ? 145.927 72.648  10.555  1.00 75.76  ? 896  ARG A NE  1 
ATOM   6938  C  CZ  . ARG A 1  896  ? 144.644 72.316  10.638  1.00 75.50  ? 896  ARG A CZ  1 
ATOM   6939  N  NH1 . ARG A 1  896  ? 143.712 73.228  10.379  1.00 73.99  ? 896  ARG A NH1 1 
ATOM   6940  N  NH2 . ARG A 1  896  ? 144.298 71.083  10.996  1.00 76.18  ? 896  ARG A NH2 1 
ATOM   6941  N  N   . TYR A 1  897  ? 150.177 75.916  7.654   1.00 57.19  ? 897  TYR A N   1 
ATOM   6942  C  CA  . TYR A 1  897  ? 150.741 75.405  6.410   1.00 56.07  ? 897  TYR A CA  1 
ATOM   6943  C  C   . TYR A 1  897  ? 151.972 76.165  5.948   1.00 57.62  ? 897  TYR A C   1 
ATOM   6944  O  O   . TYR A 1  897  ? 152.600 75.794  4.946   1.00 58.17  ? 897  TYR A O   1 
ATOM   6945  C  CB  . TYR A 1  897  ? 149.697 75.466  5.303   1.00 52.62  ? 897  TYR A CB  1 
ATOM   6946  C  CG  . TYR A 1  897  ? 148.379 74.875  5.686   1.00 51.43  ? 897  TYR A CG  1 
ATOM   6947  C  CD1 . TYR A 1  897  ? 147.873 75.053  6.961   1.00 52.32  ? 897  TYR A CD1 1 
ATOM   6948  C  CD2 . TYR A 1  897  ? 147.621 74.156  4.774   1.00 52.15  ? 897  TYR A CD2 1 
ATOM   6949  C  CE1 . TYR A 1  897  ? 146.657 74.538  7.328   1.00 54.86  ? 897  TYR A CE1 1 
ATOM   6950  C  CE2 . TYR A 1  897  ? 146.385 73.629  5.134   1.00 55.15  ? 897  TYR A CE2 1 
ATOM   6951  C  CZ  . TYR A 1  897  ? 145.912 73.827  6.423   1.00 55.86  ? 897  TYR A CZ  1 
ATOM   6952  O  OH  . TYR A 1  897  ? 144.698 73.321  6.829   1.00 58.53  ? 897  TYR A OH  1 
ATOM   6953  N  N   . ARG A 1  898  ? 152.317 77.224  6.677   1.00 58.58  ? 898  ARG A N   1 
ATOM   6954  C  CA  . ARG A 1  898  ? 153.463 78.058  6.320   1.00 57.54  ? 898  ARG A CA  1 
ATOM   6955  C  C   . ARG A 1  898  ? 154.816 77.582  6.806   1.00 55.71  ? 898  ARG A C   1 
ATOM   6956  O  O   . ARG A 1  898  ? 155.068 77.432  8.007   1.00 53.46  ? 898  ARG A O   1 
ATOM   6957  C  CB  . ARG A 1  898  ? 153.248 79.491  6.802   1.00 61.09  ? 898  ARG A CB  1 
ATOM   6958  C  CG  . ARG A 1  898  ? 154.351 80.469  6.398   1.00 64.73  ? 898  ARG A CG  1 
ATOM   6959  C  CD  . ARG A 1  898  ? 154.716 80.378  4.914   1.00 67.86  ? 898  ARG A CD  1 
ATOM   6960  N  NE  . ARG A 1  898  ? 155.342 81.614  4.444   1.00 70.59  ? 898  ARG A NE  1 
ATOM   6961  C  CZ  . ARG A 1  898  ? 156.005 81.733  3.297   1.00 71.70  ? 898  ARG A CZ  1 
ATOM   6962  N  NH1 . ARG A 1  898  ? 156.136 80.683  2.495   1.00 68.82  ? 898  ARG A NH1 1 
ATOM   6963  N  NH2 . ARG A 1  898  ? 156.529 82.906  2.954   1.00 72.48  ? 898  ARG A NH2 1 
ATOM   6964  N  N   . VAL A 1  899  ? 155.694 77.354  5.846   1.00 54.37  ? 899  VAL A N   1 
ATOM   6965  C  CA  . VAL A 1  899  ? 157.029 76.921  6.162   1.00 54.80  ? 899  VAL A CA  1 
ATOM   6966  C  C   . VAL A 1  899  ? 157.990 77.835  5.437   1.00 57.04  ? 899  VAL A C   1 
ATOM   6967  O  O   . VAL A 1  899  ? 157.946 77.956  4.208   1.00 58.24  ? 899  VAL A O   1 
ATOM   6968  C  CB  . VAL A 1  899  ? 157.236 75.466  5.753   1.00 53.53  ? 899  VAL A CB  1 
ATOM   6969  C  CG1 . VAL A 1  899  ? 158.711 75.130  5.688   1.00 52.12  ? 899  VAL A CG1 1 
ATOM   6970  C  CG2 . VAL A 1  899  ? 156.559 74.577  6.763   1.00 53.67  ? 899  VAL A CG2 1 
ATOM   6971  N  N   . ASP A 1  900  ? 158.829 78.503  6.226   1.00 57.68  ? 900  ASP A N   1 
ATOM   6972  C  CA  . ASP A 1  900  ? 159.828 79.438  5.724   1.00 57.37  ? 900  ASP A CA  1 
ATOM   6973  C  C   . ASP A 1  900  ? 161.165 78.917  6.220   1.00 55.16  ? 900  ASP A C   1 
ATOM   6974  O  O   . ASP A 1  900  ? 161.449 78.957  7.412   1.00 55.47  ? 900  ASP A O   1 
ATOM   6975  C  CB  . ASP A 1  900  ? 159.573 80.837  6.295   1.00 62.83  ? 900  ASP A CB  1 
ATOM   6976  C  CG  . ASP A 1  900  ? 160.317 81.930  5.540   1.00 67.28  ? 900  ASP A CG  1 
ATOM   6977  O  OD1 . ASP A 1  900  ? 161.526 81.754  5.279   1.00 71.96  ? 900  ASP A OD1 1 
ATOM   6978  O  OD2 . ASP A 1  900  ? 159.697 82.971  5.219   1.00 68.18  ? 900  ASP A OD2 1 
ATOM   6979  N  N   . LEU A 1  901  ? 161.975 78.424  5.295   1.00 53.06  ? 901  LEU A N   1 
ATOM   6980  C  CA  . LEU A 1  901  ? 163.276 77.868  5.624   1.00 53.09  ? 901  LEU A CA  1 
ATOM   6981  C  C   . LEU A 1  901  ? 164.287 78.957  5.919   1.00 52.93  ? 901  LEU A C   1 
ATOM   6982  O  O   . LEU A 1  901  ? 165.386 78.675  6.407   1.00 55.93  ? 901  LEU A O   1 
ATOM   6983  C  CB  . LEU A 1  901  ? 163.778 77.002  4.467   1.00 53.17  ? 901  LEU A CB  1 
ATOM   6984  C  CG  . LEU A 1  901  ? 162.825 75.862  4.095   1.00 54.86  ? 901  LEU A CG  1 
ATOM   6985  C  CD1 . LEU A 1  901  ? 163.335 75.116  2.857   1.00 54.14  ? 901  LEU A CD1 1 
ATOM   6986  C  CD2 . LEU A 1  901  ? 162.672 74.928  5.306   1.00 54.74  ? 901  LEU A CD2 1 
ATOM   6987  N  N   . LEU A 1  902  ? 163.910 80.197  5.618   1.00 50.58  ? 902  LEU A N   1 
ATOM   6988  C  CA  . LEU A 1  902  ? 164.777 81.350  5.838   1.00 49.23  ? 902  LEU A CA  1 
ATOM   6989  C  C   . LEU A 1  902  ? 164.250 82.180  7.004   1.00 52.19  ? 902  LEU A C   1 
ATOM   6990  O  O   . LEU A 1  902  ? 163.810 83.312  6.814   1.00 52.75  ? 902  LEU A O   1 
ATOM   6991  C  CB  . LEU A 1  902  ? 164.815 82.210  4.577   1.00 40.99  ? 902  LEU A CB  1 
ATOM   6992  C  CG  . LEU A 1  902  ? 164.811 81.417  3.276   1.00 35.04  ? 902  LEU A CG  1 
ATOM   6993  C  CD1 . LEU A 1  902  ? 164.612 82.357  2.113   1.00 36.00  ? 902  LEU A CD1 1 
ATOM   6994  C  CD2 . LEU A 1  902  ? 166.095 80.652  3.134   1.00 31.24  ? 902  LEU A CD2 1 
ATOM   6995  N  N   . ASN A 1  903  ? 164.284 81.622  8.208   1.00 55.41  ? 903  ASN A N   1 
ATOM   6996  C  CA  . ASN A 1  903  ? 163.801 82.358  9.360   1.00 59.16  ? 903  ASN A CA  1 
ATOM   6997  C  C   . ASN A 1  903  ? 163.797 81.544  10.644  1.00 61.77  ? 903  ASN A C   1 
ATOM   6998  O  O   . ASN A 1  903  ? 163.091 80.550  10.757  1.00 62.26  ? 903  ASN A O   1 
ATOM   6999  C  CB  . ASN A 1  903  ? 162.397 82.876  9.079   1.00 59.88  ? 903  ASN A CB  1 
ATOM   7000  C  CG  . ASN A 1  903  ? 161.892 83.783  10.166  1.00 63.48  ? 903  ASN A CG  1 
ATOM   7001  O  OD1 . ASN A 1  903  ? 160.877 84.448  9.999   1.00 66.92  ? 903  ASN A OD1 1 
ATOM   7002  N  ND2 . ASN A 1  903  ? 162.593 83.814  11.296  1.00 65.58  ? 903  ASN A ND2 1 
ATOM   7003  N  N   . THR A 1  904  ? 164.575 81.991  11.618  1.00 65.16  ? 904  THR A N   1 
ATOM   7004  C  CA  . THR A 1  904  ? 164.674 81.319  12.903  1.00 71.08  ? 904  THR A CA  1 
ATOM   7005  C  C   . THR A 1  904  ? 163.326 80.946  13.513  1.00 74.93  ? 904  THR A C   1 
ATOM   7006  O  O   . THR A 1  904  ? 163.208 79.919  14.184  1.00 76.59  ? 904  THR A O   1 
ATOM   7007  C  CB  . THR A 1  904  ? 165.392 82.206  13.914  1.00 71.20  ? 904  THR A CB  1 
ATOM   7008  O  OG1 . THR A 1  904  ? 166.561 82.747  13.299  1.00 73.44  ? 904  THR A OG1 1 
ATOM   7009  C  CG2 . THR A 1  904  ? 165.786 81.410  15.163  1.00 71.12  ? 904  THR A CG2 1 
ATOM   7010  N  N   . ASP A 1  905  ? 162.311 81.774  13.282  1.00 78.05  ? 905  ASP A N   1 
ATOM   7011  C  CA  . ASP A 1  905  ? 160.992 81.539  13.867  1.00 79.99  ? 905  ASP A CA  1 
ATOM   7012  C  C   . ASP A 1  905  ? 159.940 80.935  12.938  1.00 78.62  ? 905  ASP A C   1 
ATOM   7013  O  O   . ASP A 1  905  ? 158.812 80.678  13.364  1.00 78.39  ? 905  ASP A O   1 
ATOM   7014  C  CB  . ASP A 1  905  ? 160.439 82.854  14.448  1.00 83.66  ? 905  ASP A CB  1 
ATOM   7015  C  CG  . ASP A 1  905  ? 161.363 83.486  15.499  1.00 86.68  ? 905  ASP A CG  1 
ATOM   7016  O  OD1 . ASP A 1  905  ? 161.725 82.792  16.481  1.00 88.29  ? 905  ASP A OD1 1 
ATOM   7017  O  OD2 . ASP A 1  905  ? 161.715 84.683  15.346  1.00 85.67  ? 905  ASP A OD2 1 
ATOM   7018  N  N   . HIS A 1  906  ? 160.295 80.703  11.679  1.00 77.23  ? 906  HIS A N   1 
ATOM   7019  C  CA  . HIS A 1  906  ? 159.331 80.155  10.729  1.00 75.98  ? 906  HIS A CA  1 
ATOM   7020  C  C   . HIS A 1  906  ? 159.831 78.967  9.904   1.00 73.11  ? 906  HIS A C   1 
ATOM   7021  O  O   . HIS A 1  906  ? 159.314 78.678  8.820   1.00 69.44  ? 906  HIS A O   1 
ATOM   7022  C  CB  . HIS A 1  906  ? 158.828 81.285  9.820   1.00 79.50  ? 906  HIS A CB  1 
ATOM   7023  C  CG  . HIS A 1  906  ? 157.762 82.136  10.452  1.00 83.22  ? 906  HIS A CG  1 
ATOM   7024  N  ND1 . HIS A 1  906  ? 157.661 82.314  11.816  1.00 83.44  ? 906  HIS A ND1 1 
ATOM   7025  C  CD2 . HIS A 1  906  ? 156.746 82.847  9.904   1.00 84.02  ? 906  HIS A CD2 1 
ATOM   7026  C  CE1 . HIS A 1  906  ? 156.628 83.094  12.082  1.00 84.13  ? 906  HIS A CE1 1 
ATOM   7027  N  NE2 . HIS A 1  906  ? 156.056 83.431  10.939  1.00 84.84  ? 906  HIS A NE2 1 
ATOM   7028  N  N   . THR A 1  907  ? 160.833 78.278  10.446  1.00 71.42  ? 907  THR A N   1 
ATOM   7029  C  CA  . THR A 1  907  ? 161.419 77.098  9.812   1.00 70.02  ? 907  THR A CA  1 
ATOM   7030  C  C   . THR A 1  907  ? 161.082 75.861  10.635  1.00 69.89  ? 907  THR A C   1 
ATOM   7031  O  O   . THR A 1  907  ? 160.759 75.953  11.821  1.00 70.56  ? 907  THR A O   1 
ATOM   7032  C  CB  . THR A 1  907  ? 162.967 77.206  9.697   1.00 68.81  ? 907  THR A CB  1 
ATOM   7033  O  OG1 . THR A 1  907  ? 163.305 78.087  8.619   1.00 69.36  ? 907  THR A OG1 1 
ATOM   7034  C  CG2 . THR A 1  907  ? 163.597 75.838  9.438   1.00 66.07  ? 907  THR A CG2 1 
ATOM   7035  N  N   . LEU A 1  908  ? 161.152 74.703  9.991   1.00 69.68  ? 908  LEU A N   1 
ATOM   7036  C  CA  . LEU A 1  908  ? 160.868 73.447  10.655  1.00 70.09  ? 908  LEU A CA  1 
ATOM   7037  C  C   . LEU A 1  908  ? 161.968 73.191  11.675  1.00 73.61  ? 908  LEU A C   1 
ATOM   7038  O  O   . LEU A 1  908  ? 163.150 73.064  11.329  1.00 75.14  ? 908  LEU A O   1 
ATOM   7039  C  CB  . LEU A 1  908  ? 160.837 72.322  9.627   1.00 66.34  ? 908  LEU A CB  1 
ATOM   7040  C  CG  . LEU A 1  908  ? 160.170 72.728  8.317   1.00 62.98  ? 908  LEU A CG  1 
ATOM   7041  C  CD1 . LEU A 1  908  ? 160.243 71.607  7.314   1.00 60.64  ? 908  LEU A CD1 1 
ATOM   7042  C  CD2 . LEU A 1  908  ? 158.738 73.101  8.601   1.00 63.19  ? 908  LEU A CD2 1 
ATOM   7043  N  N   . ASP A 1  909  ? 161.575 73.136  12.940  1.00 76.03  ? 909  ASP A N   1 
ATOM   7044  C  CA  . ASP A 1  909  ? 162.522 72.884  14.007  1.00 77.41  ? 909  ASP A CA  1 
ATOM   7045  C  C   . ASP A 1  909  ? 163.148 71.518  13.744  1.00 77.44  ? 909  ASP A C   1 
ATOM   7046  O  O   . ASP A 1  909  ? 162.445 70.517  13.672  1.00 79.19  ? 909  ASP A O   1 
ATOM   7047  C  CB  . ASP A 1  909  ? 161.789 72.881  15.339  1.00 80.02  ? 909  ASP A CB  1 
ATOM   7048  C  CG  . ASP A 1  909  ? 162.726 72.816  16.503  1.00 83.41  ? 909  ASP A CG  1 
ATOM   7049  O  OD1 . ASP A 1  909  ? 163.550 71.875  16.540  1.00 85.42  ? 909  ASP A OD1 1 
ATOM   7050  O  OD2 . ASP A 1  909  ? 162.638 73.706  17.377  1.00 85.64  ? 909  ASP A OD2 1 
ATOM   7051  N  N   . PRO A 1  910  ? 164.481 71.453  13.618  1.00 77.44  ? 910  PRO A N   1 
ATOM   7052  C  CA  . PRO A 1  910  ? 165.181 70.189  13.356  1.00 77.69  ? 910  PRO A CA  1 
ATOM   7053  C  C   . PRO A 1  910  ? 164.702 68.982  14.167  1.00 76.76  ? 910  PRO A C   1 
ATOM   7054  O  O   . PRO A 1  910  ? 164.927 67.836  13.769  1.00 78.49  ? 910  PRO A O   1 
ATOM   7055  C  CB  . PRO A 1  910  ? 166.638 70.535  13.646  1.00 79.21  ? 910  PRO A CB  1 
ATOM   7056  C  CG  . PRO A 1  910  ? 166.513 71.562  14.721  1.00 79.95  ? 910  PRO A CG  1 
ATOM   7057  C  CD  . PRO A 1  910  ? 165.418 72.447  14.161  1.00 78.84  ? 910  PRO A CD  1 
ATOM   7058  N  N   . SER A 1  911  ? 164.051 69.228  15.300  1.00 73.83  ? 911  SER A N   1 
ATOM   7059  C  CA  . SER A 1  911  ? 163.554 68.129  16.117  1.00 70.90  ? 911  SER A CA  1 
ATOM   7060  C  C   . SER A 1  911  ? 162.441 67.364  15.389  1.00 68.91  ? 911  SER A C   1 
ATOM   7061  O  O   . SER A 1  911  ? 161.865 66.422  15.936  1.00 68.30  ? 911  SER A O   1 
ATOM   7062  C  CB  . SER A 1  911  ? 163.050 68.653  17.468  1.00 70.94  ? 911  SER A CB  1 
ATOM   7063  O  OG  . SER A 1  911  ? 162.033 69.626  17.308  1.00 69.22  ? 911  SER A OG  1 
ATOM   7064  N  N   . LEU A 1  912  ? 162.154 67.770  14.153  1.00 65.96  ? 912  LEU A N   1 
ATOM   7065  C  CA  . LEU A 1  912  ? 161.128 67.123  13.345  1.00 64.27  ? 912  LEU A CA  1 
ATOM   7066  C  C   . LEU A 1  912  ? 161.738 66.433  12.155  1.00 63.45  ? 912  LEU A C   1 
ATOM   7067  O  O   . LEU A 1  912  ? 161.649 65.221  12.016  1.00 63.75  ? 912  LEU A O   1 
ATOM   7068  C  CB  . LEU A 1  912  ? 160.108 68.130  12.844  1.00 65.12  ? 912  LEU A CB  1 
ATOM   7069  C  CG  . LEU A 1  912  ? 159.416 68.923  13.944  1.00 67.26  ? 912  LEU A CG  1 
ATOM   7070  C  CD1 . LEU A 1  912  ? 158.212 69.633  13.356  1.00 68.63  ? 912  LEU A CD1 1 
ATOM   7071  C  CD2 . LEU A 1  912  ? 158.986 67.995  15.068  1.00 69.44  ? 912  LEU A CD2 1 
ATOM   7072  N  N   . LEU A 1  913  ? 162.344 67.205  11.272  1.00 62.82  ? 913  LEU A N   1 
ATOM   7073  C  CA  . LEU A 1  913  ? 162.966 66.603  10.118  1.00 65.58  ? 913  LEU A CA  1 
ATOM   7074  C  C   . LEU A 1  913  ? 164.368 66.162  10.506  1.00 69.41  ? 913  LEU A C   1 
ATOM   7075  O  O   . LEU A 1  913  ? 164.952 66.686  11.451  1.00 72.03  ? 913  LEU A O   1 
ATOM   7076  C  CB  . LEU A 1  913  ? 163.001 67.598  8.963   1.00 63.89  ? 913  LEU A CB  1 
ATOM   7077  C  CG  . LEU A 1  913  ? 163.795 67.244  7.703   1.00 64.49  ? 913  LEU A CG  1 
ATOM   7078  C  CD1 . LEU A 1  913  ? 163.743 65.761  7.409   1.00 65.05  ? 913  LEU A CD1 1 
ATOM   7079  C  CD2 . LEU A 1  913  ? 163.225 68.037  6.542   1.00 65.19  ? 913  LEU A CD2 1 
ATOM   7080  N  N   . GLU A 1  914  ? 164.890 65.173  9.787   1.00 73.21  ? 914  GLU A N   1 
ATOM   7081  C  CA  . GLU A 1  914  ? 166.228 64.638  10.031  1.00 75.58  ? 914  GLU A CA  1 
ATOM   7082  C  C   . GLU A 1  914  ? 167.204 65.649  9.457   1.00 75.15  ? 914  GLU A C   1 
ATOM   7083  O  O   . GLU A 1  914  ? 168.155 66.072  10.118  1.00 74.81  ? 914  GLU A O   1 
ATOM   7084  C  CB  . GLU A 1  914  ? 166.381 63.285  9.321   1.00 77.93  ? 914  GLU A CB  1 
ATOM   7085  C  CG  . GLU A 1  914  ? 167.421 62.342  9.924   1.00 80.45  ? 914  GLU A CG  1 
ATOM   7086  C  CD  . GLU A 1  914  ? 167.168 60.884  9.558   1.00 81.05  ? 914  GLU A CD  1 
ATOM   7087  O  OE1 . GLU A 1  914  ? 167.181 60.554  8.347   1.00 81.15  ? 914  GLU A OE1 1 
ATOM   7088  O  OE2 . GLU A 1  914  ? 166.951 60.074  10.488  1.00 80.50  ? 914  GLU A OE2 1 
ATOM   7089  N  N   . SER A 1  915  ? 166.945 66.031  8.213   1.00 75.26  ? 915  SER A N   1 
ATOM   7090  C  CA  . SER A 1  915  ? 167.755 67.016  7.522   1.00 76.91  ? 915  SER A CA  1 
ATOM   7091  C  C   . SER A 1  915  ? 167.169 68.389  7.852   1.00 77.59  ? 915  SER A C   1 
ATOM   7092  O  O   . SER A 1  915  ? 167.019 69.233  6.974   1.00 79.78  ? 915  SER A O   1 
ATOM   7093  C  CB  . SER A 1  915  ? 167.712 66.762  6.005   1.00 77.62  ? 915  SER A CB  1 
ATOM   7094  O  OG  . SER A 1  915  ? 166.388 66.770  5.487   1.00 75.78  ? 915  SER A OG  1 
ATOM   7095  N  N   . GLY A 1  916  ? 166.843 68.605  9.126   1.00 77.29  ? 916  GLY A N   1 
ATOM   7096  C  CA  . GLY A 1  916  ? 166.247 69.866  9.549   1.00 75.47  ? 916  GLY A CA  1 
ATOM   7097  C  C   . GLY A 1  916  ? 167.171 71.065  9.586   1.00 73.86  ? 916  GLY A C   1 
ATOM   7098  O  O   . GLY A 1  916  ? 166.903 72.099  8.964   1.00 71.61  ? 916  GLY A O   1 
ATOM   7099  N  N   . SER A 1  917  ? 168.263 70.928  10.328  1.00 72.97  ? 917  SER A N   1 
ATOM   7100  C  CA  . SER A 1  917  ? 169.224 72.005  10.446  1.00 71.52  ? 917  SER A CA  1 
ATOM   7101  C  C   . SER A 1  917  ? 169.967 72.245  9.140   1.00 70.65  ? 917  SER A C   1 
ATOM   7102  O  O   . SER A 1  917  ? 170.318 73.377  8.846   1.00 71.63  ? 917  SER A O   1 
ATOM   7103  C  CB  . SER A 1  917  ? 170.217 71.706  11.566  1.00 71.34  ? 917  SER A CB  1 
ATOM   7104  O  OG  . SER A 1  917  ? 170.845 70.460  11.346  1.00 73.37  ? 917  SER A OG  1 
ATOM   7105  N  N   . GLU A 1  918  ? 170.209 71.205  8.347   1.00 69.95  ? 918  GLU A N   1 
ATOM   7106  C  CA  . GLU A 1  918  ? 170.922 71.417  7.088   1.00 70.87  ? 918  GLU A CA  1 
ATOM   7107  C  C   . GLU A 1  918  ? 169.996 71.920  5.981   1.00 69.13  ? 918  GLU A C   1 
ATOM   7108  O  O   . GLU A 1  918  ? 170.281 71.783  4.784   1.00 66.84  ? 918  GLU A O   1 
ATOM   7109  C  CB  . GLU A 1  918  ? 171.636 70.143  6.632   1.00 75.19  ? 918  GLU A CB  1 
ATOM   7110  C  CG  . GLU A 1  918  ? 170.727 68.992  6.258   1.00 82.94  ? 918  GLU A CG  1 
ATOM   7111  C  CD  . GLU A 1  918  ? 171.406 67.999  5.323   1.00 87.50  ? 918  GLU A CD  1 
ATOM   7112  O  OE1 . GLU A 1  918  ? 171.773 68.401  4.190   1.00 90.30  ? 918  GLU A OE1 1 
ATOM   7113  O  OE2 . GLU A 1  918  ? 171.572 66.822  5.722   1.00 89.00  ? 918  GLU A OE2 1 
ATOM   7114  N  N   . ILE A 1  919  ? 168.884 72.512  6.402   1.00 67.70  ? 919  ILE A N   1 
ATOM   7115  C  CA  . ILE A 1  919  ? 167.893 73.067  5.490   1.00 66.81  ? 919  ILE A CA  1 
ATOM   7116  C  C   . ILE A 1  919  ? 167.796 74.578  5.705   1.00 65.45  ? 919  ILE A C   1 
ATOM   7117  O  O   . ILE A 1  919  ? 167.924 75.367  4.757   1.00 66.17  ? 919  ILE A O   1 
ATOM   7118  C  CB  . ILE A 1  919  ? 166.514 72.434  5.739   1.00 67.00  ? 919  ILE A CB  1 
ATOM   7119  C  CG1 . ILE A 1  919  ? 166.401 71.133  4.959   1.00 68.60  ? 919  ILE A CG1 1 
ATOM   7120  C  CG2 . ILE A 1  919  ? 165.415 73.370  5.312   1.00 68.58  ? 919  ILE A CG2 1 
ATOM   7121  C  CD1 . ILE A 1  919  ? 165.061 70.455  5.119   1.00 70.09  ? 919  ILE A CD1 1 
ATOM   7122  N  N   . LEU A 1  920  ? 167.556 74.957  6.963   1.00 61.35  ? 920  LEU A N   1 
ATOM   7123  C  CA  . LEU A 1  920  ? 167.441 76.351  7.388   1.00 54.58  ? 920  LEU A CA  1 
ATOM   7124  C  C   . LEU A 1  920  ? 168.321 77.206  6.509   1.00 51.64  ? 920  LEU A C   1 
ATOM   7125  O  O   . LEU A 1  920  ? 169.472 77.428  6.829   1.00 50.81  ? 920  LEU A O   1 
ATOM   7126  C  CB  . LEU A 1  920  ? 167.917 76.472  8.831   1.00 53.61  ? 920  LEU A CB  1 
ATOM   7127  C  CG  . LEU A 1  920  ? 167.755 77.766  9.612   1.00 52.35  ? 920  LEU A CG  1 
ATOM   7128  C  CD1 . LEU A 1  920  ? 168.563 77.639  10.892  1.00 53.33  ? 920  LEU A CD1 1 
ATOM   7129  C  CD2 . LEU A 1  920  ? 168.226 78.952  8.811   1.00 50.78  ? 920  LEU A CD2 1 
ATOM   7130  N  N   . GLY A 1  921  ? 167.795 77.676  5.394   1.00 50.49  ? 921  GLY A N   1 
ATOM   7131  C  CA  . GLY A 1  921  ? 168.620 78.492  4.541   1.00 52.51  ? 921  GLY A CA  1 
ATOM   7132  C  C   . GLY A 1  921  ? 168.568 78.103  3.087   1.00 56.65  ? 921  GLY A C   1 
ATOM   7133  O  O   . GLY A 1  921  ? 168.505 78.978  2.228   1.00 57.50  ? 921  GLY A O   1 
ATOM   7134  N  N   . ASP A 1  922  ? 168.586 76.810  2.788   1.00 59.80  ? 922  ASP A N   1 
ATOM   7135  C  CA  . ASP A 1  922  ? 168.554 76.403  1.387   1.00 62.19  ? 922  ASP A CA  1 
ATOM   7136  C  C   . ASP A 1  922  ? 167.578 77.255  0.598   1.00 60.62  ? 922  ASP A C   1 
ATOM   7137  O  O   . ASP A 1  922  ? 166.404 77.344  0.935   1.00 58.31  ? 922  ASP A O   1 
ATOM   7138  C  CB  . ASP A 1  922  ? 168.155 74.940  1.221   1.00 65.86  ? 922  ASP A CB  1 
ATOM   7139  C  CG  . ASP A 1  922  ? 168.158 74.508  -0.246  1.00 69.80  ? 922  ASP A CG  1 
ATOM   7140  O  OD1 . ASP A 1  922  ? 167.686 75.295  -1.103  1.00 68.88  ? 922  ASP A OD1 1 
ATOM   7141  O  OD2 . ASP A 1  922  ? 168.627 73.384  -0.543  1.00 72.62  ? 922  ASP A OD2 1 
ATOM   7142  N  N   . LEU A 1  923  ? 168.068 77.870  -0.465  1.00 62.12  ? 923  LEU A N   1 
ATOM   7143  C  CA  . LEU A 1  923  ? 167.218 78.715  -1.272  1.00 67.16  ? 923  LEU A CA  1 
ATOM   7144  C  C   . LEU A 1  923  ? 166.542 77.983  -2.411  1.00 66.33  ? 923  LEU A C   1 
ATOM   7145  O  O   . LEU A 1  923  ? 165.582 78.488  -2.995  1.00 67.95  ? 923  LEU A O   1 
ATOM   7146  C  CB  . LEU A 1  923  ? 168.014 79.893  -1.827  1.00 75.08  ? 923  LEU A CB  1 
ATOM   7147  C  CG  . LEU A 1  923  ? 167.743 81.237  -1.136  1.00 81.40  ? 923  LEU A CG  1 
ATOM   7148  C  CD1 . LEU A 1  923  ? 168.551 82.339  -1.828  1.00 84.44  ? 923  LEU A CD1 1 
ATOM   7149  C  CD2 . LEU A 1  923  ? 166.240 81.563  -1.191  1.00 84.94  ? 923  LEU A CD2 1 
ATOM   7150  N  N   . LYS A 1  924  ? 167.038 76.799  -2.741  1.00 63.80  ? 924  LYS A N   1 
ATOM   7151  C  CA  . LYS A 1  924  ? 166.431 76.041  -3.819  1.00 61.09  ? 924  LYS A CA  1 
ATOM   7152  C  C   . LYS A 1  924  ? 165.137 75.355  -3.363  1.00 55.46  ? 924  LYS A C   1 
ATOM   7153  O  O   . LYS A 1  924  ? 164.255 75.072  -4.180  1.00 52.48  ? 924  LYS A O   1 
ATOM   7154  C  CB  . LYS A 1  924  ? 167.436 75.028  -4.374  1.00 66.06  ? 924  LYS A CB  1 
ATOM   7155  C  CG  . LYS A 1  924  ? 168.587 75.675  -5.136  1.00 71.81  ? 924  LYS A CG  1 
ATOM   7156  C  CD  . LYS A 1  924  ? 169.410 74.643  -5.904  1.00 77.55  ? 924  LYS A CD  1 
ATOM   7157  C  CE  . LYS A 1  924  ? 170.454 75.311  -6.805  1.00 81.01  ? 924  LYS A CE  1 
ATOM   7158  N  NZ  . LYS A 1  924  ? 171.274 74.331  -7.585  1.00 81.75  ? 924  LYS A NZ  1 
ATOM   7159  N  N   . LEU A 1  925  ? 165.020 75.113  -2.057  1.00 49.31  ? 925  LEU A N   1 
ATOM   7160  C  CA  . LEU A 1  925  ? 163.828 74.478  -1.498  1.00 45.07  ? 925  LEU A CA  1 
ATOM   7161  C  C   . LEU A 1  925  ? 162.741 75.498  -1.193  1.00 44.01  ? 925  LEU A C   1 
ATOM   7162  O  O   . LEU A 1  925  ? 161.550 75.192  -1.278  1.00 45.84  ? 925  LEU A O   1 
ATOM   7163  C  CB  . LEU A 1  925  ? 164.138 73.725  -0.202  1.00 41.74  ? 925  LEU A CB  1 
ATOM   7164  C  CG  . LEU A 1  925  ? 165.173 72.603  -0.153  1.00 38.88  ? 925  LEU A CG  1 
ATOM   7165  C  CD1 . LEU A 1  925  ? 164.880 71.744  1.068   1.00 35.70  ? 925  LEU A CD1 1 
ATOM   7166  C  CD2 . LEU A 1  925  ? 165.119 71.768  -1.410  1.00 37.22  ? 925  LEU A CD2 1 
ATOM   7167  N  N   . GLN A 1  926  ? 163.137 76.703  -0.806  1.00 42.21  ? 926  GLN A N   1 
ATOM   7168  C  CA  . GLN A 1  926  ? 162.144 77.717  -0.521  1.00 41.43  ? 926  GLN A CA  1 
ATOM   7169  C  C   . GLN A 1  926  ? 161.470 78.139  -1.811  1.00 42.27  ? 926  GLN A C   1 
ATOM   7170  O  O   . GLN A 1  926  ? 160.692 79.082  -1.828  1.00 42.61  ? 926  GLN A O   1 
ATOM   7171  C  CB  . GLN A 1  926  ? 162.775 78.916  0.160   1.00 40.48  ? 926  GLN A CB  1 
ATOM   7172  C  CG  . GLN A 1  926  ? 162.671 78.876  1.672   1.00 41.12  ? 926  GLN A CG  1 
ATOM   7173  C  CD  . GLN A 1  926  ? 161.239 78.948  2.172   1.00 39.33  ? 926  GLN A CD  1 
ATOM   7174  O  OE1 . GLN A 1  926  ? 160.421 79.707  1.661   1.00 38.79  ? 926  GLN A OE1 1 
ATOM   7175  N  NE2 . GLN A 1  926  ? 160.938 78.170  3.191   1.00 39.64  ? 926  GLN A NE2 1 
ATOM   7176  N  N   . VAL A 1  927  ? 161.791 77.450  -2.900  1.00 43.36  ? 927  VAL A N   1 
ATOM   7177  C  CA  . VAL A 1  927  ? 161.159 77.730  -4.180  1.00 45.14  ? 927  VAL A CA  1 
ATOM   7178  C  C   . VAL A 1  927  ? 159.959 76.805  -4.214  1.00 45.89  ? 927  VAL A C   1 
ATOM   7179  O  O   . VAL A 1  927  ? 158.865 77.190  -4.637  1.00 48.49  ? 927  VAL A O   1 
ATOM   7180  C  CB  . VAL A 1  927  ? 162.076 77.399  -5.355  1.00 45.71  ? 927  VAL A CB  1 
ATOM   7181  C  CG1 . VAL A 1  927  ? 161.271 77.327  -6.654  1.00 46.29  ? 927  VAL A CG1 1 
ATOM   7182  C  CG2 . VAL A 1  927  ? 163.137 78.465  -5.465  1.00 48.61  ? 927  VAL A CG2 1 
ATOM   7183  N  N   . LEU A 1  928  ? 160.178 75.574  -3.764  1.00 43.78  ? 928  LEU A N   1 
ATOM   7184  C  CA  . LEU A 1  928  ? 159.112 74.589  -3.699  1.00 40.71  ? 928  LEU A CA  1 
ATOM   7185  C  C   . LEU A 1  928  ? 158.299 74.955  -2.487  1.00 40.52  ? 928  LEU A C   1 
ATOM   7186  O  O   . LEU A 1  928  ? 157.143 75.337  -2.598  1.00 41.97  ? 928  LEU A O   1 
ATOM   7187  C  CB  . LEU A 1  928  ? 159.659 73.181  -3.498  1.00 35.41  ? 928  LEU A CB  1 
ATOM   7188  C  CG  . LEU A 1  928  ? 160.504 72.620  -4.625  1.00 34.89  ? 928  LEU A CG  1 
ATOM   7189  C  CD1 . LEU A 1  928  ? 160.964 71.254  -4.205  1.00 32.83  ? 928  LEU A CD1 1 
ATOM   7190  C  CD2 . LEU A 1  928  ? 159.714 72.572  -5.928  1.00 33.10  ? 928  LEU A CD2 1 
ATOM   7191  N  N   . LEU A 1  929  ? 158.926 74.844  -1.325  1.00 39.89  ? 929  LEU A N   1 
ATOM   7192  C  CA  . LEU A 1  929  ? 158.263 75.146  -0.083  1.00 42.23  ? 929  LEU A CA  1 
ATOM   7193  C  C   . LEU A 1  929  ? 157.282 76.300  -0.267  1.00 46.43  ? 929  LEU A C   1 
ATOM   7194  O  O   . LEU A 1  929  ? 156.258 76.360  0.414   1.00 46.59  ? 929  LEU A O   1 
ATOM   7195  C  CB  . LEU A 1  929  ? 159.295 75.482  0.980   1.00 41.08  ? 929  LEU A CB  1 
ATOM   7196  C  CG  . LEU A 1  929  ? 158.912 75.020  2.383   1.00 39.78  ? 929  LEU A CG  1 
ATOM   7197  C  CD1 . LEU A 1  929  ? 157.492 75.467  2.723   1.00 39.61  ? 929  LEU A CD1 1 
ATOM   7198  C  CD2 . LEU A 1  929  ? 159.024 73.523  2.442   1.00 36.49  ? 929  LEU A CD2 1 
ATOM   7199  N  N   . ASP A 1  930  ? 157.587 77.214  -1.188  1.00 53.51  ? 930  ASP A N   1 
ATOM   7200  C  CA  . ASP A 1  930  ? 156.684 78.337  -1.461  1.00 63.42  ? 930  ASP A CA  1 
ATOM   7201  C  C   . ASP A 1  930  ? 155.640 77.988  -2.534  1.00 66.02  ? 930  ASP A C   1 
ATOM   7202  O  O   . ASP A 1  930  ? 154.468 78.339  -2.385  1.00 67.76  ? 930  ASP A O   1 
ATOM   7203  C  CB  . ASP A 1  930  ? 157.456 79.604  -1.876  1.00 68.90  ? 930  ASP A CB  1 
ATOM   7204  C  CG  . ASP A 1  930  ? 157.953 80.421  -0.675  1.00 73.13  ? 930  ASP A CG  1 
ATOM   7205  O  OD1 . ASP A 1  930  ? 157.225 80.512  0.339   1.00 75.20  ? 930  ASP A OD1 1 
ATOM   7206  O  OD2 . ASP A 1  930  ? 159.066 80.989  -0.755  1.00 74.65  ? 930  ASP A OD2 1 
ATOM   7207  N  N   . GLU A 1  931  ? 156.055 77.313  -3.609  1.00 68.58  ? 931  GLU A N   1 
ATOM   7208  C  CA  . GLU A 1  931  ? 155.118 76.903  -4.662  1.00 71.12  ? 931  GLU A CA  1 
ATOM   7209  C  C   . GLU A 1  931  ? 153.915 76.227  -4.012  1.00 69.37  ? 931  GLU A C   1 
ATOM   7210  O  O   . GLU A 1  931  ? 152.789 76.339  -4.500  1.00 69.41  ? 931  GLU A O   1 
ATOM   7211  C  CB  . GLU A 1  931  ? 155.769 75.902  -5.615  1.00 77.13  ? 931  GLU A CB  1 
ATOM   7212  C  CG  . GLU A 1  931  ? 156.453 76.500  -6.833  1.00 87.39  ? 931  GLU A CG  1 
ATOM   7213  C  CD  . GLU A 1  931  ? 157.031 75.423  -7.763  1.00 93.92  ? 931  GLU A CD  1 
ATOM   7214  O  OE1 . GLU A 1  931  ? 158.126 74.884  -7.460  1.00 96.48  ? 931  GLU A OE1 1 
ATOM   7215  O  OE2 . GLU A 1  931  ? 156.381 75.107  -8.793  1.00 97.11  ? 931  GLU A OE2 1 
ATOM   7216  N  N   . GLU A 1  932  ? 154.185 75.507  -2.921  1.00 67.46  ? 932  GLU A N   1 
ATOM   7217  C  CA  . GLU A 1  932  ? 153.165 74.805  -2.139  1.00 63.95  ? 932  GLU A CA  1 
ATOM   7218  C  C   . GLU A 1  932  ? 152.239 75.834  -1.512  1.00 61.17  ? 932  GLU A C   1 
ATOM   7219  O  O   . GLU A 1  932  ? 151.027 75.822  -1.732  1.00 61.19  ? 932  GLU A O   1 
ATOM   7220  C  CB  . GLU A 1  932  ? 153.808 73.962  -1.010  1.00 64.61  ? 932  GLU A CB  1 
ATOM   7221  C  CG  . GLU A 1  932  ? 152.847 73.625  0.173   1.00 64.37  ? 932  GLU A CG  1 
ATOM   7222  C  CD  . GLU A 1  932  ? 153.453 72.734  1.282   1.00 62.28  ? 932  GLU A CD  1 
ATOM   7223  O  OE1 . GLU A 1  932  ? 153.728 71.535  1.020   1.00 59.32  ? 932  GLU A OE1 1 
ATOM   7224  O  OE2 . GLU A 1  932  ? 153.634 73.237  2.421   1.00 58.64  ? 932  GLU A OE2 1 
ATOM   7225  N  N   . TYR A 1  933  ? 152.822 76.732  -0.731  1.00 56.44  ? 933  TYR A N   1 
ATOM   7226  C  CA  . TYR A 1  933  ? 152.032 77.738  -0.065  1.00 54.50  ? 933  TYR A CA  1 
ATOM   7227  C  C   . TYR A 1  933  ? 151.139 78.526  -1.013  1.00 55.50  ? 933  TYR A C   1 
ATOM   7228  O  O   . TYR A 1  933  ? 149.924 78.545  -0.844  1.00 56.60  ? 933  TYR A O   1 
ATOM   7229  C  CB  . TYR A 1  933  ? 152.928 78.694  0.699   1.00 52.00  ? 933  TYR A CB  1 
ATOM   7230  C  CG  . TYR A 1  933  ? 152.189 79.380  1.810   1.00 49.28  ? 933  TYR A CG  1 
ATOM   7231  C  CD1 . TYR A 1  933  ? 152.278 78.913  3.114   1.00 49.25  ? 933  TYR A CD1 1 
ATOM   7232  C  CD2 . TYR A 1  933  ? 151.371 80.478  1.557   1.00 47.75  ? 933  TYR A CD2 1 
ATOM   7233  C  CE1 . TYR A 1  933  ? 151.573 79.524  4.141   1.00 49.66  ? 933  TYR A CE1 1 
ATOM   7234  C  CE2 . TYR A 1  933  ? 150.662 81.100  2.577   1.00 47.56  ? 933  TYR A CE2 1 
ATOM   7235  C  CZ  . TYR A 1  933  ? 150.768 80.620  3.873   1.00 49.57  ? 933  TYR A CZ  1 
ATOM   7236  O  OH  . TYR A 1  933  ? 150.104 81.249  4.914   1.00 51.00  ? 933  TYR A OH  1 
ATOM   7237  N  N   . LYS A 1  934  ? 151.731 79.175  -2.011  1.00 57.82  ? 934  LYS A N   1 
ATOM   7238  C  CA  . LYS A 1  934  ? 150.944 79.968  -2.952  1.00 60.43  ? 934  LYS A CA  1 
ATOM   7239  C  C   . LYS A 1  934  ? 149.813 79.148  -3.538  1.00 57.65  ? 934  LYS A C   1 
ATOM   7240  O  O   . LYS A 1  934  ? 148.908 79.693  -4.173  1.00 60.82  ? 934  LYS A O   1 
ATOM   7241  C  CB  . LYS A 1  934  ? 151.820 80.520  -4.088  1.00 67.12  ? 934  LYS A CB  1 
ATOM   7242  C  CG  . LYS A 1  934  ? 152.748 81.666  -3.662  1.00 75.92  ? 934  LYS A CG  1 
ATOM   7243  C  CD  . LYS A 1  934  ? 153.476 82.309  -4.852  1.00 81.95  ? 934  LYS A CD  1 
ATOM   7244  C  CE  . LYS A 1  934  ? 154.383 83.470  -4.408  1.00 85.38  ? 934  LYS A CE  1 
ATOM   7245  N  NZ  . LYS A 1  934  ? 155.035 84.178  -5.562  1.00 87.26  ? 934  LYS A NZ  1 
ATOM   7246  N  N   . GLN A 1  935  ? 149.858 77.838  -3.312  1.00 51.75  ? 935  GLN A N   1 
ATOM   7247  C  CA  . GLN A 1  935  ? 148.828 76.950  -3.824  1.00 45.24  ? 935  GLN A CA  1 
ATOM   7248  C  C   . GLN A 1  935  ? 147.725 76.736  -2.812  1.00 40.08  ? 935  GLN A C   1 
ATOM   7249  O  O   . GLN A 1  935  ? 146.567 76.968  -3.117  1.00 36.69  ? 935  GLN A O   1 
ATOM   7250  C  CB  . GLN A 1  935  ? 149.425 75.607  -4.213  1.00 47.92  ? 935  GLN A CB  1 
ATOM   7251  C  CG  . GLN A 1  935  ? 148.475 74.723  -4.984  1.00 46.70  ? 935  GLN A CG  1 
ATOM   7252  C  CD  . GLN A 1  935  ? 147.985 75.371  -6.265  1.00 45.79  ? 935  GLN A CD  1 
ATOM   7253  O  OE1 . GLN A 1  935  ? 148.744 76.015  -6.983  1.00 43.24  ? 935  GLN A OE1 1 
ATOM   7254  N  NE2 . GLN A 1  935  ? 146.711 75.184  -6.564  1.00 48.08  ? 935  GLN A NE2 1 
ATOM   7255  N  N   . LEU A 1  936  ? 148.079 76.295  -1.609  1.00 37.39  ? 936  LEU A N   1 
ATOM   7256  C  CA  . LEU A 1  936  ? 147.070 76.075  -0.575  1.00 38.82  ? 936  LEU A CA  1 
ATOM   7257  C  C   . LEU A 1  936  ? 146.279 77.361  -0.466  1.00 40.86  ? 936  LEU A C   1 
ATOM   7258  O  O   . LEU A 1  936  ? 145.121 77.379  -0.039  1.00 43.13  ? 936  LEU A O   1 
ATOM   7259  C  CB  . LEU A 1  936  ? 147.709 75.784  0.780   1.00 36.20  ? 936  LEU A CB  1 
ATOM   7260  C  CG  . LEU A 1  936  ? 149.090 75.145  0.802   1.00 35.71  ? 936  LEU A CG  1 
ATOM   7261  C  CD1 . LEU A 1  936  ? 149.329 74.629  2.202   1.00 35.81  ? 936  LEU A CD1 1 
ATOM   7262  C  CD2 . LEU A 1  936  ? 149.198 74.018  -0.215  1.00 36.27  ? 936  LEU A CD2 1 
ATOM   7263  N  N   . VAL A 1  937  ? 146.941 78.442  -0.853  1.00 42.21  ? 937  VAL A N   1 
ATOM   7264  C  CA  . VAL A 1  937  ? 146.356 79.766  -0.844  1.00 43.17  ? 937  VAL A CA  1 
ATOM   7265  C  C   . VAL A 1  937  ? 145.400 79.880  -2.008  1.00 43.23  ? 937  VAL A C   1 
ATOM   7266  O  O   . VAL A 1  937  ? 144.192 79.997  -1.806  1.00 42.47  ? 937  VAL A O   1 
ATOM   7267  C  CB  . VAL A 1  937  ? 147.447 80.822  -0.970  1.00 44.85  ? 937  VAL A CB  1 
ATOM   7268  C  CG1 . VAL A 1  937  ? 146.885 82.101  -1.566  1.00 44.95  ? 937  VAL A CG1 1 
ATOM   7269  C  CG2 . VAL A 1  937  ? 148.052 81.070  0.404   1.00 46.20  ? 937  VAL A CG2 1 
ATOM   7270  N  N   . LYS A 1  938  ? 145.939 79.831  -3.225  1.00 44.82  ? 938  LYS A N   1 
ATOM   7271  C  CA  . LYS A 1  938  ? 145.100 79.923  -4.410  1.00 48.36  ? 938  LYS A CA  1 
ATOM   7272  C  C   . LYS A 1  938  ? 143.881 79.046  -4.181  1.00 48.97  ? 938  LYS A C   1 
ATOM   7273  O  O   . LYS A 1  938  ? 142.794 79.306  -4.702  1.00 51.00  ? 938  LYS A O   1 
ATOM   7274  C  CB  . LYS A 1  938  ? 145.831 79.436  -5.660  1.00 49.46  ? 938  LYS A CB  1 
ATOM   7275  C  CG  . LYS A 1  938  ? 144.989 79.624  -6.915  1.00 52.33  ? 938  LYS A CG  1 
ATOM   7276  C  CD  . LYS A 1  938  ? 145.354 78.670  -8.045  1.00 56.14  ? 938  LYS A CD  1 
ATOM   7277  C  CE  . LYS A 1  938  ? 146.721 78.960  -8.656  1.00 57.50  ? 938  LYS A CE  1 
ATOM   7278  N  NZ  . LYS A 1  938  ? 146.962 78.151  -9.899  1.00 55.20  ? 938  LYS A NZ  1 
ATOM   7279  N  N   . ASP A 1  939  ? 144.080 77.997  -3.391  1.00 48.62  ? 939  ASP A N   1 
ATOM   7280  C  CA  . ASP A 1  939  ? 143.012 77.074  -3.058  1.00 47.70  ? 939  ASP A CA  1 
ATOM   7281  C  C   . ASP A 1  939  ? 142.017 77.797  -2.173  1.00 44.37  ? 939  ASP A C   1 
ATOM   7282  O  O   . ASP A 1  939  ? 140.881 78.035  -2.572  1.00 41.31  ? 939  ASP A O   1 
ATOM   7283  C  CB  . ASP A 1  939  ? 143.579 75.843  -2.334  1.00 52.48  ? 939  ASP A CB  1 
ATOM   7284  C  CG  . ASP A 1  939  ? 144.094 74.773  -3.303  1.00 55.40  ? 939  ASP A CG  1 
ATOM   7285  O  OD1 . ASP A 1  939  ? 144.432 75.117  -4.462  1.00 55.44  ? 939  ASP A OD1 1 
ATOM   7286  O  OD2 . ASP A 1  939  ? 144.165 73.586  -2.901  1.00 56.96  ? 939  ASP A OD2 1 
ATOM   7287  N  N   . ARG A 1  940  ? 142.455 78.165  -0.979  1.00 43.20  ? 940  ARG A N   1 
ATOM   7288  C  CA  . ARG A 1  940  ? 141.582 78.853  -0.051  1.00 45.47  ? 940  ARG A CA  1 
ATOM   7289  C  C   . ARG A 1  940  ? 140.626 79.769  -0.788  1.00 48.38  ? 940  ARG A C   1 
ATOM   7290  O  O   . ARG A 1  940  ? 139.420 79.750  -0.549  1.00 49.12  ? 940  ARG A O   1 
ATOM   7291  C  CB  . ARG A 1  940  ? 142.401 79.667  0.934   1.00 43.24  ? 940  ARG A CB  1 
ATOM   7292  C  CG  . ARG A 1  940  ? 141.611 80.142  2.126   1.00 43.47  ? 940  ARG A CG  1 
ATOM   7293  C  CD  . ARG A 1  940  ? 142.532 80.143  3.314   1.00 47.28  ? 940  ARG A CD  1 
ATOM   7294  N  NE  . ARG A 1  940  ? 141.861 80.298  4.601   1.00 49.07  ? 940  ARG A NE  1 
ATOM   7295  C  CZ  . ARG A 1  940  ? 141.646 81.462  5.194   1.00 48.86  ? 940  ARG A CZ  1 
ATOM   7296  N  NH1 . ARG A 1  940  ? 142.045 82.584  4.609   1.00 50.22  ? 940  ARG A NH1 1 
ATOM   7297  N  NH2 . ARG A 1  940  ? 141.058 81.498  6.379   1.00 47.34  ? 940  ARG A NH2 1 
ATOM   7298  N  N   . LYS A 1  941  ? 141.163 80.558  -1.706  1.00 52.95  ? 941  LYS A N   1 
ATOM   7299  C  CA  . LYS A 1  941  ? 140.328 81.487  -2.456  1.00 59.97  ? 941  LYS A CA  1 
ATOM   7300  C  C   . LYS A 1  941  ? 139.327 80.728  -3.313  1.00 58.78  ? 941  LYS A C   1 
ATOM   7301  O  O   . LYS A 1  941  ? 138.125 80.993  -3.252  1.00 61.26  ? 941  LYS A O   1 
ATOM   7302  C  CB  . LYS A 1  941  ? 141.194 82.416  -3.320  1.00 67.26  ? 941  LYS A CB  1 
ATOM   7303  C  CG  . LYS A 1  941  ? 142.286 83.171  -2.519  1.00 79.12  ? 941  LYS A CG  1 
ATOM   7304  C  CD  . LYS A 1  941  ? 141.718 84.018  -1.348  1.00 86.32  ? 941  LYS A CD  1 
ATOM   7305  C  CE  . LYS A 1  941  ? 142.372 83.707  0.036   1.00 89.15  ? 941  LYS A CE  1 
ATOM   7306  N  NZ  . LYS A 1  941  ? 143.777 84.200  0.264   1.00 89.22  ? 941  LYS A NZ  1 
ATOM   7307  N  N   . PHE A 1  942  ? 139.819 79.779  -4.102  1.00 55.27  ? 942  PHE A N   1 
ATOM   7308  C  CA  . PHE A 1  942  ? 138.944 78.980  -4.946  1.00 49.57  ? 942  PHE A CA  1 
ATOM   7309  C  C   . PHE A 1  942  ? 137.737 78.491  -4.154  1.00 48.07  ? 942  PHE A C   1 
ATOM   7310  O  O   . PHE A 1  942  ? 136.592 78.690  -4.556  1.00 49.27  ? 942  PHE A O   1 
ATOM   7311  C  CB  . PHE A 1  942  ? 139.684 77.761  -5.478  1.00 47.25  ? 942  PHE A CB  1 
ATOM   7312  C  CG  . PHE A 1  942  ? 138.814 76.837  -6.273  1.00 41.14  ? 942  PHE A CG  1 
ATOM   7313  C  CD1 . PHE A 1  942  ? 138.827 76.883  -7.663  1.00 40.11  ? 942  PHE A CD1 1 
ATOM   7314  C  CD2 . PHE A 1  942  ? 137.946 75.956  -5.633  1.00 35.67  ? 942  PHE A CD2 1 
ATOM   7315  C  CE1 . PHE A 1  942  ? 137.988 76.076  -8.403  1.00 38.02  ? 942  PHE A CE1 1 
ATOM   7316  C  CE2 . PHE A 1  942  ? 137.104 75.149  -6.363  1.00 33.67  ? 942  PHE A CE2 1 
ATOM   7317  C  CZ  . PHE A 1  942  ? 137.122 75.205  -7.750  1.00 35.42  ? 942  PHE A CZ  1 
ATOM   7318  N  N   . LEU A 1  943  ? 138.005 77.836  -3.031  1.00 44.58  ? 943  LEU A N   1 
ATOM   7319  C  CA  . LEU A 1  943  ? 136.942 77.298  -2.200  1.00 44.00  ? 943  LEU A CA  1 
ATOM   7320  C  C   . LEU A 1  943  ? 135.932 78.327  -1.745  1.00 43.73  ? 943  LEU A C   1 
ATOM   7321  O  O   . LEU A 1  943  ? 134.729 78.153  -1.936  1.00 45.55  ? 943  LEU A O   1 
ATOM   7322  C  CB  . LEU A 1  943  ? 137.521 76.608  -0.975  1.00 43.30  ? 943  LEU A CB  1 
ATOM   7323  C  CG  . LEU A 1  943  ? 138.417 75.403  -1.227  1.00 44.21  ? 943  LEU A CG  1 
ATOM   7324  C  CD1 . LEU A 1  943  ? 138.655 74.686  0.084   1.00 45.08  ? 943  LEU A CD1 1 
ATOM   7325  C  CD2 . LEU A 1  943  ? 137.766 74.467  -2.224  1.00 45.00  ? 943  LEU A CD2 1 
ATOM   7326  N  N   . ARG A 1  944  ? 136.411 79.396  -1.132  1.00 43.16  ? 944  ARG A N   1 
ATOM   7327  C  CA  . ARG A 1  944  ? 135.500 80.419  -0.659  1.00 46.05  ? 944  ARG A CA  1 
ATOM   7328  C  C   . ARG A 1  944  ? 134.647 81.012  -1.785  1.00 48.76  ? 944  ARG A C   1 
ATOM   7329  O  O   . ARG A 1  944  ? 133.647 81.684  -1.524  1.00 51.64  ? 944  ARG A O   1 
ATOM   7330  C  CB  . ARG A 1  944  ? 136.278 81.505  0.085   1.00 44.00  ? 944  ARG A CB  1 
ATOM   7331  C  CG  . ARG A 1  944  ? 136.838 81.026  1.419   1.00 39.00  ? 944  ARG A CG  1 
ATOM   7332  C  CD  . ARG A 1  944  ? 137.450 82.161  2.198   1.00 36.07  ? 944  ARG A CD  1 
ATOM   7333  N  NE  . ARG A 1  944  ? 137.623 81.832  3.606   1.00 31.83  ? 944  ARG A NE  1 
ATOM   7334  C  CZ  . ARG A 1  944  ? 137.964 82.721  4.536   1.00 34.35  ? 944  ARG A CZ  1 
ATOM   7335  N  NH1 . ARG A 1  944  ? 138.170 83.992  4.204   1.00 31.47  ? 944  ARG A NH1 1 
ATOM   7336  N  NH2 . ARG A 1  944  ? 138.089 82.346  5.801   1.00 35.38  ? 944  ARG A NH2 1 
ATOM   7337  N  N   . GLU A 1  945  ? 135.037 80.754  -3.032  1.00 50.40  ? 945  GLU A N   1 
ATOM   7338  C  CA  . GLU A 1  945  ? 134.287 81.242  -4.191  1.00 51.42  ? 945  GLU A CA  1 
ATOM   7339  C  C   . GLU A 1  945  ? 133.260 80.197  -4.589  1.00 48.31  ? 945  GLU A C   1 
ATOM   7340  O  O   . GLU A 1  945  ? 132.411 80.443  -5.442  1.00 48.25  ? 945  GLU A O   1 
ATOM   7341  C  CB  . GLU A 1  945  ? 135.211 81.478  -5.384  1.00 57.72  ? 945  GLU A CB  1 
ATOM   7342  C  CG  . GLU A 1  945  ? 135.699 82.900  -5.561  1.00 65.67  ? 945  GLU A CG  1 
ATOM   7343  C  CD  . GLU A 1  945  ? 136.610 83.041  -6.775  1.00 70.65  ? 945  GLU A CD  1 
ATOM   7344  O  OE1 . GLU A 1  945  ? 136.152 82.771  -7.912  1.00 72.55  ? 945  GLU A OE1 1 
ATOM   7345  O  OE2 . GLU A 1  945  ? 137.789 83.417  -6.589  1.00 73.36  ? 945  GLU A OE2 1 
ATOM   7346  N  N   . VAL A 1  946  ? 133.363 79.022  -3.976  1.00 44.81  ? 946  VAL A N   1 
ATOM   7347  C  CA  . VAL A 1  946  ? 132.457 77.915  -4.250  1.00 41.42  ? 946  VAL A CA  1 
ATOM   7348  C  C   . VAL A 1  946  ? 131.547 77.705  -3.055  1.00 43.23  ? 946  VAL A C   1 
ATOM   7349  O  O   . VAL A 1  946  ? 130.338 77.890  -3.140  1.00 44.65  ? 946  VAL A O   1 
ATOM   7350  C  CB  . VAL A 1  946  ? 133.253 76.621  -4.544  1.00 36.98  ? 946  VAL A CB  1 
ATOM   7351  C  CG1 . VAL A 1  946  ? 132.439 75.392  -4.154  1.00 31.02  ? 946  VAL A CG1 1 
ATOM   7352  C  CG2 . VAL A 1  946  ? 133.631 76.581  -6.031  1.00 34.00  ? 946  VAL A CG2 1 
ATOM   7353  N  N   . PHE A 1  947  ? 132.138 77.324  -1.936  1.00 44.58  ? 947  PHE A N   1 
ATOM   7354  C  CA  . PHE A 1  947  ? 131.369 77.104  -0.729  1.00 48.15  ? 947  PHE A CA  1 
ATOM   7355  C  C   . PHE A 1  947  ? 131.239 78.409  0.049   1.00 51.17  ? 947  PHE A C   1 
ATOM   7356  O  O   . PHE A 1  947  ? 131.673 78.499  1.202   1.00 54.93  ? 947  PHE A O   1 
ATOM   7357  C  CB  . PHE A 1  947  ? 132.053 76.038  0.126   1.00 48.17  ? 947  PHE A CB  1 
ATOM   7358  C  CG  . PHE A 1  947  ? 132.059 74.671  -0.500  1.00 46.99  ? 947  PHE A CG  1 
ATOM   7359  C  CD1 . PHE A 1  947  ? 133.224 73.923  -0.554  1.00 47.91  ? 947  PHE A CD1 1 
ATOM   7360  C  CD2 . PHE A 1  947  ? 130.888 74.118  -1.002  1.00 48.06  ? 947  PHE A CD2 1 
ATOM   7361  C  CE1 . PHE A 1  947  ? 133.220 72.645  -1.091  1.00 49.33  ? 947  PHE A CE1 1 
ATOM   7362  C  CE2 . PHE A 1  947  ? 130.873 72.840  -1.540  1.00 47.41  ? 947  PHE A CE2 1 
ATOM   7363  C  CZ  . PHE A 1  947  ? 132.037 72.104  -1.585  1.00 49.14  ? 947  PHE A CZ  1 
ATOM   7364  N  N   . VAL A 1  948  ? 130.638 79.414  -0.588  1.00 51.31  ? 948  VAL A N   1 
ATOM   7365  C  CA  . VAL A 1  948  ? 130.446 80.729  0.024   1.00 52.59  ? 948  VAL A CA  1 
ATOM   7366  C  C   . VAL A 1  948  ? 129.974 80.659  1.475   1.00 54.81  ? 948  VAL A C   1 
ATOM   7367  O  O   . VAL A 1  948  ? 130.477 81.378  2.332   1.00 55.58  ? 948  VAL A O   1 
ATOM   7368  C  CB  . VAL A 1  948  ? 129.428 81.558  -0.767  1.00 51.56  ? 948  VAL A CB  1 
ATOM   7369  C  CG1 . VAL A 1  948  ? 129.325 82.955  -0.165  1.00 52.28  ? 948  VAL A CG1 1 
ATOM   7370  C  CG2 . VAL A 1  948  ? 129.839 81.627  -2.224  1.00 50.89  ? 948  VAL A CG2 1 
ATOM   7371  N  N   . ASP A 1  949  ? 128.994 79.800  1.732   1.00 57.43  ? 949  ASP A N   1 
ATOM   7372  C  CA  . ASP A 1  949  ? 128.440 79.602  3.067   1.00 58.21  ? 949  ASP A CA  1 
ATOM   7373  C  C   . ASP A 1  949  ? 129.518 79.570  4.118   1.00 55.44  ? 949  ASP A C   1 
ATOM   7374  O  O   . ASP A 1  949  ? 129.294 79.959  5.263   1.00 53.69  ? 949  ASP A O   1 
ATOM   7375  C  CB  . ASP A 1  949  ? 127.703 78.271  3.123   1.00 68.11  ? 949  ASP A CB  1 
ATOM   7376  C  CG  . ASP A 1  949  ? 126.211 78.437  3.174   1.00 77.02  ? 949  ASP A CG  1 
ATOM   7377  O  OD1 . ASP A 1  949  ? 125.709 78.901  4.225   1.00 82.45  ? 949  ASP A OD1 1 
ATOM   7378  O  OD2 . ASP A 1  949  ? 125.545 78.108  2.163   1.00 82.19  ? 949  ASP A OD2 1 
ATOM   7379  N  N   . GLY A 1  950  ? 130.681 79.076  3.704   1.00 54.36  ? 950  GLY A N   1 
ATOM   7380  C  CA  . GLY A 1  950  ? 131.824 78.932  4.585   1.00 53.99  ? 950  GLY A CA  1 
ATOM   7381  C  C   . GLY A 1  950  ? 131.940 77.468  4.971   1.00 54.86  ? 950  GLY A C   1 
ATOM   7382  O  O   . GLY A 1  950  ? 132.982 77.013  5.446   1.00 54.44  ? 950  GLY A O   1 
ATOM   7383  N  N   . GLU A 1  951  ? 130.852 76.731  4.742   1.00 56.98  ? 951  GLU A N   1 
ATOM   7384  C  CA  . GLU A 1  951  ? 130.760 75.307  5.068   1.00 57.36  ? 951  GLU A CA  1 
ATOM   7385  C  C   . GLU A 1  951  ? 131.979 74.551  4.583   1.00 53.42  ? 951  GLU A C   1 
ATOM   7386  O  O   . GLU A 1  951  ? 132.295 74.566  3.391   1.00 51.90  ? 951  GLU A O   1 
ATOM   7387  C  CB  . GLU A 1  951  ? 129.495 74.693  4.456   1.00 63.04  ? 951  GLU A CB  1 
ATOM   7388  C  CG  . GLU A 1  951  ? 129.146 73.332  5.050   1.00 71.41  ? 951  GLU A CG  1 
ATOM   7389  C  CD  . GLU A 1  951  ? 128.839 73.410  6.540   1.00 75.35  ? 951  GLU A CD  1 
ATOM   7390  O  OE1 . GLU A 1  951  ? 127.768 73.959  6.895   1.00 77.21  ? 951  GLU A OE1 1 
ATOM   7391  O  OE2 . GLU A 1  951  ? 129.670 72.933  7.350   1.00 76.49  ? 951  GLU A OE2 1 
ATOM   7392  N  N   . ALA A 1  952  ? 132.643 73.872  5.514   1.00 50.02  ? 952  ALA A N   1 
ATOM   7393  C  CA  . ALA A 1  952  ? 133.860 73.131  5.201   1.00 48.96  ? 952  ALA A CA  1 
ATOM   7394  C  C   . ALA A 1  952  ? 133.718 71.616  5.071   1.00 46.60  ? 952  ALA A C   1 
ATOM   7395  O  O   . ALA A 1  952  ? 134.568 70.950  4.464   1.00 43.36  ? 952  ALA A O   1 
ATOM   7396  C  CB  . ALA A 1  952  ? 134.916 73.452  6.244   1.00 52.41  ? 952  ALA A CB  1 
ATOM   7397  N  N   . ASN A 1  953  ? 132.648 71.079  5.640   1.00 42.87  ? 953  ASN A N   1 
ATOM   7398  C  CA  . ASN A 1  953  ? 132.414 69.653  5.607   1.00 40.13  ? 953  ASN A CA  1 
ATOM   7399  C  C   . ASN A 1  953  ? 131.660 69.250  4.365   1.00 36.99  ? 953  ASN A C   1 
ATOM   7400  O  O   . ASN A 1  953  ? 130.572 69.754  4.107   1.00 35.62  ? 953  ASN A O   1 
ATOM   7401  C  CB  . ASN A 1  953  ? 131.643 69.271  6.849   1.00 43.89  ? 953  ASN A CB  1 
ATOM   7402  C  CG  . ASN A 1  953  ? 132.244 69.884  8.084   1.00 49.87  ? 953  ASN A CG  1 
ATOM   7403  O  OD1 . ASN A 1  953  ? 133.422 69.668  8.377   1.00 50.82  ? 953  ASN A OD1 1 
ATOM   7404  N  ND2 . ASN A 1  953  ? 131.451 70.671  8.810   1.00 52.63  ? 953  ASN A ND2 1 
ATOM   7405  N  N   . TRP A 1  954  ? 132.251 68.340  3.593   1.00 35.93  ? 954  TRP A N   1 
ATOM   7406  C  CA  . TRP A 1  954  ? 131.639 67.856  2.354   1.00 35.35  ? 954  TRP A CA  1 
ATOM   7407  C  C   . TRP A 1  954  ? 131.808 66.354  1.991   1.00 34.43  ? 954  TRP A C   1 
ATOM   7408  O  O   . TRP A 1  954  ? 132.724 65.665  2.463   1.00 35.36  ? 954  TRP A O   1 
ATOM   7409  C  CB  . TRP A 1  954  ? 132.113 68.741  1.183   1.00 35.01  ? 954  TRP A CB  1 
ATOM   7410  C  CG  . TRP A 1  954  ? 131.682 70.155  1.364   1.00 34.87  ? 954  TRP A CG  1 
ATOM   7411  C  CD1 . TRP A 1  954  ? 132.330 71.125  2.072   1.00 37.13  ? 954  TRP A CD1 1 
ATOM   7412  C  CD2 . TRP A 1  954  ? 130.408 70.699  1.017   1.00 35.65  ? 954  TRP A CD2 1 
ATOM   7413  N  NE1 . TRP A 1  954  ? 131.530 72.233  2.204   1.00 38.75  ? 954  TRP A NE1 1 
ATOM   7414  C  CE2 . TRP A 1  954  ? 130.342 71.994  1.568   1.00 38.28  ? 954  TRP A CE2 1 
ATOM   7415  C  CE3 . TRP A 1  954  ? 129.310 70.211  0.302   1.00 35.82  ? 954  TRP A CE3 1 
ATOM   7416  C  CZ2 . TRP A 1  954  ? 129.216 72.806  1.430   1.00 40.67  ? 954  TRP A CZ2 1 
ATOM   7417  C  CZ3 . TRP A 1  954  ? 128.194 71.015  0.165   1.00 36.73  ? 954  TRP A CZ3 1 
ATOM   7418  C  CH2 . TRP A 1  954  ? 128.153 72.299  0.728   1.00 38.61  ? 954  TRP A CH2 1 
ATOM   7419  N  N   . PRO A 1  955  ? 130.899 65.828  1.152   1.00 32.44  ? 955  PRO A N   1 
ATOM   7420  C  CA  . PRO A 1  955  ? 130.957 64.438  0.732   1.00 32.64  ? 955  PRO A CA  1 
ATOM   7421  C  C   . PRO A 1  955  ? 132.082 64.280  -0.288  1.00 33.19  ? 955  PRO A C   1 
ATOM   7422  O  O   . PRO A 1  955  ? 131.993 64.811  -1.402  1.00 33.33  ? 955  PRO A O   1 
ATOM   7423  C  CB  . PRO A 1  955  ? 129.598 64.239  0.088   1.00 34.49  ? 955  PRO A CB  1 
ATOM   7424  C  CG  . PRO A 1  955  ? 129.394 65.526  -0.613  1.00 31.56  ? 955  PRO A CG  1 
ATOM   7425  C  CD  . PRO A 1  955  ? 129.757 66.494  0.501   1.00 33.99  ? 955  PRO A CD  1 
ATOM   7426  N  N   . LEU A 1  956  ? 133.126 63.543  0.093   1.00 31.66  ? 956  LEU A N   1 
ATOM   7427  C  CA  . LEU A 1  956  ? 134.277 63.303  -0.784  1.00 25.80  ? 956  LEU A CA  1 
ATOM   7428  C  C   . LEU A 1  956  ? 134.909 61.904  -0.678  1.00 21.61  ? 956  LEU A C   1 
ATOM   7429  O  O   . LEU A 1  956  ? 135.168 61.409  0.415   1.00 20.02  ? 956  LEU A O   1 
ATOM   7430  C  CB  . LEU A 1  956  ? 135.358 64.357  -0.518  1.00 24.32  ? 956  LEU A CB  1 
ATOM   7431  C  CG  . LEU A 1  956  ? 135.229 65.715  -1.205  1.00 20.83  ? 956  LEU A CG  1 
ATOM   7432  C  CD1 . LEU A 1  956  ? 136.484 66.530  -0.920  1.00 20.11  ? 956  LEU A CD1 1 
ATOM   7433  C  CD2 . LEU A 1  956  ? 135.060 65.512  -2.715  1.00 24.15  ? 956  LEU A CD2 1 
ATOM   7434  N  N   . PRO A 1  957  ? 135.186 61.264  -1.826  1.00 20.28  ? 957  PRO A N   1 
ATOM   7435  C  CA  . PRO A 1  957  ? 135.789 59.935  -1.803  1.00 21.82  ? 957  PRO A CA  1 
ATOM   7436  C  C   . PRO A 1  957  ? 137.109 59.925  -1.037  1.00 24.39  ? 957  PRO A C   1 
ATOM   7437  O  O   . PRO A 1  957  ? 137.672 60.983  -0.765  1.00 22.37  ? 957  PRO A O   1 
ATOM   7438  C  CB  . PRO A 1  957  ? 135.956 59.612  -3.292  1.00 19.05  ? 957  PRO A CB  1 
ATOM   7439  C  CG  . PRO A 1  957  ? 136.151 60.924  -3.897  1.00 18.78  ? 957  PRO A CG  1 
ATOM   7440  C  CD  . PRO A 1  957  ? 135.098 61.754  -3.209  1.00 19.40  ? 957  PRO A CD  1 
ATOM   7441  N  N   . VAL A 1  958  ? 137.574 58.726  -0.678  1.00 26.68  ? 958  VAL A N   1 
ATOM   7442  C  CA  . VAL A 1  958  ? 138.829 58.539  0.055   1.00 28.04  ? 958  VAL A CA  1 
ATOM   7443  C  C   . VAL A 1  958  ? 138.855 59.213  1.412   1.00 27.43  ? 958  VAL A C   1 
ATOM   7444  O  O   . VAL A 1  958  ? 139.159 60.387  1.508   1.00 26.57  ? 958  VAL A O   1 
ATOM   7445  C  CB  . VAL A 1  958  ? 140.046 59.108  -0.707  1.00 29.00  ? 958  VAL A CB  1 
ATOM   7446  C  CG1 . VAL A 1  958  ? 141.313 58.845  0.099   1.00 28.08  ? 958  VAL A CG1 1 
ATOM   7447  C  CG2 . VAL A 1  958  ? 140.141 58.515  -2.100  1.00 28.90  ? 958  VAL A CG2 1 
ATOM   7448  N  N   . ASN A 1  959  ? 138.549 58.498  2.473   1.00 29.52  ? 959  ASN A N   1 
ATOM   7449  C  CA  . ASN A 1  959  ? 138.620 59.159  3.756   1.00 34.83  ? 959  ASN A CA  1 
ATOM   7450  C  C   . ASN A 1  959  ? 140.101 59.249  4.093   1.00 36.74  ? 959  ASN A C   1 
ATOM   7451  O  O   . ASN A 1  959  ? 140.743 58.235  4.353   1.00 37.61  ? 959  ASN A O   1 
ATOM   7452  C  CB  . ASN A 1  959  ? 137.891 58.360  4.831   1.00 40.36  ? 959  ASN A CB  1 
ATOM   7453  C  CG  . ASN A 1  959  ? 138.041 58.978  6.212   1.00 42.29  ? 959  ASN A CG  1 
ATOM   7454  O  OD1 . ASN A 1  959  ? 139.117 59.464  6.561   1.00 44.84  ? 959  ASN A OD1 1 
ATOM   7455  N  ND2 . ASN A 1  959  ? 136.970 58.949  7.008   1.00 41.01  ? 959  ASN A ND2 1 
ATOM   7456  N  N   . ILE A 1  960  ? 140.651 60.455  4.091   1.00 38.56  ? 960  ILE A N   1 
ATOM   7457  C  CA  . ILE A 1  960  ? 142.066 60.615  4.389   1.00 39.02  ? 960  ILE A CA  1 
ATOM   7458  C  C   . ILE A 1  960  ? 142.337 60.837  5.873   1.00 41.00  ? 960  ILE A C   1 
ATOM   7459  O  O   . ILE A 1  960  ? 143.474 60.749  6.321   1.00 39.64  ? 960  ILE A O   1 
ATOM   7460  C  CB  . ILE A 1  960  ? 142.681 61.754  3.537   1.00 35.50  ? 960  ILE A CB  1 
ATOM   7461  C  CG1 . ILE A 1  960  ? 142.586 61.375  2.058   1.00 32.70  ? 960  ILE A CG1 1 
ATOM   7462  C  CG2 . ILE A 1  960  ? 144.131 61.973  3.904   1.00 35.65  ? 960  ILE A CG2 1 
ATOM   7463  C  CD1 . ILE A 1  960  ? 143.164 62.384  1.120   1.00 31.05  ? 960  ILE A CD1 1 
ATOM   7464  N  N   . ARG A 1  961  ? 141.295 61.112  6.646   1.00 46.48  ? 961  ARG A N   1 
ATOM   7465  C  CA  . ARG A 1  961  ? 141.496 61.306  8.082   1.00 51.87  ? 961  ARG A CA  1 
ATOM   7466  C  C   . ARG A 1  961  ? 141.979 59.965  8.616   1.00 50.06  ? 961  ARG A C   1 
ATOM   7467  O  O   . ARG A 1  961  ? 142.974 59.893  9.331   1.00 50.65  ? 961  ARG A O   1 
ATOM   7468  C  CB  . ARG A 1  961  ? 140.187 61.682  8.826   1.00 57.33  ? 961  ARG A CB  1 
ATOM   7469  C  CG  . ARG A 1  961  ? 139.437 62.975  8.372   1.00 62.74  ? 961  ARG A CG  1 
ATOM   7470  C  CD  . ARG A 1  961  ? 138.183 63.249  9.264   1.00 62.12  ? 961  ARG A CD  1 
ATOM   7471  N  NE  . ARG A 1  961  ? 137.335 64.358  8.807   1.00 55.52  ? 961  ARG A NE  1 
ATOM   7472  C  CZ  . ARG A 1  961  ? 136.211 64.746  9.411   1.00 51.75  ? 961  ARG A CZ  1 
ATOM   7473  N  NH1 . ARG A 1  961  ? 135.769 64.135  10.503  1.00 45.95  ? 961  ARG A NH1 1 
ATOM   7474  N  NH2 . ARG A 1  961  ? 135.519 65.752  8.915   1.00 51.11  ? 961  ARG A NH2 1 
ATOM   7475  N  N   . ARG A 1  962  ? 141.267 58.902  8.245   1.00 48.49  ? 962  ARG A N   1 
ATOM   7476  C  CA  . ARG A 1  962  ? 141.591 57.562  8.706   1.00 46.81  ? 962  ARG A CA  1 
ATOM   7477  C  C   . ARG A 1  962  ? 142.822 56.995  8.045   1.00 44.71  ? 962  ARG A C   1 
ATOM   7478  O  O   . ARG A 1  962  ? 143.734 56.550  8.733   1.00 46.38  ? 962  ARG A O   1 
ATOM   7479  C  CB  . ARG A 1  962  ? 140.416 56.597  8.479   1.00 49.76  ? 962  ARG A CB  1 
ATOM   7480  C  CG  . ARG A 1  962  ? 139.176 56.857  9.337   1.00 53.15  ? 962  ARG A CG  1 
ATOM   7481  C  CD  . ARG A 1  962  ? 138.069 55.796  9.145   1.00 55.80  ? 962  ARG A CD  1 
ATOM   7482  N  NE  . ARG A 1  962  ? 137.476 55.735  7.798   1.00 57.51  ? 962  ARG A NE  1 
ATOM   7483  C  CZ  . ARG A 1  962  ? 137.950 55.007  6.783   1.00 58.79  ? 962  ARG A CZ  1 
ATOM   7484  N  NH1 . ARG A 1  962  ? 139.040 54.261  6.938   1.00 61.55  ? 962  ARG A NH1 1 
ATOM   7485  N  NH2 . ARG A 1  962  ? 137.328 55.010  5.608   1.00 56.24  ? 962  ARG A NH2 1 
ATOM   7486  N  N   . ILE A 1  963  ? 142.854 57.011  6.717   1.00 42.36  ? 963  ILE A N   1 
ATOM   7487  C  CA  . ILE A 1  963  ? 143.988 56.449  5.988   1.00 44.80  ? 963  ILE A CA  1 
ATOM   7488  C  C   . ILE A 1  963  ? 145.310 56.729  6.703   1.00 43.78  ? 963  ILE A C   1 
ATOM   7489  O  O   . ILE A 1  963  ? 146.257 55.951  6.632   1.00 43.44  ? 963  ILE A O   1 
ATOM   7490  C  CB  . ILE A 1  963  ? 144.060 56.998  4.551   1.00 45.99  ? 963  ILE A CB  1 
ATOM   7491  C  CG1 . ILE A 1  963  ? 144.762 55.993  3.640   1.00 46.37  ? 963  ILE A CG1 1 
ATOM   7492  C  CG2 . ILE A 1  963  ? 144.861 58.279  4.523   1.00 50.78  ? 963  ILE A CG2 1 
ATOM   7493  C  CD1 . ILE A 1  963  ? 144.816 56.420  2.190   1.00 44.52  ? 963  ILE A CD1 1 
ATOM   7494  N  N   . ILE A 1  964  ? 145.362 57.852  7.401   1.00 43.35  ? 964  ILE A N   1 
ATOM   7495  C  CA  . ILE A 1  964  ? 146.551 58.230  8.136   1.00 41.95  ? 964  ILE A CA  1 
ATOM   7496  C  C   . ILE A 1  964  ? 146.538 57.609  9.517   1.00 45.92  ? 964  ILE A C   1 
ATOM   7497  O  O   . ILE A 1  964  ? 147.543 57.065  9.954   1.00 46.73  ? 964  ILE A O   1 
ATOM   7498  C  CB  . ILE A 1  964  ? 146.642 59.742  8.262   1.00 37.43  ? 964  ILE A CB  1 
ATOM   7499  C  CG1 . ILE A 1  964  ? 147.367 60.289  7.036   1.00 35.52  ? 964  ILE A CG1 1 
ATOM   7500  C  CG2 . ILE A 1  964  ? 147.291 60.122  9.581   1.00 36.08  ? 964  ILE A CG2 1 
ATOM   7501  C  CD1 . ILE A 1  964  ? 147.314 61.780  6.912   1.00 35.62  ? 964  ILE A CD1 1 
ATOM   7502  N  N   . GLN A 1  965  ? 145.405 57.704  10.209  1.00 50.66  ? 965  GLN A N   1 
ATOM   7503  C  CA  . GLN A 1  965  ? 145.288 57.119  11.534  1.00 53.97  ? 965  GLN A CA  1 
ATOM   7504  C  C   . GLN A 1  965  ? 145.815 55.704  11.448  1.00 55.17  ? 965  GLN A C   1 
ATOM   7505  O  O   . GLN A 1  965  ? 146.428 55.214  12.388  1.00 56.85  ? 965  GLN A O   1 
ATOM   7506  C  CB  . GLN A 1  965  ? 143.837 57.092  11.998  1.00 57.99  ? 965  GLN A CB  1 
ATOM   7507  C  CG  . GLN A 1  965  ? 143.270 58.457  12.297  1.00 67.63  ? 965  GLN A CG  1 
ATOM   7508  C  CD  . GLN A 1  965  ? 141.910 58.389  12.966  1.00 72.55  ? 965  GLN A CD  1 
ATOM   7509  O  OE1 . GLN A 1  965  ? 141.742 57.700  13.976  1.00 76.53  ? 965  GLN A OE1 1 
ATOM   7510  N  NE2 . GLN A 1  965  ? 140.932 59.110  12.413  1.00 75.51  ? 965  GLN A NE2 1 
ATOM   7511  N  N   . ASN A 1  966  ? 145.578 55.042  10.318  1.00 56.91  ? 966  ASN A N   1 
ATOM   7512  C  CA  . ASN A 1  966  ? 146.081 53.689  10.148  1.00 59.46  ? 966  ASN A CA  1 
ATOM   7513  C  C   . ASN A 1  966  ? 147.594 53.798  10.026  1.00 60.97  ? 966  ASN A C   1 
ATOM   7514  O  O   . ASN A 1  966  ? 148.333 53.237  10.842  1.00 62.32  ? 966  ASN A O   1 
ATOM   7515  C  CB  . ASN A 1  966  ? 145.480 53.029  8.903   1.00 61.42  ? 966  ASN A CB  1 
ATOM   7516  C  CG  . ASN A 1  966  ? 144.020 52.639  9.097   1.00 66.22  ? 966  ASN A CG  1 
ATOM   7517  O  OD1 . ASN A 1  966  ? 143.638 52.106  10.145  1.00 69.07  ? 966  ASN A OD1 1 
ATOM   7518  N  ND2 . ASN A 1  966  ? 143.199 52.891  8.084   1.00 70.08  ? 966  ASN A ND2 1 
ATOM   7519  N  N   . ALA A 1  967  ? 148.045 54.552  9.026   1.00 61.84  ? 967  ALA A N   1 
ATOM   7520  C  CA  . ALA A 1  967  ? 149.472 54.763  8.790   1.00 62.79  ? 967  ALA A CA  1 
ATOM   7521  C  C   . ALA A 1  967  ? 150.193 55.021  10.101  1.00 63.50  ? 967  ALA A C   1 
ATOM   7522  O  O   . ALA A 1  967  ? 151.369 54.712  10.251  1.00 62.50  ? 967  ALA A O   1 
ATOM   7523  C  CB  . ALA A 1  967  ? 149.668 55.935  7.853   1.00 62.25  ? 967  ALA A CB  1 
ATOM   7524  N  N   . GLN A 1  968  ? 149.462 55.594  11.044  1.00 66.18  ? 968  GLN A N   1 
ATOM   7525  C  CA  . GLN A 1  968  ? 149.985 55.904  12.359  1.00 68.32  ? 968  GLN A CA  1 
ATOM   7526  C  C   . GLN A 1  968  ? 150.439 54.646  13.069  1.00 69.63  ? 968  GLN A C   1 
ATOM   7527  O  O   . GLN A 1  968  ? 151.588 54.243  12.942  1.00 70.78  ? 968  GLN A O   1 
ATOM   7528  C  CB  . GLN A 1  968  ? 148.907 56.592  13.198  1.00 71.66  ? 968  GLN A CB  1 
ATOM   7529  C  CG  . GLN A 1  968  ? 148.500 57.949  12.677  1.00 73.94  ? 968  GLN A CG  1 
ATOM   7530  C  CD  . GLN A 1  968  ? 149.597 58.950  12.869  1.00 76.27  ? 968  GLN A CD  1 
ATOM   7531  O  OE1 . GLN A 1  968  ? 149.770 59.498  13.958  1.00 79.19  ? 968  GLN A OE1 1 
ATOM   7532  N  NE2 . GLN A 1  968  ? 150.373 59.178  11.819  1.00 77.47  ? 968  GLN A NE2 1 
ATOM   7533  N  N   . GLN A 1  969  ? 149.522 54.016  13.796  1.00 70.96  ? 969  GLN A N   1 
ATOM   7534  C  CA  . GLN A 1  969  ? 149.835 52.824  14.572  1.00 73.63  ? 969  GLN A CA  1 
ATOM   7535  C  C   . GLN A 1  969  ? 150.123 51.544  13.790  1.00 72.11  ? 969  GLN A C   1 
ATOM   7536  O  O   . GLN A 1  969  ? 150.193 50.464  14.373  1.00 72.04  ? 969  GLN A O   1 
ATOM   7537  C  CB  . GLN A 1  969  ? 148.721 52.559  15.575  1.00 77.38  ? 969  GLN A CB  1 
ATOM   7538  C  CG  . GLN A 1  969  ? 147.474 52.054  14.921  1.00 89.83  ? 969  GLN A CG  1 
ATOM   7539  C  CD  . GLN A 1  969  ? 147.106 50.660  15.376  1.00 96.70  ? 969  GLN A CD  1 
ATOM   7540  O  OE1 . GLN A 1  969  ? 147.243 50.336  16.558  1.00 100.40 ? 969  GLN A OE1 1 
ATOM   7541  N  NE2 . GLN A 1  969  ? 146.618 49.828  14.447  1.00 99.28  ? 969  GLN A NE2 1 
ATOM   7542  N  N   . THR A 1  970  ? 150.279 51.646  12.478  1.00 71.56  ? 970  THR A N   1 
ATOM   7543  C  CA  . THR A 1  970  ? 150.601 50.459  11.698  1.00 73.22  ? 970  THR A CA  1 
ATOM   7544  C  C   . THR A 1  970  ? 152.127 50.347  11.625  1.00 74.07  ? 970  THR A C   1 
ATOM   7545  O  O   . THR A 1  970  ? 152.666 49.285  11.318  1.00 74.52  ? 970  THR A O   1 
ATOM   7546  C  CB  . THR A 1  970  ? 149.991 50.527  10.272  1.00 73.71  ? 970  THR A CB  1 
ATOM   7547  O  OG1 . THR A 1  970  ? 148.573 50.343  10.359  1.00 75.25  ? 970  THR A OG1 1 
ATOM   7548  C  CG2 . THR A 1  970  ? 150.565 49.441  9.373   1.00 74.12  ? 970  THR A CG2 1 
ATOM   7549  N  N   . PHE A 1  971  ? 152.819 51.445  11.927  1.00 74.31  ? 971  PHE A N   1 
ATOM   7550  C  CA  . PHE A 1  971  ? 154.281 51.463  11.916  1.00 74.47  ? 971  PHE A CA  1 
ATOM   7551  C  C   . PHE A 1  971  ? 154.797 51.849  13.288  1.00 78.24  ? 971  PHE A C   1 
ATOM   7552  O  O   . PHE A 1  971  ? 155.989 52.092  13.491  1.00 77.14  ? 971  PHE A O   1 
ATOM   7553  C  CB  . PHE A 1  971  ? 154.795 52.442  10.872  1.00 67.98  ? 971  PHE A CB  1 
ATOM   7554  C  CG  . PHE A 1  971  ? 154.309 52.145  9.494   1.00 61.62  ? 971  PHE A CG  1 
ATOM   7555  C  CD1 . PHE A 1  971  ? 152.968 52.291  9.176   1.00 58.03  ? 971  PHE A CD1 1 
ATOM   7556  C  CD2 . PHE A 1  971  ? 155.186 51.700  8.515   1.00 60.66  ? 971  PHE A CD2 1 
ATOM   7557  C  CE1 . PHE A 1  971  ? 152.505 52.004  7.907   1.00 57.74  ? 971  PHE A CE1 1 
ATOM   7558  C  CE2 . PHE A 1  971  ? 154.732 51.408  7.235   1.00 58.71  ? 971  PHE A CE2 1 
ATOM   7559  C  CZ  . PHE A 1  971  ? 153.389 51.559  6.931   1.00 58.56  ? 971  PHE A CZ  1 
ATOM   7560  N  N   . HIS A 1  972  ? 153.860 51.900  14.224  1.00 84.74  ? 972  HIS A N   1 
ATOM   7561  C  CA  . HIS A 1  972  ? 154.142 52.225  15.608  1.00 91.44  ? 972  HIS A CA  1 
ATOM   7562  C  C   . HIS A 1  972  ? 155.025 53.454  15.718  1.00 93.69  ? 972  HIS A C   1 
ATOM   7563  O  O   . HIS A 1  972  ? 155.944 53.502  16.529  1.00 95.43  ? 972  HIS A O   1 
ATOM   7564  C  CB  . HIS A 1  972  ? 154.788 51.011  16.285  1.00 96.02  ? 972  HIS A CB  1 
ATOM   7565  C  CG  . HIS A 1  972  ? 153.924 49.781  16.264  1.00 100.55 ? 972  HIS A CG  1 
ATOM   7566  N  ND1 . HIS A 1  972  ? 152.801 49.644  17.057  1.00 101.70 ? 972  HIS A ND1 1 
ATOM   7567  C  CD2 . HIS A 1  972  ? 153.995 48.651  15.518  1.00 100.93 ? 972  HIS A CD2 1 
ATOM   7568  C  CE1 . HIS A 1  972  ? 152.221 48.486  16.799  1.00 101.32 ? 972  HIS A CE1 1 
ATOM   7569  N  NE2 . HIS A 1  972  ? 152.924 47.863  15.869  1.00 101.36 ? 972  HIS A NE2 1 
ATOM   7570  N  N   . ILE A 1  973  ? 154.729 54.449  14.890  1.00 96.49  ? 973  ILE A N   1 
ATOM   7571  C  CA  . ILE A 1  973  ? 155.469 55.701  14.880  1.00 99.54  ? 973  ILE A CA  1 
ATOM   7572  C  C   . ILE A 1  973  ? 155.488 56.339  16.260  1.00 102.50 ? 973  ILE A C   1 
ATOM   7573  O  O   . ILE A 1  973  ? 154.477 56.324  16.970  1.00 102.82 ? 973  ILE A O   1 
ATOM   7574  C  CB  . ILE A 1  973  ? 154.842 56.689  13.902  1.00 99.20  ? 973  ILE A CB  1 
ATOM   7575  C  CG1 . ILE A 1  973  ? 155.161 56.254  12.476  1.00 100.22 ? 973  ILE A CG1 1 
ATOM   7576  C  CG2 . ILE A 1  973  ? 155.340 58.093  14.184  1.00 99.05  ? 973  ILE A CG2 1 
ATOM   7577  C  CD1 . ILE A 1  973  ? 154.526 57.122  11.424  1.00 103.37 ? 973  ILE A CD1 1 
ATOM   7578  N  N   . ASP A 1  974  ? 156.640 56.905  16.623  1.00 105.59 ? 974  ASP A N   1 
ATOM   7579  C  CA  . ASP A 1  974  ? 156.820 57.557  17.922  1.00 107.84 ? 974  ASP A CA  1 
ATOM   7580  C  C   . ASP A 1  974  ? 156.959 59.077  17.798  1.00 109.15 ? 974  ASP A C   1 
ATOM   7581  O  O   . ASP A 1  974  ? 157.746 59.582  16.994  1.00 109.78 ? 974  ASP A O   1 
ATOM   7582  C  CB  . ASP A 1  974  ? 158.043 56.969  18.642  1.00 106.57 ? 974  ASP A CB  1 
ATOM   7583  C  CG  . ASP A 1  974  ? 159.328 57.147  17.858  1.00 106.21 ? 974  ASP A CG  1 
ATOM   7584  O  OD1 . ASP A 1  974  ? 159.320 56.921  16.627  1.00 105.74 ? 974  ASP A OD1 1 
ATOM   7585  O  OD2 . ASP A 1  974  ? 160.350 57.502  18.481  1.00 105.77 ? 974  ASP A OD2 1 
ATOM   7586  N  N   . HIS A 1  975  ? 156.184 59.794  18.609  1.00 110.47 ? 975  HIS A N   1 
ATOM   7587  C  CA  . HIS A 1  975  ? 156.180 61.253  18.604  1.00 111.30 ? 975  HIS A CA  1 
ATOM   7588  C  C   . HIS A 1  975  ? 157.428 61.866  19.246  1.00 109.20 ? 975  HIS A C   1 
ATOM   7589  O  O   . HIS A 1  975  ? 157.431 63.049  19.598  1.00 108.77 ? 975  HIS A O   1 
ATOM   7590  C  CB  . HIS A 1  975  ? 154.920 61.776  19.318  1.00 115.56 ? 975  HIS A CB  1 
ATOM   7591  C  CG  . HIS A 1  975  ? 153.632 61.378  18.656  1.00 119.71 ? 975  HIS A CG  1 
ATOM   7592  N  ND1 . HIS A 1  975  ? 153.337 61.691  17.346  1.00 121.18 ? 975  HIS A ND1 1 
ATOM   7593  C  CD2 . HIS A 1  975  ? 152.556 60.706  19.134  1.00 120.97 ? 975  HIS A CD2 1 
ATOM   7594  C  CE1 . HIS A 1  975  ? 152.135 61.229  17.043  1.00 121.05 ? 975  HIS A CE1 1 
ATOM   7595  N  NE2 . HIS A 1  975  ? 151.641 60.628  18.110  1.00 121.69 ? 975  HIS A NE2 1 
ATOM   7596  N  N   . THR A 1  976  ? 158.482 61.067  19.399  1.00 106.22 ? 976  THR A N   1 
ATOM   7597  C  CA  . THR A 1  976  ? 159.724 61.554  19.997  1.00 102.75 ? 976  THR A CA  1 
ATOM   7598  C  C   . THR A 1  976  ? 160.805 61.805  18.943  1.00 100.91 ? 976  THR A C   1 
ATOM   7599  O  O   . THR A 1  976  ? 161.184 62.951  18.697  1.00 102.01 ? 976  THR A O   1 
ATOM   7600  C  CB  . THR A 1  976  ? 160.277 60.566  21.056  1.00 102.16 ? 976  THR A CB  1 
ATOM   7601  O  OG1 . THR A 1  976  ? 160.561 59.307  20.439  1.00 101.06 ? 976  THR A OG1 1 
ATOM   7602  C  CG2 . THR A 1  976  ? 159.263 60.360  22.181  1.00 102.25 ? 976  THR A CG2 1 
ATOM   7603  N  N   . LYS A 1  977  ? 161.294 60.742  18.315  1.00 97.53  ? 977  LYS A N   1 
ATOM   7604  C  CA  . LYS A 1  977  ? 162.333 60.876  17.298  1.00 93.94  ? 977  LYS A CA  1 
ATOM   7605  C  C   . LYS A 1  977  ? 161.827 61.526  16.014  1.00 88.77  ? 977  LYS A C   1 
ATOM   7606  O  O   . LYS A 1  977  ? 160.671 61.360  15.629  1.00 89.30  ? 977  LYS A O   1 
ATOM   7607  C  CB  . LYS A 1  977  ? 162.944 59.509  16.986  1.00 97.68  ? 977  LYS A CB  1 
ATOM   7608  C  CG  . LYS A 1  977  ? 163.614 58.853  18.191  1.00 102.96 ? 977  LYS A CG  1 
ATOM   7609  C  CD  . LYS A 1  977  ? 164.263 57.515  17.835  1.00 105.84 ? 977  LYS A CD  1 
ATOM   7610  C  CE  . LYS A 1  977  ? 164.998 56.921  19.037  1.00 107.21 ? 977  LYS A CE  1 
ATOM   7611  N  NZ  . LYS A 1  977  ? 165.810 55.720  18.685  1.00 106.80 ? 977  LYS A NZ  1 
ATOM   7612  N  N   . PRO A 1  978  ? 162.704 62.270  15.329  1.00 83.04  ? 978  PRO A N   1 
ATOM   7613  C  CA  . PRO A 1  978  ? 162.441 62.988  14.082  1.00 78.91  ? 978  PRO A CA  1 
ATOM   7614  C  C   . PRO A 1  978  ? 162.233 62.109  12.864  1.00 74.66  ? 978  PRO A C   1 
ATOM   7615  O  O   . PRO A 1  978  ? 162.702 60.980  12.819  1.00 72.59  ? 978  PRO A O   1 
ATOM   7616  C  CB  . PRO A 1  978  ? 163.680 63.850  13.932  1.00 79.00  ? 978  PRO A CB  1 
ATOM   7617  C  CG  . PRO A 1  978  ? 164.733 62.934  14.422  1.00 81.55  ? 978  PRO A CG  1 
ATOM   7618  C  CD  . PRO A 1  978  ? 164.119 62.415  15.705  1.00 82.79  ? 978  PRO A CD  1 
ATOM   7619  N  N   . SER A 1  979  ? 161.535 62.659  11.874  1.00 71.18  ? 979  SER A N   1 
ATOM   7620  C  CA  . SER A 1  979  ? 161.259 61.967  10.623  1.00 68.11  ? 979  SER A CA  1 
ATOM   7621  C  C   . SER A 1  979  ? 162.546 61.648  9.880   1.00 66.66  ? 979  SER A C   1 
ATOM   7622  O  O   . SER A 1  979  ? 163.616 61.548  10.484  1.00 67.58  ? 979  SER A O   1 
ATOM   7623  C  CB  . SER A 1  979  ? 160.369 62.828  9.721   1.00 67.70  ? 979  SER A CB  1 
ATOM   7624  O  OG  . SER A 1  979  ? 160.381 62.365  8.374   1.00 63.98  ? 979  SER A OG  1 
ATOM   7625  N  N   . ASP A 1  980  ? 162.420 61.495  8.563   1.00 62.95  ? 980  ASP A N   1 
ATOM   7626  C  CA  . ASP A 1  980  ? 163.531 61.179  7.678   1.00 61.24  ? 980  ASP A CA  1 
ATOM   7627  C  C   . ASP A 1  980  ? 163.150 61.533  6.248   1.00 58.16  ? 980  ASP A C   1 
ATOM   7628  O  O   . ASP A 1  980  ? 163.763 61.080  5.282   1.00 58.10  ? 980  ASP A O   1 
ATOM   7629  C  CB  . ASP A 1  980  ? 163.890 59.683  7.774   1.00 65.58  ? 980  ASP A CB  1 
ATOM   7630  C  CG  . ASP A 1  980  ? 162.660 58.756  7.726   1.00 66.63  ? 980  ASP A CG  1 
ATOM   7631  O  OD1 . ASP A 1  980  ? 161.848 58.779  8.680   1.00 66.50  ? 980  ASP A OD1 1 
ATOM   7632  O  OD2 . ASP A 1  980  ? 162.513 57.993  6.740   1.00 68.46  ? 980  ASP A OD2 1 
ATOM   7633  N  N   . LEU A 1  981  ? 162.130 62.362  6.121   1.00 55.19  ? 981  LEU A N   1 
ATOM   7634  C  CA  . LEU A 1  981  ? 161.650 62.759  4.812   1.00 54.99  ? 981  LEU A CA  1 
ATOM   7635  C  C   . LEU A 1  981  ? 162.387 63.967  4.228   1.00 54.06  ? 981  LEU A C   1 
ATOM   7636  O  O   . LEU A 1  981  ? 162.674 64.932  4.929   1.00 54.14  ? 981  LEU A O   1 
ATOM   7637  C  CB  . LEU A 1  981  ? 160.156 63.073  4.918   1.00 54.77  ? 981  LEU A CB  1 
ATOM   7638  C  CG  . LEU A 1  981  ? 159.214 61.943  5.346   1.00 52.80  ? 981  LEU A CG  1 
ATOM   7639  C  CD1 . LEU A 1  981  ? 158.151 62.466  6.311   1.00 52.41  ? 981  LEU A CD1 1 
ATOM   7640  C  CD2 . LEU A 1  981  ? 158.587 61.325  4.090   1.00 52.24  ? 981  LEU A CD2 1 
ATOM   7641  N  N   . THR A 1  982  ? 162.719 63.917  2.947   1.00 53.40  ? 982  THR A N   1 
ATOM   7642  C  CA  . THR A 1  982  ? 163.359 65.079  2.339   1.00 54.16  ? 982  THR A CA  1 
ATOM   7643  C  C   . THR A 1  982  ? 162.157 65.995  2.108   1.00 50.32  ? 982  THR A C   1 
ATOM   7644  O  O   . THR A 1  982  ? 161.076 65.518  1.758   1.00 48.81  ? 982  THR A O   1 
ATOM   7645  C  CB  . THR A 1  982  ? 164.001 64.762  0.948   1.00 58.19  ? 982  THR A CB  1 
ATOM   7646  O  OG1 . THR A 1  982  ? 164.882 63.634  1.058   1.00 61.29  ? 982  THR A OG1 1 
ATOM   7647  C  CG2 . THR A 1  982  ? 164.795 65.972  0.429   1.00 59.62  ? 982  THR A CG2 1 
ATOM   7648  N  N   . ILE A 1  983  ? 162.308 67.297  2.319   1.00 46.55  ? 983  ILE A N   1 
ATOM   7649  C  CA  . ILE A 1  983  ? 161.170 68.162  2.074   1.00 41.73  ? 983  ILE A CA  1 
ATOM   7650  C  C   . ILE A 1  983  ? 160.872 68.101  0.602   1.00 42.41  ? 983  ILE A C   1 
ATOM   7651  O  O   . ILE A 1  983  ? 159.814 68.525  0.159   1.00 42.47  ? 983  ILE A O   1 
ATOM   7652  C  CB  . ILE A 1  983  ? 161.426 69.586  2.500   1.00 38.75  ? 983  ILE A CB  1 
ATOM   7653  C  CG1 . ILE A 1  983  ? 161.431 69.635  4.025   1.00 39.16  ? 983  ILE A CG1 1 
ATOM   7654  C  CG2 . ILE A 1  983  ? 160.352 70.488  1.949   1.00 35.61  ? 983  ILE A CG2 1 
ATOM   7655  C  CD1 . ILE A 1  983  ? 161.506 71.005  4.596   1.00 43.46  ? 983  ILE A CD1 1 
ATOM   7656  N  N   . LYS A 1  984  ? 161.819 67.561  -0.155  1.00 44.27  ? 984  LYS A N   1 
ATOM   7657  C  CA  . LYS A 1  984  ? 161.624 67.385  -1.580  1.00 46.53  ? 984  LYS A CA  1 
ATOM   7658  C  C   . LYS A 1  984  ? 160.683 66.181  -1.679  1.00 48.20  ? 984  LYS A C   1 
ATOM   7659  O  O   . LYS A 1  984  ? 159.756 66.155  -2.501  1.00 46.29  ? 984  LYS A O   1 
ATOM   7660  C  CB  . LYS A 1  984  ? 162.955 67.081  -2.280  1.00 45.68  ? 984  LYS A CB  1 
ATOM   7661  C  CG  . LYS A 1  984  ? 163.353 68.121  -3.322  1.00 47.64  ? 984  LYS A CG  1 
ATOM   7662  C  CD  . LYS A 1  984  ? 164.352 67.576  -4.335  1.00 51.30  ? 984  LYS A CD  1 
ATOM   7663  C  CE  . LYS A 1  984  ? 164.595 68.574  -5.467  1.00 52.95  ? 984  LYS A CE  1 
ATOM   7664  N  NZ  . LYS A 1  984  ? 165.419 68.001  -6.578  1.00 56.11  ? 984  LYS A NZ  1 
ATOM   7665  N  N   . ASP A 1  985  ? 160.926 65.200  -0.804  1.00 51.39  ? 985  ASP A N   1 
ATOM   7666  C  CA  . ASP A 1  985  ? 160.136 63.967  -0.747  1.00 54.11  ? 985  ASP A CA  1 
ATOM   7667  C  C   . ASP A 1  985  ? 158.654 64.271  -0.685  1.00 52.87  ? 985  ASP A C   1 
ATOM   7668  O  O   . ASP A 1  985  ? 157.889 63.859  -1.560  1.00 54.49  ? 985  ASP A O   1 
ATOM   7669  C  CB  . ASP A 1  985  ? 160.490 63.114  0.489   1.00 58.44  ? 985  ASP A CB  1 
ATOM   7670  C  CG  . ASP A 1  985  ? 161.735 62.256  0.294   1.00 62.26  ? 985  ASP A CG  1 
ATOM   7671  O  OD1 . ASP A 1  985  ? 162.028 61.883  -0.869  1.00 63.65  ? 985  ASP A OD1 1 
ATOM   7672  O  OD2 . ASP A 1  985  ? 162.402 61.937  1.314   1.00 62.10  ? 985  ASP A OD2 1 
ATOM   7673  N  N   . ILE A 1  986  ? 158.254 64.988  0.361   1.00 49.41  ? 986  ILE A N   1 
ATOM   7674  C  CA  . ILE A 1  986  ? 156.855 65.316  0.548   1.00 45.61  ? 986  ILE A CA  1 
ATOM   7675  C  C   . ILE A 1  986  ? 156.236 66.003  -0.645  1.00 44.55  ? 986  ILE A C   1 
ATOM   7676  O  O   . ILE A 1  986  ? 155.489 65.400  -1.415  1.00 44.32  ? 986  ILE A O   1 
ATOM   7677  C  CB  . ILE A 1  986  ? 156.641 66.217  1.765   1.00 44.99  ? 986  ILE A CB  1 
ATOM   7678  C  CG1 . ILE A 1  986  ? 157.054 65.479  3.029   1.00 44.76  ? 986  ILE A CG1 1 
ATOM   7679  C  CG2 . ILE A 1  986  ? 155.178 66.615  1.870   1.00 44.34  ? 986  ILE A CG2 1 
ATOM   7680  C  CD1 . ILE A 1  986  ? 156.653 66.186  4.287   1.00 42.59  ? 986  ILE A CD1 1 
ATOM   7681  N  N   . VAL A 1  987  ? 156.555 67.277  -0.790  1.00 43.53  ? 987  VAL A N   1 
ATOM   7682  C  CA  . VAL A 1  987  ? 155.996 68.075  -1.860  1.00 45.32  ? 987  VAL A CA  1 
ATOM   7683  C  C   . VAL A 1  987  ? 156.059 67.449  -3.240  1.00 45.06  ? 987  VAL A C   1 
ATOM   7684  O  O   . VAL A 1  987  ? 155.044 67.386  -3.937  1.00 46.43  ? 987  VAL A O   1 
ATOM   7685  C  CB  . VAL A 1  987  ? 156.651 69.457  -1.896  1.00 46.40  ? 987  VAL A CB  1 
ATOM   7686  C  CG1 . VAL A 1  987  ? 156.101 70.264  -3.061  1.00 48.20  ? 987  VAL A CG1 1 
ATOM   7687  C  CG2 . VAL A 1  987  ? 156.378 70.177  -0.580  1.00 49.15  ? 987  VAL A CG2 1 
ATOM   7688  N  N   . LEU A 1  988  ? 157.234 66.983  -3.643  1.00 44.43  ? 988  LEU A N   1 
ATOM   7689  C  CA  . LEU A 1  988  ? 157.358 66.381  -4.961  1.00 46.38  ? 988  LEU A CA  1 
ATOM   7690  C  C   . LEU A 1  988  ? 156.566 65.077  -5.145  1.00 47.54  ? 988  LEU A C   1 
ATOM   7691  O  O   . LEU A 1  988  ? 156.305 64.649  -6.275  1.00 47.35  ? 988  LEU A O   1 
ATOM   7692  C  CB  . LEU A 1  988  ? 158.832 66.168  -5.297  1.00 44.68  ? 988  LEU A CB  1 
ATOM   7693  C  CG  . LEU A 1  988  ? 159.453 67.357  -6.032  1.00 43.73  ? 988  LEU A CG  1 
ATOM   7694  C  CD1 . LEU A 1  988  ? 160.948 67.134  -6.185  1.00 44.82  ? 988  LEU A CD1 1 
ATOM   7695  C  CD2 . LEU A 1  988  ? 158.779 67.534  -7.399  1.00 42.70  ? 988  LEU A CD2 1 
ATOM   7696  N  N   . GLY A 1  989  ? 156.180 64.450  -4.036  1.00 48.87  ? 989  GLY A N   1 
ATOM   7697  C  CA  . GLY A 1  989  ? 155.413 63.219  -4.117  1.00 47.16  ? 989  GLY A CA  1 
ATOM   7698  C  C   . GLY A 1  989  ? 153.936 63.545  -4.200  1.00 46.21  ? 989  GLY A C   1 
ATOM   7699  O  O   . GLY A 1  989  ? 153.254 63.175  -5.161  1.00 45.90  ? 989  GLY A O   1 
ATOM   7700  N  N   . VAL A 1  990  ? 153.442 64.255  -3.190  1.00 44.23  ? 990  VAL A N   1 
ATOM   7701  C  CA  . VAL A 1  990  ? 152.044 64.640  -3.155  1.00 43.49  ? 990  VAL A CA  1 
ATOM   7702  C  C   . VAL A 1  990  ? 151.674 65.257  -4.487  1.00 45.81  ? 990  VAL A C   1 
ATOM   7703  O  O   . VAL A 1  990  ? 150.507 65.337  -4.845  1.00 45.96  ? 990  VAL A O   1 
ATOM   7704  C  CB  . VAL A 1  990  ? 151.775 65.658  -2.049  1.00 39.95  ? 990  VAL A CB  1 
ATOM   7705  C  CG1 . VAL A 1  990  ? 150.312 66.019  -2.027  1.00 37.71  ? 990  VAL A CG1 1 
ATOM   7706  C  CG2 . VAL A 1  990  ? 152.178 65.081  -0.724  1.00 39.43  ? 990  VAL A CG2 1 
ATOM   7707  N  N   . LYS A 1  991  ? 152.678 65.689  -5.231  1.00 49.45  ? 991  LYS A N   1 
ATOM   7708  C  CA  . LYS A 1  991  ? 152.417 66.284  -6.523  1.00 55.40  ? 991  LYS A CA  1 
ATOM   7709  C  C   . LYS A 1  991  ? 152.239 65.171  -7.540  1.00 56.23  ? 991  LYS A C   1 
ATOM   7710  O  O   . LYS A 1  991  ? 151.399 65.262  -8.432  1.00 56.52  ? 991  LYS A O   1 
ATOM   7711  C  CB  . LYS A 1  991  ? 153.571 67.215  -6.923  1.00 60.17  ? 991  LYS A CB  1 
ATOM   7712  C  CG  . LYS A 1  991  ? 153.257 68.150  -8.107  1.00 65.43  ? 991  LYS A CG  1 
ATOM   7713  C  CD  . LYS A 1  991  ? 154.142 69.400  -8.095  1.00 67.48  ? 991  LYS A CD  1 
ATOM   7714  C  CE  . LYS A 1  991  ? 153.763 70.360  -9.214  1.00 69.23  ? 991  LYS A CE  1 
ATOM   7715  N  NZ  . LYS A 1  991  ? 154.547 71.628  -9.128  1.00 72.33  ? 991  LYS A NZ  1 
ATOM   7716  N  N   . ASP A 1  992  ? 153.022 64.111  -7.405  1.00 58.96  ? 992  ASP A N   1 
ATOM   7717  C  CA  . ASP A 1  992  ? 152.902 63.003  -8.337  1.00 63.15  ? 992  ASP A CA  1 
ATOM   7718  C  C   . ASP A 1  992  ? 151.640 62.204  -8.082  1.00 58.97  ? 992  ASP A C   1 
ATOM   7719  O  O   . ASP A 1  992  ? 151.082 61.601  -8.999  1.00 59.59  ? 992  ASP A O   1 
ATOM   7720  C  CB  . ASP A 1  992  ? 154.122 62.091  -8.248  1.00 75.97  ? 992  ASP A CB  1 
ATOM   7721  C  CG  . ASP A 1  992  ? 155.281 62.597  -9.090  1.00 86.87  ? 992  ASP A CG  1 
ATOM   7722  O  OD1 . ASP A 1  992  ? 155.092 62.749  -10.325 1.00 92.79  ? 992  ASP A OD1 1 
ATOM   7723  O  OD2 . ASP A 1  992  ? 156.373 62.842  -8.521  1.00 92.28  ? 992  ASP A OD2 1 
ATOM   7724  N  N   . LEU A 1  993  ? 151.194 62.207  -6.832  1.00 52.59  ? 993  LEU A N   1 
ATOM   7725  C  CA  . LEU A 1  993  ? 149.989 61.488  -6.451  1.00 46.37  ? 993  LEU A CA  1 
ATOM   7726  C  C   . LEU A 1  993  ? 148.818 61.898  -7.327  1.00 44.74  ? 993  LEU A C   1 
ATOM   7727  O  O   . LEU A 1  993  ? 148.234 61.080  -8.026  1.00 41.09  ? 993  LEU A O   1 
ATOM   7728  C  CB  . LEU A 1  993  ? 149.658 61.767  -4.989  1.00 42.71  ? 993  LEU A CB  1 
ATOM   7729  C  CG  . LEU A 1  993  ? 148.252 61.357  -4.573  1.00 39.74  ? 993  LEU A CG  1 
ATOM   7730  C  CD1 . LEU A 1  993  ? 148.042 59.938  -4.973  1.00 41.42  ? 993  LEU A CD1 1 
ATOM   7731  C  CD2 . LEU A 1  993  ? 148.058 61.509  -3.082  1.00 39.96  ? 993  LEU A CD2 1 
ATOM   7732  N  N   . GLN A 1  994  ? 148.483 63.178  -7.281  1.00 45.62  ? 994  GLN A N   1 
ATOM   7733  C  CA  . GLN A 1  994  ? 147.388 63.707  -8.071  1.00 48.68  ? 994  GLN A CA  1 
ATOM   7734  C  C   . GLN A 1  994  ? 147.567 63.329  -9.530  1.00 50.65  ? 994  GLN A C   1 
ATOM   7735  O  O   . GLN A 1  994  ? 146.595 63.169  -10.257 1.00 52.39  ? 994  GLN A O   1 
ATOM   7736  C  CB  . GLN A 1  994  ? 147.339 65.232  -7.976  1.00 49.66  ? 994  GLN A CB  1 
ATOM   7737  C  CG  . GLN A 1  994  ? 147.388 65.809  -6.571  1.00 52.89  ? 994  GLN A CG  1 
ATOM   7738  C  CD  . GLN A 1  994  ? 147.471 67.335  -6.572  1.00 55.13  ? 994  GLN A CD  1 
ATOM   7739  O  OE1 . GLN A 1  994  ? 147.615 67.964  -5.518  1.00 55.22  ? 994  GLN A OE1 1 
ATOM   7740  N  NE2 . GLN A 1  994  ? 147.377 67.936  -7.760  1.00 57.05  ? 994  GLN A NE2 1 
ATOM   7741  N  N   . GLU A 1  995  ? 148.809 63.201  -9.974  1.00 53.32  ? 995  GLU A N   1 
ATOM   7742  C  CA  . GLU A 1  995  ? 149.041 62.851  -11.366 1.00 56.46  ? 995  GLU A CA  1 
ATOM   7743  C  C   . GLU A 1  995  ? 148.415 61.516  -11.714 1.00 53.44  ? 995  GLU A C   1 
ATOM   7744  O  O   . GLU A 1  995  ? 148.180 61.213  -12.891 1.00 50.58  ? 995  GLU A O   1 
ATOM   7745  C  CB  . GLU A 1  995  ? 150.540 62.807  -11.674 1.00 64.01  ? 995  GLU A CB  1 
ATOM   7746  C  CG  . GLU A 1  995  ? 151.079 64.106  -12.265 1.00 74.17  ? 995  GLU A CG  1 
ATOM   7747  C  CD  . GLU A 1  995  ? 150.339 64.536  -13.543 1.00 78.87  ? 995  GLU A CD  1 
ATOM   7748  O  OE1 . GLU A 1  995  ? 150.423 63.820  -14.571 1.00 80.85  ? 995  GLU A OE1 1 
ATOM   7749  O  OE2 . GLU A 1  995  ? 149.671 65.597  -13.516 1.00 81.43  ? 995  GLU A OE2 1 
ATOM   7750  N  N   . ASN A 1  996  ? 148.128 60.724  -10.685 1.00 51.11  ? 996  ASN A N   1 
ATOM   7751  C  CA  . ASN A 1  996  ? 147.552 59.406  -10.904 1.00 49.25  ? 996  ASN A CA  1 
ATOM   7752  C  C   . ASN A 1  996  ? 146.110 59.153  -10.448 1.00 44.14  ? 996  ASN A C   1 
ATOM   7753  O  O   . ASN A 1  996  ? 145.577 58.074  -10.693 1.00 45.27  ? 996  ASN A O   1 
ATOM   7754  C  CB  . ASN A 1  996  ? 148.482 58.335  -10.321 1.00 53.62  ? 996  ASN A CB  1 
ATOM   7755  C  CG  . ASN A 1  996  ? 149.814 58.261  -11.058 1.00 57.73  ? 996  ASN A CG  1 
ATOM   7756  O  OD1 . ASN A 1  996  ? 149.854 58.274  -12.296 1.00 59.25  ? 996  ASN A OD1 1 
ATOM   7757  N  ND2 . ASN A 1  996  ? 150.911 58.175  -10.303 1.00 59.75  ? 996  ASN A ND2 1 
ATOM   7758  N  N   . LEU A 1  997  ? 145.469 60.121  -9.802  1.00 34.05  ? 997  LEU A N   1 
ATOM   7759  C  CA  . LEU A 1  997  ? 144.091 59.912  -9.388  1.00 24.40  ? 997  LEU A CA  1 
ATOM   7760  C  C   . LEU A 1  997  ? 143.224 60.071  -10.615 1.00 23.84  ? 997  LEU A C   1 
ATOM   7761  O  O   . LEU A 1  997  ? 142.201 60.734  -10.566 1.00 23.88  ? 997  LEU A O   1 
ATOM   7762  C  CB  . LEU A 1  997  ? 143.677 60.938  -8.343  1.00 15.69  ? 997  LEU A CB  1 
ATOM   7763  C  CG  . LEU A 1  997  ? 144.689 61.094  -7.224  1.00 13.33  ? 997  LEU A CG  1 
ATOM   7764  C  CD1 . LEU A 1  997  ? 144.138 61.911  -6.099  1.00 9.02   ? 997  LEU A CD1 1 
ATOM   7765  C  CD2 . LEU A 1  997  ? 145.030 59.735  -6.726  1.00 16.71  ? 997  LEU A CD2 1 
ATOM   7766  N  N   . LEU A 1  998  ? 143.632 59.466  -11.722 1.00 24.34  ? 998  LEU A N   1 
ATOM   7767  C  CA  . LEU A 1  998  ? 142.874 59.580  -12.958 1.00 27.19  ? 998  LEU A CA  1 
ATOM   7768  C  C   . LEU A 1  998  ? 141.421 59.151  -12.849 1.00 28.08  ? 998  LEU A C   1 
ATOM   7769  O  O   . LEU A 1  998  ? 141.131 58.087  -12.310 1.00 28.12  ? 998  LEU A O   1 
ATOM   7770  C  CB  . LEU A 1  998  ? 143.527 58.757  -14.057 1.00 30.10  ? 998  LEU A CB  1 
ATOM   7771  C  CG  . LEU A 1  998  ? 144.954 59.128  -14.444 1.00 37.44  ? 998  LEU A CG  1 
ATOM   7772  C  CD1 . LEU A 1  998  ? 145.950 58.505  -13.479 1.00 40.76  ? 998  LEU A CD1 1 
ATOM   7773  C  CD2 . LEU A 1  998  ? 145.214 58.631  -15.861 1.00 41.38  ? 998  LEU A CD2 1 
ATOM   7774  N  N   . VAL A 1  999  ? 140.505 59.975  -13.357 1.00 27.83  ? 999  VAL A N   1 
ATOM   7775  C  CA  . VAL A 1  999  ? 139.089 59.626  -13.343 1.00 25.55  ? 999  VAL A CA  1 
ATOM   7776  C  C   . VAL A 1  999  ? 138.679 59.421  -14.780 1.00 25.97  ? 999  VAL A C   1 
ATOM   7777  O  O   . VAL A 1  999  ? 137.910 58.532  -15.085 1.00 25.31  ? 999  VAL A O   1 
ATOM   7778  C  CB  . VAL A 1  999  ? 138.218 60.701  -12.699 1.00 23.56  ? 999  VAL A CB  1 
ATOM   7779  C  CG1 . VAL A 1  999  ? 136.769 60.444  -13.050 1.00 22.39  ? 999  VAL A CG1 1 
ATOM   7780  C  CG2 . VAL A 1  999  ? 138.396 60.674  -11.170 1.00 21.27  ? 999  VAL A CG2 1 
ATOM   7781  N  N   . LEU A 1  1000 ? 139.191 60.254  -15.666 1.00 29.45  ? 1000 LEU A N   1 
ATOM   7782  C  CA  . LEU A 1  1000 ? 138.920 60.073  -17.076 1.00 36.29  ? 1000 LEU A CA  1 
ATOM   7783  C  C   . LEU A 1  1000 ? 140.259 59.675  -17.676 1.00 41.32  ? 1000 LEU A C   1 
ATOM   7784  O  O   . LEU A 1  1000 ? 141.287 59.812  -17.006 1.00 42.94  ? 1000 LEU A O   1 
ATOM   7785  C  CB  . LEU A 1  1000 ? 138.382 61.350  -17.690 1.00 39.28  ? 1000 LEU A CB  1 
ATOM   7786  C  CG  . LEU A 1  1000 ? 136.860 61.247  -17.724 1.00 42.80  ? 1000 LEU A CG  1 
ATOM   7787  C  CD1 . LEU A 1  1000 ? 136.233 62.523  -18.312 1.00 43.82  ? 1000 LEU A CD1 1 
ATOM   7788  C  CD2 . LEU A 1  1000 ? 136.494 59.998  -18.550 1.00 43.60  ? 1000 LEU A CD2 1 
ATOM   7789  N  N   . ARG A 1  1001 ? 140.288 59.190  -18.915 1.00 44.83  ? 1001 ARG A N   1 
ATOM   7790  C  CA  . ARG A 1  1001 ? 141.575 58.748  -19.436 1.00 49.56  ? 1001 ARG A CA  1 
ATOM   7791  C  C   . ARG A 1  1001 ? 142.080 59.289  -20.746 1.00 53.23  ? 1001 ARG A C   1 
ATOM   7792  O  O   . ARG A 1  1001 ? 143.288 59.409  -20.922 1.00 54.30  ? 1001 ARG A O   1 
ATOM   7793  C  CB  . ARG A 1  1001 ? 141.615 57.214  -19.466 1.00 50.32  ? 1001 ARG A CB  1 
ATOM   7794  C  CG  . ARG A 1  1001 ? 142.086 56.620  -18.135 1.00 51.26  ? 1001 ARG A CG  1 
ATOM   7795  C  CD  . ARG A 1  1001 ? 141.510 55.243  -17.805 1.00 49.60  ? 1001 ARG A CD  1 
ATOM   7796  N  NE  . ARG A 1  1001 ? 141.664 54.955  -16.378 1.00 50.75  ? 1001 ARG A NE  1 
ATOM   7797  C  CZ  . ARG A 1  1001 ? 142.835 54.884  -15.744 1.00 51.85  ? 1001 ARG A CZ  1 
ATOM   7798  N  NH1 . ARG A 1  1001 ? 143.974 55.072  -16.404 1.00 49.04  ? 1001 ARG A NH1 1 
ATOM   7799  N  NH2 . ARG A 1  1001 ? 142.871 54.643  -14.440 1.00 54.03  ? 1001 ARG A NH2 1 
ATOM   7800  N  N   . GLY A 1  1002 ? 141.170 59.600  -21.659 1.00 57.29  ? 1002 GLY A N   1 
ATOM   7801  C  CA  . GLY A 1  1002 ? 141.554 60.133  -22.959 1.00 63.01  ? 1002 GLY A CA  1 
ATOM   7802  C  C   . GLY A 1  1002 ? 143.007 60.512  -23.251 1.00 66.75  ? 1002 GLY A C   1 
ATOM   7803  O  O   . GLY A 1  1002 ? 143.773 60.948  -22.386 1.00 64.83  ? 1002 GLY A O   1 
ATOM   7804  N  N   . LYS A 1  1003 ? 143.369 60.370  -24.520 1.00 72.31  ? 1003 LYS A N   1 
ATOM   7805  C  CA  . LYS A 1  1003 ? 144.714 60.668  -24.998 1.00 76.59  ? 1003 LYS A CA  1 
ATOM   7806  C  C   . LYS A 1  1003 ? 144.842 62.119  -25.486 1.00 74.73  ? 1003 LYS A C   1 
ATOM   7807  O  O   . LYS A 1  1003 ? 145.937 62.562  -25.823 1.00 75.20  ? 1003 LYS A O   1 
ATOM   7808  C  CB  . LYS A 1  1003 ? 145.051 59.716  -26.157 1.00 82.53  ? 1003 LYS A CB  1 
ATOM   7809  C  CG  . LYS A 1  1003 ? 146.541 59.505  -26.442 1.00 89.54  ? 1003 LYS A CG  1 
ATOM   7810  C  CD  . LYS A 1  1003 ? 147.120 58.357  -25.600 1.00 95.19  ? 1003 LYS A CD  1 
ATOM   7811  C  CE  . LYS A 1  1003 ? 148.528 57.956  -26.068 1.00 98.19  ? 1003 LYS A CE  1 
ATOM   7812  N  NZ  . LYS A 1  1003 ? 149.109 56.795  -25.313 1.00 98.74  ? 1003 LYS A NZ  1 
ATOM   7813  N  N   . ASN A 1  1004 ? 143.729 62.852  -25.522 1.00 71.85  ? 1004 ASN A N   1 
ATOM   7814  C  CA  . ASN A 1  1004 ? 143.738 64.231  -26.008 1.00 69.35  ? 1004 ASN A CA  1 
ATOM   7815  C  C   . ASN A 1  1004 ? 143.502 65.280  -24.929 1.00 68.17  ? 1004 ASN A C   1 
ATOM   7816  O  O   . ASN A 1  1004 ? 143.268 64.953  -23.770 1.00 68.32  ? 1004 ASN A O   1 
ATOM   7817  C  CB  . ASN A 1  1004 ? 142.684 64.409  -27.100 1.00 69.00  ? 1004 ASN A CB  1 
ATOM   7818  C  CG  . ASN A 1  1004 ? 141.322 64.759  -26.538 1.00 67.64  ? 1004 ASN A CG  1 
ATOM   7819  O  OD1 . ASN A 1  1004 ? 141.122 65.844  -25.998 1.00 66.31  ? 1004 ASN A OD1 1 
ATOM   7820  N  ND2 . ASN A 1  1004 ? 140.380 63.838  -26.654 1.00 69.82  ? 1004 ASN A ND2 1 
ATOM   7821  N  N   . GLU A 1  1005 ? 143.542 66.545  -25.343 1.00 67.89  ? 1005 GLU A N   1 
ATOM   7822  C  CA  . GLU A 1  1005 ? 143.352 67.685  -24.449 1.00 68.35  ? 1005 GLU A CA  1 
ATOM   7823  C  C   . GLU A 1  1005 ? 141.947 67.763  -23.846 1.00 65.07  ? 1005 GLU A C   1 
ATOM   7824  O  O   . GLU A 1  1005 ? 141.768 67.517  -22.656 1.00 62.91  ? 1005 GLU A O   1 
ATOM   7825  C  CB  . GLU A 1  1005 ? 143.667 68.988  -25.197 1.00 73.90  ? 1005 GLU A CB  1 
ATOM   7826  C  CG  . GLU A 1  1005 ? 143.598 70.258  -24.332 1.00 83.54  ? 1005 GLU A CG  1 
ATOM   7827  C  CD  . GLU A 1  1005 ? 144.809 70.447  -23.404 1.00 87.73  ? 1005 GLU A CD  1 
ATOM   7828  O  OE1 . GLU A 1  1005 ? 145.127 69.530  -22.608 1.00 89.58  ? 1005 GLU A OE1 1 
ATOM   7829  O  OE2 . GLU A 1  1005 ? 145.438 71.529  -23.466 1.00 89.25  ? 1005 GLU A OE2 1 
ATOM   7830  N  N   . ILE A 1  1006 ? 140.964 68.120  -24.670 1.00 62.84  ? 1006 ILE A N   1 
ATOM   7831  C  CA  . ILE A 1  1006 ? 139.575 68.237  -24.230 1.00 59.68  ? 1006 ILE A CA  1 
ATOM   7832  C  C   . ILE A 1  1006 ? 139.307 67.410  -22.989 1.00 57.25  ? 1006 ILE A C   1 
ATOM   7833  O  O   . ILE A 1  1006 ? 138.872 67.923  -21.961 1.00 57.44  ? 1006 ILE A O   1 
ATOM   7834  C  CB  . ILE A 1  1006 ? 138.575 67.749  -25.311 1.00 60.05  ? 1006 ILE A CB  1 
ATOM   7835  C  CG1 . ILE A 1  1006 ? 138.508 68.740  -26.475 1.00 62.48  ? 1006 ILE A CG1 1 
ATOM   7836  C  CG2 . ILE A 1  1006 ? 137.200 67.574  -24.697 1.00 58.78  ? 1006 ILE A CG2 1 
ATOM   7837  C  CD1 . ILE A 1  1006 ? 137.353 68.480  -27.447 1.00 61.74  ? 1006 ILE A CD1 1 
ATOM   7838  N  N   . ILE A 1  1007 ? 139.572 66.116  -23.102 1.00 54.83  ? 1007 ILE A N   1 
ATOM   7839  C  CA  . ILE A 1  1007 ? 139.340 65.194  -22.005 1.00 52.61  ? 1007 ILE A CA  1 
ATOM   7840  C  C   . ILE A 1  1007 ? 140.325 65.373  -20.873 1.00 53.27  ? 1007 ILE A C   1 
ATOM   7841  O  O   . ILE A 1  1007 ? 139.926 65.555  -19.724 1.00 51.85  ? 1007 ILE A O   1 
ATOM   7842  C  CB  . ILE A 1  1007 ? 139.465 63.751  -22.449 1.00 52.86  ? 1007 ILE A CB  1 
ATOM   7843  C  CG1 . ILE A 1  1007 ? 138.910 63.574  -23.868 1.00 53.97  ? 1007 ILE A CG1 1 
ATOM   7844  C  CG2 . ILE A 1  1007 ? 138.770 62.867  -21.426 1.00 51.30  ? 1007 ILE A CG2 1 
ATOM   7845  C  CD1 . ILE A 1  1007 ? 137.407 63.686  -23.987 1.00 57.38  ? 1007 ILE A CD1 1 
ATOM   7846  N  N   . GLN A 1  1008 ? 141.616 65.293  -21.198 1.00 56.89  ? 1008 GLN A N   1 
ATOM   7847  C  CA  . GLN A 1  1008 ? 142.669 65.440  -20.192 1.00 60.09  ? 1008 GLN A CA  1 
ATOM   7848  C  C   . GLN A 1  1008 ? 142.476 66.751  -19.445 1.00 58.88  ? 1008 GLN A C   1 
ATOM   7849  O  O   . GLN A 1  1008 ? 143.107 66.996  -18.416 1.00 59.30  ? 1008 GLN A O   1 
ATOM   7850  C  CB  . GLN A 1  1008 ? 144.074 65.388  -20.831 1.00 63.68  ? 1008 GLN A CB  1 
ATOM   7851  C  CG  . GLN A 1  1008 ? 144.716 63.975  -20.947 1.00 67.04  ? 1008 GLN A CG  1 
ATOM   7852  C  CD  . GLN A 1  1008 ? 145.100 63.351  -19.595 1.00 67.98  ? 1008 GLN A CD  1 
ATOM   7853  O  OE1 . GLN A 1  1008 ? 145.646 64.022  -18.716 1.00 68.82  ? 1008 GLN A OE1 1 
ATOM   7854  N  NE2 . GLN A 1  1008 ? 144.831 62.056  -19.440 1.00 69.38  ? 1008 GLN A NE2 1 
ATOM   7855  N  N   . ASN A 1  1009 ? 141.594 67.593  -19.968 1.00 58.19  ? 1009 ASN A N   1 
ATOM   7856  C  CA  . ASN A 1  1009 ? 141.316 68.854  -19.315 1.00 58.56  ? 1009 ASN A CA  1 
ATOM   7857  C  C   . ASN A 1  1009 ? 140.154 68.616  -18.363 1.00 57.83  ? 1009 ASN A C   1 
ATOM   7858  O  O   . ASN A 1  1009 ? 140.191 69.043  -17.213 1.00 57.26  ? 1009 ASN A O   1 
ATOM   7859  C  CB  . ASN A 1  1009 ? 140.964 69.930  -20.342 1.00 60.62  ? 1009 ASN A CB  1 
ATOM   7860  C  CG  . ASN A 1  1009 ? 141.548 71.286  -19.978 1.00 61.60  ? 1009 ASN A CG  1 
ATOM   7861  O  OD1 . ASN A 1  1009 ? 141.251 71.838  -18.911 1.00 62.27  ? 1009 ASN A OD1 1 
ATOM   7862  N  ND2 . ASN A 1  1009 ? 142.392 71.826  -20.858 1.00 60.25  ? 1009 ASN A ND2 1 
ATOM   7863  N  N   . ALA A 1  1010 ? 139.131 67.916  -18.843 1.00 58.77  ? 1010 ALA A N   1 
ATOM   7864  C  CA  . ALA A 1  1010 ? 137.967 67.601  -18.016 1.00 59.22  ? 1010 ALA A CA  1 
ATOM   7865  C  C   . ALA A 1  1010 ? 138.411 66.774  -16.804 1.00 56.76  ? 1010 ALA A C   1 
ATOM   7866  O  O   . ALA A 1  1010 ? 137.756 66.766  -15.756 1.00 55.15  ? 1010 ALA A O   1 
ATOM   7867  C  CB  . ALA A 1  1010 ? 136.930 66.828  -18.837 1.00 62.33  ? 1010 ALA A CB  1 
ATOM   7868  N  N   . GLN A 1  1011 ? 139.528 66.075  -16.968 1.00 52.58  ? 1011 GLN A N   1 
ATOM   7869  C  CA  . GLN A 1  1011 ? 140.088 65.265  -15.905 1.00 49.75  ? 1011 GLN A CA  1 
ATOM   7870  C  C   . GLN A 1  1011 ? 140.426 66.204  -14.756 1.00 51.84  ? 1011 GLN A C   1 
ATOM   7871  O  O   . GLN A 1  1011 ? 139.806 66.143  -13.689 1.00 49.47  ? 1011 GLN A O   1 
ATOM   7872  C  CB  . GLN A 1  1011 ? 141.329 64.527  -16.439 1.00 46.42  ? 1011 GLN A CB  1 
ATOM   7873  C  CG  . GLN A 1  1011 ? 142.454 64.179  -15.451 1.00 44.84  ? 1011 GLN A CG  1 
ATOM   7874  C  CD  . GLN A 1  1011 ? 142.009 63.388  -14.238 1.00 43.12  ? 1011 GLN A CD  1 
ATOM   7875  O  OE1 . GLN A 1  1011 ? 141.106 62.563  -14.318 1.00 42.35  ? 1011 GLN A OE1 1 
ATOM   7876  N  NE2 . GLN A 1  1011 ? 142.670 63.620  -13.107 1.00 40.85  ? 1011 GLN A NE2 1 
ATOM   7877  N  N   . ARG A 1  1012 ? 141.379 67.102  -14.999 1.00 57.01  ? 1012 ARG A N   1 
ATOM   7878  C  CA  . ARG A 1  1012 ? 141.822 68.058  -13.982 1.00 63.43  ? 1012 ARG A CA  1 
ATOM   7879  C  C   . ARG A 1  1012 ? 140.645 68.662  -13.222 1.00 62.78  ? 1012 ARG A C   1 
ATOM   7880  O  O   . ARG A 1  1012 ? 140.788 69.089  -12.073 1.00 62.75  ? 1012 ARG A O   1 
ATOM   7881  C  CB  . ARG A 1  1012 ? 142.651 69.198  -14.610 1.00 69.49  ? 1012 ARG A CB  1 
ATOM   7882  C  CG  . ARG A 1  1012 ? 143.949 68.784  -15.319 1.00 79.02  ? 1012 ARG A CG  1 
ATOM   7883  C  CD  . ARG A 1  1012 ? 144.834 70.009  -15.608 1.00 87.67  ? 1012 ARG A CD  1 
ATOM   7884  N  NE  . ARG A 1  1012 ? 145.919 69.738  -16.562 1.00 97.12  ? 1012 ARG A NE  1 
ATOM   7885  C  CZ  . ARG A 1  1012 ? 145.892 70.060  -17.859 1.00 101.00 ? 1012 ARG A CZ  1 
ATOM   7886  N  NH1 . ARG A 1  1012 ? 144.833 70.672  -18.380 1.00 103.72 ? 1012 ARG A NH1 1 
ATOM   7887  N  NH2 . ARG A 1  1012 ? 146.927 69.775  -18.645 1.00 102.13 ? 1012 ARG A NH2 1 
ATOM   7888  N  N   . ASP A 1  1013 ? 139.484 68.690  -13.868 1.00 62.81  ? 1013 ASP A N   1 
ATOM   7889  C  CA  . ASP A 1  1013 ? 138.286 69.259  -13.265 1.00 63.39  ? 1013 ASP A CA  1 
ATOM   7890  C  C   . ASP A 1  1013 ? 137.621 68.300  -12.294 1.00 60.48  ? 1013 ASP A C   1 
ATOM   7891  O  O   . ASP A 1  1013 ? 137.436 68.610  -11.113 1.00 61.89  ? 1013 ASP A O   1 
ATOM   7892  C  CB  . ASP A 1  1013 ? 137.282 69.651  -14.353 1.00 68.98  ? 1013 ASP A CB  1 
ATOM   7893  C  CG  . ASP A 1  1013 ? 137.857 70.644  -15.347 1.00 73.53  ? 1013 ASP A CG  1 
ATOM   7894  O  OD1 . ASP A 1  1013 ? 138.456 71.647  -14.899 1.00 75.78  ? 1013 ASP A OD1 1 
ATOM   7895  O  OD2 . ASP A 1  1013 ? 137.705 70.427  -16.572 1.00 76.95  ? 1013 ASP A OD2 1 
ATOM   7896  N  N   . ALA A 1  1014 ? 137.256 67.132  -12.796 1.00 55.04  ? 1014 ALA A N   1 
ATOM   7897  C  CA  . ALA A 1  1014 ? 136.602 66.148  -11.959 1.00 49.46  ? 1014 ALA A CA  1 
ATOM   7898  C  C   . ALA A 1  1014 ? 137.478 65.785  -10.772 1.00 44.34  ? 1014 ALA A C   1 
ATOM   7899  O  O   . ALA A 1  1014 ? 137.043 65.107  -9.840  1.00 45.50  ? 1014 ALA A O   1 
ATOM   7900  C  CB  . ALA A 1  1014 ? 136.292 64.915  -12.772 1.00 52.57  ? 1014 ALA A CB  1 
ATOM   7901  N  N   . VAL A 1  1015 ? 138.712 66.258  -10.794 1.00 37.03  ? 1015 VAL A N   1 
ATOM   7902  C  CA  . VAL A 1  1015 ? 139.644 65.943  -9.729  1.00 32.41  ? 1015 VAL A CA  1 
ATOM   7903  C  C   . VAL A 1  1015 ? 139.810 67.050  -8.698  1.00 30.53  ? 1015 VAL A C   1 
ATOM   7904  O  O   . VAL A 1  1015 ? 139.996 66.791  -7.497  1.00 26.76  ? 1015 VAL A O   1 
ATOM   7905  C  CB  . VAL A 1  1015 ? 141.020 65.629  -10.333 1.00 31.55  ? 1015 VAL A CB  1 
ATOM   7906  C  CG1 . VAL A 1  1015 ? 141.982 65.199  -9.251  1.00 31.73  ? 1015 VAL A CG1 1 
ATOM   7907  C  CG2 . VAL A 1  1015 ? 140.876 64.561  -11.395 1.00 28.97  ? 1015 VAL A CG2 1 
ATOM   7908  N  N   . THR A 1  1016 ? 139.731 68.282  -9.193  1.00 30.94  ? 1016 THR A N   1 
ATOM   7909  C  CA  . THR A 1  1016 ? 139.927 69.487  -8.392  1.00 29.97  ? 1016 THR A CA  1 
ATOM   7910  C  C   . THR A 1  1016 ? 139.482 69.457  -6.939  1.00 29.82  ? 1016 THR A C   1 
ATOM   7911  O  O   . THR A 1  1016 ? 140.306 69.285  -6.033  1.00 30.31  ? 1016 THR A O   1 
ATOM   7912  C  CB  . THR A 1  1016 ? 139.282 70.716  -9.051  1.00 28.26  ? 1016 THR A CB  1 
ATOM   7913  O  OG1 . THR A 1  1016 ? 139.754 70.852  -10.398 1.00 29.94  ? 1016 THR A OG1 1 
ATOM   7914  C  CG2 . THR A 1  1016 ? 139.657 71.958  -8.271  1.00 27.27  ? 1016 THR A CG2 1 
ATOM   7915  N  N   . LEU A 1  1017 ? 138.185 69.628  -6.715  1.00 28.08  ? 1017 LEU A N   1 
ATOM   7916  C  CA  . LEU A 1  1017 ? 137.670 69.667  -5.360  1.00 26.60  ? 1017 LEU A CA  1 
ATOM   7917  C  C   . LEU A 1  1017 ? 138.332 68.669  -4.419  1.00 26.64  ? 1017 LEU A C   1 
ATOM   7918  O  O   . LEU A 1  1017 ? 138.409 68.902  -3.206  1.00 27.91  ? 1017 LEU A O   1 
ATOM   7919  C  CB  . LEU A 1  1017 ? 136.162 69.473  -5.370  1.00 22.00  ? 1017 LEU A CB  1 
ATOM   7920  C  CG  . LEU A 1  1017 ? 135.457 69.453  -4.015  1.00 20.30  ? 1017 LEU A CG  1 
ATOM   7921  C  CD1 . LEU A 1  1017 ? 136.000 70.495  -3.033  1.00 14.97  ? 1017 LEU A CD1 1 
ATOM   7922  C  CD2 . LEU A 1  1017 ? 133.996 69.671  -4.295  1.00 20.80  ? 1017 LEU A CD2 1 
ATOM   7923  N  N   . PHE A 1  1018 ? 138.835 67.571  -4.974  1.00 26.73  ? 1018 PHE A N   1 
ATOM   7924  C  CA  . PHE A 1  1018 ? 139.478 66.561  -4.147  1.00 26.72  ? 1018 PHE A CA  1 
ATOM   7925  C  C   . PHE A 1  1018 ? 140.873 66.978  -3.718  1.00 26.88  ? 1018 PHE A C   1 
ATOM   7926  O  O   . PHE A 1  1018 ? 141.137 67.178  -2.526  1.00 27.42  ? 1018 PHE A O   1 
ATOM   7927  C  CB  . PHE A 1  1018 ? 139.547 65.202  -4.878  1.00 28.20  ? 1018 PHE A CB  1 
ATOM   7928  C  CG  . PHE A 1  1018 ? 140.293 64.129  -4.102  1.00 28.49  ? 1018 PHE A CG  1 
ATOM   7929  C  CD1 . PHE A 1  1018 ? 140.179 64.046  -2.715  1.00 28.39  ? 1018 PHE A CD1 1 
ATOM   7930  C  CD2 . PHE A 1  1018 ? 141.140 63.236  -4.745  1.00 28.86  ? 1018 PHE A CD2 1 
ATOM   7931  C  CE1 . PHE A 1  1018 ? 140.899 63.101  -1.988  1.00 28.35  ? 1018 PHE A CE1 1 
ATOM   7932  C  CE2 . PHE A 1  1018 ? 141.859 62.291  -4.016  1.00 29.57  ? 1018 PHE A CE2 1 
ATOM   7933  C  CZ  . PHE A 1  1018 ? 141.738 62.230  -2.639  1.00 27.96  ? 1018 PHE A CZ  1 
ATOM   7934  N  N   . CYS A 1  1019 ? 141.761 67.102  -4.695  1.00 25.41  ? 1019 CYS A N   1 
ATOM   7935  C  CA  . CYS A 1  1019 ? 143.134 67.463  -4.416  1.00 25.88  ? 1019 CYS A CA  1 
ATOM   7936  C  C   . CYS A 1  1019 ? 143.221 68.493  -3.321  1.00 27.45  ? 1019 CYS A C   1 
ATOM   7937  O  O   . CYS A 1  1019 ? 143.989 68.335  -2.386  1.00 29.34  ? 1019 CYS A O   1 
ATOM   7938  C  CB  . CYS A 1  1019 ? 143.780 67.997  -5.671  1.00 25.29  ? 1019 CYS A CB  1 
ATOM   7939  S  SG  . CYS A 1  1019 ? 143.434 66.948  -7.063  1.00 26.83  ? 1019 CYS A SG  1 
ATOM   7940  N  N   . CYS A 1  1020 ? 142.420 69.548  -3.438  1.00 29.09  ? 1020 CYS A N   1 
ATOM   7941  C  CA  . CYS A 1  1020 ? 142.405 70.633  -2.454  1.00 32.26  ? 1020 CYS A CA  1 
ATOM   7942  C  C   . CYS A 1  1020 ? 142.360 70.089  -1.032  1.00 31.94  ? 1020 CYS A C   1 
ATOM   7943  O  O   . CYS A 1  1020 ? 142.964 70.667  -0.119  1.00 31.88  ? 1020 CYS A O   1 
ATOM   7944  C  CB  . CYS A 1  1020 ? 141.206 71.535  -2.715  1.00 31.92  ? 1020 CYS A CB  1 
ATOM   7945  S  SG  . CYS A 1  1020 ? 141.028 71.881  -4.482  1.00 44.05  ? 1020 CYS A SG  1 
ATOM   7946  N  N   . LEU A 1  1021 ? 141.640 68.978  -0.862  1.00 30.95  ? 1021 LEU A N   1 
ATOM   7947  C  CA  . LEU A 1  1021 ? 141.517 68.303  0.426   1.00 27.17  ? 1021 LEU A CA  1 
ATOM   7948  C  C   . LEU A 1  1021 ? 142.831 67.590  0.624   1.00 23.17  ? 1021 LEU A C   1 
ATOM   7949  O  O   . LEU A 1  1021 ? 143.413 67.574  1.706   1.00 20.47  ? 1021 LEU A O   1 
ATOM   7950  C  CB  . LEU A 1  1021 ? 140.380 67.272  0.390   1.00 29.00  ? 1021 LEU A CB  1 
ATOM   7951  C  CG  . LEU A 1  1021 ? 140.377 66.211  1.505   1.00 29.20  ? 1021 LEU A CG  1 
ATOM   7952  C  CD1 . LEU A 1  1021 ? 140.531 66.856  2.881   1.00 32.82  ? 1021 LEU A CD1 1 
ATOM   7953  C  CD2 . LEU A 1  1021 ? 139.091 65.414  1.432   1.00 27.78  ? 1021 LEU A CD2 1 
ATOM   7954  N  N   . LEU A 1  1022 ? 143.284 66.991  -0.459  1.00 20.16  ? 1022 LEU A N   1 
ATOM   7955  C  CA  . LEU A 1  1022 ? 144.529 66.276  -0.453  1.00 20.99  ? 1022 LEU A CA  1 
ATOM   7956  C  C   . LEU A 1  1022 ? 145.635 67.192  0.097   1.00 21.72  ? 1022 LEU A C   1 
ATOM   7957  O  O   . LEU A 1  1022 ? 146.131 66.969  1.211   1.00 19.41  ? 1022 LEU A O   1 
ATOM   7958  C  CB  . LEU A 1  1022 ? 144.823 65.834  -1.881  1.00 20.74  ? 1022 LEU A CB  1 
ATOM   7959  C  CG  . LEU A 1  1022 ? 145.949 64.845  -2.118  1.00 23.49  ? 1022 LEU A CG  1 
ATOM   7960  C  CD1 . LEU A 1  1022 ? 145.711 63.569  -1.317  1.00 22.78  ? 1022 LEU A CD1 1 
ATOM   7961  C  CD2 . LEU A 1  1022 ? 146.009 64.558  -3.608  1.00 27.93  ? 1022 LEU A CD2 1 
ATOM   7962  N  N   . ARG A 1  1023 ? 145.991 68.225  -0.682  1.00 23.09  ? 1023 ARG A N   1 
ATOM   7963  C  CA  . ARG A 1  1023 ? 147.034 69.203  -0.330  1.00 21.74  ? 1023 ARG A CA  1 
ATOM   7964  C  C   . ARG A 1  1023 ? 146.760 69.796  1.031   1.00 21.83  ? 1023 ARG A C   1 
ATOM   7965  O  O   . ARG A 1  1023 ? 147.680 70.089  1.788   1.00 18.92  ? 1023 ARG A O   1 
ATOM   7966  C  CB  . ARG A 1  1023 ? 147.075 70.341  -1.338  1.00 20.64  ? 1023 ARG A CB  1 
ATOM   7967  C  CG  . ARG A 1  1023 ? 147.086 69.920  -2.776  1.00 23.35  ? 1023 ARG A CG  1 
ATOM   7968  C  CD  . ARG A 1  1023 ? 146.659 71.103  -3.608  1.00 29.08  ? 1023 ARG A CD  1 
ATOM   7969  N  NE  . ARG A 1  1023 ? 146.320 70.744  -4.979  1.00 36.43  ? 1023 ARG A NE  1 
ATOM   7970  C  CZ  . ARG A 1  1023 ? 145.609 71.522  -5.792  1.00 38.87  ? 1023 ARG A CZ  1 
ATOM   7971  N  NH1 . ARG A 1  1023 ? 145.169 72.698  -5.358  1.00 39.81  ? 1023 ARG A NH1 1 
ATOM   7972  N  NH2 . ARG A 1  1023 ? 145.339 71.129  -7.037  1.00 41.11  ? 1023 ARG A NH2 1 
ATOM   7973  N  N   . SER A 1  1024 ? 145.478 69.998  1.314   1.00 24.10  ? 1024 SER A N   1 
ATOM   7974  C  CA  . SER A 1  1024 ? 145.034 70.527  2.598   1.00 26.51  ? 1024 SER A CA  1 
ATOM   7975  C  C   . SER A 1  1024 ? 145.607 69.634  3.695   1.00 26.63  ? 1024 SER A C   1 
ATOM   7976  O  O   . SER A 1  1024 ? 146.021 70.107  4.758   1.00 23.07  ? 1024 SER A O   1 
ATOM   7977  C  CB  . SER A 1  1024 ? 143.495 70.501  2.672   1.00 27.36  ? 1024 SER A CB  1 
ATOM   7978  O  OG  . SER A 1  1024 ? 143.012 70.638  4.003   1.00 26.32  ? 1024 SER A OG  1 
ATOM   7979  N  N   . ARG A 1  1025 ? 145.631 68.335  3.401   1.00 27.31  ? 1025 ARG A N   1 
ATOM   7980  C  CA  . ARG A 1  1025 ? 146.106 67.322  4.333   1.00 29.30  ? 1025 ARG A CA  1 
ATOM   7981  C  C   . ARG A 1  1025 ? 147.587 67.014  4.216   1.00 29.68  ? 1025 ARG A C   1 
ATOM   7982  O  O   . ARG A 1  1025 ? 148.274 66.864  5.223   1.00 30.94  ? 1025 ARG A O   1 
ATOM   7983  C  CB  . ARG A 1  1025 ? 145.314 66.023  4.143   1.00 29.94  ? 1025 ARG A CB  1 
ATOM   7984  C  CG  . ARG A 1  1025 ? 143.812 66.146  4.309   1.00 28.15  ? 1025 ARG A CG  1 
ATOM   7985  C  CD  . ARG A 1  1025 ? 143.453 66.787  5.621   1.00 28.56  ? 1025 ARG A CD  1 
ATOM   7986  N  NE  . ARG A 1  1025 ? 142.010 66.797  5.801   1.00 32.21  ? 1025 ARG A NE  1 
ATOM   7987  C  CZ  . ARG A 1  1025 ? 141.382 66.070  6.715   1.00 33.75  ? 1025 ARG A CZ  1 
ATOM   7988  N  NH1 . ARG A 1  1025 ? 142.096 65.291  7.520   1.00 35.23  ? 1025 ARG A NH1 1 
ATOM   7989  N  NH2 . ARG A 1  1025 ? 140.053 66.112  6.817   1.00 29.64  ? 1025 ARG A NH2 1 
ATOM   7990  N  N   . LEU A 1  1026 ? 148.083 66.908  2.993   1.00 30.62  ? 1026 LEU A N   1 
ATOM   7991  C  CA  . LEU A 1  1026 ? 149.492 66.594  2.807   1.00 35.25  ? 1026 LEU A CA  1 
ATOM   7992  C  C   . LEU A 1  1026 ? 150.368 67.850  2.672   1.00 37.30  ? 1026 LEU A C   1 
ATOM   7993  O  O   . LEU A 1  1026 ? 151.154 68.033  1.725   1.00 37.80  ? 1026 LEU A O   1 
ATOM   7994  C  CB  . LEU A 1  1026 ? 149.626 65.650  1.618   1.00 36.03  ? 1026 LEU A CB  1 
ATOM   7995  C  CG  . LEU A 1  1026 ? 148.672 64.465  1.843   1.00 36.01  ? 1026 LEU A CG  1 
ATOM   7996  C  CD1 . LEU A 1  1026 ? 148.666 63.551  0.619   1.00 38.20  ? 1026 LEU A CD1 1 
ATOM   7997  C  CD2 . LEU A 1  1026 ? 149.083 63.704  3.113   1.00 32.95  ? 1026 LEU A CD2 1 
ATOM   7998  N  N   . ALA A 1  1027 ? 150.211 68.706  3.675   1.00 38.47  ? 1027 ALA A N   1 
ATOM   7999  C  CA  . ALA A 1  1027 ? 150.933 69.958  3.772   1.00 37.63  ? 1027 ALA A CA  1 
ATOM   8000  C  C   . ALA A 1  1027 ? 152.243 69.720  4.498   1.00 34.71  ? 1027 ALA A C   1 
ATOM   8001  O  O   . ALA A 1  1027 ? 152.274 69.168  5.598   1.00 30.63  ? 1027 ALA A O   1 
ATOM   8002  C  CB  . ALA A 1  1027 ? 150.092 70.974  4.525   1.00 41.45  ? 1027 ALA A CB  1 
ATOM   8003  N  N   . THR A 1  1028 ? 153.321 70.156  3.868   1.00 31.43  ? 1028 THR A N   1 
ATOM   8004  C  CA  . THR A 1  1028 ? 154.634 69.979  4.424   1.00 29.79  ? 1028 THR A CA  1 
ATOM   8005  C  C   . THR A 1  1028 ? 154.733 70.345  5.882   1.00 29.27  ? 1028 THR A C   1 
ATOM   8006  O  O   . THR A 1  1028 ? 155.490 69.732  6.616   1.00 29.99  ? 1028 THR A O   1 
ATOM   8007  C  CB  . THR A 1  1028 ? 155.643 70.786  3.661   1.00 29.70  ? 1028 THR A CB  1 
ATOM   8008  O  OG1 . THR A 1  1028 ? 155.520 70.483  2.266   1.00 29.13  ? 1028 THR A OG1 1 
ATOM   8009  C  CG2 . THR A 1  1028 ? 157.047 70.447  4.138   1.00 28.93  ? 1028 THR A CG2 1 
ATOM   8010  N  N   . ARG A 1  1029 ? 153.984 71.340  6.323   1.00 30.06  ? 1029 ARG A N   1 
ATOM   8011  C  CA  . ARG A 1  1029 ? 154.077 71.694  7.733   1.00 34.52  ? 1029 ARG A CA  1 
ATOM   8012  C  C   . ARG A 1  1029 ? 153.240 70.715  8.536   1.00 34.54  ? 1029 ARG A C   1 
ATOM   8013  O  O   . ARG A 1  1029 ? 153.547 70.395  9.688   1.00 33.52  ? 1029 ARG A O   1 
ATOM   8014  C  CB  . ARG A 1  1029 ? 153.586 73.123  7.969   1.00 39.31  ? 1029 ARG A CB  1 
ATOM   8015  C  CG  . ARG A 1  1029 ? 154.401 73.894  9.009   1.00 45.03  ? 1029 ARG A CG  1 
ATOM   8016  C  CD  . ARG A 1  1029 ? 154.042 73.559  10.451  1.00 50.71  ? 1029 ARG A CD  1 
ATOM   8017  N  NE  . ARG A 1  1029 ? 155.035 74.081  11.394  1.00 57.73  ? 1029 ARG A NE  1 
ATOM   8018  C  CZ  . ARG A 1  1029 ? 155.669 75.250  11.276  1.00 61.01  ? 1029 ARG A CZ  1 
ATOM   8019  N  NH1 . ARG A 1  1029 ? 155.435 76.057  10.243  1.00 61.19  ? 1029 ARG A NH1 1 
ATOM   8020  N  NH2 . ARG A 1  1029 ? 156.544 75.619  12.209  1.00 63.28  ? 1029 ARG A NH2 1 
ATOM   8021  N  N   . ARG A 1  1030 ? 152.178 70.243  7.895   1.00 35.61  ? 1030 ARG A N   1 
ATOM   8022  C  CA  . ARG A 1  1030 ? 151.249 69.299  8.489   1.00 37.02  ? 1030 ARG A CA  1 
ATOM   8023  C  C   . ARG A 1  1030 ? 151.933 67.937  8.632   1.00 36.80  ? 1030 ARG A C   1 
ATOM   8024  O  O   . ARG A 1  1030 ? 152.176 67.450  9.747   1.00 36.15  ? 1030 ARG A O   1 
ATOM   8025  C  CB  . ARG A 1  1030 ? 150.015 69.177  7.588   1.00 39.40  ? 1030 ARG A CB  1 
ATOM   8026  C  CG  . ARG A 1  1030 ? 148.704 69.624  8.217   1.00 43.91  ? 1030 ARG A CG  1 
ATOM   8027  C  CD  . ARG A 1  1030 ? 147.590 69.671  7.177   1.00 49.46  ? 1030 ARG A CD  1 
ATOM   8028  N  NE  . ARG A 1  1030 ? 146.275 69.989  7.739   1.00 53.71  ? 1030 ARG A NE  1 
ATOM   8029  C  CZ  . ARG A 1  1030 ? 145.498 69.124  8.388   1.00 55.36  ? 1030 ARG A CZ  1 
ATOM   8030  N  NH1 . ARG A 1  1030 ? 145.897 67.869  8.566   1.00 56.55  ? 1030 ARG A NH1 1 
ATOM   8031  N  NH2 . ARG A 1  1030 ? 144.315 69.509  8.855   1.00 54.53  ? 1030 ARG A NH2 1 
ATOM   8032  N  N   . VAL A 1  1031 ? 152.250 67.340  7.485   1.00 35.38  ? 1031 VAL A N   1 
ATOM   8033  C  CA  . VAL A 1  1031 ? 152.888 66.034  7.428   1.00 33.81  ? 1031 VAL A CA  1 
ATOM   8034  C  C   . VAL A 1  1031 ? 153.877 65.752  8.547   1.00 34.53  ? 1031 VAL A C   1 
ATOM   8035  O  O   . VAL A 1  1031 ? 153.905 64.645  9.052   1.00 36.03  ? 1031 VAL A O   1 
ATOM   8036  C  CB  . VAL A 1  1031 ? 153.624 65.829  6.090   1.00 32.37  ? 1031 VAL A CB  1 
ATOM   8037  C  CG1 . VAL A 1  1031 ? 154.205 64.444  6.030   1.00 28.98  ? 1031 VAL A CG1 1 
ATOM   8038  C  CG2 . VAL A 1  1031 ? 152.676 66.051  4.933   1.00 32.63  ? 1031 VAL A CG2 1 
ATOM   8039  N  N   . LEU A 1  1032 ? 154.673 66.741  8.950   1.00 36.10  ? 1032 LEU A N   1 
ATOM   8040  C  CA  . LEU A 1  1032 ? 155.676 66.515  9.992   1.00 38.74  ? 1032 LEU A CA  1 
ATOM   8041  C  C   . LEU A 1  1032 ? 155.366 66.909  11.424  1.00 41.99  ? 1032 LEU A C   1 
ATOM   8042  O  O   . LEU A 1  1032 ? 155.553 66.112  12.343  1.00 43.60  ? 1032 LEU A O   1 
ATOM   8043  C  CB  . LEU A 1  1032 ? 156.997 67.178  9.615   1.00 36.32  ? 1032 LEU A CB  1 
ATOM   8044  C  CG  . LEU A 1  1032 ? 157.758 66.603  8.427   1.00 35.28  ? 1032 LEU A CG  1 
ATOM   8045  C  CD1 . LEU A 1  1032 ? 157.181 67.130  7.131   1.00 35.27  ? 1032 LEU A CD1 1 
ATOM   8046  C  CD2 . LEU A 1  1032 ? 159.217 66.988  8.553   1.00 35.41  ? 1032 LEU A CD2 1 
ATOM   8047  N  N   . GLN A 1  1033 ? 154.920 68.140  11.624  1.00 45.54  ? 1033 GLN A N   1 
ATOM   8048  C  CA  . GLN A 1  1033 ? 154.634 68.619  12.971  1.00 50.00  ? 1033 GLN A CA  1 
ATOM   8049  C  C   . GLN A 1  1033 ? 153.333 68.086  13.563  1.00 51.35  ? 1033 GLN A C   1 
ATOM   8050  O  O   . GLN A 1  1033 ? 153.190 68.015  14.789  1.00 50.75  ? 1033 GLN A O   1 
ATOM   8051  C  CB  . GLN A 1  1033 ? 154.629 70.153  12.976  1.00 52.82  ? 1033 GLN A CB  1 
ATOM   8052  C  CG  . GLN A 1  1033 ? 154.285 70.805  14.314  1.00 56.30  ? 1033 GLN A CG  1 
ATOM   8053  C  CD  . GLN A 1  1033 ? 154.471 72.310  14.272  1.00 57.31  ? 1033 GLN A CD  1 
ATOM   8054  O  OE1 . GLN A 1  1033 ? 155.542 72.827  14.606  1.00 59.44  ? 1033 GLN A OE1 1 
ATOM   8055  N  NE2 . GLN A 1  1033 ? 153.434 73.022  13.836  1.00 56.39  ? 1033 GLN A NE2 1 
ATOM   8056  N  N   . GLU A 1  1034 ? 152.387 67.717  12.700  1.00 53.11  ? 1034 GLU A N   1 
ATOM   8057  C  CA  . GLU A 1  1034 ? 151.109 67.190  13.165  1.00 54.67  ? 1034 GLU A CA  1 
ATOM   8058  C  C   . GLU A 1  1034 ? 151.146 65.663  13.271  1.00 55.40  ? 1034 GLU A C   1 
ATOM   8059  O  O   . GLU A 1  1034 ? 151.011 65.108  14.368  1.00 57.98  ? 1034 GLU A O   1 
ATOM   8060  C  CB  . GLU A 1  1034 ? 149.975 67.660  12.243  1.00 56.10  ? 1034 GLU A CB  1 
ATOM   8061  C  CG  . GLU A 1  1034 ? 149.598 69.131  12.460  1.00 59.12  ? 1034 GLU A CG  1 
ATOM   8062  C  CD  . GLU A 1  1034 ? 148.520 69.650  11.507  1.00 61.06  ? 1034 GLU A CD  1 
ATOM   8063  O  OE1 . GLU A 1  1034 ? 147.345 69.225  11.622  1.00 61.45  ? 1034 GLU A OE1 1 
ATOM   8064  O  OE2 . GLU A 1  1034 ? 148.859 70.496  10.649  1.00 59.85  ? 1034 GLU A OE2 1 
ATOM   8065  N  N   . TYR A 1  1035 ? 151.329 64.971  12.153  1.00 53.00  ? 1035 TYR A N   1 
ATOM   8066  C  CA  . TYR A 1  1035 ? 151.398 63.523  12.231  1.00 52.58  ? 1035 TYR A CA  1 
ATOM   8067  C  C   . TYR A 1  1035 ? 152.741 62.999  11.771  1.00 51.65  ? 1035 TYR A C   1 
ATOM   8068  O  O   . TYR A 1  1035 ? 152.961 62.771  10.593  1.00 54.88  ? 1035 TYR A O   1 
ATOM   8069  C  CB  . TYR A 1  1035 ? 150.271 62.879  11.437  1.00 54.42  ? 1035 TYR A CB  1 
ATOM   8070  C  CG  . TYR A 1  1035 ? 149.578 63.726  10.392  1.00 53.78  ? 1035 TYR A CG  1 
ATOM   8071  C  CD1 . TYR A 1  1035 ? 150.178 64.002  9.165   1.00 51.60  ? 1035 TYR A CD1 1 
ATOM   8072  C  CD2 . TYR A 1  1035 ? 148.252 64.128  10.583  1.00 56.15  ? 1035 TYR A CD2 1 
ATOM   8073  C  CE1 . TYR A 1  1035 ? 149.461 64.643  8.145   1.00 53.92  ? 1035 TYR A CE1 1 
ATOM   8074  C  CE2 . TYR A 1  1035 ? 147.529 64.770  9.577   1.00 55.70  ? 1035 TYR A CE2 1 
ATOM   8075  C  CZ  . TYR A 1  1035 ? 148.132 65.020  8.359   1.00 54.39  ? 1035 TYR A CZ  1 
ATOM   8076  O  OH  . TYR A 1  1035 ? 147.384 65.614  7.361   1.00 52.46  ? 1035 TYR A OH  1 
ATOM   8077  N  N   . ARG A 1  1036 ? 153.624 62.795  12.732  1.00 48.77  ? 1036 ARG A N   1 
ATOM   8078  C  CA  . ARG A 1  1036 ? 154.983 62.346  12.490  1.00 49.33  ? 1036 ARG A CA  1 
ATOM   8079  C  C   . ARG A 1  1036 ? 155.311 61.296  11.420  1.00 45.05  ? 1036 ARG A C   1 
ATOM   8080  O  O   . ARG A 1  1036 ? 156.240 60.524  11.600  1.00 44.62  ? 1036 ARG A O   1 
ATOM   8081  C  CB  . ARG A 1  1036 ? 155.560 61.880  13.816  1.00 57.63  ? 1036 ARG A CB  1 
ATOM   8082  C  CG  . ARG A 1  1036 ? 155.604 62.947  14.885  1.00 64.95  ? 1036 ARG A CG  1 
ATOM   8083  C  CD  . ARG A 1  1036 ? 156.690 63.973  14.615  1.00 70.35  ? 1036 ARG A CD  1 
ATOM   8084  N  NE  . ARG A 1  1036 ? 156.946 64.778  15.806  1.00 78.97  ? 1036 ARG A NE  1 
ATOM   8085  C  CZ  . ARG A 1  1036 ? 156.023 65.503  16.440  1.00 83.60  ? 1036 ARG A CZ  1 
ATOM   8086  N  NH1 . ARG A 1  1036 ? 154.770 65.531  15.997  1.00 84.72  ? 1036 ARG A NH1 1 
ATOM   8087  N  NH2 . ARG A 1  1036 ? 156.350 66.200  17.525  1.00 86.32  ? 1036 ARG A NH2 1 
ATOM   8088  N  N   . LEU A 1  1037 ? 154.607 61.268  10.300  1.00 41.43  ? 1037 LEU A N   1 
ATOM   8089  C  CA  . LEU A 1  1037 ? 154.901 60.264  9.276   1.00 40.60  ? 1037 LEU A CA  1 
ATOM   8090  C  C   . LEU A 1  1037 ? 156.385 60.101  8.952   1.00 41.25  ? 1037 LEU A C   1 
ATOM   8091  O  O   . LEU A 1  1037 ? 157.169 61.015  9.189   1.00 42.76  ? 1037 LEU A O   1 
ATOM   8092  C  CB  . LEU A 1  1037 ? 154.170 60.582  7.972   1.00 39.13  ? 1037 LEU A CB  1 
ATOM   8093  C  CG  . LEU A 1  1037 ? 152.654 60.757  7.989   1.00 37.03  ? 1037 LEU A CG  1 
ATOM   8094  C  CD1 . LEU A 1  1037 ? 152.109 60.150  6.709   1.00 36.36  ? 1037 LEU A CD1 1 
ATOM   8095  C  CD2 . LEU A 1  1037 ? 152.034 60.095  9.213   1.00 34.58  ? 1037 LEU A CD2 1 
ATOM   8096  N  N   . THR A 1  1038 ? 156.748 58.927  8.416   1.00 42.34  ? 1038 THR A N   1 
ATOM   8097  C  CA  . THR A 1  1038 ? 158.123 58.596  8.000   1.00 42.94  ? 1038 THR A CA  1 
ATOM   8098  C  C   . THR A 1  1038 ? 158.072 58.245  6.516   1.00 43.70  ? 1038 THR A C   1 
ATOM   8099  O  O   . THR A 1  1038 ? 157.021 57.861  6.011   1.00 42.94  ? 1038 THR A O   1 
ATOM   8100  C  CB  . THR A 1  1038 ? 158.706 57.357  8.724   1.00 42.27  ? 1038 THR A CB  1 
ATOM   8101  O  OG1 . THR A 1  1038 ? 158.238 56.164  8.079   1.00 40.88  ? 1038 THR A OG1 1 
ATOM   8102  C  CG2 . THR A 1  1038 ? 158.304 57.346  10.191  1.00 40.01  ? 1038 THR A CG2 1 
ATOM   8103  N  N   . LYS A 1  1039 ? 159.203 58.364  5.827   1.00 46.20  ? 1039 LYS A N   1 
ATOM   8104  C  CA  . LYS A 1  1039 ? 159.257 58.064  4.399   1.00 49.23  ? 1039 LYS A CA  1 
ATOM   8105  C  C   . LYS A 1  1039 ? 158.332 56.903  4.129   1.00 50.29  ? 1039 LYS A C   1 
ATOM   8106  O  O   . LYS A 1  1039 ? 157.462 56.970  3.260   1.00 51.51  ? 1039 LYS A O   1 
ATOM   8107  C  CB  . LYS A 1  1039 ? 160.688 57.701  3.978   1.00 51.47  ? 1039 LYS A CB  1 
ATOM   8108  C  CG  . LYS A 1  1039 ? 160.810 56.929  2.654   1.00 55.05  ? 1039 LYS A CG  1 
ATOM   8109  C  CD  . LYS A 1  1039 ? 160.910 57.800  1.391   1.00 56.32  ? 1039 LYS A CD  1 
ATOM   8110  C  CE  . LYS A 1  1039 ? 161.159 56.909  0.147   1.00 57.43  ? 1039 LYS A CE  1 
ATOM   8111  N  NZ  . LYS A 1  1039 ? 161.354 57.629  -1.153  1.00 56.14  ? 1039 LYS A NZ  1 
ATOM   8112  N  N   . GLN A 1  1040 ? 158.512 55.844  4.908   1.00 51.46  ? 1040 GLN A N   1 
ATOM   8113  C  CA  . GLN A 1  1040 ? 157.705 54.647  4.761   1.00 53.45  ? 1040 GLN A CA  1 
ATOM   8114  C  C   . GLN A 1  1040 ? 156.219 55.015  4.858   1.00 52.15  ? 1040 GLN A C   1 
ATOM   8115  O  O   . GLN A 1  1040 ? 155.520 55.086  3.839   1.00 51.81  ? 1040 GLN A O   1 
ATOM   8116  C  CB  . GLN A 1  1040 ? 158.106 53.621  5.840   1.00 58.34  ? 1040 GLN A CB  1 
ATOM   8117  C  CG  . GLN A 1  1040 ? 157.583 52.188  5.603   1.00 64.99  ? 1040 GLN A CG  1 
ATOM   8118  C  CD  . GLN A 1  1040 ? 158.220 51.137  6.521   1.00 66.92  ? 1040 GLN A CD  1 
ATOM   8119  O  OE1 . GLN A 1  1040 ? 158.245 51.291  7.750   1.00 68.84  ? 1040 GLN A OE1 1 
ATOM   8120  N  NE2 . GLN A 1  1040 ? 158.727 50.059  5.921   1.00 67.87  ? 1040 GLN A NE2 1 
ATOM   8121  N  N   . ALA A 1  1041 ? 155.755 55.273  6.080   1.00 50.81  ? 1041 ALA A N   1 
ATOM   8122  C  CA  . ALA A 1  1041 ? 154.358 55.622  6.337   1.00 48.77  ? 1041 ALA A CA  1 
ATOM   8123  C  C   . ALA A 1  1041 ? 153.799 56.472  5.216   1.00 47.72  ? 1041 ALA A C   1 
ATOM   8124  O  O   . ALA A 1  1041 ? 152.806 56.122  4.578   1.00 47.05  ? 1041 ALA A O   1 
ATOM   8125  C  CB  . ALA A 1  1041 ? 154.249 56.365  7.649   1.00 48.88  ? 1041 ALA A CB  1 
ATOM   8126  N  N   . PHE A 1  1042 ? 154.455 57.599  4.993   1.00 47.53  ? 1042 PHE A N   1 
ATOM   8127  C  CA  . PHE A 1  1042 ? 154.066 58.524  3.949   1.00 48.19  ? 1042 PHE A CA  1 
ATOM   8128  C  C   . PHE A 1  1042 ? 153.832 57.725  2.658   1.00 48.67  ? 1042 PHE A C   1 
ATOM   8129  O  O   . PHE A 1  1042 ? 152.693 57.572  2.205   1.00 48.80  ? 1042 PHE A O   1 
ATOM   8130  C  CB  . PHE A 1  1042 ? 155.182 59.562  3.756   1.00 48.06  ? 1042 PHE A CB  1 
ATOM   8131  C  CG  . PHE A 1  1042 ? 154.812 60.691  2.838   1.00 47.33  ? 1042 PHE A CG  1 
ATOM   8132  C  CD1 . PHE A 1  1042 ? 153.998 61.724  3.286   1.00 46.16  ? 1042 PHE A CD1 1 
ATOM   8133  C  CD2 . PHE A 1  1042 ? 155.228 60.686  1.504   1.00 46.31  ? 1042 PHE A CD2 1 
ATOM   8134  C  CE1 . PHE A 1  1042 ? 153.597 62.734  2.419   1.00 46.35  ? 1042 PHE A CE1 1 
ATOM   8135  C  CE2 . PHE A 1  1042 ? 154.836 61.687  0.626   1.00 45.53  ? 1042 PHE A CE2 1 
ATOM   8136  C  CZ  . PHE A 1  1042 ? 154.017 62.713  1.082   1.00 46.92  ? 1042 PHE A CZ  1 
ATOM   8137  N  N   . ASP A 1  1043 ? 154.914 57.202  2.088   1.00 49.03  ? 1043 ASP A N   1 
ATOM   8138  C  CA  . ASP A 1  1043 ? 154.855 56.419  0.860   1.00 49.98  ? 1043 ASP A CA  1 
ATOM   8139  C  C   . ASP A 1  1043 ? 153.731 55.402  0.850   1.00 48.24  ? 1043 ASP A C   1 
ATOM   8140  O  O   . ASP A 1  1043 ? 153.287 54.950  -0.214  1.00 47.98  ? 1043 ASP A O   1 
ATOM   8141  C  CB  . ASP A 1  1043 ? 156.186 55.721  0.641   1.00 55.53  ? 1043 ASP A CB  1 
ATOM   8142  C  CG  . ASP A 1  1043 ? 157.229 56.653  0.081   1.00 61.08  ? 1043 ASP A CG  1 
ATOM   8143  O  OD1 . ASP A 1  1043 ? 157.157 56.953  -1.133  1.00 64.35  ? 1043 ASP A OD1 1 
ATOM   8144  O  OD2 . ASP A 1  1043 ? 158.105 57.098  0.854   1.00 64.47  ? 1043 ASP A OD2 1 
ATOM   8145  N  N   . TRP A 1  1044 ? 153.288 55.024  2.042   1.00 44.26  ? 1044 TRP A N   1 
ATOM   8146  C  CA  . TRP A 1  1044 ? 152.180 54.093  2.160   1.00 39.10  ? 1044 TRP A CA  1 
ATOM   8147  C  C   . TRP A 1  1044 ? 150.936 54.936  1.915   1.00 35.66  ? 1044 TRP A C   1 
ATOM   8148  O  O   . TRP A 1  1044 ? 150.228 54.754  0.919   1.00 34.82  ? 1044 TRP A O   1 
ATOM   8149  C  CB  . TRP A 1  1044 ? 152.116 53.504  3.566   1.00 39.35  ? 1044 TRP A CB  1 
ATOM   8150  C  CG  . TRP A 1  1044 ? 151.054 52.452  3.733   1.00 40.25  ? 1044 TRP A CG  1 
ATOM   8151  C  CD1 . TRP A 1  1044 ? 150.963 51.263  3.063   1.00 42.64  ? 1044 TRP A CD1 1 
ATOM   8152  C  CD2 . TRP A 1  1044 ? 149.993 52.450  4.689   1.00 39.12  ? 1044 TRP A CD2 1 
ATOM   8153  N  NE1 . TRP A 1  1044 ? 149.919 50.518  3.552   1.00 40.08  ? 1044 TRP A NE1 1 
ATOM   8154  C  CE2 . TRP A 1  1044 ? 149.309 51.224  4.552   1.00 38.98  ? 1044 TRP A CE2 1 
ATOM   8155  C  CE3 . TRP A 1  1044 ? 149.556 53.360  5.651   1.00 40.94  ? 1044 TRP A CE3 1 
ATOM   8156  C  CZ2 . TRP A 1  1044 ? 148.216 50.887  5.345   1.00 41.25  ? 1044 TRP A CZ2 1 
ATOM   8157  C  CZ3 . TRP A 1  1044 ? 148.464 53.021  6.439   1.00 43.23  ? 1044 TRP A CZ3 1 
ATOM   8158  C  CH2 . TRP A 1  1044 ? 147.808 51.796  6.282   1.00 42.41  ? 1044 TRP A CH2 1 
ATOM   8159  N  N   . VAL A 1  1045 ? 150.699 55.873  2.833   1.00 29.58  ? 1045 VAL A N   1 
ATOM   8160  C  CA  . VAL A 1  1045 ? 149.557 56.764  2.753   1.00 24.48  ? 1045 VAL A CA  1 
ATOM   8161  C  C   . VAL A 1  1045 ? 149.318 57.176  1.320   1.00 24.79  ? 1045 VAL A C   1 
ATOM   8162  O  O   . VAL A 1  1045 ? 148.180 57.245  0.873   1.00 24.38  ? 1045 VAL A O   1 
ATOM   8163  C  CB  . VAL A 1  1045 ? 149.769 58.010  3.606   1.00 20.83  ? 1045 VAL A CB  1 
ATOM   8164  C  CG1 . VAL A 1  1045 ? 148.547 58.904  3.533   1.00 17.37  ? 1045 VAL A CG1 1 
ATOM   8165  C  CG2 . VAL A 1  1045 ? 150.028 57.605  5.035   1.00 20.62  ? 1045 VAL A CG2 1 
ATOM   8166  N  N   . LEU A 1  1046 ? 150.386 57.443  0.588   1.00 27.60  ? 1046 LEU A N   1 
ATOM   8167  C  CA  . LEU A 1  1046 ? 150.202 57.817  -0.798  1.00 34.85  ? 1046 LEU A CA  1 
ATOM   8168  C  C   . LEU A 1  1046 ? 149.674 56.643  -1.597  1.00 38.83  ? 1046 LEU A C   1 
ATOM   8169  O  O   . LEU A 1  1046 ? 148.775 56.803  -2.419  1.00 40.76  ? 1046 LEU A O   1 
ATOM   8170  C  CB  . LEU A 1  1046 ? 151.505 58.312  -1.426  1.00 38.07  ? 1046 LEU A CB  1 
ATOM   8171  C  CG  . LEU A 1  1046 ? 151.982 59.701  -0.989  1.00 42.29  ? 1046 LEU A CG  1 
ATOM   8172  C  CD1 . LEU A 1  1046 ? 153.024 60.239  -1.979  1.00 43.15  ? 1046 LEU A CD1 1 
ATOM   8173  C  CD2 . LEU A 1  1046 ? 150.790 60.646  -0.932  1.00 43.35  ? 1046 LEU A CD2 1 
ATOM   8174  N  N   . SER A 1  1047 ? 150.225 55.458  -1.357  1.00 43.87  ? 1047 SER A N   1 
ATOM   8175  C  CA  . SER A 1  1047 ? 149.779 54.280  -2.091  1.00 49.41  ? 1047 SER A CA  1 
ATOM   8176  C  C   . SER A 1  1047 ? 148.275 54.031  -1.960  1.00 48.84  ? 1047 SER A C   1 
ATOM   8177  O  O   . SER A 1  1047 ? 147.560 53.965  -2.971  1.00 51.03  ? 1047 SER A O   1 
ATOM   8178  C  CB  . SER A 1  1047 ? 150.534 53.034  -1.631  1.00 52.85  ? 1047 SER A CB  1 
ATOM   8179  O  OG  . SER A 1  1047 ? 150.069 51.891  -2.342  1.00 60.42  ? 1047 SER A OG  1 
ATOM   8180  N  N   . ASN A 1  1048 ? 147.796 53.886  -0.725  1.00 46.20  ? 1048 ASN A N   1 
ATOM   8181  C  CA  . ASN A 1  1048 ? 146.372 53.638  -0.495  1.00 43.28  ? 1048 ASN A CA  1 
ATOM   8182  C  C   . ASN A 1  1048 ? 145.504 54.667  -1.196  1.00 38.60  ? 1048 ASN A C   1 
ATOM   8183  O  O   . ASN A 1  1048 ? 144.602 54.323  -1.961  1.00 39.74  ? 1048 ASN A O   1 
ATOM   8184  C  CB  . ASN A 1  1048 ? 146.021 53.669  0.996   1.00 47.89  ? 1048 ASN A CB  1 
ATOM   8185  C  CG  . ASN A 1  1048 ? 146.582 52.493  1.760   1.00 49.70  ? 1048 ASN A CG  1 
ATOM   8186  O  OD1 . ASN A 1  1048 ? 146.034 52.105  2.802   1.00 52.24  ? 1048 ASN A OD1 1 
ATOM   8187  N  ND2 . ASN A 1  1048 ? 147.686 51.927  1.264   1.00 50.34  ? 1048 ASN A ND2 1 
ATOM   8188  N  N   . ILE A 1  1049 ? 145.774 55.936  -0.922  1.00 30.33  ? 1049 ILE A N   1 
ATOM   8189  C  CA  . ILE A 1  1049 ? 144.993 56.993  -1.521  1.00 23.24  ? 1049 ILE A CA  1 
ATOM   8190  C  C   . ILE A 1  1049 ? 144.860 56.835  -3.017  1.00 21.32  ? 1049 ILE A C   1 
ATOM   8191  O  O   . ILE A 1  1049 ? 143.771 56.955  -3.554  1.00 20.87  ? 1049 ILE A O   1 
ATOM   8192  C  CB  . ILE A 1  1049 ? 145.580 58.347  -1.210  1.00 21.37  ? 1049 ILE A CB  1 
ATOM   8193  C  CG1 . ILE A 1  1049 ? 145.348 58.660  0.269   1.00 21.36  ? 1049 ILE A CG1 1 
ATOM   8194  C  CG2 . ILE A 1  1049 ? 144.962 59.384  -2.116  1.00 20.68  ? 1049 ILE A CG2 1 
ATOM   8195  C  CD1 . ILE A 1  1049 ? 145.836 60.017  0.719   1.00 22.23  ? 1049 ILE A CD1 1 
ATOM   8196  N  N   . GLU A 1  1050 ? 145.961 56.564  -3.697  1.00 22.15  ? 1050 GLU A N   1 
ATOM   8197  C  CA  . GLU A 1  1050 ? 145.889 56.388  -5.134  1.00 27.54  ? 1050 GLU A CA  1 
ATOM   8198  C  C   . GLU A 1  1050 ? 144.899 55.288  -5.469  1.00 26.58  ? 1050 GLU A C   1 
ATOM   8199  O  O   . GLU A 1  1050 ? 144.225 55.338  -6.501  1.00 27.00  ? 1050 GLU A O   1 
ATOM   8200  C  CB  . GLU A 1  1050 ? 147.254 56.022  -5.707  1.00 36.02  ? 1050 GLU A CB  1 
ATOM   8201  C  CG  . GLU A 1  1050 ? 147.183 55.011  -6.846  1.00 47.83  ? 1050 GLU A CG  1 
ATOM   8202  C  CD  . GLU A 1  1050 ? 148.065 55.377  -8.024  1.00 55.46  ? 1050 GLU A CD  1 
ATOM   8203  O  OE1 . GLU A 1  1050 ? 149.252 55.717  -7.802  1.00 59.64  ? 1050 GLU A OE1 1 
ATOM   8204  O  OE2 . GLU A 1  1050 ? 147.570 55.313  -9.175  1.00 59.92  ? 1050 GLU A OE2 1 
ATOM   8205  N  N   . ALA A 1  1051 ? 144.822 54.287  -4.599  1.00 25.17  ? 1051 ALA A N   1 
ATOM   8206  C  CA  . ALA A 1  1051 ? 143.917 53.169  -4.824  1.00 24.65  ? 1051 ALA A CA  1 
ATOM   8207  C  C   . ALA A 1  1051 ? 142.532 53.489  -4.323  1.00 22.63  ? 1051 ALA A C   1 
ATOM   8208  O  O   . ALA A 1  1051 ? 141.621 53.662  -5.121  1.00 23.61  ? 1051 ALA A O   1 
ATOM   8209  C  CB  . ALA A 1  1051 ? 144.439 51.914  -4.146  1.00 25.49  ? 1051 ALA A CB  1 
ATOM   8210  N  N   . GLN A 1  1052 ? 142.381 53.580  -3.004  1.00 23.18  ? 1052 GLN A N   1 
ATOM   8211  C  CA  . GLN A 1  1052 ? 141.085 53.872  -2.405  1.00 25.76  ? 1052 GLN A CA  1 
ATOM   8212  C  C   . GLN A 1  1052 ? 140.317 54.853  -3.261  1.00 22.52  ? 1052 GLN A C   1 
ATOM   8213  O  O   . GLN A 1  1052 ? 139.086 54.857  -3.272  1.00 21.48  ? 1052 GLN A O   1 
ATOM   8214  C  CB  . GLN A 1  1052 ? 141.245 54.420  -0.990  1.00 31.38  ? 1052 GLN A CB  1 
ATOM   8215  C  CG  . GLN A 1  1052 ? 140.788 53.434  0.056   1.00 43.31  ? 1052 GLN A CG  1 
ATOM   8216  C  CD  . GLN A 1  1052 ? 141.022 53.912  1.475   1.00 52.90  ? 1052 GLN A CD  1 
ATOM   8217  O  OE1 . GLN A 1  1052 ? 140.117 54.444  2.135   1.00 57.19  ? 1052 GLN A OE1 1 
ATOM   8218  N  NE2 . GLN A 1  1052 ? 142.248 53.725  1.958   1.00 58.58  ? 1052 GLN A NE2 1 
ATOM   8219  N  N   . PHE A 1  1053 ? 141.056 55.683  -3.984  1.00 17.23  ? 1053 PHE A N   1 
ATOM   8220  C  CA  . PHE A 1  1053 ? 140.451 56.652  -4.874  1.00 14.43  ? 1053 PHE A CA  1 
ATOM   8221  C  C   . PHE A 1  1053 ? 140.012 55.856  -6.094  1.00 15.60  ? 1053 PHE A C   1 
ATOM   8222  O  O   . PHE A 1  1053 ? 138.821 55.700  -6.359  1.00 13.25  ? 1053 PHE A O   1 
ATOM   8223  C  CB  . PHE A 1  1053 ? 141.477 57.718  -5.269  1.00 10.60  ? 1053 PHE A CB  1 
ATOM   8224  C  CG  . PHE A 1  1053 ? 140.933 58.781  -6.184  1.00 7.34   ? 1053 PHE A CG  1 
ATOM   8225  C  CD1 . PHE A 1  1053 ? 140.144 59.812  -5.685  1.00 8.98   ? 1053 PHE A CD1 1 
ATOM   8226  C  CD2 . PHE A 1  1053 ? 141.167 58.722  -7.555  1.00 7.77   ? 1053 PHE A CD2 1 
ATOM   8227  C  CE1 . PHE A 1  1053 ? 139.589 60.766  -6.546  1.00 7.94   ? 1053 PHE A CE1 1 
ATOM   8228  C  CE2 . PHE A 1  1053 ? 140.618 59.667  -8.419  1.00 8.77   ? 1053 PHE A CE2 1 
ATOM   8229  C  CZ  . PHE A 1  1053 ? 139.827 60.689  -7.917  1.00 7.71   ? 1053 PHE A CZ  1 
ATOM   8230  N  N   . LEU A 1  1054 ? 140.993 55.338  -6.820  1.00 19.47  ? 1054 LEU A N   1 
ATOM   8231  C  CA  . LEU A 1  1054 ? 140.734 54.546  -8.007  1.00 25.07  ? 1054 LEU A CA  1 
ATOM   8232  C  C   . LEU A 1  1054 ? 139.581 53.558  -7.841  1.00 28.80  ? 1054 LEU A C   1 
ATOM   8233  O  O   . LEU A 1  1054 ? 138.881 53.259  -8.811  1.00 29.12  ? 1054 LEU A O   1 
ATOM   8234  C  CB  . LEU A 1  1054 ? 142.008 53.813  -8.411  1.00 27.66  ? 1054 LEU A CB  1 
ATOM   8235  C  CG  . LEU A 1  1054 ? 142.895 54.708  -9.271  1.00 31.99  ? 1054 LEU A CG  1 
ATOM   8236  C  CD1 . LEU A 1  1054 ? 144.282 54.116  -9.470  1.00 31.76  ? 1054 LEU A CD1 1 
ATOM   8237  C  CD2 . LEU A 1  1054 ? 142.186 54.904  -10.603 1.00 36.73  ? 1054 LEU A CD2 1 
ATOM   8238  N  N   . ARG A 1  1055 ? 139.391 53.048  -6.621  1.00 33.12  ? 1055 ARG A N   1 
ATOM   8239  C  CA  . ARG A 1  1055 ? 138.299 52.106  -6.331  1.00 34.87  ? 1055 ARG A CA  1 
ATOM   8240  C  C   . ARG A 1  1055 ? 137.010 52.888  -6.161  1.00 33.72  ? 1055 ARG A C   1 
ATOM   8241  O  O   . ARG A 1  1055 ? 135.927 52.408  -6.510  1.00 34.80  ? 1055 ARG A O   1 
ATOM   8242  C  CB  . ARG A 1  1055 ? 138.542 51.329  -5.032  1.00 37.74  ? 1055 ARG A CB  1 
ATOM   8243  C  CG  . ARG A 1  1055 ? 139.281 50.007  -5.161  1.00 44.88  ? 1055 ARG A CG  1 
ATOM   8244  C  CD  . ARG A 1  1055 ? 139.254 49.288  -3.815  1.00 50.84  ? 1055 ARG A CD  1 
ATOM   8245  N  NE  . ARG A 1  1055 ? 140.586 48.885  -3.370  1.00 60.30  ? 1055 ARG A NE  1 
ATOM   8246  C  CZ  . ARG A 1  1055 ? 140.994 48.899  -2.101  1.00 64.09  ? 1055 ARG A CZ  1 
ATOM   8247  N  NH1 . ARG A 1  1055 ? 140.174 49.301  -1.132  1.00 65.98  ? 1055 ARG A NH1 1 
ATOM   8248  N  NH2 . ARG A 1  1055 ? 142.228 48.507  -1.796  1.00 65.68  ? 1055 ARG A NH2 1 
ATOM   8249  N  N   . SER A 1  1056 ? 137.143 54.092  -5.609  1.00 30.84  ? 1056 SER A N   1 
ATOM   8250  C  CA  . SER A 1  1056 ? 136.004 54.959  -5.373  1.00 29.71  ? 1056 SER A CA  1 
ATOM   8251  C  C   . SER A 1  1056 ? 135.282 55.377  -6.645  1.00 29.60  ? 1056 SER A C   1 
ATOM   8252  O  O   . SER A 1  1056 ? 134.115 55.743  -6.601  1.00 32.14  ? 1056 SER A O   1 
ATOM   8253  C  CB  . SER A 1  1056 ? 136.441 56.185  -4.579  1.00 28.77  ? 1056 SER A CB  1 
ATOM   8254  O  OG  . SER A 1  1056 ? 136.712 55.826  -3.234  1.00 29.87  ? 1056 SER A OG  1 
ATOM   8255  N  N   . VAL A 1  1057 ? 135.959 55.308  -7.781  1.00 28.47  ? 1057 VAL A N   1 
ATOM   8256  C  CA  . VAL A 1  1057 ? 135.333 55.668  -9.045  1.00 27.95  ? 1057 VAL A CA  1 
ATOM   8257  C  C   . VAL A 1  1057 ? 134.026 54.915  -9.263  1.00 26.59  ? 1057 VAL A C   1 
ATOM   8258  O  O   . VAL A 1  1057 ? 133.668 54.038  -8.494  1.00 30.36  ? 1057 VAL A O   1 
ATOM   8259  C  CB  . VAL A 1  1057 ? 136.250 55.340  -10.206 1.00 30.82  ? 1057 VAL A CB  1 
ATOM   8260  C  CG1 . VAL A 1  1057 ? 135.714 55.965  -11.492 1.00 31.77  ? 1057 VAL A CG1 1 
ATOM   8261  C  CG2 . VAL A 1  1057 ? 137.661 55.815  -9.886  1.00 36.00  ? 1057 VAL A CG2 1 
ATOM   8262  N  N   . VAL A 1  1058 ? 133.314 55.260  -10.324 1.00 24.18  ? 1058 VAL A N   1 
ATOM   8263  C  CA  . VAL A 1  1058 ? 132.055 54.608  -10.648 1.00 21.58  ? 1058 VAL A CA  1 
ATOM   8264  C  C   . VAL A 1  1058 ? 132.279 53.597  -11.771 1.00 24.04  ? 1058 VAL A C   1 
ATOM   8265  O  O   . VAL A 1  1058 ? 133.121 53.808  -12.653 1.00 26.98  ? 1058 VAL A O   1 
ATOM   8266  C  CB  . VAL A 1  1058 ? 131.008 55.651  -11.066 1.00 16.31  ? 1058 VAL A CB  1 
ATOM   8267  C  CG1 . VAL A 1  1058 ? 130.262 55.212  -12.318 1.00 14.19  ? 1058 VAL A CG1 1 
ATOM   8268  C  CG2 . VAL A 1  1058 ? 130.058 55.862  -9.932  1.00 15.06  ? 1058 VAL A CG2 1 
ATOM   8269  N  N   . HIS A 1  1059 ? 131.520 52.503  -11.735 1.00 21.93  ? 1059 HIS A N   1 
ATOM   8270  C  CA  . HIS A 1  1059 ? 131.652 51.444  -12.727 1.00 21.41  ? 1059 HIS A CA  1 
ATOM   8271  C  C   . HIS A 1  1059 ? 130.784 51.601  -13.955 1.00 18.58  ? 1059 HIS A C   1 
ATOM   8272  O  O   . HIS A 1  1059 ? 129.569 51.564  -13.878 1.00 18.82  ? 1059 HIS A O   1 
ATOM   8273  C  CB  . HIS A 1  1059 ? 131.355 50.108  -12.070 1.00 28.97  ? 1059 HIS A CB  1 
ATOM   8274  C  CG  . HIS A 1  1059 ? 132.416 49.660  -11.119 1.00 37.51  ? 1059 HIS A CG  1 
ATOM   8275  N  ND1 . HIS A 1  1059 ? 133.473 48.864  -11.510 1.00 39.29  ? 1059 HIS A ND1 1 
ATOM   8276  C  CD2 . HIS A 1  1059 ? 132.620 49.948  -9.812  1.00 42.38  ? 1059 HIS A CD2 1 
ATOM   8277  C  CE1 . HIS A 1  1059 ? 134.283 48.686  -10.482 1.00 45.56  ? 1059 HIS A CE1 1 
ATOM   8278  N  NE2 . HIS A 1  1059 ? 133.791 49.334  -9.440  1.00 46.67  ? 1059 HIS A NE2 1 
ATOM   8279  N  N   . PRO A 1  1060 ? 131.411 51.766  -15.117 1.00 17.09  ? 1060 PRO A N   1 
ATOM   8280  C  CA  . PRO A 1  1060 ? 130.677 51.928  -16.372 1.00 16.55  ? 1060 PRO A CA  1 
ATOM   8281  C  C   . PRO A 1  1060 ? 129.643 50.848  -16.606 1.00 14.86  ? 1060 PRO A C   1 
ATOM   8282  O  O   . PRO A 1  1060 ? 129.899 49.881  -17.311 1.00 15.17  ? 1060 PRO A O   1 
ATOM   8283  C  CB  . PRO A 1  1060 ? 131.777 51.902  -17.426 1.00 16.63  ? 1060 PRO A CB  1 
ATOM   8284  C  CG  . PRO A 1  1060 ? 132.916 52.562  -16.737 1.00 18.91  ? 1060 PRO A CG  1 
ATOM   8285  C  CD  . PRO A 1  1060 ? 132.854 51.973  -15.320 1.00 20.22  ? 1060 PRO A CD  1 
ATOM   8286  N  N   . GLY A 1  1061 ? 128.474 51.029  -16.015 1.00 15.72  ? 1061 GLY A N   1 
ATOM   8287  C  CA  . GLY A 1  1061 ? 127.407 50.072  -16.171 1.00 17.48  ? 1061 GLY A CA  1 
ATOM   8288  C  C   . GLY A 1  1061 ? 126.269 50.567  -15.324 1.00 20.66  ? 1061 GLY A C   1 
ATOM   8289  O  O   . GLY A 1  1061 ? 125.163 50.783  -15.823 1.00 20.49  ? 1061 GLY A O   1 
ATOM   8290  N  N   . GLU A 1  1062 ? 126.575 50.748  -14.036 1.00 23.08  ? 1062 GLU A N   1 
ATOM   8291  C  CA  . GLU A 1  1062 ? 125.645 51.240  -13.014 1.00 22.94  ? 1062 GLU A CA  1 
ATOM   8292  C  C   . GLU A 1  1062 ? 124.453 51.989  -13.581 1.00 20.85  ? 1062 GLU A C   1 
ATOM   8293  O  O   . GLU A 1  1062 ? 124.605 53.113  -14.063 1.00 19.22  ? 1062 GLU A O   1 
ATOM   8294  C  CB  . GLU A 1  1062 ? 126.365 52.198  -12.068 1.00 24.51  ? 1062 GLU A CB  1 
ATOM   8295  C  CG  . GLU A 1  1062 ? 127.271 51.553  -11.070 1.00 32.89  ? 1062 GLU A CG  1 
ATOM   8296  C  CD  . GLU A 1  1062 ? 126.642 51.484  -9.690  1.00 38.63  ? 1062 GLU A CD  1 
ATOM   8297  O  OE1 . GLU A 1  1062 ? 126.367 52.546  -9.088  1.00 42.15  ? 1062 GLU A OE1 1 
ATOM   8298  O  OE2 . GLU A 1  1062 ? 126.415 50.362  -9.197  1.00 44.37  ? 1062 GLU A OE2 1 
ATOM   8299  N  N   . MET A 1  1063 ? 123.268 51.393  -13.525 1.00 17.50  ? 1063 MET A N   1 
ATOM   8300  C  CA  . MET A 1  1063 ? 122.089 52.091  -14.026 1.00 14.71  ? 1063 MET A CA  1 
ATOM   8301  C  C   . MET A 1  1063 ? 121.782 53.206  -13.040 1.00 12.38  ? 1063 MET A C   1 
ATOM   8302  O  O   . MET A 1  1063 ? 120.964 53.037  -12.131 1.00 12.56  ? 1063 MET A O   1 
ATOM   8303  C  CB  . MET A 1  1063 ? 120.915 51.139  -14.101 1.00 14.46  ? 1063 MET A CB  1 
ATOM   8304  C  CG  . MET A 1  1063 ? 121.231 49.954  -14.931 1.00 12.90  ? 1063 MET A CG  1 
ATOM   8305  S  SD  . MET A 1  1063 ? 121.673 50.499  -16.553 1.00 14.51  ? 1063 MET A SD  1 
ATOM   8306  C  CE  . MET A 1  1063 ? 120.102 51.038  -17.073 1.00 10.28  ? 1063 MET A CE  1 
ATOM   8307  N  N   . VAL A 1  1064 ? 122.422 54.357  -13.203 1.00 8.59   ? 1064 VAL A N   1 
ATOM   8308  C  CA  . VAL A 1  1064 ? 122.160 55.387  -12.226 1.00 8.37   ? 1064 VAL A CA  1 
ATOM   8309  C  C   . VAL A 1  1064 ? 120.788 55.976  -12.334 1.00 9.06   ? 1064 VAL A C   1 
ATOM   8310  O  O   . VAL A 1  1064 ? 120.170 56.301  -11.310 1.00 11.19  ? 1064 VAL A O   1 
ATOM   8311  C  CB  . VAL A 1  1064 ? 123.107 56.561  -12.283 1.00 6.65   ? 1064 VAL A CB  1 
ATOM   8312  C  CG1 . VAL A 1  1064 ? 122.882 57.360  -10.997 1.00 8.99   ? 1064 VAL A CG1 1 
ATOM   8313  C  CG2 . VAL A 1  1064 ? 124.557 56.105  -12.423 1.00 7.69   ? 1064 VAL A CG2 1 
ATOM   8314  N  N   . GLY A 1  1065 ? 120.324 56.137  -13.571 1.00 7.13   ? 1065 GLY A N   1 
ATOM   8315  C  CA  . GLY A 1  1065 ? 119.010 56.714  -13.775 1.00 6.90   ? 1065 GLY A CA  1 
ATOM   8316  C  C   . GLY A 1  1065 ? 118.052 56.192  -12.727 1.00 1.98   ? 1065 GLY A C   1 
ATOM   8317  O  O   . GLY A 1  1065 ? 117.559 56.918  -11.851 1.00 1.00   ? 1065 GLY A O   1 
ATOM   8318  N  N   . VAL A 1  1066 ? 117.816 54.897  -12.811 1.00 1.81   ? 1066 VAL A N   1 
ATOM   8319  C  CA  . VAL A 1  1066 ? 116.928 54.245  -11.892 1.00 4.07   ? 1066 VAL A CA  1 
ATOM   8320  C  C   . VAL A 1  1066 ? 117.362 54.414  -10.465 1.00 5.38   ? 1066 VAL A C   1 
ATOM   8321  O  O   . VAL A 1  1066 ? 116.538 54.635  -9.583  1.00 3.07   ? 1066 VAL A O   1 
ATOM   8322  C  CB  . VAL A 1  1066 ? 116.863 52.787  -12.208 1.00 6.06   ? 1066 VAL A CB  1 
ATOM   8323  C  CG1 . VAL A 1  1066 ? 116.047 52.057  -11.122 1.00 7.39   ? 1066 VAL A CG1 1 
ATOM   8324  C  CG2 . VAL A 1  1066 ? 116.283 52.624  -13.628 1.00 6.19   ? 1066 VAL A CG2 1 
ATOM   8325  N  N   . LEU A 1  1067 ? 118.659 54.292  -10.228 1.00 10.85  ? 1067 LEU A N   1 
ATOM   8326  C  CA  . LEU A 1  1067 ? 119.143 54.450  -8.874  1.00 16.43  ? 1067 LEU A CA  1 
ATOM   8327  C  C   . LEU A 1  1067 ? 118.724 55.824  -8.395  1.00 18.61  ? 1067 LEU A C   1 
ATOM   8328  O  O   . LEU A 1  1067 ? 118.031 55.970  -7.378  1.00 23.60  ? 1067 LEU A O   1 
ATOM   8329  C  CB  . LEU A 1  1067 ? 120.658 54.331  -8.799  1.00 16.65  ? 1067 LEU A CB  1 
ATOM   8330  C  CG  . LEU A 1  1067 ? 121.137 54.704  -7.388  1.00 18.61  ? 1067 LEU A CG  1 
ATOM   8331  C  CD1 . LEU A 1  1067 ? 120.224 54.125  -6.313  1.00 20.28  ? 1067 LEU A CD1 1 
ATOM   8332  C  CD2 . LEU A 1  1067 ? 122.550 54.217  -7.196  1.00 23.23  ? 1067 LEU A CD2 1 
ATOM   8333  N  N   . ALA A 1  1068 ? 119.165 56.837  -9.130  1.00 17.34  ? 1068 ALA A N   1 
ATOM   8334  C  CA  . ALA A 1  1068 ? 118.813 58.197  -8.800  1.00 16.06  ? 1068 ALA A CA  1 
ATOM   8335  C  C   . ALA A 1  1068 ? 117.331 58.188  -8.408  1.00 15.36  ? 1068 ALA A C   1 
ATOM   8336  O  O   . ALA A 1  1068 ? 116.982 58.356  -7.230  1.00 15.53  ? 1068 ALA A O   1 
ATOM   8337  C  CB  . ALA A 1  1068 ? 119.041 59.076  -10.011 1.00 17.60  ? 1068 ALA A CB  1 
ATOM   8338  N  N   . ALA A 1  1069 ? 116.483 57.946  -9.409  1.00 13.97  ? 1069 ALA A N   1 
ATOM   8339  C  CA  . ALA A 1  1069 ? 115.033 57.904  -9.241  1.00 14.34  ? 1069 ALA A CA  1 
ATOM   8340  C  C   . ALA A 1  1069 ? 114.629 57.338  -7.896  1.00 15.64  ? 1069 ALA A C   1 
ATOM   8341  O  O   . ALA A 1  1069 ? 114.086 58.044  -7.047  1.00 15.53  ? 1069 ALA A O   1 
ATOM   8342  C  CB  . ALA A 1  1069 ? 114.416 57.080  -10.339 1.00 12.82  ? 1069 ALA A CB  1 
ATOM   8343  N  N   . GLN A 1  1070 ? 114.894 56.053  -7.715  1.00 17.29  ? 1070 GLN A N   1 
ATOM   8344  C  CA  . GLN A 1  1070 ? 114.560 55.372  -6.475  1.00 20.59  ? 1070 GLN A CA  1 
ATOM   8345  C  C   . GLN A 1  1070 ? 114.834 56.226  -5.249  1.00 20.69  ? 1070 GLN A C   1 
ATOM   8346  O  O   . GLN A 1  1070 ? 113.951 56.446  -4.428  1.00 23.83  ? 1070 GLN A O   1 
ATOM   8347  C  CB  . GLN A 1  1070 ? 115.374 54.084  -6.322  1.00 23.78  ? 1070 GLN A CB  1 
ATOM   8348  C  CG  . GLN A 1  1070 ? 115.172 53.019  -7.387  1.00 28.78  ? 1070 GLN A CG  1 
ATOM   8349  C  CD  . GLN A 1  1070 ? 115.131 51.620  -6.788  1.00 31.70  ? 1070 GLN A CD  1 
ATOM   8350  O  OE1 . GLN A 1  1070 ? 116.035 51.213  -6.038  1.00 29.80  ? 1070 GLN A OE1 1 
ATOM   8351  N  NE2 . GLN A 1  1070 ? 114.073 50.875  -7.115  1.00 32.54  ? 1070 GLN A NE2 1 
ATOM   8352  N  N   . SER A 1  1071 ? 116.073 56.693  -5.147  1.00 18.64  ? 1071 SER A N   1 
ATOM   8353  C  CA  . SER A 1  1071 ? 116.562 57.489  -4.024  1.00 16.53  ? 1071 SER A CA  1 
ATOM   8354  C  C   . SER A 1  1071 ? 115.834 58.793  -3.650  1.00 15.31  ? 1071 SER A C   1 
ATOM   8355  O  O   . SER A 1  1071 ? 116.010 59.330  -2.543  1.00 13.86  ? 1071 SER A O   1 
ATOM   8356  C  CB  . SER A 1  1071 ? 118.034 57.764  -4.264  1.00 17.28  ? 1071 SER A CB  1 
ATOM   8357  O  OG  . SER A 1  1071 ? 118.695 56.538  -4.493  1.00 18.50  ? 1071 SER A OG  1 
ATOM   8358  N  N   . ILE A 1  1072 ? 115.027 59.303  -4.573  1.00 13.71  ? 1072 ILE A N   1 
ATOM   8359  C  CA  . ILE A 1  1072 ? 114.260 60.513  -4.326  1.00 13.34  ? 1072 ILE A CA  1 
ATOM   8360  C  C   . ILE A 1  1072 ? 112.841 60.070  -3.903  1.00 16.70  ? 1072 ILE A C   1 
ATOM   8361  O  O   . ILE A 1  1072 ? 112.260 60.593  -2.938  1.00 14.81  ? 1072 ILE A O   1 
ATOM   8362  C  CB  . ILE A 1  1072 ? 114.186 61.372  -5.602  1.00 10.88  ? 1072 ILE A CB  1 
ATOM   8363  C  CG1 . ILE A 1  1072 ? 115.587 61.592  -6.190  1.00 7.36   ? 1072 ILE A CG1 1 
ATOM   8364  C  CG2 . ILE A 1  1072 ? 113.591 62.699  -5.270  1.00 10.70  ? 1072 ILE A CG2 1 
ATOM   8365  C  CD1 . ILE A 1  1072 ? 115.597 62.376  -7.503  1.00 5.43   ? 1072 ILE A CD1 1 
ATOM   8366  N  N   . GLY A 1  1073 ? 112.302 59.085  -4.622  1.00 17.06  ? 1073 GLY A N   1 
ATOM   8367  C  CA  . GLY A 1  1073 ? 110.980 58.561  -4.311  1.00 21.04  ? 1073 GLY A CA  1 
ATOM   8368  C  C   . GLY A 1  1073 ? 110.914 57.820  -2.981  1.00 23.68  ? 1073 GLY A C   1 
ATOM   8369  O  O   . GLY A 1  1073 ? 109.891 57.826  -2.295  1.00 22.81  ? 1073 GLY A O   1 
ATOM   8370  N  N   . GLU A 1  1074 ? 112.008 57.166  -2.618  1.00 27.24  ? 1074 GLU A N   1 
ATOM   8371  C  CA  . GLU A 1  1074 ? 112.067 56.435  -1.363  1.00 31.57  ? 1074 GLU A CA  1 
ATOM   8372  C  C   . GLU A 1  1074 ? 111.658 57.412  -0.274  1.00 31.37  ? 1074 GLU A C   1 
ATOM   8373  O  O   . GLU A 1  1074 ? 110.643 57.216  0.407   1.00 31.10  ? 1074 GLU A O   1 
ATOM   8374  C  CB  . GLU A 1  1074 ? 113.499 55.935  -1.106  1.00 37.62  ? 1074 GLU A CB  1 
ATOM   8375  C  CG  . GLU A 1  1074 ? 113.670 54.799  -0.069  1.00 46.03  ? 1074 GLU A CG  1 
ATOM   8376  C  CD  . GLU A 1  1074 ? 113.511 55.225  1.400   1.00 51.32  ? 1074 GLU A CD  1 
ATOM   8377  O  OE1 . GLU A 1  1074 ? 114.048 56.286  1.796   1.00 53.91  ? 1074 GLU A OE1 1 
ATOM   8378  O  OE2 . GLU A 1  1074 ? 112.865 54.475  2.170   1.00 54.24  ? 1074 GLU A OE2 1 
ATOM   8379  N  N   . PRO A 1  1075 ? 112.433 58.502  -0.122  1.00 30.81  ? 1075 PRO A N   1 
ATOM   8380  C  CA  . PRO A 1  1075 ? 112.172 59.527  0.886   1.00 33.35  ? 1075 PRO A CA  1 
ATOM   8381  C  C   . PRO A 1  1075 ? 110.922 60.293  0.528   1.00 36.08  ? 1075 PRO A C   1 
ATOM   8382  O  O   . PRO A 1  1075 ? 110.203 60.765  1.407   1.00 39.82  ? 1075 PRO A O   1 
ATOM   8383  C  CB  . PRO A 1  1075 ? 113.405 60.392  0.801   1.00 31.28  ? 1075 PRO A CB  1 
ATOM   8384  C  CG  . PRO A 1  1075 ? 113.640 60.401  -0.668  1.00 30.28  ? 1075 PRO A CG  1 
ATOM   8385  C  CD  . PRO A 1  1075 ? 113.498 58.955  -1.033  1.00 28.99  ? 1075 PRO A CD  1 
ATOM   8386  N  N   . ALA A 1  1076 ? 110.668 60.423  -0.768  1.00 36.02  ? 1076 ALA A N   1 
ATOM   8387  C  CA  . ALA A 1  1076 ? 109.481 61.128  -1.201  1.00 40.21  ? 1076 ALA A CA  1 
ATOM   8388  C  C   . ALA A 1  1076 ? 108.291 60.492  -0.502  1.00 43.04  ? 1076 ALA A C   1 
ATOM   8389  O  O   . ALA A 1  1076 ? 107.431 61.159  0.060   1.00 44.02  ? 1076 ALA A O   1 
ATOM   8390  C  CB  . ALA A 1  1076 ? 109.326 61.007  -2.692  1.00 38.72  ? 1076 ALA A CB  1 
ATOM   8391  N  N   . THR A 1  1077 ? 108.272 59.176  -0.520  1.00 47.16  ? 1077 THR A N   1 
ATOM   8392  C  CA  . THR A 1  1077 ? 107.196 58.434  0.080   1.00 54.28  ? 1077 THR A CA  1 
ATOM   8393  C  C   . THR A 1  1077 ? 106.971 58.680  1.549   1.00 58.45  ? 1077 THR A C   1 
ATOM   8394  O  O   . THR A 1  1077 ? 105.837 58.643  2.022   1.00 60.10  ? 1077 THR A O   1 
ATOM   8395  C  CB  . THR A 1  1077 ? 107.436 56.980  -0.105  1.00 55.92  ? 1077 THR A CB  1 
ATOM   8396  O  OG1 . THR A 1  1077 ? 107.604 56.725  -1.504  1.00 59.87  ? 1077 THR A OG1 1 
ATOM   8397  C  CG2 . THR A 1  1077 ? 106.265 56.186  0.450   1.00 60.74  ? 1077 THR A CG2 1 
ATOM   8398  N  N   . GLN A 1  1078 ? 108.058 58.910  2.269   1.00 64.99  ? 1078 GLN A N   1 
ATOM   8399  C  CA  . GLN A 1  1078 ? 107.990 59.143  3.701   1.00 72.91  ? 1078 GLN A CA  1 
ATOM   8400  C  C   . GLN A 1  1078 ? 107.677 60.590  4.082   1.00 72.61  ? 1078 GLN A C   1 
ATOM   8401  O  O   . GLN A 1  1078 ? 107.491 60.907  5.262   1.00 75.13  ? 1078 GLN A O   1 
ATOM   8402  C  CB  . GLN A 1  1078 ? 109.303 58.703  4.350   1.00 78.16  ? 1078 GLN A CB  1 
ATOM   8403  C  CG  . GLN A 1  1078 ? 109.400 57.213  4.598   1.00 87.40  ? 1078 GLN A CG  1 
ATOM   8404  C  CD  . GLN A 1  1078 ? 110.751 56.820  5.139   1.00 93.29  ? 1078 GLN A CD  1 
ATOM   8405  O  OE1 . GLN A 1  1078 ? 111.314 57.516  5.989   1.00 96.01  ? 1078 GLN A OE1 1 
ATOM   8406  N  NE2 . GLN A 1  1078 ? 111.283 55.694  4.660   1.00 97.38  ? 1078 GLN A NE2 1 
ATOM   8407  N  N   . MET A 1  1079 ? 107.611 61.469  3.091   1.00 70.68  ? 1079 MET A N   1 
ATOM   8408  C  CA  . MET A 1  1079 ? 107.322 62.867  3.369   1.00 70.39  ? 1079 MET A CA  1 
ATOM   8409  C  C   . MET A 1  1079 ? 105.965 63.059  3.992   1.00 74.64  ? 1079 MET A C   1 
ATOM   8410  O  O   . MET A 1  1079 ? 105.011 62.378  3.638   1.00 74.77  ? 1079 MET A O   1 
ATOM   8411  C  CB  . MET A 1  1079 ? 107.382 63.696  2.102   1.00 65.79  ? 1079 MET A CB  1 
ATOM   8412  C  CG  . MET A 1  1079 ? 108.776 63.940  1.626   1.00 61.28  ? 1079 MET A CG  1 
ATOM   8413  S  SD  . MET A 1  1079 ? 108.827 65.360  0.557   1.00 57.08  ? 1079 MET A SD  1 
ATOM   8414  C  CE  . MET A 1  1079 ? 108.017 64.743  -0.842  1.00 50.31  ? 1079 MET A CE  1 
ATOM   8415  N  N   . THR A 1  1080 ? 105.873 63.999  4.920   1.00 81.92  ? 1080 THR A N   1 
ATOM   8416  C  CA  . THR A 1  1080 ? 104.600 64.258  5.562   1.00 88.80  ? 1080 THR A CA  1 
ATOM   8417  C  C   . THR A 1  1080 ? 103.725 64.980  4.563   1.00 89.84  ? 1080 THR A C   1 
ATOM   8418  O  O   . THR A 1  1080 ? 104.215 65.470  3.547   1.00 85.56  ? 1080 THR A O   1 
ATOM   8419  C  CB  . THR A 1  1080 ? 104.756 65.141  6.794   1.00 91.62  ? 1080 THR A CB  1 
ATOM   8420  O  OG1 . THR A 1  1080 ? 105.748 64.580  7.664   1.00 95.84  ? 1080 THR A OG1 1 
ATOM   8421  C  CG2 . THR A 1  1080 ? 103.429 65.233  7.535   1.00 93.87  ? 1080 THR A CG2 1 
ATOM   8422  N  N   . LEU A 1  1081 ? 102.431 65.046  4.846   1.00 95.08  ? 1081 LEU A N   1 
ATOM   8423  C  CA  . LEU A 1  1081 ? 101.527 65.719  3.939   1.00 103.63 ? 1081 LEU A CA  1 
ATOM   8424  C  C   . LEU A 1  1081 ? 100.680 66.826  4.475   1.00 107.92 ? 1081 LEU A C   1 
ATOM   8425  O  O   . LEU A 1  1081 ? 100.093 66.720  5.553   1.00 110.01 ? 1081 LEU A O   1 
ATOM   8426  C  CB  . LEU A 1  1081 ? 100.582 64.740  3.272   1.00 107.31 ? 1081 LEU A CB  1 
ATOM   8427  C  CG  . LEU A 1  1081 ? 101.002 64.617  1.819   1.00 111.93 ? 1081 LEU A CG  1 
ATOM   8428  C  CD1 . LEU A 1  1081 ? 101.065 65.978  1.134   1.00 110.52 ? 1081 LEU A CD1 1 
ATOM   8429  C  CD2 . LEU A 1  1081 ? 102.369 63.966  1.827   1.00 114.79 ? 1081 LEU A CD2 1 
ATOM   8430  N  N   . ASN A 1  1082 ? 100.613 67.888  3.680   1.00 113.65 ? 1082 ASN A N   1 
ATOM   8431  C  CA  . ASN A 1  1082 ? 99.788  69.038  3.994   1.00 117.19 ? 1082 ASN A CA  1 
ATOM   8432  C  C   . ASN A 1  1082 ? 99.876  69.318  5.496   1.00 118.40 ? 1082 ASN A C   1 
ATOM   8433  O  O   . ASN A 1  1082 ? 98.922  69.085  6.241   1.00 118.65 ? 1082 ASN A O   1 
ATOM   8434  C  CB  . ASN A 1  1082 ? 98.360  68.694  3.554   1.00 118.34 ? 1082 ASN A CB  1 
ATOM   8435  C  CG  . ASN A 1  1082 ? 98.301  67.384  2.733   1.00 119.70 ? 1082 ASN A CG  1 
ATOM   8436  O  OD1 . ASN A 1  1082 ? 98.872  67.281  1.641   1.00 119.83 ? 1082 ASN A OD1 1 
ATOM   8437  N  ND2 . ASN A 1  1082 ? 97.620  66.382  3.275   1.00 119.56 ? 1082 ASN A ND2 1 
ATOM   8438  N  N   . THR A 1  1083 ? 101.031 69.811  5.936   1.00 118.67 ? 1083 THR A N   1 
ATOM   8439  C  CA  . THR A 1  1083 ? 101.237 70.077  7.353   1.00 120.89 ? 1083 THR A CA  1 
ATOM   8440  C  C   . THR A 1  1083 ? 101.087 71.538  7.717   1.00 121.88 ? 1083 THR A C   1 
ATOM   8441  O  O   . THR A 1  1083 ? 100.172 71.930  8.461   1.00 120.06 ? 1083 THR A O   1 
ATOM   8442  C  CB  . THR A 1  1083 ? 102.641 69.627  7.806   1.00 120.27 ? 1083 THR A CB  1 
ATOM   8443  O  OG1 . THR A 1  1083 ? 102.831 68.247  7.470   1.00 121.30 ? 1083 THR A OG1 1 
ATOM   8444  C  CG2 . THR A 1  1083 ? 102.794 69.798  9.315   1.00 119.50 ? 1083 THR A CG2 1 
ATOM   8445  N  N   . PHE A 1  1084 ? 102.001 72.333  7.175   1.00 123.49 ? 1084 PHE A N   1 
ATOM   8446  C  CA  . PHE A 1  1084 ? 102.034 73.753  7.446   1.00 123.91 ? 1084 PHE A CA  1 
ATOM   8447  C  C   . PHE A 1  1084 ? 102.135 73.903  8.965   1.00 121.12 ? 1084 PHE A C   1 
ATOM   8448  O  O   . PHE A 1  1084 ? 101.185 73.625  9.708   1.00 118.49 ? 1084 PHE A O   1 
ATOM   8449  C  CB  . PHE A 1  1084 ? 100.775 74.447  6.897   1.00 127.96 ? 1084 PHE A CB  1 
ATOM   8450  C  CG  . PHE A 1  1084 ? 100.663 74.406  5.386   1.00 132.27 ? 1084 PHE A CG  1 
ATOM   8451  C  CD1 . PHE A 1  1084 ? 99.538  73.853  4.775   1.00 134.86 ? 1084 PHE A CD1 1 
ATOM   8452  C  CD2 . PHE A 1  1084 ? 101.669 74.932  4.576   1.00 133.67 ? 1084 PHE A CD2 1 
ATOM   8453  C  CE1 . PHE A 1  1084 ? 99.424  73.804  3.379   1.00 137.30 ? 1084 PHE A CE1 1 
ATOM   8454  C  CE2 . PHE A 1  1084 ? 101.566 74.888  3.178   1.00 135.95 ? 1084 PHE A CE2 1 
ATOM   8455  C  CZ  . PHE A 1  1084 ? 100.437 74.331  2.579   1.00 137.46 ? 1084 PHE A CZ  1 
ATOM   8456  N  N   . HIS A 1  1085 ? 103.327 74.296  9.406   1.00 118.68 ? 1085 HIS A N   1 
ATOM   8457  C  CA  . HIS A 1  1085 ? 103.630 74.521  10.814  1.00 116.56 ? 1085 HIS A CA  1 
ATOM   8458  C  C   . HIS A 1  1085 ? 103.421 75.998  11.057  1.00 112.94 ? 1085 HIS A C   1 
ATOM   8459  O  O   . HIS A 1  1085 ? 103.395 76.463  12.195  1.00 111.94 ? 1085 HIS A O   1 
ATOM   8460  C  CB  . HIS A 1  1085 ? 105.085 74.169  11.099  1.00 120.66 ? 1085 HIS A CB  1 
ATOM   8461  C  CG  . HIS A 1  1085 ? 105.429 72.767  10.729  1.00 124.87 ? 1085 HIS A CG  1 
ATOM   8462  N  ND1 . HIS A 1  1085 ? 104.951 71.685  11.433  1.00 127.19 ? 1085 HIS A ND1 1 
ATOM   8463  C  CD2 . HIS A 1  1085 ? 106.100 72.266  9.666   1.00 126.52 ? 1085 HIS A CD2 1 
ATOM   8464  C  CE1 . HIS A 1  1085 ? 105.310 70.572  10.816  1.00 128.26 ? 1085 HIS A CE1 1 
ATOM   8465  N  NE2 . HIS A 1  1085 ? 106.005 70.896  9.742   1.00 128.68 ? 1085 HIS A NE2 1 
ATOM   8466  N  N   . PHE A 1  1086 ? 103.281 76.732  9.962   1.00 108.15 ? 1086 PHE A N   1 
ATOM   8467  C  CA  . PHE A 1  1086 ? 103.076 78.160  10.031  1.00 104.20 ? 1086 PHE A CA  1 
ATOM   8468  C  C   . PHE A 1  1086 ? 101.639 78.482  10.400  1.00 101.36 ? 1086 PHE A C   1 
ATOM   8469  O  O   . PHE A 1  1086 ? 101.402 79.385  11.193  1.00 101.87 ? 1086 PHE A O   1 
ATOM   8470  C  CB  . PHE A 1  1086 ? 103.472 78.806  8.702   1.00 106.51 ? 1086 PHE A CB  1 
ATOM   8471  C  CG  . PHE A 1  1086 ? 104.935 78.649  8.377   1.00 109.18 ? 1086 PHE A CG  1 
ATOM   8472  C  CD1 . PHE A 1  1086 ? 105.346 77.885  7.288   1.00 111.53 ? 1086 PHE A CD1 1 
ATOM   8473  C  CD2 . PHE A 1  1086 ? 105.907 79.211  9.202   1.00 110.02 ? 1086 PHE A CD2 1 
ATOM   8474  C  CE1 . PHE A 1  1086 ? 106.707 77.678  7.029   1.00 112.90 ? 1086 PHE A CE1 1 
ATOM   8475  C  CE2 . PHE A 1  1086 ? 107.269 79.011  8.953   1.00 111.42 ? 1086 PHE A CE2 1 
ATOM   8476  C  CZ  . PHE A 1  1086 ? 107.670 78.242  7.866   1.00 112.20 ? 1086 PHE A CZ  1 
ATOM   8477  N  N   . ALA A 1  1087 ? 100.680 77.747  9.842   1.00 98.78  ? 1087 ALA A N   1 
ATOM   8478  C  CA  . ALA A 1  1087 ? 99.274  77.977  10.172  1.00 95.69  ? 1087 ALA A CA  1 
ATOM   8479  C  C   . ALA A 1  1087 ? 99.228  78.319  11.662  1.00 93.48  ? 1087 ALA A C   1 
ATOM   8480  O  O   . ALA A 1  1087 ? 99.835  77.630  12.490  1.00 91.16  ? 1087 ALA A O   1 
ATOM   8481  C  CB  . ALA A 1  1087 ? 98.445  76.733  9.879   1.00 96.37  ? 1087 ALA A CB  1 
ATOM   8482  N  N   . GLY A 1  1088 ? 98.516  79.399  11.979  1.00 92.50  ? 1088 GLY A N   1 
ATOM   8483  C  CA  . GLY A 1  1088 ? 98.422  79.904  13.342  1.00 89.62  ? 1088 GLY A CA  1 
ATOM   8484  C  C   . GLY A 1  1088 ? 99.165  81.235  13.313  1.00 86.15  ? 1088 GLY A C   1 
ATOM   8485  O  O   . GLY A 1  1088 ? 99.432  81.867  14.342  1.00 85.71  ? 1088 GLY A O   1 
ATOM   8486  N  N   . VAL A 1  1089 ? 99.487  81.628  12.078  1.00 82.92  ? 1089 VAL A N   1 
ATOM   8487  C  CA  . VAL A 1  1089 ? 100.216 82.838  11.709  1.00 77.99  ? 1089 VAL A CA  1 
ATOM   8488  C  C   . VAL A 1  1089 ? 99.937  83.010  10.203  1.00 77.88  ? 1089 VAL A C   1 
ATOM   8489  O  O   . VAL A 1  1089 ? 100.842 83.020  9.366   1.00 74.78  ? 1089 VAL A O   1 
ATOM   8490  C  CB  . VAL A 1  1089 ? 101.736 82.648  11.999  1.00 74.60  ? 1089 VAL A CB  1 
ATOM   8491  C  CG1 . VAL A 1  1089 ? 102.570 83.677  11.285  1.00 72.00  ? 1089 VAL A CG1 1 
ATOM   8492  C  CG2 . VAL A 1  1089 ? 101.983 82.750  13.492  1.00 74.02  ? 1089 VAL A CG2 1 
ATOM   8493  N  N   . ALA A 1  1090 ? 98.647  83.110  9.879   1.00 79.40  ? 1090 ALA A N   1 
ATOM   8494  C  CA  . ALA A 1  1090 ? 98.189  83.274  8.505   1.00 82.31  ? 1090 ALA A CA  1 
ATOM   8495  C  C   . ALA A 1  1090 ? 98.807  84.524  7.935   1.00 84.53  ? 1090 ALA A C   1 
ATOM   8496  O  O   . ALA A 1  1090 ? 98.995  85.499  8.654   1.00 86.12  ? 1090 ALA A O   1 
ATOM   8497  C  CB  . ALA A 1  1090 ? 96.662  83.384  8.455   1.00 81.00  ? 1090 ALA A CB  1 
ATOM   8498  N  N   . SER A 1  1091 ? 99.101  84.476  6.640   1.00 87.38  ? 1091 SER A N   1 
ATOM   8499  C  CA  . SER A 1  1091 ? 99.716  85.569  5.887   1.00 91.43  ? 1091 SER A CA  1 
ATOM   8500  C  C   . SER A 1  1091 ? 101.224 85.336  5.777   1.00 92.68  ? 1091 SER A C   1 
ATOM   8501  O  O   . SER A 1  1091 ? 101.910 85.970  4.965   1.00 92.19  ? 1091 SER A O   1 
ATOM   8502  C  CB  . SER A 1  1091 ? 99.427  86.932  6.527   1.00 93.17  ? 1091 SER A CB  1 
ATOM   8503  O  OG  . SER A 1  1091 ? 100.226 87.144  7.671   1.00 94.63  ? 1091 SER A OG  1 
ATOM   8504  N  N   . LYS A 1  1092 ? 101.735 84.428  6.605   1.00 93.48  ? 1092 LYS A N   1 
ATOM   8505  C  CA  . LYS A 1  1092 ? 103.144 84.061  6.551   1.00 95.64  ? 1092 LYS A CA  1 
ATOM   8506  C  C   . LYS A 1  1092 ? 103.129 82.601  6.134   1.00 91.51  ? 1092 LYS A C   1 
ATOM   8507  O  O   . LYS A 1  1092 ? 104.020 81.826  6.469   1.00 88.75  ? 1092 LYS A O   1 
ATOM   8508  C  CB  . LYS A 1  1092 ? 103.831 84.207  7.914   1.00 103.08 ? 1092 LYS A CB  1 
ATOM   8509  C  CG  . LYS A 1  1092 ? 105.365 84.087  7.826   1.00 110.99 ? 1092 LYS A CG  1 
ATOM   8510  C  CD  . LYS A 1  1092 ? 105.928 85.067  6.779   1.00 116.36 ? 1092 LYS A CD  1 
ATOM   8511  C  CE  . LYS A 1  1092 ? 107.415 84.864  6.491   1.00 117.94 ? 1092 LYS A CE  1 
ATOM   8512  N  NZ  . LYS A 1  1092 ? 107.908 85.885  5.516   1.00 119.59 ? 1092 LYS A NZ  1 
ATOM   8513  N  N   . LYS A 1  1093 ? 102.089 82.248  5.387   1.00 89.35  ? 1093 LYS A N   1 
ATOM   8514  C  CA  . LYS A 1  1093 ? 101.893 80.891  4.910   1.00 87.41  ? 1093 LYS A CA  1 
ATOM   8515  C  C   . LYS A 1  1093 ? 102.599 80.606  3.591   1.00 83.59  ? 1093 LYS A C   1 
ATOM   8516  O  O   . LYS A 1  1093 ? 102.422 81.327  2.607   1.00 81.04  ? 1093 LYS A O   1 
ATOM   8517  C  CB  . LYS A 1  1093 ? 100.394 80.602  4.779   1.00 91.61  ? 1093 LYS A CB  1 
ATOM   8518  C  CG  . LYS A 1  1093 ? 99.627  80.706  6.104   1.00 96.75  ? 1093 LYS A CG  1 
ATOM   8519  C  CD  . LYS A 1  1093 ? 98.150  80.344  5.938   1.00 100.73 ? 1093 LYS A CD  1 
ATOM   8520  C  CE  . LYS A 1  1093 ? 97.419  80.331  7.281   1.00 103.04 ? 1093 LYS A CE  1 
ATOM   8521  N  NZ  . LYS A 1  1093 ? 95.991  79.898  7.171   1.00 102.82 ? 1093 LYS A NZ  1 
ATOM   8522  N  N   . VAL A 1  1094 ? 103.393 79.535  3.598   1.00 80.21  ? 1094 VAL A N   1 
ATOM   8523  C  CA  . VAL A 1  1094 ? 104.165 79.092  2.442   1.00 76.41  ? 1094 VAL A CA  1 
ATOM   8524  C  C   . VAL A 1  1094 ? 103.987 77.593  2.179   1.00 72.46  ? 1094 VAL A C   1 
ATOM   8525  O  O   . VAL A 1  1094 ? 103.852 76.804  3.115   1.00 68.04  ? 1094 VAL A O   1 
ATOM   8526  C  CB  . VAL A 1  1094 ? 105.665 79.385  2.645   1.00 77.72  ? 1094 VAL A CB  1 
ATOM   8527  C  CG1 . VAL A 1  1094 ? 106.460 78.871  1.456   1.00 80.99  ? 1094 VAL A CG1 1 
ATOM   8528  C  CG2 . VAL A 1  1094 ? 105.882 80.891  2.826   1.00 79.74  ? 1094 VAL A CG2 1 
ATOM   8529  N  N   . THR A 1  1095 ? 103.995 77.222  0.896   1.00 71.18  ? 1095 THR A N   1 
ATOM   8530  C  CA  . THR A 1  1095 ? 103.828 75.832  0.452   1.00 69.64  ? 1095 THR A CA  1 
ATOM   8531  C  C   . THR A 1  1095 ? 105.060 74.987  0.693   1.00 69.61  ? 1095 THR A C   1 
ATOM   8532  O  O   . THR A 1  1095 ? 106.119 75.248  0.117   1.00 71.24  ? 1095 THR A O   1 
ATOM   8533  C  CB  . THR A 1  1095 ? 103.557 75.717  -1.059  1.00 67.56  ? 1095 THR A CB  1 
ATOM   8534  O  OG1 . THR A 1  1095 ? 102.402 76.476  -1.414  1.00 69.12  ? 1095 THR A OG1 1 
ATOM   8535  C  CG2 . THR A 1  1095 ? 103.320 74.273  -1.425  1.00 65.70  ? 1095 THR A CG2 1 
ATOM   8536  N  N   . SER A 1  1096 ? 104.910 73.960  1.520   1.00 68.21  ? 1096 SER A N   1 
ATOM   8537  C  CA  . SER A 1  1096 ? 106.014 73.064  1.825   1.00 67.79  ? 1096 SER A CA  1 
ATOM   8538  C  C   . SER A 1  1096 ? 105.492 71.644  1.998   1.00 66.43  ? 1096 SER A C   1 
ATOM   8539  O  O   . SER A 1  1096 ? 104.363 71.435  2.464   1.00 68.90  ? 1096 SER A O   1 
ATOM   8540  C  CB  . SER A 1  1096 ? 106.766 73.524  3.093   1.00 69.65  ? 1096 SER A CB  1 
ATOM   8541  O  OG  . SER A 1  1096 ? 105.959 73.492  4.262   1.00 72.80  ? 1096 SER A OG  1 
ATOM   8542  N  N   . GLY A 1  1097 ? 106.319 70.674  1.609   1.00 62.80  ? 1097 GLY A N   1 
ATOM   8543  C  CA  . GLY A 1  1097 ? 105.940 69.278  1.708   1.00 56.04  ? 1097 GLY A CA  1 
ATOM   8544  C  C   . GLY A 1  1097 ? 105.628 68.659  0.356   1.00 52.17  ? 1097 GLY A C   1 
ATOM   8545  O  O   . GLY A 1  1097 ? 105.965 69.196  -0.700  1.00 50.74  ? 1097 GLY A O   1 
ATOM   8546  N  N   . VAL A 1  1098 ? 104.958 67.518  0.395   1.00 48.41  ? 1098 VAL A N   1 
ATOM   8547  C  CA  . VAL A 1  1098 ? 104.608 66.791  -0.816  1.00 43.43  ? 1098 VAL A CA  1 
ATOM   8548  C  C   . VAL A 1  1098 ? 103.813 67.562  -1.854  1.00 41.19  ? 1098 VAL A C   1 
ATOM   8549  O  O   . VAL A 1  1098 ? 104.085 67.471  -3.054  1.00 37.48  ? 1098 VAL A O   1 
ATOM   8550  C  CB  . VAL A 1  1098 ? 103.848 65.515  -0.460  1.00 42.27  ? 1098 VAL A CB  1 
ATOM   8551  C  CG1 . VAL A 1  1098 ? 103.185 64.929  -1.700  1.00 36.04  ? 1098 VAL A CG1 1 
ATOM   8552  C  CG2 . VAL A 1  1098 ? 104.817 64.524  0.172   1.00 43.72  ? 1098 VAL A CG2 1 
ATOM   8553  N  N   . PRO A 1  1099 ? 102.808 68.324  -1.414  1.00 42.20  ? 1099 PRO A N   1 
ATOM   8554  C  CA  . PRO A 1  1099 ? 102.036 69.070  -2.406  1.00 40.92  ? 1099 PRO A CA  1 
ATOM   8555  C  C   . PRO A 1  1099 ? 102.983 69.933  -3.222  1.00 37.16  ? 1099 PRO A C   1 
ATOM   8556  O  O   . PRO A 1  1099 ? 102.744 70.182  -4.406  1.00 33.67  ? 1099 PRO A O   1 
ATOM   8557  C  CB  . PRO A 1  1099 ? 101.087 69.896  -1.546  1.00 43.97  ? 1099 PRO A CB  1 
ATOM   8558  C  CG  . PRO A 1  1099 ? 101.911 70.142  -0.299  1.00 45.79  ? 1099 PRO A CG  1 
ATOM   8559  C  CD  . PRO A 1  1099 ? 102.482 68.770  -0.048  1.00 45.25  ? 1099 PRO A CD  1 
ATOM   8560  N  N   . ARG A 1  1100 ? 104.064 70.370  -2.567  1.00 35.62  ? 1100 ARG A N   1 
ATOM   8561  C  CA  . ARG A 1  1100 ? 105.087 71.225  -3.190  1.00 33.73  ? 1100 ARG A CA  1 
ATOM   8562  C  C   . ARG A 1  1100 ? 105.866 70.447  -4.226  1.00 28.21  ? 1100 ARG A C   1 
ATOM   8563  O  O   . ARG A 1  1100 ? 105.998 70.870  -5.375  1.00 26.19  ? 1100 ARG A O   1 
ATOM   8564  C  CB  . ARG A 1  1100 ? 106.069 71.778  -2.136  1.00 36.80  ? 1100 ARG A CB  1 
ATOM   8565  C  CG  . ARG A 1  1100 ? 107.309 72.528  -2.717  1.00 39.46  ? 1100 ARG A CG  1 
ATOM   8566  C  CD  . ARG A 1  1100 ? 106.984 73.898  -3.378  1.00 40.90  ? 1100 ARG A CD  1 
ATOM   8567  N  NE  . ARG A 1  1100 ? 108.103 74.452  -4.155  1.00 38.22  ? 1100 ARG A NE  1 
ATOM   8568  C  CZ  . ARG A 1  1100 ? 107.954 75.238  -5.221  1.00 36.75  ? 1100 ARG A CZ  1 
ATOM   8569  N  NH1 . ARG A 1  1100 ? 106.744 75.567  -5.630  1.00 37.41  ? 1100 ARG A NH1 1 
ATOM   8570  N  NH2 . ARG A 1  1100 ? 109.002 75.668  -5.908  1.00 35.23  ? 1100 ARG A NH2 1 
ATOM   8571  N  N   . LEU A 1  1101 ? 106.391 69.309  -3.791  1.00 23.18  ? 1101 LEU A N   1 
ATOM   8572  C  CA  . LEU A 1  1101 ? 107.157 68.439  -4.657  1.00 17.91  ? 1101 LEU A CA  1 
ATOM   8573  C  C   . LEU A 1  1101 ? 106.304 68.088  -5.869  1.00 16.51  ? 1101 LEU A C   1 
ATOM   8574  O  O   . LEU A 1  1101 ? 106.804 67.969  -6.987  1.00 13.71  ? 1101 LEU A O   1 
ATOM   8575  C  CB  . LEU A 1  1101 ? 107.565 67.195  -3.875  1.00 13.83  ? 1101 LEU A CB  1 
ATOM   8576  C  CG  . LEU A 1  1101 ? 108.285 66.107  -4.656  1.00 9.66   ? 1101 LEU A CG  1 
ATOM   8577  C  CD1 . LEU A 1  1101 ? 109.239 66.701  -5.696  1.00 1.76   ? 1101 LEU A CD1 1 
ATOM   8578  C  CD2 . LEU A 1  1101 ? 109.004 65.230  -3.656  1.00 8.56   ? 1101 LEU A CD2 1 
ATOM   8579  N  N   . LYS A 1  1102 ? 105.008 67.937  -5.636  1.00 18.43  ? 1102 LYS A N   1 
ATOM   8580  C  CA  . LYS A 1  1102 ? 104.087 67.640  -6.714  1.00 24.34  ? 1102 LYS A CA  1 
ATOM   8581  C  C   . LYS A 1  1102 ? 104.282 68.776  -7.695  1.00 24.10  ? 1102 LYS A C   1 
ATOM   8582  O  O   . LYS A 1  1102 ? 104.695 68.598  -8.851  1.00 19.73  ? 1102 LYS A O   1 
ATOM   8583  C  CB  . LYS A 1  1102 ? 102.657 67.661  -6.178  1.00 34.40  ? 1102 LYS A CB  1 
ATOM   8584  C  CG  . LYS A 1  1102 ? 101.590 67.358  -7.227  1.00 45.40  ? 1102 LYS A CG  1 
ATOM   8585  C  CD  . LYS A 1  1102 ? 100.166 67.375  -6.646  1.00 53.24  ? 1102 LYS A CD  1 
ATOM   8586  C  CE  . LYS A 1  1102 ? 99.148  66.850  -7.674  1.00 56.70  ? 1102 LYS A CE  1 
ATOM   8587  N  NZ  . LYS A 1  1102 ? 97.733  66.875  -7.190  1.00 62.48  ? 1102 LYS A NZ  1 
ATOM   8588  N  N   . GLU A 1  1103 ? 103.988 69.958  -7.164  1.00 29.45  ? 1103 GLU A N   1 
ATOM   8589  C  CA  . GLU A 1  1103 ? 104.083 71.247  -7.848  1.00 33.35  ? 1103 GLU A CA  1 
ATOM   8590  C  C   . GLU A 1  1103 ? 105.308 71.310  -8.770  1.00 31.13  ? 1103 GLU A C   1 
ATOM   8591  O  O   . GLU A 1  1103 ? 105.228 71.798  -9.912  1.00 29.28  ? 1103 GLU A O   1 
ATOM   8592  C  CB  . GLU A 1  1103 ? 104.162 72.355  -6.781  1.00 36.27  ? 1103 GLU A CB  1 
ATOM   8593  C  CG  . GLU A 1  1103 ? 103.308 73.576  -7.037  1.00 45.55  ? 1103 GLU A CG  1 
ATOM   8594  C  CD  . GLU A 1  1103 ? 103.046 74.391  -5.762  1.00 51.16  ? 1103 GLU A CD  1 
ATOM   8595  O  OE1 . GLU A 1  1103 ? 104.015 74.875  -5.127  1.00 51.74  ? 1103 GLU A OE1 1 
ATOM   8596  O  OE2 . GLU A 1  1103 ? 101.858 74.550  -5.392  1.00 58.18  ? 1103 GLU A OE2 1 
ATOM   8597  N  N   . ILE A 1  1104 ? 106.435 70.807  -8.262  1.00 27.86  ? 1104 ILE A N   1 
ATOM   8598  C  CA  . ILE A 1  1104 ? 107.675 70.825  -9.011  1.00 21.29  ? 1104 ILE A CA  1 
ATOM   8599  C  C   . ILE A 1  1104 ? 107.599 69.898  -10.179 1.00 20.22  ? 1104 ILE A C   1 
ATOM   8600  O  O   . ILE A 1  1104 ? 107.234 70.310  -11.261 1.00 21.26  ? 1104 ILE A O   1 
ATOM   8601  C  CB  . ILE A 1  1104 ? 108.868 70.404  -8.172  1.00 17.86  ? 1104 ILE A CB  1 
ATOM   8602  C  CG1 . ILE A 1  1104 ? 108.937 71.248  -6.902  1.00 20.59  ? 1104 ILE A CG1 1 
ATOM   8603  C  CG2 . ILE A 1  1104 ? 110.127 70.568  -8.992  1.00 12.54  ? 1104 ILE A CG2 1 
ATOM   8604  C  CD1 . ILE A 1  1104 ? 110.178 71.014  -6.054  1.00 21.83  ? 1104 ILE A CD1 1 
ATOM   8605  N  N   . LEU A 1  1105 ? 107.952 68.643  -9.946  1.00 20.29  ? 1105 LEU A N   1 
ATOM   8606  C  CA  . LEU A 1  1105 ? 107.946 67.620  -10.983 1.00 22.20  ? 1105 LEU A CA  1 
ATOM   8607  C  C   . LEU A 1  1105 ? 106.902 67.928  -12.047 1.00 26.37  ? 1105 LEU A C   1 
ATOM   8608  O  O   . LEU A 1  1105 ? 107.112 67.680  -13.242 1.00 29.64  ? 1105 LEU A O   1 
ATOM   8609  C  CB  . LEU A 1  1105 ? 107.683 66.258  -10.343 1.00 16.82  ? 1105 LEU A CB  1 
ATOM   8610  C  CG  . LEU A 1  1105 ? 108.747 65.980  -9.282  1.00 12.43  ? 1105 LEU A CG  1 
ATOM   8611  C  CD1 . LEU A 1  1105 ? 108.249 64.982  -8.280  1.00 9.89   ? 1105 LEU A CD1 1 
ATOM   8612  C  CD2 . LEU A 1  1105 ? 110.012 65.508  -9.970  1.00 9.95   ? 1105 LEU A CD2 1 
ATOM   8613  N  N   . ASN A 1  1106 ? 105.782 68.490  -11.608 1.00 28.86  ? 1106 ASN A N   1 
ATOM   8614  C  CA  . ASN A 1  1106 ? 104.717 68.848  -12.526 1.00 32.10  ? 1106 ASN A CA  1 
ATOM   8615  C  C   . ASN A 1  1106 ? 105.074 70.034  -13.431 1.00 34.48  ? 1106 ASN A C   1 
ATOM   8616  O  O   . ASN A 1  1106 ? 104.616 70.091  -14.575 1.00 33.33  ? 1106 ASN A O   1 
ATOM   8617  C  CB  . ASN A 1  1106 ? 103.454 69.209  -11.746 1.00 33.50  ? 1106 ASN A CB  1 
ATOM   8618  C  CG  . ASN A 1  1106 ? 102.693 68.003  -11.255 1.00 35.02  ? 1106 ASN A CG  1 
ATOM   8619  O  OD1 . ASN A 1  1106 ? 102.164 67.207  -12.047 1.00 32.24  ? 1106 ASN A OD1 1 
ATOM   8620  N  ND2 . ASN A 1  1106 ? 102.612 67.866  -9.935  1.00 36.99  ? 1106 ASN A ND2 1 
ATOM   8621  N  N   . VAL A 1  1107 ? 105.886 70.967  -12.917 1.00 38.17  ? 1107 VAL A N   1 
ATOM   8622  C  CA  . VAL A 1  1107 ? 106.274 72.194  -13.632 1.00 40.84  ? 1107 VAL A CA  1 
ATOM   8623  C  C   . VAL A 1  1107 ? 104.975 72.936  -13.766 1.00 46.22  ? 1107 VAL A C   1 
ATOM   8624  O  O   . VAL A 1  1107 ? 104.479 73.192  -14.867 1.00 47.68  ? 1107 VAL A O   1 
ATOM   8625  C  CB  . VAL A 1  1107 ? 106.854 71.930  -15.037 1.00 39.71  ? 1107 VAL A CB  1 
ATOM   8626  C  CG1 . VAL A 1  1107 ? 106.863 73.215  -15.867 1.00 36.57  ? 1107 VAL A CG1 1 
ATOM   8627  C  CG2 . VAL A 1  1107 ? 108.268 71.412  -14.906 1.00 38.14  ? 1107 VAL A CG2 1 
ATOM   8628  N  N   . ALA A 1  1108 ? 104.418 73.247  -12.605 1.00 52.83  ? 1108 ALA A N   1 
ATOM   8629  C  CA  . ALA A 1  1108 ? 103.146 73.933  -12.511 1.00 60.85  ? 1108 ALA A CA  1 
ATOM   8630  C  C   . ALA A 1  1108 ? 103.341 75.438  -12.570 1.00 65.26  ? 1108 ALA A C   1 
ATOM   8631  O  O   . ALA A 1  1108 ? 104.319 75.960  -12.022 1.00 68.32  ? 1108 ALA A O   1 
ATOM   8632  C  CB  . ALA A 1  1108 ? 102.459 73.542  -11.202 1.00 62.96  ? 1108 ALA A CB  1 
ATOM   8633  N  N   . LYS A 1  1109 ? 102.422 76.135  -13.236 1.00 67.19  ? 1109 LYS A N   1 
ATOM   8634  C  CA  . LYS A 1  1109 ? 102.516 77.585  -13.310 1.00 69.74  ? 1109 LYS A CA  1 
ATOM   8635  C  C   . LYS A 1  1109 ? 101.992 78.198  -11.999 1.00 67.31  ? 1109 LYS A C   1 
ATOM   8636  O  O   . LYS A 1  1109 ? 102.770 78.697  -11.187 1.00 69.28  ? 1109 LYS A O   1 
ATOM   8637  C  CB  . LYS A 1  1109 ? 101.730 78.111  -14.516 1.00 74.43  ? 1109 LYS A CB  1 
ATOM   8638  C  CG  . LYS A 1  1109 ? 101.772 79.643  -14.692 1.00 83.98  ? 1109 LYS A CG  1 
ATOM   8639  C  CD  . LYS A 1  1109 ? 103.202 80.200  -14.908 1.00 87.02  ? 1109 LYS A CD  1 
ATOM   8640  C  CE  . LYS A 1  1109 ? 103.205 81.735  -15.090 1.00 88.16  ? 1109 LYS A CE  1 
ATOM   8641  N  NZ  . LYS A 1  1109 ? 104.573 82.353  -15.096 1.00 85.24  ? 1109 LYS A NZ  1 
ATOM   8642  N  N   . ASN A 1  1110 ? 100.686 78.133  -11.776 1.00 63.11  ? 1110 ASN A N   1 
ATOM   8643  C  CA  . ASN A 1  1110 ? 100.098 78.695  -10.571 1.00 60.06  ? 1110 ASN A CA  1 
ATOM   8644  C  C   . ASN A 1  1110 ? 100.493 78.015  -9.270  1.00 55.67  ? 1110 ASN A C   1 
ATOM   8645  O  O   . ASN A 1  1110 ? 99.738  77.211  -8.740  1.00 57.32  ? 1110 ASN A O   1 
ATOM   8646  C  CB  . ASN A 1  1110 ? 98.578  78.687  -10.692 1.00 66.57  ? 1110 ASN A CB  1 
ATOM   8647  C  CG  . ASN A 1  1110 ? 98.074  77.566  -11.578 1.00 71.18  ? 1110 ASN A CG  1 
ATOM   8648  O  OD1 . ASN A 1  1110 ? 98.326  77.558  -12.784 1.00 75.62  ? 1110 ASN A OD1 1 
ATOM   8649  N  ND2 . ASN A 1  1110 ? 97.362  76.610  -10.988 1.00 73.09  ? 1110 ASN A ND2 1 
ATOM   8650  N  N   . MET A 1  1111 ? 101.667 78.335  -8.743  1.00 50.37  ? 1111 MET A N   1 
ATOM   8651  C  CA  . MET A 1  1111 ? 102.072 77.738  -7.486  1.00 48.26  ? 1111 MET A CA  1 
ATOM   8652  C  C   . MET A 1  1111 ? 101.340 78.427  -6.360  1.00 49.50  ? 1111 MET A C   1 
ATOM   8653  O  O   . MET A 1  1111 ? 101.021 79.606  -6.455  1.00 47.23  ? 1111 MET A O   1 
ATOM   8654  C  CB  . MET A 1  1111 ? 103.582 77.848  -7.281  1.00 48.21  ? 1111 MET A CB  1 
ATOM   8655  C  CG  . MET A 1  1111 ? 104.266 78.970  -8.026  1.00 47.56  ? 1111 MET A CG  1 
ATOM   8656  S  SD  . MET A 1  1111 ? 105.955 78.492  -8.528  1.00 49.60  ? 1111 MET A SD  1 
ATOM   8657  C  CE  . MET A 1  1111 ? 106.851 78.865  -7.033  1.00 43.56  ? 1111 MET A CE  1 
ATOM   8658  N  N   . LYS A 1  1112 ? 101.056 77.679  -5.302  1.00 52.45  ? 1112 LYS A N   1 
ATOM   8659  C  CA  . LYS A 1  1112 ? 100.353 78.230  -4.151  1.00 57.48  ? 1112 LYS A CA  1 
ATOM   8660  C  C   . LYS A 1  1112 ? 101.123 79.398  -3.540  1.00 56.43  ? 1112 LYS A C   1 
ATOM   8661  O  O   . LYS A 1  1112 ? 100.551 80.451  -3.281  1.00 57.26  ? 1112 LYS A O   1 
ATOM   8662  C  CB  . LYS A 1  1112 ? 100.138 77.157  -3.084  1.00 63.14  ? 1112 LYS A CB  1 
ATOM   8663  C  CG  . LYS A 1  1112 ? 99.201  76.023  -3.463  1.00 69.38  ? 1112 LYS A CG  1 
ATOM   8664  C  CD  . LYS A 1  1112 ? 98.928  75.188  -2.217  1.00 77.21  ? 1112 LYS A CD  1 
ATOM   8665  C  CE  . LYS A 1  1112 ? 97.970  74.035  -2.478  1.00 82.33  ? 1112 LYS A CE  1 
ATOM   8666  N  NZ  . LYS A 1  1112 ? 97.690  73.283  -1.211  1.00 85.93  ? 1112 LYS A NZ  1 
ATOM   8667  N  N   . THR A 1  1113 ? 102.414 79.202  -3.290  1.00 54.78  ? 1113 THR A N   1 
ATOM   8668  C  CA  . THR A 1  1113 ? 103.255 80.258  -2.736  1.00 54.61  ? 1113 THR A CA  1 
ATOM   8669  C  C   . THR A 1  1113 ? 104.239 80.701  -3.815  1.00 55.36  ? 1113 THR A C   1 
ATOM   8670  O  O   . THR A 1  1113 ? 105.130 79.945  -4.195  1.00 57.79  ? 1113 THR A O   1 
ATOM   8671  C  CB  . THR A 1  1113 ? 104.042 79.768  -1.524  1.00 53.79  ? 1113 THR A CB  1 
ATOM   8672  O  OG1 . THR A 1  1113 ? 103.143 79.561  -0.434  1.00 56.02  ? 1113 THR A OG1 1 
ATOM   8673  C  CG2 . THR A 1  1113 ? 105.088 80.789  -1.121  1.00 54.74  ? 1113 THR A CG2 1 
ATOM   8674  N  N   . PRO A 1  1114 ? 104.092 81.936  -4.324  1.00 54.36  ? 1114 PRO A N   1 
ATOM   8675  C  CA  . PRO A 1  1114 ? 105.010 82.388  -5.366  1.00 54.26  ? 1114 PRO A CA  1 
ATOM   8676  C  C   . PRO A 1  1114 ? 106.104 83.370  -4.939  1.00 55.94  ? 1114 PRO A C   1 
ATOM   8677  O  O   . PRO A 1  1114 ? 106.740 83.978  -5.792  1.00 60.93  ? 1114 PRO A O   1 
ATOM   8678  C  CB  . PRO A 1  1114 ? 104.061 82.998  -6.378  1.00 53.18  ? 1114 PRO A CB  1 
ATOM   8679  C  CG  . PRO A 1  1114 ? 103.133 83.735  -5.474  1.00 54.74  ? 1114 PRO A CG  1 
ATOM   8680  C  CD  . PRO A 1  1114 ? 102.876 82.767  -4.323  1.00 54.23  ? 1114 PRO A CD  1 
ATOM   8681  N  N   . SER A 1  1115 ? 106.339 83.508  -3.634  1.00 56.31  ? 1115 SER A N   1 
ATOM   8682  C  CA  . SER A 1  1115 ? 107.362 84.430  -3.111  1.00 56.09  ? 1115 SER A CA  1 
ATOM   8683  C  C   . SER A 1  1115 ? 108.664 84.607  -3.913  1.00 53.26  ? 1115 SER A C   1 
ATOM   8684  O  O   . SER A 1  1115 ? 108.945 83.906  -4.890  1.00 51.86  ? 1115 SER A O   1 
ATOM   8685  C  CB  . SER A 1  1115 ? 107.728 84.060  -1.662  1.00 59.92  ? 1115 SER A CB  1 
ATOM   8686  O  OG  . SER A 1  1115 ? 108.795 84.862  -1.164  1.00 59.73  ? 1115 SER A OG  1 
ATOM   8687  N  N   . LEU A 1  1116 ? 109.462 85.566  -3.458  1.00 49.03  ? 1116 LEU A N   1 
ATOM   8688  C  CA  . LEU A 1  1116 ? 110.723 85.914  -4.086  1.00 44.01  ? 1116 LEU A CA  1 
ATOM   8689  C  C   . LEU A 1  1116 ? 111.449 86.867  -3.143  1.00 44.18  ? 1116 LEU A C   1 
ATOM   8690  O  O   . LEU A 1  1116 ? 110.993 87.986  -2.874  1.00 42.18  ? 1116 LEU A O   1 
ATOM   8691  C  CB  . LEU A 1  1116 ? 110.463 86.583  -5.440  1.00 37.51  ? 1116 LEU A CB  1 
ATOM   8692  C  CG  . LEU A 1  1116 ? 110.569 88.096  -5.600  1.00 29.96  ? 1116 LEU A CG  1 
ATOM   8693  C  CD1 . LEU A 1  1116 ? 112.030 88.448  -5.674  1.00 28.06  ? 1116 LEU A CD1 1 
ATOM   8694  C  CD2 . LEU A 1  1116 ? 109.866 88.554  -6.869  1.00 27.91  ? 1116 LEU A CD2 1 
ATOM   8695  N  N   . THR A 1  1117 ? 112.578 86.387  -2.639  1.00 44.08  ? 1117 THR A N   1 
ATOM   8696  C  CA  . THR A 1  1117 ? 113.419 87.121  -1.711  1.00 43.33  ? 1117 THR A CA  1 
ATOM   8697  C  C   . THR A 1  1117 ? 114.384 88.056  -2.441  1.00 44.02  ? 1117 THR A C   1 
ATOM   8698  O  O   . THR A 1  1117 ? 115.065 87.628  -3.380  1.00 46.39  ? 1117 THR A O   1 
ATOM   8699  C  CB  . THR A 1  1117 ? 114.219 86.120  -0.856  1.00 43.09  ? 1117 THR A CB  1 
ATOM   8700  O  OG1 . THR A 1  1117 ? 113.401 85.656  0.224   1.00 44.50  ? 1117 THR A OG1 1 
ATOM   8701  C  CG2 . THR A 1  1117 ? 115.471 86.747  -0.312  1.00 44.80  ? 1117 THR A CG2 1 
ATOM   8702  N  N   . VAL A 1  1118 ? 114.430 89.329  -2.027  1.00 43.57  ? 1118 VAL A N   1 
ATOM   8703  C  CA  . VAL A 1  1118 ? 115.348 90.303  -2.634  1.00 44.55  ? 1118 VAL A CA  1 
ATOM   8704  C  C   . VAL A 1  1118 ? 116.248 90.896  -1.589  1.00 47.83  ? 1118 VAL A C   1 
ATOM   8705  O  O   . VAL A 1  1118 ? 115.786 91.327  -0.530  1.00 44.73  ? 1118 VAL A O   1 
ATOM   8706  C  CB  . VAL A 1  1118 ? 114.642 91.468  -3.286  1.00 41.46  ? 1118 VAL A CB  1 
ATOM   8707  C  CG1 . VAL A 1  1118 ? 114.197 91.089  -4.671  1.00 42.12  ? 1118 VAL A CG1 1 
ATOM   8708  C  CG2 . VAL A 1  1118 ? 113.491 91.906  -2.415  1.00 39.35  ? 1118 VAL A CG2 1 
ATOM   8709  N  N   . TYR A 1  1119 ? 117.537 90.925  -1.912  1.00 54.44  ? 1119 TYR A N   1 
ATOM   8710  C  CA  . TYR A 1  1119 ? 118.550 91.449  -1.014  1.00 63.54  ? 1119 TYR A CA  1 
ATOM   8711  C  C   . TYR A 1  1119 ? 118.908 92.843  -1.493  1.00 69.53  ? 1119 TYR A C   1 
ATOM   8712  O  O   . TYR A 1  1119 ? 118.830 93.114  -2.693  1.00 71.71  ? 1119 TYR A O   1 
ATOM   8713  C  CB  . TYR A 1  1119 ? 119.790 90.547  -1.041  1.00 65.97  ? 1119 TYR A CB  1 
ATOM   8714  C  CG  . TYR A 1  1119 ? 119.534 89.096  -0.644  1.00 70.00  ? 1119 TYR A CG  1 
ATOM   8715  C  CD1 . TYR A 1  1119 ? 118.968 88.178  -1.540  1.00 70.55  ? 1119 TYR A CD1 1 
ATOM   8716  C  CD2 . TYR A 1  1119 ? 119.820 88.652  0.650   1.00 72.03  ? 1119 TYR A CD2 1 
ATOM   8717  C  CE1 . TYR A 1  1119 ? 118.692 86.853  -1.143  1.00 71.39  ? 1119 TYR A CE1 1 
ATOM   8718  C  CE2 . TYR A 1  1119 ? 119.544 87.336  1.055   1.00 71.88  ? 1119 TYR A CE2 1 
ATOM   8719  C  CZ  . TYR A 1  1119 ? 118.983 86.446  0.162   1.00 71.47  ? 1119 TYR A CZ  1 
ATOM   8720  O  OH  . TYR A 1  1119 ? 118.709 85.169  0.601   1.00 71.25  ? 1119 TYR A OH  1 
ATOM   8721  N  N   . LEU A 1  1120 ? 119.291 93.717  -0.559  1.00 76.25  ? 1120 LEU A N   1 
ATOM   8722  C  CA  . LEU A 1  1120 ? 119.661 95.104  -0.863  1.00 83.36  ? 1120 LEU A CA  1 
ATOM   8723  C  C   . LEU A 1  1120 ? 120.923 95.230  -1.695  1.00 89.15  ? 1120 LEU A C   1 
ATOM   8724  O  O   . LEU A 1  1120 ? 121.541 94.234  -2.060  1.00 91.73  ? 1120 LEU A O   1 
ATOM   8725  C  CB  . LEU A 1  1120 ? 119.897 95.886  0.417   1.00 83.24  ? 1120 LEU A CB  1 
ATOM   8726  C  CG  . LEU A 1  1120 ? 118.709 96.247  1.290   1.00 84.54  ? 1120 LEU A CG  1 
ATOM   8727  C  CD1 . LEU A 1  1120 ? 117.880 95.015  1.584   1.00 85.88  ? 1120 LEU A CD1 1 
ATOM   8728  C  CD2 . LEU A 1  1120 ? 119.242 96.887  2.571   1.00 85.78  ? 1120 LEU A CD2 1 
ATOM   8729  N  N   . GLU A 1  1121 ? 121.310 96.470  -1.977  1.00 94.70  ? 1121 GLU A N   1 
ATOM   8730  C  CA  . GLU A 1  1121 ? 122.517 96.730  -2.747  1.00 100.81 ? 1121 GLU A CA  1 
ATOM   8731  C  C   . GLU A 1  1121 ? 123.655 96.688  -1.729  1.00 104.77 ? 1121 GLU A C   1 
ATOM   8732  O  O   . GLU A 1  1121 ? 123.445 96.985  -0.552  1.00 101.10 ? 1121 GLU A O   1 
ATOM   8733  C  CB  . GLU A 1  1121 ? 122.429 98.097  -3.441  1.00 103.74 ? 1121 GLU A CB  1 
ATOM   8734  C  CG  . GLU A 1  1121 ? 123.168 98.160  -4.784  1.00 107.33 ? 1121 GLU A CG  1 
ATOM   8735  C  CD  . GLU A 1  1121 ? 122.734 99.325  -5.662  1.00 109.64 ? 1121 GLU A CD  1 
ATOM   8736  O  OE1 . GLU A 1  1121 ? 122.867 100.492 -5.224  1.00 111.03 ? 1121 GLU A OE1 1 
ATOM   8737  O  OE2 . GLU A 1  1121 ? 122.259 99.069  -6.795  1.00 109.41 ? 1121 GLU A OE2 1 
ATOM   8738  N  N   . PRO A 1  1122 ? 124.872 96.312  -2.171  1.00 110.76 ? 1122 PRO A N   1 
ATOM   8739  C  CA  . PRO A 1  1122 ? 126.051 96.214  -1.304  1.00 113.47 ? 1122 PRO A CA  1 
ATOM   8740  C  C   . PRO A 1  1122 ? 125.943 96.924  0.043   1.00 114.62 ? 1122 PRO A C   1 
ATOM   8741  O  O   . PRO A 1  1122 ? 125.202 96.487  0.924   1.00 111.34 ? 1122 PRO A O   1 
ATOM   8742  C  CB  . PRO A 1  1122 ? 127.164 96.764  -2.193  1.00 114.58 ? 1122 PRO A CB  1 
ATOM   8743  C  CG  . PRO A 1  1122 ? 126.809 96.170  -3.535  1.00 113.43 ? 1122 PRO A CG  1 
ATOM   8744  C  CD  . PRO A 1  1122 ? 125.275 96.273  -3.595  1.00 113.15 ? 1122 PRO A CD  1 
ATOM   8745  N  N   . GLY A 1  1123 ? 126.695 98.008  0.198   1.00 118.51 ? 1123 GLY A N   1 
ATOM   8746  C  CA  . GLY A 1  1123 ? 126.671 98.758  1.438   1.00 123.38 ? 1123 GLY A CA  1 
ATOM   8747  C  C   . GLY A 1  1123 ? 125.304 98.741  2.089   1.00 126.45 ? 1123 GLY A C   1 
ATOM   8748  O  O   . GLY A 1  1123 ? 125.120 98.085  3.113   1.00 127.45 ? 1123 GLY A O   1 
ATOM   8749  N  N   . HIS A 1  1124 ? 124.349 99.447  1.485   1.00 129.68 ? 1124 HIS A N   1 
ATOM   8750  C  CA  . HIS A 1  1124 ? 122.981 99.531  2.000   1.00 132.33 ? 1124 HIS A CA  1 
ATOM   8751  C  C   . HIS A 1  1124 ? 122.556 98.170  2.520   1.00 130.55 ? 1124 HIS A C   1 
ATOM   8752  O  O   . HIS A 1  1124 ? 122.027 97.340  1.783   1.00 129.85 ? 1124 HIS A O   1 
ATOM   8753  C  CB  . HIS A 1  1124 ? 122.017 99.992  0.900   1.00 138.64 ? 1124 HIS A CB  1 
ATOM   8754  C  CG  . HIS A 1  1124 ? 122.521 101.160 0.106   1.00 145.93 ? 1124 HIS A CG  1 
ATOM   8755  N  ND1 . HIS A 1  1124 ? 122.949 102.332 0.692   1.00 149.09 ? 1124 HIS A ND1 1 
ATOM   8756  C  CD2 . HIS A 1  1124 ? 122.687 101.326 -1.230  1.00 148.19 ? 1124 HIS A CD2 1 
ATOM   8757  C  CE1 . HIS A 1  1124 ? 123.360 103.168 -0.246  1.00 149.75 ? 1124 HIS A CE1 1 
ATOM   8758  N  NE2 . HIS A 1  1124 ? 123.211 102.582 -1.420  1.00 149.86 ? 1124 HIS A NE2 1 
ATOM   8759  N  N   . ALA A 1  1125 ? 122.812 97.950  3.801   1.00 128.51 ? 1125 ALA A N   1 
ATOM   8760  C  CA  . ALA A 1  1125 ? 122.489 96.692  4.441   1.00 126.23 ? 1125 ALA A CA  1 
ATOM   8761  C  C   . ALA A 1  1125 ? 121.763 96.988  5.732   1.00 124.75 ? 1125 ALA A C   1 
ATOM   8762  O  O   . ALA A 1  1125 ? 120.566 97.256  5.722   1.00 123.93 ? 1125 ALA A O   1 
ATOM   8763  C  CB  . ALA A 1  1125 ? 123.766 95.905  4.723   1.00 126.02 ? 1125 ALA A CB  1 
ATOM   8764  N  N   . ALA A 1  1126 ? 122.503 96.959  6.836   1.00 124.17 ? 1126 ALA A N   1 
ATOM   8765  C  CA  . ALA A 1  1126 ? 121.950 97.210  8.162   1.00 124.39 ? 1126 ALA A CA  1 
ATOM   8766  C  C   . ALA A 1  1126 ? 121.198 98.534  8.259   1.00 124.37 ? 1126 ALA A C   1 
ATOM   8767  O  O   . ALA A 1  1126 ? 120.766 98.929  9.343   1.00 124.74 ? 1126 ALA A O   1 
ATOM   8768  C  CB  . ALA A 1  1126 ? 123.063 97.167  9.205   1.00 124.23 ? 1126 ALA A CB  1 
ATOM   8769  N  N   . ASP A 1  1127 ? 121.036 99.211  7.126   1.00 124.24 ? 1127 ASP A N   1 
ATOM   8770  C  CA  . ASP A 1  1127 ? 120.333 100.489 7.086   1.00 123.76 ? 1127 ASP A CA  1 
ATOM   8771  C  C   . ASP A 1  1127 ? 118.823 100.311 7.293   1.00 120.88 ? 1127 ASP A C   1 
ATOM   8772  O  O   . ASP A 1  1127 ? 118.027 100.469 6.366   1.00 120.86 ? 1127 ASP A O   1 
ATOM   8773  C  CB  . ASP A 1  1127 ? 120.607 101.192 5.748   1.00 127.42 ? 1127 ASP A CB  1 
ATOM   8774  C  CG  . ASP A 1  1127 ? 121.194 102.591 5.922   1.00 129.10 ? 1127 ASP A CG  1 
ATOM   8775  O  OD1 . ASP A 1  1127 ? 120.587 103.405 6.655   1.00 129.25 ? 1127 ASP A OD1 1 
ATOM   8776  O  OD2 . ASP A 1  1127 ? 122.258 102.873 5.319   1.00 129.62 ? 1127 ASP A OD2 1 
ATOM   8777  N  N   . GLN A 1  1128 ? 118.448 99.971  8.523   1.00 117.19 ? 1128 GLN A N   1 
ATOM   8778  C  CA  . GLN A 1  1128 ? 117.055 99.772  8.900   1.00 113.98 ? 1128 GLN A CA  1 
ATOM   8779  C  C   . GLN A 1  1128 ? 116.111 100.530 7.978   1.00 112.81 ? 1128 GLN A C   1 
ATOM   8780  O  O   . GLN A 1  1128 ? 115.504 99.950  7.089   1.00 110.72 ? 1128 GLN A O   1 
ATOM   8781  C  CB  . GLN A 1  1128 ? 116.860 100.231 10.348  1.00 114.20 ? 1128 GLN A CB  1 
ATOM   8782  C  CG  . GLN A 1  1128 ? 115.418 100.378 10.814  1.00 112.45 ? 1128 GLN A CG  1 
ATOM   8783  C  CD  . GLN A 1  1128 ? 114.680 99.064  10.885  1.00 110.77 ? 1128 GLN A CD  1 
ATOM   8784  O  OE1 . GLN A 1  1128 ? 114.448 98.422  9.866   1.00 109.57 ? 1128 GLN A OE1 1 
ATOM   8785  N  NE2 . GLN A 1  1128 ? 114.305 98.655  12.094  1.00 108.83 ? 1128 GLN A NE2 1 
ATOM   8786  N  N   . GLU A 1  1129 ? 116.014 101.836 8.184   1.00 113.28 ? 1129 GLU A N   1 
ATOM   8787  C  CA  . GLU A 1  1129 ? 115.138 102.678 7.383   1.00 114.42 ? 1129 GLU A CA  1 
ATOM   8788  C  C   . GLU A 1  1129 ? 115.286 102.413 5.889   1.00 113.14 ? 1129 GLU A C   1 
ATOM   8789  O  O   . GLU A 1  1129 ? 114.289 102.290 5.181   1.00 112.55 ? 1129 GLU A O   1 
ATOM   8790  C  CB  . GLU A 1  1129 ? 115.416 104.151 7.685   1.00 118.61 ? 1129 GLU A CB  1 
ATOM   8791  C  CG  . GLU A 1  1129 ? 114.382 105.118 7.123   1.00 123.74 ? 1129 GLU A CG  1 
ATOM   8792  C  CD  . GLU A 1  1129 ? 114.687 106.572 7.473   1.00 126.96 ? 1129 GLU A CD  1 
ATOM   8793  O  OE1 . GLU A 1  1129 ? 115.686 107.122 6.953   1.00 128.53 ? 1129 GLU A OE1 1 
ATOM   8794  O  OE2 . GLU A 1  1129 ? 113.929 107.164 8.274   1.00 128.67 ? 1129 GLU A OE2 1 
ATOM   8795  N  N   . GLN A 1  1130 ? 116.524 102.328 5.412   1.00 112.06 ? 1130 GLN A N   1 
ATOM   8796  C  CA  . GLN A 1  1130 ? 116.782 102.065 3.998   1.00 111.17 ? 1130 GLN A CA  1 
ATOM   8797  C  C   . GLN A 1  1130 ? 115.824 100.964 3.555   1.00 108.67 ? 1130 GLN A C   1 
ATOM   8798  O  O   . GLN A 1  1130 ? 115.447 100.871 2.389   1.00 109.84 ? 1130 GLN A O   1 
ATOM   8799  C  CB  . GLN A 1  1130 ? 118.239 101.619 3.804   1.00 114.16 ? 1130 GLN A CB  1 
ATOM   8800  C  CG  . GLN A 1  1130 ? 118.650 101.154 2.391   1.00 117.03 ? 1130 GLN A CG  1 
ATOM   8801  C  CD  . GLN A 1  1130 ? 119.024 102.296 1.451   1.00 117.12 ? 1130 GLN A CD  1 
ATOM   8802  O  OE1 . GLN A 1  1130 ? 119.151 103.447 1.874   1.00 117.58 ? 1130 GLN A OE1 1 
ATOM   8803  N  NE2 . GLN A 1  1130 ? 119.214 101.974 0.166   1.00 115.71 ? 1130 GLN A NE2 1 
ATOM   8804  N  N   . ALA A 1  1131 ? 115.411 100.137 4.505   1.00 104.35 ? 1131 ALA A N   1 
ATOM   8805  C  CA  . ALA A 1  1131 ? 114.495 99.058  4.197   1.00 101.08 ? 1131 ALA A CA  1 
ATOM   8806  C  C   . ALA A 1  1131 ? 113.166 99.550  3.630   1.00 99.82  ? 1131 ALA A C   1 
ATOM   8807  O  O   . ALA A 1  1131 ? 112.969 99.515  2.419   1.00 98.25  ? 1131 ALA A O   1 
ATOM   8808  C  CB  . ALA A 1  1131 ? 114.260 98.226  5.425   1.00 101.87 ? 1131 ALA A CB  1 
ATOM   8809  N  N   . LYS A 1  1132 ? 112.255 100.003 4.490   1.00 99.09  ? 1132 LYS A N   1 
ATOM   8810  C  CA  . LYS A 1  1132 ? 110.960 100.477 4.016   1.00 99.50  ? 1132 LYS A CA  1 
ATOM   8811  C  C   . LYS A 1  1132 ? 111.154 101.320 2.759   1.00 97.78  ? 1132 LYS A C   1 
ATOM   8812  O  O   . LYS A 1  1132 ? 110.426 101.156 1.782   1.00 97.55  ? 1132 LYS A O   1 
ATOM   8813  C  CB  . LYS A 1  1132 ? 110.233 101.270 5.118   1.00 103.81 ? 1132 LYS A CB  1 
ATOM   8814  C  CG  . LYS A 1  1132 ? 111.167 101.875 6.191   1.00 111.96 ? 1132 LYS A CG  1 
ATOM   8815  C  CD  . LYS A 1  1132 ? 110.468 102.966 7.053   1.00 115.94 ? 1132 LYS A CD  1 
ATOM   8816  C  CE  . LYS A 1  1132 ? 111.289 103.416 8.292   1.00 116.40 ? 1132 LYS A CE  1 
ATOM   8817  N  NZ  . LYS A 1  1132 ? 110.814 104.720 8.865   1.00 114.03 ? 1132 LYS A NZ  1 
ATOM   8818  N  N   . LEU A 1  1133 ? 112.167 102.185 2.770   1.00 96.10  ? 1133 LEU A N   1 
ATOM   8819  C  CA  . LEU A 1  1133 ? 112.458 103.043 1.618   1.00 93.66  ? 1133 LEU A CA  1 
ATOM   8820  C  C   . LEU A 1  1133 ? 112.322 102.310 0.296   1.00 90.05  ? 1133 LEU A C   1 
ATOM   8821  O  O   . LEU A 1  1133 ? 111.975 102.913 -0.722  1.00 90.66  ? 1133 LEU A O   1 
ATOM   8822  C  CB  . LEU A 1  1133 ? 113.869 103.622 1.711   1.00 96.87  ? 1133 LEU A CB  1 
ATOM   8823  C  CG  . LEU A 1  1133 ? 114.045 104.852 2.598   1.00 100.50 ? 1133 LEU A CG  1 
ATOM   8824  C  CD1 . LEU A 1  1133 ? 115.513 105.275 2.587   1.00 102.48 ? 1133 LEU A CD1 1 
ATOM   8825  C  CD2 . LEU A 1  1133 ? 113.154 105.981 2.088   1.00 102.60 ? 1133 LEU A CD2 1 
ATOM   8826  N  N   . ILE A 1  1134 ? 112.602 101.011 0.308   1.00 84.20  ? 1134 ILE A N   1 
ATOM   8827  C  CA  . ILE A 1  1134 ? 112.490 100.230 -0.905  1.00 77.75  ? 1134 ILE A CA  1 
ATOM   8828  C  C   . ILE A 1  1134 ? 111.233 99.402  -0.845  1.00 76.71  ? 1134 ILE A C   1 
ATOM   8829  O  O   . ILE A 1  1134 ? 110.614 99.139  -1.870  1.00 76.58  ? 1134 ILE A O   1 
ATOM   8830  C  CB  . ILE A 1  1134 ? 113.681 99.320  -1.091  1.00 74.49  ? 1134 ILE A CB  1 
ATOM   8831  C  CG1 . ILE A 1  1134 ? 114.948 100.092 -0.762  1.00 72.76  ? 1134 ILE A CG1 1 
ATOM   8832  C  CG2 . ILE A 1  1134 ? 113.748 98.855  -2.529  1.00 73.31  ? 1134 ILE A CG2 1 
ATOM   8833  C  CD1 . ILE A 1  1134 ? 116.202 99.338  -1.033  1.00 75.22  ? 1134 ILE A CD1 1 
ATOM   8834  N  N   . ARG A 1  1135 ? 110.853 98.985  0.357   1.00 75.78  ? 1135 ARG A N   1 
ATOM   8835  C  CA  . ARG A 1  1135 ? 109.631 98.212  0.494   1.00 75.00  ? 1135 ARG A CA  1 
ATOM   8836  C  C   . ARG A 1  1135 ? 108.624 98.924  -0.387  1.00 73.44  ? 1135 ARG A C   1 
ATOM   8837  O  O   . ARG A 1  1135 ? 108.202 98.400  -1.419  1.00 71.40  ? 1135 ARG A O   1 
ATOM   8838  C  CB  . ARG A 1  1135 ? 109.123 98.224  1.939   1.00 77.67  ? 1135 ARG A CB  1 
ATOM   8839  C  CG  . ARG A 1  1135 ? 107.731 97.609  2.103   1.00 79.73  ? 1135 ARG A CG  1 
ATOM   8840  C  CD  . ARG A 1  1135 ? 107.192 97.814  3.504   1.00 85.44  ? 1135 ARG A CD  1 
ATOM   8841  N  NE  . ARG A 1  1135 ? 105.937 97.104  3.728   1.00 93.90  ? 1135 ARG A NE  1 
ATOM   8842  C  CZ  . ARG A 1  1135 ? 105.412 96.869  4.931   1.00 100.50 ? 1135 ARG A CZ  1 
ATOM   8843  N  NH1 . ARG A 1  1135 ? 106.031 97.288  6.033   1.00 103.74 ? 1135 ARG A NH1 1 
ATOM   8844  N  NH2 . ARG A 1  1135 ? 104.270 96.196  5.035   1.00 104.54 ? 1135 ARG A NH2 1 
ATOM   8845  N  N   . SER A 1  1136 ? 108.284 100.146 0.021   1.00 72.72  ? 1136 SER A N   1 
ATOM   8846  C  CA  . SER A 1  1136 ? 107.318 100.979 -0.688  1.00 71.39  ? 1136 SER A CA  1 
ATOM   8847  C  C   . SER A 1  1136 ? 107.729 101.284 -2.109  1.00 68.34  ? 1136 SER A C   1 
ATOM   8848  O  O   . SER A 1  1136 ? 106.991 101.924 -2.853  1.00 70.36  ? 1136 SER A O   1 
ATOM   8849  C  CB  . SER A 1  1136 ? 107.078 102.289 0.074   1.00 73.37  ? 1136 SER A CB  1 
ATOM   8850  O  OG  . SER A 1  1136 ? 108.236 102.698 0.775   1.00 73.38  ? 1136 SER A OG  1 
ATOM   8851  N  N   . ALA A 1  1137 ? 108.908 100.823 -2.492  1.00 64.09  ? 1137 ALA A N   1 
ATOM   8852  C  CA  . ALA A 1  1137 ? 109.385 101.059 -3.841  1.00 61.61  ? 1137 ALA A CA  1 
ATOM   8853  C  C   . ALA A 1  1137 ? 109.094 99.842  -4.713  1.00 59.66  ? 1137 ALA A C   1 
ATOM   8854  O  O   . ALA A 1  1137 ? 109.381 99.840  -5.918  1.00 56.83  ? 1137 ALA A O   1 
ATOM   8855  C  CB  . ALA A 1  1137 ? 110.869 101.344 -3.812  1.00 61.63  ? 1137 ALA A CB  1 
ATOM   8856  N  N   . ILE A 1  1138 ? 108.506 98.820  -4.085  1.00 56.94  ? 1138 ILE A N   1 
ATOM   8857  C  CA  . ILE A 1  1138 ? 108.174 97.559  -4.747  1.00 51.67  ? 1138 ILE A CA  1 
ATOM   8858  C  C   . ILE A 1  1138 ? 106.718 97.125  -4.536  1.00 50.91  ? 1138 ILE A C   1 
ATOM   8859  O  O   . ILE A 1  1138 ? 105.949 96.981  -5.496  1.00 49.11  ? 1138 ILE A O   1 
ATOM   8860  C  CB  . ILE A 1  1138 ? 109.062 96.419  -4.219  1.00 48.36  ? 1138 ILE A CB  1 
ATOM   8861  C  CG1 . ILE A 1  1138 ? 110.453 96.933  -3.859  1.00 46.87  ? 1138 ILE A CG1 1 
ATOM   8862  C  CG2 . ILE A 1  1138 ? 109.218 95.379  -5.284  1.00 50.09  ? 1138 ILE A CG2 1 
ATOM   8863  C  CD1 . ILE A 1  1138 ? 111.359 95.864  -3.282  1.00 44.18  ? 1138 ILE A CD1 1 
ATOM   8864  N  N   . GLU A 1  1139 ? 106.364 96.901  -3.270  1.00 49.62  ? 1139 GLU A N   1 
ATOM   8865  C  CA  . GLU A 1  1139 ? 105.024 96.461  -2.898  1.00 48.89  ? 1139 GLU A CA  1 
ATOM   8866  C  C   . GLU A 1  1139 ? 103.950 97.251  -3.574  1.00 49.50  ? 1139 GLU A C   1 
ATOM   8867  O  O   . GLU A 1  1139 ? 103.670 98.363  -3.178  1.00 53.05  ? 1139 GLU A O   1 
ATOM   8868  C  CB  . GLU A 1  1139 ? 104.802 96.567  -1.393  1.00 49.98  ? 1139 GLU A CB  1 
ATOM   8869  C  CG  . GLU A 1  1139 ? 103.355 96.336  -0.962  1.00 53.94  ? 1139 GLU A CG  1 
ATOM   8870  C  CD  . GLU A 1  1139 ? 103.185 96.381  0.555   1.00 59.97  ? 1139 GLU A CD  1 
ATOM   8871  O  OE1 . GLU A 1  1139 ? 104.217 96.370  1.264   1.00 63.14  ? 1139 GLU A OE1 1 
ATOM   8872  O  OE2 . GLU A 1  1139 ? 102.028 96.416  1.043   1.00 63.30  ? 1139 GLU A OE2 1 
ATOM   8873  N  N   . HIS A 1  1140 ? 103.350 96.662  -4.596  1.00 51.08  ? 1140 HIS A N   1 
ATOM   8874  C  CA  . HIS A 1  1140 ? 102.262 97.273  -5.351  1.00 52.54  ? 1140 HIS A CA  1 
ATOM   8875  C  C   . HIS A 1  1140 ? 101.286 98.053  -4.466  1.00 54.89  ? 1140 HIS A C   1 
ATOM   8876  O  O   . HIS A 1  1140 ? 100.683 97.473  -3.556  1.00 55.30  ? 1140 HIS A O   1 
ATOM   8877  C  CB  . HIS A 1  1140 ? 101.495 96.172  -6.062  1.00 53.95  ? 1140 HIS A CB  1 
ATOM   8878  C  CG  . HIS A 1  1140 ? 100.485 96.673  -7.030  1.00 53.20  ? 1140 HIS A CG  1 
ATOM   8879  N  ND1 . HIS A 1  1140 ? 100.711 97.778  -7.818  1.00 53.21  ? 1140 HIS A ND1 1 
ATOM   8880  C  CD2 . HIS A 1  1140 ? 99.295  96.165  -7.423  1.00 55.31  ? 1140 HIS A CD2 1 
ATOM   8881  C  CE1 . HIS A 1  1140 ? 99.708  97.927  -8.664  1.00 54.33  ? 1140 HIS A CE1 1 
ATOM   8882  N  NE2 . HIS A 1  1140 ? 98.836  96.960  -8.446  1.00 58.73  ? 1140 HIS A NE2 1 
ATOM   8883  N  N   . THR A 1  1141 ? 101.138 99.358  -4.738  1.00 57.00  ? 1141 THR A N   1 
ATOM   8884  C  CA  . THR A 1  1141 ? 100.225 100.250 -3.989  1.00 57.05  ? 1141 THR A CA  1 
ATOM   8885  C  C   . THR A 1  1141 ? 99.184  100.861 -4.951  1.00 57.86  ? 1141 THR A C   1 
ATOM   8886  O  O   . THR A 1  1141 ? 99.536  101.437 -5.982  1.00 57.91  ? 1141 THR A O   1 
ATOM   8887  C  CB  . THR A 1  1141 ? 100.978 101.432 -3.275  1.00 54.47  ? 1141 THR A CB  1 
ATOM   8888  O  OG1 . THR A 1  1141 ? 101.943 100.935 -2.336  1.00 51.30  ? 1141 THR A OG1 1 
ATOM   8889  C  CG2 . THR A 1  1141 ? 99.988  102.283 -2.512  1.00 55.38  ? 1141 THR A CG2 1 
ATOM   8890  N  N   . THR A 1  1142 ? 97.907  100.731 -4.611  1.00 59.16  ? 1142 THR A N   1 
ATOM   8891  C  CA  . THR A 1  1142 ? 96.837  101.252 -5.453  1.00 62.22  ? 1142 THR A CA  1 
ATOM   8892  C  C   . THR A 1  1142 ? 96.003  102.230 -4.688  1.00 62.15  ? 1142 THR A C   1 
ATOM   8893  O  O   . THR A 1  1142 ? 95.854  102.107 -3.476  1.00 60.82  ? 1142 THR A O   1 
ATOM   8894  C  CB  . THR A 1  1142 ? 95.889  100.155 -5.906  1.00 66.43  ? 1142 THR A CB  1 
ATOM   8895  O  OG1 . THR A 1  1142 ? 95.784  99.168  -4.871  1.00 69.36  ? 1142 THR A OG1 1 
ATOM   8896  C  CG2 . THR A 1  1142 ? 96.372  99.526  -7.189  1.00 69.97  ? 1142 THR A CG2 1 
ATOM   8897  N  N   . LEU A 1  1143 ? 95.432  103.189 -5.404  1.00 63.50  ? 1143 LEU A N   1 
ATOM   8898  C  CA  . LEU A 1  1143 ? 94.611  104.192 -4.761  1.00 64.91  ? 1143 LEU A CA  1 
ATOM   8899  C  C   . LEU A 1  1143 ? 93.660  103.508 -3.797  1.00 65.09  ? 1143 LEU A C   1 
ATOM   8900  O  O   . LEU A 1  1143 ? 93.504  103.929 -2.646  1.00 63.65  ? 1143 LEU A O   1 
ATOM   8901  C  CB  . LEU A 1  1143 ? 93.825  104.978 -5.807  1.00 64.44  ? 1143 LEU A CB  1 
ATOM   8902  C  CG  . LEU A 1  1143 ? 92.837  106.001 -5.247  1.00 66.05  ? 1143 LEU A CG  1 
ATOM   8903  C  CD1 . LEU A 1  1143 ? 93.479  106.766 -4.101  1.00 67.11  ? 1143 LEU A CD1 1 
ATOM   8904  C  CD2 . LEU A 1  1143 ? 92.397  106.942 -6.355  1.00 65.13  ? 1143 LEU A CD2 1 
ATOM   8905  N  N   . LYS A 1  1144 ? 93.046  102.436 -4.278  1.00 65.23  ? 1144 LYS A N   1 
ATOM   8906  C  CA  . LYS A 1  1144 ? 92.100  101.681 -3.477  1.00 69.33  ? 1144 LYS A CA  1 
ATOM   8907  C  C   . LYS A 1  1144 ? 92.660  101.302 -2.102  1.00 68.79  ? 1144 LYS A C   1 
ATOM   8908  O  O   . LYS A 1  1144 ? 91.913  101.190 -1.125  1.00 71.03  ? 1144 LYS A O   1 
ATOM   8909  C  CB  . LYS A 1  1144 ? 91.676  100.420 -4.240  1.00 73.92  ? 1144 LYS A CB  1 
ATOM   8910  C  CG  . LYS A 1  1144 ? 90.595  99.575  -3.553  1.00 78.46  ? 1144 LYS A CG  1 
ATOM   8911  C  CD  . LYS A 1  1144 ? 90.208  98.377  -4.413  1.00 81.36  ? 1144 LYS A CD  1 
ATOM   8912  C  CE  . LYS A 1  1144 ? 89.107  97.561  -3.769  1.00 83.39  ? 1144 LYS A CE  1 
ATOM   8913  N  NZ  . LYS A 1  1144 ? 88.781  96.394  -4.627  1.00 88.11  ? 1144 LYS A NZ  1 
ATOM   8914  N  N   . SER A 1  1145 ? 93.971  101.116 -2.018  1.00 66.37  ? 1145 SER A N   1 
ATOM   8915  C  CA  . SER A 1  1145 ? 94.584  100.732 -0.752  1.00 64.39  ? 1145 SER A CA  1 
ATOM   8916  C  C   . SER A 1  1145 ? 94.635  101.876 0.251   1.00 62.00  ? 1145 SER A C   1 
ATOM   8917  O  O   . SER A 1  1145 ? 94.542  101.658 1.467   1.00 62.04  ? 1145 SER A O   1 
ATOM   8918  C  CB  . SER A 1  1145 ? 96.002  100.194 -0.991  1.00 64.57  ? 1145 SER A CB  1 
ATOM   8919  O  OG  . SER A 1  1145 ? 96.820  101.136 -1.665  1.00 62.12  ? 1145 SER A OG  1 
ATOM   8920  N  N   . VAL A 1  1146 ? 94.755  103.092 -0.278  1.00 58.01  ? 1146 VAL A N   1 
ATOM   8921  C  CA  . VAL A 1  1146 ? 94.865  104.302 0.530   1.00 52.66  ? 1146 VAL A CA  1 
ATOM   8922  C  C   . VAL A 1  1146 ? 93.584  105.087 0.783   1.00 52.30  ? 1146 VAL A C   1 
ATOM   8923  O  O   . VAL A 1  1146 ? 93.552  105.971 1.644   1.00 55.30  ? 1146 VAL A O   1 
ATOM   8924  C  CB  . VAL A 1  1146 ? 95.895  105.249 -0.089  1.00 48.86  ? 1146 VAL A CB  1 
ATOM   8925  C  CG1 . VAL A 1  1146 ? 97.298  104.750 0.229   1.00 45.65  ? 1146 VAL A CG1 1 
ATOM   8926  C  CG2 . VAL A 1  1146 ? 95.678  105.334 -1.598  1.00 40.23  ? 1146 VAL A CG2 1 
ATOM   8927  N  N   . THR A 1  1147 ? 92.530  104.766 0.048   1.00 46.97  ? 1147 THR A N   1 
ATOM   8928  C  CA  . THR A 1  1147 ? 91.262  105.452 0.213   1.00 44.03  ? 1147 THR A CA  1 
ATOM   8929  C  C   . THR A 1  1147 ? 90.498  104.963 1.448   1.00 41.99  ? 1147 THR A C   1 
ATOM   8930  O  O   . THR A 1  1147 ? 90.757  103.872 1.955   1.00 41.34  ? 1147 THR A O   1 
ATOM   8931  C  CB  . THR A 1  1147 ? 90.404  105.236 -1.029  1.00 44.55  ? 1147 THR A CB  1 
ATOM   8932  O  OG1 . THR A 1  1147 ? 91.183  105.530 -2.191  1.00 46.53  ? 1147 THR A OG1 1 
ATOM   8933  C  CG2 . THR A 1  1147 ? 89.197  106.133 -1.010  1.00 47.40  ? 1147 THR A CG2 1 
ATOM   8934  N  N   . ILE A 1  1148 ? 89.582  105.789 1.949   1.00 39.73  ? 1148 ILE A N   1 
ATOM   8935  C  CA  . ILE A 1  1148 ? 88.750  105.418 3.091   1.00 39.68  ? 1148 ILE A CA  1 
ATOM   8936  C  C   . ILE A 1  1148 ? 87.287  105.535 2.686   1.00 41.00  ? 1148 ILE A C   1 
ATOM   8937  O  O   . ILE A 1  1148 ? 86.395  105.191 3.454   1.00 44.14  ? 1148 ILE A O   1 
ATOM   8938  C  CB  . ILE A 1  1148 ? 88.972  106.315 4.333   1.00 37.78  ? 1148 ILE A CB  1 
ATOM   8939  C  CG1 . ILE A 1  1148 ? 90.308  105.996 4.986   1.00 37.43  ? 1148 ILE A CG1 1 
ATOM   8940  C  CG2 . ILE A 1  1148 ? 87.891  106.053 5.382   1.00 40.47  ? 1148 ILE A CG2 1 
ATOM   8941  C  CD1 . ILE A 1  1148 ? 90.431  106.552 6.414   1.00 38.31  ? 1148 ILE A CD1 1 
ATOM   8942  N  N   . ALA A 1  1149 ? 87.036  106.014 1.474   1.00 41.04  ? 1149 ALA A N   1 
ATOM   8943  C  CA  . ALA A 1  1149 ? 85.668  106.150 1.003   1.00 40.92  ? 1149 ALA A CA  1 
ATOM   8944  C  C   . ALA A 1  1149 ? 85.638  106.853 -0.326  1.00 42.86  ? 1149 ALA A C   1 
ATOM   8945  O  O   . ALA A 1  1149 ? 86.639  107.371 -0.791  1.00 41.81  ? 1149 ALA A O   1 
ATOM   8946  C  CB  . ALA A 1  1149 ? 84.855  106.936 2.006   1.00 40.18  ? 1149 ALA A CB  1 
ATOM   8947  N  N   . SER A 1  1150 ? 84.482  106.846 -0.956  1.00 48.11  ? 1150 SER A N   1 
ATOM   8948  C  CA  . SER A 1  1150 ? 84.315  107.549 -2.212  1.00 58.41  ? 1150 SER A CA  1 
ATOM   8949  C  C   . SER A 1  1150 ? 82.885  108.049 -2.088  1.00 64.68  ? 1150 SER A C   1 
ATOM   8950  O  O   . SER A 1  1150 ? 82.003  107.293 -1.667  1.00 70.16  ? 1150 SER A O   1 
ATOM   8951  C  CB  . SER A 1  1150 ? 84.495  106.614 -3.420  1.00 57.94  ? 1150 SER A CB  1 
ATOM   8952  O  OG  . SER A 1  1150 ? 83.540  105.569 -3.442  1.00 61.77  ? 1150 SER A OG  1 
ATOM   8953  N  N   . GLU A 1  1151 ? 82.656  109.322 -2.403  1.00 67.77  ? 1151 GLU A N   1 
ATOM   8954  C  CA  . GLU A 1  1151 ? 81.324  109.896 -2.285  1.00 67.95  ? 1151 GLU A CA  1 
ATOM   8955  C  C   . GLU A 1  1151 ? 80.995  110.757 -3.478  1.00 68.73  ? 1151 GLU A C   1 
ATOM   8956  O  O   . GLU A 1  1151 ? 81.851  111.479 -3.984  1.00 70.12  ? 1151 GLU A O   1 
ATOM   8957  C  CB  . GLU A 1  1151 ? 81.243  110.745 -1.023  1.00 66.99  ? 1151 GLU A CB  1 
ATOM   8958  C  CG  . GLU A 1  1151 ? 81.509  109.988 0.258   1.00 68.81  ? 1151 GLU A CG  1 
ATOM   8959  C  CD  . GLU A 1  1151 ? 81.997  110.896 1.367   1.00 69.85  ? 1151 GLU A CD  1 
ATOM   8960  O  OE1 . GLU A 1  1151 ? 83.000  111.607 1.129   1.00 67.98  ? 1151 GLU A OE1 1 
ATOM   8961  O  OE2 . GLU A 1  1151 ? 81.392  110.899 2.467   1.00 70.31  ? 1151 GLU A OE2 1 
ATOM   8962  N  N   . ILE A 1  1152 ? 79.755  110.676 -3.935  1.00 69.03  ? 1152 ILE A N   1 
ATOM   8963  C  CA  . ILE A 1  1152 ? 79.346  111.498 -5.054  1.00 71.65  ? 1152 ILE A CA  1 
ATOM   8964  C  C   . ILE A 1  1152 ? 78.400  112.540 -4.475  1.00 73.42  ? 1152 ILE A C   1 
ATOM   8965  O  O   . ILE A 1  1152 ? 77.386  112.202 -3.863  1.00 74.22  ? 1152 ILE A O   1 
ATOM   8966  C  CB  . ILE A 1  1152 ? 78.646  110.666 -6.132  1.00 71.87  ? 1152 ILE A CB  1 
ATOM   8967  C  CG1 . ILE A 1  1152 ? 79.336  109.310 -6.246  1.00 73.62  ? 1152 ILE A CG1 1 
ATOM   8968  C  CG2 . ILE A 1  1152 ? 78.751  111.361 -7.484  1.00 70.33  ? 1152 ILE A CG2 1 
ATOM   8969  C  CD1 . ILE A 1  1152 ? 78.820  108.451 -7.387  1.00 78.11  ? 1152 ILE A CD1 1 
ATOM   8970  N  N   . TYR A 1  1153 ? 78.750  113.810 -4.651  1.00 74.21  ? 1153 TYR A N   1 
ATOM   8971  C  CA  . TYR A 1  1153 ? 77.952  114.908 -4.125  1.00 75.44  ? 1153 TYR A CA  1 
ATOM   8972  C  C   . TYR A 1  1153 ? 77.327  115.814 -5.173  1.00 78.86  ? 1153 TYR A C   1 
ATOM   8973  O  O   . TYR A 1  1153 ? 77.738  115.816 -6.343  1.00 78.98  ? 1153 TYR A O   1 
ATOM   8974  C  CB  . TYR A 1  1153 ? 78.821  115.778 -3.243  1.00 72.55  ? 1153 TYR A CB  1 
ATOM   8975  C  CG  . TYR A 1  1153 ? 79.050  115.251 -1.869  1.00 71.42  ? 1153 TYR A CG  1 
ATOM   8976  C  CD1 . TYR A 1  1153 ? 79.466  113.950 -1.658  1.00 72.63  ? 1153 TYR A CD1 1 
ATOM   8977  C  CD2 . TYR A 1  1153 ? 78.910  116.084 -0.772  1.00 71.41  ? 1153 TYR A CD2 1 
ATOM   8978  C  CE1 . TYR A 1  1153 ? 79.747  113.495 -0.375  1.00 73.40  ? 1153 TYR A CE1 1 
ATOM   8979  C  CE2 . TYR A 1  1153 ? 79.187  115.645 0.506   1.00 70.92  ? 1153 TYR A CE2 1 
ATOM   8980  C  CZ  . TYR A 1  1153 ? 79.608  114.355 0.704   1.00 71.50  ? 1153 TYR A CZ  1 
ATOM   8981  O  OH  . TYR A 1  1153 ? 79.912  113.943 1.982   1.00 70.43  ? 1153 TYR A OH  1 
ATOM   8982  N  N   . TYR A 1  1154 ? 76.330  116.591 -4.743  1.00 81.87  ? 1154 TYR A N   1 
ATOM   8983  C  CA  . TYR A 1  1154 ? 75.709  117.549 -5.646  1.00 85.70  ? 1154 TYR A CA  1 
ATOM   8984  C  C   . TYR A 1  1154 ? 76.188  118.957 -5.287  1.00 86.76  ? 1154 TYR A C   1 
ATOM   8985  O  O   . TYR A 1  1154 ? 75.568  119.661 -4.484  1.00 87.27  ? 1154 TYR A O   1 
ATOM   8986  C  CB  . TYR A 1  1154 ? 74.179  117.510 -5.601  1.00 85.38  ? 1154 TYR A CB  1 
ATOM   8987  C  CG  . TYR A 1  1154 ? 73.588  118.415 -6.669  1.00 86.79  ? 1154 TYR A CG  1 
ATOM   8988  C  CD1 . TYR A 1  1154 ? 73.832  118.173 -8.022  1.00 88.35  ? 1154 TYR A CD1 1 
ATOM   8989  C  CD2 . TYR A 1  1154 ? 72.867  119.558 -6.330  1.00 87.34  ? 1154 TYR A CD2 1 
ATOM   8990  C  CE1 . TYR A 1  1154 ? 73.381  119.049 -9.013  1.00 88.93  ? 1154 TYR A CE1 1 
ATOM   8991  C  CE2 . TYR A 1  1154 ? 72.409  120.442 -7.315  1.00 89.08  ? 1154 TYR A CE2 1 
ATOM   8992  C  CZ  . TYR A 1  1154 ? 72.674  120.180 -8.654  1.00 89.30  ? 1154 TYR A CZ  1 
ATOM   8993  O  OH  . TYR A 1  1154 ? 72.243  121.053 -9.632  1.00 89.78  ? 1154 TYR A OH  1 
ATOM   8994  N  N   . ASP A 1  1155 ? 77.313  119.343 -5.883  1.00 86.84  ? 1155 ASP A N   1 
ATOM   8995  C  CA  . ASP A 1  1155 ? 77.915  120.648 -5.674  1.00 86.80  ? 1155 ASP A CA  1 
ATOM   8996  C  C   . ASP A 1  1155 ? 78.031  121.249 -7.076  1.00 89.31  ? 1155 ASP A C   1 
ATOM   8997  O  O   . ASP A 1  1155 ? 78.832  120.782 -7.891  1.00 89.50  ? 1155 ASP A O   1 
ATOM   8998  C  CB  . ASP A 1  1155 ? 79.292  120.485 -5.020  1.00 84.28  ? 1155 ASP A CB  1 
ATOM   8999  C  CG  . ASP A 1  1155 ? 79.427  121.290 -3.744  1.00 84.57  ? 1155 ASP A CG  1 
ATOM   9000  O  OD1 . ASP A 1  1155 ? 79.272  122.522 -3.820  1.00 87.91  ? 1155 ASP A OD1 1 
ATOM   9001  O  OD2 . ASP A 1  1155 ? 79.684  120.708 -2.669  1.00 81.95  ? 1155 ASP A OD2 1 
ATOM   9002  N  N   . PRO A 1  1156 ? 77.194  122.266 -7.384  1.00 91.08  ? 1156 PRO A N   1 
ATOM   9003  C  CA  . PRO A 1  1156 ? 77.125  122.987 -8.667  1.00 92.49  ? 1156 PRO A CA  1 
ATOM   9004  C  C   . PRO A 1  1156 ? 77.979  124.249 -8.724  1.00 93.98  ? 1156 PRO A C   1 
ATOM   9005  O  O   . PRO A 1  1156 ? 78.293  124.765 -9.806  1.00 92.58  ? 1156 PRO A O   1 
ATOM   9006  C  CB  . PRO A 1  1156 ? 75.646  123.310 -8.783  1.00 92.15  ? 1156 PRO A CB  1 
ATOM   9007  C  CG  . PRO A 1  1156 ? 75.314  123.675 -7.366  1.00 91.79  ? 1156 PRO A CG  1 
ATOM   9008  C  CD  . PRO A 1  1156 ? 76.054  122.638 -6.525  1.00 89.92  ? 1156 PRO A CD  1 
ATOM   9009  N  N   . ASP A 1  1157 ? 78.341  124.740 -7.545  1.00 95.80  ? 1157 ASP A N   1 
ATOM   9010  C  CA  . ASP A 1  1157 ? 79.148  125.937 -7.440  1.00 98.99  ? 1157 ASP A CA  1 
ATOM   9011  C  C   . ASP A 1  1157 ? 80.623  125.592 -7.281  1.00 98.46  ? 1157 ASP A C   1 
ATOM   9012  O  O   . ASP A 1  1157 ? 81.107  125.408 -6.159  1.00 95.96  ? 1157 ASP A O   1 
ATOM   9013  C  CB  . ASP A 1  1157 ? 78.683  126.767 -6.248  1.00 103.02 ? 1157 ASP A CB  1 
ATOM   9014  C  CG  . ASP A 1  1157 ? 79.308  128.143 -6.227  1.00 107.50 ? 1157 ASP A CG  1 
ATOM   9015  O  OD1 . ASP A 1  1157 ? 79.027  128.946 -7.145  1.00 108.62 ? 1157 ASP A OD1 1 
ATOM   9016  O  OD2 . ASP A 1  1157 ? 80.089  128.418 -5.295  1.00 111.98 ? 1157 ASP A OD2 1 
ATOM   9017  N  N   . PRO A 1  1158 ? 81.359  125.495 -8.404  1.00 98.67  ? 1158 PRO A N   1 
ATOM   9018  C  CA  . PRO A 1  1158 ? 82.780  125.167 -8.290  1.00 100.28 ? 1158 PRO A CA  1 
ATOM   9019  C  C   . PRO A 1  1158 ? 83.591  126.198 -7.502  1.00 102.47 ? 1158 PRO A C   1 
ATOM   9020  O  O   . PRO A 1  1158 ? 84.823  126.147 -7.495  1.00 104.60 ? 1158 PRO A O   1 
ATOM   9021  C  CB  . PRO A 1  1158 ? 83.224  125.030 -9.752  1.00 98.24  ? 1158 PRO A CB  1 
ATOM   9022  C  CG  . PRO A 1  1158 ? 82.263  125.897 -10.493 1.00 97.26  ? 1158 PRO A CG  1 
ATOM   9023  C  CD  . PRO A 1  1158 ? 80.960  125.583 -9.821  1.00 97.22  ? 1158 PRO A CD  1 
ATOM   9024  N  N   . ARG A 1  1159 ? 82.903  127.126 -6.837  1.00 103.20 ? 1159 ARG A N   1 
ATOM   9025  C  CA  . ARG A 1  1159 ? 83.575  128.147 -6.032  1.00 105.08 ? 1159 ARG A CA  1 
ATOM   9026  C  C   . ARG A 1  1159 ? 83.139  128.116 -4.562  1.00 104.78 ? 1159 ARG A C   1 
ATOM   9027  O  O   . ARG A 1  1159 ? 83.282  129.101 -3.826  1.00 102.94 ? 1159 ARG A O   1 
ATOM   9028  C  CB  . ARG A 1  1159 ? 83.368  129.544 -6.640  1.00 108.23 ? 1159 ARG A CB  1 
ATOM   9029  C  CG  . ARG A 1  1159 ? 84.123  129.734 -7.954  1.00 112.02 ? 1159 ARG A CG  1 
ATOM   9030  C  CD  . ARG A 1  1159 ? 84.117  131.171 -8.467  1.00 115.71 ? 1159 ARG A CD  1 
ATOM   9031  N  NE  . ARG A 1  1159 ? 84.809  131.260 -9.756  1.00 118.82 ? 1159 ARG A NE  1 
ATOM   9032  C  CZ  . ARG A 1  1159 ? 84.961  132.377 -10.466 1.00 120.26 ? 1159 ARG A CZ  1 
ATOM   9033  N  NH1 . ARG A 1  1159 ? 84.469  133.529 -10.022 1.00 121.43 ? 1159 ARG A NH1 1 
ATOM   9034  N  NH2 . ARG A 1  1159 ? 85.605  132.337 -11.627 1.00 119.38 ? 1159 ARG A NH2 1 
ATOM   9035  N  N   . SER A 1  1160 ? 82.605  126.966 -4.155  1.00 105.06 ? 1160 SER A N   1 
ATOM   9036  C  CA  . SER A 1  1160 ? 82.176  126.716 -2.779  1.00 106.19 ? 1160 SER A CA  1 
ATOM   9037  C  C   . SER A 1  1160 ? 81.518  125.343 -2.693  1.00 105.20 ? 1160 SER A C   1 
ATOM   9038  O  O   . SER A 1  1160 ? 80.677  124.985 -3.521  1.00 104.83 ? 1160 SER A O   1 
ATOM   9039  C  CB  . SER A 1  1160 ? 81.217  127.805 -2.270  1.00 107.52 ? 1160 SER A CB  1 
ATOM   9040  O  OG  . SER A 1  1160 ? 79.956  127.749 -2.910  1.00 112.91 ? 1160 SER A OG  1 
ATOM   9041  N  N   . THR A 1  1161 ? 81.928  124.571 -1.693  1.00 104.79 ? 1161 THR A N   1 
ATOM   9042  C  CA  . THR A 1  1161 ? 81.397  123.235 -1.498  1.00 105.13 ? 1161 THR A CA  1 
ATOM   9043  C  C   . THR A 1  1161 ? 80.367  123.207 -0.398  1.00 103.25 ? 1161 THR A C   1 
ATOM   9044  O  O   . THR A 1  1161 ? 80.615  123.670 0.711   1.00 101.23 ? 1161 THR A O   1 
ATOM   9045  C  CB  . THR A 1  1161 ? 82.509  122.233 -1.138  1.00 107.18 ? 1161 THR A CB  1 
ATOM   9046  O  OG1 . THR A 1  1161 ? 83.391  122.078 -2.254  1.00 109.89 ? 1161 THR A OG1 1 
ATOM   9047  C  CG2 . THR A 1  1161 ? 81.919  120.885 -0.798  1.00 106.83 ? 1161 THR A CG2 1 
ATOM   9048  N  N   . VAL A 1  1162 ? 79.210  122.645 -0.718  1.00 103.20 ? 1162 VAL A N   1 
ATOM   9049  C  CA  . VAL A 1  1162 ? 78.122  122.526 0.235   1.00 104.82 ? 1162 VAL A CA  1 
ATOM   9050  C  C   . VAL A 1  1162 ? 78.632  121.870 1.507   1.00 106.14 ? 1162 VAL A C   1 
ATOM   9051  O  O   . VAL A 1  1162 ? 77.897  121.729 2.486   1.00 104.88 ? 1162 VAL A O   1 
ATOM   9052  C  CB  . VAL A 1  1162 ? 77.003  121.649 -0.327  1.00 104.84 ? 1162 VAL A CB  1 
ATOM   9053  C  CG1 . VAL A 1  1162 ? 75.790  121.710 0.586   1.00 105.22 ? 1162 VAL A CG1 1 
ATOM   9054  C  CG2 . VAL A 1  1162 ? 76.666  122.087 -1.741  1.00 105.71 ? 1162 VAL A CG2 1 
ATOM   9055  N  N   . ILE A 1  1163 ? 79.897  121.462 1.480   1.00 108.08 ? 1163 ILE A N   1 
ATOM   9056  C  CA  . ILE A 1  1163 ? 80.511  120.810 2.622   1.00 109.71 ? 1163 ILE A CA  1 
ATOM   9057  C  C   . ILE A 1  1163 ? 81.328  121.785 3.432   1.00 110.20 ? 1163 ILE A C   1 
ATOM   9058  O  O   . ILE A 1  1163 ? 82.122  122.547 2.886   1.00 107.25 ? 1163 ILE A O   1 
ATOM   9059  C  CB  . ILE A 1  1163 ? 81.458  119.680 2.195   1.00 110.36 ? 1163 ILE A CB  1 
ATOM   9060  C  CG1 . ILE A 1  1163 ? 80.779  118.790 1.153   1.00 111.65 ? 1163 ILE A CG1 1 
ATOM   9061  C  CG2 . ILE A 1  1163 ? 81.844  118.847 3.415   1.00 110.57 ? 1163 ILE A CG2 1 
ATOM   9062  C  CD1 . ILE A 1  1163 ? 81.715  117.796 0.487   1.00 111.07 ? 1163 ILE A CD1 1 
ATOM   9063  N  N   . PRO A 1  1164 ? 81.145  121.768 4.756   1.00 113.13 ? 1164 PRO A N   1 
ATOM   9064  C  CA  . PRO A 1  1164 ? 81.895  122.667 5.629   1.00 115.79 ? 1164 PRO A CA  1 
ATOM   9065  C  C   . PRO A 1  1164 ? 83.377  122.324 5.568   1.00 118.16 ? 1164 PRO A C   1 
ATOM   9066  O  O   . PRO A 1  1164 ? 84.148  122.979 4.875   1.00 117.91 ? 1164 PRO A O   1 
ATOM   9067  C  CB  . PRO A 1  1164 ? 81.288  122.393 7.006   1.00 116.34 ? 1164 PRO A CB  1 
ATOM   9068  C  CG  . PRO A 1  1164 ? 80.867  120.953 6.911   1.00 115.66 ? 1164 PRO A CG  1 
ATOM   9069  C  CD  . PRO A 1  1164 ? 80.242  120.905 5.539   1.00 114.71 ? 1164 PRO A CD  1 
ATOM   9070  N  N   . GLU A 1  1165 ? 83.748  121.275 6.291   1.00 121.78 ? 1165 GLU A N   1 
ATOM   9071  C  CA  . GLU A 1  1165 ? 85.118  120.775 6.379   1.00 125.36 ? 1165 GLU A CA  1 
ATOM   9072  C  C   . GLU A 1  1165 ? 85.981  120.930 5.115   1.00 125.54 ? 1165 GLU A C   1 
ATOM   9073  O  O   . GLU A 1  1165 ? 87.207  120.843 5.191   1.00 125.68 ? 1165 GLU A O   1 
ATOM   9074  C  CB  . GLU A 1  1165 ? 85.069  119.298 6.772   1.00 128.94 ? 1165 GLU A CB  1 
ATOM   9075  C  CG  . GLU A 1  1165 ? 83.916  118.950 7.714   1.00 133.88 ? 1165 GLU A CG  1 
ATOM   9076  C  CD  . GLU A 1  1165 ? 83.690  117.450 7.840   1.00 136.74 ? 1165 GLU A CD  1 
ATOM   9077  O  OE1 . GLU A 1  1165 ? 83.412  116.797 6.807   1.00 138.16 ? 1165 GLU A OE1 1 
ATOM   9078  O  OE2 . GLU A 1  1165 ? 83.788  116.925 8.970   1.00 138.65 ? 1165 GLU A OE2 1 
ATOM   9079  N  N   . ASP A 1  1166 ? 85.345  121.155 3.966   1.00 125.68 ? 1166 ASP A N   1 
ATOM   9080  C  CA  . ASP A 1  1166 ? 86.043  121.294 2.683   1.00 125.42 ? 1166 ASP A CA  1 
ATOM   9081  C  C   . ASP A 1  1166 ? 86.419  122.712 2.255   1.00 125.77 ? 1166 ASP A C   1 
ATOM   9082  O  O   . ASP A 1  1166 ? 87.286  122.896 1.399   1.00 126.04 ? 1166 ASP A O   1 
ATOM   9083  C  CB  . ASP A 1  1166 ? 85.200  120.667 1.570   1.00 124.27 ? 1166 ASP A CB  1 
ATOM   9084  C  CG  . ASP A 1  1166 ? 85.686  119.293 1.175   1.00 123.52 ? 1166 ASP A CG  1 
ATOM   9085  O  OD1 . ASP A 1  1166 ? 85.931  118.459 2.073   1.00 122.94 ? 1166 ASP A OD1 1 
ATOM   9086  O  OD2 . ASP A 1  1166 ? 85.815  119.045 -0.040  1.00 121.56 ? 1166 ASP A OD2 1 
ATOM   9087  N  N   . GLU A 1  1167 ? 85.763  123.708 2.841   1.00 126.61 ? 1167 GLU A N   1 
ATOM   9088  C  CA  . GLU A 1  1167 ? 86.013  125.107 2.499   1.00 127.03 ? 1167 GLU A CA  1 
ATOM   9089  C  C   . GLU A 1  1167 ? 87.473  125.429 2.223   1.00 125.92 ? 1167 GLU A C   1 
ATOM   9090  O  O   . GLU A 1  1167 ? 87.919  125.423 1.070   1.00 124.02 ? 1167 GLU A O   1 
ATOM   9091  C  CB  . GLU A 1  1167 ? 85.510  126.032 3.616   1.00 129.07 ? 1167 GLU A CB  1 
ATOM   9092  C  CG  . GLU A 1  1167 ? 84.023  125.900 3.933   1.00 131.39 ? 1167 GLU A CG  1 
ATOM   9093  C  CD  . GLU A 1  1167 ? 83.457  127.129 4.631   1.00 132.08 ? 1167 GLU A CD  1 
ATOM   9094  O  OE1 . GLU A 1  1167 ? 83.389  128.197 3.982   1.00 132.47 ? 1167 GLU A OE1 1 
ATOM   9095  O  OE2 . GLU A 1  1167 ? 83.083  127.030 5.821   1.00 132.76 ? 1167 GLU A OE2 1 
ATOM   9096  N  N   . GLU A 1  1168 ? 88.198  125.720 3.298   1.00 125.66 ? 1168 GLU A N   1 
ATOM   9097  C  CA  . GLU A 1  1168 ? 89.604  126.073 3.226   1.00 127.18 ? 1168 GLU A CA  1 
ATOM   9098  C  C   . GLU A 1  1168 ? 90.322  125.540 1.994   1.00 126.79 ? 1168 GLU A C   1 
ATOM   9099  O  O   . GLU A 1  1168 ? 91.132  126.245 1.399   1.00 126.57 ? 1168 GLU A O   1 
ATOM   9100  C  CB  . GLU A 1  1168 ? 90.311  125.624 4.506   1.00 129.53 ? 1168 GLU A CB  1 
ATOM   9101  C  CG  . GLU A 1  1168 ? 89.904  126.452 5.719   1.00 133.25 ? 1168 GLU A CG  1 
ATOM   9102  C  CD  . GLU A 1  1168 ? 90.606  126.038 7.003   1.00 136.70 ? 1168 GLU A CD  1 
ATOM   9103  O  OE1 . GLU A 1  1168 ? 91.862  126.044 7.040   1.00 138.83 ? 1168 GLU A OE1 1 
ATOM   9104  O  OE2 . GLU A 1  1168 ? 89.892  125.718 7.980   1.00 137.59 ? 1168 GLU A OE2 1 
ATOM   9105  N  N   . ILE A 1  1169 ? 90.026  124.308 1.598   1.00 126.97 ? 1169 ILE A N   1 
ATOM   9106  C  CA  . ILE A 1  1169 ? 90.674  123.751 0.418   1.00 127.61 ? 1169 ILE A CA  1 
ATOM   9107  C  C   . ILE A 1  1169 ? 90.413  124.661 -0.765  1.00 128.45 ? 1169 ILE A C   1 
ATOM   9108  O  O   . ILE A 1  1169 ? 91.248  125.490 -1.119  1.00 129.56 ? 1169 ILE A O   1 
ATOM   9109  C  CB  . ILE A 1  1169 ? 90.150  122.341 0.075   1.00 127.36 ? 1169 ILE A CB  1 
ATOM   9110  C  CG1 . ILE A 1  1169 ? 90.571  121.358 1.168   1.00 128.48 ? 1169 ILE A CG1 1 
ATOM   9111  C  CG2 . ILE A 1  1169 ? 90.689  121.897 -1.285  1.00 125.36 ? 1169 ILE A CG2 1 
ATOM   9112  C  CD1 . ILE A 1  1169 ? 90.136  119.933 0.925   1.00 129.93 ? 1169 ILE A CD1 1 
ATOM   9113  N  N   . ILE A 1  1170 ? 89.242  124.500 -1.363  1.00 129.20 ? 1170 ILE A N   1 
ATOM   9114  C  CA  . ILE A 1  1170 ? 88.839  125.290 -2.510  1.00 130.54 ? 1170 ILE A CA  1 
ATOM   9115  C  C   . ILE A 1  1170 ? 89.498  126.664 -2.539  1.00 132.99 ? 1170 ILE A C   1 
ATOM   9116  O  O   . ILE A 1  1170 ? 90.274  126.966 -3.446  1.00 132.82 ? 1170 ILE A O   1 
ATOM   9117  C  CB  . ILE A 1  1170 ? 87.318  125.449 -2.530  1.00 128.66 ? 1170 ILE A CB  1 
ATOM   9118  C  CG1 . ILE A 1  1170 ? 86.665  124.079 -2.697  1.00 128.88 ? 1170 ILE A CG1 1 
ATOM   9119  C  CG2 . ILE A 1  1170 ? 86.905  126.361 -3.654  1.00 128.12 ? 1170 ILE A CG2 1 
ATOM   9120  C  CD1 . ILE A 1  1170 ? 85.163  124.122 -2.822  1.00 128.09 ? 1170 ILE A CD1 1 
ATOM   9121  N  N   . GLN A 1  1171 ? 89.204  127.489 -1.539  1.00 136.03 ? 1171 GLN A N   1 
ATOM   9122  C  CA  . GLN A 1  1171 ? 89.776  128.831 -1.473  1.00 139.61 ? 1171 GLN A CA  1 
ATOM   9123  C  C   . GLN A 1  1171 ? 91.214  128.904 -1.978  1.00 139.60 ? 1171 GLN A C   1 
ATOM   9124  O  O   . GLN A 1  1171 ? 91.593  129.863 -2.646  1.00 140.03 ? 1171 GLN A O   1 
ATOM   9125  C  CB  . GLN A 1  1171 ? 89.724  129.375 -0.038  1.00 142.49 ? 1171 GLN A CB  1 
ATOM   9126  C  CG  . GLN A 1  1171 ? 88.437  130.118 0.316   1.00 147.77 ? 1171 GLN A CG  1 
ATOM   9127  C  CD  . GLN A 1  1171 ? 88.438  130.667 1.739   1.00 149.85 ? 1171 GLN A CD  1 
ATOM   9128  O  OE1 . GLN A 1  1171 ? 89.365  131.371 2.148   1.00 149.35 ? 1171 GLN A OE1 1 
ATOM   9129  N  NE2 . GLN A 1  1171 ? 87.389  130.352 2.497   1.00 151.20 ? 1171 GLN A NE2 1 
ATOM   9130  N  N   . LEU A 1  1172 ? 92.004  127.881 -1.673  1.00 140.49 ? 1172 LEU A N   1 
ATOM   9131  C  CA  . LEU A 1  1172 ? 93.409  127.850 -2.068  1.00 141.51 ? 1172 LEU A CA  1 
ATOM   9132  C  C   . LEU A 1  1172 ? 93.694  127.591 -3.542  1.00 140.35 ? 1172 LEU A C   1 
ATOM   9133  O  O   . LEU A 1  1172 ? 94.662  128.110 -4.087  1.00 139.98 ? 1172 LEU A O   1 
ATOM   9134  C  CB  . LEU A 1  1172 ? 94.165  126.812 -1.231  1.00 144.03 ? 1172 LEU A CB  1 
ATOM   9135  C  CG  . LEU A 1  1172 ? 94.233  127.018 0.288   1.00 147.01 ? 1172 LEU A CG  1 
ATOM   9136  C  CD1 . LEU A 1  1172 ? 95.050  125.894 0.913   1.00 147.36 ? 1172 LEU A CD1 1 
ATOM   9137  C  CD2 . LEU A 1  1172 ? 94.859  128.375 0.611   1.00 149.05 ? 1172 LEU A CD2 1 
ATOM   9138  N  N   . HIS A 1  1173 ? 92.860  126.796 -4.192  1.00 139.92 ? 1173 HIS A N   1 
ATOM   9139  C  CA  . HIS A 1  1173 ? 93.091  126.473 -5.590  1.00 141.12 ? 1173 HIS A CA  1 
ATOM   9140  C  C   . HIS A 1  1173 ? 92.565  127.476 -6.587  1.00 141.62 ? 1173 HIS A C   1 
ATOM   9141  O  O   . HIS A 1  1173 ? 92.638  127.241 -7.791  1.00 140.93 ? 1173 HIS A O   1 
ATOM   9142  C  CB  . HIS A 1  1173 ? 92.502  125.106 -5.905  1.00 142.56 ? 1173 HIS A CB  1 
ATOM   9143  C  CG  . HIS A 1  1173 ? 93.231  123.978 -5.247  1.00 145.00 ? 1173 HIS A CG  1 
ATOM   9144  N  ND1 . HIS A 1  1173 ? 94.179  123.224 -5.899  1.00 145.15 ? 1173 HIS A ND1 1 
ATOM   9145  C  CD2 . HIS A 1  1173 ? 93.164  123.497 -3.982  1.00 146.59 ? 1173 HIS A CD2 1 
ATOM   9146  C  CE1 . HIS A 1  1173 ? 94.669  122.320 -5.065  1.00 145.55 ? 1173 HIS A CE1 1 
ATOM   9147  N  NE2 . HIS A 1  1173 ? 94.070  122.466 -3.898  1.00 147.11 ? 1173 HIS A NE2 1 
ATOM   9148  N  N   . PHE A 1  1174 ? 92.038  128.594 -6.103  1.00 143.63 ? 1174 PHE A N   1 
ATOM   9149  C  CA  . PHE A 1  1174 ? 91.506  129.601 -7.011  1.00 145.76 ? 1174 PHE A CA  1 
ATOM   9150  C  C   . PHE A 1  1174 ? 92.279  130.905 -6.984  1.00 145.61 ? 1174 PHE A C   1 
ATOM   9151  O  O   . PHE A 1  1174 ? 92.315  131.639 -7.973  1.00 144.61 ? 1174 PHE A O   1 
ATOM   9152  C  CB  . PHE A 1  1174 ? 90.027  129.832 -6.721  1.00 147.86 ? 1174 PHE A CB  1 
ATOM   9153  C  CG  . PHE A 1  1174 ? 89.192  128.605 -6.935  1.00 150.64 ? 1174 PHE A CG  1 
ATOM   9154  C  CD1 . PHE A 1  1174 ? 89.222  127.564 -6.014  1.00 151.15 ? 1174 PHE A CD1 1 
ATOM   9155  C  CD2 . PHE A 1  1174 ? 88.437  128.453 -8.096  1.00 151.07 ? 1174 PHE A CD2 1 
ATOM   9156  C  CE1 . PHE A 1  1174 ? 88.516  126.390 -6.243  1.00 151.04 ? 1174 PHE A CE1 1 
ATOM   9157  C  CE2 . PHE A 1  1174 ? 87.725  127.279 -8.335  1.00 150.84 ? 1174 PHE A CE2 1 
ATOM   9158  C  CZ  . PHE A 1  1174 ? 87.767  126.245 -7.406  1.00 151.12 ? 1174 PHE A CZ  1 
ATOM   9159  N  N   . SER A 1  1175 ? 92.903  131.195 -5.852  1.00 145.89 ? 1175 SER A N   1 
ATOM   9160  C  CA  . SER A 1  1175 ? 93.698  132.400 -5.768  1.00 145.80 ? 1175 SER A CA  1 
ATOM   9161  C  C   . SER A 1  1175 ? 94.891  132.199 -6.709  1.00 146.52 ? 1175 SER A C   1 
ATOM   9162  O  O   . SER A 1  1175 ? 95.194  133.063 -7.533  1.00 146.76 ? 1175 SER A O   1 
ATOM   9163  C  CB  . SER A 1  1175 ? 94.159  132.642 -4.322  1.00 144.83 ? 1175 SER A CB  1 
ATOM   9164  O  OG  . SER A 1  1175 ? 94.799  131.508 -3.762  1.00 144.07 ? 1175 SER A OG  1 
ATOM   9165  N  N   . LEU A 1  1176 ? 95.531  131.033 -6.617  1.00 147.28 ? 1176 LEU A N   1 
ATOM   9166  C  CA  . LEU A 1  1176 ? 96.701  130.719 -7.444  1.00 146.61 ? 1176 LEU A CA  1 
ATOM   9167  C  C   . LEU A 1  1176 ? 96.453  129.677 -8.550  1.00 145.85 ? 1176 LEU A C   1 
ATOM   9168  O  O   . LEU A 1  1176 ? 96.293  130.105 -9.720  1.00 144.13 ? 1176 LEU A O   1 
ATOM   9169  C  CB  . LEU A 1  1176 ? 97.856  130.240 -6.546  1.00 146.81 ? 1176 LEU A CB  1 
ATOM   9170  C  CG  . LEU A 1  1176 ? 98.414  131.178 -5.464  1.00 145.92 ? 1176 LEU A CG  1 
ATOM   9171  C  CD1 . LEU A 1  1176 ? 99.479  130.456 -4.635  1.00 144.47 ? 1176 LEU A CD1 1 
ATOM   9172  C  CD2 . LEU A 1  1176 ? 99.003  132.414 -6.119  1.00 145.72 ? 1176 LEU A CD2 1 
ATOM   9173  N  N   . GLN A 1  1187 ? 81.587  125.476 -18.517 1.00 127.26 ? 1187 GLN A N   1 
ATOM   9174  C  CA  . GLN A 1  1187 ? 82.862  124.707 -18.600 1.00 127.65 ? 1187 GLN A CA  1 
ATOM   9175  C  C   . GLN A 1  1187 ? 82.773  123.322 -17.950 1.00 126.46 ? 1187 GLN A C   1 
ATOM   9176  O  O   . GLN A 1  1187 ? 82.466  122.339 -18.627 1.00 125.14 ? 1187 GLN A O   1 
ATOM   9177  C  CB  . GLN A 1  1187 ? 84.005  125.513 -17.961 1.00 130.16 ? 1187 GLN A CB  1 
ATOM   9178  C  CG  . GLN A 1  1187 ? 83.619  126.309 -16.708 1.00 131.09 ? 1187 GLN A CG  1 
ATOM   9179  C  CD  . GLN A 1  1187 ? 84.826  126.672 -15.847 1.00 132.22 ? 1187 GLN A CD  1 
ATOM   9180  O  OE1 . GLN A 1  1187 ? 85.877  127.076 -16.358 1.00 132.88 ? 1187 GLN A OE1 1 
ATOM   9181  N  NE2 . GLN A 1  1187 ? 84.676  126.534 -14.531 1.00 131.13 ? 1187 GLN A NE2 1 
ATOM   9182  N  N   . GLN A 1  1188 ? 83.035  123.261 -16.641 1.00 125.18 ? 1188 GLN A N   1 
ATOM   9183  C  CA  . GLN A 1  1188 ? 83.023  122.010 -15.861 1.00 121.73 ? 1188 GLN A CA  1 
ATOM   9184  C  C   . GLN A 1  1188 ? 81.648  121.345 -15.680 1.00 118.17 ? 1188 GLN A C   1 
ATOM   9185  O  O   . GLN A 1  1188 ? 80.693  121.657 -16.394 1.00 117.70 ? 1188 GLN A O   1 
ATOM   9186  C  CB  . GLN A 1  1188 ? 83.646  122.254 -14.471 1.00 122.28 ? 1188 GLN A CB  1 
ATOM   9187  C  CG  . GLN A 1  1188 ? 85.153  122.514 -14.470 1.00 124.50 ? 1188 GLN A CG  1 
ATOM   9188  C  CD  . GLN A 1  1188 ? 85.669  122.994 -13.122 1.00 126.11 ? 1188 GLN A CD  1 
ATOM   9189  O  OE1 . GLN A 1  1188 ? 85.481  122.333 -12.100 1.00 125.85 ? 1188 GLN A OE1 1 
ATOM   9190  N  NE2 . GLN A 1  1188 ? 86.326  124.155 -13.118 1.00 127.39 ? 1188 GLN A NE2 1 
ATOM   9191  N  N   . SER A 1  1189 ? 81.576  120.412 -14.725 1.00 113.31 ? 1189 SER A N   1 
ATOM   9192  C  CA  . SER A 1  1189 ? 80.344  119.678 -14.389 1.00 107.45 ? 1189 SER A CA  1 
ATOM   9193  C  C   . SER A 1  1189 ? 79.997  119.899 -12.914 1.00 101.40 ? 1189 SER A C   1 
ATOM   9194  O  O   . SER A 1  1189 ? 80.875  120.164 -12.099 1.00 101.96 ? 1189 SER A O   1 
ATOM   9195  C  CB  . SER A 1  1189 ? 80.506  118.172 -14.640 1.00 109.57 ? 1189 SER A CB  1 
ATOM   9196  O  OG  . SER A 1  1189 ? 79.381  117.441 -14.162 1.00 108.09 ? 1189 SER A OG  1 
ATOM   9197  N  N   . PRO A 1  1190 ? 78.709  119.777 -12.557 1.00 94.26  ? 1190 PRO A N   1 
ATOM   9198  C  CA  . PRO A 1  1190 ? 78.211  119.967 -11.189 1.00 86.64  ? 1190 PRO A CA  1 
ATOM   9199  C  C   . PRO A 1  1190 ? 78.261  118.736 -10.306 1.00 79.53  ? 1190 PRO A C   1 
ATOM   9200  O  O   . PRO A 1  1190 ? 77.984  118.803 -9.111  1.00 75.80  ? 1190 PRO A O   1 
ATOM   9201  C  CB  . PRO A 1  1190 ? 76.782  120.412 -11.421 1.00 88.71  ? 1190 PRO A CB  1 
ATOM   9202  C  CG  . PRO A 1  1190 ? 76.383  119.537 -12.575 1.00 91.26  ? 1190 PRO A CG  1 
ATOM   9203  C  CD  . PRO A 1  1190 ? 77.586  119.603 -13.499 1.00 93.56  ? 1190 PRO A CD  1 
ATOM   9204  N  N   . TRP A 1  1191 ? 78.611  117.612 -10.907 1.00 74.50  ? 1191 TRP A N   1 
ATOM   9205  C  CA  . TRP A 1  1191 ? 78.666  116.347 -10.201 1.00 68.90  ? 1191 TRP A CA  1 
ATOM   9206  C  C   . TRP A 1  1191 ? 79.970  116.075 -9.501  1.00 64.98  ? 1191 TRP A C   1 
ATOM   9207  O  O   . TRP A 1  1191 ? 80.978  115.807 -10.144 1.00 67.12  ? 1191 TRP A O   1 
ATOM   9208  C  CB  . TRP A 1  1191 ? 78.350  115.248 -11.192 1.00 70.92  ? 1191 TRP A CB  1 
ATOM   9209  C  CG  . TRP A 1  1191 ? 76.894  115.166 -11.391 1.00 71.95  ? 1191 TRP A CG  1 
ATOM   9210  C  CD1 . TRP A 1  1191 ? 76.209  115.219 -12.572 1.00 72.92  ? 1191 TRP A CD1 1 
ATOM   9211  C  CD2 . TRP A 1  1191 ? 75.915  115.010 -10.359 1.00 68.88  ? 1191 TRP A CD2 1 
ATOM   9212  N  NE1 . TRP A 1  1191 ? 74.856  115.101 -12.335 1.00 71.53  ? 1191 TRP A NE1 1 
ATOM   9213  C  CE2 . TRP A 1  1191 ? 74.651  114.971 -10.985 1.00 68.64  ? 1191 TRP A CE2 1 
ATOM   9214  C  CE3 . TRP A 1  1191 ? 75.986  114.899 -8.963  1.00 64.33  ? 1191 TRP A CE3 1 
ATOM   9215  C  CZ2 . TRP A 1  1191 ? 73.468  114.822 -10.261 1.00 65.17  ? 1191 TRP A CZ2 1 
ATOM   9216  C  CZ3 . TRP A 1  1191 ? 74.811  114.749 -8.246  1.00 61.62  ? 1191 TRP A CZ3 1 
ATOM   9217  C  CH2 . TRP A 1  1191 ? 73.569  114.712 -8.896  1.00 61.73  ? 1191 TRP A CH2 1 
ATOM   9218  N  N   . LEU A 1  1192 ? 79.952  116.119 -8.178  1.00 59.05  ? 1192 LEU A N   1 
ATOM   9219  C  CA  . LEU A 1  1192 ? 81.180  115.902 -7.437  1.00 58.23  ? 1192 LEU A CA  1 
ATOM   9220  C  C   . LEU A 1  1192 ? 81.458  114.476 -7.000  1.00 59.15  ? 1192 LEU A C   1 
ATOM   9221  O  O   . LEU A 1  1192 ? 80.538  113.689 -6.778  1.00 62.48  ? 1192 LEU A O   1 
ATOM   9222  C  CB  . LEU A 1  1192 ? 81.221  116.769 -6.190  1.00 57.84  ? 1192 LEU A CB  1 
ATOM   9223  C  CG  . LEU A 1  1192 ? 82.565  116.609 -5.473  1.00 57.85  ? 1192 LEU A CG  1 
ATOM   9224  C  CD1 . LEU A 1  1192 ? 83.617  117.350 -6.283  1.00 57.30  ? 1192 LEU A CD1 1 
ATOM   9225  C  CD2 . LEU A 1  1192 ? 82.514  117.127 -4.045  1.00 59.15  ? 1192 LEU A CD2 1 
ATOM   9226  N  N   . LEU A 1  1193 ? 82.751  114.172 -6.865  1.00 57.56  ? 1193 LEU A N   1 
ATOM   9227  C  CA  . LEU A 1  1193 ? 83.249  112.875 -6.408  1.00 51.26  ? 1193 LEU A CA  1 
ATOM   9228  C  C   . LEU A 1  1193 ? 84.366  113.149 -5.406  1.00 48.14  ? 1193 LEU A C   1 
ATOM   9229  O  O   . LEU A 1  1193 ? 85.457  113.559 -5.776  1.00 46.08  ? 1193 LEU A O   1 
ATOM   9230  C  CB  . LEU A 1  1193 ? 83.785  112.062 -7.574  1.00 50.38  ? 1193 LEU A CB  1 
ATOM   9231  C  CG  . LEU A 1  1193 ? 84.583  110.850 -7.101  1.00 51.55  ? 1193 LEU A CG  1 
ATOM   9232  C  CD1 . LEU A 1  1193 ? 83.941  110.209 -5.865  1.00 48.90  ? 1193 LEU A CD1 1 
ATOM   9233  C  CD2 . LEU A 1  1193 ? 84.683  109.866 -8.256  1.00 54.84  ? 1193 LEU A CD2 1 
ATOM   9234  N  N   . ARG A 1  1194 ? 84.082  112.909 -4.137  1.00 47.08  ? 1194 ARG A N   1 
ATOM   9235  C  CA  . ARG A 1  1194 ? 85.032  113.189 -3.072  1.00 50.25  ? 1194 ARG A CA  1 
ATOM   9236  C  C   . ARG A 1  1194 ? 85.631  111.939 -2.435  1.00 51.58  ? 1194 ARG A C   1 
ATOM   9237  O  O   . ARG A 1  1194 ? 84.885  111.061 -2.006  1.00 53.85  ? 1194 ARG A O   1 
ATOM   9238  C  CB  . ARG A 1  1194 ? 84.323  114.043 -2.021  1.00 51.15  ? 1194 ARG A CB  1 
ATOM   9239  C  CG  . ARG A 1  1194 ? 85.083  114.289 -0.742  1.00 53.40  ? 1194 ARG A CG  1 
ATOM   9240  C  CD  . ARG A 1  1194 ? 84.421  115.415 0.018   1.00 55.70  ? 1194 ARG A CD  1 
ATOM   9241  N  NE  . ARG A 1  1194 ? 84.996  115.644 1.341   1.00 60.05  ? 1194 ARG A NE  1 
ATOM   9242  C  CZ  . ARG A 1  1194 ? 84.766  114.877 2.403   1.00 62.70  ? 1194 ARG A CZ  1 
ATOM   9243  N  NH1 . ARG A 1  1194 ? 83.969  113.820 2.293   1.00 63.92  ? 1194 ARG A NH1 1 
ATOM   9244  N  NH2 . ARG A 1  1194 ? 85.311  115.177 3.581   1.00 62.13  ? 1194 ARG A NH2 1 
ATOM   9245  N  N   . LEU A 1  1195 ? 86.969  111.893 -2.343  1.00 49.39  ? 1195 LEU A N   1 
ATOM   9246  C  CA  . LEU A 1  1195 ? 87.712  110.746 -1.794  1.00 45.41  ? 1195 LEU A CA  1 
ATOM   9247  C  C   . LEU A 1  1195 ? 88.553  110.989 -0.558  1.00 44.27  ? 1195 LEU A C   1 
ATOM   9248  O  O   . LEU A 1  1195 ? 89.675  111.432 -0.692  1.00 45.24  ? 1195 LEU A O   1 
ATOM   9249  C  CB  . LEU A 1  1195 ? 88.670  110.204 -2.845  1.00 43.12  ? 1195 LEU A CB  1 
ATOM   9250  C  CG  . LEU A 1  1195 ? 88.100  110.023 -4.241  1.00 44.53  ? 1195 LEU A CG  1 
ATOM   9251  C  CD1 . LEU A 1  1195 ? 89.191  109.610 -5.201  1.00 45.45  ? 1195 LEU A CD1 1 
ATOM   9252  C  CD2 . LEU A 1  1195 ? 87.011  108.981 -4.191  1.00 47.59  ? 1195 LEU A CD2 1 
ATOM   9253  N  N   . GLU A 1  1196 ? 88.053  110.679 0.631   1.00 46.06  ? 1196 GLU A N   1 
ATOM   9254  C  CA  . GLU A 1  1196 ? 88.864  110.862 1.833   1.00 53.79  ? 1196 GLU A CA  1 
ATOM   9255  C  C   . GLU A 1  1196 ? 89.933  109.749 1.837   1.00 58.71  ? 1196 GLU A C   1 
ATOM   9256  O  O   . GLU A 1  1196 ? 89.643  108.637 1.412   1.00 61.73  ? 1196 GLU A O   1 
ATOM   9257  C  CB  . GLU A 1  1196 ? 87.981  110.766 3.079   1.00 56.41  ? 1196 GLU A CB  1 
ATOM   9258  C  CG  . GLU A 1  1196 ? 88.713  111.048 4.392   1.00 60.30  ? 1196 GLU A CG  1 
ATOM   9259  C  CD  . GLU A 1  1196 ? 87.873  110.739 5.629   1.00 63.16  ? 1196 GLU A CD  1 
ATOM   9260  O  OE1 . GLU A 1  1196 ? 86.639  110.557 5.501   1.00 67.03  ? 1196 GLU A OE1 1 
ATOM   9261  O  OE2 . GLU A 1  1196 ? 88.453  110.685 6.736   1.00 61.82  ? 1196 GLU A OE2 1 
ATOM   9262  N  N   . LEU A 1  1197 ? 91.157  110.037 2.294   1.00 63.47  ? 1197 LEU A N   1 
ATOM   9263  C  CA  . LEU A 1  1197 ? 92.245  109.038 2.311   1.00 67.61  ? 1197 LEU A CA  1 
ATOM   9264  C  C   . LEU A 1  1197 ? 92.779  108.744 3.717   1.00 75.12  ? 1197 LEU A C   1 
ATOM   9265  O  O   . LEU A 1  1197 ? 92.563  109.523 4.651   1.00 79.11  ? 1197 LEU A O   1 
ATOM   9266  C  CB  . LEU A 1  1197 ? 93.418  109.483 1.421   1.00 60.31  ? 1197 LEU A CB  1 
ATOM   9267  C  CG  . LEU A 1  1197 ? 93.198  109.890 -0.043  1.00 57.87  ? 1197 LEU A CG  1 
ATOM   9268  C  CD1 . LEU A 1  1197 ? 94.518  109.894 -0.803  1.00 57.96  ? 1197 LEU A CD1 1 
ATOM   9269  C  CD2 . LEU A 1  1197 ? 92.260  108.932 -0.700  1.00 57.66  ? 1197 LEU A CD2 1 
ATOM   9270  N  N   . ASP A 1  1198 ? 93.481  107.624 3.876   1.00 81.80  ? 1198 ASP A N   1 
ATOM   9271  C  CA  . ASP A 1  1198 ? 93.996  107.290 5.195   1.00 88.71  ? 1198 ASP A CA  1 
ATOM   9272  C  C   . ASP A 1  1198 ? 95.387  107.832 5.407   1.00 92.55  ? 1198 ASP A C   1 
ATOM   9273  O  O   . ASP A 1  1198 ? 96.280  107.617 4.596   1.00 92.29  ? 1198 ASP A O   1 
ATOM   9274  C  CB  . ASP A 1  1198 ? 94.007  105.782 5.437   1.00 89.49  ? 1198 ASP A CB  1 
ATOM   9275  C  CG  . ASP A 1  1198 ? 94.329  105.441 6.880   1.00 91.19  ? 1198 ASP A CG  1 
ATOM   9276  O  OD1 . ASP A 1  1198 ? 95.189  106.132 7.455   1.00 91.79  ? 1198 ASP A OD1 1 
ATOM   9277  O  OD2 . ASP A 1  1198 ? 93.739  104.498 7.445   1.00 93.05  ? 1198 ASP A OD2 1 
ATOM   9278  N  N   . ARG A 1  1199 ? 95.558  108.544 6.511   1.00 99.42  ? 1199 ARG A N   1 
ATOM   9279  C  CA  . ARG A 1  1199 ? 96.845  109.121 6.847   1.00 106.84 ? 1199 ARG A CA  1 
ATOM   9280  C  C   . ARG A 1  1199 ? 97.805  107.980 7.158   1.00 108.31 ? 1199 ARG A C   1 
ATOM   9281  O  O   . ARG A 1  1199 ? 98.835  107.826 6.505   1.00 107.41 ? 1199 ARG A O   1 
ATOM   9282  C  CB  . ARG A 1  1199 ? 96.691  110.027 8.066   1.00 113.77 ? 1199 ARG A CB  1 
ATOM   9283  C  CG  . ARG A 1  1199 ? 97.147  111.461 7.873   1.00 121.28 ? 1199 ARG A CG  1 
ATOM   9284  C  CD  . ARG A 1  1199 ? 96.654  112.268 9.042   1.00 128.56 ? 1199 ARG A CD  1 
ATOM   9285  N  NE  . ARG A 1  1199 ? 97.313  113.557 9.151   1.00 136.61 ? 1199 ARG A NE  1 
ATOM   9286  C  CZ  . ARG A 1  1199 ? 97.208  114.340 10.218  1.00 142.85 ? 1199 ARG A CZ  1 
ATOM   9287  N  NH1 . ARG A 1  1199 ? 96.468  113.953 11.252  1.00 146.30 ? 1199 ARG A NH1 1 
ATOM   9288  N  NH2 . ARG A 1  1199 ? 97.851  115.502 10.260  1.00 146.12 ? 1199 ARG A NH2 1 
ATOM   9289  N  N   . ALA A 1  1200 ? 97.441  107.178 8.155   1.00 111.14 ? 1200 ALA A N   1 
ATOM   9290  C  CA  . ALA A 1  1200 ? 98.246  106.038 8.591   1.00 111.96 ? 1200 ALA A CA  1 
ATOM   9291  C  C   . ALA A 1  1200 ? 98.778  105.224 7.411   1.00 111.30 ? 1200 ALA A C   1 
ATOM   9292  O  O   . ALA A 1  1200 ? 99.882  104.674 7.459   1.00 109.75 ? 1200 ALA A O   1 
ATOM   9293  C  CB  . ALA A 1  1200 ? 97.406  105.138 9.523   1.00 112.61 ? 1200 ALA A CB  1 
ATOM   9294  N  N   . ALA A 1  1201 ? 97.983  105.166 6.348   1.00 111.34 ? 1201 ALA A N   1 
ATOM   9295  C  CA  . ALA A 1  1201 ? 98.336  104.412 5.157   1.00 110.78 ? 1201 ALA A CA  1 
ATOM   9296  C  C   . ALA A 1  1201 ? 99.198  105.195 4.187   1.00 110.07 ? 1201 ALA A C   1 
ATOM   9297  O  O   . ALA A 1  1201 ? 99.575  104.684 3.139   1.00 107.94 ? 1201 ALA A O   1 
ATOM   9298  C  CB  . ALA A 1  1201 ? 97.073  103.951 4.455   1.00 113.06 ? 1201 ALA A CB  1 
ATOM   9299  N  N   . MET A 1  1202 ? 99.510  106.436 4.527   1.00 111.12 ? 1202 MET A N   1 
ATOM   9300  C  CA  . MET A 1  1202 ? 100.326 107.258 3.647   1.00 113.09 ? 1202 MET A CA  1 
ATOM   9301  C  C   . MET A 1  1202 ? 101.774 107.335 4.108   1.00 116.88 ? 1202 MET A C   1 
ATOM   9302  O  O   . MET A 1  1202 ? 102.603 107.985 3.478   1.00 114.76 ? 1202 MET A O   1 
ATOM   9303  C  CB  . MET A 1  1202 ? 99.729  108.660 3.542   1.00 111.11 ? 1202 MET A CB  1 
ATOM   9304  C  CG  . MET A 1  1202 ? 98.402  108.720 2.785   1.00 106.54 ? 1202 MET A CG  1 
ATOM   9305  S  SD  . MET A 1  1202 ? 98.568  108.410 1.010   1.00 99.42  ? 1202 MET A SD  1 
ATOM   9306  C  CE  . MET A 1  1202 ? 98.330  109.992 0.338   1.00 96.04  ? 1202 MET A CE  1 
ATOM   9307  N  N   . ASN A 1  1203 ? 102.072 106.673 5.219   1.00 123.98 ? 1203 ASN A N   1 
ATOM   9308  C  CA  . ASN A 1  1203 ? 103.431 106.643 5.749   1.00 129.40 ? 1203 ASN A CA  1 
ATOM   9309  C  C   . ASN A 1  1203 ? 103.977 105.235 5.613   1.00 131.47 ? 1203 ASN A C   1 
ATOM   9310  O  O   . ASN A 1  1203 ? 105.067 105.043 5.071   1.00 132.88 ? 1203 ASN A O   1 
ATOM   9311  C  CB  . ASN A 1  1203 ? 103.465 107.060 7.216   1.00 131.73 ? 1203 ASN A CB  1 
ATOM   9312  C  CG  . ASN A 1  1203 ? 103.200 108.528 7.400   1.00 132.83 ? 1203 ASN A CG  1 
ATOM   9313  O  OD1 . ASN A 1  1203 ? 103.756 109.361 6.685   1.00 131.54 ? 1203 ASN A OD1 1 
ATOM   9314  N  ND2 . ASN A 1  1203 ? 102.356 108.860 8.369   1.00 134.60 ? 1203 ASN A ND2 1 
ATOM   9315  N  N   . ASP A 1  1204 ? 103.223 104.258 6.120   1.00 132.58 ? 1204 ASP A N   1 
ATOM   9316  C  CA  . ASP A 1  1204 ? 103.614 102.855 6.024   1.00 131.98 ? 1204 ASP A CA  1 
ATOM   9317  C  C   . ASP A 1  1204 ? 104.347 102.749 4.682   1.00 130.67 ? 1204 ASP A C   1 
ATOM   9318  O  O   . ASP A 1  1204 ? 105.519 102.367 4.626   1.00 130.86 ? 1204 ASP A O   1 
ATOM   9319  C  CB  . ASP A 1  1204 ? 102.355 101.977 6.056   1.00 134.05 ? 1204 ASP A CB  1 
ATOM   9320  C  CG  . ASP A 1  1204 ? 102.656 100.499 5.891   1.00 134.55 ? 1204 ASP A CG  1 
ATOM   9321  O  OD1 . ASP A 1  1204 ? 102.971 100.075 4.755   1.00 134.87 ? 1204 ASP A OD1 1 
ATOM   9322  O  OD2 . ASP A 1  1204 ? 102.574 99.763  6.899   1.00 134.56 ? 1204 ASP A OD2 1 
ATOM   9323  N  N   . LYS A 1  1205 ? 103.654 103.132 3.613   1.00 128.55 ? 1205 LYS A N   1 
ATOM   9324  C  CA  . LYS A 1  1205 ? 104.221 103.156 2.269   1.00 126.50 ? 1205 LYS A CA  1 
ATOM   9325  C  C   . LYS A 1  1205 ? 104.261 104.644 1.974   1.00 125.62 ? 1205 LYS A C   1 
ATOM   9326  O  O   . LYS A 1  1205 ? 103.264 105.211 1.544   1.00 125.91 ? 1205 LYS A O   1 
ATOM   9327  C  CB  . LYS A 1  1205 ? 103.289 102.480 1.266   1.00 126.01 ? 1205 LYS A CB  1 
ATOM   9328  C  CG  . LYS A 1  1205 ? 102.719 101.169 1.743   1.00 126.18 ? 1205 LYS A CG  1 
ATOM   9329  C  CD  . LYS A 1  1205 ? 101.685 100.645 0.773   1.00 127.43 ? 1205 LYS A CD  1 
ATOM   9330  C  CE  . LYS A 1  1205 ? 100.934 99.474  1.379   1.00 129.05 ? 1205 LYS A CE  1 
ATOM   9331  N  NZ  . LYS A 1  1205 ? 99.929  98.910  0.437   1.00 131.25 ? 1205 LYS A NZ  1 
ATOM   9332  N  N   . ASP A 1  1206 ? 105.397 105.278 2.230   1.00 125.45 ? 1206 ASP A N   1 
ATOM   9333  C  CA  . ASP A 1  1206 ? 105.539 106.714 2.013   1.00 126.00 ? 1206 ASP A CA  1 
ATOM   9334  C  C   . ASP A 1  1206 ? 104.727 107.247 0.827   1.00 125.35 ? 1206 ASP A C   1 
ATOM   9335  O  O   . ASP A 1  1206 ? 104.583 106.562 -0.184  1.00 125.58 ? 1206 ASP A O   1 
ATOM   9336  C  CB  . ASP A 1  1206 ? 107.025 107.062 1.855   1.00 127.18 ? 1206 ASP A CB  1 
ATOM   9337  C  CG  . ASP A 1  1206 ? 107.778 107.031 3.187   1.00 128.71 ? 1206 ASP A CG  1 
ATOM   9338  O  OD1 . ASP A 1  1206 ? 107.489 107.884 4.052   1.00 129.68 ? 1206 ASP A OD1 1 
ATOM   9339  O  OD2 . ASP A 1  1206 ? 108.652 106.157 3.377   1.00 129.32 ? 1206 ASP A OD2 1 
ATOM   9340  N  N   . LEU A 1  1207 ? 104.173 108.453 0.984   1.00 124.16 ? 1207 LEU A N   1 
ATOM   9341  C  CA  . LEU A 1  1207 ? 103.372 109.127 -0.051  1.00 121.96 ? 1207 LEU A CA  1 
ATOM   9342  C  C   . LEU A 1  1207 ? 102.989 110.559 0.336   1.00 120.29 ? 1207 LEU A C   1 
ATOM   9343  O  O   . LEU A 1  1207 ? 103.003 110.928 1.515   1.00 120.34 ? 1207 LEU A O   1 
ATOM   9344  C  CB  . LEU A 1  1207 ? 102.089 108.345 -0.372  1.00 123.57 ? 1207 LEU A CB  1 
ATOM   9345  C  CG  . LEU A 1  1207 ? 102.159 107.193 -1.386  1.00 124.00 ? 1207 LEU A CG  1 
ATOM   9346  C  CD1 . LEU A 1  1207 ? 100.791 106.552 -1.543  1.00 125.77 ? 1207 LEU A CD1 1 
ATOM   9347  C  CD2 . LEU A 1  1207 ? 102.642 107.708 -2.724  1.00 120.59 ? 1207 LEU A CD2 1 
ATOM   9348  N  N   . THR A 1  1208 ? 102.639 111.353 -0.677  1.00 117.76 ? 1208 THR A N   1 
ATOM   9349  C  CA  . THR A 1  1208 ? 102.252 112.756 -0.503  1.00 115.73 ? 1208 THR A CA  1 
ATOM   9350  C  C   . THR A 1  1208 ? 101.111 113.181 -1.419  1.00 110.67 ? 1208 THR A C   1 
ATOM   9351  O  O   . THR A 1  1208 ? 101.203 113.037 -2.640  1.00 110.05 ? 1208 THR A O   1 
ATOM   9352  C  CB  . THR A 1  1208 ? 103.429 113.707 -0.788  1.00 118.61 ? 1208 THR A CB  1 
ATOM   9353  O  OG1 . THR A 1  1208 ? 104.348 113.675 0.311   1.00 123.28 ? 1208 THR A OG1 1 
ATOM   9354  C  CG2 . THR A 1  1208 ? 102.926 115.136 -0.996  1.00 120.14 ? 1208 THR A CG2 1 
ATOM   9355  N  N   . MET A 1  1209 ? 100.059 113.735 -0.816  1.00 104.71 ? 1209 MET A N   1 
ATOM   9356  C  CA  . MET A 1  1209 ? 98.883  114.197 -1.546  1.00 97.97  ? 1209 MET A CA  1 
ATOM   9357  C  C   . MET A 1  1209 ? 99.263  114.557 -2.954  1.00 95.34  ? 1209 MET A C   1 
ATOM   9358  O  O   . MET A 1  1209 ? 98.701  114.037 -3.913  1.00 93.13  ? 1209 MET A O   1 
ATOM   9359  C  CB  . MET A 1  1209 ? 98.277  115.429 -0.877  1.00 96.11  ? 1209 MET A CB  1 
ATOM   9360  C  CG  . MET A 1  1209 ? 97.650  115.166 0.471   1.00 95.21  ? 1209 MET A CG  1 
ATOM   9361  S  SD  . MET A 1  1209 ? 96.439  113.831 0.428   1.00 93.77  ? 1209 MET A SD  1 
ATOM   9362  C  CE  . MET A 1  1209 ? 94.924  114.694 0.044   1.00 93.16  ? 1209 MET A CE  1 
ATOM   9363  N  N   . GLY A 1  1210 ? 100.231 115.457 -3.066  1.00 94.66  ? 1210 GLY A N   1 
ATOM   9364  C  CA  . GLY A 1  1210 ? 100.686 115.880 -4.370  1.00 93.79  ? 1210 GLY A CA  1 
ATOM   9365  C  C   . GLY A 1  1210 ? 100.789 114.656 -5.239  1.00 92.65  ? 1210 GLY A C   1 
ATOM   9366  O  O   . GLY A 1  1210 ? 99.970  114.445 -6.126  1.00 90.62  ? 1210 GLY A O   1 
ATOM   9367  N  N   . GLN A 1  1211 ? 101.785 113.829 -4.956  1.00 93.34  ? 1211 GLN A N   1 
ATOM   9368  C  CA  . GLN A 1  1211 ? 101.993 112.617 -5.719  1.00 93.66  ? 1211 GLN A CA  1 
ATOM   9369  C  C   . GLN A 1  1211 ? 100.663 111.977 -6.102  1.00 91.58  ? 1211 GLN A C   1 
ATOM   9370  O  O   . GLN A 1  1211 ? 100.320 111.904 -7.278  1.00 90.68  ? 1211 GLN A O   1 
ATOM   9371  C  CB  . GLN A 1  1211 ? 102.810 111.615 -4.908  1.00 98.43  ? 1211 GLN A CB  1 
ATOM   9372  C  CG  . GLN A 1  1211 ? 104.170 112.093 -4.439  1.00 102.89 ? 1211 GLN A CG  1 
ATOM   9373  C  CD  . GLN A 1  1211 ? 104.927 110.994 -3.705  1.00 107.18 ? 1211 GLN A CD  1 
ATOM   9374  O  OE1 . GLN A 1  1211 ? 104.493 110.517 -2.650  1.00 109.64 ? 1211 GLN A OE1 1 
ATOM   9375  N  NE2 . GLN A 1  1211 ? 106.059 110.577 -4.269  1.00 108.01 ? 1211 GLN A NE2 1 
ATOM   9376  N  N   . VAL A 1  1212 ? 99.912  111.531 -5.097  1.00 90.54  ? 1212 VAL A N   1 
ATOM   9377  C  CA  . VAL A 1  1212 ? 98.633  110.857 -5.320  1.00 88.96  ? 1212 VAL A CA  1 
ATOM   9378  C  C   . VAL A 1  1212 ? 97.838  111.464 -6.451  1.00 88.75  ? 1212 VAL A C   1 
ATOM   9379  O  O   . VAL A 1  1212 ? 97.838  110.962 -7.570  1.00 85.81  ? 1212 VAL A O   1 
ATOM   9380  C  CB  . VAL A 1  1212 ? 97.738  110.871 -4.059  1.00 89.26  ? 1212 VAL A CB  1 
ATOM   9381  C  CG1 . VAL A 1  1212 ? 96.388  110.261 -4.390  1.00 88.35  ? 1212 VAL A CG1 1 
ATOM   9382  C  CG2 . VAL A 1  1212 ? 98.393  110.091 -2.926  1.00 88.51  ? 1212 VAL A CG2 1 
ATOM   9383  N  N   . GLY A 1  1213 ? 97.143  112.545 -6.143  1.00 91.99  ? 1213 GLY A N   1 
ATOM   9384  C  CA  . GLY A 1  1213 ? 96.351  113.202 -7.155  1.00 97.28  ? 1213 GLY A CA  1 
ATOM   9385  C  C   . GLY A 1  1213 ? 97.182  113.372 -8.405  1.00 100.06 ? 1213 GLY A C   1 
ATOM   9386  O  O   . GLY A 1  1213 ? 96.789  112.925 -9.483  1.00 99.30  ? 1213 GLY A O   1 
ATOM   9387  N  N   . GLU A 1  1214 ? 98.341  114.010 -8.250  1.00 103.78 ? 1214 GLU A N   1 
ATOM   9388  C  CA  . GLU A 1  1214 ? 99.249  114.247 -9.368  1.00 106.38 ? 1214 GLU A CA  1 
ATOM   9389  C  C   . GLU A 1  1214 ? 99.178  113.082 -10.334 1.00 103.14 ? 1214 GLU A C   1 
ATOM   9390  O  O   . GLU A 1  1214 ? 99.206  113.268 -11.549 1.00 103.04 ? 1214 GLU A O   1 
ATOM   9391  C  CB  . GLU A 1  1214 ? 100.692 114.424 -8.868  1.00 112.80 ? 1214 GLU A CB  1 
ATOM   9392  C  CG  . GLU A 1  1214 ? 101.110 115.878 -8.603  1.00 121.41 ? 1214 GLU A CG  1 
ATOM   9393  C  CD  . GLU A 1  1214 ? 101.532 116.626 -9.872  1.00 125.26 ? 1214 GLU A CD  1 
ATOM   9394  O  OE1 . GLU A 1  1214 ? 100.743 116.669 -10.847 1.00 127.19 ? 1214 GLU A OE1 1 
ATOM   9395  O  OE2 . GLU A 1  1214 ? 102.657 117.176 -9.890  1.00 127.58 ? 1214 GLU A OE2 1 
ATOM   9396  N  N   . ARG A 1  1215 ? 99.070  111.877 -9.786  1.00 99.33  ? 1215 ARG A N   1 
ATOM   9397  C  CA  . ARG A 1  1215 ? 98.988  110.692 -10.616 1.00 94.30  ? 1215 ARG A CA  1 
ATOM   9398  C  C   . ARG A 1  1215 ? 97.608  110.628 -11.242 1.00 89.67  ? 1215 ARG A C   1 
ATOM   9399  O  O   . ARG A 1  1215 ? 97.478  110.540 -12.459 1.00 88.10  ? 1215 ARG A O   1 
ATOM   9400  C  CB  . ARG A 1  1215 ? 99.251  109.438 -9.784  1.00 96.59  ? 1215 ARG A CB  1 
ATOM   9401  C  CG  . ARG A 1  1215 ? 99.677  108.245 -10.615 1.00 100.07 ? 1215 ARG A CG  1 
ATOM   9402  C  CD  . ARG A 1  1215 ? 100.839 108.620 -11.523 1.00 104.04 ? 1215 ARG A CD  1 
ATOM   9403  N  NE  . ARG A 1  1215 ? 101.337 107.481 -12.286 1.00 108.51 ? 1215 ARG A NE  1 
ATOM   9404  C  CZ  . ARG A 1  1215 ? 101.947 106.432 -11.743 1.00 111.19 ? 1215 ARG A CZ  1 
ATOM   9405  N  NH1 . ARG A 1  1215 ? 102.135 106.377 -10.429 1.00 112.77 ? 1215 ARG A NH1 1 
ATOM   9406  N  NH2 . ARG A 1  1215 ? 102.373 105.439 -12.513 1.00 112.33 ? 1215 ARG A NH2 1 
ATOM   9407  N  N   . ILE A 1  1216 ? 96.580  110.693 -10.405 1.00 85.40  ? 1216 ILE A N   1 
ATOM   9408  C  CA  . ILE A 1  1216 ? 95.210  110.641 -10.886 1.00 82.54  ? 1216 ILE A CA  1 
ATOM   9409  C  C   . ILE A 1  1216 ? 95.042  111.590 -12.048 1.00 84.99  ? 1216 ILE A C   1 
ATOM   9410  O  O   . ILE A 1  1216 ? 94.392  111.267 -13.040 1.00 82.96  ? 1216 ILE A O   1 
ATOM   9411  C  CB  . ILE A 1  1216 ? 94.218  111.087 -9.824  1.00 78.63  ? 1216 ILE A CB  1 
ATOM   9412  C  CG1 . ILE A 1  1216 ? 94.608  110.513 -8.468  1.00 77.38  ? 1216 ILE A CG1 1 
ATOM   9413  C  CG2 . ILE A 1  1216 ? 92.829  110.647 -10.222 1.00 74.81  ? 1216 ILE A CG2 1 
ATOM   9414  C  CD1 . ILE A 1  1216 ? 93.780  111.040 -7.333  1.00 76.90  ? 1216 ILE A CD1 1 
ATOM   9415  N  N   . LYS A 1  1217 ? 95.635  112.771 -11.912 1.00 89.98  ? 1217 LYS A N   1 
ATOM   9416  C  CA  . LYS A 1  1217 ? 95.529  113.792 -12.942 1.00 95.96  ? 1217 LYS A CA  1 
ATOM   9417  C  C   . LYS A 1  1217 ? 96.168  113.338 -14.252 1.00 98.93  ? 1217 LYS A C   1 
ATOM   9418  O  O   . LYS A 1  1217 ? 95.522  113.391 -15.297 1.00 98.41  ? 1217 LYS A O   1 
ATOM   9419  C  CB  . LYS A 1  1217 ? 96.143  115.120 -12.447 1.00 97.47  ? 1217 LYS A CB  1 
ATOM   9420  C  CG  . LYS A 1  1217 ? 95.621  116.369 -13.186 1.00 99.92  ? 1217 LYS A CG  1 
ATOM   9421  C  CD  . LYS A 1  1217 ? 95.764  117.662 -12.358 1.00 102.58 ? 1217 LYS A CD  1 
ATOM   9422  C  CE  . LYS A 1  1217 ? 95.048  118.850 -13.033 1.00 104.45 ? 1217 LYS A CE  1 
ATOM   9423  N  NZ  . LYS A 1  1217 ? 94.982  120.105 -12.206 1.00 103.38 ? 1217 LYS A NZ  1 
ATOM   9424  N  N   . GLN A 1  1218 ? 97.418  112.875 -14.203 1.00 104.01 ? 1218 GLN A N   1 
ATOM   9425  C  CA  . GLN A 1  1218 ? 98.102  112.416 -15.417 1.00 107.26 ? 1218 GLN A CA  1 
ATOM   9426  C  C   . GLN A 1  1218 ? 97.601  111.038 -15.830 1.00 105.79 ? 1218 GLN A C   1 
ATOM   9427  O  O   . GLN A 1  1218 ? 98.171  110.385 -16.708 1.00 103.20 ? 1218 GLN A O   1 
ATOM   9428  C  CB  . GLN A 1  1218 ? 99.632  112.396 -15.224 1.00 111.79 ? 1218 GLN A CB  1 
ATOM   9429  C  CG  . GLN A 1  1218 ? 100.149 111.547 -14.064 1.00 117.48 ? 1218 GLN A CG  1 
ATOM   9430  C  CD  . GLN A 1  1218 ? 101.657 111.680 -13.870 1.00 119.44 ? 1218 GLN A CD  1 
ATOM   9431  O  OE1 . GLN A 1  1218 ? 102.438 111.395 -14.780 1.00 120.57 ? 1218 GLN A OE1 1 
ATOM   9432  N  NE2 . GLN A 1  1218 ? 102.070 112.114 -12.680 1.00 120.73 ? 1218 GLN A NE2 1 
ATOM   9433  N  N   . THR A 1  1219 ? 96.515  110.619 -15.185 1.00 106.17 ? 1219 THR A N   1 
ATOM   9434  C  CA  . THR A 1  1219 ? 95.879  109.335 -15.455 1.00 107.39 ? 1219 THR A CA  1 
ATOM   9435  C  C   . THR A 1  1219 ? 94.807  109.522 -16.521 1.00 107.48 ? 1219 THR A C   1 
ATOM   9436  O  O   . THR A 1  1219 ? 94.700  108.722 -17.452 1.00 106.55 ? 1219 THR A O   1 
ATOM   9437  C  CB  . THR A 1  1219 ? 95.197  108.771 -14.205 1.00 107.71 ? 1219 THR A CB  1 
ATOM   9438  O  OG1 . THR A 1  1219 ? 96.131  108.730 -13.122 1.00 110.16 ? 1219 THR A OG1 1 
ATOM   9439  C  CG2 . THR A 1  1219 ? 94.686  107.372 -14.477 1.00 106.94 ? 1219 THR A CG2 1 
ATOM   9440  N  N   . PHE A 1  1220 ? 94.003  110.574 -16.361 1.00 108.36 ? 1220 PHE A N   1 
ATOM   9441  C  CA  . PHE A 1  1220 ? 92.943  110.901 -17.315 1.00 108.36 ? 1220 PHE A CA  1 
ATOM   9442  C  C   . PHE A 1  1220 ? 93.390  112.096 -18.160 1.00 111.56 ? 1220 PHE A C   1 
ATOM   9443  O  O   . PHE A 1  1220 ? 92.945  112.269 -19.296 1.00 110.61 ? 1220 PHE A O   1 
ATOM   9444  C  CB  . PHE A 1  1220 ? 91.643  111.266 -16.596 1.00 103.09 ? 1220 PHE A CB  1 
ATOM   9445  C  CG  . PHE A 1  1220 ? 91.108  110.188 -15.695 1.00 98.67  ? 1220 PHE A CG  1 
ATOM   9446  C  CD1 . PHE A 1  1220 ? 91.597  110.033 -14.400 1.00 97.79  ? 1220 PHE A CD1 1 
ATOM   9447  C  CD2 . PHE A 1  1220 ? 90.085  109.349 -16.129 1.00 95.44  ? 1220 PHE A CD2 1 
ATOM   9448  C  CE1 . PHE A 1  1220 ? 91.067  109.064 -13.547 1.00 94.62  ? 1220 PHE A CE1 1 
ATOM   9449  C  CE2 . PHE A 1  1220 ? 89.550  108.378 -15.286 1.00 92.28  ? 1220 PHE A CE2 1 
ATOM   9450  C  CZ  . PHE A 1  1220 ? 90.042  108.235 -13.992 1.00 92.20  ? 1220 PHE A CZ  1 
ATOM   9451  N  N   . LYS A 1  1221 ? 94.264  112.917 -17.578 1.00 115.97 ? 1221 LYS A N   1 
ATOM   9452  C  CA  . LYS A 1  1221 ? 94.826  114.106 -18.227 1.00 119.72 ? 1221 LYS A CA  1 
ATOM   9453  C  C   . LYS A 1  1221 ? 93.864  115.304 -18.340 1.00 120.94 ? 1221 LYS A C   1 
ATOM   9454  O  O   . LYS A 1  1221 ? 93.135  115.625 -17.392 1.00 119.81 ? 1221 LYS A O   1 
ATOM   9455  C  CB  . LYS A 1  1221 ? 95.381  113.739 -19.620 1.00 120.38 ? 1221 LYS A CB  1 
ATOM   9456  C  CG  . LYS A 1  1221 ? 96.614  112.817 -19.617 1.00 120.58 ? 1221 LYS A CG  1 
ATOM   9457  C  CD  . LYS A 1  1221 ? 97.129  112.570 -21.041 1.00 120.98 ? 1221 LYS A CD  1 
ATOM   9458  C  CE  . LYS A 1  1221 ? 98.413  111.738 -21.064 1.00 122.19 ? 1221 LYS A CE  1 
ATOM   9459  N  NZ  . LYS A 1  1221 ? 98.943  111.528 -22.450 1.00 121.08 ? 1221 LYS A NZ  1 
ATOM   9460  N  N   . ASN A 1  1222 ? 93.890  115.969 -19.498 1.00 122.67 ? 1222 ASN A N   1 
ATOM   9461  C  CA  . ASN A 1  1222 ? 93.043  117.135 -19.765 1.00 122.08 ? 1222 ASN A CA  1 
ATOM   9462  C  C   . ASN A 1  1222 ? 91.605  116.740 -20.111 1.00 120.23 ? 1222 ASN A C   1 
ATOM   9463  O  O   . ASN A 1  1222 ? 91.238  116.687 -21.290 1.00 119.59 ? 1222 ASN A O   1 
ATOM   9464  C  CB  . ASN A 1  1222 ? 93.616  117.985 -20.923 1.00 123.72 ? 1222 ASN A CB  1 
ATOM   9465  C  CG  . ASN A 1  1222 ? 94.818  118.839 -20.511 1.00 124.98 ? 1222 ASN A CG  1 
ATOM   9466  O  OD1 . ASN A 1  1222 ? 95.887  118.320 -20.190 1.00 126.50 ? 1222 ASN A OD1 1 
ATOM   9467  N  ND2 . ASN A 1  1222 ? 94.641  120.159 -20.528 1.00 124.30 ? 1222 ASN A ND2 1 
ATOM   9468  N  N   . ASP A 1  1223 ? 90.812  116.451 -19.077 1.00 117.86 ? 1223 ASP A N   1 
ATOM   9469  C  CA  . ASP A 1  1223 ? 89.393  116.098 -19.218 1.00 114.67 ? 1223 ASP A CA  1 
ATOM   9470  C  C   . ASP A 1  1223 ? 88.776  115.529 -17.930 1.00 110.53 ? 1223 ASP A C   1 
ATOM   9471  O  O   . ASP A 1  1223 ? 88.035  114.546 -17.947 1.00 106.69 ? 1223 ASP A O   1 
ATOM   9472  C  CB  . ASP A 1  1223 ? 89.169  115.134 -20.395 1.00 117.12 ? 1223 ASP A CB  1 
ATOM   9473  C  CG  . ASP A 1  1223 ? 89.717  113.755 -20.141 1.00 119.01 ? 1223 ASP A CG  1 
ATOM   9474  O  OD1 . ASP A 1  1223 ? 90.950  113.617 -19.976 1.00 119.88 ? 1223 ASP A OD1 1 
ATOM   9475  O  OD2 . ASP A 1  1223 ? 88.903  112.807 -20.112 1.00 119.28 ? 1223 ASP A OD2 1 
ATOM   9476  N  N   . LEU A 1  1224 ? 89.083  116.196 -16.822 1.00 107.06 ? 1224 LEU A N   1 
ATOM   9477  C  CA  . LEU A 1  1224 ? 88.598  115.853 -15.489 1.00 103.84 ? 1224 LEU A CA  1 
ATOM   9478  C  C   . LEU A 1  1224 ? 89.356  116.732 -14.492 1.00 102.64 ? 1224 LEU A C   1 
ATOM   9479  O  O   . LEU A 1  1224 ? 90.544  116.531 -14.248 1.00 102.31 ? 1224 LEU A O   1 
ATOM   9480  C  CB  . LEU A 1  1224 ? 88.848  114.378 -15.179 1.00 104.14 ? 1224 LEU A CB  1 
ATOM   9481  C  CG  . LEU A 1  1224 ? 88.598  113.977 -13.719 1.00 104.77 ? 1224 LEU A CG  1 
ATOM   9482  C  CD1 . LEU A 1  1224 ? 87.150  114.205 -13.374 1.00 105.25 ? 1224 LEU A CD1 1 
ATOM   9483  C  CD2 . LEU A 1  1224 ? 88.962  112.523 -13.499 1.00 105.29 ? 1224 LEU A CD2 1 
ATOM   9484  N  N   . PHE A 1  1225 ? 88.664  117.712 -13.922 1.00 100.80 ? 1225 PHE A N   1 
ATOM   9485  C  CA  . PHE A 1  1225 ? 89.282  118.639 -12.982 1.00 100.05 ? 1225 PHE A CA  1 
ATOM   9486  C  C   . PHE A 1  1225 ? 89.466  118.019 -11.599 1.00 95.30  ? 1225 PHE A C   1 
ATOM   9487  O  O   . PHE A 1  1225 ? 88.537  117.435 -11.050 1.00 92.04  ? 1225 PHE A O   1 
ATOM   9488  C  CB  . PHE A 1  1225 ? 88.432  119.916 -12.892 1.00 107.04 ? 1225 PHE A CB  1 
ATOM   9489  C  CG  . PHE A 1  1225 ? 89.116  121.065 -12.189 1.00 113.94 ? 1225 PHE A CG  1 
ATOM   9490  C  CD1 . PHE A 1  1225 ? 90.293  121.617 -12.701 1.00 116.90 ? 1225 PHE A CD1 1 
ATOM   9491  C  CD2 . PHE A 1  1225 ? 88.587  121.591 -11.009 1.00 115.82 ? 1225 PHE A CD2 1 
ATOM   9492  C  CE1 . PHE A 1  1225 ? 90.935  122.678 -12.046 1.00 119.04 ? 1225 PHE A CE1 1 
ATOM   9493  C  CE2 . PHE A 1  1225 ? 89.218  122.649 -10.347 1.00 117.87 ? 1225 PHE A CE2 1 
ATOM   9494  C  CZ  . PHE A 1  1225 ? 90.395  123.194 -10.866 1.00 119.08 ? 1225 PHE A CZ  1 
ATOM   9495  N  N   . VAL A 1  1226 ? 90.670  118.167 -11.046 1.00 92.28  ? 1226 VAL A N   1 
ATOM   9496  C  CA  . VAL A 1  1226 ? 91.008  117.619 -9.734  1.00 90.18  ? 1226 VAL A CA  1 
ATOM   9497  C  C   . VAL A 1  1226 ? 91.654  118.634 -8.780  1.00 89.84  ? 1226 VAL A C   1 
ATOM   9498  O  O   . VAL A 1  1226 ? 92.299  119.587 -9.212  1.00 89.77  ? 1226 VAL A O   1 
ATOM   9499  C  CB  . VAL A 1  1226 ? 91.947  116.427 -9.893  1.00 88.84  ? 1226 VAL A CB  1 
ATOM   9500  C  CG1 . VAL A 1  1226 ? 92.030  115.657 -8.593  1.00 90.41  ? 1226 VAL A CG1 1 
ATOM   9501  C  CG2 . VAL A 1  1226 ? 91.450  115.541 -11.013 1.00 87.74  ? 1226 VAL A CG2 1 
ATOM   9502  N  N   . ILE A 1  1227 ? 91.493  118.401 -7.479  1.00 88.56  ? 1227 ILE A N   1 
ATOM   9503  C  CA  . ILE A 1  1227 ? 92.007  119.291 -6.436  1.00 87.94  ? 1227 ILE A CA  1 
ATOM   9504  C  C   . ILE A 1  1227 ? 92.405  118.440 -5.226  1.00 85.95  ? 1227 ILE A C   1 
ATOM   9505  O  O   . ILE A 1  1227 ? 92.219  117.235 -5.262  1.00 85.93  ? 1227 ILE A O   1 
ATOM   9506  C  CB  . ILE A 1  1227 ? 90.891  120.266 -6.018  1.00 89.96  ? 1227 ILE A CB  1 
ATOM   9507  C  CG1 . ILE A 1  1227 ? 90.395  121.041 -7.239  1.00 90.62  ? 1227 ILE A CG1 1 
ATOM   9508  C  CG2 . ILE A 1  1227 ? 91.380  121.208 -4.948  1.00 92.51  ? 1227 ILE A CG2 1 
ATOM   9509  C  CD1 . ILE A 1  1227 ? 89.060  121.726 -7.021  1.00 92.56  ? 1227 ILE A CD1 1 
ATOM   9510  N  N   . TRP A 1  1228 ? 92.933  119.041 -4.158  1.00 85.46  ? 1228 TRP A N   1 
ATOM   9511  C  CA  . TRP A 1  1228 ? 93.306  118.250 -2.985  1.00 86.05  ? 1228 TRP A CA  1 
ATOM   9512  C  C   . TRP A 1  1228 ? 93.889  118.991 -1.793  1.00 87.41  ? 1228 TRP A C   1 
ATOM   9513  O  O   . TRP A 1  1228 ? 94.729  119.861 -1.950  1.00 87.23  ? 1228 TRP A O   1 
ATOM   9514  C  CB  . TRP A 1  1228 ? 94.283  117.170 -3.405  1.00 87.05  ? 1228 TRP A CB  1 
ATOM   9515  C  CG  . TRP A 1  1228 ? 95.537  117.691 -4.014  1.00 85.74  ? 1228 TRP A CG  1 
ATOM   9516  C  CD1 . TRP A 1  1228 ? 96.634  118.154 -3.354  1.00 87.37  ? 1228 TRP A CD1 1 
ATOM   9517  C  CD2 . TRP A 1  1228 ? 95.855  117.742 -5.410  1.00 83.57  ? 1228 TRP A CD2 1 
ATOM   9518  N  NE1 . TRP A 1  1228 ? 97.621  118.483 -4.251  1.00 87.40  ? 1228 TRP A NE1 1 
ATOM   9519  C  CE2 . TRP A 1  1228 ? 97.168  118.239 -5.521  1.00 84.48  ? 1228 TRP A CE2 1 
ATOM   9520  C  CE3 . TRP A 1  1228 ? 95.158  117.413 -6.578  1.00 81.08  ? 1228 TRP A CE3 1 
ATOM   9521  C  CZ2 . TRP A 1  1228 ? 97.801  118.414 -6.754  1.00 83.32  ? 1228 TRP A CZ2 1 
ATOM   9522  C  CZ3 . TRP A 1  1228 ? 95.788  117.587 -7.805  1.00 79.96  ? 1228 TRP A CZ3 1 
ATOM   9523  C  CH2 . TRP A 1  1228 ? 97.096  118.083 -7.882  1.00 81.06  ? 1228 TRP A CH2 1 
ATOM   9524  N  N   . SER A 1  1229 ? 93.466  118.615 -0.594  1.00 89.95  ? 1229 SER A N   1 
ATOM   9525  C  CA  . SER A 1  1229 ? 93.958  119.260 0.616   1.00 95.16  ? 1229 SER A CA  1 
ATOM   9526  C  C   . SER A 1  1229 ? 95.474  119.172 0.738   1.00 99.40  ? 1229 SER A C   1 
ATOM   9527  O  O   . SER A 1  1229 ? 96.154  118.693 -0.167  1.00 97.77  ? 1229 SER A O   1 
ATOM   9528  C  CB  . SER A 1  1229 ? 93.313  118.632 1.847   1.00 94.79  ? 1229 SER A CB  1 
ATOM   9529  O  OG  . SER A 1  1229 ? 93.594  117.249 1.905   1.00 96.30  ? 1229 SER A OG  1 
ATOM   9530  N  N   . GLU A 1  1230 ? 95.997  119.648 1.865   1.00 107.74 ? 1230 GLU A N   1 
ATOM   9531  C  CA  . GLU A 1  1230 ? 97.434  119.629 2.114   1.00 115.70 ? 1230 GLU A CA  1 
ATOM   9532  C  C   . GLU A 1  1230 ? 97.807  118.716 3.261   1.00 115.90 ? 1230 GLU A C   1 
ATOM   9533  O  O   . GLU A 1  1230 ? 97.086  118.596 4.254   1.00 114.96 ? 1230 GLU A O   1 
ATOM   9534  C  CB  . GLU A 1  1230 ? 97.970  121.035 2.414   1.00 123.56 ? 1230 GLU A CB  1 
ATOM   9535  C  CG  . GLU A 1  1230 ? 98.101  121.953 1.191   1.00 134.42 ? 1230 GLU A CG  1 
ATOM   9536  C  CD  . GLU A 1  1230 ? 98.693  123.340 1.517   1.00 141.21 ? 1230 GLU A CD  1 
ATOM   9537  O  OE1 . GLU A 1  1230 ? 98.127  124.074 2.367   1.00 144.90 ? 1230 GLU A OE1 1 
ATOM   9538  O  OE2 . GLU A 1  1230 ? 99.729  123.706 0.910   1.00 145.51 ? 1230 GLU A OE2 1 
ATOM   9539  N  N   . ASP A 1  1231 ? 98.966  118.096 3.103   1.00 117.05 ? 1231 ASP A N   1 
ATOM   9540  C  CA  . ASP A 1  1231 ? 99.518  117.165 4.065   1.00 119.14 ? 1231 ASP A CA  1 
ATOM   9541  C  C   . ASP A 1  1231 ? 99.362  117.591 5.520   1.00 120.96 ? 1231 ASP A C   1 
ATOM   9542  O  O   . ASP A 1  1231 ? 99.706  116.832 6.423   1.00 121.81 ? 1231 ASP A O   1 
ATOM   9543  C  CB  . ASP A 1  1231 ? 100.993 116.939 3.737   1.00 117.77 ? 1231 ASP A CB  1 
ATOM   9544  C  CG  . ASP A 1  1231 ? 101.199 116.406 2.328   1.00 116.06 ? 1231 ASP A CG  1 
ATOM   9545  O  OD1 . ASP A 1  1231 ? 101.053 115.184 2.122   1.00 114.85 ? 1231 ASP A OD1 1 
ATOM   9546  O  OD2 . ASP A 1  1231 ? 101.494 117.211 1.420   1.00 114.41 ? 1231 ASP A OD2 1 
ATOM   9547  N  N   . ASN A 1  1232 ? 98.840  118.787 5.760   1.00 122.60 ? 1232 ASN A N   1 
ATOM   9548  C  CA  . ASN A 1  1232 ? 98.672  119.235 7.130   1.00 126.03 ? 1232 ASN A CA  1 
ATOM   9549  C  C   . ASN A 1  1232 ? 97.216  119.180 7.612   1.00 124.49 ? 1232 ASN A C   1 
ATOM   9550  O  O   . ASN A 1  1232 ? 96.956  119.170 8.815   1.00 125.42 ? 1232 ASN A O   1 
ATOM   9551  C  CB  . ASN A 1  1232 ? 99.246  120.648 7.288   1.00 132.02 ? 1232 ASN A CB  1 
ATOM   9552  C  CG  . ASN A 1  1232 ? 99.564  120.999 8.745   1.00 137.73 ? 1232 ASN A CG  1 
ATOM   9553  O  OD1 . ASN A 1  1232 ? 98.673  121.020 9.599   1.00 141.51 ? 1232 ASN A OD1 1 
ATOM   9554  N  ND2 . ASN A 1  1232 ? 100.841 121.278 9.030   1.00 138.79 ? 1232 ASN A ND2 1 
ATOM   9555  N  N   . ASP A 1  1233 ? 96.267  119.129 6.686   1.00 121.51 ? 1233 ASP A N   1 
ATOM   9556  C  CA  . ASP A 1  1233 ? 94.856  119.066 7.068   1.00 120.87 ? 1233 ASP A CA  1 
ATOM   9557  C  C   . ASP A 1  1233 ? 94.520  117.804 7.862   1.00 120.53 ? 1233 ASP A C   1 
ATOM   9558  O  O   . ASP A 1  1233 ? 94.995  116.721 7.529   1.00 120.96 ? 1233 ASP A O   1 
ATOM   9559  C  CB  . ASP A 1  1233 ? 93.981  119.127 5.822   1.00 120.19 ? 1233 ASP A CB  1 
ATOM   9560  C  CG  . ASP A 1  1233 ? 93.949  120.503 5.211   1.00 119.75 ? 1233 ASP A CG  1 
ATOM   9561  O  OD1 . ASP A 1  1233 ? 93.307  121.398 5.802   1.00 119.44 ? 1233 ASP A OD1 1 
ATOM   9562  O  OD2 . ASP A 1  1233 ? 94.574  120.693 4.147   1.00 118.14 ? 1233 ASP A OD2 1 
ATOM   9563  N  N   . GLU A 1  1234 ? 93.696  117.938 8.902   1.00 120.29 ? 1234 GLU A N   1 
ATOM   9564  C  CA  . GLU A 1  1234 ? 93.324  116.784 9.721   1.00 119.47 ? 123