data_1Y3Y
# 
_entry.id   1Y3Y 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1Y3Y         
RCSB  RCSB031085   
WWPDB D_1000031085 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1Y3U 'TRYPSIN INHIBITOR COMPLEX' unspecified 
PDB 1Y3V 'TRYPSIN INHIBITOR COMPLEX' unspecified 
PDB 1Y3W 'TRYPSIN INHIBITOR COMPLEX' unspecified 
PDB 1Y3X 'TRYPSIN INHIBITOR COMPLEX' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1Y3Y 
_pdbx_database_status.recvd_initial_deposition_date   2004-11-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fokkens, J.' 1 
'Klebe, G.'   2 
# 
_citation.id                        primary 
_citation.title                     
'A simple protocol to estimate differences in protein binding affinity for enantiomers without prior resolution of racemates.' 
_citation.journal_abbrev            Angew.Chem.Int.Ed.Engl. 
_citation.journal_volume            45 
_citation.page_first                985 
_citation.page_last                 989 
_citation.year                      2006 
_citation.journal_id_ASTM           ACIEAY 
_citation.country                   GE 
_citation.journal_id_ISSN           0570-0833 
_citation.journal_id_CSD            0179 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16374786 
_citation.pdbx_database_id_DOI      10.1002/anie.200502302 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Fokkens, J.' 1 
primary 'Klebe, G.'   2 
# 
_cell.entry_id           1Y3Y 
_cell.length_a           54.852 
_cell.length_b           54.852 
_cell.length_c           109.166 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1Y3Y 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'Trypsin, cationic' 23324.287 1   3.4.21.4 ? ? ? 
2 non-polymer syn 'CALCIUM ION' 40.078    1   ?        ? ? ? 
3 non-polymer syn 
'(1R,3AS,4R,8AS,8BR)-4-(2-BENZO[1,3]DIOXOL-5-YL-1-CYCLOPROPYL-3-OXO-DECAHYDRO-PYRROLO[3,4-A]PYRROLIZIN-4-YL)-BENZAMIDINE' 458.552 
1   ?        ? ? ? 
4 water       nat water 18.015    112 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Beta-trypsin, Fragment' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT
LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM
FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT
LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM
FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ILE n 
1 2   VAL n 
1 3   GLY n 
1 4   GLY n 
1 5   TYR n 
1 6   THR n 
1 7   CYS n 
1 8   GLY n 
1 9   ALA n 
1 10  ASN n 
1 11  THR n 
1 12  VAL n 
1 13  PRO n 
1 14  TYR n 
1 15  GLN n 
1 16  VAL n 
1 17  SER n 
1 18  LEU n 
1 19  ASN n 
1 20  SER n 
1 21  GLY n 
1 22  TYR n 
1 23  HIS n 
1 24  PHE n 
1 25  CYS n 
1 26  GLY n 
1 27  GLY n 
1 28  SER n 
1 29  LEU n 
1 30  ILE n 
1 31  ASN n 
1 32  SER n 
1 33  GLN n 
1 34  TRP n 
1 35  VAL n 
1 36  VAL n 
1 37  SER n 
1 38  ALA n 
1 39  ALA n 
1 40  HIS n 
1 41  CYS n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  GLY n 
1 46  ILE n 
1 47  GLN n 
1 48  VAL n 
1 49  ARG n 
1 50  LEU n 
1 51  GLY n 
1 52  GLU n 
1 53  ASP n 
1 54  ASN n 
1 55  ILE n 
1 56  ASN n 
1 57  VAL n 
1 58  VAL n 
1 59  GLU n 
1 60  GLY n 
1 61  ASN n 
1 62  GLU n 
1 63  GLN n 
1 64  PHE n 
1 65  ILE n 
1 66  SER n 
1 67  ALA n 
1 68  SER n 
1 69  LYS n 
1 70  SER n 
1 71  ILE n 
1 72  VAL n 
1 73  HIS n 
1 74  PRO n 
1 75  SER n 
1 76  TYR n 
1 77  ASN n 
1 78  SER n 
1 79  ASN n 
1 80  THR n 
1 81  LEU n 
1 82  ASN n 
1 83  ASN n 
1 84  ASP n 
1 85  ILE n 
1 86  MET n 
1 87  LEU n 
1 88  ILE n 
1 89  LYS n 
1 90  LEU n 
1 91  LYS n 
1 92  SER n 
1 93  ALA n 
1 94  ALA n 
1 95  SER n 
1 96  LEU n 
1 97  ASN n 
1 98  SER n 
1 99  ARG n 
1 100 VAL n 
1 101 ALA n 
1 102 SER n 
1 103 ILE n 
1 104 SER n 
1 105 LEU n 
1 106 PRO n 
1 107 THR n 
1 108 SER n 
1 109 CYS n 
1 110 ALA n 
1 111 SER n 
1 112 ALA n 
1 113 GLY n 
1 114 THR n 
1 115 GLN n 
1 116 CYS n 
1 117 LEU n 
1 118 ILE n 
1 119 SER n 
1 120 GLY n 
1 121 TRP n 
1 122 GLY n 
1 123 ASN n 
1 124 THR n 
1 125 LYS n 
1 126 SER n 
1 127 SER n 
1 128 GLY n 
1 129 THR n 
1 130 SER n 
1 131 TYR n 
1 132 PRO n 
1 133 ASP n 
1 134 VAL n 
1 135 LEU n 
1 136 LYS n 
1 137 CYS n 
1 138 LEU n 
1 139 LYS n 
1 140 ALA n 
1 141 PRO n 
1 142 ILE n 
1 143 LEU n 
1 144 SER n 
1 145 ASP n 
1 146 SER n 
1 147 SER n 
1 148 CYS n 
1 149 LYS n 
1 150 SER n 
1 151 ALA n 
1 152 TYR n 
1 153 PRO n 
1 154 GLY n 
1 155 GLN n 
1 156 ILE n 
1 157 THR n 
1 158 SER n 
1 159 ASN n 
1 160 MET n 
1 161 PHE n 
1 162 CYS n 
1 163 ALA n 
1 164 GLY n 
1 165 TYR n 
1 166 LEU n 
1 167 GLU n 
1 168 GLY n 
1 169 GLY n 
1 170 LYS n 
1 171 ASP n 
1 172 SER n 
1 173 CYS n 
1 174 GLN n 
1 175 GLY n 
1 176 ASP n 
1 177 SER n 
1 178 GLY n 
1 179 GLY n 
1 180 PRO n 
1 181 VAL n 
1 182 VAL n 
1 183 CYS n 
1 184 SER n 
1 185 GLY n 
1 186 LYS n 
1 187 LEU n 
1 188 GLN n 
1 189 GLY n 
1 190 ILE n 
1 191 VAL n 
1 192 SER n 
1 193 TRP n 
1 194 GLY n 
1 195 SER n 
1 196 GLY n 
1 197 CYS n 
1 198 ALA n 
1 199 GLN n 
1 200 LYS n 
1 201 ASN n 
1 202 LYS n 
1 203 PRO n 
1 204 GLY n 
1 205 VAL n 
1 206 TYR n 
1 207 THR n 
1 208 LYS n 
1 209 VAL n 
1 210 CYS n 
1 211 ASN n 
1 212 TYR n 
1 213 VAL n 
1 214 SER n 
1 215 TRP n 
1 216 ILE n 
1 217 LYS n 
1 218 GLN n 
1 219 THR n 
1 220 ILE n 
1 221 ALA n 
1 222 SER n 
1 223 ASN n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                cattle 
_entity_src_nat.pdbx_organism_scientific   'Bos taurus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9913 
_entity_src_nat.genus                      Bos 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     BLOOD 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TRY1_BOVIN 
_struct_ref.pdbx_db_accession          P00760 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT
LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM
FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
;
_struct_ref.pdbx_align_begin           21 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1Y3Y 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 216 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00760 
_struct_ref_seq.db_align_beg                  21 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  243 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       16 
_struct_ref_seq.pdbx_auth_seq_align_end       238 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION' ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'    181.189 
UIR non-polymer         . 
'(1R,3AS,4R,8AS,8BR)-4-(2-BENZO[1,3]DIOXOL-5-YL-1-CYCLOPROPYL-3-OXO-DECAHYDRO-PYRROLO[3,4-A]PYRROLIZIN-4-YL)-BENZAMIDINE' ? 
'C27 H30 N4 O3'  458.552 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1Y3Y 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.02 
_exptl_crystal.density_percent_sol   39.15 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'ammonium sulfate, Imidazol, Calcium chloride, benzamidin hydrochloride, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2002-11-22 
_diffrn_detector.details                'OSMICS MIRRORS' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    none 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1Y3Y 
_reflns.observed_criterion_sigma_F   0.000 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.d_resolution_high            1.75 
_reflns.d_resolution_low             25.0 
_reflns.number_all                   18963 
_reflns.number_obs                   18963 
_reflns.percent_possible_obs         97.1 
_reflns.pdbx_Rmerge_I_obs            0.1 
_reflns.pdbx_Rsym_value              0.1 
_reflns.pdbx_netI_over_sigmaI        7.665 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.75 
_reflns_shell.d_res_low              1.79 
_reflns_shell.percent_possible_all   94.0 
_reflns_shell.Rmerge_I_obs           0.45 
_reflns_shell.pdbx_Rsym_value        0.45 
_reflns_shell.meanI_over_sigI_obs    1.93 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      18963 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1Y3Y 
_refine.ls_number_reflns_obs                     17118 
_refine.ls_number_reflns_all                     18963 
_refine.pdbx_ls_sigma_I                          0.000 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10.00 
_refine.ls_d_res_high                            1.75 
_refine.ls_percent_reflns_obs                    95.9 
_refine.ls_R_factor_obs                          0.1626 
_refine.ls_R_factor_all                          0.1667 
_refine.ls_R_factor_R_work                       0.1626 
_refine.ls_R_factor_R_free                       0.199 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  1845 
_refine.ls_number_parameters                     7235 
_refine.ls_number_restraints                     7066 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R' 
_refine.details                                  
'ANISOTROPIC SCALING APPLIED BY THE METHOD OF PARKIN, MOEZZI & HOPE, J.APPL.CRYST.28(1995)53-56' 
_refine.pdbx_starting_model                      'PDB ENTRY 1K1N' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH AND HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1Y3Y 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      14 
_refine_analyze.occupancy_sum_hydrogen          1588.62 
_refine_analyze.occupancy_sum_non_hydrogen      1758.54 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1670 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         23 
_refine_hist.number_atoms_solvent             112 
_refine_hist.number_atoms_total               1805 
_refine_hist.d_res_high                       1.75 
_refine_hist.d_res_low                        10.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.007  ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              0.026  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         0.000  ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    0.0285 ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      0.043  ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  0.049  ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  0.019  ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt 0.000  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    0.072  ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      0.000  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1Y3Y 
_pdbx_refine.R_factor_all_no_cutoff                      0.1667 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    0.1475 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               13944 
_pdbx_refine.number_reflns_obs_no_cutoff                 ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1Y3Y 
_struct.title                     'TRYPSIN INHIBITOR COMPLEX' 
_struct.pdbx_descriptor           'Trypsin, cationic (E.C.3.4.21.4)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1Y3Y 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'Trypsin, Inhibitor Complex, BARREL, 6 STRANDED BETA-SHEET, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 38  ? TYR A 42  ? ALA A 55  TYR A 59  5 ? 5  
HELX_P HELX_P2 2 SER A 144 ? TYR A 152 ? SER A 164 TYR A 172 1 ? 9  
HELX_P HELX_P3 3 TYR A 212 ? SER A 222 ? TYR A 234 SER A 244 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 7   SG ? ? ? 1_555 A CYS 137 SG  ? ? A CYS 22   A CYS 157  1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf2 disulf ? ? A CYS 25  SG ? ? ? 1_555 A CYS 41  SG  ? ? A CYS 42   A CYS 58   1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf3 disulf ? ? A CYS 109 SG ? ? ? 1_555 A CYS 210 SG  ? ? A CYS 128  A CYS 232  1_555 ? ? ? ? ? ? ? 2.048 ? 
disulf4 disulf ? ? A CYS 116 SG ? ? ? 1_555 A CYS 183 SG  ? ? A CYS 136  A CYS 201  1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf5 disulf ? ? A CYS 148 SG ? ? ? 1_555 A CYS 162 SG  ? ? A CYS 168  A CYS 182  1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf6 disulf ? ? A CYS 173 SG ? ? ? 1_555 A CYS 197 SG  ? ? A CYS 191  A CYS 220  1_555 ? ? ? ? ? ? ? 2.017 ? 
metalc1 metalc ? ? B CA  .   CA ? ? ? 1_555 D HOH .   O   ? ? A CA  3333 A HOH 9020 1_555 ? ? ? ? ? ? ? 2.494 ? 
metalc2 metalc ? ? B CA  .   CA ? ? ? 1_555 A GLU 52  OE1 ? ? A CA  3333 A GLU 70   1_555 ? ? ? ? ? ? ? 2.296 ? 
metalc3 metalc ? ? B CA  .   CA ? ? ? 1_555 A GLU 62  OE2 ? ? A CA  3333 A GLU 80   1_555 ? ? ? ? ? ? ? 2.222 ? 
metalc4 metalc ? ? B CA  .   CA ? ? ? 1_555 D HOH .   O   ? ? A CA  3333 A HOH 9017 1_555 ? ? ? ? ? ? ? 2.474 ? 
metalc5 metalc ? ? B CA  .   CA ? ? ? 1_555 A ASN 54  O   ? ? A CA  3333 A ASN 72   1_555 ? ? ? ? ? ? ? 2.371 ? 
metalc6 metalc ? ? B CA  .   CA ? ? ? 1_555 A VAL 57  O   ? ? A CA  3333 A VAL 75   1_555 ? ? ? ? ? ? ? 2.237 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 5   ? THR A 6   ? TYR A 20  THR A 21  
A 2 LYS A 136 ? PRO A 141 ? LYS A 156 PRO A 161 
A 3 GLN A 115 ? GLY A 120 ? GLN A 135 GLY A 140 
A 4 PRO A 180 ? CYS A 183 ? PRO A 198 CYS A 201 
A 5 LYS A 186 ? TRP A 193 ? LYS A 204 TRP A 215 
A 6 GLY A 204 ? LYS A 208 ? GLY A 226 LYS A 230 
A 7 MET A 160 ? ALA A 163 ? MET A 180 ALA A 183 
B 1 GLN A 15  ? ASN A 19  ? GLN A 30  ASN A 34  
B 2 HIS A 23  ? ASN A 31  ? HIS A 40  ASN A 48  
B 3 TRP A 34  ? SER A 37  ? TRP A 51  SER A 54  
B 4 MET A 86  ? LEU A 90  ? MET A 104 LEU A 108 
B 5 GLN A 63  ? VAL A 72  ? GLN A 81  VAL A 90  
B 6 GLN A 47  ? LEU A 50  ? GLN A 64  LEU A 67  
B 7 GLN A 15  ? ASN A 19  ? GLN A 30  ASN A 34  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 5   ? N TYR A 20  O CYS A 137 ? O CYS A 157 
A 2 3 O ALA A 140 ? O ALA A 160 N CYS A 116 ? N CYS A 136 
A 3 4 N LEU A 117 ? N LEU A 137 O VAL A 182 ? O VAL A 200 
A 4 5 N CYS A 183 ? N CYS A 201 O LYS A 186 ? O LYS A 204 
A 5 6 N TRP A 193 ? N TRP A 215 O VAL A 205 ? O VAL A 227 
A 6 7 O TYR A 206 ? O TYR A 228 N PHE A 161 ? N PHE A 181 
B 1 2 N LEU A 18  ? N LEU A 33  O CYS A 25  ? O CYS A 42  
B 2 3 N SER A 28  ? N SER A 45  O VAL A 36  ? O VAL A 53  
B 3 4 N VAL A 35  ? N VAL A 52  O ILE A 88  ? O ILE A 106 
B 4 5 O LYS A 89  ? O LYS A 107 N SER A 68  ? N SER A 86  
B 5 6 O ILE A 65  ? O ILE A 83  N VAL A 48  ? N VAL A 65  
B 6 7 O GLN A 47  ? O GLN A 64  N ASN A 19  ? N ASN A 34  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 3333'  
AC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE UIR A 2222' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  GLU A 52  ? GLU A 70   . ? 1_555 ? 
2  AC1 6  ASN A 54  ? ASN A 72   . ? 1_555 ? 
3  AC1 6  VAL A 57  ? VAL A 75   . ? 1_555 ? 
4  AC1 6  GLU A 62  ? GLU A 80   . ? 1_555 ? 
5  AC1 6  HOH D .   ? HOH A 9017 . ? 1_555 ? 
6  AC1 6  HOH D .   ? HOH A 9020 . ? 1_555 ? 
7  AC2 12 HIS A 40  ? HIS A 57   . ? 1_555 ? 
8  AC2 12 ASP A 171 ? ASP A 189  . ? 1_555 ? 
9  AC2 12 SER A 172 ? SER A 190  . ? 1_555 ? 
10 AC2 12 GLN A 174 ? GLN A 192  . ? 1_555 ? 
11 AC2 12 SER A 177 ? SER A 195  . ? 1_555 ? 
12 AC2 12 SER A 192 ? SER A 214  . ? 1_555 ? 
13 AC2 12 TRP A 193 ? TRP A 215  . ? 1_555 ? 
14 AC2 12 GLY A 194 ? GLY A 216  . ? 1_555 ? 
15 AC2 12 GLY A 196 ? GLY A 219  . ? 1_555 ? 
16 AC2 12 GLY A 204 ? GLY A 226  . ? 1_555 ? 
17 AC2 12 HOH D .   ? HOH A 9030 . ? 1_555 ? 
18 AC2 12 HOH D .   ? HOH A 9095 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1Y3Y 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    1Y3Y 
_atom_sites.fract_transf_matrix[1][1]   0.018231 
_atom_sites.fract_transf_matrix[1][2]   0.010526 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021051 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009160 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ILE A 1 1   ? 51.846 15.488 48.117 1.00 12.83  ? 16   ILE A N   1 
ATOM   2    C  CA  . ILE A 1 1   ? 51.797 14.360 49.053 1.00 10.52  ? 16   ILE A CA  1 
ATOM   3    C  C   . ILE A 1 1   ? 53.070 14.336 49.892 1.00 17.32  ? 16   ILE A C   1 
ATOM   4    O  O   . ILE A 1 1   ? 54.162 14.302 49.324 1.00 14.85  ? 16   ILE A O   1 
ATOM   5    C  CB  . ILE A 1 1   ? 51.648 13.043 48.280 1.00 11.89  ? 16   ILE A CB  1 
ATOM   6    C  CG1 . ILE A 1 1   ? 50.338 12.918 47.476 1.00 16.53  ? 16   ILE A CG1 1 
ATOM   7    C  CG2 . ILE A 1 1   ? 51.820 11.824 49.175 1.00 16.11  ? 16   ILE A CG2 1 
ATOM   8    C  CD1 . ILE A 1 1   ? 49.096 12.752 48.309 1.00 13.97  ? 16   ILE A CD1 1 
ATOM   9    N  N   . VAL A 1 2   ? 52.902 14.360 51.202 1.00 16.62  ? 17   VAL A N   1 
ATOM   10   C  CA  . VAL A 1 2   ? 54.005 14.288 52.153 1.00 16.21  ? 17   VAL A CA  1 
ATOM   11   C  C   . VAL A 1 2   ? 54.151 12.849 52.628 1.00 17.08  ? 17   VAL A C   1 
ATOM   12   O  O   . VAL A 1 2   ? 53.142 12.243 52.978 1.00 16.58  ? 17   VAL A O   1 
ATOM   13   C  CB  . VAL A 1 2   ? 53.797 15.204 53.359 1.00 12.60  ? 17   VAL A CB  1 
ATOM   14   C  CG1 . VAL A 1 2   ? 55.062 15.214 54.218 1.00 28.19  ? 17   VAL A CG1 1 
ATOM   15   C  CG2 . VAL A 1 2   ? 53.447 16.618 52.936 1.00 14.03  ? 17   VAL A CG2 1 
ATOM   16   N  N   . GLY A 1 3   ? 55.367 12.327 52.596 1.00 14.59  ? 18   GLY A N   1 
ATOM   17   C  CA  . GLY A 1 3   ? 55.696 11.033 53.157 1.00 15.46  ? 18   GLY A CA  1 
ATOM   18   C  C   . GLY A 1 3   ? 55.289 9.862  52.293 1.00 15.24  ? 18   GLY A C   1 
ATOM   19   O  O   . GLY A 1 3   ? 55.219 8.741  52.796 1.00 22.75  ? 18   GLY A O   1 
ATOM   20   N  N   . GLY A 1 4   ? 55.047 10.136 51.021 1.00 18.02  ? 19   GLY A N   1 
ATOM   21   C  CA  . GLY A 1 4   ? 54.587 9.144  50.077 1.00 18.97  ? 19   GLY A CA  1 
ATOM   22   C  C   . GLY A 1 4   ? 55.744 8.623  49.244 1.00 18.95  ? 19   GLY A C   1 
ATOM   23   O  O   . GLY A 1 4   ? 56.899 8.857  49.575 1.00 22.92  ? 19   GLY A O   1 
ATOM   24   N  N   . TYR A 1 5   ? 55.387 7.926  48.175 1.00 16.57  ? 20   TYR A N   1 
ATOM   25   C  CA  . TYR A 1 5   ? 56.363 7.408  47.244 1.00 15.10  ? 20   TYR A CA  1 
ATOM   26   C  C   . TYR A 1 5   ? 55.969 7.738  45.817 1.00 21.01  ? 20   TYR A C   1 
ATOM   27   O  O   . TYR A 1 5   ? 54.826 8.050  45.483 1.00 19.94  ? 20   TYR A O   1 
ATOM   28   C  CB  . TYR A 1 5   ? 56.497 5.887  47.422 1.00 16.49  ? 20   TYR A CB  1 
ATOM   29   C  CG  . TYR A 1 5   ? 55.184 5.163  47.221 1.00 16.85  ? 20   TYR A CG  1 
ATOM   30   C  CD1 . TYR A 1 5   ? 54.879 4.547  46.018 1.00 18.26  ? 20   TYR A CD1 1 
ATOM   31   C  CD2 . TYR A 1 5   ? 54.244 5.109  48.249 1.00 28.38  ? 20   TYR A CD2 1 
ATOM   32   C  CE1 . TYR A 1 5   ? 53.671 3.887  45.834 1.00 17.40  ? 20   TYR A CE1 1 
ATOM   33   C  CE2 . TYR A 1 5   ? 53.042 4.453  48.078 1.00 20.94  ? 20   TYR A CE2 1 
ATOM   34   C  CZ  . TYR A 1 5   ? 52.767 3.847  46.878 1.00 19.90  ? 20   TYR A CZ  1 
ATOM   35   O  OH  . TYR A 1 5   ? 51.574 3.196  46.693 1.00 28.81  ? 20   TYR A OH  1 
ATOM   36   N  N   . THR A 1 6   ? 56.973 7.627  44.960 1.00 15.75  ? 21   THR A N   1 
ATOM   37   C  CA  . THR A 1 6   ? 56.710 7.748  43.533 1.00 11.38  ? 21   THR A CA  1 
ATOM   38   C  C   . THR A 1 6   ? 55.849 6.632  43.004 1.00 13.01  ? 21   THR A C   1 
ATOM   39   O  O   . THR A 1 6   ? 56.187 5.454  43.051 1.00 18.88  ? 21   THR A O   1 
ATOM   40   C  CB  . THR A 1 6   ? 58.073 7.795  42.801 1.00 17.28  ? 21   THR A CB  1 
ATOM   41   O  OG1 . THR A 1 6   ? 58.812 8.917  43.314 1.00 23.36  ? 21   THR A OG1 1 
ATOM   42   C  CG2 . THR A 1 6   ? 57.865 8.014  41.325 1.00 21.37  ? 21   THR A CG2 1 
ATOM   43   N  N   . CYS A 1 7   ? 54.662 6.957  42.487 1.00 16.39  ? 22   CYS A N   1 
ATOM   44   C  CA  . CYS A 1 7   ? 53.730 5.921  42.079 1.00 17.81  ? 22   CYS A CA  1 
ATOM   45   C  C   . CYS A 1 7   ? 54.311 4.963  41.036 1.00 29.58  ? 22   CYS A C   1 
ATOM   46   O  O   . CYS A 1 7   ? 54.134 3.752  41.129 1.00 28.80  ? 22   CYS A O   1 
ATOM   47   C  CB  . CYS A 1 7   ? 52.458 6.508  41.453 1.00 20.58  ? 22   CYS A CB  1 
ATOM   48   S  SG  . CYS A 1 7   ? 51.605 7.716  42.479 1.00 14.50  ? 22   CYS A SG  1 
ATOM   49   N  N   . GLY A 1 8   ? 54.968 5.544  40.044 1.00 22.23  ? 23   GLY A N   1 
ATOM   50   C  CA  . GLY A 1 8   ? 55.364 4.879  38.816 1.00 25.97  ? 23   GLY A CA  1 
ATOM   51   C  C   . GLY A 1 8   ? 54.515 5.452  37.691 1.00 23.51  ? 23   GLY A C   1 
ATOM   52   O  O   . GLY A 1 8   ? 53.338 5.758  37.846 1.00 18.12  ? 23   GLY A O   1 
ATOM   53   N  N   . ALA A 1 9   ? 55.088 5.627  36.509 1.00 18.78  ? 24   ALA A N   1 
ATOM   54   C  CA  . ALA A 1 9   ? 54.317 6.254  35.439 1.00 15.83  ? 24   ALA A CA  1 
ATOM   55   C  C   . ALA A 1 9   ? 53.070 5.462  35.076 1.00 16.68  ? 24   ALA A C   1 
ATOM   56   O  O   . ALA A 1 9   ? 53.127 4.253  34.858 1.00 18.80  ? 24   ALA A O   1 
ATOM   57   C  CB  . ALA A 1 9   ? 55.179 6.392  34.187 1.00 25.09  ? 24   ALA A CB  1 
ATOM   58   N  N   . ASN A 1 10  ? 51.955 6.169  35.038 1.00 16.20  ? 25   ASN A N   1 
ATOM   59   C  CA  . ASN A 1 10  ? 50.660 5.697  34.625 1.00 19.80  ? 25   ASN A CA  1 
ATOM   60   C  C   . ASN A 1 10  ? 50.205 4.450  35.381 1.00 20.31  ? 25   ASN A C   1 
ATOM   61   O  O   . ASN A 1 10  ? 49.461 3.638  34.843 1.00 21.99  ? 25   ASN A O   1 
ATOM   62   C  CB  . ASN A 1 10  ? 50.683 5.416  33.121 1.00 26.19  ? 25   ASN A CB  1 
ATOM   63   C  CG  . ASN A 1 10  ? 51.267 6.570  32.324 1.00 29.12  ? 25   ASN A CG  1 
ATOM   64   O  OD1 . ASN A 1 10  ? 52.294 6.414  31.661 1.00 23.49  ? 25   ASN A OD1 1 
ATOM   65   N  ND2 . ASN A 1 10  ? 50.611 7.720  32.362 1.00 32.45  ? 25   ASN A ND2 1 
ATOM   66   N  N   . THR A 1 11  ? 50.649 4.335  36.623 1.00 15.39  ? 26   THR A N   1 
ATOM   67   C  CA  . THR A 1 11  ? 50.115 3.285  37.486 1.00 19.72  ? 26   THR A CA  1 
ATOM   68   C  C   . THR A 1 11  ? 48.812 3.727  38.157 1.00 17.60  ? 26   THR A C   1 
ATOM   69   O  O   . THR A 1 11  ? 48.154 2.936  38.835 1.00 23.43  ? 26   THR A O   1 
ATOM   70   C  CB  . THR A 1 11  ? 51.087 2.860  38.604 1.00 23.33  ? 26   THR A CB  1 
ATOM   71   O  OG1 . THR A 1 11  ? 51.463 4.006  39.372 1.00 31.32  ? 26   THR A OG1 1 
ATOM   72   C  CG2 . THR A 1 11  ? 52.354 2.256  38.014 1.00 26.78  ? 26   THR A CG2 1 
ATOM   73   N  N   . VAL A 1 12  ? 48.480 4.997  37.977 1.00 15.91  ? 27   VAL A N   1 
ATOM   74   C  CA  . VAL A 1 12  ? 47.246 5.576  38.525 1.00 13.40  ? 27   VAL A CA  1 
ATOM   75   C  C   . VAL A 1 12  ? 46.568 6.247  37.330 1.00 11.52  ? 27   VAL A C   1 
ATOM   76   O  O   . VAL A 1 12  ? 46.603 7.449  37.156 1.00 14.52  ? 27   VAL A O   1 
ATOM   77   C  CB  . VAL A 1 12  ? 47.481 6.564  39.674 1.00 18.21  ? 27   VAL A CB  1 
ATOM   78   C  CG1 . VAL A 1 12  ? 46.172 6.961  40.357 1.00 18.89  ? 27   VAL A CG1 1 
ATOM   79   C  CG2 . VAL A 1 12  ? 48.426 5.975  40.710 1.00 19.62  ? 27   VAL A CG2 1 
ATOM   80   N  N   . PRO A 1 13  ? 45.974 5.438  36.449 1.00 14.46  ? 28   PRO A N   1 
ATOM   81   C  CA  . PRO A 1 13  ? 45.522 5.925  35.169 1.00 14.10  ? 28   PRO A CA  1 
ATOM   82   C  C   . PRO A 1 13  ? 44.255 6.775  35.188 1.00 8.57   ? 28   PRO A C   1 
ATOM   83   O  O   . PRO A 1 13  ? 43.979 7.348  34.159 1.00 12.54  ? 28   PRO A O   1 
ATOM   84   C  CB  . PRO A 1 13  ? 45.230 4.631  34.381 1.00 18.89  ? 28   PRO A CB  1 
ATOM   85   C  CG  . PRO A 1 13  ? 44.990 3.583  35.400 1.00 16.84  ? 28   PRO A CG  1 
ATOM   86   C  CD  . PRO A 1 13  ? 45.739 3.999  36.628 1.00 21.75  ? 28   PRO A CD  1 
ATOM   87   N  N   . TYR A 1 14  ? 43.547 6.834  36.298 1.00 11.20  ? 29   TYR A N   1 
ATOM   88   C  CA  . TYR A 1 14  ? 42.360 7.681  36.369 1.00 9.44   ? 29   TYR A CA  1 
ATOM   89   C  C   . TYR A 1 14  ? 42.733 9.082  36.846 1.00 9.97   ? 29   TYR A C   1 
ATOM   90   O  O   . TYR A 1 14  ? 41.845 9.933  36.912 1.00 10.30  ? 29   TYR A O   1 
ATOM   91   C  CB  . TYR A 1 14  ? 41.367 7.035  37.351 1.00 11.70  ? 29   TYR A CB  1 
ATOM   92   C  CG  . TYR A 1 14  ? 42.000 6.621  38.668 1.00 10.25  ? 29   TYR A CG  1 
ATOM   93   C  CD1 . TYR A 1 14  ? 42.249 7.485  39.725 1.00 10.91  ? 29   TYR A CD1 1 
ATOM   94   C  CD2 . TYR A 1 14  ? 42.368 5.293  38.843 1.00 11.76  ? 29   TYR A CD2 1 
ATOM   95   C  CE1 . TYR A 1 14  ? 42.831 7.050  40.898 1.00 14.04  ? 29   TYR A CE1 1 
ATOM   96   C  CE2 . TYR A 1 14  ? 42.955 4.841  40.011 1.00 12.35  ? 29   TYR A CE2 1 
ATOM   97   C  CZ  . TYR A 1 14  ? 43.190 5.724  41.041 1.00 9.01   ? 29   TYR A CZ  1 
ATOM   98   O  OH  . TYR A 1 14  ? 43.768 5.292  42.210 1.00 14.49  ? 29   TYR A OH  1 
ATOM   99   N  N   . GLN A 1 15  ? 44.003 9.262  37.185 1.00 8.63   ? 30   GLN A N   1 
ATOM   100  C  CA  . GLN A 1 15  ? 44.524 10.500 37.741 1.00 13.47  ? 30   GLN A CA  1 
ATOM   101  C  C   . GLN A 1 15  ? 44.591 11.563 36.652 1.00 11.96  ? 30   GLN A C   1 
ATOM   102  O  O   . GLN A 1 15  ? 45.193 11.291 35.610 1.00 14.63  ? 30   GLN A O   1 
ATOM   103  C  CB  . GLN A 1 15  ? 45.932 10.368 38.363 1.00 10.63  ? 30   GLN A CB  1 
ATOM   104  C  CG  . GLN A 1 15  ? 46.501 11.726 38.775 1.00 7.72   ? 30   GLN A CG  1 
ATOM   105  C  CD  . GLN A 1 15  ? 46.015 12.329 40.061 1.00 10.02  ? 30   GLN A CD  1 
ATOM   106  O  OE1 . GLN A 1 15  ? 45.669 13.493 40.304 1.00 23.42  ? 30   GLN A OE1 1 
ATOM   107  N  NE2 . GLN A 1 15  ? 46.005 11.515 41.091 1.00 7.81   ? 30   GLN A NE2 1 
ATOM   108  N  N   . VAL A 1 16  ? 43.992 12.724 36.891 1.00 7.47   ? 31   VAL A N   1 
ATOM   109  C  CA  . VAL A 1 16  ? 44.194 13.846 35.982 1.00 9.95   ? 31   VAL A CA  1 
ATOM   110  C  C   . VAL A 1 16  ? 44.827 15.037 36.703 1.00 8.40   ? 31   VAL A C   1 
ATOM   111  O  O   . VAL A 1 16  ? 44.828 15.190 37.918 1.00 9.20   ? 31   VAL A O   1 
ATOM   112  C  CB  . VAL A 1 16  ? 42.908 14.317 35.275 1.00 18.16  ? 31   VAL A CB  1 
ATOM   113  C  CG1 . VAL A 1 16  ? 42.198 13.115 34.641 1.00 19.86  ? 31   VAL A CG1 1 
ATOM   114  C  CG2 . VAL A 1 16  ? 41.980 15.068 36.208 1.00 20.79  ? 31   VAL A CG2 1 
ATOM   115  N  N   . SER A 1 17  ? 45.362 15.916 35.879 1.00 7.89   ? 32   SER A N   1 
ATOM   116  C  CA  . SER A 1 17  ? 45.932 17.172 36.293 1.00 9.31   ? 32   SER A CA  1 
ATOM   117  C  C   . SER A 1 17  ? 45.052 18.258 35.657 1.00 7.60   ? 32   SER A C   1 
ATOM   118  O  O   . SER A 1 17  ? 44.771 18.144 34.474 1.00 11.25  ? 32   SER A O   1 
ATOM   119  C  CB  . SER A 1 17  ? 47.373 17.386 35.832 1.00 17.08  ? 32   SER A CB  1 
ATOM   120  O  OG  . SER A 1 17  ? 47.516 18.713 35.339 1.00 27.82  ? 32   SER A OG  1 
ATOM   121  N  N   . LEU A 1 18  ? 44.642 19.222 36.453 1.00 8.11   ? 33   LEU A N   1 
ATOM   122  C  CA  . LEU A 1 18  ? 43.914 20.350 35.876 1.00 10.31  ? 33   LEU A CA  1 
ATOM   123  C  C   . LEU A 1 18  ? 44.927 21.466 35.680 1.00 11.50  ? 33   LEU A C   1 
ATOM   124  O  O   . LEU A 1 18  ? 45.700 21.778 36.576 1.00 10.32  ? 33   LEU A O   1 
ATOM   125  C  CB  . LEU A 1 18  ? 42.779 20.789 36.760 1.00 10.25  ? 33   LEU A CB  1 
ATOM   126  C  CG  . LEU A 1 18  ? 41.732 19.759 37.183 1.00 11.41  ? 33   LEU A CG  1 
ATOM   127  C  CD1 . LEU A 1 18  ? 40.690 20.489 38.026 1.00 16.13  ? 33   LEU A CD1 1 
ATOM   128  C  CD2 . LEU A 1 18  ? 41.093 19.041 36.014 1.00 12.92  ? 33   LEU A CD2 1 
ATOM   129  N  N   . ASN A 1 19  ? 44.914 22.038 34.498 1.00 9.44   ? 34   ASN A N   1 
ATOM   130  C  CA  . ASN A 1 19  ? 45.968 22.948 34.069 1.00 7.53   ? 34   ASN A CA  1 
ATOM   131  C  C   . ASN A 1 19  ? 45.373 24.250 33.550 1.00 10.21  ? 34   ASN A C   1 
ATOM   132  O  O   . ASN A 1 19  ? 44.494 24.261 32.695 1.00 14.59  ? 34   ASN A O   1 
ATOM   133  C  CB  . ASN A 1 19  ? 46.799 22.288 32.960 1.00 9.35   ? 34   ASN A CB  1 
ATOM   134  C  CG  . ASN A 1 19  ? 47.979 23.115 32.516 1.00 17.29  ? 34   ASN A CG  1 
ATOM   135  O  OD1 . ASN A 1 19  ? 47.801 24.143 31.870 1.00 12.23  ? 34   ASN A OD1 1 
ATOM   136  N  ND2 . ASN A 1 19  ? 49.173 22.663 32.881 1.00 13.41  ? 34   ASN A ND2 1 
ATOM   137  N  N   . SER A 1 20  ? 45.810 25.379 34.082 1.00 10.96  ? 37   SER A N   1 
ATOM   138  C  CA  . SER A 1 20  ? 45.363 26.652 33.533 1.00 12.05  ? 37   SER A CA  1 
ATOM   139  C  C   . SER A 1 20  ? 46.593 27.479 33.167 1.00 13.08  ? 37   SER A C   1 
ATOM   140  O  O   . SER A 1 20  ? 46.646 28.664 33.499 1.00 13.57  ? 37   SER A O   1 
ATOM   141  C  CB  . SER A 1 20  ? 44.470 27.392 34.521 1.00 17.67  ? 37   SER A CB  1 
ATOM   142  O  OG  . SER A 1 20  ? 45.110 27.512 35.784 1.00 22.61  ? 37   SER A OG  1 
ATOM   143  N  N   . GLY A 1 21  ? 47.535 26.815 32.514 1.00 14.67  ? 38   GLY A N   1 
ATOM   144  C  CA  . GLY A 1 21  ? 48.851 27.385 32.241 1.00 14.96  ? 38   GLY A CA  1 
ATOM   145  C  C   . GLY A 1 21  ? 49.940 26.759 33.096 1.00 14.33  ? 38   GLY A C   1 
ATOM   146  O  O   . GLY A 1 21  ? 51.137 26.920 32.849 1.00 11.20  ? 38   GLY A O   1 
ATOM   147  N  N   . TYR A 1 22  ? 49.493 26.035 34.107 1.00 12.27  ? 39   TYR A N   1 
ATOM   148  C  CA  . TYR A 1 22  ? 50.304 25.402 35.137 1.00 7.74   ? 39   TYR A CA  1 
ATOM   149  C  C   . TYR A 1 22  ? 49.418 24.369 35.824 1.00 13.10  ? 39   TYR A C   1 
ATOM   150  O  O   . TYR A 1 22  ? 48.203 24.571 35.769 1.00 11.27  ? 39   TYR A O   1 
ATOM   151  C  CB  . TYR A 1 22  ? 50.840 26.428 36.149 1.00 10.03  ? 39   TYR A CB  1 
ATOM   152  C  CG  . TYR A 1 22  ? 49.732 27.318 36.650 1.00 12.40  ? 39   TYR A CG  1 
ATOM   153  C  CD1 . TYR A 1 22  ? 49.496 28.514 35.989 1.00 11.06  ? 39   TYR A CD1 1 
ATOM   154  C  CD2 . TYR A 1 22  ? 48.922 26.997 37.728 1.00 16.86  ? 39   TYR A CD2 1 
ATOM   155  C  CE1 . TYR A 1 22  ? 48.489 29.357 36.402 1.00 19.93  ? 39   TYR A CE1 1 
ATOM   156  C  CE2 . TYR A 1 22  ? 47.905 27.823 38.155 1.00 15.48  ? 39   TYR A CE2 1 
ATOM   157  C  CZ  . TYR A 1 22  ? 47.707 29.006 37.480 1.00 23.78  ? 39   TYR A CZ  1 
ATOM   158  O  OH  . TYR A 1 22  ? 46.704 29.868 37.874 1.00 26.03  ? 39   TYR A OH  1 
ATOM   159  N  N   . HIS A 1 23  ? 49.951 23.327 36.440 1.00 13.07  ? 40   HIS A N   1 
ATOM   160  C  CA  . HIS A 1 23  ? 49.106 22.440 37.232 1.00 9.40   ? 40   HIS A CA  1 
ATOM   161  C  C   . HIS A 1 23  ? 48.563 23.163 38.442 1.00 9.04   ? 40   HIS A C   1 
ATOM   162  O  O   . HIS A 1 23  ? 49.296 23.826 39.196 1.00 10.27  ? 40   HIS A O   1 
ATOM   163  C  CB  . HIS A 1 23  ? 49.928 21.214 37.654 1.00 9.51   ? 40   HIS A CB  1 
ATOM   164  C  CG  . HIS A 1 23  ? 49.344 20.450 38.796 1.00 15.63  ? 40   HIS A CG  1 
ATOM   165  N  ND1 . HIS A 1 23  ? 48.493 19.393 38.639 1.00 13.89  ? 40   HIS A ND1 1 
ATOM   166  C  CD2 . HIS A 1 23  ? 49.473 20.529 40.156 1.00 16.17  ? 40   HIS A CD2 1 
ATOM   167  C  CE1 . HIS A 1 23  ? 48.097 18.876 39.775 1.00 9.01   ? 40   HIS A CE1 1 
ATOM   168  N  NE2 . HIS A 1 23  ? 48.693 19.563 40.721 1.00 11.20  ? 40   HIS A NE2 1 
ATOM   169  N  N   . PHE A 1 24  ? 47.285 23.034 38.752 1.00 6.60   ? 41   PHE A N   1 
ATOM   170  C  CA  . PHE A 1 24  ? 46.771 23.639 39.973 1.00 14.32  ? 41   PHE A CA  1 
ATOM   171  C  C   . PHE A 1 24  ? 45.846 22.730 40.775 1.00 8.94   ? 41   PHE A C   1 
ATOM   172  O  O   . PHE A 1 24  ? 45.570 23.080 41.935 1.00 11.30  ? 41   PHE A O   1 
ATOM   173  C  CB  . PHE A 1 24  ? 46.021 24.943 39.657 1.00 18.21  ? 41   PHE A CB  1 
ATOM   174  C  CG  . PHE A 1 24  ? 44.725 24.733 38.906 1.00 14.50  ? 41   PHE A CG  1 
ATOM   175  C  CD1 . PHE A 1 24  ? 43.499 24.676 39.559 1.00 19.15  ? 41   PHE A CD1 1 
ATOM   176  C  CD2 . PHE A 1 24  ? 44.726 24.598 37.537 1.00 14.71  ? 41   PHE A CD2 1 
ATOM   177  C  CE1 . PHE A 1 24  ? 42.315 24.484 38.860 1.00 16.67  ? 41   PHE A CE1 1 
ATOM   178  C  CE2 . PHE A 1 24  ? 43.559 24.406 36.837 1.00 19.19  ? 41   PHE A CE2 1 
ATOM   179  C  CZ  . PHE A 1 24  ? 42.346 24.344 37.496 1.00 14.36  ? 41   PHE A CZ  1 
ATOM   180  N  N   . CYS A 1 25  ? 45.351 21.627 40.247 1.00 9.21   ? 42   CYS A N   1 
ATOM   181  C  CA  . CYS A 1 25  ? 44.498 20.733 41.018 1.00 10.70  ? 42   CYS A CA  1 
ATOM   182  C  C   . CYS A 1 25  ? 44.564 19.357 40.360 1.00 7.61   ? 42   CYS A C   1 
ATOM   183  O  O   . CYS A 1 25  ? 44.870 19.330 39.162 1.00 8.08   ? 42   CYS A O   1 
ATOM   184  C  CB  . CYS A 1 25  ? 43.075 21.269 41.081 1.00 10.54  ? 42   CYS A CB  1 
ATOM   185  S  SG  . CYS A 1 25  ? 42.731 22.316 42.500 1.00 11.30  ? 42   CYS A SG  1 
ATOM   186  N  N   . GLY A 1 26  ? 44.313 18.336 41.163 1.00 5.71   ? 43   GLY A N   1 
ATOM   187  C  CA  . GLY A 1 26  ? 44.062 16.995 40.665 1.00 7.49   ? 43   GLY A CA  1 
ATOM   188  C  C   . GLY A 1 26  ? 42.589 16.806 40.339 1.00 12.11  ? 43   GLY A C   1 
ATOM   189  O  O   . GLY A 1 26  ? 41.749 17.689 40.493 1.00 7.19   ? 43   GLY A O   1 
ATOM   190  N  N   . GLY A 1 27  ? 42.263 15.617 39.869 1.00 11.97  ? 44   GLY A N   1 
ATOM   191  C  CA  . GLY A 1 27  ? 40.929 15.198 39.485 1.00 9.31   ? 44   GLY A CA  1 
ATOM   192  C  C   . GLY A 1 27  ? 40.954 13.717 39.120 1.00 13.72  ? 44   GLY A C   1 
ATOM   193  O  O   . GLY A 1 27  ? 42.029 13.125 39.043 1.00 12.78  ? 44   GLY A O   1 
ATOM   194  N  N   . SER A 1 28  ? 39.785 13.157 38.908 1.00 9.97   ? 45   SER A N   1 
ATOM   195  C  CA  . SER A 1 28  ? 39.601 11.755 38.596 1.00 7.62   ? 45   SER A CA  1 
ATOM   196  C  C   . SER A 1 28  ? 38.722 11.597 37.361 1.00 5.79   ? 45   SER A C   1 
ATOM   197  O  O   . SER A 1 28  ? 37.662 12.229 37.316 1.00 10.81  ? 45   SER A O   1 
ATOM   198  C  CB  . SER A 1 28  ? 38.914 11.057 39.761 1.00 14.08  ? 45   SER A CB  1 
ATOM   199  O  OG  . SER A 1 28  ? 39.698 11.069 40.942 1.00 12.70  ? 45   SER A OG  1 
ATOM   200  N  N   . LEU A 1 29  ? 39.130 10.755 36.432 1.00 9.73   ? 46   LEU A N   1 
ATOM   201  C  CA  . LEU A 1 29  ? 38.298 10.459 35.262 1.00 7.75   ? 46   LEU A CA  1 
ATOM   202  C  C   . LEU A 1 29  ? 37.241 9.441  35.642 1.00 8.32   ? 46   LEU A C   1 
ATOM   203  O  O   . LEU A 1 29  ? 37.587 8.363  36.107 1.00 12.73  ? 46   LEU A O   1 
ATOM   204  C  CB  . LEU A 1 29  ? 39.149 9.932  34.117 1.00 8.96   ? 46   LEU A CB  1 
ATOM   205  C  CG  . LEU A 1 29  ? 38.529 9.828  32.726 1.00 11.74  ? 46   LEU A CG  1 
ATOM   206  C  CD1 . LEU A 1 29  ? 38.284 11.213 32.167 1.00 14.16  ? 46   LEU A CD1 1 
ATOM   207  C  CD2 . LEU A 1 29  ? 39.437 9.011  31.811 1.00 15.39  ? 46   LEU A CD2 1 
ATOM   208  N  N   . ILE A 1 30  ? 35.968 9.737  35.451 1.00 10.03  ? 47   ILE A N   1 
ATOM   209  C  CA  . ILE A 1 30  ? 34.957 8.761  35.848 1.00 10.28  ? 47   ILE A CA  1 
ATOM   210  C  C   . ILE A 1 30  ? 34.268 8.094  34.654 1.00 9.93   ? 47   ILE A C   1 
ATOM   211  O  O   . ILE A 1 30  ? 33.630 7.058  34.850 1.00 16.05  ? 47   ILE A O   1 
ATOM   212  C  CB  . ILE A 1 30  ? 33.920 9.379  36.799 1.00 13.02  ? 47   ILE A CB  1 
ATOM   213  C  CG1 . ILE A 1 30  ? 33.168 10.611 36.320 1.00 20.82  ? 47   ILE A CG1 1 
ATOM   214  C  CG2 . ILE A 1 30  ? 34.619 9.685  38.132 1.00 19.35  ? 47   ILE A CG2 1 
ATOM   215  C  CD1 . ILE A 1 30  ? 31.828 10.747 37.022 1.00 27.61  ? 47   ILE A CD1 1 
ATOM   216  N  N   . ASN A 1 31  ? 34.385 8.662  33.474 1.00 14.47  ? 48   ASN A N   1 
ATOM   217  C  CA  . ASN A 1 31  ? 34.063 8.049  32.183 1.00 14.81  ? 48   ASN A CA  1 
ATOM   218  C  C   . ASN A 1 31  ? 34.749 8.826  31.071 1.00 13.27  ? 48   ASN A C   1 
ATOM   219  O  O   . ASN A 1 31  ? 35.492 9.790  31.315 1.00 14.27  ? 48   ASN A O   1 
ATOM   220  C  CB  . ASN A 1 31  ? 32.564 7.966  31.929 1.00 9.52   ? 48   ASN A CB  1 
ATOM   221  C  CG  . ASN A 1 31  ? 31.873 9.283  31.682 1.00 11.33  ? 48   ASN A CG  1 
ATOM   222  O  OD1 . ASN A 1 31  ? 32.308 10.195 30.986 1.00 14.02  ? 48   ASN A OD1 1 
ATOM   223  N  ND2 . ASN A 1 31  ? 30.694 9.371  32.304 1.00 20.93  ? 48   ASN A ND2 1 
ATOM   224  N  N   . SER A 1 32  ? 34.519 8.420  29.823 1.00 10.00  ? 49   SER A N   1 
ATOM   225  C  CA  . SER A 1 32  ? 35.348 9.074  28.792 1.00 11.15  ? 49   SER A CA  1 
ATOM   226  C  C   . SER A 1 32  ? 35.079 10.559 28.669 1.00 14.39  ? 49   SER A C   1 
ATOM   227  O  O   . SER A 1 32  ? 35.926 11.253 28.075 1.00 10.97  ? 49   SER A O   1 
ATOM   228  C  CB  A SER A 1 32  ? 35.141 8.371  27.446 0.33 16.75  ? 49   SER A CB  1 
ATOM   229  C  CB  B SER A 1 32  ? 35.177 8.375  27.438 0.67 17.13  ? 49   SER A CB  1 
ATOM   230  O  OG  A SER A 1 32  ? 35.384 6.980  27.562 0.33 23.89  ? 49   SER A OG  1 
ATOM   231  O  OG  B SER A 1 32  ? 34.010 8.842  26.779 0.67 15.59  ? 49   SER A OG  1 
ATOM   232  N  N   . GLN A 1 33  ? 33.986 11.078 29.246 1.00 10.95  ? 50   GLN A N   1 
ATOM   233  C  CA  . GLN A 1 33  ? 33.682 12.476 28.999 1.00 8.97   ? 50   GLN A CA  1 
ATOM   234  C  C   . GLN A 1 33  ? 33.672 13.351 30.252 1.00 11.55  ? 50   GLN A C   1 
ATOM   235  O  O   . GLN A 1 33  ? 33.445 14.554 30.132 1.00 13.24  ? 50   GLN A O   1 
ATOM   236  C  CB  . GLN A 1 33  ? 32.294 12.627 28.363 1.00 15.48  ? 50   GLN A CB  1 
ATOM   237  C  CG  . GLN A 1 33  ? 32.040 11.892 27.079 1.00 24.65  ? 50   GLN A CG  1 
ATOM   238  C  CD  . GLN A 1 33  ? 30.608 11.801 26.605 1.00 32.25  ? 50   GLN A CD  1 
ATOM   239  O  OE1 . GLN A 1 33  ? 30.379 11.781 25.388 1.00 32.35  ? 50   GLN A OE1 1 
ATOM   240  N  NE2 . GLN A 1 33  ? 29.608 11.709 27.479 1.00 37.10  ? 50   GLN A NE2 1 
ATOM   241  N  N   . TRP A 1 34  ? 33.861 12.765 31.422 1.00 7.04   ? 51   TRP A N   1 
ATOM   242  C  CA  . TRP A 1 34  ? 33.648 13.468 32.682 1.00 6.40   ? 51   TRP A CA  1 
ATOM   243  C  C   . TRP A 1 34  ? 34.750 13.249 33.712 1.00 11.74  ? 51   TRP A C   1 
ATOM   244  O  O   . TRP A 1 34  ? 35.258 12.163 33.956 1.00 8.44   ? 51   TRP A O   1 
ATOM   245  C  CB  . TRP A 1 34  ? 32.328 13.002 33.297 1.00 6.43   ? 51   TRP A CB  1 
ATOM   246  C  CG  . TRP A 1 34  ? 31.148 13.548 32.559 1.00 8.41   ? 51   TRP A CG  1 
ATOM   247  C  CD1 . TRP A 1 34  ? 30.475 12.933 31.542 1.00 10.29  ? 51   TRP A CD1 1 
ATOM   248  C  CD2 . TRP A 1 34  ? 30.523 14.814 32.798 1.00 8.44   ? 51   TRP A CD2 1 
ATOM   249  N  NE1 . TRP A 1 34  ? 29.461 13.765 31.146 1.00 9.58   ? 51   TRP A NE1 1 
ATOM   250  C  CE2 . TRP A 1 34  ? 29.451 14.910 31.873 1.00 10.06  ? 51   TRP A CE2 1 
ATOM   251  C  CE3 . TRP A 1 34  ? 30.725 15.877 33.669 1.00 8.88   ? 51   TRP A CE3 1 
ATOM   252  C  CZ2 . TRP A 1 34  ? 28.631 16.036 31.838 1.00 8.19   ? 51   TRP A CZ2 1 
ATOM   253  C  CZ3 . TRP A 1 34  ? 29.910 16.982 33.634 1.00 13.06  ? 51   TRP A CZ3 1 
ATOM   254  C  CH2 . TRP A 1 34  ? 28.860 17.056 32.717 1.00 13.89  ? 51   TRP A CH2 1 
ATOM   255  N  N   . VAL A 1 35  ? 35.082 14.348 34.380 1.00 7.23   ? 52   VAL A N   1 
ATOM   256  C  CA  . VAL A 1 35  ? 36.099 14.388 35.423 1.00 10.93  ? 52   VAL A CA  1 
ATOM   257  C  C   . VAL A 1 35  ? 35.468 14.869 36.724 1.00 10.84  ? 52   VAL A C   1 
ATOM   258  O  O   . VAL A 1 35  ? 34.639 15.793 36.663 1.00 12.26  ? 52   VAL A O   1 
ATOM   259  C  CB  . VAL A 1 35  ? 37.234 15.349 35.013 1.00 9.80   ? 52   VAL A CB  1 
ATOM   260  C  CG1 . VAL A 1 35  ? 38.093 15.645 36.242 1.00 8.97   ? 52   VAL A CG1 1 
ATOM   261  C  CG2 . VAL A 1 35  ? 38.047 14.817 33.844 1.00 13.96  ? 52   VAL A CG2 1 
ATOM   262  N  N   . VAL A 1 36  ? 35.828 14.271 37.850 1.00 6.17   ? 53   VAL A N   1 
ATOM   263  C  CA  . VAL A 1 36  ? 35.366 14.812 39.128 1.00 4.84   ? 53   VAL A CA  1 
ATOM   264  C  C   . VAL A 1 36  ? 36.542 15.438 39.870 1.00 6.47   ? 53   VAL A C   1 
ATOM   265  O  O   . VAL A 1 36  ? 37.667 14.969 39.860 1.00 7.70   ? 53   VAL A O   1 
ATOM   266  C  CB  . VAL A 1 36  ? 34.699 13.764 40.022 1.00 10.76  ? 53   VAL A CB  1 
ATOM   267  C  CG1 . VAL A 1 36  ? 35.672 12.648 40.314 1.00 19.99  ? 53   VAL A CG1 1 
ATOM   268  C  CG2 . VAL A 1 36  ? 34.212 14.411 41.310 1.00 20.15  ? 53   VAL A CG2 1 
ATOM   269  N  N   . SER A 1 37  ? 36.305 16.565 40.517 1.00 6.87   ? 54   SER A N   1 
ATOM   270  C  CA  . SER A 1 37  ? 37.346 17.246 41.287 1.00 9.30   ? 54   SER A CA  1 
ATOM   271  C  C   . SER A 1 37  ? 36.671 17.945 42.478 1.00 10.76  ? 54   SER A C   1 
ATOM   272  O  O   . SER A 1 37  ? 35.505 17.681 42.792 1.00 7.41   ? 54   SER A O   1 
ATOM   273  C  CB  . SER A 1 37  ? 38.149 18.180 40.398 1.00 7.78   ? 54   SER A CB  1 
ATOM   274  O  OG  . SER A 1 37  ? 39.158 18.921 41.035 1.00 10.57  ? 54   SER A OG  1 
ATOM   275  N  N   . ALA A 1 38  ? 37.409 18.812 43.134 1.00 10.12  ? 55   ALA A N   1 
ATOM   276  C  CA  . ALA A 1 38  ? 36.916 19.638 44.219 1.00 10.38  ? 55   ALA A CA  1 
ATOM   277  C  C   . ALA A 1 38  ? 36.350 20.951 43.661 1.00 7.40   ? 55   ALA A C   1 
ATOM   278  O  O   . ALA A 1 38  ? 36.894 21.544 42.729 1.00 9.30   ? 55   ALA A O   1 
ATOM   279  C  CB  . ALA A 1 38  ? 38.000 19.924 45.244 1.00 10.87  ? 55   ALA A CB  1 
ATOM   280  N  N   . ALA A 1 39  ? 35.241 21.362 44.254 1.00 6.37   ? 56   ALA A N   1 
ATOM   281  C  CA  . ALA A 1 39  ? 34.629 22.655 43.959 1.00 4.65   ? 56   ALA A CA  1 
ATOM   282  C  C   . ALA A 1 39  ? 35.628 23.784 44.225 1.00 6.07   ? 56   ALA A C   1 
ATOM   283  O  O   . ALA A 1 39  ? 35.625 24.758 43.469 1.00 12.77  ? 56   ALA A O   1 
ATOM   284  C  CB  . ALA A 1 39  ? 33.357 22.825 44.746 1.00 12.21  ? 56   ALA A CB  1 
ATOM   285  N  N   . HIS A 1 40  ? 36.495 23.693 45.224 1.00 8.75   ? 57   HIS A N   1 
ATOM   286  C  CA  . HIS A 1 40  ? 37.445 24.782 45.505 1.00 7.01   ? 57   HIS A CA  1 
ATOM   287  C  C   . HIS A 1 40  ? 38.480 24.883 44.380 1.00 9.83   ? 57   HIS A C   1 
ATOM   288  O  O   . HIS A 1 40  ? 39.277 25.833 44.326 1.00 11.76  ? 57   HIS A O   1 
ATOM   289  C  CB  . HIS A 1 40  ? 38.052 24.682 46.896 1.00 11.59  ? 57   HIS A CB  1 
ATOM   290  C  CG  . HIS A 1 40  ? 39.184 23.757 47.147 1.00 9.00   ? 57   HIS A CG  1 
ATOM   291  N  ND1 . HIS A 1 40  ? 39.035 22.504 47.719 1.00 8.39   ? 57   HIS A ND1 1 
ATOM   292  C  CD2 . HIS A 1 40  ? 40.512 23.869 46.912 1.00 15.54  ? 57   HIS A CD2 1 
ATOM   293  C  CE1 . HIS A 1 40  ? 40.199 21.907 47.817 1.00 19.90  ? 57   HIS A CE1 1 
ATOM   294  N  NE2 . HIS A 1 40  ? 41.121 22.712 47.323 1.00 16.71  ? 57   HIS A NE2 1 
ATOM   295  N  N   . CYS A 1 41  ? 38.507 23.946 43.441 1.00 7.86   ? 58   CYS A N   1 
ATOM   296  C  CA  . CYS A 1 41  ? 39.410 23.981 42.307 1.00 8.26   ? 58   CYS A CA  1 
ATOM   297  C  C   . CYS A 1 41  ? 38.798 24.741 41.129 1.00 16.58  ? 58   CYS A C   1 
ATOM   298  O  O   . CYS A 1 41  ? 39.421 24.899 40.083 1.00 16.99  ? 58   CYS A O   1 
ATOM   299  C  CB  . CYS A 1 41  ? 39.808 22.568 41.882 1.00 8.12   ? 58   CYS A CB  1 
ATOM   300  S  SG  . CYS A 1 41  ? 40.871 21.718 43.061 1.00 11.88  ? 58   CYS A SG  1 
ATOM   301  N  N   . TYR A 1 42  ? 37.567 25.193 41.296 1.00 14.91  ? 59   TYR A N   1 
ATOM   302  C  CA  . TYR A 1 42  ? 36.841 25.887 40.263 1.00 13.52  ? 59   TYR A CA  1 
ATOM   303  C  C   . TYR A 1 42  ? 37.672 27.048 39.704 1.00 11.19  ? 59   TYR A C   1 
ATOM   304  O  O   . TYR A 1 42  ? 38.152 27.898 40.447 1.00 13.96  ? 59   TYR A O   1 
ATOM   305  C  CB  . TYR A 1 42  ? 35.489 26.458 40.750 1.00 14.29  ? 59   TYR A CB  1 
ATOM   306  C  CG  . TYR A 1 42  ? 34.917 27.372 39.650 1.00 11.59  ? 59   TYR A CG  1 
ATOM   307  C  CD1 . TYR A 1 42  ? 34.880 28.755 39.803 1.00 19.01  ? 59   TYR A CD1 1 
ATOM   308  C  CD2 . TYR A 1 42  ? 34.431 26.834 38.465 1.00 15.70  ? 59   TYR A CD2 1 
ATOM   309  C  CE1 . TYR A 1 42  ? 34.375 29.566 38.815 1.00 17.35  ? 59   TYR A CE1 1 
ATOM   310  C  CE2 . TYR A 1 42  ? 33.921 27.659 37.458 1.00 15.69  ? 59   TYR A CE2 1 
ATOM   311  C  CZ  . TYR A 1 42  ? 33.900 29.018 37.647 1.00 21.05  ? 59   TYR A CZ  1 
ATOM   312  O  OH  . TYR A 1 42  ? 33.398 29.873 36.679 1.00 32.84  ? 59   TYR A OH  1 
ATOM   313  N  N   . LYS A 1 43  ? 37.732 27.062 38.380 1.00 18.39  ? 60   LYS A N   1 
ATOM   314  C  CA  . LYS A 1 43  ? 38.126 28.217 37.593 1.00 24.04  ? 60   LYS A CA  1 
ATOM   315  C  C   . LYS A 1 43  ? 37.801 28.060 36.112 1.00 22.97  ? 60   LYS A C   1 
ATOM   316  O  O   . LYS A 1 43  ? 37.529 26.984 35.581 1.00 21.51  ? 60   LYS A O   1 
ATOM   317  C  CB  . LYS A 1 43  ? 39.608 28.500 37.790 1.00 35.14  ? 60   LYS A CB  1 
ATOM   318  C  CG  . LYS A 1 43  ? 40.552 27.616 37.007 1.00 37.25  ? 60   LYS A CG  1 
ATOM   319  C  CD  . LYS A 1 43  ? 41.943 28.252 36.972 1.00 36.30  ? 60   LYS A CD  1 
ATOM   320  C  CE  . LYS A 1 43  ? 42.570 28.152 38.356 1.00 24.48  ? 60   LYS A CE  1 
ATOM   321  N  NZ  . LYS A 1 43  ? 43.654 29.144 38.569 1.00 41.83  ? 60   LYS A NZ  1 
ATOM   322  N  N   . SER A 1 44  ? 37.831 29.190 35.407 1.00 27.26  ? 61   SER A N   1 
ATOM   323  C  CA  . SER A 1 44  ? 37.521 29.130 33.977 1.00 24.22  ? 61   SER A CA  1 
ATOM   324  C  C   . SER A 1 44  ? 38.793 28.803 33.197 1.00 14.83  ? 61   SER A C   1 
ATOM   325  O  O   . SER A 1 44  ? 39.902 29.002 33.676 1.00 31.21  ? 61   SER A O   1 
ATOM   326  C  CB  . SER A 1 44  ? 36.890 30.421 33.467 1.00 36.80  ? 61   SER A CB  1 
ATOM   327  O  OG  . SER A 1 44  ? 37.179 31.567 34.230 1.00 46.46  ? 61   SER A OG  1 
ATOM   328  N  N   . GLY A 1 45  ? 38.625 28.280 31.989 1.00 23.67  ? 62   GLY A N   1 
ATOM   329  C  CA  . GLY A 1 45  ? 39.755 28.070 31.098 1.00 26.64  ? 62   GLY A CA  1 
ATOM   330  C  C   . GLY A 1 45  ? 40.625 26.897 31.492 1.00 24.71  ? 62   GLY A C   1 
ATOM   331  O  O   . GLY A 1 45  ? 41.845 26.886 31.391 1.00 41.98  ? 62   GLY A O   1 
ATOM   332  N  N   . ILE A 1 46  ? 39.967 25.852 31.970 1.00 15.11  ? 63   ILE A N   1 
ATOM   333  C  CA  . ILE A 1 46  ? 40.674 24.666 32.439 1.00 13.65  ? 63   ILE A CA  1 
ATOM   334  C  C   . ILE A 1 46  ? 40.950 23.737 31.271 1.00 10.24  ? 63   ILE A C   1 
ATOM   335  O  O   . ILE A 1 46  ? 40.083 23.483 30.419 1.00 12.15  ? 63   ILE A O   1 
ATOM   336  C  CB  . ILE A 1 46  ? 39.847 23.957 33.521 1.00 21.94  ? 63   ILE A CB  1 
ATOM   337  C  CG1 . ILE A 1 46  ? 39.725 24.756 34.821 1.00 22.17  ? 63   ILE A CG1 1 
ATOM   338  C  CG2 . ILE A 1 46  ? 40.421 22.571 33.790 1.00 15.92  ? 63   ILE A CG2 1 
ATOM   339  C  CD1 . ILE A 1 46  ? 38.880 24.087 35.876 1.00 34.25  ? 63   ILE A CD1 1 
ATOM   340  N  N   . GLN A 1 47  ? 42.169 23.228 31.221 1.00 10.13  ? 64   GLN A N   1 
ATOM   341  C  CA  . GLN A 1 47  ? 42.533 22.143 30.328 1.00 8.34   ? 64   GLN A CA  1 
ATOM   342  C  C   . GLN A 1 47  ? 42.804 20.918 31.220 1.00 14.07  ? 64   GLN A C   1 
ATOM   343  O  O   . GLN A 1 47  ? 43.498 20.986 32.221 1.00 12.56  ? 64   GLN A O   1 
ATOM   344  C  CB  . GLN A 1 47  ? 43.749 22.380 29.446 1.00 10.47  ? 64   GLN A CB  1 
ATOM   345  C  CG  . GLN A 1 47  ? 44.108 21.259 28.483 1.00 17.27  ? 64   GLN A CG  1 
ATOM   346  C  CD  . GLN A 1 47  ? 45.345 21.555 27.656 1.00 25.66  ? 64   GLN A CD  1 
ATOM   347  O  OE1 . GLN A 1 47  ? 46.445 21.632 28.179 1.00 15.26  ? 64   GLN A OE1 1 
ATOM   348  N  NE2 . GLN A 1 47  ? 45.233 21.728 26.341 1.00 25.72  ? 64   GLN A NE2 1 
ATOM   349  N  N   . VAL A 1 48  ? 42.214 19.817 30.799 1.00 13.28  ? 65   VAL A N   1 
ATOM   350  C  CA  . VAL A 1 48  ? 42.386 18.582 31.539 1.00 11.28  ? 65   VAL A CA  1 
ATOM   351  C  C   . VAL A 1 48  ? 43.504 17.794 30.888 1.00 7.88   ? 65   VAL A C   1 
ATOM   352  O  O   . VAL A 1 48  ? 43.505 17.610 29.656 1.00 10.88  ? 65   VAL A O   1 
ATOM   353  C  CB  . VAL A 1 48  ? 41.067 17.800 31.509 1.00 11.94  ? 65   VAL A CB  1 
ATOM   354  C  CG1 . VAL A 1 48  ? 41.245 16.442 32.145 1.00 14.07  ? 65   VAL A CG1 1 
ATOM   355  C  CG2 . VAL A 1 48  ? 39.990 18.585 32.256 1.00 13.04  ? 65   VAL A CG2 1 
ATOM   356  N  N   . ARG A 1 49  ? 44.438 17.320 31.684 1.00 9.00   ? 66   ARG A N   1 
ATOM   357  C  CA  . ARG A 1 49  ? 45.584 16.594 31.158 1.00 9.07   ? 66   ARG A CA  1 
ATOM   358  C  C   . ARG A 1 49  ? 45.567 15.175 31.764 1.00 13.17  ? 66   ARG A C   1 
ATOM   359  O  O   . ARG A 1 49  ? 45.731 15.007 32.965 1.00 11.00  ? 66   ARG A O   1 
ATOM   360  C  CB  . ARG A 1 49  ? 46.884 17.324 31.424 1.00 12.71  ? 66   ARG A CB  1 
ATOM   361  C  CG  . ARG A 1 49  ? 46.910 18.734 30.884 1.00 13.63  ? 66   ARG A CG  1 
ATOM   362  C  CD  . ARG A 1 49  ? 48.247 19.446 31.076 1.00 14.60  ? 66   ARG A CD  1 
ATOM   363  N  NE  . ARG A 1 49  ? 48.429 20.384 29.979 1.00 12.38  ? 66   ARG A NE  1 
ATOM   364  C  CZ  . ARG A 1 49  ? 49.542 20.865 29.450 1.00 14.61  ? 66   ARG A CZ  1 
ATOM   365  N  NH1 . ARG A 1 49  ? 50.728 20.528 29.923 1.00 13.59  ? 66   ARG A NH1 1 
ATOM   366  N  NH2 . ARG A 1 49  ? 49.497 21.712 28.420 1.00 15.14  ? 66   ARG A NH2 1 
ATOM   367  N  N   . LEU A 1 50  ? 45.360 14.206 30.883 1.00 7.72   ? 67   LEU A N   1 
ATOM   368  C  CA  . LEU A 1 50  ? 45.279 12.790 31.128 1.00 8.81   ? 67   LEU A CA  1 
ATOM   369  C  C   . LEU A 1 50  ? 46.572 12.081 30.734 1.00 9.97   ? 67   LEU A C   1 
ATOM   370  O  O   . LEU A 1 50  ? 47.265 12.571 29.845 1.00 11.64  ? 67   LEU A O   1 
ATOM   371  C  CB  A LEU A 1 50  ? 44.108 12.229 30.310 0.46 8.16   ? 67   LEU A CB  1 
ATOM   372  C  CB  B LEU A 1 50  ? 44.151 12.140 30.330 0.54 9.25   ? 67   LEU A CB  1 
ATOM   373  C  CG  A LEU A 1 50  ? 42.741 12.845 30.577 0.46 8.92   ? 67   LEU A CG  1 
ATOM   374  C  CG  B LEU A 1 50  ? 42.839 12.865 30.107 0.54 8.43   ? 67   LEU A CG  1 
ATOM   375  C  CD1 A LEU A 1 50  ? 42.478 14.080 29.724 0.46 18.78  ? 67   LEU A CD1 1 
ATOM   376  C  CD1 B LEU A 1 50  ? 42.064 12.214 28.970 0.54 18.11  ? 67   LEU A CD1 1 
ATOM   377  C  CD2 A LEU A 1 50  ? 41.632 11.836 30.309 0.46 6.12   ? 67   LEU A CD2 1 
ATOM   378  C  CD2 B LEU A 1 50  ? 41.988 12.874 31.369 0.54 20.57  ? 67   LEU A CD2 1 
ATOM   379  N  N   . GLY A 1 51  ? 46.841 10.946 31.356 1.00 9.45   ? 69   GLY A N   1 
ATOM   380  C  CA  . GLY A 1 51  ? 47.959 10.072 31.057 1.00 15.80  ? 69   GLY A CA  1 
ATOM   381  C  C   . GLY A 1 51  ? 49.294 10.667 31.462 1.00 13.62  ? 69   GLY A C   1 
ATOM   382  O  O   . GLY A 1 51  ? 50.345 10.326 30.939 1.00 13.62  ? 69   GLY A O   1 
ATOM   383  N  N   . GLU A 1 52  ? 49.237 11.594 32.410 1.00 10.80  ? 70   GLU A N   1 
ATOM   384  C  CA  . GLU A 1 52  ? 50.436 12.251 32.875 1.00 9.04   ? 70   GLU A CA  1 
ATOM   385  C  C   . GLU A 1 52  ? 51.252 11.464 33.888 1.00 19.36  ? 70   GLU A C   1 
ATOM   386  O  O   . GLU A 1 52  ? 50.654 10.868 34.773 1.00 14.27  ? 70   GLU A O   1 
ATOM   387  C  CB  . GLU A 1 52  ? 50.084 13.559 33.605 1.00 10.19  ? 70   GLU A CB  1 
ATOM   388  C  CG  . GLU A 1 52  ? 49.729 14.686 32.670 1.00 12.69  ? 70   GLU A CG  1 
ATOM   389  C  CD  . GLU A 1 52  ? 50.885 15.344 31.946 1.00 15.89  ? 70   GLU A CD  1 
ATOM   390  O  OE1 . GLU A 1 52  ? 51.960 14.722 31.860 1.00 12.35  ? 70   GLU A OE1 1 
ATOM   391  O  OE2 . GLU A 1 52  ? 50.716 16.468 31.407 1.00 12.91  ? 70   GLU A OE2 1 
ATOM   392  N  N   . ASP A 1 53  ? 52.581 11.571 33.748 1.00 11.68  ? 71   ASP A N   1 
ATOM   393  C  CA  . ASP A 1 53  ? 53.425 11.243 34.898 1.00 9.19   ? 71   ASP A CA  1 
ATOM   394  C  C   . ASP A 1 53  ? 54.229 12.492 35.261 1.00 12.29  ? 71   ASP A C   1 
ATOM   395  O  O   . ASP A 1 53  ? 53.976 13.183 36.244 1.00 13.62  ? 71   ASP A O   1 
ATOM   396  C  CB  . ASP A 1 53  ? 54.305 10.032 34.657 1.00 14.50  ? 71   ASP A CB  1 
ATOM   397  C  CG  . ASP A 1 53  ? 54.990 9.614  35.955 1.00 17.34  ? 71   ASP A CG  1 
ATOM   398  O  OD1 . ASP A 1 53  ? 54.333 9.676  37.004 1.00 18.29  ? 71   ASP A OD1 1 
ATOM   399  O  OD2 . ASP A 1 53  ? 56.180 9.247  35.946 1.00 21.23  ? 71   ASP A OD2 1 
ATOM   400  N  N   . ASN A 1 54  ? 55.217 12.814 34.426 1.00 11.70  ? 72   ASN A N   1 
ATOM   401  C  CA  . ASN A 1 54  ? 55.968 14.034 34.670 1.00 14.66  ? 72   ASN A CA  1 
ATOM   402  C  C   . ASN A 1 54  ? 55.212 15.195 34.037 1.00 9.74   ? 72   ASN A C   1 
ATOM   403  O  O   . ASN A 1 54  ? 55.026 15.242 32.822 1.00 13.20  ? 72   ASN A O   1 
ATOM   404  C  CB  . ASN A 1 54  ? 57.367 13.937 34.062 1.00 15.07  ? 72   ASN A CB  1 
ATOM   405  C  CG  . ASN A 1 54  ? 58.202 15.142 34.462 1.00 18.88  ? 72   ASN A CG  1 
ATOM   406  O  OD1 . ASN A 1 54  ? 57.763 16.286 34.360 1.00 17.10  ? 72   ASN A OD1 1 
ATOM   407  N  ND2 . ASN A 1 54  ? 59.422 14.917 34.942 1.00 17.66  ? 72   ASN A ND2 1 
ATOM   408  N  N   . ILE A 1 55  ? 54.781 16.146 34.847 1.00 7.92   ? 73   ILE A N   1 
ATOM   409  C  CA  . ILE A 1 55  ? 53.877 17.147 34.274 1.00 15.50  ? 73   ILE A CA  1 
ATOM   410  C  C   . ILE A 1 55  ? 54.617 18.276 33.558 1.00 16.09  ? 73   ILE A C   1 
ATOM   411  O  O   . ILE A 1 55  ? 53.990 19.193 33.041 1.00 13.50  ? 73   ILE A O   1 
ATOM   412  C  CB  . ILE A 1 55  ? 52.952 17.746 35.360 1.00 14.76  ? 73   ILE A CB  1 
ATOM   413  C  CG1 . ILE A 1 55  ? 53.732 18.198 36.585 1.00 16.52  ? 73   ILE A CG1 1 
ATOM   414  C  CG2 . ILE A 1 55  ? 51.832 16.761 35.664 1.00 14.78  ? 73   ILE A CG2 1 
ATOM   415  C  CD1 . ILE A 1 55  ? 53.024 19.073 37.585 1.00 17.62  ? 73   ILE A CD1 1 
ATOM   416  N  N   . ASN A 1 56  ? 55.944 18.182 33.524 1.00 11.46  ? 74   ASN A N   1 
ATOM   417  C  CA  . ASN A 1 56  ? 56.789 19.174 32.890 1.00 8.54   ? 74   ASN A CA  1 
ATOM   418  C  C   . ASN A 1 56  ? 57.478 18.629 31.643 1.00 19.10  ? 74   ASN A C   1 
ATOM   419  O  O   . ASN A 1 56  ? 58.270 19.298 30.998 1.00 16.84  ? 74   ASN A O   1 
ATOM   420  C  CB  . ASN A 1 56  ? 57.834 19.661 33.887 1.00 17.73  ? 74   ASN A CB  1 
ATOM   421  C  CG  . ASN A 1 56  ? 57.318 20.823 34.706 1.00 15.46  ? 74   ASN A CG  1 
ATOM   422  O  OD1 . ASN A 1 56  ? 56.542 21.650 34.229 1.00 10.60  ? 74   ASN A OD1 1 
ATOM   423  N  ND2 . ASN A 1 56  ? 57.778 20.889 35.942 1.00 20.19  ? 74   ASN A ND2 1 
ATOM   424  N  N   . VAL A 1 57  ? 57.187 17.391 31.293 1.00 10.02  ? 75   VAL A N   1 
ATOM   425  C  CA  . VAL A 1 57  ? 57.853 16.703 30.202 1.00 9.79   ? 75   VAL A CA  1 
ATOM   426  C  C   . VAL A 1 57  ? 56.797 15.972 29.401 1.00 11.28  ? 75   VAL A C   1 
ATOM   427  O  O   . VAL A 1 57  ? 55.997 15.220 29.955 1.00 12.62  ? 75   VAL A O   1 
ATOM   428  C  CB  . VAL A 1 57  ? 58.904 15.690 30.687 1.00 15.76  ? 75   VAL A CB  1 
ATOM   429  C  CG1 . VAL A 1 57  ? 59.507 14.999 29.462 1.00 27.15  ? 75   VAL A CG1 1 
ATOM   430  C  CG2 . VAL A 1 57  ? 59.986 16.335 31.541 1.00 20.42  ? 75   VAL A CG2 1 
ATOM   431  N  N   . VAL A 1 58  ? 56.813 16.186 28.100 1.00 13.28  ? 76   VAL A N   1 
ATOM   432  C  CA  . VAL A 1 58  ? 55.924 15.379 27.280 1.00 12.04  ? 76   VAL A CA  1 
ATOM   433  C  C   . VAL A 1 58  ? 56.533 14.015 27.042 1.00 19.95  ? 76   VAL A C   1 
ATOM   434  O  O   . VAL A 1 58  ? 57.583 13.904 26.418 1.00 17.94  ? 76   VAL A O   1 
ATOM   435  C  CB  . VAL A 1 58  ? 55.690 16.104 25.939 1.00 19.15  ? 76   VAL A CB  1 
ATOM   436  C  CG1 . VAL A 1 58  ? 54.954 15.169 25.000 1.00 22.41  ? 76   VAL A CG1 1 
ATOM   437  C  CG2 . VAL A 1 58  ? 54.937 17.399 26.200 1.00 14.40  ? 76   VAL A CG2 1 
ATOM   438  N  N   . GLU A 1 59  ? 55.922 12.955 27.514 1.00 15.42  ? 77   GLU A N   1 
ATOM   439  C  CA  . GLU A 1 59  ? 56.529 11.621 27.529 1.00 13.90  ? 77   GLU A CA  1 
ATOM   440  C  C   . GLU A 1 59  ? 55.902 10.697 26.498 1.00 23.47  ? 77   GLU A C   1 
ATOM   441  O  O   . GLU A 1 59  ? 56.514 9.681  26.154 1.00 30.14  ? 77   GLU A O   1 
ATOM   442  C  CB  . GLU A 1 59  ? 56.436 11.058 28.941 1.00 14.64  ? 77   GLU A CB  1 
ATOM   443  C  CG  . GLU A 1 59  ? 57.218 11.883 29.952 1.00 18.37  ? 77   GLU A CG  1 
ATOM   444  C  CD  . GLU A 1 59  ? 57.271 11.339 31.356 1.00 31.13  ? 77   GLU A CD  1 
ATOM   445  O  OE1 . GLU A 1 59  ? 56.273 11.383 32.107 1.00 16.50  ? 77   GLU A OE1 1 
ATOM   446  O  OE2 . GLU A 1 59  ? 58.356 10.856 31.761 1.00 29.27  ? 77   GLU A OE2 1 
ATOM   447  N  N   . GLY A 1 60  ? 54.731 11.051 25.974 1.00 25.28  ? 78   GLY A N   1 
ATOM   448  C  CA  . GLY A 1 60  ? 54.107 10.317 24.892 1.00 37.09  ? 78   GLY A CA  1 
ATOM   449  C  C   . GLY A 1 60  ? 52.761 9.698  25.172 1.00 32.05  ? 78   GLY A C   1 
ATOM   450  O  O   . GLY A 1 60  ? 52.038 9.285  24.252 1.00 37.77  ? 78   GLY A O   1 
ATOM   451  N  N   . ASN A 1 61  ? 52.341 9.587  26.433 1.00 16.94  ? 79   ASN A N   1 
ATOM   452  C  CA  . ASN A 1 61  ? 51.007 9.047  26.665 1.00 18.59  ? 79   ASN A CA  1 
ATOM   453  C  C   . ASN A 1 61  ? 49.979 10.095 27.052 1.00 20.99  ? 79   ASN A C   1 
ATOM   454  O  O   . ASN A 1 61  ? 48.901 9.732  27.536 1.00 23.71  ? 79   ASN A O   1 
ATOM   455  C  CB  . ASN A 1 61  ? 51.047 8.000  27.796 1.00 26.00  ? 79   ASN A CB  1 
ATOM   456  C  CG  . ASN A 1 61  ? 51.970 6.860  27.366 1.00 34.59  ? 79   ASN A CG  1 
ATOM   457  O  OD1 . ASN A 1 61  ? 53.004 6.628  27.985 1.00 43.38  ? 79   ASN A OD1 1 
ATOM   458  N  ND2 . ASN A 1 61  ? 51.566 6.192  26.295 1.00 29.88  ? 79   ASN A ND2 1 
ATOM   459  N  N   . GLU A 1 62  ? 50.279 11.379 26.868 1.00 15.90  ? 80   GLU A N   1 
ATOM   460  C  CA  . GLU A 1 62  ? 49.328 12.394 27.315 1.00 13.59  ? 80   GLU A CA  1 
ATOM   461  C  C   . GLU A 1 62  ? 48.192 12.632 26.323 1.00 12.07  ? 80   GLU A C   1 
ATOM   462  O  O   . GLU A 1 62  ? 48.398 12.513 25.113 1.00 13.65  ? 80   GLU A O   1 
ATOM   463  C  CB  . GLU A 1 62  ? 50.046 13.729 27.519 1.00 16.87  ? 80   GLU A CB  1 
ATOM   464  C  CG  . GLU A 1 62  ? 51.096 13.738 28.619 1.00 14.69  ? 80   GLU A CG  1 
ATOM   465  C  CD  . GLU A 1 62  ? 52.497 13.500 28.074 1.00 11.28  ? 80   GLU A CD  1 
ATOM   466  O  OE1 . GLU A 1 62  ? 52.590 13.046 26.921 1.00 13.31  ? 80   GLU A OE1 1 
ATOM   467  O  OE2 . GLU A 1 62  ? 53.481 13.764 28.812 1.00 11.12  ? 80   GLU A OE2 1 
ATOM   468  N  N   . GLN A 1 63  ? 47.051 13.012 26.850 1.00 10.05  ? 81   GLN A N   1 
ATOM   469  C  CA  . GLN A 1 63  ? 45.932 13.603 26.126 1.00 7.17   ? 81   GLN A CA  1 
ATOM   470  C  C   . GLN A 1 63  ? 45.583 14.926 26.802 1.00 15.88  ? 81   GLN A C   1 
ATOM   471  O  O   . GLN A 1 63  ? 45.343 14.896 28.010 1.00 11.77  ? 81   GLN A O   1 
ATOM   472  C  CB  . GLN A 1 63  ? 44.698 12.717 26.062 1.00 13.74  ? 81   GLN A CB  1 
ATOM   473  C  CG  . GLN A 1 63  ? 45.073 11.327 25.562 1.00 16.59  ? 81   GLN A CG  1 
ATOM   474  C  CD  . GLN A 1 63  ? 43.897 10.381 25.661 1.00 16.44  ? 81   GLN A CD  1 
ATOM   475  O  OE1 . GLN A 1 63  ? 42.781 10.801 25.361 1.00 15.96  ? 81   GLN A OE1 1 
ATOM   476  N  NE2 . GLN A 1 63  ? 44.185 9.152  26.061 1.00 17.51  ? 81   GLN A NE2 1 
ATOM   477  N  N   . PHE A 1 64  ? 45.576 15.999 26.024 1.00 13.46  ? 82   PHE A N   1 
ATOM   478  C  CA  . PHE A 1 64  ? 45.250 17.314 26.601 1.00 8.61   ? 82   PHE A CA  1 
ATOM   479  C  C   . PHE A 1 64  ? 43.880 17.723 26.095 1.00 15.48  ? 82   PHE A C   1 
ATOM   480  O  O   . PHE A 1 64  ? 43.689 17.803 24.871 1.00 17.85  ? 82   PHE A O   1 
ATOM   481  C  CB  . PHE A 1 64  ? 46.302 18.336 26.209 1.00 13.62  ? 82   PHE A CB  1 
ATOM   482  C  CG  . PHE A 1 64  ? 47.713 18.122 26.720 1.00 12.40  ? 82   PHE A CG  1 
ATOM   483  C  CD1 . PHE A 1 64  ? 48.746 18.825 26.118 1.00 21.46  ? 82   PHE A CD1 1 
ATOM   484  C  CD2 . PHE A 1 64  ? 48.011 17.272 27.753 1.00 9.88   ? 82   PHE A CD2 1 
ATOM   485  C  CE1 . PHE A 1 64  ? 50.039 18.659 26.576 1.00 21.80  ? 82   PHE A CE1 1 
ATOM   486  C  CE2 . PHE A 1 64  ? 49.296 17.080 28.224 1.00 13.80  ? 82   PHE A CE2 1 
ATOM   487  C  CZ  . PHE A 1 64  ? 50.314 17.803 27.622 1.00 19.97  ? 82   PHE A CZ  1 
ATOM   488  N  N   . ILE A 1 65  ? 42.906 17.967 26.964 1.00 13.51  ? 83   ILE A N   1 
ATOM   489  C  CA  . ILE A 1 65  ? 41.551 18.207 26.453 1.00 12.99  ? 83   ILE A CA  1 
ATOM   490  C  C   . ILE A 1 65  ? 40.917 19.334 27.245 1.00 11.16  ? 83   ILE A C   1 
ATOM   491  O  O   . ILE A 1 65  ? 40.910 19.332 28.476 1.00 10.34  ? 83   ILE A O   1 
ATOM   492  C  CB  . ILE A 1 65  ? 40.676 16.949 26.524 1.00 16.35  ? 83   ILE A CB  1 
ATOM   493  C  CG1 . ILE A 1 65  ? 41.297 15.691 25.903 1.00 20.65  ? 83   ILE A CG1 1 
ATOM   494  C  CG2 . ILE A 1 65  ? 39.318 17.171 25.866 1.00 17.05  ? 83   ILE A CG2 1 
ATOM   495  C  CD1 . ILE A 1 65  ? 40.520 14.423 26.183 1.00 32.79  ? 83   ILE A CD1 1 
ATOM   496  N  N   . SER A 1 66  ? 40.415 20.320 26.512 1.00 12.36  ? 84   SER A N   1 
ATOM   497  C  CA  . SER A 1 66  ? 39.810 21.465 27.182 1.00 14.03  ? 84   SER A CA  1 
ATOM   498  C  C   . SER A 1 66  ? 38.457 21.054 27.770 1.00 12.50  ? 84   SER A C   1 
ATOM   499  O  O   . SER A 1 66  ? 37.805 20.134 27.269 1.00 15.36  ? 84   SER A O   1 
ATOM   500  C  CB  A SER A 1 66  ? 39.617 22.627 26.213 0.32 21.00  ? 84   SER A CB  1 
ATOM   501  C  CB  B SER A 1 66  ? 39.681 22.671 26.259 0.68 23.02  ? 84   SER A CB  1 
ATOM   502  O  OG  A SER A 1 66  ? 40.660 22.799 25.271 0.32 7.61   ? 84   SER A OG  1 
ATOM   503  O  OG  B SER A 1 66  ? 40.767 23.566 26.530 0.68 31.46  ? 84   SER A OG  1 
ATOM   504  N  N   . ALA A 1 67  ? 38.073 21.755 28.822 1.00 11.64  ? 85   ALA A N   1 
ATOM   505  C  CA  . ALA A 1 67  ? 36.776 21.509 29.447 1.00 13.31  ? 85   ALA A CA  1 
ATOM   506  C  C   . ALA A 1 67  ? 35.727 22.301 28.692 1.00 8.11   ? 85   ALA A C   1 
ATOM   507  O  O   . ALA A 1 67  ? 35.911 23.431 28.239 1.00 16.14  ? 85   ALA A O   1 
ATOM   508  C  CB  . ALA A 1 67  ? 36.782 21.838 30.922 1.00 13.79  ? 85   ALA A CB  1 
ATOM   509  N  N   . SER A 1 68  ? 34.571 21.664 28.509 1.00 9.47   ? 86   SER A N   1 
ATOM   510  C  CA  . SER A 1 68  ? 33.472 22.344 27.840 1.00 13.30  ? 86   SER A CA  1 
ATOM   511  C  C   . SER A 1 68  ? 32.548 23.030 28.841 1.00 9.65   ? 86   SER A C   1 
ATOM   512  O  O   . SER A 1 68  ? 31.924 24.052 28.559 1.00 15.27  ? 86   SER A O   1 
ATOM   513  C  CB  . SER A 1 68  ? 32.668 21.341 27.017 1.00 15.82  ? 86   SER A CB  1 
ATOM   514  O  OG  . SER A 1 68  ? 32.039 20.386 27.847 1.00 26.32  ? 86   SER A OG  1 
ATOM   515  N  N   . LYS A 1 69  ? 32.431 22.443 30.018 1.00 14.14  ? 87   LYS A N   1 
ATOM   516  C  CA  . LYS A 1 69  ? 31.449 22.783 31.049 1.00 13.32  ? 87   LYS A CA  1 
ATOM   517  C  C   . LYS A 1 69  ? 31.959 22.365 32.426 1.00 11.61  ? 87   LYS A C   1 
ATOM   518  O  O   . LYS A 1 69  ? 32.549 21.288 32.539 1.00 12.09  ? 87   LYS A O   1 
ATOM   519  C  CB  . LYS A 1 69  ? 30.137 22.057 30.740 1.00 17.09  ? 87   LYS A CB  1 
ATOM   520  C  CG  . LYS A 1 69  ? 28.855 22.653 31.256 1.00 31.30  ? 87   LYS A CG  1 
ATOM   521  C  CD  . LYS A 1 69  ? 27.638 21.853 30.795 1.00 31.60  ? 87   LYS A CD  1 
ATOM   522  C  CE  . LYS A 1 69  ? 26.370 22.699 30.790 1.00 32.30  ? 87   LYS A CE  1 
ATOM   523  N  NZ  . LYS A 1 69  ? 25.189 21.926 30.305 1.00 36.71  ? 87   LYS A NZ  1 
ATOM   524  N  N   . SER A 1 70  ? 31.729 23.189 33.438 1.00 7.68   ? 88   SER A N   1 
ATOM   525  C  CA  . SER A 1 70  ? 32.065 22.842 34.805 1.00 10.66  ? 88   SER A CA  1 
ATOM   526  C  C   . SER A 1 70  ? 30.812 23.068 35.639 1.00 10.52  ? 88   SER A C   1 
ATOM   527  O  O   . SER A 1 70  ? 30.127 24.059 35.405 1.00 13.28  ? 88   SER A O   1 
ATOM   528  C  CB  . SER A 1 70  ? 33.170 23.724 35.391 1.00 16.28  ? 88   SER A CB  1 
ATOM   529  O  OG  . SER A 1 70  ? 34.375 23.491 34.687 1.00 26.36  ? 88   SER A OG  1 
ATOM   530  N  N   . ILE A 1 71  ? 30.583 22.151 36.553 1.00 11.52  ? 89   ILE A N   1 
ATOM   531  C  CA  . ILE A 1 71  ? 29.397 22.205 37.398 1.00 11.30  ? 89   ILE A CA  1 
ATOM   532  C  C   . ILE A 1 71  ? 29.811 21.994 38.841 1.00 6.67   ? 89   ILE A C   1 
ATOM   533  O  O   . ILE A 1 71  ? 30.174 20.903 39.264 1.00 9.28   ? 89   ILE A O   1 
ATOM   534  C  CB  . ILE A 1 71  ? 28.370 21.149 36.970 1.00 10.34  ? 89   ILE A CB  1 
ATOM   535  C  CG1 . ILE A 1 71  ? 27.954 21.258 35.504 1.00 12.09  ? 89   ILE A CG1 1 
ATOM   536  C  CG2 . ILE A 1 71  ? 27.174 21.191 37.915 1.00 8.46   ? 89   ILE A CG2 1 
ATOM   537  C  CD1 . ILE A 1 71  ? 27.209 20.039 35.002 1.00 15.31  ? 89   ILE A CD1 1 
ATOM   538  N  N   . VAL A 1 72  ? 29.755 23.099 39.597 1.00 11.47  ? 90   VAL A N   1 
ATOM   539  C  CA  . VAL A 1 72  ? 30.044 23.028 41.029 1.00 13.02  ? 90   VAL A CA  1 
ATOM   540  C  C   . VAL A 1 72  ? 28.806 22.532 41.744 1.00 9.41   ? 90   VAL A C   1 
ATOM   541  O  O   . VAL A 1 72  ? 27.704 22.886 41.303 1.00 13.15  ? 90   VAL A O   1 
ATOM   542  C  CB  . VAL A 1 72  ? 30.449 24.409 41.566 1.00 11.09  ? 90   VAL A CB  1 
ATOM   543  C  CG1 . VAL A 1 72  ? 30.491 24.454 43.077 1.00 16.42  ? 90   VAL A CG1 1 
ATOM   544  C  CG2 . VAL A 1 72  ? 31.797 24.791 40.962 1.00 10.71  ? 90   VAL A CG2 1 
ATOM   545  N  N   . HIS A 1 73  ? 28.980 21.772 42.820 1.00 7.82   ? 91   HIS A N   1 
ATOM   546  C  CA  . HIS A 1 73  ? 27.805 21.294 43.543 1.00 10.83  ? 91   HIS A CA  1 
ATOM   547  C  C   . HIS A 1 73  ? 26.865 22.431 43.923 1.00 7.84   ? 91   HIS A C   1 
ATOM   548  O  O   . HIS A 1 73  ? 27.313 23.498 44.355 1.00 13.02  ? 91   HIS A O   1 
ATOM   549  C  CB  . HIS A 1 73  ? 28.261 20.496 44.774 1.00 10.51  ? 91   HIS A CB  1 
ATOM   550  C  CG  . HIS A 1 73  ? 27.159 19.643 45.312 1.00 10.48  ? 91   HIS A CG  1 
ATOM   551  N  ND1 . HIS A 1 73  ? 26.390 20.119 46.335 1.00 11.15  ? 91   HIS A ND1 1 
ATOM   552  C  CD2 . HIS A 1 73  ? 26.671 18.417 45.086 1.00 7.74   ? 91   HIS A CD2 1 
ATOM   553  C  CE1 . HIS A 1 73  ? 25.455 19.282 46.705 1.00 12.87  ? 91   HIS A CE1 1 
ATOM   554  N  NE2 . HIS A 1 73  ? 25.624 18.215 45.942 1.00 13.26  ? 91   HIS A NE2 1 
ATOM   555  N  N   . PRO A 1 74  ? 25.565 22.263 43.768 1.00 9.63   ? 92   PRO A N   1 
ATOM   556  C  CA  . PRO A 1 74  ? 24.607 23.351 44.038 1.00 14.06  ? 92   PRO A CA  1 
ATOM   557  C  C   . PRO A 1 74  ? 24.604 23.931 45.439 1.00 11.69  ? 92   PRO A C   1 
ATOM   558  O  O   . PRO A 1 74  ? 24.226 25.073 45.716 1.00 13.85  ? 92   PRO A O   1 
ATOM   559  C  CB  . PRO A 1 74  ? 23.242 22.673 43.854 1.00 18.04  ? 92   PRO A CB  1 
ATOM   560  C  CG  . PRO A 1 74  ? 23.479 21.218 43.820 1.00 21.08  ? 92   PRO A CG  1 
ATOM   561  C  CD  . PRO A 1 74  ? 24.861 21.061 43.276 1.00 12.32  ? 92   PRO A CD  1 
ATOM   562  N  N   . SER A 1 75  ? 25.008 23.168 46.415 1.00 9.11   ? 93   SER A N   1 
ATOM   563  C  CA  . SER A 1 75  ? 25.150 23.532 47.820 1.00 12.80  ? 93   SER A CA  1 
ATOM   564  C  C   . SER A 1 75  ? 26.589 23.663 48.314 1.00 15.12  ? 93   SER A C   1 
ATOM   565  O  O   . SER A 1 75  ? 26.860 23.720 49.516 1.00 10.59  ? 93   SER A O   1 
ATOM   566  C  CB  . SER A 1 75  ? 24.403 22.531 48.727 1.00 19.50  ? 93   SER A CB  1 
ATOM   567  O  OG  . SER A 1 75  ? 23.151 22.222 48.145 1.00 19.87  ? 93   SER A OG  1 
ATOM   568  N  N   . TYR A 1 76  ? 27.583 23.762 47.440 1.00 8.92   ? 94   TYR A N   1 
ATOM   569  C  CA  . TYR A 1 76  ? 28.947 24.055 47.847 1.00 9.71   ? 94   TYR A CA  1 
ATOM   570  C  C   . TYR A 1 76  ? 29.014 25.322 48.703 1.00 11.19  ? 94   TYR A C   1 
ATOM   571  O  O   . TYR A 1 76  ? 28.512 26.379 48.338 1.00 11.15  ? 94   TYR A O   1 
ATOM   572  C  CB  . TYR A 1 76  ? 29.879 24.192 46.644 1.00 9.11   ? 94   TYR A CB  1 
ATOM   573  C  CG  . TYR A 1 76  ? 31.270 24.675 46.992 1.00 10.90  ? 94   TYR A CG  1 
ATOM   574  C  CD1 . TYR A 1 76  ? 31.821 25.795 46.405 1.00 12.59  ? 94   TYR A CD1 1 
ATOM   575  C  CD2 . TYR A 1 76  ? 32.040 23.982 47.926 1.00 10.56  ? 94   TYR A CD2 1 
ATOM   576  C  CE1 . TYR A 1 76  ? 33.096 26.238 46.724 1.00 14.69  ? 94   TYR A CE1 1 
ATOM   577  C  CE2 . TYR A 1 76  ? 33.314 24.424 48.246 1.00 9.33   ? 94   TYR A CE2 1 
ATOM   578  C  CZ  . TYR A 1 76  ? 33.847 25.542 47.655 1.00 11.49  ? 94   TYR A CZ  1 
ATOM   579  O  OH  . TYR A 1 76  ? 35.123 25.936 48.000 1.00 10.68  ? 94   TYR A OH  1 
ATOM   580  N  N   . ASN A 1 77  ? 29.680 25.206 49.846 1.00 11.09  ? 95   ASN A N   1 
ATOM   581  C  CA  . ASN A 1 77  ? 29.844 26.362 50.740 1.00 14.85  ? 95   ASN A CA  1 
ATOM   582  C  C   . ASN A 1 77  ? 31.333 26.636 50.916 1.00 12.95  ? 95   ASN A C   1 
ATOM   583  O  O   . ASN A 1 77  ? 31.969 25.838 51.588 1.00 13.29  ? 95   ASN A O   1 
ATOM   584  C  CB  . ASN A 1 77  ? 29.170 26.080 52.065 1.00 12.75  ? 95   ASN A CB  1 
ATOM   585  C  CG  . ASN A 1 77  ? 29.257 27.199 53.085 1.00 20.50  ? 95   ASN A CG  1 
ATOM   586  O  OD1 . ASN A 1 77  ? 30.123 28.064 53.051 1.00 13.74  ? 95   ASN A OD1 1 
ATOM   587  N  ND2 . ASN A 1 77  ? 28.321 27.174 54.031 1.00 23.07  ? 95   ASN A ND2 1 
ATOM   588  N  N   . SER A 1 78  ? 31.827 27.708 50.304 1.00 11.03  ? 96   SER A N   1 
ATOM   589  C  CA  . SER A 1 78  ? 33.258 27.980 50.296 1.00 9.67   ? 96   SER A CA  1 
ATOM   590  C  C   . SER A 1 78  ? 33.823 28.291 51.680 1.00 18.64  ? 96   SER A C   1 
ATOM   591  O  O   . SER A 1 78  ? 35.042 28.240 51.870 1.00 22.24  ? 96   SER A O   1 
ATOM   592  C  CB  . SER A 1 78  ? 33.621 29.155 49.396 1.00 15.29  ? 96   SER A CB  1 
ATOM   593  O  OG  . SER A 1 78  ? 32.842 30.297 49.663 1.00 17.69  ? 96   SER A OG  1 
ATOM   594  N  N   . ASN A 1 79  ? 32.965 28.637 52.621 1.00 14.91  ? 97   ASN A N   1 
ATOM   595  C  CA  . ASN A 1 79  ? 33.497 29.022 53.914 1.00 18.23  ? 97   ASN A CA  1 
ATOM   596  C  C   . ASN A 1 79  ? 33.829 27.803 54.764 1.00 17.38  ? 97   ASN A C   1 
ATOM   597  O  O   . ASN A 1 79  ? 34.844 27.838 55.454 1.00 26.20  ? 97   ASN A O   1 
ATOM   598  C  CB  . ASN A 1 79  ? 32.475 29.929 54.617 1.00 20.01  ? 97   ASN A CB  1 
ATOM   599  C  CG  . ASN A 1 79  ? 32.369 31.213 53.778 1.00 27.03  ? 97   ASN A CG  1 
ATOM   600  O  OD1 . ASN A 1 79  ? 33.384 31.799 53.396 1.00 37.66  ? 97   ASN A OD1 1 
ATOM   601  N  ND2 . ASN A 1 79  ? 31.153 31.631 53.487 1.00 38.91  ? 97   ASN A ND2 1 
ATOM   602  N  N   . THR A 1 80  ? 32.997 26.777 54.698 1.00 15.58  ? 98   THR A N   1 
ATOM   603  C  CA  . THR A 1 80  ? 33.084 25.579 55.510 1.00 15.16  ? 98   THR A CA  1 
ATOM   604  C  C   . THR A 1 80  ? 33.616 24.373 54.732 1.00 11.80  ? 98   THR A C   1 
ATOM   605  O  O   . THR A 1 80  ? 34.011 23.372 55.335 1.00 12.65  ? 98   THR A O   1 
ATOM   606  C  CB  . THR A 1 80  ? 31.713 25.206 56.080 1.00 17.12  ? 98   THR A CB  1 
ATOM   607  O  OG1 . THR A 1 80  ? 30.732 25.104 55.042 1.00 17.11  ? 98   THR A OG1 1 
ATOM   608  C  CG2 . THR A 1 80  ? 31.106 26.303 56.964 1.00 20.94  ? 98   THR A CG2 1 
ATOM   609  N  N   . LEU A 1 81  ? 33.608 24.474 53.426 1.00 10.29  ? 99   LEU A N   1 
ATOM   610  C  CA  . LEU A 1 81  ? 34.026 23.504 52.433 1.00 10.03  ? 99   LEU A CA  1 
ATOM   611  C  C   . LEU A 1 81  ? 33.146 22.264 52.377 1.00 10.68  ? 99   LEU A C   1 
ATOM   612  O  O   . LEU A 1 81  ? 33.491 21.192 51.897 1.00 11.53  ? 99   LEU A O   1 
ATOM   613  C  CB  . LEU A 1 81  ? 35.475 23.071 52.683 1.00 11.82  ? 99   LEU A CB  1 
ATOM   614  C  CG  . LEU A 1 81  ? 36.584 24.030 52.252 1.00 22.46  ? 99   LEU A CG  1 
ATOM   615  C  CD1 . LEU A 1 81  ? 37.686 23.298 51.497 1.00 40.57  ? 99   LEU A CD1 1 
ATOM   616  C  CD2 . LEU A 1 81  ? 36.006 25.147 51.393 1.00 44.76  ? 99   LEU A CD2 1 
ATOM   617  N  N   . ASN A 1 82  ? 31.929 22.401 52.840 1.00 12.12  ? 100  ASN A N   1 
ATOM   618  C  CA  . ASN A 1 82  ? 30.842 21.448 52.740 1.00 7.54   ? 100  ASN A CA  1 
ATOM   619  C  C   . ASN A 1 82  ? 30.445 21.347 51.262 1.00 6.04   ? 100  ASN A C   1 
ATOM   620  O  O   . ASN A 1 82  ? 30.319 22.376 50.604 1.00 10.48  ? 100  ASN A O   1 
ATOM   621  C  CB  . ASN A 1 82  ? 29.642 21.826 53.600 1.00 12.11  ? 100  ASN A CB  1 
ATOM   622  C  CG  . ASN A 1 82  ? 28.758 20.637 53.912 1.00 10.86  ? 100  ASN A CG  1 
ATOM   623  O  OD1 . ASN A 1 82  ? 29.135 19.450 53.898 1.00 14.74  ? 100  ASN A OD1 1 
ATOM   624  N  ND2 . ASN A 1 82  ? 27.505 20.957 54.197 1.00 15.58  ? 100  ASN A ND2 1 
ATOM   625  N  N   . ASN A 1 83  ? 30.323 20.123 50.795 1.00 9.83   ? 101  ASN A N   1 
ATOM   626  C  CA  . ASN A 1 83  ? 29.942 19.808 49.424 1.00 7.51   ? 101  ASN A CA  1 
ATOM   627  C  C   . ASN A 1 83  ? 31.030 20.267 48.461 1.00 5.70   ? 101  ASN A C   1 
ATOM   628  O  O   . ASN A 1 83  ? 30.692 20.851 47.436 1.00 7.25   ? 101  ASN A O   1 
ATOM   629  C  CB  . ASN A 1 83  ? 28.591 20.426 49.093 1.00 6.21   ? 101  ASN A CB  1 
ATOM   630  C  CG  . ASN A 1 83  ? 27.462 19.964 50.005 1.00 9.82   ? 101  ASN A CG  1 
ATOM   631  O  OD1 . ASN A 1 83  ? 27.179 18.768 50.147 1.00 12.62  ? 101  ASN A OD1 1 
ATOM   632  N  ND2 . ASN A 1 83  ? 26.811 20.922 50.647 1.00 13.02  ? 101  ASN A ND2 1 
ATOM   633  N  N   . ASP A 1 84  ? 32.269 19.965 48.801 1.00 7.50   ? 102  ASP A N   1 
ATOM   634  C  CA  . ASP A 1 84  ? 33.444 20.323 48.022 1.00 8.01   ? 102  ASP A CA  1 
ATOM   635  C  C   . ASP A 1 84  ? 33.656 19.313 46.890 1.00 10.29  ? 102  ASP A C   1 
ATOM   636  O  O   . ASP A 1 84  ? 34.514 18.453 46.926 1.00 8.45   ? 102  ASP A O   1 
ATOM   637  C  CB  . ASP A 1 84  ? 34.708 20.425 48.868 1.00 7.99   ? 102  ASP A CB  1 
ATOM   638  C  CG  . ASP A 1 84  ? 35.843 21.120 48.158 1.00 12.44  ? 102  ASP A CG  1 
ATOM   639  O  OD1 . ASP A 1 84  ? 35.601 21.705 47.088 1.00 8.33   ? 102  ASP A OD1 1 
ATOM   640  O  OD2 . ASP A 1 84  ? 36.987 21.112 48.673 1.00 12.11  ? 102  ASP A OD2 1 
ATOM   641  N  N   . ILE A 1 85  ? 32.821 19.472 45.868 1.00 7.84   ? 103  ILE A N   1 
ATOM   642  C  CA  . ILE A 1 85  ? 32.862 18.596 44.704 1.00 5.66   ? 103  ILE A CA  1 
ATOM   643  C  C   . ILE A 1 85  ? 32.304 19.313 43.473 1.00 10.66  ? 103  ILE A C   1 
ATOM   644  O  O   . ILE A 1 85  ? 31.370 20.107 43.537 1.00 8.47   ? 103  ILE A O   1 
ATOM   645  C  CB  . ILE A 1 85  ? 32.103 17.284 44.935 1.00 7.73   ? 103  ILE A CB  1 
ATOM   646  C  CG1 . ILE A 1 85  ? 32.169 16.293 43.772 1.00 6.75   ? 103  ILE A CG1 1 
ATOM   647  C  CG2 . ILE A 1 85  ? 30.656 17.581 45.282 1.00 11.15  ? 103  ILE A CG2 1 
ATOM   648  C  CD1 . ILE A 1 85  ? 31.712 14.898 44.125 1.00 16.09  ? 103  ILE A CD1 1 
ATOM   649  N  N   . MET A 1 86  ? 32.931 18.975 42.341 1.00 11.49  ? 104  MET A N   1 
ATOM   650  C  CA  . MET A 1 86  ? 32.560 19.591 41.057 1.00 7.96   ? 104  MET A CA  1 
ATOM   651  C  C   . MET A 1 86  ? 32.781 18.605 39.922 1.00 4.88   ? 104  MET A C   1 
ATOM   652  O  O   . MET A 1 86  ? 33.666 17.747 40.024 1.00 9.68   ? 104  MET A O   1 
ATOM   653  C  CB  . MET A 1 86  ? 33.363 20.855 40.860 1.00 12.44  ? 104  MET A CB  1 
ATOM   654  C  CG  . MET A 1 86  ? 34.127 21.033 39.584 1.00 22.72  ? 104  MET A CG  1 
ATOM   655  S  SD  . MET A 1 86  ? 35.001 22.622 39.555 1.00 19.99  ? 104  MET A SD  1 
ATOM   656  C  CE  . MET A 1 86  ? 36.686 22.022 39.545 1.00 23.86  ? 104  MET A CE  1 
ATOM   657  N  N   . LEU A 1 87  ? 31.987 18.713 38.877 1.00 7.27   ? 105  LEU A N   1 
ATOM   658  C  CA  . LEU A 1 87  ? 32.090 17.897 37.686 1.00 6.59   ? 105  LEU A CA  1 
ATOM   659  C  C   . LEU A 1 87  ? 32.608 18.724 36.525 1.00 6.62   ? 105  LEU A C   1 
ATOM   660  O  O   . LEU A 1 87  ? 32.206 19.875 36.351 1.00 10.97  ? 105  LEU A O   1 
ATOM   661  C  CB  . LEU A 1 87  ? 30.722 17.295 37.312 1.00 5.79   ? 105  LEU A CB  1 
ATOM   662  C  CG  . LEU A 1 87  ? 30.271 16.217 38.307 1.00 14.64  ? 105  LEU A CG  1 
ATOM   663  C  CD1 . LEU A 1 87  ? 28.780 16.009 38.190 1.00 17.03  ? 105  LEU A CD1 1 
ATOM   664  C  CD2 . LEU A 1 87  ? 31.052 14.945 38.036 1.00 14.99  ? 105  LEU A CD2 1 
ATOM   665  N  N   . ILE A 1 88  ? 33.484 18.177 35.723 1.00 7.01   ? 106  ILE A N   1 
ATOM   666  C  CA  . ILE A 1 88  ? 34.020 18.862 34.557 1.00 7.72   ? 106  ILE A CA  1 
ATOM   667  C  C   . ILE A 1 88  ? 33.764 18.005 33.331 1.00 12.14  ? 106  ILE A C   1 
ATOM   668  O  O   . ILE A 1 88  ? 34.142 16.836 33.346 1.00 10.35  ? 106  ILE A O   1 
ATOM   669  C  CB  . ILE A 1 88  ? 35.532 19.115 34.693 1.00 8.13   ? 106  ILE A CB  1 
ATOM   670  C  CG1 . ILE A 1 88  ? 35.886 19.809 36.007 1.00 12.55  ? 106  ILE A CG1 1 
ATOM   671  C  CG2 . ILE A 1 88  ? 36.054 19.866 33.488 1.00 14.78  ? 106  ILE A CG2 1 
ATOM   672  C  CD1 . ILE A 1 88  ? 37.347 20.107 36.166 1.00 14.74  ? 106  ILE A CD1 1 
ATOM   673  N  N   . LYS A 1 89  ? 33.118 18.601 32.346 1.00 9.46   ? 107  LYS A N   1 
ATOM   674  C  CA  . LYS A 1 89  ? 32.904 17.870 31.097 1.00 7.61   ? 107  LYS A CA  1 
ATOM   675  C  C   . LYS A 1 89  ? 33.981 18.236 30.052 1.00 7.15   ? 107  LYS A C   1 
ATOM   676  O  O   . LYS A 1 89  ? 34.277 19.415 29.837 1.00 12.92  ? 107  LYS A O   1 
ATOM   677  C  CB  . LYS A 1 89  ? 31.524 18.152 30.523 1.00 14.85  ? 107  LYS A CB  1 
ATOM   678  C  CG  . LYS A 1 89  ? 31.109 17.124 29.475 1.00 17.52  ? 107  LYS A CG  1 
ATOM   679  C  CD  . LYS A 1 89  ? 29.873 17.568 28.716 1.00 19.98  ? 107  LYS A CD  1 
ATOM   680  C  CE  . LYS A 1 89  ? 29.333 16.386 27.913 1.00 16.01  ? 107  LYS A CE  1 
ATOM   681  N  NZ  . LYS A 1 89  ? 28.157 16.797 27.098 1.00 17.70  ? 107  LYS A NZ  1 
ATOM   682  N  N   . LEU A 1 90  ? 34.528 17.215 29.424 1.00 8.69   ? 108  LEU A N   1 
ATOM   683  C  CA  . LEU A 1 90  ? 35.531 17.311 28.376 1.00 13.41  ? 108  LEU A CA  1 
ATOM   684  C  C   . LEU A 1 90  ? 34.895 17.651 27.023 1.00 20.30  ? 108  LEU A C   1 
ATOM   685  O  O   . LEU A 1 90  ? 33.861 17.102 26.637 1.00 12.70  ? 108  LEU A O   1 
ATOM   686  C  CB  . LEU A 1 90  ? 36.307 16.010 28.223 1.00 13.36  ? 108  LEU A CB  1 
ATOM   687  C  CG  . LEU A 1 90  ? 37.044 15.434 29.427 1.00 15.78  ? 108  LEU A CG  1 
ATOM   688  C  CD1 . LEU A 1 90  ? 37.735 14.126 29.084 1.00 15.70  ? 108  LEU A CD1 1 
ATOM   689  C  CD2 . LEU A 1 90  ? 38.044 16.451 29.963 1.00 17.74  ? 108  LEU A CD2 1 
ATOM   690  N  N   . LYS A 1 91  ? 35.540 18.562 26.301 1.00 15.41  ? 109  LYS A N   1 
ATOM   691  C  CA  . LYS A 1 91  ? 35.078 19.010 24.994 1.00 17.01  ? 109  LYS A CA  1 
ATOM   692  C  C   . LYS A 1 91  ? 34.942 17.856 24.014 1.00 11.04  ? 109  LYS A C   1 
ATOM   693  O  O   . LYS A 1 91  ? 34.029 17.823 23.187 1.00 18.19  ? 109  LYS A O   1 
ATOM   694  C  CB  . LYS A 1 91  ? 36.049 20.033 24.389 1.00 26.37  ? 109  LYS A CB  1 
ATOM   695  C  CG  . LYS A 1 91  ? 35.572 21.470 24.458 1.00 50.08  ? 109  LYS A CG  1 
ATOM   696  C  CD  . LYS A 1 91  ? 36.322 22.351 23.472 1.00 68.15  ? 109  LYS A CD  1 
ATOM   697  C  CE  . LYS A 1 91  ? 36.377 23.801 23.922 1.00 76.41  ? 109  LYS A CE  1 
ATOM   698  N  NZ  . LYS A 1 91  ? 35.059 24.337 24.371 1.00 75.07  ? 109  LYS A NZ  1 
ATOM   699  N  N   . SER A 1 92  ? 35.855 16.914 24.114 1.00 9.43   ? 110  SER A N   1 
ATOM   700  C  CA  . SER A 1 92  ? 35.824 15.688 23.349 1.00 18.60  ? 110  SER A CA  1 
ATOM   701  C  C   . SER A 1 92  ? 36.194 14.524 24.260 1.00 21.97  ? 110  SER A C   1 
ATOM   702  O  O   . SER A 1 92  ? 36.922 14.736 25.229 1.00 18.55  ? 110  SER A O   1 
ATOM   703  C  CB  A SER A 1 92  ? 36.772 15.750 22.151 0.53 24.40  ? 110  SER A CB  1 
ATOM   704  C  CB  B SER A 1 92  ? 36.762 15.778 22.145 0.47 24.16  ? 110  SER A CB  1 
ATOM   705  O  OG  A SER A 1 92  ? 37.576 16.921 22.167 0.53 34.89  ? 110  SER A OG  1 
ATOM   706  O  OG  B SER A 1 92  ? 38.102 15.800 22.598 0.47 23.68  ? 110  SER A OG  1 
ATOM   707  N  N   . ALA A 1 93  ? 35.657 13.362 23.917 1.00 15.74  ? 111  ALA A N   1 
ATOM   708  C  CA  . ALA A 1 93  ? 35.854 12.132 24.669 1.00 16.21  ? 111  ALA A CA  1 
ATOM   709  C  C   . ALA A 1 93  ? 37.330 11.747 24.668 1.00 16.13  ? 111  ALA A C   1 
ATOM   710  O  O   . ALA A 1 93  ? 38.043 11.826 23.673 1.00 13.90  ? 111  ALA A O   1 
ATOM   711  C  CB  . ALA A 1 93  ? 35.050 10.953 24.148 1.00 17.70  ? 111  ALA A CB  1 
ATOM   712  N  N   . ALA A 1 94  ? 37.750 11.310 25.842 1.00 13.49  ? 112  ALA A N   1 
ATOM   713  C  CA  . ALA A 1 94  ? 39.097 10.791 26.012 1.00 13.47  ? 112  ALA A CA  1 
ATOM   714  C  C   . ALA A 1 94  ? 39.179 9.392  25.392 1.00 12.12  ? 112  ALA A C   1 
ATOM   715  O  O   . ALA A 1 94  ? 38.229 8.631  25.322 1.00 16.73  ? 112  ALA A O   1 
ATOM   716  C  CB  . ALA A 1 94  ? 39.524 10.755 27.466 1.00 16.18  ? 112  ALA A CB  1 
ATOM   717  N  N   . SER A 1 95  ? 40.390 9.080  24.953 1.00 15.37  ? 113  SER A N   1 
ATOM   718  C  CA  . SER A 1 95  ? 40.608 7.733  24.432 1.00 20.33  ? 113  SER A CA  1 
ATOM   719  C  C   . SER A 1 95  ? 41.184 6.879  25.532 1.00 20.15  ? 113  SER A C   1 
ATOM   720  O  O   . SER A 1 95  ? 42.251 7.057  26.100 1.00 25.42  ? 113  SER A O   1 
ATOM   721  C  CB  A SER A 1 95  ? 41.527 7.770  23.211 0.32 21.43  ? 113  SER A CB  1 
ATOM   722  C  CB  B SER A 1 95  ? 41.484 7.814  23.180 0.68 20.15  ? 113  SER A CB  1 
ATOM   723  O  OG  A SER A 1 95  ? 42.132 6.506  22.999 0.32 23.15  ? 113  SER A OG  1 
ATOM   724  O  OG  B SER A 1 95  ? 40.780 8.551  22.187 0.68 38.23  ? 113  SER A OG  1 
ATOM   725  N  N   . LEU A 1 96  ? 40.379 5.885  25.912 1.00 13.32  ? 114  LEU A N   1 
ATOM   726  C  CA  . LEU A 1 96  ? 40.749 5.064  27.038 1.00 12.09  ? 114  LEU A CA  1 
ATOM   727  C  C   . LEU A 1 96  ? 41.696 3.967  26.597 1.00 18.18  ? 114  LEU A C   1 
ATOM   728  O  O   . LEU A 1 96  ? 41.484 3.446  25.511 1.00 18.55  ? 114  LEU A O   1 
ATOM   729  C  CB  . LEU A 1 96  ? 39.477 4.456  27.632 1.00 20.72  ? 114  LEU A CB  1 
ATOM   730  C  CG  . LEU A 1 96  ? 38.436 5.498  28.037 1.00 29.69  ? 114  LEU A CG  1 
ATOM   731  C  CD1 . LEU A 1 96  ? 37.221 4.817  28.645 1.00 29.91  ? 114  LEU A CD1 1 
ATOM   732  C  CD2 . LEU A 1 96  ? 39.024 6.506  29.006 1.00 25.60  ? 114  LEU A CD2 1 
ATOM   733  N  N   . ASN A 1 97  ? 42.685 3.683  27.424 1.00 15.23  ? 115  ASN A N   1 
ATOM   734  C  CA  . ASN A 1 97  ? 43.733 2.731  27.034 1.00 17.99  ? 115  ASN A CA  1 
ATOM   735  C  C   . ASN A 1 97  ? 44.390 2.240  28.306 1.00 17.63  ? 115  ASN A C   1 
ATOM   736  O  O   . ASN A 1 97  ? 43.836 2.471  29.383 1.00 24.15  ? 115  ASN A O   1 
ATOM   737  C  CB  . ASN A 1 97  ? 44.753 3.353  26.093 1.00 19.01  ? 115  ASN A CB  1 
ATOM   738  C  CG  . ASN A 1 97  ? 45.438 4.595  26.670 1.00 13.33  ? 115  ASN A CG  1 
ATOM   739  O  OD1 . ASN A 1 97  ? 45.908 4.561  27.808 1.00 19.94  ? 115  ASN A OD1 1 
ATOM   740  N  ND2 . ASN A 1 97  ? 45.491 5.665  25.885 1.00 24.28  ? 115  ASN A ND2 1 
ATOM   741  N  N   . SER A 1 98  ? 45.538 1.585  28.239 1.00 20.29  ? 116  SER A N   1 
ATOM   742  C  CA  . SER A 1 98  ? 46.058 1.095  29.523 1.00 29.38  ? 116  SER A CA  1 
ATOM   743  C  C   . SER A 1 98  ? 46.479 2.230  30.451 1.00 27.30  ? 116  SER A C   1 
ATOM   744  O  O   . SER A 1 98  ? 46.515 2.047  31.676 1.00 36.35  ? 116  SER A O   1 
ATOM   745  C  CB  A SER A 1 98  ? 47.228 0.142  29.282 0.58 30.40  ? 116  SER A CB  1 
ATOM   746  C  CB  B SER A 1 98  ? 47.236 0.151  29.275 0.42 30.31  ? 116  SER A CB  1 
ATOM   747  O  OG  A SER A 1 98  ? 47.951 0.511  28.120 0.58 29.53  ? 116  SER A OG  1 
ATOM   748  O  OG  B SER A 1 98  ? 48.410 0.604  29.931 0.42 29.62  ? 116  SER A OG  1 
ATOM   749  N  N   . ARG A 1 99  ? 46.796 3.375  29.865 1.00 21.67  ? 117  ARG A N   1 
ATOM   750  C  CA  . ARG A 1 99  ? 47.448 4.474  30.557 1.00 24.22  ? 117  ARG A CA  1 
ATOM   751  C  C   . ARG A 1 99  ? 46.452 5.538  31.002 1.00 25.28  ? 117  ARG A C   1 
ATOM   752  O  O   . ARG A 1 99  ? 46.789 6.360  31.848 1.00 22.45  ? 117  ARG A O   1 
ATOM   753  C  CB  A ARG A 1 99  ? 48.481 5.168  29.664 0.36 25.67  ? 117  ARG A CB  1 
ATOM   754  C  CB  B ARG A 1 99  ? 48.537 5.094  29.667 0.64 26.38  ? 117  ARG A CB  1 
ATOM   755  C  CG  A ARG A 1 99  ? 49.440 4.249  28.933 0.36 27.63  ? 117  ARG A CG  1 
ATOM   756  C  CG  B ARG A 1 99  ? 49.920 4.571  30.032 0.64 25.90  ? 117  ARG A CG  1 
ATOM   757  C  CD  A ARG A 1 99  ? 49.231 4.319  27.425 0.36 25.72  ? 117  ARG A CD  1 
ATOM   758  C  CD  B ARG A 1 99  ? 50.748 4.112  28.861 0.64 30.73  ? 117  ARG A CD  1 
ATOM   759  N  NE  A ARG A 1 99  ? 49.448 2.999  26.826 0.36 32.07  ? 117  ARG A NE  1 
ATOM   760  N  NE  B ARG A 1 99  ? 51.687 3.051  29.173 0.64 40.59  ? 117  ARG A NE  1 
ATOM   761  C  CZ  A ARG A 1 99  ? 50.650 2.424  26.773 0.36 33.14  ? 117  ARG A CZ  1 
ATOM   762  C  CZ  B ARG A 1 99  ? 52.757 3.081  29.948 0.64 49.72  ? 117  ARG A CZ  1 
ATOM   763  N  NH1 A ARG A 1 99  ? 51.708 3.051  27.277 0.36 24.90  ? 117  ARG A NH1 1 
ATOM   764  N  NH1 B ARG A 1 99  ? 53.151 4.169  30.600 0.64 40.36  ? 117  ARG A NH1 1 
ATOM   765  N  NH2 A ARG A 1 99  ? 50.801 1.228  26.220 0.36 39.48  ? 117  ARG A NH2 1 
ATOM   766  N  NH2 B ARG A 1 99  ? 53.495 1.980  30.100 0.64 68.64  ? 117  ARG A NH2 1 
ATOM   767  N  N   . VAL A 1 100 ? 45.286 5.487  30.383 1.00 15.27  ? 118  VAL A N   1 
ATOM   768  C  CA  . VAL A 1 100 ? 44.172 6.387  30.653 1.00 12.13  ? 118  VAL A CA  1 
ATOM   769  C  C   . VAL A 1 100 ? 42.901 5.586  30.897 1.00 17.90  ? 118  VAL A C   1 
ATOM   770  O  O   . VAL A 1 100 ? 42.367 4.975  29.978 1.00 16.95  ? 118  VAL A O   1 
ATOM   771  C  CB  . VAL A 1 100 ? 43.952 7.393  29.510 1.00 21.41  ? 118  VAL A CB  1 
ATOM   772  C  CG1 . VAL A 1 100 ? 42.801 8.337  29.826 1.00 23.34  ? 118  VAL A CG1 1 
ATOM   773  C  CG2 . VAL A 1 100 ? 45.238 8.165  29.243 1.00 17.08  ? 118  VAL A CG2 1 
ATOM   774  N  N   . ALA A 1 101 ? 42.410 5.592  32.125 1.00 16.80  ? 119  ALA A N   1 
ATOM   775  C  CA  . ALA A 1 101 ? 41.375 4.703  32.581 1.00 11.55  ? 119  ALA A CA  1 
ATOM   776  C  C   . ALA A 1 101 ? 40.454 5.453  33.533 1.00 17.97  ? 119  ALA A C   1 
ATOM   777  O  O   . ALA A 1 101 ? 40.951 6.322  34.245 1.00 16.65  ? 119  ALA A O   1 
ATOM   778  C  CB  . ALA A 1 101 ? 41.957 3.492  33.293 1.00 15.62  ? 119  ALA A CB  1 
ATOM   779  N  N   . SER A 1 102 ? 39.181 5.086  33.485 1.00 12.56  ? 120  SER A N   1 
ATOM   780  C  CA  . SER A 1 102 ? 38.230 5.715  34.421 1.00 8.65   ? 120  SER A CA  1 
ATOM   781  C  C   . SER A 1 102 ? 38.178 4.924  35.723 1.00 14.41  ? 120  SER A C   1 
ATOM   782  O  O   . SER A 1 102 ? 38.546 3.752  35.791 1.00 14.61  ? 120  SER A O   1 
ATOM   783  C  CB  . SER A 1 102 ? 36.862 5.827  33.760 1.00 22.46  ? 120  SER A CB  1 
ATOM   784  O  OG  . SER A 1 102 ? 36.342 4.540  33.495 1.00 23.51  ? 120  SER A OG  1 
ATOM   785  N  N   . ILE A 1 103 ? 37.732 5.551  36.804 1.00 12.64  ? 121  ILE A N   1 
ATOM   786  C  CA  . ILE A 1 103 ? 37.638 4.874  38.080 1.00 14.58  ? 121  ILE A CA  1 
ATOM   787  C  C   . ILE A 1 103 ? 36.156 4.748  38.441 1.00 12.97  ? 121  ILE A C   1 
ATOM   788  O  O   . ILE A 1 103 ? 35.388 5.642  38.133 1.00 13.69  ? 121  ILE A O   1 
ATOM   789  C  CB  . ILE A 1 103 ? 38.341 5.608  39.239 1.00 12.68  ? 121  ILE A CB  1 
ATOM   790  C  CG1 . ILE A 1 103 ? 38.244 4.902  40.577 1.00 14.89  ? 121  ILE A CG1 1 
ATOM   791  C  CG2 . ILE A 1 103 ? 37.823 7.031  39.362 1.00 10.36  ? 121  ILE A CG2 1 
ATOM   792  C  CD1 . ILE A 1 103 ? 39.125 3.695  40.768 1.00 18.24  ? 121  ILE A CD1 1 
ATOM   793  N  N   . SER A 1 104 ? 35.788 3.662  39.093 1.00 15.33  ? 122  SER A N   1 
ATOM   794  C  CA  . SER A 1 104 ? 34.389 3.388  39.405 1.00 12.89  ? 122  SER A CA  1 
ATOM   795  C  C   . SER A 1 104 ? 33.848 4.196  40.580 1.00 13.70  ? 122  SER A C   1 
ATOM   796  O  O   . SER A 1 104 ? 34.538 4.421  41.572 1.00 10.14  ? 122  SER A O   1 
ATOM   797  C  CB  A SER A 1 104 ? 34.222 1.888  39.703 0.39 14.69  ? 122  SER A CB  1 
ATOM   798  C  CB  B SER A 1 104 ? 34.226 1.897  39.739 0.61 13.76  ? 122  SER A CB  1 
ATOM   799  O  OG  A SER A 1 104 ? 34.980 1.490  40.832 0.39 28.40  ? 122  SER A OG  1 
ATOM   800  O  OG  B SER A 1 104 ? 34.298 1.074  38.594 0.61 17.54  ? 122  SER A OG  1 
ATOM   801  N  N   . LEU A 1 105 ? 32.580 4.614  40.485 1.00 14.24  ? 123  LEU A N   1 
ATOM   802  C  CA  . LEU A 1 105 ? 31.916 5.257  41.615 1.00 9.99   ? 123  LEU A CA  1 
ATOM   803  C  C   . LEU A 1 105 ? 31.535 4.177  42.632 1.00 13.86  ? 123  LEU A C   1 
ATOM   804  O  O   . LEU A 1 105 ? 31.258 3.040  42.224 1.00 13.41  ? 123  LEU A O   1 
ATOM   805  C  CB  . LEU A 1 105 ? 30.692 6.037  41.161 1.00 14.67  ? 123  LEU A CB  1 
ATOM   806  C  CG  . LEU A 1 105 ? 30.936 7.282  40.300 1.00 18.05  ? 123  LEU A CG  1 
ATOM   807  C  CD1 . LEU A 1 105 ? 29.619 7.974  39.993 1.00 23.83  ? 123  LEU A CD1 1 
ATOM   808  C  CD2 . LEU A 1 105 ? 31.863 8.258  40.996 1.00 17.80  ? 123  LEU A CD2 1 
ATOM   809  N  N   . PRO A 1 106 ? 31.530 4.545  43.909 1.00 11.91  ? 124  PRO A N   1 
ATOM   810  C  CA  . PRO A 1 106 ? 31.218 3.574  44.958 1.00 15.86  ? 124  PRO A CA  1 
ATOM   811  C  C   . PRO A 1 106 ? 29.759 3.142  44.950 1.00 18.05  ? 124  PRO A C   1 
ATOM   812  O  O   . PRO A 1 106 ? 28.882 3.879  44.513 1.00 16.11  ? 124  PRO A O   1 
ATOM   813  C  CB  . PRO A 1 106 ? 31.495 4.340  46.245 1.00 21.11  ? 124  PRO A CB  1 
ATOM   814  C  CG  . PRO A 1 106 ? 31.551 5.774  45.900 1.00 20.01  ? 124  PRO A CG  1 
ATOM   815  C  CD  . PRO A 1 106 ? 31.824 5.883  44.428 1.00 11.70  ? 124  PRO A CD  1 
ATOM   816  N  N   . THR A 1 107 ? 29.475 1.936  45.454 1.00 17.99  ? 125  THR A N   1 
ATOM   817  C  CA  . THR A 1 107 ? 28.088 1.493  45.612 1.00 28.23  ? 125  THR A CA  1 
ATOM   818  C  C   . THR A 1 107 ? 27.617 1.627  47.057 1.00 16.81  ? 125  THR A C   1 
ATOM   819  O  O   . THR A 1 107 ? 26.436 1.550  47.407 1.00 22.82  ? 125  THR A O   1 
ATOM   820  C  CB  . THR A 1 107 ? 27.941 0.023  45.182 1.00 28.54  ? 125  THR A CB  1 
ATOM   821  O  OG1 . THR A 1 107 ? 28.945 -0.721 45.876 1.00 48.59  ? 125  THR A OG1 1 
ATOM   822  C  CG2 . THR A 1 107 ? 28.201 -0.110 43.692 1.00 42.05  ? 125  THR A CG2 1 
ATOM   823  N  N   . SER A 1 108 ? 28.599 1.830  47.911 1.00 11.46  ? 127  SER A N   1 
ATOM   824  C  CA  . SER A 1 108 ? 28.391 2.024  49.330 1.00 13.17  ? 127  SER A CA  1 
ATOM   825  C  C   . SER A 1 108 ? 29.594 2.794  49.876 1.00 6.30   ? 127  SER A C   1 
ATOM   826  O  O   . SER A 1 108 ? 30.619 2.867  49.202 1.00 13.72  ? 127  SER A O   1 
ATOM   827  C  CB  . SER A 1 108 ? 28.258 0.682  50.033 1.00 19.78  ? 127  SER A CB  1 
ATOM   828  O  OG  . SER A 1 108 ? 29.436 -0.078 49.831 1.00 23.70  ? 127  SER A OG  1 
ATOM   829  N  N   . CYS A 1 109 ? 29.454 3.328  51.058 1.00 9.02   ? 128  CYS A N   1 
ATOM   830  C  CA  . CYS A 1 109 ? 30.532 4.044  51.724 1.00 17.08  ? 128  CYS A CA  1 
ATOM   831  C  C   . CYS A 1 109 ? 31.572 3.112  52.328 1.00 26.55  ? 128  CYS A C   1 
ATOM   832  O  O   . CYS A 1 109 ? 31.269 1.950  52.612 1.00 30.66  ? 128  CYS A O   1 
ATOM   833  C  CB  . CYS A 1 109 ? 29.926 4.922  52.834 1.00 14.88  ? 128  CYS A CB  1 
ATOM   834  S  SG  . CYS A 1 109 ? 28.721 6.098  52.168 1.00 14.13  ? 128  CYS A SG  1 
ATOM   835  N  N   . ALA A 1 110 ? 32.794 3.598  52.539 1.00 16.95  ? 129  ALA A N   1 
ATOM   836  C  CA  . ALA A 1 110 ? 33.862 2.768  53.078 1.00 19.41  ? 129  ALA A CA  1 
ATOM   837  C  C   . ALA A 1 110 ? 33.906 2.872  54.598 1.00 21.78  ? 129  ALA A C   1 
ATOM   838  O  O   . ALA A 1 110 ? 33.577 3.924  55.130 1.00 25.29  ? 129  ALA A O   1 
ATOM   839  C  CB  . ALA A 1 110 ? 35.237 3.159  52.551 1.00 27.89  ? 129  ALA A CB  1 
ATOM   840  N  N   . SER A 1 111 ? 34.324 1.789  55.236 1.00 16.57  ? 130  SER A N   1 
ATOM   841  C  CA  . SER A 1 111 ? 34.456 1.830  56.693 1.00 12.94  ? 130  SER A CA  1 
ATOM   842  C  C   . SER A 1 111 ? 35.812 2.317  57.159 1.00 15.34  ? 130  SER A C   1 
ATOM   843  O  O   . SER A 1 111 ? 36.845 2.129  56.525 1.00 19.74  ? 130  SER A O   1 
ATOM   844  C  CB  . SER A 1 111 ? 34.257 0.425  57.262 1.00 20.09  ? 130  SER A CB  1 
ATOM   845  O  OG  . SER A 1 111 ? 35.039 -0.499 56.539 1.00 35.46  ? 130  SER A OG  1 
ATOM   846  N  N   . ALA A 1 112 ? 35.786 2.932  58.345 1.00 17.03  ? 132  ALA A N   1 
ATOM   847  C  CA  . ALA A 1 112 ? 36.993 3.304  59.051 1.00 13.31  ? 132  ALA A CA  1 
ATOM   848  C  C   . ALA A 1 112 ? 37.949 2.100  59.092 1.00 19.20  ? 132  ALA A C   1 
ATOM   849  O  O   . ALA A 1 112 ? 37.497 0.967  59.286 1.00 21.18  ? 132  ALA A O   1 
ATOM   850  C  CB  . ALA A 1 112 ? 36.713 3.777  60.475 1.00 23.32  ? 132  ALA A CB  1 
ATOM   851  N  N   . GLY A 1 113 ? 39.231 2.343  58.903 1.00 17.90  ? 133  GLY A N   1 
ATOM   852  C  CA  . GLY A 1 113 ? 40.268 1.336  58.887 1.00 20.05  ? 133  GLY A CA  1 
ATOM   853  C  C   . GLY A 1 113 ? 40.514 0.814  57.484 1.00 18.67  ? 133  GLY A C   1 
ATOM   854  O  O   . GLY A 1 113 ? 41.508 0.149  57.213 1.00 22.70  ? 133  GLY A O   1 
ATOM   855  N  N   . THR A 1 114 ? 39.597 1.120  56.570 1.00 13.53  ? 134  THR A N   1 
ATOM   856  C  CA  . THR A 1 114 ? 39.798 0.716  55.186 1.00 17.18  ? 134  THR A CA  1 
ATOM   857  C  C   . THR A 1 114 ? 40.999 1.431  54.583 1.00 19.32  ? 134  THR A C   1 
ATOM   858  O  O   . THR A 1 114 ? 41.158 2.639  54.746 1.00 15.52  ? 134  THR A O   1 
ATOM   859  C  CB  . THR A 1 114 ? 38.518 1.031  54.389 1.00 16.64  ? 134  THR A CB  1 
ATOM   860  O  OG1 . THR A 1 114 ? 37.486 0.125  54.780 1.00 23.89  ? 134  THR A OG1 1 
ATOM   861  C  CG2 . THR A 1 114 ? 38.803 0.822  52.917 1.00 15.70  ? 134  THR A CG2 1 
ATOM   862  N  N   . GLN A 1 115 ? 41.864 0.696  53.903 1.00 13.47  ? 135  GLN A N   1 
ATOM   863  C  CA  . GLN A 1 115 ? 43.086 1.237  53.308 1.00 18.94  ? 135  GLN A CA  1 
ATOM   864  C  C   . GLN A 1 115 ? 42.802 1.890  51.959 1.00 12.58  ? 135  GLN A C   1 
ATOM   865  O  O   . GLN A 1 115 ? 42.126 1.335  51.095 1.00 14.34  ? 135  GLN A O   1 
ATOM   866  C  CB  A GLN A 1 115 ? 44.104 0.107  53.145 0.47 28.75  ? 135  GLN A CB  1 
ATOM   867  C  CB  B GLN A 1 115 ? 44.154 0.142  53.155 0.53 28.85  ? 135  GLN A CB  1 
ATOM   868  C  CG  A GLN A 1 115 ? 45.552 0.542  53.312 0.47 33.94  ? 135  GLN A CG  1 
ATOM   869  C  CG  B GLN A 1 115 ? 45.122 0.397  52.014 0.53 32.03  ? 135  GLN A CG  1 
ATOM   870  C  CD  A GLN A 1 115 ? 45.833 1.002  54.732 0.47 33.67  ? 135  GLN A CD  1 
ATOM   871  C  CD  B GLN A 1 115 ? 46.356 -0.473 51.982 0.53 37.10  ? 135  GLN A CD  1 
ATOM   872  O  OE1 A GLN A 1 115 ? 45.662 0.249  55.686 0.47 41.77  ? 135  GLN A OE1 1 
ATOM   873  O  OE1 B GLN A 1 115 ? 47.075 -0.639 52.967 0.53 42.94  ? 135  GLN A OE1 1 
ATOM   874  N  NE2 A GLN A 1 115 ? 46.254 2.253  54.847 0.47 20.70  ? 135  GLN A NE2 1 
ATOM   875  N  NE2 B GLN A 1 115 ? 46.636 -1.046 50.808 0.53 36.58  ? 135  GLN A NE2 1 
ATOM   876  N  N   . CYS A 1 116 ? 43.316 3.104  51.742 1.00 9.85   ? 136  CYS A N   1 
ATOM   877  C  CA  . CYS A 1 116 ? 43.047 3.825  50.515 1.00 14.16  ? 136  CYS A CA  1 
ATOM   878  C  C   . CYS A 1 116 ? 44.344 4.330  49.861 1.00 12.82  ? 136  CYS A C   1 
ATOM   879  O  O   . CYS A 1 116 ? 45.332 4.434  50.594 1.00 15.43  ? 136  CYS A O   1 
ATOM   880  C  CB  . CYS A 1 116 ? 42.163 5.037  50.814 1.00 12.67  ? 136  CYS A CB  1 
ATOM   881  S  SG  . CYS A 1 116 ? 40.595 4.632  51.577 1.00 14.22  ? 136  CYS A SG  1 
ATOM   882  N  N   . LEU A 1 117 ? 44.251 4.635  48.562 1.00 14.35  ? 137  LEU A N   1 
ATOM   883  C  CA  . LEU A 1 117 ? 45.316 5.214  47.768 1.00 13.58  ? 137  LEU A CA  1 
ATOM   884  C  C   . LEU A 1 117 ? 44.980 6.667  47.411 1.00 8.03   ? 137  LEU A C   1 
ATOM   885  O  O   . LEU A 1 117 ? 43.947 6.902  46.804 1.00 9.39   ? 137  LEU A O   1 
ATOM   886  C  CB  . LEU A 1 117 ? 45.582 4.433  46.473 1.00 8.55   ? 137  LEU A CB  1 
ATOM   887  C  CG  . LEU A 1 117 ? 46.786 4.906  45.652 1.00 13.24  ? 137  LEU A CG  1 
ATOM   888  C  CD1 . LEU A 1 117 ? 48.094 4.792  46.427 1.00 25.70  ? 137  LEU A CD1 1 
ATOM   889  C  CD2 . LEU A 1 117 ? 46.883 4.130  44.351 1.00 21.22  ? 137  LEU A CD2 1 
ATOM   890  N  N   . ILE A 1 118 ? 45.851 7.562  47.841 1.00 8.39   ? 138  ILE A N   1 
ATOM   891  C  CA  . ILE A 1 118 ? 45.769 8.997  47.589 1.00 9.16   ? 138  ILE A CA  1 
ATOM   892  C  C   . ILE A 1 118 ? 46.951 9.383  46.706 1.00 9.62   ? 138  ILE A C   1 
ATOM   893  O  O   . ILE A 1 118 ? 48.050 8.903  46.949 1.00 10.63  ? 138  ILE A O   1 
ATOM   894  C  CB  . ILE A 1 118 ? 45.735 9.781  48.910 1.00 13.03  ? 138  ILE A CB  1 
ATOM   895  C  CG1 . ILE A 1 118 ? 44.661 9.234  49.877 1.00 13.03  ? 138  ILE A CG1 1 
ATOM   896  C  CG2 . ILE A 1 118 ? 45.557 11.279 48.711 1.00 14.95  ? 138  ILE A CG2 1 
ATOM   897  C  CD1 . ILE A 1 118 ? 44.928 9.574  51.326 1.00 24.56  ? 138  ILE A CD1 1 
ATOM   898  N  N   . SER A 1 119 ? 46.709 10.198 45.687 1.00 12.14  ? 139  SER A N   1 
ATOM   899  C  CA  . SER A 1 119 ? 47.787 10.511 44.758 1.00 8.76   ? 139  SER A CA  1 
ATOM   900  C  C   . SER A 1 119 ? 47.709 11.951 44.295 1.00 10.38  ? 139  SER A C   1 
ATOM   901  O  O   . SER A 1 119 ? 46.648 12.577 44.276 1.00 9.91   ? 139  SER A O   1 
ATOM   902  C  CB  . SER A 1 119 ? 47.719 9.585  43.552 1.00 12.33  ? 139  SER A CB  1 
ATOM   903  O  OG  . SER A 1 119 ? 46.387 9.313  43.188 1.00 12.55  ? 139  SER A OG  1 
ATOM   904  N  N   . GLY A 1 120 ? 48.866 12.460 43.884 1.00 10.20  ? 140  GLY A N   1 
ATOM   905  C  CA  . GLY A 1 120 ? 48.887 13.823 43.379 1.00 12.03  ? 140  GLY A CA  1 
ATOM   906  C  C   . GLY A 1 120 ? 50.272 14.414 43.242 1.00 16.45  ? 140  GLY A C   1 
ATOM   907  O  O   . GLY A 1 120 ? 51.303 13.855 43.605 1.00 9.84   ? 140  GLY A O   1 
ATOM   908  N  N   . TRP A 1 121 ? 50.260 15.621 42.673 1.00 12.62  ? 141  TRP A N   1 
ATOM   909  C  CA  . TRP A 1 121 ? 51.524 16.296 42.414 1.00 12.94  ? 141  TRP A CA  1 
ATOM   910  C  C   . TRP A 1 121 ? 51.792 17.429 43.387 1.00 7.97   ? 141  TRP A C   1 
ATOM   911  O  O   . TRP A 1 121 ? 52.526 18.373 43.034 1.00 13.79  ? 141  TRP A O   1 
ATOM   912  C  CB  . TRP A 1 121 ? 51.490 16.837 40.990 1.00 12.60  ? 141  TRP A CB  1 
ATOM   913  C  CG  . TRP A 1 121 ? 51.575 15.843 39.878 1.00 7.40   ? 141  TRP A CG  1 
ATOM   914  C  CD1 . TRP A 1 121 ? 52.723 15.286 39.387 1.00 12.44  ? 141  TRP A CD1 1 
ATOM   915  C  CD2 . TRP A 1 121 ? 50.506 15.298 39.097 1.00 11.28  ? 141  TRP A CD2 1 
ATOM   916  N  NE1 . TRP A 1 121 ? 52.431 14.428 38.365 1.00 14.54  ? 141  TRP A NE1 1 
ATOM   917  C  CE2 . TRP A 1 121 ? 51.078 14.412 38.161 1.00 14.08  ? 141  TRP A CE2 1 
ATOM   918  C  CE3 . TRP A 1 121 ? 49.118 15.458 39.080 1.00 11.20  ? 141  TRP A CE3 1 
ATOM   919  C  CZ2 . TRP A 1 121 ? 50.334 13.689 37.232 1.00 12.30  ? 141  TRP A CZ2 1 
ATOM   920  C  CZ3 . TRP A 1 121 ? 48.381 14.735 38.155 1.00 10.85  ? 141  TRP A CZ3 1 
ATOM   921  C  CH2 . TRP A 1 121 ? 48.971 13.860 37.235 1.00 14.46  ? 141  TRP A CH2 1 
ATOM   922  N  N   . GLY A 1 122 ? 51.235 17.407 44.580 1.00 10.46  ? 142  GLY A N   1 
ATOM   923  C  CA  . GLY A 1 122 ? 51.330 18.487 45.514 1.00 10.28  ? 142  GLY A CA  1 
ATOM   924  C  C   . GLY A 1 122 ? 52.660 18.482 46.247 1.00 14.06  ? 142  GLY A C   1 
ATOM   925  O  O   . GLY A 1 122 ? 53.462 17.584 46.001 1.00 15.22  ? 142  GLY A O   1 
ATOM   926  N  N   . ASN A 1 123 ? 52.780 19.487 47.093 1.00 13.02  ? 143  ASN A N   1 
ATOM   927  C  CA  . ASN A 1 123 ? 53.997 19.728 47.859 1.00 15.05  ? 143  ASN A CA  1 
ATOM   928  C  C   . ASN A 1 123 ? 54.346 18.484 48.651 1.00 20.85  ? 143  ASN A C   1 
ATOM   929  O  O   . ASN A 1 123 ? 53.453 17.769 49.126 1.00 15.65  ? 143  ASN A O   1 
ATOM   930  C  CB  . ASN A 1 123 ? 53.806 20.965 48.730 1.00 13.61  ? 143  ASN A CB  1 
ATOM   931  C  CG  . ASN A 1 123 ? 55.029 21.314 49.571 1.00 19.33  ? 143  ASN A CG  1 
ATOM   932  O  OD1 . ASN A 1 123 ? 56.142 20.850 49.346 1.00 31.03  ? 143  ASN A OD1 1 
ATOM   933  N  ND2 . ASN A 1 123 ? 54.767 22.160 50.570 1.00 30.22  ? 143  ASN A ND2 1 
ATOM   934  N  N   . THR A 1 124 ? 55.644 18.206 48.749 1.00 14.76  ? 144  THR A N   1 
ATOM   935  C  CA  . THR A 1 124 ? 56.058 16.976 49.440 1.00 16.92  ? 144  THR A CA  1 
ATOM   936  C  C   . THR A 1 124 ? 56.716 17.266 50.778 1.00 24.51  ? 144  THR A C   1 
ATOM   937  O  O   . THR A 1 124 ? 57.219 16.352 51.444 1.00 22.35  ? 144  THR A O   1 
ATOM   938  C  CB  . THR A 1 124 ? 57.051 16.150 48.607 1.00 18.96  ? 144  THR A CB  1 
ATOM   939  O  OG1 . THR A 1 124 ? 58.227 16.947 48.380 1.00 22.90  ? 144  THR A OG1 1 
ATOM   940  C  CG2 . THR A 1 124 ? 56.450 15.792 47.262 1.00 19.95  ? 144  THR A CG2 1 
ATOM   941  N  N   . LYS A 1 125 ? 56.746 18.515 51.226 1.00 24.99  ? 145  LYS A N   1 
ATOM   942  C  CA  . LYS A 1 125 ? 57.346 18.715 52.559 1.00 31.31  ? 145  LYS A CA  1 
ATOM   943  C  C   . LYS A 1 125 ? 56.341 19.286 53.537 1.00 35.60  ? 145  LYS A C   1 
ATOM   944  O  O   . LYS A 1 125 ? 55.488 20.091 53.155 1.00 35.93  ? 145  LYS A O   1 
ATOM   945  C  CB  . LYS A 1 125 ? 58.558 19.635 52.413 1.00 34.47  ? 145  LYS A CB  1 
ATOM   946  C  CG  . LYS A 1 125 ? 59.831 18.897 52.018 1.00 42.98  ? 145  LYS A CG  1 
ATOM   947  C  CD  . LYS A 1 125 ? 60.918 19.849 51.534 1.00 57.99  ? 145  LYS A CD  1 
ATOM   948  C  CE  . LYS A 1 125 ? 62.272 19.157 51.539 1.00 69.90  ? 145  LYS A CE  1 
ATOM   949  N  NZ  . LYS A 1 125 ? 62.841 18.998 50.168 1.00 97.91  ? 145  LYS A NZ  1 
ATOM   950  N  N   . SER A 1 126 ? 56.395 18.915 54.823 1.00 42.40  ? 146  SER A N   1 
ATOM   951  C  CA  . SER A 1 126 ? 55.406 19.574 55.697 1.00 60.21  ? 146  SER A CA  1 
ATOM   952  C  C   . SER A 1 126 ? 55.900 20.965 56.108 1.00 61.68  ? 146  SER A C   1 
ATOM   953  O  O   . SER A 1 126 ? 55.116 21.904 56.247 1.00 74.89  ? 146  SER A O   1 
ATOM   954  C  CB  . SER A 1 126 ? 55.054 18.756 56.929 1.00 64.37  ? 146  SER A CB  1 
ATOM   955  O  OG  . SER A 1 126 ? 56.132 18.051 57.499 1.00 63.29  ? 146  SER A OG  1 
ATOM   956  N  N   . SER A 1 127 ? 57.208 21.094 56.289 1.00 53.22  ? 147  SER A N   1 
ATOM   957  C  CA  . SER A 1 127 ? 57.822 22.362 56.651 1.00 56.63  ? 147  SER A CA  1 
ATOM   958  C  C   . SER A 1 127 ? 58.023 23.235 55.421 1.00 55.04  ? 147  SER A C   1 
ATOM   959  O  O   . SER A 1 127 ? 57.371 24.260 55.229 1.00 74.42  ? 147  SER A O   1 
ATOM   960  C  CB  . SER A 1 127 ? 59.153 22.111 57.353 1.00 65.80  ? 147  SER A CB  1 
ATOM   961  N  N   . GLY A 1 128 ? 58.949 22.808 54.563 1.00 49.80  ? 148  GLY A N   1 
ATOM   962  C  CA  . GLY A 1 128 ? 59.283 23.583 53.395 1.00 56.44  ? 148  GLY A CA  1 
ATOM   963  C  C   . GLY A 1 128 ? 58.272 23.548 52.268 1.00 49.18  ? 148  GLY A C   1 
ATOM   964  O  O   . GLY A 1 128 ? 57.120 23.135 52.378 1.00 32.42  ? 148  GLY A O   1 
ATOM   965  N  N   . THR A 1 129 ? 58.767 24.022 51.130 1.00 45.80  ? 149  THR A N   1 
ATOM   966  C  CA  . THR A 1 129 ? 58.088 23.957 49.854 1.00 43.45  ? 149  THR A CA  1 
ATOM   967  C  C   . THR A 1 129 ? 58.929 23.134 48.886 1.00 32.34  ? 149  THR A C   1 
ATOM   968  O  O   . THR A 1 129 ? 60.034 23.570 48.561 1.00 22.35  ? 149  THR A O   1 
ATOM   969  C  CB  . THR A 1 129 ? 57.860 25.344 49.223 1.00 52.07  ? 149  THR A CB  1 
ATOM   970  O  OG1 . THR A 1 129 ? 56.950 26.105 50.028 1.00 70.45  ? 149  THR A OG1 1 
ATOM   971  C  CG2 . THR A 1 129 ? 57.217 25.215 47.850 1.00 56.23  ? 149  THR A CG2 1 
ATOM   972  N  N   . SER A 1 130 ? 58.409 21.997 48.438 1.00 23.20  ? 150  SER A N   1 
ATOM   973  C  CA  . SER A 1 130 ? 59.034 21.315 47.316 1.00 33.39  ? 150  SER A CA  1 
ATOM   974  C  C   . SER A 1 130 ? 57.988 20.539 46.502 1.00 29.14  ? 150  SER A C   1 
ATOM   975  O  O   . SER A 1 130 ? 57.325 19.607 46.945 1.00 20.93  ? 150  SER A O   1 
ATOM   976  C  CB  . SER A 1 130 ? 60.188 20.397 47.729 1.00 32.87  ? 150  SER A CB  1 
ATOM   977  O  OG  . SER A 1 130 ? 60.922 20.058 46.548 1.00 34.00  ? 150  SER A OG  1 
ATOM   978  N  N   . TYR A 1 131 ? 57.857 20.983 45.250 1.00 18.46  ? 151  TYR A N   1 
ATOM   979  C  CA  . TYR A 1 131 ? 56.882 20.380 44.371 1.00 16.08  ? 151  TYR A CA  1 
ATOM   980  C  C   . TYR A 1 131 ? 57.560 19.389 43.434 1.00 23.04  ? 151  TYR A C   1 
ATOM   981  O  O   . TYR A 1 131 ? 58.553 19.701 42.774 1.00 20.92  ? 151  TYR A O   1 
ATOM   982  C  CB  . TYR A 1 131 ? 56.142 21.437 43.562 1.00 19.74  ? 151  TYR A CB  1 
ATOM   983  C  CG  . TYR A 1 131 ? 55.172 22.194 44.439 1.00 21.60  ? 151  TYR A CG  1 
ATOM   984  C  CD1 . TYR A 1 131 ? 53.860 21.767 44.518 1.00 23.14  ? 151  TYR A CD1 1 
ATOM   985  C  CD2 . TYR A 1 131 ? 55.585 23.301 45.166 1.00 21.99  ? 151  TYR A CD2 1 
ATOM   986  C  CE1 . TYR A 1 131 ? 52.941 22.430 45.312 1.00 31.01  ? 151  TYR A CE1 1 
ATOM   987  C  CE2 . TYR A 1 131 ? 54.663 23.965 45.957 1.00 28.73  ? 151  TYR A CE2 1 
ATOM   988  C  CZ  . TYR A 1 131 ? 53.359 23.530 46.029 1.00 31.71  ? 151  TYR A CZ  1 
ATOM   989  O  OH  . TYR A 1 131 ? 52.425 24.178 46.816 1.00 49.28  ? 151  TYR A OH  1 
ATOM   990  N  N   . PRO A 1 132 ? 56.981 18.203 43.419 1.00 16.39  ? 152  PRO A N   1 
ATOM   991  C  CA  . PRO A 1 132 ? 57.496 17.141 42.570 1.00 18.66  ? 152  PRO A CA  1 
ATOM   992  C  C   . PRO A 1 132 ? 56.941 17.304 41.162 1.00 20.52  ? 152  PRO A C   1 
ATOM   993  O  O   . PRO A 1 132 ? 55.924 17.922 40.850 1.00 22.95  ? 152  PRO A O   1 
ATOM   994  C  CB  . PRO A 1 132 ? 56.928 15.894 43.247 1.00 22.81  ? 152  PRO A CB  1 
ATOM   995  C  CG  . PRO A 1 132 ? 55.592 16.363 43.742 1.00 19.95  ? 152  PRO A CG  1 
ATOM   996  C  CD  . PRO A 1 132 ? 55.785 17.778 44.166 1.00 18.05  ? 152  PRO A CD  1 
ATOM   997  N  N   . ASP A 1 133 ? 57.652 16.709 40.212 1.00 16.48  ? 153  ASP A N   1 
ATOM   998  C  CA  . ASP A 1 133 ? 57.057 16.811 38.881 1.00 14.28  ? 153  ASP A CA  1 
ATOM   999  C  C   . ASP A 1 133 ? 56.488 15.470 38.441 1.00 8.18   ? 153  ASP A C   1 
ATOM   1000 O  O   . ASP A 1 133 ? 55.704 15.469 37.484 1.00 13.15  ? 153  ASP A O   1 
ATOM   1001 C  CB  . ASP A 1 133 ? 58.077 17.370 37.910 1.00 15.58  ? 153  ASP A CB  1 
ATOM   1002 C  CG  . ASP A 1 133 ? 58.328 18.855 38.164 1.00 18.26  ? 153  ASP A CG  1 
ATOM   1003 O  OD1 . ASP A 1 133 ? 57.490 19.513 38.817 1.00 30.03  ? 153  ASP A OD1 1 
ATOM   1004 O  OD2 . ASP A 1 133 ? 59.370 19.345 37.711 1.00 30.49  ? 153  ASP A OD2 1 
ATOM   1005 N  N   . VAL A 1 134 ? 56.823 14.407 39.147 1.00 13.65  ? 154  VAL A N   1 
ATOM   1006 C  CA  . VAL A 1 134 ? 56.181 13.115 38.934 1.00 11.37  ? 154  VAL A CA  1 
ATOM   1007 C  C   . VAL A 1 134 ? 55.091 12.804 39.955 1.00 12.07  ? 154  VAL A C   1 
ATOM   1008 O  O   . VAL A 1 134 ? 55.028 13.337 41.065 1.00 9.17   ? 154  VAL A O   1 
ATOM   1009 C  CB  . VAL A 1 134 ? 57.205 11.964 38.942 1.00 15.03  ? 154  VAL A CB  1 
ATOM   1010 C  CG1 . VAL A 1 134 ? 58.076 12.060 37.699 1.00 22.80  ? 154  VAL A CG1 1 
ATOM   1011 C  CG2 . VAL A 1 134 ? 58.045 11.969 40.204 1.00 27.14  ? 154  VAL A CG2 1 
ATOM   1012 N  N   . LEU A 1 135 ? 54.173 11.903 39.635 1.00 13.31  ? 155  LEU A N   1 
ATOM   1013 C  CA  . LEU A 1 135 ? 53.042 11.637 40.516 1.00 9.05   ? 155  LEU A CA  1 
ATOM   1014 C  C   . LEU A 1 135 ? 53.485 10.891 41.782 1.00 11.02  ? 155  LEU A C   1 
ATOM   1015 O  O   . LEU A 1 135 ? 54.249 9.925  41.694 1.00 12.27  ? 155  LEU A O   1 
ATOM   1016 C  CB  . LEU A 1 135 ? 51.978 10.860 39.749 1.00 8.85   ? 155  LEU A CB  1 
ATOM   1017 C  CG  . LEU A 1 135 ? 50.612 10.667 40.416 1.00 11.75  ? 155  LEU A CG  1 
ATOM   1018 C  CD1 . LEU A 1 135 ? 49.890 11.995 40.565 1.00 11.02  ? 155  LEU A CD1 1 
ATOM   1019 C  CD2 . LEU A 1 135 ? 49.753 9.682  39.639 1.00 14.48  ? 155  LEU A CD2 1 
ATOM   1020 N  N   . LYS A 1 136 ? 52.994 11.343 42.929 1.00 10.64  ? 156  LYS A N   1 
ATOM   1021 C  CA  . LYS A 1 136 ? 53.301 10.724 44.214 1.00 7.69   ? 156  LYS A CA  1 
ATOM   1022 C  C   . LYS A 1 136 ? 52.038 10.032 44.723 1.00 15.02  ? 156  LYS A C   1 
ATOM   1023 O  O   . LYS A 1 136 ? 50.938 10.448 44.373 1.00 14.46  ? 156  LYS A O   1 
ATOM   1024 C  CB  . LYS A 1 136 ? 53.737 11.723 45.278 1.00 14.24  ? 156  LYS A CB  1 
ATOM   1025 C  CG  . LYS A 1 136 ? 54.958 12.568 44.955 1.00 18.90  ? 156  LYS A CG  1 
ATOM   1026 C  CD  . LYS A 1 136 ? 56.122 11.634 44.660 1.00 23.74  ? 156  LYS A CD  1 
ATOM   1027 C  CE  . LYS A 1 136 ? 57.466 12.258 44.985 1.00 41.62  ? 156  LYS A CE  1 
ATOM   1028 N  NZ  . LYS A 1 136 ? 58.550 11.222 44.937 1.00 37.53  ? 156  LYS A NZ  1 
ATOM   1029 N  N   . CYS A 1 137 ? 52.245 9.022  45.532 1.00 10.13  ? 157  CYS A N   1 
ATOM   1030 C  CA  . CYS A 1 137 ? 51.222 8.134  46.022 1.00 11.60  ? 157  CYS A CA  1 
ATOM   1031 C  C   . CYS A 1 137 ? 51.358 7.958  47.534 1.00 17.34  ? 157  CYS A C   1 
ATOM   1032 O  O   . CYS A 1 137 ? 52.452 8.022  48.076 1.00 14.90  ? 157  CYS A O   1 
ATOM   1033 C  CB  . CYS A 1 137 ? 51.343 6.778  45.348 1.00 8.26   ? 157  CYS A CB  1 
ATOM   1034 S  SG  . CYS A 1 137 ? 50.532 6.567  43.769 1.00 16.21  ? 157  CYS A SG  1 
ATOM   1035 N  N   . LEU A 1 138 ? 50.236 7.729  48.202 1.00 14.70  ? 158  LEU A N   1 
ATOM   1036 C  CA  . LEU A 1 138 ? 50.262 7.491  49.631 1.00 17.79  ? 158  LEU A CA  1 
ATOM   1037 C  C   . LEU A 1 138 ? 49.185 6.479  49.975 1.00 13.91  ? 158  LEU A C   1 
ATOM   1038 O  O   . LEU A 1 138 ? 48.034 6.675  49.622 1.00 10.56  ? 158  LEU A O   1 
ATOM   1039 C  CB  . LEU A 1 138 ? 50.031 8.794  50.388 1.00 15.97  ? 158  LEU A CB  1 
ATOM   1040 C  CG  . LEU A 1 138 ? 49.784 8.662  51.897 1.00 22.95  ? 158  LEU A CG  1 
ATOM   1041 C  CD1 . LEU A 1 138 ? 51.033 8.212  52.637 1.00 21.74  ? 158  LEU A CD1 1 
ATOM   1042 C  CD2 . LEU A 1 138 ? 49.262 9.974  52.447 1.00 16.65  ? 158  LEU A CD2 1 
ATOM   1043 N  N   . LYS A 1 139 ? 49.555 5.399  50.659 1.00 13.35  ? 159  LYS A N   1 
ATOM   1044 C  CA  . LYS A 1 139 ? 48.503 4.561  51.226 1.00 14.93  ? 159  LYS A CA  1 
ATOM   1045 C  C   . LYS A 1 139 ? 48.156 5.043  52.626 1.00 18.60  ? 159  LYS A C   1 
ATOM   1046 O  O   . LYS A 1 139 ? 48.997 5.286  53.483 1.00 16.21  ? 159  LYS A O   1 
ATOM   1047 C  CB  . LYS A 1 139 ? 48.933 3.087  51.232 1.00 22.83  ? 159  LYS A CB  1 
ATOM   1048 C  CG  . LYS A 1 139 ? 48.915 2.510  49.819 1.00 40.45  ? 159  LYS A CG  1 
ATOM   1049 C  CD  . LYS A 1 139 ? 49.613 1.168  49.721 1.00 54.41  ? 159  LYS A CD  1 
ATOM   1050 C  CE  . LYS A 1 139 ? 51.076 1.325  49.337 1.00 64.16  ? 159  LYS A CE  1 
ATOM   1051 N  NZ  . LYS A 1 139 ? 51.837 0.066  49.559 1.00 80.69  ? 159  LYS A NZ  1 
ATOM   1052 N  N   . ALA A 1 140 ? 46.851 5.184  52.854 1.00 10.31  ? 160  ALA A N   1 
ATOM   1053 C  CA  . ALA A 1 140 ? 46.399 5.764  54.109 1.00 16.65  ? 160  ALA A CA  1 
ATOM   1054 C  C   . ALA A 1 140 ? 45.044 5.204  54.485 1.00 14.69  ? 160  ALA A C   1 
ATOM   1055 O  O   . ALA A 1 140 ? 44.198 4.936  53.629 1.00 15.27  ? 160  ALA A O   1 
ATOM   1056 C  CB  . ALA A 1 140 ? 46.361 7.281  53.947 1.00 19.22  ? 160  ALA A CB  1 
ATOM   1057 N  N   . PRO A 1 141 ? 44.790 5.014  55.771 1.00 13.90  ? 161  PRO A N   1 
ATOM   1058 C  CA  . PRO A 1 141 ? 43.472 4.511  56.138 1.00 10.06  ? 161  PRO A CA  1 
ATOM   1059 C  C   . PRO A 1 141 ? 42.465 5.592  56.477 1.00 13.21  ? 161  PRO A C   1 
ATOM   1060 O  O   . PRO A 1 141 ? 42.799 6.683  56.935 1.00 13.39  ? 161  PRO A O   1 
ATOM   1061 C  CB  . PRO A 1 141 ? 43.800 3.755  57.440 1.00 16.61  ? 161  PRO A CB  1 
ATOM   1062 C  CG  . PRO A 1 141 ? 44.913 4.527  58.049 1.00 18.95  ? 161  PRO A CG  1 
ATOM   1063 C  CD  . PRO A 1 141 ? 45.660 5.206  56.935 1.00 12.61  ? 161  PRO A CD  1 
ATOM   1064 N  N   . ILE A 1 142 ? 41.199 5.237  56.269 1.00 13.60  ? 162  ILE A N   1 
ATOM   1065 C  CA  . ILE A 1 142 ? 40.140 6.113  56.731 1.00 10.71  ? 162  ILE A CA  1 
ATOM   1066 C  C   . ILE A 1 142 ? 40.091 6.066  58.245 1.00 11.50  ? 162  ILE A C   1 
ATOM   1067 O  O   . ILE A 1 142 ? 40.145 4.991  58.838 1.00 13.93  ? 162  ILE A O   1 
ATOM   1068 C  CB  . ILE A 1 142 ? 38.783 5.676  56.162 1.00 14.39  ? 162  ILE A CB  1 
ATOM   1069 C  CG1 . ILE A 1 142 ? 38.760 5.680  54.638 1.00 15.71  ? 162  ILE A CG1 1 
ATOM   1070 C  CG2 . ILE A 1 142 ? 37.684 6.517  56.801 1.00 12.25  ? 162  ILE A CG2 1 
ATOM   1071 C  CD1 . ILE A 1 142 ? 37.486 5.243  53.956 1.00 15.21  ? 162  ILE A CD1 1 
ATOM   1072 N  N   . LEU A 1 143 ? 40.028 7.231  58.857 1.00 9.35   ? 163  LEU A N   1 
ATOM   1073 C  CA  . LEU A 1 143 ? 39.951 7.316  60.295 1.00 7.58   ? 163  LEU A CA  1 
ATOM   1074 C  C   . LEU A 1 143 ? 38.510 7.268  60.766 1.00 10.82  ? 163  LEU A C   1 
ATOM   1075 O  O   . LEU A 1 143 ? 37.570 7.574  60.067 1.00 13.62  ? 163  LEU A O   1 
ATOM   1076 C  CB  . LEU A 1 143 ? 40.586 8.600  60.841 1.00 10.40  ? 163  LEU A CB  1 
ATOM   1077 C  CG  . LEU A 1 143 ? 42.086 8.680  60.524 1.00 12.76  ? 163  LEU A CG  1 
ATOM   1078 C  CD1 . LEU A 1 143 ? 42.615 10.075 60.770 1.00 26.49  ? 163  LEU A CD1 1 
ATOM   1079 C  CD2 . LEU A 1 143 ? 42.819 7.632  61.365 1.00 25.12  ? 163  LEU A CD2 1 
ATOM   1080 N  N   . SER A 1 144 ? 38.390 6.893  62.036 1.00 13.07  ? 164  SER A N   1 
ATOM   1081 C  CA  . SER A 1 144 ? 37.063 6.961  62.637 1.00 11.48  ? 164  SER A CA  1 
ATOM   1082 C  C   . SER A 1 144 ? 36.556 8.399  62.686 1.00 11.42  ? 164  SER A C   1 
ATOM   1083 O  O   . SER A 1 144 ? 37.296 9.354  62.879 1.00 14.33  ? 164  SER A O   1 
ATOM   1084 C  CB  A SER A 1 144 ? 37.076 6.341  64.036 0.25 20.10  ? 164  SER A CB  1 
ATOM   1085 C  CB  B SER A 1 144 ? 37.111 6.387  64.060 0.75 22.85  ? 164  SER A CB  1 
ATOM   1086 O  OG  A SER A 1 144 ? 37.229 7.379  64.986 0.25 14.44  ? 164  SER A OG  1 
ATOM   1087 O  OG  B SER A 1 144 ? 38.069 7.087  64.841 0.75 22.07  ? 164  SER A OG  1 
ATOM   1088 N  N   . ASP A 1 145 ? 35.242 8.520  62.538 1.00 15.42  ? 165  ASP A N   1 
ATOM   1089 C  CA  . ASP A 1 145 ? 34.618 9.850  62.527 1.00 21.48  ? 165  ASP A CA  1 
ATOM   1090 C  C   . ASP A 1 145 ? 34.880 10.577 63.837 1.00 19.50  ? 165  ASP A C   1 
ATOM   1091 O  O   . ASP A 1 145 ? 35.030 11.809 63.871 1.00 16.39  ? 165  ASP A O   1 
ATOM   1092 C  CB  . ASP A 1 145 ? 33.139 9.700  62.187 1.00 29.38  ? 165  ASP A CB  1 
ATOM   1093 C  CG  . ASP A 1 145 ? 32.780 9.453  60.735 1.00 37.22  ? 165  ASP A CG  1 
ATOM   1094 O  OD1 . ASP A 1 145 ? 31.740 8.800  60.480 1.00 49.13  ? 165  ASP A OD1 1 
ATOM   1095 O  OD2 . ASP A 1 145 ? 33.467 9.883  59.790 1.00 27.45  ? 165  ASP A OD2 1 
ATOM   1096 N  N   . SER A 1 146 ? 34.966 9.891  64.985 1.00 11.10  ? 166  SER A N   1 
ATOM   1097 C  CA  . SER A 1 146 ? 35.280 10.589 66.234 1.00 15.55  ? 166  SER A CA  1 
ATOM   1098 C  C   . SER A 1 146 ? 36.702 11.110 66.302 1.00 15.62  ? 166  SER A C   1 
ATOM   1099 O  O   . SER A 1 146 ? 36.924 12.191 66.863 1.00 18.94  ? 166  SER A O   1 
ATOM   1100 C  CB  . SER A 1 146 ? 35.003 9.707  67.465 1.00 18.45  ? 166  SER A CB  1 
ATOM   1101 O  OG  . SER A 1 146 ? 35.947 8.658  67.614 1.00 30.14  ? 166  SER A OG  1 
ATOM   1102 N  N   . SER A 1 147 ? 37.702 10.431 65.755 1.00 19.51  ? 167  SER A N   1 
ATOM   1103 C  CA  . SER A 1 147 ? 39.034 11.028 65.688 1.00 17.75  ? 167  SER A CA  1 
ATOM   1104 C  C   . SER A 1 147 ? 39.031 12.270 64.816 1.00 15.79  ? 167  SER A C   1 
ATOM   1105 O  O   . SER A 1 147 ? 39.709 13.270 65.034 1.00 16.61  ? 167  SER A O   1 
ATOM   1106 C  CB  . SER A 1 147 ? 40.072 10.042 65.125 1.00 24.91  ? 167  SER A CB  1 
ATOM   1107 O  OG  . SER A 1 147 ? 40.079 8.843  65.870 1.00 46.09  ? 167  SER A OG  1 
ATOM   1108 N  N   . CYS A 1 148 ? 38.238 12.170 63.750 1.00 10.05  ? 168  CYS A N   1 
ATOM   1109 C  CA  . CYS A 1 148 ? 38.141 13.280 62.799 1.00 9.95   ? 168  CYS A CA  1 
ATOM   1110 C  C   . CYS A 1 148 ? 37.514 14.513 63.441 1.00 15.06  ? 168  CYS A C   1 
ATOM   1111 O  O   . CYS A 1 148 ? 38.020 15.620 63.300 1.00 13.90  ? 168  CYS A O   1 
ATOM   1112 C  CB  . CYS A 1 148 ? 37.355 12.813 61.572 1.00 13.19  ? 168  CYS A CB  1 
ATOM   1113 S  SG  . CYS A 1 148 ? 37.373 13.878 60.106 1.00 14.09  ? 168  CYS A SG  1 
ATOM   1114 N  N   . LYS A 1 149 ? 36.409 14.311 64.155 1.00 19.94  ? 169  LYS A N   1 
ATOM   1115 C  CA  . LYS A 1 149 ? 35.666 15.414 64.753 1.00 11.37  ? 169  LYS A CA  1 
ATOM   1116 C  C   . LYS A 1 149 ? 36.427 16.015 65.928 1.00 11.96  ? 169  LYS A C   1 
ATOM   1117 O  O   . LYS A 1 149 ? 36.283 17.210 66.194 1.00 17.47  ? 169  LYS A O   1 
ATOM   1118 C  CB  . LYS A 1 149 ? 34.276 14.947 65.168 1.00 13.29  ? 169  LYS A CB  1 
ATOM   1119 C  CG  . LYS A 1 149 ? 33.309 14.850 64.008 1.00 12.72  ? 169  LYS A CG  1 
ATOM   1120 C  CD  . LYS A 1 149 ? 32.074 14.046 64.334 1.00 12.03  ? 169  LYS A CD  1 
ATOM   1121 C  CE  . LYS A 1 149 ? 31.157 13.961 63.113 1.00 19.22  ? 169  LYS A CE  1 
ATOM   1122 N  NZ  . LYS A 1 149 ? 29.848 13.353 63.493 1.00 25.13  ? 169  LYS A NZ  1 
ATOM   1123 N  N   . SER A 1 150 ? 37.219 15.204 66.608 1.00 15.76  ? 170  SER A N   1 
ATOM   1124 C  CA  . SER A 1 150 ? 38.064 15.661 67.705 1.00 19.80  ? 170  SER A CA  1 
ATOM   1125 C  C   . SER A 1 150 ? 39.180 16.588 67.253 1.00 20.45  ? 170  SER A C   1 
ATOM   1126 O  O   . SER A 1 150 ? 39.485 17.559 67.944 1.00 17.47  ? 170  SER A O   1 
ATOM   1127 C  CB  . SER A 1 150 ? 38.668 14.437 68.421 1.00 25.33  ? 170  SER A CB  1 
ATOM   1128 O  OG  . SER A 1 150 ? 37.567 13.715 68.981 1.00 33.59  ? 170  SER A OG  1 
ATOM   1129 N  N   . ALA A 1 151 ? 39.769 16.273 66.097 1.00 14.06  ? 171  ALA A N   1 
ATOM   1130 C  CA  . ALA A 1 151 ? 40.805 17.097 65.503 1.00 12.99  ? 171  ALA A CA  1 
ATOM   1131 C  C   . ALA A 1 151 ? 40.259 18.453 65.064 1.00 15.87  ? 171  ALA A C   1 
ATOM   1132 O  O   . ALA A 1 151 ? 40.964 19.454 65.202 1.00 22.39  ? 171  ALA A O   1 
ATOM   1133 C  CB  . ALA A 1 151 ? 41.459 16.343 64.346 1.00 20.51  ? 171  ALA A CB  1 
ATOM   1134 N  N   . TYR A 1 152 ? 39.030 18.489 64.570 1.00 18.05  ? 172  TYR A N   1 
ATOM   1135 C  CA  . TYR A 1 152 ? 38.390 19.661 63.980 1.00 15.71  ? 172  TYR A CA  1 
ATOM   1136 C  C   . TYR A 1 152 ? 36.996 19.961 64.491 1.00 16.17  ? 172  TYR A C   1 
ATOM   1137 O  O   . TYR A 1 152 ? 35.956 19.817 63.832 1.00 15.43  ? 172  TYR A O   1 
ATOM   1138 C  CB  . TYR A 1 152 ? 38.310 19.382 62.487 1.00 14.70  ? 172  TYR A CB  1 
ATOM   1139 C  CG  . TYR A 1 152 ? 39.642 19.223 61.779 1.00 17.44  ? 172  TYR A CG  1 
ATOM   1140 C  CD1 . TYR A 1 152 ? 39.971 18.004 61.202 1.00 15.17  ? 172  TYR A CD1 1 
ATOM   1141 C  CD2 . TYR A 1 152 ? 40.551 20.261 61.690 1.00 13.06  ? 172  TYR A CD2 1 
ATOM   1142 C  CE1 . TYR A 1 152 ? 41.168 17.828 60.557 1.00 12.97  ? 172  TYR A CE1 1 
ATOM   1143 C  CE2 . TYR A 1 152 ? 41.760 20.098 61.034 1.00 18.33  ? 172  TYR A CE2 1 
ATOM   1144 C  CZ  . TYR A 1 152 ? 42.057 18.877 60.475 1.00 16.91  ? 172  TYR A CZ  1 
ATOM   1145 O  OH  . TYR A 1 152 ? 43.244 18.684 59.812 1.00 17.27  ? 172  TYR A OH  1 
ATOM   1146 N  N   . PRO A 1 153 ? 36.899 20.365 65.752 1.00 14.10  ? 173  PRO A N   1 
ATOM   1147 C  CA  . PRO A 1 153 ? 35.583 20.486 66.373 1.00 12.84  ? 173  PRO A CA  1 
ATOM   1148 C  C   . PRO A 1 153 ? 34.676 21.476 65.677 1.00 14.47  ? 173  PRO A C   1 
ATOM   1149 O  O   . PRO A 1 153 ? 35.073 22.593 65.394 1.00 19.21  ? 173  PRO A O   1 
ATOM   1150 C  CB  . PRO A 1 153 ? 35.908 20.998 67.792 1.00 24.92  ? 173  PRO A CB  1 
ATOM   1151 C  CG  . PRO A 1 153 ? 37.338 20.661 68.013 1.00 31.32  ? 173  PRO A CG  1 
ATOM   1152 C  CD  . PRO A 1 153 ? 38.002 20.680 66.662 1.00 28.01  ? 173  PRO A CD  1 
ATOM   1153 N  N   . GLY A 1 154 ? 33.450 21.038 65.412 1.00 19.66  ? 174  GLY A N   1 
ATOM   1154 C  CA  . GLY A 1 154 ? 32.471 21.931 64.820 1.00 21.67  ? 174  GLY A CA  1 
ATOM   1155 C  C   . GLY A 1 154 ? 32.715 22.161 63.342 1.00 21.38  ? 174  GLY A C   1 
ATOM   1156 O  O   . GLY A 1 154 ? 32.018 22.980 62.735 1.00 25.23  ? 174  GLY A O   1 
ATOM   1157 N  N   . GLN A 1 155 ? 33.691 21.466 62.764 1.00 13.33  ? 175  GLN A N   1 
ATOM   1158 C  CA  . GLN A 1 155 ? 33.979 21.706 61.347 1.00 17.08  ? 175  GLN A CA  1 
ATOM   1159 C  C   . GLN A 1 155 ? 33.653 20.523 60.443 1.00 19.74  ? 175  GLN A C   1 
ATOM   1160 O  O   . GLN A 1 155 ? 33.628 20.643 59.211 1.00 17.48  ? 175  GLN A O   1 
ATOM   1161 C  CB  . GLN A 1 155 ? 35.462 22.062 61.148 1.00 16.34  ? 175  GLN A CB  1 
ATOM   1162 C  CG  . GLN A 1 155 ? 35.820 23.464 61.618 1.00 17.51  ? 175  GLN A CG  1 
ATOM   1163 C  CD  . GLN A 1 155 ? 37.319 23.714 61.506 1.00 27.38  ? 175  GLN A CD  1 
ATOM   1164 O  OE1 . GLN A 1 155 ? 37.775 24.411 60.603 1.00 33.81  ? 175  GLN A OE1 1 
ATOM   1165 N  NE2 . GLN A 1 155 ? 38.049 23.105 62.429 1.00 26.73  ? 175  GLN A NE2 1 
ATOM   1166 N  N   . ILE A 1 156 ? 33.430 19.333 60.991 1.00 10.84  ? 176  ILE A N   1 
ATOM   1167 C  CA  . ILE A 1 156 ? 33.209 18.195 60.077 1.00 10.29  ? 176  ILE A CA  1 
ATOM   1168 C  C   . ILE A 1 156 ? 31.728 17.938 59.921 1.00 15.26  ? 176  ILE A C   1 
ATOM   1169 O  O   . ILE A 1 156 ? 31.015 17.924 60.927 1.00 16.26  ? 176  ILE A O   1 
ATOM   1170 C  CB  . ILE A 1 156 ? 33.943 16.966 60.626 1.00 13.86  ? 176  ILE A CB  1 
ATOM   1171 C  CG1 . ILE A 1 156 ? 35.432 17.309 60.827 1.00 12.43  ? 176  ILE A CG1 1 
ATOM   1172 C  CG2 . ILE A 1 156 ? 33.765 15.726 59.792 1.00 17.49  ? 176  ILE A CG2 1 
ATOM   1173 C  CD1 . ILE A 1 156 ? 36.155 17.692 59.542 1.00 13.38  ? 176  ILE A CD1 1 
ATOM   1174 N  N   . THR A 1 157 ? 31.294 17.737 58.693 1.00 12.39  ? 177  THR A N   1 
ATOM   1175 C  CA  . THR A 1 157 ? 29.924 17.427 58.334 1.00 9.28   ? 177  THR A CA  1 
ATOM   1176 C  C   . THR A 1 157 ? 29.856 15.958 57.925 1.00 10.19  ? 177  THR A C   1 
ATOM   1177 O  O   . THR A 1 157 ? 30.872 15.254 57.779 1.00 10.12  ? 177  THR A O   1 
ATOM   1178 C  CB  . THR A 1 157 ? 29.426 18.322 57.187 1.00 10.61  ? 177  THR A CB  1 
ATOM   1179 O  OG1 . THR A 1 157 ? 30.274 18.162 56.023 1.00 12.24  ? 177  THR A OG1 1 
ATOM   1180 C  CG2 . THR A 1 157 ? 29.543 19.788 57.566 1.00 22.39  ? 177  THR A CG2 1 
ATOM   1181 N  N   . SER A 1 158 ? 28.649 15.489 57.680 1.00 11.25  ? 178  SER A N   1 
ATOM   1182 C  CA  . SER A 1 158 ? 28.453 14.112 57.216 1.00 12.63  ? 178  SER A CA  1 
ATOM   1183 C  C   . SER A 1 158 ? 28.986 13.840 55.822 1.00 16.89  ? 178  SER A C   1 
ATOM   1184 O  O   . SER A 1 158 ? 29.076 12.733 55.293 1.00 12.22  ? 178  SER A O   1 
ATOM   1185 C  CB  . SER A 1 158 ? 26.950 13.821 57.221 1.00 22.10  ? 178  SER A CB  1 
ATOM   1186 O  OG  . SER A 1 158 ? 26.286 14.849 56.500 1.00 40.42  ? 178  SER A OG  1 
ATOM   1187 N  N   . ASN A 1 159 ? 29.332 14.889 55.104 1.00 9.03   ? 179  ASN A N   1 
ATOM   1188 C  CA  . ASN A 1 159 ? 29.900 14.850 53.767 1.00 10.78  ? 179  ASN A CA  1 
ATOM   1189 C  C   . ASN A 1 159 ? 31.414 14.894 53.710 1.00 12.45  ? 179  ASN A C   1 
ATOM   1190 O  O   . ASN A 1 159 ? 32.032 15.147 52.666 1.00 9.37   ? 179  ASN A O   1 
ATOM   1191 C  CB  . ASN A 1 159 ? 29.400 16.064 52.965 1.00 11.79  ? 179  ASN A CB  1 
ATOM   1192 C  CG  . ASN A 1 159 ? 27.894 16.056 52.822 1.00 12.42  ? 179  ASN A CG  1 
ATOM   1193 O  OD1 . ASN A 1 159 ? 27.282 15.020 52.579 1.00 13.67  ? 179  ASN A OD1 1 
ATOM   1194 N  ND2 . ASN A 1 159 ? 27.300 17.238 52.972 1.00 17.79  ? 179  ASN A ND2 1 
ATOM   1195 N  N   . MET A 1 160 ? 32.034 14.691 54.845 1.00 7.06   ? 180  MET A N   1 
ATOM   1196 C  CA  . MET A 1 160 ? 33.465 14.676 54.975 1.00 9.12   ? 180  MET A CA  1 
ATOM   1197 C  C   . MET A 1 160 ? 33.953 13.455 55.750 1.00 11.00  ? 180  MET A C   1 
ATOM   1198 O  O   . MET A 1 160 ? 33.287 12.887 56.609 1.00 12.54  ? 180  MET A O   1 
ATOM   1199 C  CB  . MET A 1 160 ? 33.932 15.910 55.747 1.00 6.47   ? 180  MET A CB  1 
ATOM   1200 C  CG  . MET A 1 160 ? 33.397 17.209 55.194 1.00 12.46  ? 180  MET A CG  1 
ATOM   1201 S  SD  . MET A 1 160 ? 33.951 18.582 56.238 1.00 12.61  ? 180  MET A SD  1 
ATOM   1202 C  CE  . MET A 1 160 ? 33.167 19.904 55.302 1.00 13.63  ? 180  MET A CE  1 
ATOM   1203 N  N   . PHE A 1 161 ? 35.172 13.032 55.453 1.00 9.12   ? 181  PHE A N   1 
ATOM   1204 C  CA  . PHE A 1 161 ? 35.847 12.011 56.260 1.00 10.99  ? 181  PHE A CA  1 
ATOM   1205 C  C   . PHE A 1 161 ? 37.311 12.421 56.341 1.00 12.10  ? 181  PHE A C   1 
ATOM   1206 O  O   . PHE A 1 161 ? 37.870 13.190 55.558 1.00 11.25  ? 181  PHE A O   1 
ATOM   1207 C  CB  . PHE A 1 161 ? 35.664 10.573 55.765 1.00 11.19  ? 181  PHE A CB  1 
ATOM   1208 C  CG  . PHE A 1 161 ? 36.359 10.222 54.458 1.00 10.85  ? 181  PHE A CG  1 
ATOM   1209 C  CD1 . PHE A 1 161 ? 37.654 9.759  54.434 1.00 7.41   ? 181  PHE A CD1 1 
ATOM   1210 C  CD2 . PHE A 1 161 ? 35.710 10.360 53.235 1.00 17.68  ? 181  PHE A CD2 1 
ATOM   1211 C  CE1 . PHE A 1 161 ? 38.261 9.465  53.234 1.00 10.36  ? 181  PHE A CE1 1 
ATOM   1212 C  CE2 . PHE A 1 161 ? 36.317 10.057 52.023 1.00 9.81   ? 181  PHE A CE2 1 
ATOM   1213 C  CZ  . PHE A 1 161 ? 37.617 9.601  52.015 1.00 14.94  ? 181  PHE A CZ  1 
ATOM   1214 N  N   . CYS A 1 162 ? 37.964 11.854 57.344 1.00 10.56  ? 182  CYS A N   1 
ATOM   1215 C  CA  . CYS A 1 162 ? 39.369 12.054 57.573 1.00 9.61   ? 182  CYS A CA  1 
ATOM   1216 C  C   . CYS A 1 162 ? 40.107 10.767 57.206 1.00 12.18  ? 182  CYS A C   1 
ATOM   1217 O  O   . CYS A 1 162 ? 39.624 9.650  57.404 1.00 8.17   ? 182  CYS A O   1 
ATOM   1218 C  CB  . CYS A 1 162 ? 39.744 12.373 59.022 1.00 10.29  ? 182  CYS A CB  1 
ATOM   1219 S  SG  . CYS A 1 162 ? 39.328 14.007 59.602 1.00 13.01  ? 182  CYS A SG  1 
ATOM   1220 N  N   . ALA A 1 163 ? 41.302 11.032 56.688 1.00 9.56   ? 183  ALA A N   1 
ATOM   1221 C  CA  . ALA A 1 163 ? 42.197 9.927  56.429 1.00 5.05   ? 183  ALA A CA  1 
ATOM   1222 C  C   . ALA A 1 163 ? 43.646 10.353 56.624 1.00 9.60   ? 183  ALA A C   1 
ATOM   1223 O  O   . ALA A 1 163 ? 44.042 11.496 56.449 1.00 12.71  ? 183  ALA A O   1 
ATOM   1224 C  CB  . ALA A 1 163 ? 42.007 9.372  55.025 1.00 11.79  ? 183  ALA A CB  1 
ATOM   1225 N  N   . GLY A 1 164 ? 44.398 9.319  57.024 1.00 11.94  ? 184  GLY A N   1 
ATOM   1226 C  CA  . GLY A 1 164 ? 45.812 9.563  57.241 1.00 12.44  ? 184  GLY A CA  1 
ATOM   1227 C  C   . GLY A 1 164 ? 46.250 8.943  58.557 1.00 12.00  ? 184  GLY A C   1 
ATOM   1228 O  O   . GLY A 1 164 ? 45.846 7.832  58.930 1.00 20.71  ? 184  GLY A O   1 
ATOM   1229 N  N   . TYR A 1 165 A 47.089 9.715  59.232 1.00 17.70  ? 184  TYR A N   1 
ATOM   1230 C  CA  . TYR A 1 165 A 47.826 9.263  60.404 1.00 18.24  ? 184  TYR A CA  1 
ATOM   1231 C  C   . TYR A 1 165 A 47.887 10.375 61.437 1.00 19.73  ? 184  TYR A C   1 
ATOM   1232 O  O   . TYR A 1 165 A 48.350 11.498 61.228 1.00 22.13  ? 184  TYR A O   1 
ATOM   1233 C  CB  . TYR A 1 165 A 49.218 8.803  59.983 1.00 15.53  ? 184  TYR A CB  1 
ATOM   1234 C  CG  . TYR A 1 165 A 49.282 7.715  58.944 1.00 19.74  ? 184  TYR A CG  1 
ATOM   1235 C  CD1 . TYR A 1 165 A 49.292 8.036  57.581 1.00 20.80  ? 184  TYR A CD1 1 
ATOM   1236 C  CD2 . TYR A 1 165 A 49.325 6.371  59.281 1.00 27.51  ? 184  TYR A CD2 1 
ATOM   1237 C  CE1 . TYR A 1 165 A 49.350 7.052  56.617 1.00 22.28  ? 184  TYR A CE1 1 
ATOM   1238 C  CE2 . TYR A 1 165 A 49.385 5.369  58.325 1.00 22.63  ? 184  TYR A CE2 1 
ATOM   1239 C  CZ  . TYR A 1 165 A 49.399 5.723  56.992 1.00 21.20  ? 184  TYR A CZ  1 
ATOM   1240 O  OH  . TYR A 1 165 A 49.450 4.740  56.038 1.00 24.84  ? 184  TYR A OH  1 
ATOM   1241 N  N   . LEU A 1 166 ? 47.384 10.019 62.625 1.00 14.58  ? 185  LEU A N   1 
ATOM   1242 C  CA  . LEU A 1 166 ? 47.299 11.067 63.651 1.00 19.99  ? 185  LEU A CA  1 
ATOM   1243 C  C   . LEU A 1 166 ? 48.671 11.448 64.167 1.00 16.94  ? 185  LEU A C   1 
ATOM   1244 O  O   . LEU A 1 166 ? 48.870 12.522 64.733 1.00 30.91  ? 185  LEU A O   1 
ATOM   1245 C  CB  . LEU A 1 166 ? 46.334 10.572 64.730 1.00 25.34  ? 185  LEU A CB  1 
ATOM   1246 C  CG  . LEU A 1 166 ? 44.869 10.528 64.279 1.00 27.66  ? 185  LEU A CG  1 
ATOM   1247 C  CD1 . LEU A 1 166 ? 44.017 9.794  65.308 1.00 40.99  ? 185  LEU A CD1 1 
ATOM   1248 C  CD2 . LEU A 1 166 ? 44.329 11.930 64.010 1.00 28.83  ? 185  LEU A CD2 1 
ATOM   1249 N  N   . GLU A 1 167 ? 49.634 10.557 63.958 1.00 19.90  ? 186  GLU A N   1 
ATOM   1250 C  CA  . GLU A 1 167 ? 51.003 10.807 64.399 1.00 23.74  ? 186  GLU A CA  1 
ATOM   1251 C  C   . GLU A 1 167 ? 51.713 11.809 63.497 1.00 37.26  ? 186  GLU A C   1 
ATOM   1252 O  O   . GLU A 1 167 ? 52.809 12.300 63.775 1.00 33.82  ? 186  GLU A O   1 
ATOM   1253 C  CB  . GLU A 1 167 ? 51.776 9.498  64.445 0.54 23.43  ? 186  GLU A CB  1 
ATOM   1254 N  N   . GLY A 1 168 ? 51.072 12.129 62.372 1.00 29.43  ? 187  GLY A N   1 
ATOM   1255 C  CA  . GLY A 1 168 ? 51.689 13.043 61.430 1.00 30.14  ? 187  GLY A CA  1 
ATOM   1256 C  C   . GLY A 1 168 ? 52.604 12.306 60.467 1.00 26.64  ? 187  GLY A C   1 
ATOM   1257 O  O   . GLY A 1 168 ? 52.628 11.076 60.488 1.00 36.27  ? 187  GLY A O   1 
ATOM   1258 N  N   . GLY A 1 169 ? 53.334 13.055 59.649 1.00 24.63  ? 188  GLY A N   1 
ATOM   1259 C  CA  . GLY A 1 169 ? 54.331 12.547 58.745 1.00 24.36  ? 188  GLY A CA  1 
ATOM   1260 C  C   . GLY A 1 169 ? 53.923 12.153 57.347 1.00 20.09  ? 188  GLY A C   1 
ATOM   1261 O  O   . GLY A 1 169 ? 54.782 12.133 56.462 1.00 19.95  ? 188  GLY A O   1 
ATOM   1262 N  N   . LYS A 1 170 A 52.666 11.797 57.116 1.00 15.50  ? 188  LYS A N   1 
ATOM   1263 C  CA  . LYS A 1 170 A 52.125 11.330 55.853 1.00 16.41  ? 188  LYS A CA  1 
ATOM   1264 C  C   . LYS A 1 170 A 50.751 11.957 55.651 1.00 15.86  ? 188  LYS A C   1 
ATOM   1265 O  O   . LYS A 1 170 A 49.864 11.838 56.497 1.00 17.62  ? 188  LYS A O   1 
ATOM   1266 C  CB  . LYS A 1 170 A 52.006 9.808  55.797 1.00 20.57  ? 188  LYS A CB  1 
ATOM   1267 C  CG  . LYS A 1 170 A 53.293 9.117  56.236 1.00 25.29  ? 188  LYS A CG  1 
ATOM   1268 C  CD  . LYS A 1 170 A 53.189 7.609  56.077 1.00 32.06  ? 188  LYS A CD  1 
ATOM   1269 C  CE  . LYS A 1 170 A 54.495 6.919  56.436 1.00 35.18  ? 188  LYS A CE  1 
ATOM   1270 N  NZ  . LYS A 1 170 A 54.331 5.442  56.557 1.00 56.50  ? 188  LYS A NZ  1 
ATOM   1271 N  N   . ASP A 1 171 ? 50.594 12.656 54.534 1.00 17.03  ? 189  ASP A N   1 
ATOM   1272 C  CA  . ASP A 1 171 ? 49.358 13.379 54.282 1.00 14.27  ? 189  ASP A CA  1 
ATOM   1273 C  C   . ASP A 1 171 ? 49.321 13.896 52.858 1.00 13.83  ? 189  ASP A C   1 
ATOM   1274 O  O   . ASP A 1 171 ? 50.350 13.954 52.176 1.00 14.93  ? 189  ASP A O   1 
ATOM   1275 C  CB  . ASP A 1 171 ? 49.310 14.534 55.275 1.00 15.60  ? 189  ASP A CB  1 
ATOM   1276 C  CG  . ASP A 1 171 ? 48.008 15.290 55.399 1.00 18.48  ? 189  ASP A CG  1 
ATOM   1277 O  OD1 . ASP A 1 171 ? 48.063 16.311 56.123 1.00 18.11  ? 189  ASP A OD1 1 
ATOM   1278 O  OD2 . ASP A 1 171 ? 46.986 14.863 54.820 1.00 15.44  ? 189  ASP A OD2 1 
ATOM   1279 N  N   . SER A 1 172 ? 48.129 14.300 52.436 1.00 15.89  ? 190  SER A N   1 
ATOM   1280 C  CA  . SER A 1 172 ? 48.103 15.087 51.193 1.00 12.64  ? 190  SER A CA  1 
ATOM   1281 C  C   . SER A 1 172 ? 48.492 16.521 51.553 1.00 11.62  ? 190  SER A C   1 
ATOM   1282 O  O   . SER A 1 172 ? 48.714 16.881 52.717 1.00 19.45  ? 190  SER A O   1 
ATOM   1283 C  CB  . SER A 1 172 ? 46.745 14.945 50.515 1.00 13.72  ? 190  SER A CB  1 
ATOM   1284 O  OG  . SER A 1 172 ? 45.718 15.314 51.411 1.00 22.36  ? 190  SER A OG  1 
ATOM   1285 N  N   . CYS A 1 173 ? 48.601 17.423 50.586 1.00 12.44  ? 191  CYS A N   1 
ATOM   1286 C  CA  . CYS A 1 173 ? 49.094 18.771 50.820 1.00 15.64  ? 191  CYS A CA  1 
ATOM   1287 C  C   . CYS A 1 173 ? 48.738 19.685 49.659 1.00 21.18  ? 191  CYS A C   1 
ATOM   1288 O  O   . CYS A 1 173 ? 48.013 19.303 48.737 1.00 20.27  ? 191  CYS A O   1 
ATOM   1289 C  CB  . CYS A 1 173 ? 50.615 18.710 51.030 1.00 23.68  ? 191  CYS A CB  1 
ATOM   1290 S  SG  . CYS A 1 173 ? 51.353 20.140 51.856 1.00 20.98  ? 191  CYS A SG  1 
ATOM   1291 N  N   . GLN A 1 174 ? 49.270 20.901 49.667 1.00 16.87  ? 192  GLN A N   1 
ATOM   1292 C  CA  . GLN A 1 174 ? 48.999 21.867 48.610 1.00 19.83  ? 192  GLN A CA  1 
ATOM   1293 C  C   . GLN A 1 174 ? 49.359 21.334 47.228 1.00 12.78  ? 192  GLN A C   1 
ATOM   1294 O  O   . GLN A 1 174 ? 50.477 20.885 46.972 1.00 18.49  ? 192  GLN A O   1 
ATOM   1295 C  CB  A GLN A 1 174 ? 49.784 23.153 48.891 0.31 26.60  ? 192  GLN A CB  1 
ATOM   1296 C  CB  B GLN A 1 174 ? 49.725 23.184 48.890 0.69 25.35  ? 192  GLN A CB  1 
ATOM   1297 C  CG  A GLN A 1 174 ? 48.931 24.287 49.444 0.31 27.53  ? 192  GLN A CG  1 
ATOM   1298 C  CG  B GLN A 1 174 ? 51.080 23.148 49.559 0.69 39.91  ? 192  GLN A CG  1 
ATOM   1299 C  CD  A GLN A 1 174 ? 48.437 25.197 48.338 0.31 31.55  ? 192  GLN A CD  1 
ATOM   1300 C  CD  B GLN A 1 174 ? 51.263 23.633 50.973 0.69 48.58  ? 192  GLN A CD  1 
ATOM   1301 O  OE1 A GLN A 1 174 ? 49.116 25.372 47.320 0.31 41.25  ? 192  GLN A OE1 1 
ATOM   1302 O  OE1 B GLN A 1 174 ? 52.218 23.211 51.656 0.69 49.20  ? 192  GLN A OE1 1 
ATOM   1303 N  NE2 A GLN A 1 174 ? 47.258 25.771 48.534 0.31 22.97  ? 192  GLN A NE2 1 
ATOM   1304 N  NE2 B GLN A 1 174 ? 50.444 24.521 51.533 0.69 53.67  ? 192  GLN A NE2 1 
ATOM   1305 N  N   . GLY A 1 175 ? 48.395 21.397 46.299 1.00 17.78  ? 193  GLY A N   1 
ATOM   1306 C  CA  . GLY A 1 175 ? 48.573 20.951 44.936 1.00 12.27  ? 193  GLY A CA  1 
ATOM   1307 C  C   . GLY A 1 175 ? 47.950 19.588 44.682 1.00 9.93   ? 193  GLY A C   1 
ATOM   1308 O  O   . GLY A 1 175 ? 47.801 19.149 43.540 1.00 11.21  ? 193  GLY A O   1 
ATOM   1309 N  N   . ASP A 1 176 ? 47.604 18.907 45.785 1.00 6.65   ? 194  ASP A N   1 
ATOM   1310 C  CA  . ASP A 1 176 ? 46.896 17.635 45.699 1.00 10.46  ? 194  ASP A CA  1 
ATOM   1311 C  C   . ASP A 1 176 ? 45.377 17.772 45.677 1.00 8.74   ? 194  ASP A C   1 
ATOM   1312 O  O   . ASP A 1 176 ? 44.675 16.804 45.360 1.00 9.39   ? 194  ASP A O   1 
ATOM   1313 C  CB  . ASP A 1 176 ? 47.292 16.799 46.928 1.00 16.40  ? 194  ASP A CB  1 
ATOM   1314 C  CG  . ASP A 1 176 ? 48.717 16.302 46.896 1.00 14.39  ? 194  ASP A CG  1 
ATOM   1315 O  OD1 . ASP A 1 176 ? 49.355 16.283 47.960 1.00 11.94  ? 194  ASP A OD1 1 
ATOM   1316 O  OD2 . ASP A 1 176 ? 49.188 15.901 45.822 1.00 9.21   ? 194  ASP A OD2 1 
ATOM   1317 N  N   . SER A 1 177 ? 44.865 18.958 46.007 1.00 8.40   ? 195  SER A N   1 
ATOM   1318 C  CA  . SER A 1 177 ? 43.454 19.271 46.025 1.00 8.84   ? 195  SER A CA  1 
ATOM   1319 C  C   . SER A 1 177 ? 42.730 18.735 44.801 1.00 8.62   ? 195  SER A C   1 
ATOM   1320 O  O   . SER A 1 177 ? 43.207 18.959 43.688 1.00 9.08   ? 195  SER A O   1 
ATOM   1321 C  CB  . SER A 1 177 ? 43.191 20.790 45.960 1.00 15.67  ? 195  SER A CB  1 
ATOM   1322 O  OG  . SER A 1 177 ? 43.531 21.447 47.152 1.00 18.69  ? 195  SER A OG  1 
ATOM   1323 N  N   . GLY A 1 178 ? 41.591 18.111 45.030 1.00 8.42   ? 196  GLY A N   1 
ATOM   1324 C  CA  . GLY A 1 178 ? 40.724 17.676 43.955 1.00 5.33   ? 196  GLY A CA  1 
ATOM   1325 C  C   . GLY A 1 178 ? 41.016 16.276 43.477 1.00 5.38   ? 196  GLY A C   1 
ATOM   1326 O  O   . GLY A 1 178 ? 40.276 15.670 42.710 1.00 10.87  ? 196  GLY A O   1 
ATOM   1327 N  N   . GLY A 1 179 ? 42.148 15.746 43.961 1.00 11.57  ? 197  GLY A N   1 
ATOM   1328 C  CA  . GLY A 1 179 ? 42.600 14.441 43.524 1.00 9.89   ? 197  GLY A CA  1 
ATOM   1329 C  C   . GLY A 1 179 ? 41.877 13.298 44.201 1.00 10.47  ? 197  GLY A C   1 
ATOM   1330 O  O   . GLY A 1 179 ? 41.085 13.505 45.119 1.00 9.10   ? 197  GLY A O   1 
ATOM   1331 N  N   . PRO A 1 180 ? 42.147 12.091 43.734 1.00 11.33  ? 198  PRO A N   1 
ATOM   1332 C  CA  . PRO A 1 180 ? 41.389 10.929 44.201 1.00 11.91  ? 198  PRO A CA  1 
ATOM   1333 C  C   . PRO A 1 180 ? 41.875 10.280 45.484 1.00 9.33   ? 198  PRO A C   1 
ATOM   1334 O  O   . PRO A 1 180 ? 43.052 10.323 45.830 1.00 11.38  ? 198  PRO A O   1 
ATOM   1335 C  CB  . PRO A 1 180 ? 41.623 9.909  43.062 1.00 13.48  ? 198  PRO A CB  1 
ATOM   1336 C  CG  . PRO A 1 180 ? 42.892 10.304 42.416 1.00 12.57  ? 198  PRO A CG  1 
ATOM   1337 C  CD  . PRO A 1 180 ? 43.137 11.749 42.712 1.00 11.92  ? 198  PRO A CD  1 
ATOM   1338 N  N   . VAL A 1 181 ? 40.918 9.642  46.147 1.00 7.27   ? 199  VAL A N   1 
ATOM   1339 C  CA  . VAL A 1 181 ? 41.107 8.731  47.259 1.00 8.82   ? 199  VAL A CA  1 
ATOM   1340 C  C   . VAL A 1 181 ? 40.360 7.457  46.872 1.00 5.62   ? 199  VAL A C   1 
ATOM   1341 O  O   . VAL A 1 181 ? 39.131 7.493  46.811 1.00 11.16  ? 199  VAL A O   1 
ATOM   1342 C  CB  . VAL A 1 181 ? 40.570 9.293  48.576 1.00 12.20  ? 199  VAL A CB  1 
ATOM   1343 C  CG1 . VAL A 1 181 ? 40.877 8.380  49.730 1.00 9.75   ? 199  VAL A CG1 1 
ATOM   1344 C  CG2 . VAL A 1 181 ? 41.134 10.682 48.872 1.00 14.23  ? 199  VAL A CG2 1 
ATOM   1345 N  N   . VAL A 1 182 ? 41.132 6.428  46.571 1.00 8.20   ? 200  VAL A N   1 
ATOM   1346 C  CA  . VAL A 1 182 ? 40.571 5.215  45.990 1.00 8.94   ? 200  VAL A CA  1 
ATOM   1347 C  C   . VAL A 1 182 ? 40.746 4.071  46.980 1.00 11.17  ? 200  VAL A C   1 
ATOM   1348 O  O   . VAL A 1 182 ? 41.834 3.740  47.444 1.00 11.17  ? 200  VAL A O   1 
ATOM   1349 C  CB  . VAL A 1 182 ? 41.183 4.889  44.623 1.00 5.83   ? 200  VAL A CB  1 
ATOM   1350 C  CG1 . VAL A 1 182 ? 40.805 3.492  44.130 1.00 12.87  ? 200  VAL A CG1 1 
ATOM   1351 C  CG2 . VAL A 1 182 ? 40.715 5.927  43.617 1.00 11.03  ? 200  VAL A CG2 1 
ATOM   1352 N  N   . CYS A 1 183 ? 39.605 3.476  47.316 1.00 6.12   ? 201  CYS A N   1 
ATOM   1353 C  CA  . CYS A 1 183 ? 39.633 2.404  48.313 1.00 6.84   ? 201  CYS A CA  1 
ATOM   1354 C  C   . CYS A 1 183 ? 38.820 1.243  47.770 1.00 11.19  ? 201  CYS A C   1 
ATOM   1355 O  O   . CYS A 1 183 ? 37.667 1.377  47.366 1.00 11.76  ? 201  CYS A O   1 
ATOM   1356 C  CB  . CYS A 1 183 ? 39.096 2.867  49.659 1.00 13.54  ? 201  CYS A CB  1 
ATOM   1357 S  SG  . CYS A 1 183 ? 39.217 4.623  50.096 1.00 15.49  ? 201  CYS A SG  1 
ATOM   1358 N  N   . SER A 1 184 ? 39.458 0.081  47.730 1.00 17.59  ? 202  SER A N   1 
ATOM   1359 C  CA  . SER A 1 184 ? 38.771 -1.091 47.185 1.00 20.68  ? 202  SER A CA  1 
ATOM   1360 C  C   . SER A 1 184 ? 38.213 -0.872 45.797 1.00 19.36  ? 202  SER A C   1 
ATOM   1361 O  O   . SER A 1 184 ? 37.060 -1.266 45.585 1.00 21.99  ? 202  SER A O   1 
ATOM   1362 C  CB  . SER A 1 184 ? 37.592 -1.466 48.090 1.00 22.81  ? 202  SER A CB  1 
ATOM   1363 O  OG  . SER A 1 184 ? 38.106 -1.818 49.360 1.00 29.96  ? 202  SER A OG  1 
ATOM   1364 N  N   . GLY A 1 185 ? 39.012 -0.265 44.936 1.00 17.17  ? 203  GLY A N   1 
ATOM   1365 C  CA  . GLY A 1 185 ? 38.690 -0.075 43.542 1.00 18.69  ? 203  GLY A CA  1 
ATOM   1366 C  C   . GLY A 1 185 ? 37.635 0.960  43.253 1.00 18.08  ? 203  GLY A C   1 
ATOM   1367 O  O   . GLY A 1 185 ? 37.197 1.050  42.103 1.00 16.78  ? 203  GLY A O   1 
ATOM   1368 N  N   . LYS A 1 186 ? 37.233 1.735  44.261 1.00 10.98  ? 204  LYS A N   1 
ATOM   1369 C  CA  . LYS A 1 186 ? 36.166 2.700  44.023 1.00 12.85  ? 204  LYS A CA  1 
ATOM   1370 C  C   . LYS A 1 186 ? 36.594 4.101  44.445 1.00 15.10  ? 204  LYS A C   1 
ATOM   1371 O  O   . LYS A 1 186 ? 37.306 4.245  45.437 1.00 8.68   ? 204  LYS A O   1 
ATOM   1372 C  CB  . LYS A 1 186 ? 34.910 2.415  44.864 1.00 16.29  ? 204  LYS A CB  1 
ATOM   1373 C  CG  . LYS A 1 186 ? 34.316 1.015  44.736 1.00 22.12  ? 204  LYS A CG  1 
ATOM   1374 C  CD  . LYS A 1 186 ? 33.878 0.788  43.304 1.00 24.10  ? 204  LYS A CD  1 
ATOM   1375 C  CE  . LYS A 1 186 ? 33.071 -0.478 43.084 1.00 40.09  ? 204  LYS A CE  1 
ATOM   1376 N  NZ  . LYS A 1 186 ? 33.038 -0.884 41.640 1.00 53.46  ? 204  LYS A NZ  1 
ATOM   1377 N  N   . LEU A 1 187 ? 36.137 5.144  43.772 1.00 9.63   ? 209  LEU A N   1 
ATOM   1378 C  CA  . LEU A 1 187 ? 36.477 6.476  44.273 1.00 10.93  ? 209  LEU A CA  1 
ATOM   1379 C  C   . LEU A 1 187 ? 35.673 6.857  45.506 1.00 9.72   ? 209  LEU A C   1 
ATOM   1380 O  O   . LEU A 1 187 ? 34.461 7.120  45.419 1.00 13.99  ? 209  LEU A O   1 
ATOM   1381 C  CB  . LEU A 1 187 ? 36.191 7.420  43.116 1.00 6.78   ? 209  LEU A CB  1 
ATOM   1382 C  CG  . LEU A 1 187 ? 36.503 8.878  43.451 1.00 8.50   ? 209  LEU A CG  1 
ATOM   1383 C  CD1 . LEU A 1 187 ? 38.002 9.027  43.643 1.00 12.28  ? 209  LEU A CD1 1 
ATOM   1384 C  CD2 . LEU A 1 187 ? 35.959 9.761  42.339 1.00 10.10  ? 209  LEU A CD2 1 
ATOM   1385 N  N   . GLN A 1 188 ? 36.291 6.896  46.692 1.00 10.05  ? 210  GLN A N   1 
ATOM   1386 C  CA  . GLN A 1 188 ? 35.532 7.218  47.906 1.00 7.51   ? 210  GLN A CA  1 
ATOM   1387 C  C   . GLN A 1 188 ? 35.774 8.644  48.375 1.00 4.30   ? 210  GLN A C   1 
ATOM   1388 O  O   . GLN A 1 188 ? 34.995 9.200  49.150 1.00 5.64   ? 210  GLN A O   1 
ATOM   1389 C  CB  . GLN A 1 188 ? 35.905 6.253  49.040 1.00 9.29   ? 210  GLN A CB  1 
ATOM   1390 C  CG  . GLN A 1 188 ? 35.428 4.835  48.811 1.00 13.21  ? 210  GLN A CG  1 
ATOM   1391 C  CD  . GLN A 1 188 ? 33.945 4.651  49.045 1.00 18.02  ? 210  GLN A CD  1 
ATOM   1392 O  OE1 . GLN A 1 188 ? 33.179 5.586  49.243 1.00 14.50  ? 210  GLN A OE1 1 
ATOM   1393 N  NE2 . GLN A 1 188 ? 33.544 3.378  48.998 1.00 15.74  ? 210  GLN A NE2 1 
ATOM   1394 N  N   . GLY A 1 189 ? 36.872 9.270  47.971 1.00 7.49   ? 211  GLY A N   1 
ATOM   1395 C  CA  . GLY A 1 189 ? 37.187 10.590 48.497 1.00 10.22  ? 211  GLY A CA  1 
ATOM   1396 C  C   . GLY A 1 189 ? 37.806 11.533 47.484 1.00 13.00  ? 211  GLY A C   1 
ATOM   1397 O  O   . GLY A 1 189 ? 38.381 11.148 46.464 1.00 9.98   ? 211  GLY A O   1 
ATOM   1398 N  N   . ILE A 1 190 ? 37.675 12.819 47.788 1.00 11.01  ? 212  ILE A N   1 
ATOM   1399 C  CA  . ILE A 1 190 ? 38.345 13.855 47.020 1.00 4.88   ? 212  ILE A CA  1 
ATOM   1400 C  C   . ILE A 1 190 ? 39.187 14.686 47.976 1.00 6.24   ? 212  ILE A C   1 
ATOM   1401 O  O   . ILE A 1 190 ? 38.665 15.085 49.021 1.00 7.63   ? 212  ILE A O   1 
ATOM   1402 C  CB  . ILE A 1 190 ? 37.338 14.723 46.266 1.00 3.57   ? 212  ILE A CB  1 
ATOM   1403 C  CG1 . ILE A 1 190 ? 36.477 13.938 45.288 1.00 4.28   ? 212  ILE A CG1 1 
ATOM   1404 C  CG2 . ILE A 1 190 ? 38.028 15.896 45.594 1.00 8.25   ? 212  ILE A CG2 1 
ATOM   1405 C  CD1 . ILE A 1 190 ? 35.224 14.623 44.821 1.00 14.73  ? 212  ILE A CD1 1 
ATOM   1406 N  N   . VAL A 1 191 ? 40.466 14.898 47.648 1.00 9.50   ? 213  VAL A N   1 
ATOM   1407 C  CA  . VAL A 1 191 ? 41.334 15.744 48.477 1.00 8.44   ? 213  VAL A CA  1 
ATOM   1408 C  C   . VAL A 1 191 ? 40.721 17.122 48.652 1.00 8.53   ? 213  VAL A C   1 
ATOM   1409 O  O   . VAL A 1 191 ? 40.573 17.848 47.665 1.00 9.67   ? 213  VAL A O   1 
ATOM   1410 C  CB  . VAL A 1 191 ? 42.733 15.865 47.861 1.00 6.81   ? 213  VAL A CB  1 
ATOM   1411 C  CG1 . VAL A 1 191 ? 43.584 16.769 48.729 1.00 11.75  ? 213  VAL A CG1 1 
ATOM   1412 C  CG2 . VAL A 1 191 ? 43.362 14.486 47.656 1.00 10.25  ? 213  VAL A CG2 1 
ATOM   1413 N  N   . SER A 1 192 ? 40.339 17.494 49.876 1.00 8.74   ? 214  SER A N   1 
ATOM   1414 C  CA  . SER A 1 192 ? 39.607 18.744 50.103 1.00 10.10  ? 214  SER A CA  1 
ATOM   1415 C  C   . SER A 1 192 ? 40.362 19.738 50.962 1.00 11.49  ? 214  SER A C   1 
ATOM   1416 O  O   . SER A 1 192 ? 40.791 20.797 50.503 1.00 9.29   ? 214  SER A O   1 
ATOM   1417 C  CB  . SER A 1 192 ? 38.227 18.386 50.672 1.00 8.47   ? 214  SER A CB  1 
ATOM   1418 O  OG  . SER A 1 192 ? 37.425 19.495 50.985 1.00 8.61   ? 214  SER A OG  1 
ATOM   1419 N  N   . TRP A 1 193 ? 40.575 19.467 52.251 1.00 9.38   ? 215  TRP A N   1 
ATOM   1420 C  CA  . TRP A 1 193 ? 41.264 20.438 53.090 1.00 13.37  ? 215  TRP A CA  1 
ATOM   1421 C  C   . TRP A 1 193 ? 42.012 19.759 54.234 1.00 12.23  ? 215  TRP A C   1 
ATOM   1422 O  O   . TRP A 1 193 ? 42.032 18.546 54.410 1.00 14.66  ? 215  TRP A O   1 
ATOM   1423 C  CB  . TRP A 1 193 ? 40.243 21.451 53.576 1.00 9.63   ? 215  TRP A CB  1 
ATOM   1424 C  CG  . TRP A 1 193 ? 39.114 20.999 54.448 1.00 8.85   ? 215  TRP A CG  1 
ATOM   1425 C  CD1 . TRP A 1 193 ? 37.930 20.479 54.017 1.00 7.04   ? 215  TRP A CD1 1 
ATOM   1426 C  CD2 . TRP A 1 193 ? 39.020 21.017 55.877 1.00 12.93  ? 215  TRP A CD2 1 
ATOM   1427 N  NE1 . TRP A 1 193 ? 37.115 20.171 55.087 1.00 15.04  ? 215  TRP A NE1 1 
ATOM   1428 C  CE2 . TRP A 1 193 ? 37.767 20.497 56.251 1.00 13.54  ? 215  TRP A CE2 1 
ATOM   1429 C  CE3 . TRP A 1 193 ? 39.879 21.429 56.902 1.00 17.72  ? 215  TRP A CE3 1 
ATOM   1430 C  CZ2 . TRP A 1 193 ? 37.339 20.365 57.571 1.00 15.79  ? 215  TRP A CZ2 1 
ATOM   1431 C  CZ3 . TRP A 1 193 ? 39.453 21.297 58.203 1.00 17.42  ? 215  TRP A CZ3 1 
ATOM   1432 C  CH2 . TRP A 1 193 ? 38.207 20.776 58.552 1.00 15.10  ? 215  TRP A CH2 1 
ATOM   1433 N  N   . GLY A 1 194 ? 42.674 20.589 55.030 1.00 12.16  ? 216  GLY A N   1 
ATOM   1434 C  CA  . GLY A 1 194 ? 43.407 20.071 56.174 1.00 12.80  ? 216  GLY A CA  1 
ATOM   1435 C  C   . GLY A 1 194 ? 43.972 21.262 56.933 1.00 17.80  ? 216  GLY A C   1 
ATOM   1436 O  O   . GLY A 1 194 ? 43.610 22.400 56.680 1.00 18.73  ? 216  GLY A O   1 
ATOM   1437 N  N   . SER A 1 195 ? 44.855 21.052 57.880 1.00 20.77  ? 217  SER A N   1 
ATOM   1438 C  CA  . SER A 1 195 ? 45.490 22.194 58.560 1.00 19.75  ? 217  SER A CA  1 
ATOM   1439 C  C   . SER A 1 195 ? 46.986 21.996 58.423 1.00 14.03  ? 217  SER A C   1 
ATOM   1440 O  O   . SER A 1 195 ? 47.461 21.014 58.998 1.00 20.81  ? 217  SER A O   1 
ATOM   1441 C  CB  . SER A 1 195 ? 45.031 22.237 60.001 1.00 19.49  ? 217  SER A CB  1 
ATOM   1442 O  OG  . SER A 1 195 ? 45.782 23.151 60.770 1.00 25.33  ? 217  SER A OG  1 
ATOM   1443 N  N   . GLY A 1 196 ? 47.738 22.811 57.710 1.00 23.16  ? 219  GLY A N   1 
ATOM   1444 C  CA  . GLY A 1 196 ? 49.129 22.393 57.491 1.00 22.27  ? 219  GLY A CA  1 
ATOM   1445 C  C   . GLY A 1 196 ? 49.141 21.102 56.676 1.00 24.82  ? 219  GLY A C   1 
ATOM   1446 O  O   . GLY A 1 196 ? 48.145 20.739 56.049 1.00 23.03  ? 219  GLY A O   1 
ATOM   1447 N  N   . CYS A 1 197 ? 50.249 20.385 56.681 1.00 18.57  ? 220  CYS A N   1 
ATOM   1448 C  CA  . CYS A 1 197 ? 50.375 19.088 56.051 1.00 26.75  ? 220  CYS A CA  1 
ATOM   1449 C  C   . CYS A 1 197 ? 51.249 18.190 56.938 1.00 17.95  ? 220  CYS A C   1 
ATOM   1450 O  O   . CYS A 1 197 ? 52.294 18.655 57.383 1.00 22.80  ? 220  CYS A O   1 
ATOM   1451 C  CB  . CYS A 1 197 ? 51.019 19.161 54.672 1.00 25.11  ? 220  CYS A CB  1 
ATOM   1452 S  SG  . CYS A 1 197 ? 50.237 20.320 53.527 1.00 19.63  ? 220  CYS A SG  1 
ATOM   1453 N  N   . ALA A 1 198 ? 50.772 16.983 57.122 1.00 16.40  ? 221  ALA A N   1 
ATOM   1454 C  CA  . ALA A 1 198 ? 51.469 15.949 57.858 1.00 20.07  ? 221  ALA A CA  1 
ATOM   1455 C  C   . ALA A 1 198 ? 51.780 16.370 59.291 1.00 25.09  ? 221  ALA A C   1 
ATOM   1456 O  O   . ALA A 1 198 ? 52.720 15.843 59.894 1.00 28.91  ? 221  ALA A O   1 
ATOM   1457 C  CB  . ALA A 1 198 ? 52.726 15.579 57.097 1.00 11.23  ? 221  ALA A CB  1 
ATOM   1458 N  N   . GLN A 1 199 A 50.984 17.279 59.833 1.00 16.30  ? 221  GLN A N   1 
ATOM   1459 C  CA  . GLN A 1 199 A 51.103 17.673 61.239 1.00 24.53  ? 221  GLN A CA  1 
ATOM   1460 C  C   . GLN A 1 199 A 50.385 16.712 62.178 1.00 29.78  ? 221  GLN A C   1 
ATOM   1461 O  O   . GLN A 1 199 A 49.342 16.098 61.918 1.00 21.53  ? 221  GLN A O   1 
ATOM   1462 C  CB  A GLN A 1 199 A 50.586 19.100 61.432 0.51 27.05  ? 221  GLN A CB  1 
ATOM   1463 C  CB  B GLN A 1 199 A 50.537 19.084 61.427 0.49 27.06  ? 221  GLN A CB  1 
ATOM   1464 C  CG  A GLN A 1 199 A 51.409 20.160 60.720 0.51 29.83  ? 221  GLN A CG  1 
ATOM   1465 C  CG  B GLN A 1 199 A 51.504 20.224 61.173 0.49 28.74  ? 221  GLN A CG  1 
ATOM   1466 C  CD  A GLN A 1 199 A 52.904 19.934 60.789 0.51 30.39  ? 221  GLN A CD  1 
ATOM   1467 C  CD  B GLN A 1 199 A 50.832 21.511 60.734 0.49 33.67  ? 221  GLN A CD  1 
ATOM   1468 O  OE1 A GLN A 1 199 A 53.509 20.053 61.854 0.51 27.64  ? 221  GLN A OE1 1 
ATOM   1469 O  OE1 B GLN A 1 199 A 49.648 21.761 60.986 0.49 34.10  ? 221  GLN A OE1 1 
ATOM   1470 N  NE2 A GLN A 1 199 A 53.524 19.610 59.660 0.51 35.01  ? 221  GLN A NE2 1 
ATOM   1471 N  NE2 B GLN A 1 199 A 51.592 22.363 60.045 0.49 35.73  ? 221  GLN A NE2 1 
ATOM   1472 N  N   . LYS A 1 200 ? 50.940 16.537 63.382 1.00 23.91  ? 222  LYS A N   1 
ATOM   1473 C  CA  . LYS A 1 200 ? 50.302 15.629 64.331 1.00 19.02  ? 222  LYS A CA  1 
ATOM   1474 C  C   . LYS A 1 200 ? 48.892 16.084 64.682 1.00 11.47  ? 222  LYS A C   1 
ATOM   1475 O  O   . LYS A 1 200 ? 48.651 17.286 64.824 1.00 19.61  ? 222  LYS A O   1 
ATOM   1476 C  CB  . LYS A 1 200 ? 51.118 15.526 65.615 1.00 32.21  ? 222  LYS A CB  1 
ATOM   1477 C  CG  . LYS A 1 200 ? 52.612 15.724 65.449 1.00 49.09  ? 222  LYS A CG  1 
ATOM   1478 C  CD  . LYS A 1 200 ? 53.394 14.891 66.453 1.00 65.47  ? 222  LYS A CD  1 
ATOM   1479 C  CE  . LYS A 1 200 ? 52.774 14.913 67.840 1.00 74.68  ? 222  LYS A CE  1 
ATOM   1480 N  NZ  . LYS A 1 200 ? 53.544 15.736 68.823 1.00 107.30 ? 222  LYS A NZ  1 
ATOM   1481 N  N   . ASN A 1 201 ? 48.000 15.118 64.811 1.00 15.76  ? 223  ASN A N   1 
ATOM   1482 C  CA  . ASN A 1 201 ? 46.611 15.229 65.226 1.00 19.31  ? 223  ASN A CA  1 
ATOM   1483 C  C   . ASN A 1 201 ? 45.840 16.195 64.336 1.00 22.10  ? 223  ASN A C   1 
ATOM   1484 O  O   . ASN A 1 201 ? 44.856 16.819 64.742 1.00 25.93  ? 223  ASN A O   1 
ATOM   1485 C  CB  A ASN A 1 201 ? 46.520 15.702 66.679 0.45 30.06  ? 223  ASN A CB  1 
ATOM   1486 C  CB  B ASN A 1 201 ? 46.511 15.679 66.688 0.55 30.27  ? 223  ASN A CB  1 
ATOM   1487 C  CG  A ASN A 1 201 ? 47.021 14.686 67.684 0.45 30.21  ? 223  ASN A CG  1 
ATOM   1488 C  CG  B ASN A 1 201 ? 45.502 14.867 67.478 0.55 35.35  ? 223  ASN A CG  1 
ATOM   1489 O  OD1 A ASN A 1 201 ? 47.454 13.589 67.324 0.45 35.53  ? 223  ASN A OD1 1 
ATOM   1490 O  OD1 B ASN A 1 201 ? 44.409 15.356 67.799 0.55 57.31  ? 223  ASN A OD1 1 
ATOM   1491 N  ND2 A ASN A 1 201 ? 46.971 15.047 68.963 0.45 38.37  ? 223  ASN A ND2 1 
ATOM   1492 N  ND2 B ASN A 1 201 ? 45.854 13.629 67.799 0.55 45.15  ? 223  ASN A ND2 1 
ATOM   1493 N  N   . LYS A 1 202 ? 46.318 16.317 63.108 1.00 15.94  ? 224  LYS A N   1 
ATOM   1494 C  CA  . LYS A 1 202 ? 45.674 17.110 62.079 1.00 17.44  ? 224  LYS A CA  1 
ATOM   1495 C  C   . LYS A 1 202 ? 45.592 16.333 60.771 1.00 14.59  ? 224  LYS A C   1 
ATOM   1496 O  O   . LYS A 1 202 ? 46.274 16.685 59.810 1.00 15.82  ? 224  LYS A O   1 
ATOM   1497 C  CB  . LYS A 1 202 ? 46.434 18.404 61.815 1.00 20.54  ? 224  LYS A CB  1 
ATOM   1498 C  CG  . LYS A 1 202 ? 46.380 19.372 62.986 1.00 31.14  ? 224  LYS A CG  1 
ATOM   1499 C  CD  . LYS A 1 202 ? 44.961 19.887 63.215 1.00 45.44  ? 224  LYS A CD  1 
ATOM   1500 C  CE  . LYS A 1 202 ? 44.607 19.795 64.699 1.00 55.77  ? 224  LYS A CE  1 
ATOM   1501 N  NZ  . LYS A 1 202 ? 43.765 20.937 65.145 1.00 68.04  ? 224  LYS A NZ  1 
ATOM   1502 N  N   . PRO A 1 203 ? 44.773 15.294 60.697 1.00 17.92  ? 225  PRO A N   1 
ATOM   1503 C  CA  . PRO A 1 203 ? 44.752 14.509 59.457 1.00 23.43  ? 225  PRO A CA  1 
ATOM   1504 C  C   . PRO A 1 203 ? 44.041 15.240 58.321 1.00 13.45  ? 225  PRO A C   1 
ATOM   1505 O  O   . PRO A 1 203 ? 43.328 16.219 58.516 1.00 16.03  ? 225  PRO A O   1 
ATOM   1506 C  CB  . PRO A 1 203 ? 43.962 13.254 59.838 1.00 20.25  ? 225  PRO A CB  1 
ATOM   1507 C  CG  . PRO A 1 203 ? 43.167 13.624 61.026 1.00 19.85  ? 225  PRO A CG  1 
ATOM   1508 C  CD  . PRO A 1 203 ? 43.850 14.782 61.711 1.00 19.34  ? 225  PRO A CD  1 
ATOM   1509 N  N   . GLY A 1 204 ? 44.244 14.746 57.103 1.00 13.45  ? 226  GLY A N   1 
ATOM   1510 C  CA  . GLY A 1 204 ? 43.574 15.292 55.924 1.00 10.31  ? 226  GLY A CA  1 
ATOM   1511 C  C   . GLY A 1 204 ? 42.082 15.032 55.958 1.00 6.45   ? 226  GLY A C   1 
ATOM   1512 O  O   . GLY A 1 204 ? 41.570 14.031 56.477 1.00 10.65  ? 226  GLY A O   1 
ATOM   1513 N  N   . VAL A 1 205 ? 41.335 15.962 55.366 1.00 8.60   ? 227  VAL A N   1 
ATOM   1514 C  CA  . VAL A 1 205 ? 39.888 15.881 55.246 1.00 9.98   ? 227  VAL A CA  1 
ATOM   1515 C  C   . VAL A 1 205 ? 39.508 15.781 53.773 1.00 9.19   ? 227  VAL A C   1 
ATOM   1516 O  O   . VAL A 1 205 ? 40.015 16.466 52.902 1.00 6.93   ? 227  VAL A O   1 
ATOM   1517 C  CB  . VAL A 1 205 ? 39.229 17.098 55.908 1.00 11.81  ? 227  VAL A CB  1 
ATOM   1518 C  CG1 . VAL A 1 205 ? 37.722 16.938 55.945 1.00 8.29   ? 227  VAL A CG1 1 
ATOM   1519 C  CG2 . VAL A 1 205 ? 39.855 17.270 57.286 1.00 10.28  ? 227  VAL A CG2 1 
ATOM   1520 N  N   . TYR A 1 206 ? 38.587 14.873 53.474 1.00 10.42  ? 228  TYR A N   1 
ATOM   1521 C  CA  . TYR A 1 206 ? 38.215 14.493 52.138 1.00 7.63   ? 228  TYR A CA  1 
ATOM   1522 C  C   . TYR A 1 206 ? 36.715 14.549 51.917 1.00 8.37   ? 228  TYR A C   1 
ATOM   1523 O  O   . TYR A 1 206 ? 35.978 14.204 52.847 1.00 8.61   ? 228  TYR A O   1 
ATOM   1524 C  CB  . TYR A 1 206 ? 38.684 13.039 51.915 1.00 9.51   ? 228  TYR A CB  1 
ATOM   1525 C  CG  . TYR A 1 206 ? 40.179 12.997 52.140 1.00 5.87   ? 228  TYR A CG  1 
ATOM   1526 C  CD1 . TYR A 1 206 ? 40.979 13.290 51.045 1.00 7.59   ? 228  TYR A CD1 1 
ATOM   1527 C  CD2 . TYR A 1 206 ? 40.762 12.728 53.364 1.00 7.25   ? 228  TYR A CD2 1 
ATOM   1528 C  CE1 . TYR A 1 206 ? 42.347 13.284 51.165 1.00 8.17   ? 228  TYR A CE1 1 
ATOM   1529 C  CE2 . TYR A 1 206 ? 42.150 12.722 53.477 1.00 14.29  ? 228  TYR A CE2 1 
ATOM   1530 C  CZ  . TYR A 1 206 ? 42.921 12.996 52.385 1.00 11.26  ? 228  TYR A CZ  1 
ATOM   1531 O  OH  . TYR A 1 206 ? 44.290 13.021 52.420 1.00 10.49  ? 228  TYR A OH  1 
ATOM   1532 N  N   . THR A 1 207 ? 36.306 14.969 50.741 1.00 6.64   ? 229  THR A N   1 
ATOM   1533 C  CA  . THR A 1 207 ? 34.898 14.903 50.411 1.00 5.57   ? 229  THR A CA  1 
ATOM   1534 C  C   . THR A 1 207 ? 34.434 13.453 50.296 1.00 6.48   ? 229  THR A C   1 
ATOM   1535 O  O   . THR A 1 207 ? 35.113 12.689 49.632 1.00 9.74   ? 229  THR A O   1 
ATOM   1536 C  CB  . THR A 1 207 ? 34.649 15.595 49.060 1.00 7.58   ? 229  THR A CB  1 
ATOM   1537 O  OG1 . THR A 1 207 ? 35.271 16.880 49.129 1.00 9.29   ? 229  THR A OG1 1 
ATOM   1538 C  CG2 . THR A 1 207 ? 33.155 15.718 48.808 1.00 7.91   ? 229  THR A CG2 1 
ATOM   1539 N  N   . LYS A 1 208 ? 33.325 13.118 50.945 1.00 10.99  ? 230  LYS A N   1 
ATOM   1540 C  CA  . LYS A 1 208 ? 32.771 11.773 51.007 1.00 5.40   ? 230  LYS A CA  1 
ATOM   1541 C  C   . LYS A 1 208 ? 31.885 11.458 49.817 1.00 7.14   ? 230  LYS A C   1 
ATOM   1542 O  O   . LYS A 1 208 ? 30.682 11.696 49.825 1.00 10.77  ? 230  LYS A O   1 
ATOM   1543 C  CB  . LYS A 1 208 ? 31.971 11.628 52.301 1.00 7.89   ? 230  LYS A CB  1 
ATOM   1544 C  CG  . LYS A 1 208 ? 31.551 10.199 52.581 1.00 10.37  ? 230  LYS A CG  1 
ATOM   1545 C  CD  . LYS A 1 208 ? 30.621 10.095 53.775 1.00 15.73  ? 230  LYS A CD  1 
ATOM   1546 C  CE  . LYS A 1 208 ? 31.344 9.821  55.067 1.00 30.78  ? 230  LYS A CE  1 
ATOM   1547 N  NZ  . LYS A 1 208 ? 30.449 9.124  56.038 1.00 46.46  ? 230  LYS A NZ  1 
ATOM   1548 N  N   . VAL A 1 209 ? 32.521 10.941 48.782 1.00 9.00   ? 231  VAL A N   1 
ATOM   1549 C  CA  . VAL A 1 209 ? 31.945 10.763 47.457 1.00 4.78   ? 231  VAL A CA  1 
ATOM   1550 C  C   . VAL A 1 209 ? 30.724 9.868  47.480 1.00 9.15   ? 231  VAL A C   1 
ATOM   1551 O  O   . VAL A 1 209 ? 29.826 10.086 46.652 1.00 8.36   ? 231  VAL A O   1 
ATOM   1552 C  CB  . VAL A 1 209 ? 32.997 10.234 46.456 1.00 7.53   ? 231  VAL A CB  1 
ATOM   1553 C  CG1 . VAL A 1 209 ? 32.376 9.848  45.128 1.00 9.08   ? 231  VAL A CG1 1 
ATOM   1554 C  CG2 . VAL A 1 209 ? 34.075 11.272 46.212 1.00 14.65  ? 231  VAL A CG2 1 
ATOM   1555 N  N   . CYS A 1 210 ? 30.677 8.912  48.406 1.00 11.98  ? 232  CYS A N   1 
ATOM   1556 C  CA  . CYS A 1 210 ? 29.530 8.010  48.448 1.00 9.97   ? 232  CYS A CA  1 
ATOM   1557 C  C   . CYS A 1 210 ? 28.246 8.761  48.762 1.00 12.30  ? 232  CYS A C   1 
ATOM   1558 O  O   . CYS A 1 210 ? 27.169 8.238  48.437 1.00 16.76  ? 232  CYS A O   1 
ATOM   1559 C  CB  . CYS A 1 210 ? 29.732 6.871  49.447 1.00 16.06  ? 232  CYS A CB  1 
ATOM   1560 S  SG  . CYS A 1 210 ? 29.889 7.437  51.150 1.00 10.70  ? 232  CYS A SG  1 
ATOM   1561 N  N   . ASN A 1 211 ? 28.330 9.958  49.318 1.00 10.13  ? 233  ASN A N   1 
ATOM   1562 C  CA  . ASN A 1 211 ? 27.115 10.747 49.462 1.00 6.30   ? 233  ASN A CA  1 
ATOM   1563 C  C   . ASN A 1 211 ? 26.597 11.447 48.214 1.00 11.53  ? 233  ASN A C   1 
ATOM   1564 O  O   . ASN A 1 211 ? 25.496 12.017 48.235 1.00 12.49  ? 233  ASN A O   1 
ATOM   1565 C  CB  . ASN A 1 211 ? 27.362 11.843 50.510 1.00 8.17   ? 233  ASN A CB  1 
ATOM   1566 C  CG  . ASN A 1 211 ? 27.383 11.227 51.900 1.00 14.14  ? 233  ASN A CG  1 
ATOM   1567 O  OD1 . ASN A 1 211 ? 27.256 10.006 52.037 1.00 16.14  ? 233  ASN A OD1 1 
ATOM   1568 N  ND2 . ASN A 1 211 ? 27.526 12.098 52.888 1.00 19.13  ? 233  ASN A ND2 1 
ATOM   1569 N  N   . TYR A 1 212 ? 27.349 11.465 47.126 1.00 9.71   ? 234  TYR A N   1 
ATOM   1570 C  CA  . TYR A 1 212 ? 27.039 12.271 45.955 1.00 15.62  ? 234  TYR A CA  1 
ATOM   1571 C  C   . TYR A 1 212 ? 26.764 11.454 44.703 1.00 11.26  ? 234  TYR A C   1 
ATOM   1572 O  O   . TYR A 1 212 ? 26.634 12.044 43.641 1.00 11.12  ? 234  TYR A O   1 
ATOM   1573 C  CB  . TYR A 1 212 ? 28.205 13.250 45.638 1.00 11.51  ? 234  TYR A CB  1 
ATOM   1574 C  CG  . TYR A 1 212 ? 28.411 14.211 46.794 1.00 9.64   ? 234  TYR A CG  1 
ATOM   1575 C  CD1 . TYR A 1 212 ? 27.618 15.332 46.908 1.00 12.68  ? 234  TYR A CD1 1 
ATOM   1576 C  CD2 . TYR A 1 212 ? 29.378 13.959 47.749 1.00 11.75  ? 234  TYR A CD2 1 
ATOM   1577 C  CE1 . TYR A 1 212 ? 27.791 16.215 47.947 1.00 13.10  ? 234  TYR A CE1 1 
ATOM   1578 C  CE2 . TYR A 1 212 ? 29.559 14.824 48.811 1.00 13.09  ? 234  TYR A CE2 1 
ATOM   1579 C  CZ  . TYR A 1 212 ? 28.753 15.948 48.899 1.00 8.58   ? 234  TYR A CZ  1 
ATOM   1580 O  OH  . TYR A 1 212 ? 28.934 16.811 49.956 1.00 11.05  ? 234  TYR A OH  1 
ATOM   1581 N  N   . VAL A 1 213 ? 26.690 10.126 44.768 1.00 9.12   ? 235  VAL A N   1 
ATOM   1582 C  CA  . VAL A 1 213 ? 26.639 9.356  43.535 1.00 14.26  ? 235  VAL A CA  1 
ATOM   1583 C  C   . VAL A 1 213 ? 25.380 9.604  42.721 1.00 12.64  ? 235  VAL A C   1 
ATOM   1584 O  O   . VAL A 1 213 ? 25.485 9.602  41.492 1.00 9.99   ? 235  VAL A O   1 
ATOM   1585 C  CB  . VAL A 1 213 ? 26.823 7.852  43.824 1.00 18.35  ? 235  VAL A CB  1 
ATOM   1586 C  CG1 . VAL A 1 213 ? 26.662 7.029  42.560 1.00 24.76  ? 235  VAL A CG1 1 
ATOM   1587 C  CG2 . VAL A 1 213 ? 28.208 7.680  44.436 1.00 16.62  ? 235  VAL A CG2 1 
ATOM   1588 N  N   . SER A 1 214 ? 24.249 9.816  43.377 1.00 9.67   ? 236  SER A N   1 
ATOM   1589 C  CA  . SER A 1 214 ? 23.013 10.105 42.679 1.00 14.01  ? 236  SER A CA  1 
ATOM   1590 C  C   . SER A 1 214 ? 23.105 11.437 41.947 1.00 10.56  ? 236  SER A C   1 
ATOM   1591 O  O   . SER A 1 214 ? 22.675 11.618 40.814 1.00 13.62  ? 236  SER A O   1 
ATOM   1592 C  CB  A SER A 1 214 ? 21.826 10.133 43.646 0.39 16.81  ? 236  SER A CB  1 
ATOM   1593 C  CB  B SER A 1 214 ? 21.868 10.107 43.694 0.61 16.66  ? 236  SER A CB  1 
ATOM   1594 O  OG  A SER A 1 214 ? 20.630 9.729  42.988 0.39 18.55  ? 236  SER A OG  1 
ATOM   1595 O  OG  B SER A 1 214 ? 21.715 8.769  44.156 0.61 19.54  ? 236  SER A OG  1 
ATOM   1596 N  N   . TRP A 1 215 ? 23.696 12.391 42.661 1.00 12.70  ? 237  TRP A N   1 
ATOM   1597 C  CA  . TRP A 1 215 ? 23.826 13.709 42.047 1.00 10.88  ? 237  TRP A CA  1 
ATOM   1598 C  C   . TRP A 1 215 ? 24.750 13.601 40.854 1.00 7.46   ? 237  TRP A C   1 
ATOM   1599 O  O   . TRP A 1 215 ? 24.522 14.187 39.806 1.00 10.22  ? 237  TRP A O   1 
ATOM   1600 C  CB  . TRP A 1 215 ? 24.337 14.750 43.054 1.00 12.61  ? 237  TRP A CB  1 
ATOM   1601 C  CG  . TRP A 1 215 ? 24.682 16.044 42.373 1.00 14.46  ? 237  TRP A CG  1 
ATOM   1602 C  CD1 . TRP A 1 215 ? 23.851 17.006 41.889 1.00 18.35  ? 237  TRP A CD1 1 
ATOM   1603 C  CD2 . TRP A 1 215 ? 26.005 16.503 42.100 1.00 9.80   ? 237  TRP A CD2 1 
ATOM   1604 N  NE1 . TRP A 1 215 ? 24.585 18.033 41.335 1.00 10.86  ? 237  TRP A NE1 1 
ATOM   1605 C  CE2 . TRP A 1 215 ? 25.913 17.749 41.447 1.00 10.18  ? 237  TRP A CE2 1 
ATOM   1606 C  CE3 . TRP A 1 215 ? 27.264 15.965 42.350 1.00 8.18   ? 237  TRP A CE3 1 
ATOM   1607 C  CZ2 . TRP A 1 215 ? 27.023 18.490 41.032 1.00 15.92  ? 237  TRP A CZ2 1 
ATOM   1608 C  CZ3 . TRP A 1 215 ? 28.347 16.699 41.935 1.00 10.23  ? 237  TRP A CZ3 1 
ATOM   1609 C  CH2 . TRP A 1 215 ? 28.247 17.932 41.291 1.00 12.48  ? 237  TRP A CH2 1 
ATOM   1610 N  N   . ILE A 1 216 ? 25.837 12.822 40.999 1.00 10.12  ? 238  ILE A N   1 
ATOM   1611 C  CA  . ILE A 1 216 ? 26.800 12.697 39.897 1.00 15.23  ? 238  ILE A CA  1 
ATOM   1612 C  C   . ILE A 1 216 ? 26.145 12.015 38.706 1.00 15.24  ? 238  ILE A C   1 
ATOM   1613 O  O   . ILE A 1 216 ? 26.184 12.482 37.571 1.00 11.67  ? 238  ILE A O   1 
ATOM   1614 C  CB  . ILE A 1 216 ? 28.076 11.955 40.349 1.00 8.73   ? 238  ILE A CB  1 
ATOM   1615 C  CG1 . ILE A 1 216 ? 28.980 12.768 41.262 1.00 8.31   ? 238  ILE A CG1 1 
ATOM   1616 C  CG2 . ILE A 1 216 ? 28.889 11.451 39.161 1.00 16.17  ? 238  ILE A CG2 1 
ATOM   1617 C  CD1 . ILE A 1 216 ? 30.017 11.946 42.007 1.00 8.83   ? 238  ILE A CD1 1 
ATOM   1618 N  N   . LYS A 1 217 ? 25.496 10.878 38.931 1.00 10.31  ? 239  LYS A N   1 
ATOM   1619 C  CA  . LYS A 1 217 ? 24.883 10.145 37.835 1.00 9.70   ? 239  LYS A CA  1 
ATOM   1620 C  C   . LYS A 1 217 ? 23.776 10.930 37.158 1.00 12.20  ? 239  LYS A C   1 
ATOM   1621 O  O   . LYS A 1 217 ? 23.597 10.803 35.935 1.00 14.80  ? 239  LYS A O   1 
ATOM   1622 C  CB  . LYS A 1 217 ? 24.356 8.805  38.367 1.00 13.64  ? 239  LYS A CB  1 
ATOM   1623 C  CG  . LYS A 1 217 ? 25.478 7.805  38.629 1.00 20.69  ? 239  LYS A CG  1 
ATOM   1624 C  CD  . LYS A 1 217 ? 24.895 6.458  39.054 1.00 28.42  ? 239  LYS A CD  1 
ATOM   1625 C  CE  . LYS A 1 217 ? 25.340 5.354  38.105 1.00 51.66  ? 239  LYS A CE  1 
ATOM   1626 N  NZ  . LYS A 1 217 ? 24.988 5.591  36.675 1.00 90.23  ? 239  LYS A NZ  1 
ATOM   1627 N  N   . GLN A 1 218 ? 23.047 11.735 37.913 1.00 12.29  ? 240  GLN A N   1 
ATOM   1628 C  CA  . GLN A 1 218 ? 21.909 12.449 37.332 1.00 13.73  ? 240  GLN A CA  1 
ATOM   1629 C  C   . GLN A 1 218 ? 22.413 13.636 36.528 1.00 12.61  ? 240  GLN A C   1 
ATOM   1630 O  O   . GLN A 1 218 ? 21.895 14.005 35.484 1.00 16.06  ? 240  GLN A O   1 
ATOM   1631 C  CB  . GLN A 1 218 ? 20.936 12.920 38.406 1.00 17.42  ? 240  GLN A CB  1 
ATOM   1632 C  CG  . GLN A 1 218 ? 20.114 11.798 39.030 1.00 34.39  ? 240  GLN A CG  1 
ATOM   1633 C  CD  . GLN A 1 218 ? 19.380 12.256 40.283 1.00 57.13  ? 240  GLN A CD  1 
ATOM   1634 O  OE1 . GLN A 1 218 ? 19.418 13.436 40.642 1.00 81.14  ? 240  GLN A OE1 1 
ATOM   1635 N  NE2 . GLN A 1 218 ? 18.706 11.330 40.959 1.00 89.09  ? 240  GLN A NE2 1 
ATOM   1636 N  N   . THR A 1 219 ? 23.455 14.265 37.049 1.00 6.82   ? 241  THR A N   1 
ATOM   1637 C  CA  . THR A 1 219 ? 24.058 15.415 36.388 1.00 6.51   ? 241  THR A CA  1 
ATOM   1638 C  C   . THR A 1 219 ? 24.757 15.048 35.090 1.00 9.54   ? 241  THR A C   1 
ATOM   1639 O  O   . THR A 1 219 ? 24.569 15.739 34.089 1.00 11.80  ? 241  THR A O   1 
ATOM   1640 C  CB  . THR A 1 219 ? 25.020 16.117 37.368 1.00 11.80  ? 241  THR A CB  1 
ATOM   1641 O  OG1 . THR A 1 219 ? 24.202 16.562 38.468 1.00 12.99  ? 241  THR A OG1 1 
ATOM   1642 C  CG2 . THR A 1 219 ? 25.685 17.328 36.764 1.00 16.14  ? 241  THR A CG2 1 
ATOM   1643 N  N   . ILE A 1 220 ? 25.555 13.983 35.081 1.00 9.11   ? 242  ILE A N   1 
ATOM   1644 C  CA  . ILE A 1 220 ? 26.229 13.632 33.833 1.00 10.48  ? 242  ILE A CA  1 
ATOM   1645 C  C   . ILE A 1 220 ? 25.229 13.157 32.803 1.00 11.49  ? 242  ILE A C   1 
ATOM   1646 O  O   . ILE A 1 220 ? 25.451 13.405 31.611 1.00 20.46  ? 242  ILE A O   1 
ATOM   1647 C  CB  . ILE A 1 220 ? 27.333 12.589 34.064 1.00 16.41  ? 242  ILE A CB  1 
ATOM   1648 C  CG1 . ILE A 1 220 ? 26.821 11.165 34.294 1.00 19.51  ? 242  ILE A CG1 1 
ATOM   1649 C  CG2 . ILE A 1 220 ? 28.240 13.023 35.207 1.00 18.91  ? 242  ILE A CG2 1 
ATOM   1650 C  CD1 . ILE A 1 220 ? 27.959 10.166 34.388 1.00 24.43  ? 242  ILE A CD1 1 
ATOM   1651 N  N   . ALA A 1 221 ? 24.132 12.512 33.180 1.00 11.46  ? 243  ALA A N   1 
ATOM   1652 C  CA  . ALA A 1 221 ? 23.166 12.081 32.172 1.00 14.04  ? 243  ALA A CA  1 
ATOM   1653 C  C   . ALA A 1 221 ? 22.360 13.244 31.608 1.00 11.65  ? 243  ALA A C   1 
ATOM   1654 O  O   . ALA A 1 221 ? 21.725 13.120 30.549 1.00 13.91  ? 243  ALA A O   1 
ATOM   1655 C  CB  . ALA A 1 221 ? 22.243 11.025 32.770 1.00 17.03  ? 243  ALA A CB  1 
ATOM   1656 N  N   . SER A 1 222 ? 22.351 14.392 32.264 1.00 8.97   ? 244  SER A N   1 
ATOM   1657 C  CA  . SER A 1 222 ? 21.576 15.539 31.812 1.00 11.60  ? 244  SER A CA  1 
ATOM   1658 C  C   . SER A 1 222 ? 22.373 16.646 31.153 1.00 15.25  ? 244  SER A C   1 
ATOM   1659 O  O   . SER A 1 222 ? 21.815 17.691 30.788 1.00 21.06  ? 244  SER A O   1 
ATOM   1660 C  CB  . SER A 1 222 ? 20.811 16.100 33.021 1.00 15.33  ? 244  SER A CB  1 
ATOM   1661 O  OG  . SER A 1 222 ? 19.910 15.092 33.472 1.00 26.65  ? 244  SER A OG  1 
ATOM   1662 N  N   . ASN A 1 223 ? 23.659 16.429 30.996 1.00 10.33  ? 245  ASN A N   1 
ATOM   1663 C  CA  . ASN A 1 223 ? 24.594 17.415 30.495 1.00 11.33  ? 245  ASN A CA  1 
ATOM   1664 C  C   . ASN A 1 223 ? 25.554 16.823 29.477 1.00 14.64  ? 245  ASN A C   1 
ATOM   1665 O  O   . ASN A 1 223 ? 26.455 17.568 29.045 1.00 16.96  ? 245  ASN A O   1 
ATOM   1666 C  CB  . ASN A 1 223 ? 25.364 18.000 31.689 1.00 9.83   ? 245  ASN A CB  1 
ATOM   1667 C  CG  . ASN A 1 223 ? 24.486 18.980 32.458 1.00 14.39  ? 245  ASN A CG  1 
ATOM   1668 O  OD1 . ASN A 1 223 ? 24.418 20.146 32.065 1.00 16.10  ? 245  ASN A OD1 1 
ATOM   1669 N  ND2 . ASN A 1 223 ? 23.843 18.478 33.496 1.00 15.64  ? 245  ASN A ND2 1 
ATOM   1670 O  OXT . ASN A 1 223 ? 25.407 15.636 29.134 1.00 17.25  ? 245  ASN A OXT 1 
HETATM 1671 CA CA  . CA  B 2 .   ? 53.979 14.698 30.766 1.00 13.20  ? 3333 CA  A CA  1 
HETATM 1672 N  N1  . UIR C 3 .   ? 46.782 18.521 54.803 1.00 20.44  ? 2222 UIR A N1  1 
HETATM 1673 C  C3  . UIR C 3 .   ? 45.917 18.389 53.816 1.00 19.11  ? 2222 UIR A C3  1 
HETATM 1674 C  C4  . UIR C 3 .   ? 45.414 19.445 53.008 1.00 33.68  ? 2222 UIR A C4  1 
HETATM 1675 C  C9  . UIR C 3 .   ? 45.800 20.775 53.163 1.00 38.07  ? 2222 UIR A C9  1 
HETATM 1676 C  C8  . UIR C 3 .   ? 45.267 21.753 52.308 1.00 37.66  ? 2222 UIR A C8  1 
HETATM 1677 C  C7  . UIR C 3 .   ? 44.360 21.399 51.307 1.00 42.82  ? 2222 UIR A C7  1 
HETATM 1678 C  C10 . UIR C 3 .   ? 43.765 22.444 50.399 1.00 46.16  ? 2222 UIR A C10 1 
HETATM 1679 N  N11 . UIR C 3 .   ? 44.735 23.584 50.197 1.00 53.67  ? 2222 UIR A N11 1 
HETATM 1680 C  C12 . UIR C 3 .   ? 45.827 23.235 49.234 1.00 47.30  ? 2222 UIR A C12 1 
HETATM 1681 C  C13 . UIR C 3 .   ? 45.304 23.612 47.834 1.00 35.34  ? 2222 UIR A C13 1 
HETATM 1682 C  C14 . UIR C 3 .   ? 43.987 24.306 48.008 1.00 39.58  ? 2222 UIR A C14 1 
HETATM 1683 C  C15 . UIR C 3 .   ? 43.867 24.620 49.510 1.00 51.01  ? 2222 UIR A C15 1 
HETATM 1684 C  C16 . UIR C 3 .   ? 42.391 24.343 49.937 1.00 50.58  ? 2222 UIR A C16 1 
HETATM 1685 C  C17 . UIR C 3 .   ? 41.825 25.468 50.864 1.00 57.69  ? 2222 UIR A C17 1 
HETATM 1686 N  N19 . UIR C 3 .   ? 42.356 25.129 52.174 1.00 61.16  ? 2222 UIR A N19 1 
HETATM 1687 C  C20 . UIR C 3 .   ? 42.681 23.797 52.279 1.00 55.27  ? 2222 UIR A C20 1 
HETATM 1688 O  O21 . UIR C 3 .   ? 43.149 23.269 53.322 1.00 29.73  ? 2222 UIR A O21 1 
HETATM 1689 C  C22 . UIR C 3 .   ? 42.479 23.134 50.900 1.00 41.04  ? 2222 UIR A C22 1 
HETATM 1690 C  C23 . UIR C 3 .   ? 41.867 25.870 53.393 1.00 66.34  ? 2222 UIR A C23 1 
HETATM 1691 C  C6  . UIR C 3 .   ? 43.976 20.056 51.152 1.00 40.07  ? 2222 UIR A C6  1 
HETATM 1692 C  C5  . UIR C 3 .   ? 44.507 19.090 51.983 1.00 37.33  ? 2222 UIR A C5  1 
HETATM 1693 N  N2  . UIR C 3 .   ? 45.485 17.124 53.591 1.00 19.92  ? 2222 UIR A N2  1 
HETATM 1694 O  O   . HOH D 4 .   ? 44.536 7.360  43.840 1.00 12.20  ? 9001 HOH A O   1 
HETATM 1695 O  O   . HOH D 4 .   ? 45.793 15.068 43.375 1.00 10.90  ? 9002 HOH A O   1 
HETATM 1696 O  O   . HOH D 4 .   ? 38.986 13.324 42.332 1.00 20.06  ? 9003 HOH A O   1 
HETATM 1697 O  O   . HOH D 4 .   ? 47.658 16.850 42.275 1.00 12.03  ? 9004 HOH A O   1 
HETATM 1698 O  O   . HOH D 4 .   ? 51.253 18.962 32.396 1.00 11.94  ? 9005 HOH A O   1 
HETATM 1699 O  O   . HOH D 4 .   ? 32.273 18.047 51.703 1.00 11.85  ? 9006 HOH A O   1 
HETATM 1700 O  O   . HOH D 4 .   ? 55.036 8.495  39.327 1.00 16.31  ? 9007 HOH A O   1 
HETATM 1701 O  O   . HOH D 4 .   ? 36.684 10.218 59.388 1.00 11.18  ? 9008 HOH A O   1 
HETATM 1702 O  O   . HOH D 4 .   ? 45.510 12.587 54.806 1.00 16.20  ? 9009 HOH A O   1 
HETATM 1703 O  O   . HOH D 4 .   ? 47.166 12.697 34.038 1.00 18.97  ? 9010 HOH A O   1 
HETATM 1704 O  O   . HOH D 4 .   ? 49.557 20.184 34.255 1.00 11.39  ? 9011 HOH A O   1 
HETATM 1705 O  O   . HOH D 4 .   ? 32.784 7.978  49.983 1.00 11.57  ? 9012 HOH A O   1 
HETATM 1706 O  O   . HOH D 4 .   ? 58.823 17.923 26.678 1.00 17.70  ? 9013 HOH A O   1 
HETATM 1707 O  O   . HOH D 4 .   ? 48.499 18.388 58.826 1.00 18.43  ? 9014 HOH A O   1 
HETATM 1708 O  O   . HOH D 4 .   ? 60.377 12.046 34.692 1.00 36.05  ? 9015 HOH A O   1 
HETATM 1709 O  O   . HOH D 4 .   ? 58.499 21.282 40.172 1.00 19.20  ? 9016 HOH A O   1 
HETATM 1710 O  O   . HOH D 4 .   ? 53.176 16.924 30.044 1.00 11.71  ? 9017 HOH A O   1 
HETATM 1711 O  O   . HOH D 4 .   ? 52.731 10.509 29.644 1.00 15.33  ? 9018 HOH A O   1 
HETATM 1712 O  O   . HOH D 4 .   ? 34.956 18.767 52.136 1.00 17.01  ? 9019 HOH A O   1 
HETATM 1713 O  O   . HOH D 4 .   ? 54.199 12.290 31.377 1.00 16.80  ? 9020 HOH A O   1 
HETATM 1714 O  O   . HOH D 4 .   ? 33.053 6.421  52.728 1.00 18.02  ? 9021 HOH A O   1 
HETATM 1715 O  O   . HOH D 4 .   ? 47.031 8.165  25.701 1.00 18.50  ? 9022 HOH A O   1 
HETATM 1716 O  O   . HOH D 4 .   ? 24.079 15.926 46.400 1.00 22.46  ? 9023 HOH A O   1 
HETATM 1717 O  O   . HOH D 4 .   ? 27.134 13.219 29.349 1.00 16.73  ? 9024 HOH A O   1 
HETATM 1718 O  O   . HOH D 4 .   ? 34.310 17.409 68.223 1.00 18.92  ? 9025 HOH A O   1 
HETATM 1719 O  O   . HOH D 4 .   ? 36.238 28.047 46.792 1.00 19.07  ? 9026 HOH A O   1 
HETATM 1720 O  O   . HOH D 4 .   ? 35.295 1.203  48.711 1.00 20.93  ? 9027 HOH A O   1 
HETATM 1721 O  O   . HOH D 4 .   ? 51.992 24.019 32.305 1.00 15.80  ? 9028 HOH A O   1 
HETATM 1722 O  O   . HOH D 4 .   ? 60.005 19.358 28.819 1.00 23.99  ? 9029 HOH A O   1 
HETATM 1723 O  O   . HOH D 4 .   ? 42.890 16.502 52.438 1.00 20.19  ? 9030 HOH A O   1 
HETATM 1724 O  O   . HOH D 4 .   ? 52.976 15.013 45.566 1.00 17.35  ? 9031 HOH A O   1 
HETATM 1725 O  O   . HOH D 4 .   ? 46.370 15.675 23.506 1.00 23.30  ? 9032 HOH A O   1 
HETATM 1726 O  O   . HOH D 4 .   ? 33.648 23.110 57.969 1.00 28.74  ? 9033 HOH A O   1 
HETATM 1727 O  O   . HOH D 4 .   ? 29.877 28.736 48.024 1.00 31.87  ? 9034 HOH A O   1 
HETATM 1728 O  O   . HOH D 4 .   ? 47.005 7.174  63.279 1.00 31.80  ? 9035 HOH A O   1 
HETATM 1729 O  O   . HOH D 4 .   ? 35.161 -0.506 53.659 1.00 21.05  ? 9036 HOH A O   1 
HETATM 1730 O  O   . HOH D 4 .   ? 48.385 7.681  33.590 1.00 26.08  ? 9037 HOH A O   1 
HETATM 1731 O  O   . HOH D 4 .   ? 32.350 18.612 66.616 1.00 26.92  ? 9038 HOH A O   1 
HETATM 1732 O  O   . HOH D 4 .   ? 24.571 8.766  34.497 1.00 20.08  ? 9039 HOH A O   1 
HETATM 1733 O  O   . HOH D 4 .   ? 45.162 9.780  33.362 1.00 14.39  ? 9040 HOH A O   1 
HETATM 1734 O  O   . HOH D 4 .   ? 29.818 6.995  34.212 1.00 23.46  ? 9041 HOH A O   1 
HETATM 1735 O  O   . HOH D 4 .   ? 41.810 13.123 67.007 1.00 23.78  ? 9042 HOH A O   1 
HETATM 1736 O  O   . HOH D 4 .   ? 31.084 0.655  46.996 1.00 26.20  ? 9043 HOH A O   1 
HETATM 1737 O  O   . HOH D 4 .   ? 58.120 9.442  34.022 1.00 26.01  ? 9044 HOH A O   1 
HETATM 1738 O  O   . HOH D 4 .   ? 26.509 25.827 43.095 1.00 30.85  ? 9045 HOH A O   1 
HETATM 1739 O  O   . HOH D 4 .   ? 33.558 18.398 63.671 1.00 23.00  ? 9046 HOH A O   1 
HETATM 1740 O  O   . HOH D 4 .   ? 57.457 8.249  37.822 1.00 20.69  ? 9047 HOH A O   1 
HETATM 1741 O  O   . HOH D 4 .   ? 26.192 26.977 46.717 1.00 28.29  ? 9048 HOH A O   1 
HETATM 1742 O  O   . HOH D 4 .   ? 52.641 23.007 36.043 1.00 22.50  ? 9049 HOH A O   1 
HETATM 1743 O  O   . HOH D 4 .   ? 51.929 8.758  36.391 1.00 22.61  ? 9050 HOH A O   1 
HETATM 1744 O  O   . HOH D 4 .   ? 44.031 2.562  42.418 1.00 21.76  ? 9051 HOH A O   1 
HETATM 1745 O  O   . HOH D 4 .   ? 48.115 9.763  35.320 1.00 16.41  ? 9052 HOH A O   1 
HETATM 1746 O  O   . HOH D 4 .   ? 29.627 17.372 63.184 1.00 26.19  ? 9053 HOH A O   1 
HETATM 1747 O  O   . HOH D 4 .   ? 33.547 6.446  62.139 1.00 32.78  ? 9054 HOH A O   1 
HETATM 1748 O  O   . HOH D 4 .   ? 32.904 6.217  28.853 1.00 25.67  ? 9055 HOH A O   1 
HETATM 1749 O  O   . HOH D 4 .   ? 40.467 5.655  63.650 1.00 35.40  ? 9056 HOH A O   1 
HETATM 1750 O  O   . HOH D 4 .   ? 52.209 4.774  51.538 1.00 21.26  ? 9057 HOH A O   1 
HETATM 1751 O  O   . HOH D 4 .   ? 57.180 12.630 56.576 1.00 44.29  ? 9058 HOH A O   1 
HETATM 1752 O  O   . HOH D 4 .   ? 55.706 12.071 48.971 1.00 29.63  ? 9059 HOH A O   1 
HETATM 1753 O  O   . HOH D 4 .   ? 41.787 0.006  45.179 1.00 23.36  ? 9060 HOH A O   1 
HETATM 1754 O  O   . HOH D 4 .   ? 34.650 7.429  58.818 1.00 31.36  ? 9061 HOH A O   1 
HETATM 1755 O  O   . HOH D 4 .   ? 47.598 12.341 57.655 1.00 20.06  ? 9063 HOH A O   1 
HETATM 1756 O  O   . HOH D 4 .   ? 59.698 6.775  46.061 1.00 34.94  ? 9064 HOH A O   1 
HETATM 1757 O  O   . HOH D 4 .   ? 48.367 23.078 25.905 1.00 48.70  ? 9065 HOH A O   1 
HETATM 1758 O  O   . HOH D 4 .   ? 57.703 13.575 51.408 1.00 28.32  ? 9066 HOH A O   1 
HETATM 1759 O  O   . HOH D 4 .   ? 40.317 20.212 23.554 1.00 22.59  ? 9067 HOH A O   1 
HETATM 1760 O  O   . HOH D 4 .   ? 54.181 22.387 32.716 1.00 29.01  ? 9068 HOH A O   1 
HETATM 1761 O  O   . HOH D 4 .   ? 39.078 2.341  31.960 1.00 30.02  ? 9069 HOH A O   1 
HETATM 1762 O  O   . HOH D 4 .   ? 46.617 25.500 59.644 1.00 40.38  ? 9070 HOH A O   1 
HETATM 1763 O  O   . HOH D 4 .   ? 52.553 21.947 57.675 1.00 35.82  ? 9071 HOH A O   1 
HETATM 1764 O  O   . HOH D 4 .   ? 46.274 5.854  60.772 1.00 28.83  ? 9072 HOH A O   1 
HETATM 1765 O  O   . HOH D 4 .   ? 24.092 8.942  46.246 1.00 30.40  ? 9073 HOH A O   1 
HETATM 1766 O  O   . HOH D 4 .   ? 37.559 28.170 42.873 1.00 42.80  ? 9074 HOH A O   1 
HETATM 1767 O  O   . HOH D 4 .   ? 22.226 21.365 31.696 1.00 35.77  ? 9075 HOH A O   1 
HETATM 1768 O  O   . HOH D 4 .   ? 46.729 25.253 29.395 1.00 28.54  ? 9076 HOH A O   1 
HETATM 1769 O  O   . HOH D 4 .   ? 30.844 3.712  38.050 1.00 30.50  ? 9077 HOH A O   1 
HETATM 1770 O  O   . HOH D 4 .   ? 34.538 31.931 51.319 1.00 26.24  ? 9078 HOH A O   1 
HETATM 1771 O  O   . HOH D 4 .   ? 48.624 31.226 33.685 1.00 28.59  ? 9079 HOH A O   1 
HETATM 1772 O  O   . HOH D 4 .   ? 53.948 22.391 53.791 1.00 35.87  ? 9080 HOH A O   1 
HETATM 1773 O  O   . HOH D 4 .   ? 41.497 3.682  61.051 1.00 34.69  ? 9081 HOH A O   1 
HETATM 1774 O  O   . HOH D 4 .   ? 55.715 21.106 39.776 1.00 45.83  ? 9082 HOH A O   1 
HETATM 1775 O  O   . HOH D 4 .   ? 57.906 5.321  36.433 1.00 45.40  ? 9085 HOH A O   1 
HETATM 1776 O  O   . HOH D 4 .   ? 19.707 19.361 30.883 1.00 30.16  ? 9086 HOH A O   1 
HETATM 1777 O  O   . HOH D 4 .   ? 35.036 27.694 44.223 1.00 24.82  ? 9087 HOH A O   1 
HETATM 1778 O  O   . HOH D 4 .   ? 48.358 14.516 58.959 1.00 29.21  ? 9088 HOH A O   1 
HETATM 1779 O  O   . HOH D 4 .   ? 23.755 12.414 45.805 1.00 27.59  ? 9089 HOH A O   1 
HETATM 1780 O  O   . HOH D 4 .   ? 37.085 23.928 65.331 1.00 40.60  ? 9090 HOH A O   1 
HETATM 1781 O  O   . HOH D 4 .   ? 35.408 32.310 36.799 1.00 41.29  ? 9091 HOH A O   1 
HETATM 1782 O  O   . HOH D 4 .   ? 37.105 11.328 20.977 1.00 29.93  ? 9092 HOH A O   1 
HETATM 1783 O  O   . HOH D 4 .   ? 53.791 8.341  30.103 1.00 33.15  ? 9093 HOH A O   1 
HETATM 1784 O  O   . HOH D 4 .   ? 32.214 10.346 57.779 1.00 30.39  ? 9094 HOH A O   1 
HETATM 1785 O  O   . HOH D 4 .   ? 45.723 18.300 57.337 1.00 24.49  ? 9095 HOH A O   1 
HETATM 1786 O  O   . HOH D 4 .   ? 41.267 1.965  30.082 1.00 24.93  ? 9096 HOH A O   1 
HETATM 1787 O  O   . HOH D 4 .   ? 46.727 25.051 55.319 1.00 42.61  ? 9097 HOH A O   1 
HETATM 1788 O  O   . HOH D 4 .   ? 44.009 25.070 56.518 1.00 26.13  ? 9098 HOH A O   1 
HETATM 1789 O  O   . HOH D 4 .   ? 36.512 7.731  23.509 1.00 36.17  ? 9099 HOH A O   1 
HETATM 1790 O  O   . HOH D 4 .   ? 35.371 0.193  61.170 1.00 33.85  ? 9100 HOH A O   1 
HETATM 1791 O  O   . HOH D 4 .   ? 44.279 4.952  22.924 1.00 33.42  ? 9101 HOH A O   1 
HETATM 1792 O  O   . HOH D 4 .   ? 24.332 20.638 52.554 1.00 40.03  ? 9102 HOH A O   1 
HETATM 1793 O  O   . HOH D 4 .   ? 37.492 1.054  39.233 1.00 33.76  ? 9103 HOH A O   1 
HETATM 1794 O  O   . HOH D 4 .   ? 54.703 22.369 37.947 1.00 39.59  ? 9104 HOH A O   1 
HETATM 1795 O  O   . HOH D 4 .   ? 39.119 31.528 37.017 1.00 42.57  ? 9105 HOH A O   1 
HETATM 1796 O  O   . HOH D 4 .   ? 28.838 14.710 61.101 1.00 38.17  ? 9106 HOH A O   1 
HETATM 1797 O  O   . HOH D 4 .   ? 33.983 7.108  65.645 1.00 38.66  ? 9107 HOH A O   1 
HETATM 1798 O  O   . HOH D 4 .   ? 53.714 19.295 28.955 1.00 30.71  ? 9108 HOH A O   1 
HETATM 1799 O  O   . HOH D 4 .   ? 49.362 7.363  36.817 1.00 17.34  ? 9109 HOH A O   1 
HETATM 1800 O  O   . HOH D 4 .   ? 33.541 7.849  24.102 1.00 24.78  ? 9110 HOH A O   1 
HETATM 1801 O  O   . HOH D 4 .   ? 47.723 13.702 61.383 1.00 46.03  ? 9114 HOH A O   1 
HETATM 1802 O  O   . HOH D 4 .   ? 60.198 11.644 27.558 1.00 48.53  ? 9116 HOH A O   1 
HETATM 1803 O  O   . HOH D 4 .   ? 37.861 5.593  24.019 1.00 47.40  ? 9117 HOH A O   1 
HETATM 1804 O  O   . HOH D 4 .   ? 28.065 18.734 24.342 1.00 43.73  ? 9121 HOH A O   1 
HETATM 1805 O  O   . HOH D 4 .   ? 41.125 27.096 42.063 1.00 51.81  ? 9149 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ILE 1   16  16  ILE ILE A . n 
A 1 2   VAL 2   17  17  VAL VAL A . n 
A 1 3   GLY 3   18  18  GLY GLY A . n 
A 1 4   GLY 4   19  19  GLY GLY A . n 
A 1 5   TYR 5   20  20  TYR TYR A . n 
A 1 6   THR 6   21  21  THR THR A . n 
A 1 7   CYS 7   22  22  CYS CYS A . n 
A 1 8   GLY 8   23  23  GLY GLY A . n 
A 1 9   ALA 9   24  24  ALA ALA A . n 
A 1 10  ASN 10  25  25  ASN ASN A . n 
A 1 11  THR 11  26  26  THR THR A . n 
A 1 12  VAL 12  27  27  VAL VAL A . n 
A 1 13  PRO 13  28  28  PRO PRO A . n 
A 1 14  TYR 14  29  29  TYR TYR A . n 
A 1 15  GLN 15  30  30  GLN GLN A . n 
A 1 16  VAL 16  31  31  VAL VAL A . n 
A 1 17  SER 17  32  32  SER SER A . n 
A 1 18  LEU 18  33  33  LEU LEU A . n 
A 1 19  ASN 19  34  34  ASN ASN A . n 
A 1 20  SER 20  37  37  SER SER A . n 
A 1 21  GLY 21  38  38  GLY GLY A . n 
A 1 22  TYR 22  39  39  TYR TYR A . n 
A 1 23  HIS 23  40  40  HIS HIS A . n 
A 1 24  PHE 24  41  41  PHE PHE A . n 
A 1 25  CYS 25  42  42  CYS CYS A . n 
A 1 26  GLY 26  43  43  GLY GLY A . n 
A 1 27  GLY 27  44  44  GLY GLY A . n 
A 1 28  SER 28  45  45  SER SER A . n 
A 1 29  LEU 29  46  46  LEU LEU A . n 
A 1 30  ILE 30  47  47  ILE ILE A . n 
A 1 31  ASN 31  48  48  ASN ASN A . n 
A 1 32  SER 32  49  49  SER SER A . n 
A 1 33  GLN 33  50  50  GLN GLN A . n 
A 1 34  TRP 34  51  51  TRP TRP A . n 
A 1 35  VAL 35  52  52  VAL VAL A . n 
A 1 36  VAL 36  53  53  VAL VAL A . n 
A 1 37  SER 37  54  54  SER SER A . n 
A 1 38  ALA 38  55  55  ALA ALA A . n 
A 1 39  ALA 39  56  56  ALA ALA A . n 
A 1 40  HIS 40  57  57  HIS HIS A . n 
A 1 41  CYS 41  58  58  CYS CYS A . n 
A 1 42  TYR 42  59  59  TYR TYR A . n 
A 1 43  LYS 43  60  60  LYS LYS A . n 
A 1 44  SER 44  61  61  SER SER A . n 
A 1 45  GLY 45  62  62  GLY GLY A . n 
A 1 46  ILE 46  63  63  ILE ILE A . n 
A 1 47  GLN 47  64  64  GLN GLN A . n 
A 1 48  VAL 48  65  65  VAL VAL A . n 
A 1 49  ARG 49  66  66  ARG ARG A . n 
A 1 50  LEU 50  67  67  LEU LEU A . n 
A 1 51  GLY 51  69  69  GLY GLY A . n 
A 1 52  GLU 52  70  70  GLU GLU A . n 
A 1 53  ASP 53  71  71  ASP ASP A . n 
A 1 54  ASN 54  72  72  ASN ASN A . n 
A 1 55  ILE 55  73  73  ILE ILE A . n 
A 1 56  ASN 56  74  74  ASN ASN A . n 
A 1 57  VAL 57  75  75  VAL VAL A . n 
A 1 58  VAL 58  76  76  VAL VAL A . n 
A 1 59  GLU 59  77  77  GLU GLU A . n 
A 1 60  GLY 60  78  78  GLY GLY A . n 
A 1 61  ASN 61  79  79  ASN ASN A . n 
A 1 62  GLU 62  80  80  GLU GLU A . n 
A 1 63  GLN 63  81  81  GLN GLN A . n 
A 1 64  PHE 64  82  82  PHE PHE A . n 
A 1 65  ILE 65  83  83  ILE ILE A . n 
A 1 66  SER 66  84  84  SER SER A . n 
A 1 67  ALA 67  85  85  ALA ALA A . n 
A 1 68  SER 68  86  86  SER SER A . n 
A 1 69  LYS 69  87  87  LYS LYS A . n 
A 1 70  SER 70  88  88  SER SER A . n 
A 1 71  ILE 71  89  89  ILE ILE A . n 
A 1 72  VAL 72  90  90  VAL VAL A . n 
A 1 73  HIS 73  91  91  HIS HIS A . n 
A 1 74  PRO 74  92  92  PRO PRO A . n 
A 1 75  SER 75  93  93  SER SER A . n 
A 1 76  TYR 76  94  94  TYR TYR A . n 
A 1 77  ASN 77  95  95  ASN ASN A . n 
A 1 78  SER 78  96  96  SER SER A . n 
A 1 79  ASN 79  97  97  ASN ASN A . n 
A 1 80  THR 80  98  98  THR THR A . n 
A 1 81  LEU 81  99  99  LEU LEU A . n 
A 1 82  ASN 82  100 100 ASN ASN A . n 
A 1 83  ASN 83  101 101 ASN ASN A . n 
A 1 84  ASP 84  102 102 ASP ASP A . n 
A 1 85  ILE 85  103 103 ILE ILE A . n 
A 1 86  MET 86  104 104 MET MET A . n 
A 1 87  LEU 87  105 105 LEU LEU A . n 
A 1 88  ILE 88  106 106 ILE ILE A . n 
A 1 89  LYS 89  107 107 LYS LYS A . n 
A 1 90  LEU 90  108 108 LEU LEU A . n 
A 1 91  LYS 91  109 109 LYS LYS A . n 
A 1 92  SER 92  110 110 SER SER A . n 
A 1 93  ALA 93  111 111 ALA ALA A . n 
A 1 94  ALA 94  112 112 ALA ALA A . n 
A 1 95  SER 95  113 113 SER SER A . n 
A 1 96  LEU 96  114 114 LEU LEU A . n 
A 1 97  ASN 97  115 115 ASN ASN A . n 
A 1 98  SER 98  116 116 SER SER A . n 
A 1 99  ARG 99  117 117 ARG ARG A . n 
A 1 100 VAL 100 118 118 VAL VAL A . n 
A 1 101 ALA 101 119 119 ALA ALA A . n 
A 1 102 SER 102 120 120 SER SER A . n 
A 1 103 ILE 103 121 121 ILE ILE A . n 
A 1 104 SER 104 122 122 SER SER A . n 
A 1 105 LEU 105 123 123 LEU LEU A . n 
A 1 106 PRO 106 124 124 PRO PRO A . n 
A 1 107 THR 107 125 125 THR THR A . n 
A 1 108 SER 108 127 127 SER SER A . n 
A 1 109 CYS 109 128 128 CYS CYS A . n 
A 1 110 ALA 110 129 129 ALA ALA A . n 
A 1 111 SER 111 130 130 SER SER A . n 
A 1 112 ALA 112 132 132 ALA ALA A . n 
A 1 113 GLY 113 133 133 GLY GLY A . n 
A 1 114 THR 114 134 134 THR THR A . n 
A 1 115 GLN 115 135 135 GLN GLN A . n 
A 1 116 CYS 116 136 136 CYS CYS A . n 
A 1 117 LEU 117 137 137 LEU LEU A . n 
A 1 118 ILE 118 138 138 ILE ILE A . n 
A 1 119 SER 119 139 139 SER SER A . n 
A 1 120 GLY 120 140 140 GLY GLY A . n 
A 1 121 TRP 121 141 141 TRP TRP A . n 
A 1 122 GLY 122 142 142 GLY GLY A . n 
A 1 123 ASN 123 143 143 ASN ASN A . n 
A 1 124 THR 124 144 144 THR THR A . n 
A 1 125 LYS 125 145 145 LYS LYS A . n 
A 1 126 SER 126 146 146 SER SER A . n 
A 1 127 SER 127 147 147 SER ALA A . n 
A 1 128 GLY 128 148 148 GLY GLY A . n 
A 1 129 THR 129 149 149 THR THR A . n 
A 1 130 SER 130 150 150 SER SER A . n 
A 1 131 TYR 131 151 151 TYR TYR A . n 
A 1 132 PRO 132 152 152 PRO PRO A . n 
A 1 133 ASP 133 153 153 ASP ASP A . n 
A 1 134 VAL 134 154 154 VAL VAL A . n 
A 1 135 LEU 135 155 155 LEU LEU A . n 
A 1 136 LYS 136 156 156 LYS LYS A . n 
A 1 137 CYS 137 157 157 CYS CYS A . n 
A 1 138 LEU 138 158 158 LEU LEU A . n 
A 1 139 LYS 139 159 159 LYS LYS A . n 
A 1 140 ALA 140 160 160 ALA ALA A . n 
A 1 141 PRO 141 161 161 PRO PRO A . n 
A 1 142 ILE 142 162 162 ILE ILE A . n 
A 1 143 LEU 143 163 163 LEU LEU A . n 
A 1 144 SER 144 164 164 SER SER A . n 
A 1 145 ASP 145 165 165 ASP ASP A . n 
A 1 146 SER 146 166 166 SER SER A . n 
A 1 147 SER 147 167 167 SER SER A . n 
A 1 148 CYS 148 168 168 CYS CYS A . n 
A 1 149 LYS 149 169 169 LYS LYS A . n 
A 1 150 SER 150 170 170 SER SER A . n 
A 1 151 ALA 151 171 171 ALA ALA A . n 
A 1 152 TYR 152 172 172 TYR TYR A . n 
A 1 153 PRO 153 173 173 PRO PRO A . n 
A 1 154 GLY 154 174 174 GLY GLY A . n 
A 1 155 GLN 155 175 175 GLN GLN A . n 
A 1 156 ILE 156 176 176 ILE ILE A . n 
A 1 157 THR 157 177 177 THR THR A . n 
A 1 158 SER 158 178 178 SER SER A . n 
A 1 159 ASN 159 179 179 ASN ASN A . n 
A 1 160 MET 160 180 180 MET MET A . n 
A 1 161 PHE 161 181 181 PHE PHE A . n 
A 1 162 CYS 162 182 182 CYS CYS A . n 
A 1 163 ALA 163 183 183 ALA ALA A . n 
A 1 164 GLY 164 184 184 GLY GLY A . n 
A 1 165 TYR 165 184 184 TYR TYR A A n 
A 1 166 LEU 166 185 185 LEU LEU A . n 
A 1 167 GLU 167 186 186 GLU ALA A . n 
A 1 168 GLY 168 187 187 GLY GLY A . n 
A 1 169 GLY 169 188 188 GLY GLY A . n 
A 1 170 LYS 170 188 188 LYS LYS A A n 
A 1 171 ASP 171 189 189 ASP ASP A . n 
A 1 172 SER 172 190 190 SER SER A . n 
A 1 173 CYS 173 191 191 CYS CYS A . n 
A 1 174 GLN 174 192 192 GLN GLN A . n 
A 1 175 GLY 175 193 193 GLY GLY A . n 
A 1 176 ASP 176 194 194 ASP ASP A . n 
A 1 177 SER 177 195 195 SER SER A . n 
A 1 178 GLY 178 196 196 GLY GLY A . n 
A 1 179 GLY 179 197 197 GLY GLY A . n 
A 1 180 PRO 180 198 198 PRO PRO A . n 
A 1 181 VAL 181 199 199 VAL VAL A . n 
A 1 182 VAL 182 200 200 VAL VAL A . n 
A 1 183 CYS 183 201 201 CYS CYS A . n 
A 1 184 SER 184 202 202 SER SER A . n 
A 1 185 GLY 185 203 203 GLY GLY A . n 
A 1 186 LYS 186 204 204 LYS LYS A . n 
A 1 187 LEU 187 209 209 LEU LEU A . n 
A 1 188 GLN 188 210 210 GLN GLN A . n 
A 1 189 GLY 189 211 211 GLY GLY A . n 
A 1 190 ILE 190 212 212 ILE ILE A . n 
A 1 191 VAL 191 213 213 VAL VAL A . n 
A 1 192 SER 192 214 214 SER SER A . n 
A 1 193 TRP 193 215 215 TRP TRP A . n 
A 1 194 GLY 194 216 216 GLY GLY A . n 
A 1 195 SER 195 217 217 SER SER A . n 
A 1 196 GLY 196 219 219 GLY GLY A . n 
A 1 197 CYS 197 220 220 CYS CYS A . n 
A 1 198 ALA 198 221 221 ALA ALA A . n 
A 1 199 GLN 199 221 221 GLN GLN A A n 
A 1 200 LYS 200 222 222 LYS LYS A . n 
A 1 201 ASN 201 223 223 ASN ASN A . n 
A 1 202 LYS 202 224 224 LYS LYS A . n 
A 1 203 PRO 203 225 225 PRO PRO A . n 
A 1 204 GLY 204 226 226 GLY GLY A . n 
A 1 205 VAL 205 227 227 VAL VAL A . n 
A 1 206 TYR 206 228 228 TYR TYR A . n 
A 1 207 THR 207 229 229 THR THR A . n 
A 1 208 LYS 208 230 230 LYS LYS A . n 
A 1 209 VAL 209 231 231 VAL VAL A . n 
A 1 210 CYS 210 232 232 CYS CYS A . n 
A 1 211 ASN 211 233 233 ASN ASN A . n 
A 1 212 TYR 212 234 234 TYR TYR A . n 
A 1 213 VAL 213 235 235 VAL VAL A . n 
A 1 214 SER 214 236 236 SER SER A . n 
A 1 215 TRP 215 237 237 TRP TRP A . n 
A 1 216 ILE 216 238 238 ILE ILE A . n 
A 1 217 LYS 217 239 239 LYS LYS A . n 
A 1 218 GLN 218 240 240 GLN GLN A . n 
A 1 219 THR 219 241 241 THR THR A . n 
A 1 220 ILE 220 242 242 ILE ILE A . n 
A 1 221 ALA 221 243 243 ALA ALA A . n 
A 1 222 SER 222 244 244 SER SER A . n 
A 1 223 ASN 223 245 245 ASN ASN A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CA  1   3333 3333 CA  CA  A . 
C 3 UIR 1   2222 2222 UIR UIR A . 
D 4 HOH 1   9001 9001 HOH HOH A . 
D 4 HOH 2   9002 9002 HOH HOH A . 
D 4 HOH 3   9003 9003 HOH HOH A . 
D 4 HOH 4   9004 9004 HOH HOH A . 
D 4 HOH 5   9005 9005 HOH HOH A . 
D 4 HOH 6   9006 9006 HOH HOH A . 
D 4 HOH 7   9007 9007 HOH HOH A . 
D 4 HOH 8   9008 9008 HOH HOH A . 
D 4 HOH 9   9009 9009 HOH HOH A . 
D 4 HOH 10  9010 9010 HOH HOH A . 
D 4 HOH 11  9011 9011 HOH HOH A . 
D 4 HOH 12  9012 9012 HOH HOH A . 
D 4 HOH 13  9013 9013 HOH HOH A . 
D 4 HOH 14  9014 9014 HOH HOH A . 
D 4 HOH 15  9015 9015 HOH HOH A . 
D 4 HOH 16  9016 9016 HOH HOH A . 
D 4 HOH 17  9017 9017 HOH HOH A . 
D 4 HOH 18  9018 9018 HOH HOH A . 
D 4 HOH 19  9019 9019 HOH HOH A . 
D 4 HOH 20  9020 9020 HOH HOH A . 
D 4 HOH 21  9021 9021 HOH HOH A . 
D 4 HOH 22  9022 9022 HOH HOH A . 
D 4 HOH 23  9023 9023 HOH HOH A . 
D 4 HOH 24  9024 9024 HOH HOH A . 
D 4 HOH 25  9025 9025 HOH HOH A . 
D 4 HOH 26  9026 9026 HOH HOH A . 
D 4 HOH 27  9027 9027 HOH HOH A . 
D 4 HOH 28  9028 9028 HOH HOH A . 
D 4 HOH 29  9029 9029 HOH HOH A . 
D 4 HOH 30  9030 9030 HOH HOH A . 
D 4 HOH 31  9031 9031 HOH HOH A . 
D 4 HOH 32  9032 9032 HOH HOH A . 
D 4 HOH 33  9033 9033 HOH HOH A . 
D 4 HOH 34  9034 9034 HOH HOH A . 
D 4 HOH 35  9035 9035 HOH HOH A . 
D 4 HOH 36  9036 9036 HOH HOH A . 
D 4 HOH 37  9037 9037 HOH HOH A . 
D 4 HOH 38  9038 9038 HOH HOH A . 
D 4 HOH 39  9039 9039 HOH HOH A . 
D 4 HOH 40  9040 9040 HOH HOH A . 
D 4 HOH 41  9041 9041 HOH HOH A . 
D 4 HOH 42  9042 9042 HOH HOH A . 
D 4 HOH 43  9043 9043 HOH HOH A . 
D 4 HOH 44  9044 9044 HOH HOH A . 
D 4 HOH 45  9045 9045 HOH HOH A . 
D 4 HOH 46  9046 9046 HOH HOH A . 
D 4 HOH 47  9047 9047 HOH HOH A . 
D 4 HOH 48  9048 9048 HOH HOH A . 
D 4 HOH 49  9049 9049 HOH HOH A . 
D 4 HOH 50  9050 9050 HOH HOH A . 
D 4 HOH 51  9051 9051 HOH HOH A . 
D 4 HOH 52  9052 9052 HOH HOH A . 
D 4 HOH 53  9053 9053 HOH HOH A . 
D 4 HOH 54  9054 9054 HOH HOH A . 
D 4 HOH 55  9055 9055 HOH HOH A . 
D 4 HOH 56  9056 9056 HOH HOH A . 
D 4 HOH 57  9057 9057 HOH HOH A . 
D 4 HOH 58  9058 9058 HOH HOH A . 
D 4 HOH 59  9059 9059 HOH HOH A . 
D 4 HOH 60  9060 9060 HOH HOH A . 
D 4 HOH 61  9061 9061 HOH HOH A . 
D 4 HOH 62  9063 9063 HOH HOH A . 
D 4 HOH 63  9064 9064 HOH HOH A . 
D 4 HOH 64  9065 9065 HOH HOH A . 
D 4 HOH 65  9066 9066 HOH HOH A . 
D 4 HOH 66  9067 9067 HOH HOH A . 
D 4 HOH 67  9068 9068 HOH HOH A . 
D 4 HOH 68  9069 9069 HOH HOH A . 
D 4 HOH 69  9070 9070 HOH HOH A . 
D 4 HOH 70  9071 9071 HOH HOH A . 
D 4 HOH 71  9072 9072 HOH HOH A . 
D 4 HOH 72  9073 9073 HOH HOH A . 
D 4 HOH 73  9074 9074 HOH HOH A . 
D 4 HOH 74  9075 9075 HOH HOH A . 
D 4 HOH 75  9076 9076 HOH HOH A . 
D 4 HOH 76  9077 9077 HOH HOH A . 
D 4 HOH 77  9078 9078 HOH HOH A . 
D 4 HOH 78  9079 9079 HOH HOH A . 
D 4 HOH 79  9080 9080 HOH HOH A . 
D 4 HOH 80  9081 9081 HOH HOH A . 
D 4 HOH 81  9082 9082 HOH HOH A . 
D 4 HOH 82  9085 9085 HOH HOH A . 
D 4 HOH 83  9086 9086 HOH HOH A . 
D 4 HOH 84  9087 9087 HOH HOH A . 
D 4 HOH 85  9088 9088 HOH HOH A . 
D 4 HOH 86  9089 9089 HOH HOH A . 
D 4 HOH 87  9090 9090 HOH HOH A . 
D 4 HOH 88  9091 9091 HOH HOH A . 
D 4 HOH 89  9092 9092 HOH HOH A . 
D 4 HOH 90  9093 9093 HOH HOH A . 
D 4 HOH 91  9094 9094 HOH HOH A . 
D 4 HOH 92  9095 9095 HOH HOH A . 
D 4 HOH 93  9096 9096 HOH HOH A . 
D 4 HOH 94  9097 9097 HOH HOH A . 
D 4 HOH 95  9098 9098 HOH HOH A . 
D 4 HOH 96  9099 9099 HOH HOH A . 
D 4 HOH 97  9100 9100 HOH HOH A . 
D 4 HOH 98  9101 9101 HOH HOH A . 
D 4 HOH 99  9102 9102 HOH HOH A . 
D 4 HOH 100 9103 9103 HOH HOH A . 
D 4 HOH 101 9104 9104 HOH HOH A . 
D 4 HOH 102 9105 9105 HOH HOH A . 
D 4 HOH 103 9106 9106 HOH HOH A . 
D 4 HOH 104 9107 9107 HOH HOH A . 
D 4 HOH 105 9108 9108 HOH HOH A . 
D 4 HOH 106 9109 9109 HOH HOH A . 
D 4 HOH 107 9110 9110 HOH HOH A . 
D 4 HOH 108 9114 9114 HOH HOH A . 
D 4 HOH 109 9116 9116 HOH HOH A . 
D 4 HOH 110 9117 9117 HOH HOH A . 
D 4 HOH 111 9121 9121 HOH HOH A . 
D 4 HOH 112 9149 9149 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? D HOH .  ? A HOH 9020 ? 1_555 CA ? B CA . ? A CA 3333 ? 1_555 OE1 ? A GLU 52 ? A GLU 70   ? 1_555 88.3  ? 
2  O   ? D HOH .  ? A HOH 9020 ? 1_555 CA ? B CA . ? A CA 3333 ? 1_555 OE2 ? A GLU 62 ? A GLU 80   ? 1_555 80.2  ? 
3  OE1 ? A GLU 52 ? A GLU 70   ? 1_555 CA ? B CA . ? A CA 3333 ? 1_555 OE2 ? A GLU 62 ? A GLU 80   ? 1_555 103.1 ? 
4  O   ? D HOH .  ? A HOH 9020 ? 1_555 CA ? B CA . ? A CA 3333 ? 1_555 O   ? D HOH .  ? A HOH 9017 ? 1_555 165.7 ? 
5  OE1 ? A GLU 52 ? A GLU 70   ? 1_555 CA ? B CA . ? A CA 3333 ? 1_555 O   ? D HOH .  ? A HOH 9017 ? 1_555 81.0  ? 
6  OE2 ? A GLU 62 ? A GLU 80   ? 1_555 CA ? B CA . ? A CA 3333 ? 1_555 O   ? D HOH .  ? A HOH 9017 ? 1_555 92.8  ? 
7  O   ? D HOH .  ? A HOH 9020 ? 1_555 CA ? B CA . ? A CA 3333 ? 1_555 O   ? A ASN 54 ? A ASN 72   ? 1_555 88.3  ? 
8  OE1 ? A GLU 52 ? A GLU 70   ? 1_555 CA ? B CA . ? A CA 3333 ? 1_555 O   ? A ASN 54 ? A ASN 72   ? 1_555 88.4  ? 
9  OE2 ? A GLU 62 ? A GLU 80   ? 1_555 CA ? B CA . ? A CA 3333 ? 1_555 O   ? A ASN 54 ? A ASN 72   ? 1_555 163.3 ? 
10 O   ? D HOH .  ? A HOH 9017 ? 1_555 CA ? B CA . ? A CA 3333 ? 1_555 O   ? A ASN 54 ? A ASN 72   ? 1_555 101.0 ? 
11 O   ? D HOH .  ? A HOH 9020 ? 1_555 CA ? B CA . ? A CA 3333 ? 1_555 O   ? A VAL 57 ? A VAL 75   ? 1_555 103.6 ? 
12 OE1 ? A GLU 52 ? A GLU 70   ? 1_555 CA ? B CA . ? A CA 3333 ? 1_555 O   ? A VAL 57 ? A VAL 75   ? 1_555 164.5 ? 
13 OE2 ? A GLU 62 ? A GLU 80   ? 1_555 CA ? B CA . ? A CA 3333 ? 1_555 O   ? A VAL 57 ? A VAL 75   ? 1_555 88.9  ? 
14 O   ? D HOH .  ? A HOH 9017 ? 1_555 CA ? B CA . ? A CA 3333 ? 1_555 O   ? A VAL 57 ? A VAL 75   ? 1_555 88.7  ? 
15 O   ? A ASN 54 ? A ASN 72   ? 1_555 CA ? B CA . ? A CA 3333 ? 1_555 O   ? A VAL 57 ? A VAL 75   ? 1_555 82.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-12-06 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SHELX     'model building' . ? 1 
SHELXL-97 refinement       . ? 2 
SCALEPACK 'data scaling'   . ? 3 
CNS       phasing          . ? 4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             TYR 
_pdbx_validate_rmsd_angle.auth_seq_id_1              228 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             TYR 
_pdbx_validate_rmsd_angle.auth_seq_id_2              228 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CD1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             TYR 
_pdbx_validate_rmsd_angle.auth_seq_id_3              228 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                116.53 
_pdbx_validate_rmsd_angle.angle_target_value         121.00 
_pdbx_validate_rmsd_angle.angle_deviation            -4.47 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.60 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASP 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     71 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -119.79 
_pdbx_validate_torsion.psi             -72.78 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A SER 147  ? OG  ? A SER 127 OG  
2  1 Y 1 A GLU 186  ? CG  ? A GLU 167 CG  
3  1 Y 1 A GLU 186  ? CD  ? A GLU 167 CD  
4  1 Y 1 A GLU 186  ? OE1 ? A GLU 167 OE1 
5  1 Y 1 A GLU 186  ? OE2 ? A GLU 167 OE2 
6  1 N 1 A UIR 2222 ? C18 ? C UIR 1   C18 
7  1 N 1 A UIR 2222 ? C42 ? C UIR 1   C42 
8  1 N 1 A UIR 2222 ? C41 ? C UIR 1   C41 
9  1 N 1 A UIR 2222 ? C24 ? C UIR 1   C24 
10 1 N 1 A UIR 2222 ? C25 ? C UIR 1   C25 
11 1 N 1 A UIR 2222 ? C26 ? C UIR 1   C26 
12 1 N 1 A UIR 2222 ? O27 ? C UIR 1   O27 
13 1 N 1 A UIR 2222 ? C28 ? C UIR 1   C28 
14 1 N 1 A UIR 2222 ? O29 ? C UIR 1   O29 
15 1 N 1 A UIR 2222 ? C30 ? C UIR 1   C30 
16 1 N 1 A UIR 2222 ? C31 ? C UIR 1   C31 
17 1 N 1 A UIR 2222 ? C32 ? C UIR 1   C32 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION'                                                                                                             CA  
3 '(1R,3AS,4R,8AS,8BR)-4-(2-BENZO[1,3]DIOXOL-5-YL-1-CYCLOPROPYL-3-OXO-DECAHYDRO-PYRROLO[3,4-A]PYRROLIZIN-4-YL)-BENZAMIDINE' UIR 
4 water                                                                                                                     HOH 
#