data_1Y67
# 
_entry.id   1Y67 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1Y67         
RCSB  RCSB031166   
WWPDB D_1000031166 
# 
_pdbx_database_status.entry_id                        1Y67 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2004-12-03 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chan, S.'     1 
'Tanaka, S.'   2 
'Sawaya, M.R.' 3 
'Perry, L.J.'  4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal Structure of Manganese Superoxide Dismutase from Deinococcus radiodurans' 'To be Published'          ?  ?   ?   ? 
?      ?  ?         0353 ? ? ? 
1       'Refinement of Macromolecular Structures by the Maximum-Likelihood Method'         'Acta Crystallogr.,Sect.D' 53 240 255 
1997 ABCRE6 DK 0907-4449 0766 ? ? ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chan, S.'        1 
primary 'Tanaka, S.'      2 
primary 'Sawaya, M.R.'    3 
primary 'Perry, L.J.'     4 
1       'Murshudov, G.N.' 5 
# 
_cell.length_a           43.801 
_cell.length_b           87.922 
_cell.length_c           116.198 
_cell.angle_alpha        90.000 
_cell.angle_beta         91.140 
_cell.angle_gamma        90.000 
_cell.entry_id           1Y67 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         1Y67 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                4 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Manganese Superoxide dismutase' 25470.299 4   1.15.1.1 ? ? ? 
2 non-polymer syn 'FE (III) ION'                   55.845    4   ?        ? ? ? 
3 water       nat water                            18.015    396 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        MnSOD 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAAYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQLDRVPADKKGALRNNAGGHA
NHSMFWQIMGQGQGQNGANQPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVVKDGKLDVVSTANQDNPLMGE
AIAGVSGTPILGVDVWEHAYYLNYQNRRPDYLAAFWNVVNWDEVSKRYAAAKLVPRGSAAALEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAAYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQLDRVPADKKGALRNNAGGHA
NHSMFWQIMGQGQGQNGANQPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVVKDGKLDVVSTANQDNPLMGE
AIAGVSGTPILGVDVWEHAYYLNYQNRRPDYLAAFWNVVNWDEVSKRYAAAKLVPRGSAAALEHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ALA n 
1 4   TYR n 
1 5   THR n 
1 6   LEU n 
1 7   PRO n 
1 8   GLN n 
1 9   LEU n 
1 10  PRO n 
1 11  TYR n 
1 12  ALA n 
1 13  TYR n 
1 14  ASP n 
1 15  ALA n 
1 16  LEU n 
1 17  GLU n 
1 18  PRO n 
1 19  HIS n 
1 20  ILE n 
1 21  ASP n 
1 22  ALA n 
1 23  ARG n 
1 24  THR n 
1 25  MET n 
1 26  GLU n 
1 27  ILE n 
1 28  HIS n 
1 29  HIS n 
1 30  THR n 
1 31  LYS n 
1 32  HIS n 
1 33  HIS n 
1 34  GLN n 
1 35  THR n 
1 36  TYR n 
1 37  VAL n 
1 38  ASP n 
1 39  ASN n 
1 40  ALA n 
1 41  ASN n 
1 42  LYS n 
1 43  ALA n 
1 44  LEU n 
1 45  GLU n 
1 46  GLY n 
1 47  THR n 
1 48  GLU n 
1 49  PHE n 
1 50  ALA n 
1 51  ASP n 
1 52  LEU n 
1 53  PRO n 
1 54  VAL n 
1 55  GLU n 
1 56  GLN n 
1 57  LEU n 
1 58  ILE n 
1 59  GLN n 
1 60  GLN n 
1 61  LEU n 
1 62  ASP n 
1 63  ARG n 
1 64  VAL n 
1 65  PRO n 
1 66  ALA n 
1 67  ASP n 
1 68  LYS n 
1 69  LYS n 
1 70  GLY n 
1 71  ALA n 
1 72  LEU n 
1 73  ARG n 
1 74  ASN n 
1 75  ASN n 
1 76  ALA n 
1 77  GLY n 
1 78  GLY n 
1 79  HIS n 
1 80  ALA n 
1 81  ASN n 
1 82  HIS n 
1 83  SER n 
1 84  MET n 
1 85  PHE n 
1 86  TRP n 
1 87  GLN n 
1 88  ILE n 
1 89  MET n 
1 90  GLY n 
1 91  GLN n 
1 92  GLY n 
1 93  GLN n 
1 94  GLY n 
1 95  GLN n 
1 96  ASN n 
1 97  GLY n 
1 98  ALA n 
1 99  ASN n 
1 100 GLN n 
1 101 PRO n 
1 102 SER n 
1 103 GLY n 
1 104 GLU n 
1 105 LEU n 
1 106 LEU n 
1 107 ASP n 
1 108 ALA n 
1 109 ILE n 
1 110 ASN n 
1 111 SER n 
1 112 ALA n 
1 113 PHE n 
1 114 GLY n 
1 115 SER n 
1 116 PHE n 
1 117 ASP n 
1 118 ALA n 
1 119 PHE n 
1 120 LYS n 
1 121 GLN n 
1 122 LYS n 
1 123 PHE n 
1 124 GLU n 
1 125 ASP n 
1 126 ALA n 
1 127 ALA n 
1 128 LYS n 
1 129 THR n 
1 130 ARG n 
1 131 PHE n 
1 132 GLY n 
1 133 SER n 
1 134 GLY n 
1 135 TRP n 
1 136 ALA n 
1 137 TRP n 
1 138 LEU n 
1 139 VAL n 
1 140 VAL n 
1 141 LYS n 
1 142 ASP n 
1 143 GLY n 
1 144 LYS n 
1 145 LEU n 
1 146 ASP n 
1 147 VAL n 
1 148 VAL n 
1 149 SER n 
1 150 THR n 
1 151 ALA n 
1 152 ASN n 
1 153 GLN n 
1 154 ASP n 
1 155 ASN n 
1 156 PRO n 
1 157 LEU n 
1 158 MET n 
1 159 GLY n 
1 160 GLU n 
1 161 ALA n 
1 162 ILE n 
1 163 ALA n 
1 164 GLY n 
1 165 VAL n 
1 166 SER n 
1 167 GLY n 
1 168 THR n 
1 169 PRO n 
1 170 ILE n 
1 171 LEU n 
1 172 GLY n 
1 173 VAL n 
1 174 ASP n 
1 175 VAL n 
1 176 TRP n 
1 177 GLU n 
1 178 HIS n 
1 179 ALA n 
1 180 TYR n 
1 181 TYR n 
1 182 LEU n 
1 183 ASN n 
1 184 TYR n 
1 185 GLN n 
1 186 ASN n 
1 187 ARG n 
1 188 ARG n 
1 189 PRO n 
1 190 ASP n 
1 191 TYR n 
1 192 LEU n 
1 193 ALA n 
1 194 ALA n 
1 195 PHE n 
1 196 TRP n 
1 197 ASN n 
1 198 VAL n 
1 199 VAL n 
1 200 ASN n 
1 201 TRP n 
1 202 ASP n 
1 203 GLU n 
1 204 VAL n 
1 205 SER n 
1 206 LYS n 
1 207 ARG n 
1 208 TYR n 
1 209 ALA n 
1 210 ALA n 
1 211 ALA n 
1 212 LYS n 
1 213 LEU n 
1 214 VAL n 
1 215 PRO n 
1 216 ARG n 
1 217 GLY n 
1 218 SER n 
1 219 ALA n 
1 220 ALA n 
1 221 ALA n 
1 222 LEU n 
1 223 GLU n 
1 224 HIS n 
1 225 HIS n 
1 226 HIS n 
1 227 HIS n 
1 228 HIS n 
1 229 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Deinococcus 
_entity_src_gen.pdbx_gene_src_gene                 sodA 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Deinococcus radiodurans' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1299 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21-Gold (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET22b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SODM_DEIRA 
_struct_ref.pdbx_db_accession          Q9RUV2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQLDRVPADKKGALRNNAGGHANH
SMFWQIMGQGQGQNGANQPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVVKDGKLDVVSTANQDNPLMGEAI
AGVSGTPILGVDVWEHAYYLNYQNRRPDYLAAFWNVVNWDEVSKRYAAAK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1Y67 A 3 ? 212 ? Q9RUV2 1 ? 210 ? 2 211 
2 1 1Y67 B 3 ? 212 ? Q9RUV2 1 ? 210 ? 2 211 
3 1 1Y67 C 3 ? 212 ? Q9RUV2 1 ? 210 ? 2 211 
4 1 1Y67 D 3 ? 212 ? Q9RUV2 1 ? 210 ? 2 211 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1Y67 MET A 1   ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 0   1  
1 1Y67 ALA A 2   ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 1   2  
1 1Y67 LEU A 213 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 212 3  
1 1Y67 VAL A 214 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 213 4  
1 1Y67 PRO A 215 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 214 5  
1 1Y67 ARG A 216 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 215 6  
1 1Y67 GLY A 217 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 216 7  
1 1Y67 SER A 218 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 217 8  
1 1Y67 ALA A 219 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 218 9  
1 1Y67 ALA A 220 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 219 10 
1 1Y67 ALA A 221 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 220 11 
1 1Y67 LEU A 222 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 221 12 
1 1Y67 GLU A 223 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 222 13 
1 1Y67 HIS A 224 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 223 14 
1 1Y67 HIS A 225 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 224 15 
1 1Y67 HIS A 226 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 225 16 
1 1Y67 HIS A 227 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 226 17 
1 1Y67 HIS A 228 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 227 18 
1 1Y67 HIS A 229 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 228 19 
2 1Y67 MET B 1   ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 0   20 
2 1Y67 ALA B 2   ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 1   21 
2 1Y67 LEU B 213 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 212 22 
2 1Y67 VAL B 214 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 213 23 
2 1Y67 PRO B 215 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 214 24 
2 1Y67 ARG B 216 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 215 25 
2 1Y67 GLY B 217 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 216 26 
2 1Y67 SER B 218 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 217 27 
2 1Y67 ALA B 219 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 218 28 
2 1Y67 ALA B 220 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 219 29 
2 1Y67 ALA B 221 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 220 30 
2 1Y67 LEU B 222 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 221 31 
2 1Y67 GLU B 223 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 222 32 
2 1Y67 HIS B 224 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 223 33 
2 1Y67 HIS B 225 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 224 34 
2 1Y67 HIS B 226 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 225 35 
2 1Y67 HIS B 227 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 226 36 
2 1Y67 HIS B 228 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 227 37 
2 1Y67 HIS B 229 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 228 38 
3 1Y67 MET C 1   ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 0   39 
3 1Y67 ALA C 2   ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 1   40 
3 1Y67 LEU C 213 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 212 41 
3 1Y67 VAL C 214 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 213 42 
3 1Y67 PRO C 215 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 214 43 
3 1Y67 ARG C 216 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 215 44 
3 1Y67 GLY C 217 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 216 45 
3 1Y67 SER C 218 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 217 46 
3 1Y67 ALA C 219 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 218 47 
3 1Y67 ALA C 220 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 219 48 
3 1Y67 ALA C 221 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 220 49 
3 1Y67 LEU C 222 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 221 50 
3 1Y67 GLU C 223 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 222 51 
3 1Y67 HIS C 224 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 223 52 
3 1Y67 HIS C 225 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 224 53 
3 1Y67 HIS C 226 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 225 54 
3 1Y67 HIS C 227 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 226 55 
3 1Y67 HIS C 228 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 227 56 
3 1Y67 HIS C 229 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 228 57 
4 1Y67 MET D 1   ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 0   58 
4 1Y67 ALA D 2   ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 1   59 
4 1Y67 LEU D 213 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 212 60 
4 1Y67 VAL D 214 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 213 61 
4 1Y67 PRO D 215 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 214 62 
4 1Y67 ARG D 216 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 215 63 
4 1Y67 GLY D 217 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 216 64 
4 1Y67 SER D 218 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 217 65 
4 1Y67 ALA D 219 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 218 66 
4 1Y67 ALA D 220 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 219 67 
4 1Y67 ALA D 221 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 220 68 
4 1Y67 LEU D 222 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 221 69 
4 1Y67 GLU D 223 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 222 70 
4 1Y67 HIS D 224 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 223 71 
4 1Y67 HIS D 225 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 224 72 
4 1Y67 HIS D 226 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 225 73 
4 1Y67 HIS D 227 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 226 74 
4 1Y67 HIS D 228 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 227 75 
4 1Y67 HIS D 229 ? UNP Q9RUV2 ? ? 'EXPRESSION TAG' 228 76 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
FE  non-polymer         . 'FE (III) ION'  ? 'Fe 3'           55.845  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1Y67 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   49.04 
_exptl_crystal.density_Matthews      2.43 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              7.1 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;200mM ammonium acetate (pH 7.1) 20%(w/v) PEG3350, 0.3M NaCl, 0.3M imidazole, 20mM Tris (pH 8.0), VAPOR DIFFUSION, SITTING DROP, temperature 298K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2004-04-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Double Crystal Si(111)' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 8.2.2' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.1 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   8.2.2 
# 
_reflns.entry_id                     1Y67 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            1.85 
_reflns.d_resolution_low             119.5 
_reflns.number_all                   74526 
_reflns.number_obs                   74526 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.074 
_reflns.pdbx_netI_over_sigmaI        15.4 
_reflns.B_iso_Wilson_estimate        31.7 
_reflns.pdbx_redundancy              3.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.85 
_reflns_shell.d_res_low              1.92 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.meanI_over_sigI_obs    2.6 
_reflns_shell.pdbx_Rsym_value        0.493 
_reflns_shell.pdbx_redundancy        3.5 
_reflns_shell.number_unique_all      7437 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.B_iso_mean                               31.125 
_refine.aniso_B[1][1]                            1.903 
_refine.aniso_B[2][2]                            -0.959 
_refine.aniso_B[3][3]                            -1.016 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            -1.797 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    'MASK BULK SOLVENT' 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.ls_d_res_high                            1.853 
_refine.ls_d_res_low                             119.523 
_refine.ls_number_reflns_R_free                  3697 
_refine.ls_number_reflns_obs                     74526 
_refine.ls_R_factor_R_work                       0.1841 
_refine.ls_R_factor_R_free                       0.205 
_refine.ls_R_factor_all                          0.185 
_refine.ls_wR_factor_R_work                      0.190 
_refine.ls_wR_factor_R_free                      0.212 
_refine.ls_percent_reflns_obs                    99.559 
_refine.ls_percent_reflns_R_free                 4.961 
_refine.correlation_coeff_Fo_to_Fc               0.958 
_refine.correlation_coeff_Fo_to_Fc_free          0.949 
_refine.pdbx_overall_ESU_R_Free                  0.121 
_refine.entry_id                                 1Y67 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     74526 
_refine.ls_R_factor_obs                          0.185 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 1VEW' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       0.140 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1Y67 
_refine_analyze.Luzzati_coordinate_error_obs    0.205 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6565 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             396 
_refine_hist.number_atoms_total               6965 
_refine_hist.d_res_high                       1.853 
_refine_hist.d_res_low                        119.523 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         6743 0.009  0.021  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      9172 1.093  1.918  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   825  5.212  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   352  35.443 24.830 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   1029 12.946 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   29   12.197 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           953  0.084  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     5333 0.004  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            2992 0.186  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          4663 0.298  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    420  0.106  0.200  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      1    0.025  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   36   0.141  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 17   0.117  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              4241 0.540  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             6570 0.862  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              2933 1.446  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             2602 2.279  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_low 
_refine_ls_shell.d_res_high 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.R_factor_all 
20 1.901   1.853 5549 96.179  5071 0.241 266 0.279 . . . . 'X-RAY DIFFRACTION' . 
20 1.953   1.901 5331 99.831  5039 0.22  283 0.242 . . . . 'X-RAY DIFFRACTION' . 
20 2.009   1.953 5245 99.981  5007 0.199 237 0.235 . . . . 'X-RAY DIFFRACTION' . 
20 2.071   2.009 5065 99.980  4804 0.194 260 0.239 . . . . 'X-RAY DIFFRACTION' . 
20 2.139   2.071 4918 100.000 4673 0.191 245 0.226 . . . . 'X-RAY DIFFRACTION' . 
20 2.214   2.139 4752 99.979  4524 0.187 227 0.215 . . . . 'X-RAY DIFFRACTION' . 
20 2.298   2.214 4627 99.978  4403 0.185 223 0.202 . . . . 'X-RAY DIFFRACTION' . 
20 2.391   2.298 4411 100.000 4182 0.191 229 0.209 . . . . 'X-RAY DIFFRACTION' . 
20 2.498   2.391 4224 99.976  4016 0.191 207 0.235 . . . . 'X-RAY DIFFRACTION' . 
20 2.620   2.498 4073 100.000 3859 0.194 214 0.219 . . . . 'X-RAY DIFFRACTION' . 
20 2.761   2.620 3900 99.949  3716 0.199 182 0.22  . . . . 'X-RAY DIFFRACTION' . 
20 2.929   2.761 3651 99.945  3475 0.192 174 0.237 . . . . 'X-RAY DIFFRACTION' . 
20 3.131   2.929 3453 99.971  3287 0.192 165 0.202 . . . . 'X-RAY DIFFRACTION' . 
20 3.381   3.131 3207 99.969  3053 0.183 153 0.191 . . . . 'X-RAY DIFFRACTION' . 
20 3.704   3.381 2939 99.660  2776 0.172 153 0.188 . . . . 'X-RAY DIFFRACTION' . 
20 4.141   3.704 2681 99.217  2528 0.152 132 0.199 . . . . 'X-RAY DIFFRACTION' . 
20 4.780   4.141 2371 99.325  2240 0.152 115 0.167 . . . . 'X-RAY DIFFRACTION' . 
20 5.852   4.780 2005 99.601  1905 0.18  92  0.173 . . . . 'X-RAY DIFFRACTION' . 
20 8.266   5.852 1564 99.488  1466 0.195 90  0.192 . . . . 'X-RAY DIFFRACTION' . 
20 119.523 8.266 890  96.067  805  0.176 50  0.147 . . . . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  1Y67 
_struct.title                     'Crystal Structure of Manganese Superoxide Dismutase from Deinococcus radiodurans' 
_struct.pdbx_descriptor           'Superoxide Dismutase [Mn] (E.C.1.15.1.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1Y67 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'SUPEROXIDE DISMUTASE, MANGANESE ENZYME, METALLOPROTEIN, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 'The biological assembly is a dimer formed from either chains A and B or chains C and D.' ? 
2 ?                                                                                         ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 21  ? LYS A 31  ? ASP A 20  LYS A 30  1 ? 11 
HELX_P HELX_P2  2  LYS A 31  ? GLU A 45  ? LYS A 30  GLU A 44  1 ? 15 
HELX_P HELX_P3  3  PRO A 53  ? ILE A 58  ? PRO A 52  ILE A 57  1 ? 6  
HELX_P HELX_P4  4  PRO A 65  ? ILE A 88  ? PRO A 64  ILE A 87  1 ? 24 
HELX_P HELX_P5  5  SER A 102 ? GLY A 114 ? SER A 101 GLY A 113 1 ? 13 
HELX_P HELX_P6  6  SER A 115 ? ARG A 130 ? SER A 114 ARG A 129 1 ? 16 
HELX_P HELX_P7  7  ASN A 155 ? MET A 158 ? ASN A 154 MET A 157 5 ? 4  
HELX_P HELX_P8  8  GLY A 159 ? GLY A 164 ? GLY A 158 GLY A 163 1 ? 6  
HELX_P HELX_P9  9  TRP A 176 ? ALA A 179 ? TRP A 175 ALA A 178 5 ? 4  
HELX_P HELX_P10 10 TYR A 180 ? GLN A 185 ? TYR A 179 GLN A 184 1 ? 6  
HELX_P HELX_P11 11 ARG A 187 ? TRP A 196 ? ARG A 186 TRP A 195 1 ? 10 
HELX_P HELX_P12 12 ASN A 200 ? LEU A 213 ? ASN A 199 LEU A 212 1 ? 14 
HELX_P HELX_P13 13 ASP B 21  ? LYS B 31  ? ASP B 20  LYS B 30  1 ? 11 
HELX_P HELX_P14 14 LYS B 31  ? GLU B 45  ? LYS B 30  GLU B 44  1 ? 15 
HELX_P HELX_P15 15 PRO B 53  ? ILE B 58  ? PRO B 52  ILE B 57  1 ? 6  
HELX_P HELX_P16 16 LYS B 68  ? ILE B 88  ? LYS B 67  ILE B 87  1 ? 21 
HELX_P HELX_P17 17 SER B 102 ? GLY B 114 ? SER B 101 GLY B 113 1 ? 13 
HELX_P HELX_P18 18 SER B 115 ? THR B 129 ? SER B 114 THR B 128 1 ? 15 
HELX_P HELX_P19 19 ASN B 155 ? MET B 158 ? ASN B 154 MET B 157 5 ? 4  
HELX_P HELX_P20 20 GLY B 159 ? GLY B 164 ? GLY B 158 GLY B 163 1 ? 6  
HELX_P HELX_P21 21 TRP B 176 ? ALA B 179 ? TRP B 175 ALA B 178 5 ? 4  
HELX_P HELX_P22 22 TYR B 180 ? GLN B 185 ? TYR B 179 GLN B 184 1 ? 6  
HELX_P HELX_P23 23 ARG B 187 ? TRP B 196 ? ARG B 186 TRP B 195 1 ? 10 
HELX_P HELX_P24 24 ASN B 200 ? LYS B 212 ? ASN B 199 LYS B 211 1 ? 13 
HELX_P HELX_P25 25 ASP C 21  ? LYS C 31  ? ASP C 20  LYS C 30  1 ? 11 
HELX_P HELX_P26 26 LYS C 31  ? GLU C 45  ? LYS C 30  GLU C 44  1 ? 15 
HELX_P HELX_P27 27 PRO C 53  ? ILE C 58  ? PRO C 52  ILE C 57  1 ? 6  
HELX_P HELX_P28 28 PRO C 65  ? ILE C 88  ? PRO C 64  ILE C 87  1 ? 24 
HELX_P HELX_P29 29 SER C 102 ? GLY C 114 ? SER C 101 GLY C 113 1 ? 13 
HELX_P HELX_P30 30 SER C 115 ? ARG C 130 ? SER C 114 ARG C 129 1 ? 16 
HELX_P HELX_P31 31 ASN C 155 ? MET C 158 ? ASN C 154 MET C 157 5 ? 4  
HELX_P HELX_P32 32 GLY C 159 ? GLY C 164 ? GLY C 158 GLY C 163 1 ? 6  
HELX_P HELX_P33 33 TRP C 176 ? ALA C 179 ? TRP C 175 ALA C 178 5 ? 4  
HELX_P HELX_P34 34 TYR C 180 ? GLN C 185 ? TYR C 179 GLN C 184 1 ? 6  
HELX_P HELX_P35 35 ARG C 187 ? TRP C 196 ? ARG C 186 TRP C 195 1 ? 10 
HELX_P HELX_P36 36 ASN C 200 ? LEU C 213 ? ASN C 199 LEU C 212 1 ? 14 
HELX_P HELX_P37 37 ASP D 21  ? LYS D 31  ? ASP D 20  LYS D 30  1 ? 11 
HELX_P HELX_P38 38 LYS D 31  ? GLU D 45  ? LYS D 30  GLU D 44  1 ? 15 
HELX_P HELX_P39 39 PRO D 53  ? ILE D 58  ? PRO D 52  ILE D 57  1 ? 6  
HELX_P HELX_P40 40 PRO D 65  ? ASP D 67  ? PRO D 64  ASP D 66  5 ? 3  
HELX_P HELX_P41 41 LYS D 68  ? ILE D 88  ? LYS D 67  ILE D 87  1 ? 21 
HELX_P HELX_P42 42 SER D 102 ? GLY D 114 ? SER D 101 GLY D 113 1 ? 13 
HELX_P HELX_P43 43 SER D 115 ? ARG D 130 ? SER D 114 ARG D 129 1 ? 16 
HELX_P HELX_P44 44 ASN D 155 ? MET D 158 ? ASN D 154 MET D 157 5 ? 4  
HELX_P HELX_P45 45 GLY D 159 ? GLY D 164 ? GLY D 158 GLY D 163 1 ? 6  
HELX_P HELX_P46 46 TRP D 176 ? ALA D 179 ? TRP D 175 ALA D 178 5 ? 4  
HELX_P HELX_P47 47 TYR D 180 ? GLN D 185 ? TYR D 179 GLN D 184 1 ? 6  
HELX_P HELX_P48 48 ARG D 187 ? TRP D 196 ? ARG D 186 TRP D 195 1 ? 10 
HELX_P HELX_P49 49 ASN D 197 ? VAL D 199 ? ASN D 196 VAL D 198 5 ? 3  
HELX_P HELX_P50 50 ASN D 200 ? LYS D 212 ? ASN D 199 LYS D 211 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A HIS 28  NE2 ? ? ? 1_555 E FE  . FE ? ? A HIS 27  A FE  229 1_555 ? ? ? ? ? ? ? 2.120 ? 
metalc2  metalc ? ? A HIS 82  NE2 ? ? ? 1_555 E FE  . FE ? ? A HIS 81  A FE  229 1_555 ? ? ? ? ? ? ? 2.192 ? 
metalc3  metalc ? ? A ASP 174 OD2 ? ? ? 1_555 E FE  . FE ? ? A ASP 173 A FE  229 1_555 ? ? ? ? ? ? ? 1.934 ? 
metalc4  metalc ? ? A HIS 178 NE2 ? ? ? 1_555 E FE  . FE ? ? A HIS 177 A FE  229 1_555 ? ? ? ? ? ? ? 2.200 ? 
metalc5  metalc ? ? B HIS 28  NE2 ? ? ? 1_555 F FE  . FE ? ? B HIS 27  B FE  229 1_555 ? ? ? ? ? ? ? 2.180 ? 
metalc6  metalc ? ? B HIS 82  NE2 ? ? ? 1_555 F FE  . FE ? ? B HIS 81  B FE  229 1_555 ? ? ? ? ? ? ? 2.242 ? 
metalc7  metalc ? ? B ASP 174 OD2 ? ? ? 1_555 F FE  . FE ? ? B ASP 173 B FE  229 1_555 ? ? ? ? ? ? ? 1.977 ? 
metalc8  metalc ? ? B HIS 178 NE2 ? ? ? 1_555 F FE  . FE ? ? B HIS 177 B FE  229 1_555 ? ? ? ? ? ? ? 2.156 ? 
metalc9  metalc ? ? C HIS 28  NE2 ? ? ? 1_555 G FE  . FE ? ? C HIS 27  C FE  229 1_555 ? ? ? ? ? ? ? 2.174 ? 
metalc10 metalc ? ? C HIS 82  NE2 ? ? ? 1_555 G FE  . FE ? ? C HIS 81  C FE  229 1_555 ? ? ? ? ? ? ? 2.219 ? 
metalc11 metalc ? ? C ASP 174 OD2 ? ? ? 1_555 G FE  . FE ? ? C ASP 173 C FE  229 1_555 ? ? ? ? ? ? ? 1.983 ? 
metalc12 metalc ? ? C HIS 178 NE2 ? ? ? 1_555 G FE  . FE ? ? C HIS 177 C FE  229 1_555 ? ? ? ? ? ? ? 2.113 ? 
metalc13 metalc ? ? D HIS 28  NE2 ? ? ? 1_555 H FE  . FE ? ? D HIS 27  D FE  229 1_555 ? ? ? ? ? ? ? 2.200 ? 
metalc14 metalc ? ? D HIS 82  NE2 ? ? ? 1_555 H FE  . FE ? ? D HIS 81  D FE  229 1_555 ? ? ? ? ? ? ? 2.196 ? 
metalc15 metalc ? ? D ASP 174 OD2 ? ? ? 1_555 H FE  . FE ? ? D ASP 173 D FE  229 1_555 ? ? ? ? ? ? ? 1.990 ? 
metalc16 metalc ? ? D HIS 178 NE2 ? ? ? 1_555 H FE  . FE ? ? D HIS 177 D FE  229 1_555 ? ? ? ? ? ? ? 2.154 ? 
metalc17 metalc ? ? E FE  .   FE  ? ? ? 1_555 I HOH . O  ? ? A FE  229 A HOH 233 1_555 ? ? ? ? ? ? ? 2.273 ? 
metalc18 metalc ? ? F FE  .   FE  ? ? ? 1_555 J HOH . O  ? ? B FE  229 B HOH 230 1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc19 metalc ? ? G FE  .   FE  ? ? ? 1_555 K HOH . O  ? ? C FE  229 C HOH 230 1_555 ? ? ? ? ? ? ? 2.150 ? 
metalc20 metalc ? ? H FE  .   FE  ? ? ? 1_555 L HOH . O  ? ? D FE  229 D HOH 234 1_555 ? ? ? ? ? ? ? 1.970 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 17 A . ? GLU 16 A PRO 18 A ? PRO 17 A 1 -2.64 
2 GLU 17 B . ? GLU 16 B PRO 18 B ? PRO 17 B 1 0.75  
3 GLU 17 C . ? GLU 16 C PRO 18 C ? PRO 17 C 1 -3.23 
4 GLU 17 D . ? GLU 16 D PRO 18 D ? PRO 17 D 1 -2.23 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
C ? 3 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 144 ? ALA A 151 ? LYS A 143 ALA A 150 
A 2 GLY A 134 ? LYS A 141 ? GLY A 133 LYS A 140 
A 3 THR A 168 ? ASP A 174 ? THR A 167 ASP A 173 
B 1 LYS A 144 ? ALA A 151 ? LYS A 143 ALA A 150 
B 2 GLY A 134 ? LYS A 141 ? GLY A 133 LYS A 140 
B 3 THR A 168 ? ASP A 174 ? THR A 167 ASP A 173 
C 1 LYS A 144 ? ALA A 151 ? LYS A 143 ALA A 150 
C 2 GLY A 134 ? LYS A 141 ? GLY A 133 LYS A 140 
C 3 THR A 168 ? ASP A 174 ? THR A 167 ASP A 173 
D 1 LYS A 144 ? ALA A 151 ? LYS A 143 ALA A 150 
D 2 GLY A 134 ? LYS A 141 ? GLY A 133 LYS A 140 
D 3 THR A 168 ? ASP A 174 ? THR A 167 ASP A 173 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS A 144 ? O LYS A 143 N LYS A 141 ? N LYS A 140 
A 2 3 N LEU A 138 ? N LEU A 137 O ILE A 170 ? O ILE A 169 
B 1 2 O VAL A 148 ? O VAL A 147 N TRP A 137 ? N TRP A 136 
B 2 3 N VAL A 140 ? N VAL A 139 O THR A 168 ? O THR A 167 
C 1 2 O LYS A 144 ? O LYS A 143 N LYS A 141 ? N LYS A 140 
C 2 3 N LEU A 138 ? N LEU A 137 O ILE A 170 ? O ILE A 169 
D 1 2 O VAL A 148 ? O VAL A 147 N TRP A 137 ? N TRP A 136 
D 2 3 N LEU A 138 ? N LEU A 137 O LEU A 171 ? O LEU A 170 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FE A 229' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FE B 229' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FE C 229' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FE D 229' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 HIS A 28  ? HIS A 27  . ? 1_555 ? 
2  AC1 5 HIS A 82  ? HIS A 81  . ? 1_555 ? 
3  AC1 5 ASP A 174 ? ASP A 173 . ? 1_555 ? 
4  AC1 5 HIS A 178 ? HIS A 177 . ? 1_555 ? 
5  AC1 5 HOH I .   ? HOH A 233 . ? 1_555 ? 
6  AC2 5 HIS B 28  ? HIS B 27  . ? 1_555 ? 
7  AC2 5 HIS B 82  ? HIS B 81  . ? 1_555 ? 
8  AC2 5 ASP B 174 ? ASP B 173 . ? 1_555 ? 
9  AC2 5 HIS B 178 ? HIS B 177 . ? 1_555 ? 
10 AC2 5 HOH J .   ? HOH B 230 . ? 1_555 ? 
11 AC3 5 HIS C 28  ? HIS C 27  . ? 1_555 ? 
12 AC3 5 HIS C 82  ? HIS C 81  . ? 1_555 ? 
13 AC3 5 ASP C 174 ? ASP C 173 . ? 1_555 ? 
14 AC3 5 HIS C 178 ? HIS C 177 . ? 1_555 ? 
15 AC3 5 HOH K .   ? HOH C 230 . ? 1_555 ? 
16 AC4 5 HIS D 28  ? HIS D 27  . ? 1_555 ? 
17 AC4 5 HIS D 82  ? HIS D 81  . ? 1_555 ? 
18 AC4 5 ASP D 174 ? ASP D 173 . ? 1_555 ? 
19 AC4 5 HIS D 178 ? HIS D 177 . ? 1_555 ? 
20 AC4 5 HOH L .   ? HOH D 234 . ? 1_555 ? 
# 
_atom_sites.entry_id                    1Y67 
_atom_sites.fract_transf_matrix[1][1]   0.022831 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000454 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011374 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008608 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ALA A 1 2   ? -12.687 37.854  3.344   1.00  33.35 ? 1   ALA A N   1 
ATOM   2    C  CA  . ALA A 1 2   ? -11.733 37.143  4.252   1.00  32.61 ? 1   ALA A CA  1 
ATOM   3    C  C   . ALA A 1 2   ? -11.370 35.800  3.636   1.00  32.10 ? 1   ALA A C   1 
ATOM   4    O  O   . ALA A 1 2   ? -12.130 35.275  2.820   1.00  32.48 ? 1   ALA A O   1 
ATOM   5    C  CB  . ALA A 1 2   ? -12.347 36.956  5.627   1.00  32.81 ? 1   ALA A CB  1 
ATOM   6    N  N   . ALA A 1 3   ? -10.214 35.249  4.006   1.00  31.02 ? 2   ALA A N   1 
ATOM   7    C  CA  . ALA A 1 3   ? -9.750  33.984  3.418   1.00  30.44 ? 2   ALA A CA  1 
ATOM   8    C  C   . ALA A 1 3   ? -10.675 32.796  3.727   1.00  29.98 ? 2   ALA A C   1 
ATOM   9    O  O   . ALA A 1 3   ? -11.044 32.032  2.830   1.00  29.58 ? 2   ALA A O   1 
ATOM   10   C  CB  . ALA A 1 3   ? -8.325  33.678  3.855   1.00  30.43 ? 2   ALA A CB  1 
ATOM   11   N  N   . TYR A 1 4   ? -11.043 32.661  5.000   1.00  29.48 ? 3   TYR A N   1 
ATOM   12   C  CA  . TYR A 1 4   ? -11.832 31.536  5.486   1.00  29.57 ? 3   TYR A CA  1 
ATOM   13   C  C   . TYR A 1 4   ? -13.142 32.010  6.082   1.00  29.25 ? 3   TYR A C   1 
ATOM   14   O  O   . TYR A 1 4   ? -13.226 33.119  6.592   1.00  28.78 ? 3   TYR A O   1 
ATOM   15   C  CB  . TYR A 1 4   ? -11.080 30.792  6.586   1.00  30.35 ? 3   TYR A CB  1 
ATOM   16   C  CG  . TYR A 1 4   ? -9.694  30.307  6.247   1.00  31.40 ? 3   TYR A CG  1 
ATOM   17   C  CD1 . TYR A 1 4   ? -9.408  29.728  5.006   1.00  31.95 ? 3   TYR A CD1 1 
ATOM   18   C  CD2 . TYR A 1 4   ? -8.674  30.384  7.195   1.00  32.29 ? 3   TYR A CD2 1 
ATOM   19   C  CE1 . TYR A 1 4   ? -8.128  29.264  4.715   1.00  32.91 ? 3   TYR A CE1 1 
ATOM   20   C  CE2 . TYR A 1 4   ? -7.403  29.926  6.918   1.00  33.79 ? 3   TYR A CE2 1 
ATOM   21   C  CZ  . TYR A 1 4   ? -7.135  29.371  5.678   1.00  33.02 ? 3   TYR A CZ  1 
ATOM   22   O  OH  . TYR A 1 4   ? -5.866  28.917  5.422   1.00  33.61 ? 3   TYR A OH  1 
ATOM   23   N  N   . THR A 1 5   ? -14.161 31.153  6.034   1.00  29.08 ? 4   THR A N   1 
ATOM   24   C  CA  . THR A 1 5   ? -15.416 31.417  6.734   1.00  29.16 ? 4   THR A CA  1 
ATOM   25   C  C   . THR A 1 5   ? -15.723 30.219  7.628   1.00  28.39 ? 4   THR A C   1 
ATOM   26   O  O   . THR A 1 5   ? -15.199 29.128  7.408   1.00  28.42 ? 4   THR A O   1 
ATOM   27   C  CB  . THR A 1 5   ? -16.608 31.676  5.774   1.00  29.39 ? 4   THR A CB  1 
ATOM   28   O  OG1 . THR A 1 5   ? -16.772 30.559  4.891   1.00  30.97 ? 4   THR A OG1 1 
ATOM   29   C  CG2 . THR A 1 5   ? -16.405 32.953  4.958   1.00  30.29 ? 4   THR A CG2 1 
ATOM   30   N  N   . LEU A 1 6   ? -16.550 30.432  8.648   1.00  28.06 ? 5   LEU A N   1 
ATOM   31   C  CA  . LEU A 1 6   ? -16.978 29.335  9.527   1.00  27.79 ? 5   LEU A CA  1 
ATOM   32   C  C   . LEU A 1 6   ? -17.922 28.417  8.751   1.00  27.40 ? 5   LEU A C   1 
ATOM   33   O  O   . LEU A 1 6   ? -18.933 28.893  8.222   1.00  27.18 ? 5   LEU A O   1 
ATOM   34   C  CB  . LEU A 1 6   ? -17.684 29.889  10.771  1.00  27.52 ? 5   LEU A CB  1 
ATOM   35   C  CG  . LEU A 1 6   ? -18.148 28.865  11.816  1.00  27.61 ? 5   LEU A CG  1 
ATOM   36   C  CD1 . LEU A 1 6   ? -16.954 28.303  12.575  1.00  27.13 ? 5   LEU A CD1 1 
ATOM   37   C  CD2 . LEU A 1 6   ? -19.147 29.495  12.783  1.00  27.86 ? 5   LEU A CD2 1 
ATOM   38   N  N   . PRO A 1 7   ? -17.599 27.102  8.672   1.00  27.26 ? 6   PRO A N   1 
ATOM   39   C  CA  . PRO A 1 7   ? -18.470 26.219  7.909   1.00  27.51 ? 6   PRO A CA  1 
ATOM   40   C  C   . PRO A 1 7   ? -19.748 25.915  8.670   1.00  28.00 ? 6   PRO A C   1 
ATOM   41   O  O   . PRO A 1 7   ? -19.751 25.893  9.895   1.00  28.10 ? 6   PRO A O   1 
ATOM   42   C  CB  . PRO A 1 7   ? -17.637 24.939  7.765   1.00  27.22 ? 6   PRO A CB  1 
ATOM   43   C  CG  . PRO A 1 7   ? -16.773 24.922  8.989   1.00  27.59 ? 6   PRO A CG  1 
ATOM   44   C  CD  . PRO A 1 7   ? -16.458 26.376  9.268   1.00  26.71 ? 6   PRO A CD  1 
ATOM   45   N  N   . GLN A 1 8   ? -20.831 25.685  7.947   1.00  28.48 ? 7   GLN A N   1 
ATOM   46   C  CA  . GLN A 1 8   ? -22.044 25.207  8.571   1.00  29.67 ? 7   GLN A CA  1 
ATOM   47   C  C   . GLN A 1 8   ? -21.846 23.753  8.989   1.00  29.67 ? 7   GLN A C   1 
ATOM   48   O  O   . GLN A 1 8   ? -21.175 23.000  8.290   1.00  30.04 ? 7   GLN A O   1 
ATOM   49   C  CB  . GLN A 1 8   ? -23.185 25.321  7.575   1.00  30.20 ? 7   GLN A CB  1 
ATOM   50   C  CG  . GLN A 1 8   ? -24.521 24.899  8.095   1.00  33.50 ? 7   GLN A CG  1 
ATOM   51   C  CD  . GLN A 1 8   ? -25.591 25.083  7.058   1.00  36.61 ? 7   GLN A CD  1 
ATOM   52   O  OE1 . GLN A 1 8   ? -25.662 24.334  6.073   1.00  39.03 ? 7   GLN A OE1 1 
ATOM   53   N  NE2 . GLN A 1 8   ? -26.437 26.081  7.264   1.00  38.60 ? 7   GLN A NE2 1 
ATOM   54   N  N   . LEU A 1 9   ? -22.421 23.359  10.124  1.00  29.67 ? 8   LEU A N   1 
ATOM   55   C  CA  . LEU A 1 9   ? -22.411 21.952  10.535  1.00  29.82 ? 8   LEU A CA  1 
ATOM   56   C  C   . LEU A 1 9   ? -23.307 21.110  9.635   1.00  29.59 ? 8   LEU A C   1 
ATOM   57   O  O   . LEU A 1 9   ? -24.304 21.627  9.095   1.00  29.47 ? 8   LEU A O   1 
ATOM   58   C  CB  . LEU A 1 9   ? -22.887 21.799  11.983  1.00  29.96 ? 8   LEU A CB  1 
ATOM   59   C  CG  . LEU A 1 9   ? -22.138 22.479  13.122  1.00  30.77 ? 8   LEU A CG  1 
ATOM   60   C  CD1 . LEU A 1 9   ? -22.752 22.038  14.436  1.00  31.32 ? 8   LEU A CD1 1 
ATOM   61   C  CD2 . LEU A 1 9   ? -20.670 22.136  13.074  1.00  29.37 ? 8   LEU A CD2 1 
ATOM   62   N  N   . PRO A 1 10  ? -22.964 19.813  9.454   1.00  29.21 ? 9   PRO A N   1 
ATOM   63   C  CA  . PRO A 1 10  ? -23.848 18.902  8.700   1.00  29.05 ? 9   PRO A CA  1 
ATOM   64   C  C   . PRO A 1 10  ? -25.128 18.468  9.436   1.00  28.60 ? 9   PRO A C   1 
ATOM   65   O  O   . PRO A 1 10  ? -25.866 17.647  8.916   1.00  28.76 ? 9   PRO A O   1 
ATOM   66   C  CB  . PRO A 1 10  ? -22.962 17.670  8.435   1.00  29.28 ? 9   PRO A CB  1 
ATOM   67   C  CG  . PRO A 1 10  ? -21.577 18.040  8.875   1.00  29.07 ? 9   PRO A CG  1 
ATOM   68   C  CD  . PRO A 1 10  ? -21.733 19.134  9.893   1.00  29.28 ? 9   PRO A CD  1 
ATOM   69   N  N   . TYR A 1 11  ? -25.378 19.011  10.624  1.00  28.09 ? 10  TYR A N   1 
ATOM   70   C  CA  . TYR A 1 11  ? -26.483 18.579  11.492  1.00  27.54 ? 10  TYR A CA  1 
ATOM   71   C  C   . TYR A 1 11  ? -26.736 19.699  12.511  1.00  27.61 ? 10  TYR A C   1 
ATOM   72   O  O   . TYR A 1 11  ? -25.916 20.610  12.644  1.00  28.23 ? 10  TYR A O   1 
ATOM   73   C  CB  . TYR A 1 11  ? -26.128 17.260  12.203  1.00  27.36 ? 10  TYR A CB  1 
ATOM   74   C  CG  . TYR A 1 11  ? -24.669 17.217  12.596  1.00  27.12 ? 10  TYR A CG  1 
ATOM   75   C  CD1 . TYR A 1 11  ? -24.197 17.999  13.648  1.00  27.22 ? 10  TYR A CD1 1 
ATOM   76   C  CD2 . TYR A 1 11  ? -23.751 16.449  11.878  1.00  28.25 ? 10  TYR A CD2 1 
ATOM   77   C  CE1 . TYR A 1 11  ? -22.859 18.014  13.997  1.00  27.80 ? 10  TYR A CE1 1 
ATOM   78   C  CE2 . TYR A 1 11  ? -22.390 16.453  12.229  1.00  27.04 ? 10  TYR A CE2 1 
ATOM   79   C  CZ  . TYR A 1 11  ? -21.965 17.241  13.291  1.00  27.57 ? 10  TYR A CZ  1 
ATOM   80   O  OH  . TYR A 1 11  ? -20.644 17.282  13.652  1.00  27.03 ? 10  TYR A OH  1 
ATOM   81   N  N   . ALA A 1 12  ? -27.857 19.630  13.230  1.00  27.37 ? 11  ALA A N   1 
ATOM   82   C  CA  . ALA A 1 12  ? -28.199 20.638  14.243  1.00  27.45 ? 11  ALA A CA  1 
ATOM   83   C  C   . ALA A 1 12  ? -27.332 20.475  15.495  1.00  27.64 ? 11  ALA A C   1 
ATOM   84   O  O   . ALA A 1 12  ? -26.727 19.414  15.698  1.00  27.02 ? 11  ALA A O   1 
ATOM   85   C  CB  . ALA A 1 12  ? -29.681 20.559  14.591  1.00  27.50 ? 11  ALA A CB  1 
ATOM   86   N  N   . TYR A 1 13  ? -27.266 21.524  16.322  1.00  27.60 ? 12  TYR A N   1 
ATOM   87   C  CA  . TYR A 1 13  ? -26.412 21.509  17.525  1.00  28.19 ? 12  TYR A CA  1 
ATOM   88   C  C   . TYR A 1 13  ? -26.749 20.398  18.514  1.00  28.27 ? 12  TYR A C   1 
ATOM   89   O  O   . TYR A 1 13  ? -25.867 19.922  19.227  1.00  28.31 ? 12  TYR A O   1 
ATOM   90   C  CB  . TYR A 1 13  ? -26.414 22.871  18.243  1.00  28.40 ? 12  TYR A CB  1 
ATOM   91   C  CG  . TYR A 1 13  ? -25.696 23.968  17.483  1.00  28.82 ? 12  TYR A CG  1 
ATOM   92   C  CD1 . TYR A 1 13  ? -24.399 23.777  16.999  1.00  28.59 ? 12  TYR A CD1 1 
ATOM   93   C  CD2 . TYR A 1 13  ? -26.314 25.192  17.246  1.00  30.47 ? 12  TYR A CD2 1 
ATOM   94   C  CE1 . TYR A 1 13  ? -23.739 24.776  16.302  1.00  28.89 ? 12  TYR A CE1 1 
ATOM   95   C  CE2 . TYR A 1 13  ? -25.662 26.200  16.549  1.00  31.11 ? 12  TYR A CE2 1 
ATOM   96   C  CZ  . TYR A 1 13  ? -24.378 25.984  16.080  1.00  29.38 ? 12  TYR A CZ  1 
ATOM   97   O  OH  . TYR A 1 13  ? -23.735 26.978  15.381  1.00  29.19 ? 12  TYR A OH  1 
ATOM   98   N  N   . ASP A 1 14  ? -28.016 19.983  18.542  1.00  28.29 ? 13  ASP A N   1 
ATOM   99   C  CA  . ASP A 1 14  ? -28.468 18.927  19.452  1.00  28.43 ? 13  ASP A CA  1 
ATOM   100  C  C   . ASP A 1 14  ? -28.483 17.532  18.823  1.00  28.29 ? 13  ASP A C   1 
ATOM   101  O  O   . ASP A 1 14  ? -28.974 16.582  19.435  1.00  28.67 ? 13  ASP A O   1 
ATOM   102  C  CB  . ASP A 1 14  ? -29.843 19.278  20.065  1.00  28.23 ? 13  ASP A CB  1 
ATOM   103  C  CG  . ASP A 1 14  ? -30.994 19.252  19.045  1.00  29.34 ? 13  ASP A CG  1 
ATOM   104  O  OD1 . ASP A 1 14  ? -30.776 18.983  17.843  1.00  29.64 ? 13  ASP A OD1 1 
ATOM   105  O  OD2 . ASP A 1 14  ? -32.145 19.512  19.457  1.00  31.33 ? 13  ASP A OD2 1 
ATOM   106  N  N   . ALA A 1 15  ? -27.940 17.413  17.611  1.00  27.86 ? 14  ALA A N   1 
ATOM   107  C  CA  . ALA A 1 15  ? -28.012 16.168  16.843  1.00  27.83 ? 14  ALA A CA  1 
ATOM   108  C  C   . ALA A 1 15  ? -27.144 15.033  17.390  1.00  27.58 ? 14  ALA A C   1 
ATOM   109  O  O   . ALA A 1 15  ? -27.368 13.860  17.063  1.00  27.86 ? 14  ALA A O   1 
ATOM   110  C  CB  . ALA A 1 15  ? -27.679 16.430  15.380  1.00  27.95 ? 14  ALA A CB  1 
ATOM   111  N  N   . LEU A 1 16  ? -26.164 15.378  18.216  1.00  27.12 ? 15  LEU A N   1 
ATOM   112  C  CA  . LEU A 1 16  ? -25.224 14.398  18.767  1.00  26.78 ? 15  LEU A CA  1 
ATOM   113  C  C   . LEU A 1 16  ? -25.516 14.070  20.236  1.00  26.89 ? 15  LEU A C   1 
ATOM   114  O  O   . LEU A 1 16  ? -24.736 13.371  20.892  1.00  26.70 ? 15  LEU A O   1 
ATOM   115  C  CB  . LEU A 1 16  ? -23.768 14.874  18.568  1.00  26.58 ? 15  LEU A CB  1 
ATOM   116  C  CG  . LEU A 1 16  ? -23.321 15.298  17.158  1.00  26.72 ? 15  LEU A CG  1 
ATOM   117  C  CD1 . LEU A 1 16  ? -21.830 15.605  17.136  1.00  28.03 ? 15  LEU A CD1 1 
ATOM   118  C  CD2 . LEU A 1 16  ? -23.643 14.231  16.098  1.00  27.14 ? 15  LEU A CD2 1 
ATOM   119  N  N   . GLU A 1 17  ? -26.646 14.577  20.741  1.00  27.22 ? 16  GLU A N   1 
ATOM   120  C  CA  . GLU A 1 17  ? -27.119 14.291  22.098  1.00  27.37 ? 16  GLU A CA  1 
ATOM   121  C  C   . GLU A 1 17  ? -27.462 12.806  22.230  1.00  27.37 ? 16  GLU A C   1 
ATOM   122  O  O   . GLU A 1 17  ? -27.957 12.216  21.275  1.00  27.09 ? 16  GLU A O   1 
ATOM   123  C  CB  . GLU A 1 17  ? -28.382 15.104  22.405  1.00  27.70 ? 16  GLU A CB  1 
ATOM   124  C  CG  . GLU A 1 17  ? -28.148 16.599  22.574  1.00  29.71 ? 16  GLU A CG  1 
ATOM   125  C  CD  . GLU A 1 17  ? -27.762 16.984  23.985  1.00  32.55 ? 16  GLU A CD  1 
ATOM   126  O  OE1 . GLU A 1 17  ? -27.439 16.075  24.790  1.00  32.65 ? 16  GLU A OE1 1 
ATOM   127  O  OE2 . GLU A 1 17  ? -27.785 18.203  24.292  1.00  33.38 ? 16  GLU A OE2 1 
ATOM   128  N  N   . PRO A 1 18  ? -27.214 12.200  23.411  1.00  27.26 ? 17  PRO A N   1 
ATOM   129  C  CA  . PRO A 1 18  ? -26.594 12.762  24.618  1.00  27.29 ? 17  PRO A CA  1 
ATOM   130  C  C   . PRO A 1 18  ? -25.068 12.642  24.664  1.00  27.45 ? 17  PRO A C   1 
ATOM   131  O  O   . PRO A 1 18  ? -24.448 13.029  25.664  1.00  27.71 ? 17  PRO A O   1 
ATOM   132  C  CB  . PRO A 1 18  ? -27.210 11.904  25.723  1.00  27.51 ? 17  PRO A CB  1 
ATOM   133  C  CG  . PRO A 1 18  ? -27.327 10.552  25.081  1.00  26.79 ? 17  PRO A CG  1 
ATOM   134  C  CD  . PRO A 1 18  ? -27.617 10.793  23.622  1.00  26.86 ? 17  PRO A CD  1 
ATOM   135  N  N   . HIS A 1 19  ? -24.457 12.139  23.590  1.00  27.32 ? 18  HIS A N   1 
ATOM   136  C  CA  . HIS A 1 19  ? -23.012 11.889  23.554  1.00  27.07 ? 18  HIS A CA  1 
ATOM   137  C  C   . HIS A 1 19  ? -22.179 13.177  23.642  1.00  27.44 ? 18  HIS A C   1 
ATOM   138  O  O   . HIS A 1 19  ? -21.184 13.242  24.375  1.00  26.87 ? 18  HIS A O   1 
ATOM   139  C  CB  . HIS A 1 19  ? -22.664 11.057  22.308  1.00  27.34 ? 18  HIS A CB  1 
ATOM   140  C  CG  . HIS A 1 19  ? -23.637 9.942   22.058  1.00  26.66 ? 18  HIS A CG  1 
ATOM   141  N  ND1 . HIS A 1 19  ? -23.780 8.877   22.924  1.00  26.75 ? 18  HIS A ND1 1 
ATOM   142  C  CD2 . HIS A 1 19  ? -24.543 9.748   21.069  1.00  27.34 ? 18  HIS A CD2 1 
ATOM   143  C  CE1 . HIS A 1 19  ? -24.723 8.066   22.470  1.00  28.21 ? 18  HIS A CE1 1 
ATOM   144  N  NE2 . HIS A 1 19  ? -25.197 8.568   21.342  1.00  27.53 ? 18  HIS A NE2 1 
ATOM   145  N  N   . ILE A 1 20  ? -22.595 14.195  22.888  1.00  27.39 ? 19  ILE A N   1 
ATOM   146  C  CA  . ILE A 1 20  ? -22.039 15.542  23.024  1.00  27.42 ? 19  ILE A CA  1 
ATOM   147  C  C   . ILE A 1 20  ? -23.225 16.485  23.180  1.00  26.85 ? 19  ILE A C   1 
ATOM   148  O  O   . ILE A 1 20  ? -24.185 16.419  22.403  1.00  25.84 ? 19  ILE A O   1 
ATOM   149  C  CB  . ILE A 1 20  ? -21.173 15.964  21.814  1.00  27.79 ? 19  ILE A CB  1 
ATOM   150  C  CG1 . ILE A 1 20  ? -20.097 14.905  21.509  1.00  28.31 ? 19  ILE A CG1 1 
ATOM   151  C  CG2 . ILE A 1 20  ? -20.536 17.357  22.071  1.00  27.81 ? 19  ILE A CG2 1 
ATOM   152  C  CD1 . ILE A 1 20  ? -19.226 15.229  20.297  1.00  28.19 ? 19  ILE A CD1 1 
ATOM   153  N  N   . ASP A 1 21  ? -23.161 17.349  24.192  1.00  26.73 ? 20  ASP A N   1 
ATOM   154  C  CA  . ASP A 1 21  ? -24.268 18.248  24.508  1.00  26.37 ? 20  ASP A CA  1 
ATOM   155  C  C   . ASP A 1 21  ? -24.364 19.400  23.506  1.00  25.89 ? 20  ASP A C   1 
ATOM   156  O  O   . ASP A 1 21  ? -23.347 19.898  23.007  1.00  25.23 ? 20  ASP A O   1 
ATOM   157  C  CB  . ASP A 1 21  ? -24.149 18.779  25.944  1.00  27.17 ? 20  ASP A CB  1 
ATOM   158  C  CG  . ASP A 1 21  ? -22.785 19.398  26.236  1.00  29.46 ? 20  ASP A CG  1 
ATOM   159  O  OD1 . ASP A 1 21  ? -21.758 18.685  26.105  1.00  33.96 ? 20  ASP A OD1 1 
ATOM   160  O  OD2 . ASP A 1 21  ? -22.729 20.599  26.611  1.00  31.85 ? 20  ASP A OD2 1 
ATOM   161  N  N   . ALA A 1 22  ? -25.594 19.805  23.222  1.00  25.03 ? 21  ALA A N   1 
ATOM   162  C  CA  . ALA A 1 22  ? -25.900 20.926  22.324  1.00  24.88 ? 21  ALA A CA  1 
ATOM   163  C  C   . ALA A 1 22  ? -25.169 22.223  22.678  1.00  24.68 ? 21  ALA A C   1 
ATOM   164  O  O   . ALA A 1 22  ? -24.722 22.950  21.789  1.00  24.64 ? 21  ALA A O   1 
ATOM   165  C  CB  . ALA A 1 22  ? -27.409 21.169  22.292  1.00  24.85 ? 21  ALA A CB  1 
ATOM   166  N  N   . ARG A 1 23  ? -25.059 22.525  23.971  1.00  24.75 ? 22  ARG A N   1 
ATOM   167  C  CA  . ARG A 1 23  ? -24.436 23.781  24.397  1.00  24.67 ? 22  ARG A CA  1 
ATOM   168  C  C   . ARG A 1 23  ? -22.961 23.768  24.013  1.00  24.26 ? 22  ARG A C   1 
ATOM   169  O  O   . ARG A 1 23  ? -22.463 24.729  23.432  1.00  23.69 ? 22  ARG A O   1 
ATOM   170  C  CB  . ARG A 1 23  ? -24.600 24.002  25.895  1.00  25.10 ? 22  ARG A CB  1 
ATOM   171  C  CG  . ARG A 1 23  ? -24.147 25.371  26.354  1.00  26.57 ? 22  ARG A CG  1 
ATOM   172  C  CD  . ARG A 1 23  ? -24.159 25.446  27.854  1.00  27.52 ? 22  ARG A CD  1 
ATOM   173  N  NE  . ARG A 1 23  ? -23.846 26.785  28.328  1.00  29.43 ? 22  ARG A NE  1 
ATOM   174  C  CZ  . ARG A 1 23  ? -23.490 27.061  29.577  1.00  30.98 ? 22  ARG A CZ  1 
ATOM   175  N  NH1 . ARG A 1 23  ? -23.403 26.086  30.475  1.00  31.51 ? 22  ARG A NH1 1 
ATOM   176  N  NH2 . ARG A 1 23  ? -23.228 28.315  29.929  1.00  32.63 ? 22  ARG A NH2 1 
ATOM   177  N  N   . THR A 1 24  ? -22.286 22.660  24.317  1.00  24.06 ? 23  THR A N   1 
ATOM   178  C  CA  . THR A 1 24  ? -20.911 22.454  23.893  1.00  25.29 ? 23  THR A CA  1 
ATOM   179  C  C   . THR A 1 24  ? -20.767 22.622  22.384  1.00  25.74 ? 23  THR A C   1 
ATOM   180  O  O   . THR A 1 24  ? -19.897 23.360  21.939  1.00  26.58 ? 23  THR A O   1 
ATOM   181  C  CB  . THR A 1 24  ? -20.379 21.086  24.371  1.00  24.98 ? 23  THR A CB  1 
ATOM   182  O  OG1 . THR A 1 24  ? -20.199 21.153  25.792  1.00  26.43 ? 23  THR A OG1 1 
ATOM   183  C  CG2 . THR A 1 24  ? -19.048 20.746  23.711  1.00  25.33 ? 23  THR A CG2 1 
ATOM   184  N  N   . MET A 1 25  ? -21.631 21.965  21.608  1.00  25.62 ? 24  MET A N   1 
ATOM   185  C  CA  . MET A 1 25  ? -21.536 22.040  20.144  1.00  26.27 ? 24  MET A CA  1 
ATOM   186  C  C   . MET A 1 25  ? -21.619 23.494  19.678  1.00  26.51 ? 24  MET A C   1 
ATOM   187  O  O   . MET A 1 25  ? -20.812 23.928  18.850  1.00  27.18 ? 24  MET A O   1 
ATOM   188  C  CB  . MET A 1 25  ? -22.629 21.204  19.474  1.00  26.40 ? 24  MET A CB  1 
ATOM   189  C  CG  . MET A 1 25  ? -22.505 19.715  19.705  1.00  27.98 ? 24  MET A CG  1 
ATOM   190  S  SD  . MET A 1 25  ? -21.035 19.020  18.895  1.00  30.72 ? 24  MET A SD  1 
ATOM   191  C  CE  . MET A 1 25  ? -21.384 19.408  17.170  1.00  30.81 ? 24  MET A CE  1 
ATOM   192  N  N   . GLU A 1 26  ? -22.575 24.238  20.227  1.00  26.55 ? 25  GLU A N   1 
ATOM   193  C  CA  . GLU A 1 26  ? -22.765 25.650  19.860  1.00  27.18 ? 25  GLU A CA  1 
ATOM   194  C  C   . GLU A 1 26  ? -21.546 26.506  20.209  1.00  26.16 ? 25  GLU A C   1 
ATOM   195  O  O   . GLU A 1 26  ? -21.075 27.277  19.377  1.00  26.57 ? 25  GLU A O   1 
ATOM   196  C  CB  . GLU A 1 26  ? -24.049 26.236  20.462  1.00  27.02 ? 25  GLU A CB  1 
ATOM   197  C  CG  . GLU A 1 26  ? -24.383 27.657  19.943  1.00  28.53 ? 25  GLU A CG  1 
ATOM   198  C  CD  . GLU A 1 26  ? -25.832 28.084  20.151  1.00  29.83 ? 25  GLU A CD  1 
ATOM   199  O  OE1 . GLU A 1 26  ? -26.689 27.240  20.498  1.00  32.88 ? 25  GLU A OE1 1 
ATOM   200  O  OE2 . GLU A 1 26  ? -26.122 29.286  19.954  1.00  33.36 ? 25  GLU A OE2 1 
ATOM   201  N  N   . ILE A 1 27  ? -21.040 26.377  21.432  1.00  25.10 ? 26  ILE A N   1 
ATOM   202  C  CA  . ILE A 1 27  ? -19.903 27.194  21.874  1.00  24.89 ? 26  ILE A CA  1 
ATOM   203  C  C   . ILE A 1 27  ? -18.641 26.768  21.134  1.00  24.26 ? 26  ILE A C   1 
ATOM   204  O  O   . ILE A 1 27  ? -17.851 27.599  20.684  1.00  23.64 ? 26  ILE A O   1 
ATOM   205  C  CB  . ILE A 1 27  ? -19.677 27.114  23.404  1.00  24.24 ? 26  ILE A CB  1 
ATOM   206  C  CG1 . ILE A 1 27  ? -20.902 27.677  24.147  1.00  25.67 ? 26  ILE A CG1 1 
ATOM   207  C  CG2 . ILE A 1 27  ? -18.354 27.854  23.802  1.00  24.75 ? 26  ILE A CG2 1 
ATOM   208  C  CD1 . ILE A 1 27  ? -20.892 27.448  25.646  1.00  25.76 ? 26  ILE A CD1 1 
ATOM   209  N  N   . HIS A 1 28  ? -18.479 25.461  20.995  1.00  24.09 ? 27  HIS A N   1 
ATOM   210  C  CA  . HIS A 1 28  ? -17.330 24.917  20.293  1.00  24.93 ? 27  HIS A CA  1 
ATOM   211  C  C   . HIS A 1 28  ? -17.261 25.466  18.863  1.00  25.33 ? 27  HIS A C   1 
ATOM   212  O  O   . HIS A 1 28  ? -16.171 25.777  18.362  1.00  26.18 ? 27  HIS A O   1 
ATOM   213  C  CB  . HIS A 1 28  ? -17.438 23.393  20.257  1.00  25.36 ? 27  HIS A CB  1 
ATOM   214  C  CG  . HIS A 1 28  ? -16.135 22.698  20.039  1.00  24.11 ? 27  HIS A CG  1 
ATOM   215  N  ND1 . HIS A 1 28  ? -16.022 21.326  20.051  1.00  25.11 ? 27  HIS A ND1 1 
ATOM   216  C  CD2 . HIS A 1 28  ? -14.885 23.179  19.821  1.00  26.24 ? 27  HIS A CD2 1 
ATOM   217  C  CE1 . HIS A 1 28  ? -14.761 20.990  19.845  1.00  25.36 ? 27  HIS A CE1 1 
ATOM   218  N  NE2 . HIS A 1 28  ? -14.055 22.093  19.691  1.00  23.78 ? 27  HIS A NE2 1 
ATOM   219  N  N   . HIS A 1 29  ? -18.429 25.570  18.228  1.00  25.41 ? 28  HIS A N   1 
ATOM   220  C  CA  . HIS A 1 29  ? -18.568 26.019  16.845  1.00  25.80 ? 28  HIS A CA  1 
ATOM   221  C  C   . HIS A 1 29  ? -18.509 27.549  16.713  1.00  25.86 ? 28  HIS A C   1 
ATOM   222  O  O   . HIS A 1 29  ? -17.707 28.074  15.950  1.00  25.96 ? 28  HIS A O   1 
ATOM   223  C  CB  . HIS A 1 29  ? -19.880 25.476  16.257  1.00  26.06 ? 28  HIS A CB  1 
ATOM   224  C  CG  . HIS A 1 29  ? -20.057 25.735  14.790  1.00  27.13 ? 28  HIS A CG  1 
ATOM   225  N  ND1 . HIS A 1 29  ? -21.139 26.421  14.282  1.00  27.80 ? 28  HIS A ND1 1 
ATOM   226  C  CD2 . HIS A 1 29  ? -19.299 25.385  13.723  1.00  28.12 ? 28  HIS A CD2 1 
ATOM   227  C  CE1 . HIS A 1 29  ? -21.039 26.484  12.966  1.00  28.73 ? 28  HIS A CE1 1 
ATOM   228  N  NE2 . HIS A 1 29  ? -19.931 25.866  12.601  1.00  27.46 ? 28  HIS A NE2 1 
ATOM   229  N  N   . THR A 1 30  ? -19.351 28.254  17.461  1.00  26.02 ? 29  THR A N   1 
ATOM   230  C  CA  . THR A 1 30  ? -19.540 29.693  17.257  1.00  26.06 ? 29  THR A CA  1 
ATOM   231  C  C   . THR A 1 30  ? -18.531 30.558  18.011  1.00  26.27 ? 29  THR A C   1 
ATOM   232  O  O   . THR A 1 30  ? -18.423 31.755  17.748  1.00  26.51 ? 29  THR A O   1 
ATOM   233  C  CB  . THR A 1 30  ? -20.969 30.154  17.656  1.00  26.51 ? 29  THR A CB  1 
ATOM   234  O  OG1 . THR A 1 30  ? -21.127 30.053  19.079  1.00  26.81 ? 29  THR A OG1 1 
ATOM   235  C  CG2 . THR A 1 30  ? -22.046 29.327  16.940  1.00  25.75 ? 29  THR A CG2 1 
ATOM   236  N  N   . LYS A 1 31  ? -17.818 29.969  18.967  1.00  25.65 ? 30  LYS A N   1 
ATOM   237  C  CA  . LYS A 1 31  ? -16.847 30.720  19.741  1.00  25.97 ? 30  LYS A CA  1 
ATOM   238  C  C   . LYS A 1 31  ? -15.441 30.219  19.408  1.00  25.97 ? 30  LYS A C   1 
ATOM   239  O  O   . LYS A 1 31  ? -14.640 30.972  18.875  1.00  26.49 ? 30  LYS A O   1 
ATOM   240  C  CB  . LYS A 1 31  ? -17.131 30.659  21.255  1.00  25.52 ? 30  LYS A CB  1 
ATOM   241  C  CG  . LYS A 1 31  ? -18.571 31.047  21.672  1.00  26.50 ? 30  LYS A CG  1 
ATOM   242  C  CD  . LYS A 1 31  ? -18.866 32.506  21.388  1.00  28.57 ? 30  LYS A CD  1 
ATOM   243  C  CE  . LYS A 1 31  ? -20.353 32.800  21.435  1.00  29.99 ? 30  LYS A CE  1 
ATOM   244  N  NZ  . LYS A 1 31  ? -20.546 34.268  21.411  1.00  31.15 ? 30  LYS A NZ  1 
ATOM   245  N  N   . HIS A 1 32  ? -15.162 28.943  19.683  1.00  25.60 ? 31  HIS A N   1 
ATOM   246  C  CA  . HIS A 1 32  ? -13.810 28.401  19.499  1.00  25.52 ? 31  HIS A CA  1 
ATOM   247  C  C   . HIS A 1 32  ? -13.391 28.331  18.030  1.00  24.94 ? 31  HIS A C   1 
ATOM   248  O  O   . HIS A 1 32  ? -12.372 28.918  17.642  1.00  24.66 ? 31  HIS A O   1 
ATOM   249  C  CB  . HIS A 1 32  ? -13.657 27.042  20.183  1.00  25.89 ? 31  HIS A CB  1 
ATOM   250  C  CG  . HIS A 1 32  ? -13.799 27.100  21.676  1.00  26.45 ? 31  HIS A CG  1 
ATOM   251  N  ND1 . HIS A 1 32  ? -12.794 27.548  22.503  1.00  29.64 ? 31  HIS A ND1 1 
ATOM   252  C  CD2 . HIS A 1 32  ? -14.828 26.761  22.488  1.00  28.66 ? 31  HIS A CD2 1 
ATOM   253  C  CE1 . HIS A 1 32  ? -13.197 27.489  23.760  1.00  28.62 ? 31  HIS A CE1 1 
ATOM   254  N  NE2 . HIS A 1 32  ? -14.426 27.009  23.780  1.00  28.07 ? 31  HIS A NE2 1 
ATOM   255  N  N   . HIS A 1 33  ? -14.183 27.640  17.217  1.00  24.37 ? 32  HIS A N   1 
ATOM   256  C  CA  . HIS A 1 33  ? -13.860 27.514  15.803  1.00  24.63 ? 32  HIS A CA  1 
ATOM   257  C  C   . HIS A 1 33  ? -13.849 28.898  15.136  1.00  24.75 ? 32  HIS A C   1 
ATOM   258  O  O   . HIS A 1 33  ? -12.916 29.231  14.406  1.00  24.28 ? 32  HIS A O   1 
ATOM   259  C  CB  . HIS A 1 33  ? -14.808 26.539  15.107  1.00  24.50 ? 32  HIS A CB  1 
ATOM   260  C  CG  . HIS A 1 33  ? -14.383 26.164  13.721  1.00  25.40 ? 32  HIS A CG  1 
ATOM   261  N  ND1 . HIS A 1 33  ? -15.047 25.212  12.980  1.00  26.31 ? 32  HIS A ND1 1 
ATOM   262  C  CD2 . HIS A 1 33  ? -13.367 26.608  12.941  1.00  25.35 ? 32  HIS A CD2 1 
ATOM   263  C  CE1 . HIS A 1 33  ? -14.465 25.089  11.801  1.00  26.37 ? 32  HIS A CE1 1 
ATOM   264  N  NE2 . HIS A 1 33  ? -13.444 25.925  11.750  1.00  26.51 ? 32  HIS A NE2 1 
ATOM   265  N  N   . GLN A 1 34  ? -14.870 29.704  15.417  1.00  24.77 ? 33  GLN A N   1 
ATOM   266  C  CA  . GLN A 1 34  ? -14.947 31.074  14.884  1.00  25.16 ? 33  GLN A CA  1 
ATOM   267  C  C   . GLN A 1 34  ? -13.688 31.890  15.178  1.00  24.95 ? 33  GLN A C   1 
ATOM   268  O  O   . GLN A 1 34  ? -13.196 32.632  14.318  1.00  24.88 ? 33  GLN A O   1 
ATOM   269  C  CB  . GLN A 1 34  ? -16.162 31.802  15.448  1.00  25.13 ? 33  GLN A CB  1 
ATOM   270  C  CG  . GLN A 1 34  ? -16.382 33.192  14.843  1.00  26.72 ? 33  GLN A CG  1 
ATOM   271  C  CD  . GLN A 1 34  ? -16.778 33.121  13.385  1.00  28.62 ? 33  GLN A CD  1 
ATOM   272  O  OE1 . GLN A 1 34  ? -17.887 32.702  13.051  1.00  28.32 ? 33  GLN A OE1 1 
ATOM   273  N  NE2 . GLN A 1 34  ? -15.879 33.543  12.508  1.00  28.48 ? 33  GLN A NE2 1 
ATOM   274  N  N   . THR A 1 35  ? -13.176 31.757  16.398  1.00  25.22 ? 34  THR A N   1 
ATOM   275  C  CA  . THR A 1 35  ? -11.960 32.460  16.791  1.00  25.21 ? 34  THR A CA  1 
ATOM   276  C  C   . THR A 1 35  ? -10.752 32.024  15.953  1.00  24.93 ? 34  THR A C   1 
ATOM   277  O  O   . THR A 1 35  ? -9.946  32.873  15.542  1.00  24.05 ? 34  THR A O   1 
ATOM   278  C  CB  . THR A 1 35  ? -11.698 32.337  18.317  1.00  25.23 ? 34  THR A CB  1 
ATOM   279  O  OG1 . THR A 1 35  ? -12.695 33.103  19.015  1.00  27.37 ? 34  THR A OG1 1 
ATOM   280  C  CG2 . THR A 1 35  ? -10.325 32.888  18.687  1.00  27.69 ? 34  THR A CG2 1 
ATOM   281  N  N   . TYR A 1 36  ? -10.642 30.718  15.682  1.00  24.90 ? 35  TYR A N   1 
ATOM   282  C  CA  . TYR A 1 36  ? -9.565  30.206  14.820  1.00  25.42 ? 35  TYR A CA  1 
ATOM   283  C  C   . TYR A 1 36  ? -9.672  30.773  13.401  1.00  25.25 ? 35  TYR A C   1 
ATOM   284  O  O   . TYR A 1 36  ? -8.666  31.191  12.821  1.00  24.97 ? 35  TYR A O   1 
ATOM   285  C  CB  . TYR A 1 36  ? -9.526  28.668  14.797  1.00  25.94 ? 35  TYR A CB  1 
ATOM   286  C  CG  . TYR A 1 36  ? -9.196  28.048  16.149  1.00  26.18 ? 35  TYR A CG  1 
ATOM   287  C  CD1 . TYR A 1 36  ? -8.127  28.520  16.910  1.00  26.33 ? 35  TYR A CD1 1 
ATOM   288  C  CD2 . TYR A 1 36  ? -9.944  26.992  16.655  1.00  27.24 ? 35  TYR A CD2 1 
ATOM   289  C  CE1 . TYR A 1 36  ? -7.816  27.956  18.151  1.00  27.61 ? 35  TYR A CE1 1 
ATOM   290  C  CE2 . TYR A 1 36  ? -9.655  26.433  17.908  1.00  26.56 ? 35  TYR A CE2 1 
ATOM   291  C  CZ  . TYR A 1 36  ? -8.578  26.910  18.635  1.00  27.51 ? 35  TYR A CZ  1 
ATOM   292  O  OH  . TYR A 1 36  ? -8.281  26.356  19.863  1.00  29.62 ? 35  TYR A OH  1 
ATOM   293  N  N   . VAL A 1 37  ? -10.893 30.820  12.874  1.00  25.23 ? 36  VAL A N   1 
ATOM   294  C  CA  . VAL A 1 37  ? -11.156 31.427  11.559  1.00  25.31 ? 36  VAL A CA  1 
ATOM   295  C  C   . VAL A 1 37  ? -10.730 32.897  11.541  1.00  25.85 ? 36  VAL A C   1 
ATOM   296  O  O   . VAL A 1 37  ? -9.982  33.324  10.660  1.00  25.98 ? 36  VAL A O   1 
ATOM   297  C  CB  . VAL A 1 37  ? -12.648 31.275  11.146  1.00  25.00 ? 36  VAL A CB  1 
ATOM   298  C  CG1 . VAL A 1 37  ? -12.955 32.086  9.888   1.00  24.41 ? 36  VAL A CG1 1 
ATOM   299  C  CG2 . VAL A 1 37  ? -12.969 29.812  10.912  1.00  25.42 ? 36  VAL A CG2 1 
ATOM   300  N  N   . ASP A 1 38  ? -11.197 33.661  12.525  1.00  26.52 ? 37  ASP A N   1 
ATOM   301  C  CA  . ASP A 1 38  ? -10.922 35.100  12.600  1.00  27.09 ? 37  ASP A CA  1 
ATOM   302  C  C   . ASP A 1 38  ? -9.429  35.397  12.663  1.00  27.18 ? 37  ASP A C   1 
ATOM   303  O  O   . ASP A 1 38  ? -8.932  36.274  11.956  1.00  26.77 ? 37  ASP A O   1 
ATOM   304  C  CB  . ASP A 1 38  ? -11.621 35.712  13.818  1.00  27.71 ? 37  ASP A CB  1 
ATOM   305  C  CG  . ASP A 1 38  ? -13.137 35.775  13.663  1.00  28.80 ? 37  ASP A CG  1 
ATOM   306  O  OD1 . ASP A 1 38  ? -13.670 35.466  12.573  1.00  31.81 ? 37  ASP A OD1 1 
ATOM   307  O  OD2 . ASP A 1 38  ? -13.805 36.149  14.649  1.00  31.79 ? 37  ASP A OD2 1 
ATOM   308  N  N   . ASN A 1 39  ? -8.728  34.656  13.517  1.00  27.09 ? 38  ASN A N   1 
ATOM   309  C  CA  . ASN A 1 39  ? -7.305  34.863  13.736  1.00  27.36 ? 38  ASN A CA  1 
ATOM   310  C  C   . ASN A 1 39  ? -6.436  34.377  12.573  1.00  27.34 ? 38  ASN A C   1 
ATOM   311  O  O   . ASN A 1 39  ? -5.413  34.996  12.259  1.00  27.97 ? 38  ASN A O   1 
ATOM   312  C  CB  . ASN A 1 39  ? -6.870  34.235  15.068  1.00  27.18 ? 38  ASN A CB  1 
ATOM   313  C  CG  . ASN A 1 39  ? -7.384  35.008  16.268  1.00  27.88 ? 38  ASN A CG  1 
ATOM   314  O  OD1 . ASN A 1 39  ? -7.730  36.185  16.155  1.00  29.58 ? 38  ASN A OD1 1 
ATOM   315  N  ND2 . ASN A 1 39  ? -7.426  34.358  17.425  1.00  29.07 ? 38  ASN A ND2 1 
ATOM   316  N  N   . ALA A 1 40  ? -6.848  33.296  11.923  1.00  26.95 ? 39  ALA A N   1 
ATOM   317  C  CA  . ALA A 1 40  ? -6.200  32.874  10.685  1.00  26.64 ? 39  ALA A CA  1 
ATOM   318  C  C   . ALA A 1 40  ? -6.367  33.952  9.613   1.00  26.76 ? 39  ALA A C   1 
ATOM   319  O  O   . ALA A 1 40  ? -5.414  34.289  8.913   1.00  26.55 ? 39  ALA A O   1 
ATOM   320  C  CB  . ALA A 1 40  ? -6.759  31.559  10.206  1.00  26.62 ? 39  ALA A CB  1 
ATOM   321  N  N   . ASN A 1 41  ? -7.575  34.499  9.503   1.00  26.53 ? 40  ASN A N   1 
ATOM   322  C  CA  . ASN A 1 41  ? -7.848  35.536  8.514   1.00  26.89 ? 40  ASN A CA  1 
ATOM   323  C  C   . ASN A 1 41  ? -6.976  36.779  8.732   1.00  27.54 ? 40  ASN A C   1 
ATOM   324  O  O   . ASN A 1 41  ? -6.522  37.398  7.768   1.00  27.10 ? 40  ASN A O   1 
ATOM   325  C  CB  . ASN A 1 41  ? -9.337  35.896  8.502   1.00  26.76 ? 40  ASN A CB  1 
ATOM   326  C  CG  . ASN A 1 41  ? -10.195 34.847  7.803   1.00  27.04 ? 40  ASN A CG  1 
ATOM   327  O  OD1 . ASN A 1 41  ? -9.715  34.079  6.966   1.00  26.36 ? 40  ASN A OD1 1 
ATOM   328  N  ND2 . ASN A 1 41  ? -11.479 34.826  8.133   1.00  26.38 ? 40  ASN A ND2 1 
ATOM   329  N  N   . LYS A 1 42  ? -6.718  37.115  9.997   1.00  28.22 ? 41  LYS A N   1 
ATOM   330  C  CA  . LYS A 1 42  ? -5.850  38.243  10.325  1.00  29.69 ? 41  LYS A CA  1 
ATOM   331  C  C   . LYS A 1 42  ? -4.423  38.025  9.852   1.00  29.72 ? 41  LYS A C   1 
ATOM   332  O  O   . LYS A 1 42  ? -3.813  38.929  9.271   1.00  29.56 ? 41  LYS A O   1 
ATOM   333  C  CB  . LYS A 1 42  ? -5.858  38.536  11.823  1.00  30.38 ? 41  LYS A CB  1 
ATOM   334  C  CG  . LYS A 1 42  ? -7.138  39.182  12.314  1.00  33.53 ? 41  LYS A CG  1 
ATOM   335  C  CD  . LYS A 1 42  ? -6.964  39.771  13.719  1.00  37.86 ? 41  LYS A CD  1 
ATOM   336  C  CE  . LYS A 1 42  ? -8.313  39.809  14.441  1.00  39.83 ? 41  LYS A CE  1 
ATOM   337  N  NZ  . LYS A 1 42  ? -8.311  40.767  15.578  1.00  40.67 ? 41  LYS A NZ  1 
ATOM   338  N  N   . ALA A 1 43  ? -3.902  36.829  10.110  1.00  29.95 ? 42  ALA A N   1 
ATOM   339  C  CA  . ALA A 1 43  ? -2.540  36.457  9.737   1.00  30.60 ? 42  ALA A CA  1 
ATOM   340  C  C   . ALA A 1 43  ? -2.355  36.310  8.228   1.00  31.15 ? 42  ALA A C   1 
ATOM   341  O  O   . ALA A 1 43  ? -1.241  36.465  7.723   1.00  31.61 ? 42  ALA A O   1 
ATOM   342  C  CB  . ALA A 1 43  ? -2.129  35.172  10.450  1.00  30.15 ? 42  ALA A CB  1 
ATOM   343  N  N   . LEU A 1 44  ? -3.443  36.026  7.510   1.00  31.53 ? 43  LEU A N   1 
ATOM   344  C  CA  . LEU A 1 44  ? -3.381  35.832  6.059   1.00  32.30 ? 43  LEU A CA  1 
ATOM   345  C  C   . LEU A 1 44  ? -3.615  37.101  5.252   1.00  33.65 ? 43  LEU A C   1 
ATOM   346  O  O   . LEU A 1 44  ? -3.243  37.163  4.080   1.00  33.39 ? 43  LEU A O   1 
ATOM   347  C  CB  . LEU A 1 44  ? -4.367  34.750  5.604   1.00  31.98 ? 43  LEU A CB  1 
ATOM   348  C  CG  . LEU A 1 44  ? -4.075  33.320  6.069   1.00  31.06 ? 43  LEU A CG  1 
ATOM   349  C  CD1 . LEU A 1 44  ? -5.306  32.436  5.896   1.00  29.59 ? 43  LEU A CD1 1 
ATOM   350  C  CD2 . LEU A 1 44  ? -2.881  32.728  5.348   1.00  28.83 ? 43  LEU A CD2 1 
ATOM   351  N  N   . GLU A 1 45  ? -4.233  38.096  5.884   1.00  35.33 ? 44  GLU A N   1 
ATOM   352  C  CA  . GLU A 1 45  ? -4.615  39.354  5.236   1.00  37.13 ? 44  GLU A CA  1 
ATOM   353  C  C   . GLU A 1 45  ? -3.519  39.920  4.327   1.00  37.79 ? 44  GLU A C   1 
ATOM   354  O  O   . GLU A 1 45  ? -3.778  40.231  3.159   1.00  38.28 ? 44  GLU A O   1 
ATOM   355  C  CB  . GLU A 1 45  ? -5.068  40.377  6.296   1.00  37.34 ? 44  GLU A CB  1 
ATOM   356  C  CG  . GLU A 1 45  ? -5.123  41.850  5.850   1.00  39.66 ? 44  GLU A CG  1 
ATOM   357  C  CD  . GLU A 1 45  ? -6.269  42.186  4.885   1.00  42.30 ? 44  GLU A CD  1 
ATOM   358  O  OE1 . GLU A 1 45  ? -7.080  41.296  4.542   1.00  43.69 ? 44  GLU A OE1 1 
ATOM   359  O  OE2 . GLU A 1 45  ? -6.353  43.364  4.466   1.00  43.88 ? 44  GLU A OE2 1 
ATOM   360  N  N   . GLY A 1 46  ? -2.298  40.025  4.846   1.00  38.39 ? 45  GLY A N   1 
ATOM   361  C  CA  . GLY A 1 46  ? -1.197  40.609  4.071   1.00  39.54 ? 45  GLY A CA  1 
ATOM   362  C  C   . GLY A 1 46  ? -0.201  39.596  3.525   1.00  40.04 ? 45  GLY A C   1 
ATOM   363  O  O   . GLY A 1 46  ? 1.012   39.795  3.649   1.00  40.50 ? 45  GLY A O   1 
ATOM   364  N  N   . THR A 1 47  ? -0.706  38.516  2.922   1.00  39.97 ? 46  THR A N   1 
ATOM   365  C  CA  . THR A 1 47  ? 0.147   37.448  2.379   1.00  39.83 ? 46  THR A CA  1 
ATOM   366  C  C   . THR A 1 47  ? -0.369  36.893  1.048   1.00  39.76 ? 46  THR A C   1 
ATOM   367  O  O   . THR A 1 47  ? -1.464  37.240  0.598   1.00  40.01 ? 46  THR A O   1 
ATOM   368  C  CB  . THR A 1 47  ? 0.290   36.261  3.366   1.00  39.88 ? 46  THR A CB  1 
ATOM   369  O  OG1 . THR A 1 47  ? -0.935  35.518  3.408   1.00  39.25 ? 46  THR A OG1 1 
ATOM   370  C  CG2 . THR A 1 47  ? 0.665   36.734  4.773   1.00  40.12 ? 46  THR A CG2 1 
ATOM   371  N  N   . GLU A 1 48  ? 0.427   36.011  0.441   1.00  39.40 ? 47  GLU A N   1 
ATOM   372  C  CA  . GLU A 1 48  ? 0.068   35.332  -0.801  1.00  39.20 ? 47  GLU A CA  1 
ATOM   373  C  C   . GLU A 1 48  ? -0.468  33.929  -0.516  1.00  38.60 ? 47  GLU A C   1 
ATOM   374  O  O   . GLU A 1 48  ? -0.494  33.070  -1.401  1.00  38.45 ? 47  GLU A O   1 
ATOM   375  C  CB  . GLU A 1 48  ? 1.282   35.237  -1.737  1.00  39.62 ? 47  GLU A CB  1 
ATOM   376  C  CG  . GLU A 1 48  ? 1.796   36.575  -2.288  1.00  41.29 ? 47  GLU A CG  1 
ATOM   377  C  CD  . GLU A 1 48  ? 2.502   37.421  -1.231  1.00  43.85 ? 47  GLU A CD  1 
ATOM   378  O  OE1 . GLU A 1 48  ? 2.925   36.858  -0.194  1.00  45.00 ? 47  GLU A OE1 1 
ATOM   379  O  OE2 . GLU A 1 48  ? 2.629   38.649  -1.436  1.00  44.63 ? 47  GLU A OE2 1 
ATOM   380  N  N   . PHE A 1 49  ? -0.892  33.707  0.727   1.00  37.76 ? 48  PHE A N   1 
ATOM   381  C  CA  . PHE A 1 49  ? -1.342  32.389  1.176   1.00  37.08 ? 48  PHE A CA  1 
ATOM   382  C  C   . PHE A 1 49  ? -2.850  32.341  1.415   1.00  36.72 ? 48  PHE A C   1 
ATOM   383  O  O   . PHE A 1 49  ? -3.402  31.293  1.752   1.00  36.45 ? 48  PHE A O   1 
ATOM   384  C  CB  . PHE A 1 49  ? -0.569  31.974  2.433   1.00  36.97 ? 48  PHE A CB  1 
ATOM   385  C  CG  . PHE A 1 49  ? 0.906   31.776  2.199   1.00  36.69 ? 48  PHE A CG  1 
ATOM   386  C  CD1 . PHE A 1 49  ? 1.392   30.556  1.735   1.00  36.98 ? 48  PHE A CD1 1 
ATOM   387  C  CD2 . PHE A 1 49  ? 1.807   32.811  2.434   1.00  36.74 ? 48  PHE A CD2 1 
ATOM   388  C  CE1 . PHE A 1 49  ? 2.760   30.372  1.506   1.00  37.41 ? 48  PHE A CE1 1 
ATOM   389  C  CE2 . PHE A 1 49  ? 3.173   32.637  2.214   1.00  36.64 ? 48  PHE A CE2 1 
ATOM   390  C  CZ  . PHE A 1 49  ? 3.649   31.412  1.749   1.00  36.68 ? 48  PHE A CZ  1 
ATOM   391  N  N   . ALA A 1 50  ? -3.508  33.479  1.204   1.00  36.48 ? 49  ALA A N   1 
ATOM   392  C  CA  . ALA A 1 50  ? -4.941  33.626  1.448   1.00  36.51 ? 49  ALA A CA  1 
ATOM   393  C  C   . ALA A 1 50  ? -5.824  32.797  0.508   1.00  36.62 ? 49  ALA A C   1 
ATOM   394  O  O   . ALA A 1 50  ? -6.975  32.514  0.831   1.00  36.84 ? 49  ALA A O   1 
ATOM   395  C  CB  . ALA A 1 50  ? -5.331  35.099  1.392   1.00  36.36 ? 49  ALA A CB  1 
ATOM   396  N  N   . ASP A 1 51  ? -5.283  32.398  -0.642  1.00  36.56 ? 50  ASP A N   1 
ATOM   397  C  CA  . ASP A 1 51  ? -6.058  31.653  -1.636  1.00  36.72 ? 50  ASP A CA  1 
ATOM   398  C  C   . ASP A 1 51  ? -5.931  30.127  -1.549  1.00  36.27 ? 50  ASP A C   1 
ATOM   399  O  O   . ASP A 1 51  ? -6.629  29.407  -2.264  1.00  36.48 ? 50  ASP A O   1 
ATOM   400  C  CB  . ASP A 1 51  ? -5.724  32.148  -3.048  1.00  36.89 ? 50  ASP A CB  1 
ATOM   401  C  CG  . ASP A 1 51  ? -6.210  33.571  -3.299  1.00  38.55 ? 50  ASP A CG  1 
ATOM   402  O  OD1 . ASP A 1 51  ? -7.156  34.022  -2.610  1.00  40.61 ? 50  ASP A OD1 1 
ATOM   403  O  OD2 . ASP A 1 51  ? -5.645  34.243  -4.188  1.00  40.43 ? 50  ASP A OD2 1 
ATOM   404  N  N   . LEU A 1 52  ? -5.059  29.632  -0.673  1.00  35.74 ? 51  LEU A N   1 
ATOM   405  C  CA  . LEU A 1 52  ? -4.879  28.184  -0.522  1.00  35.41 ? 51  LEU A CA  1 
ATOM   406  C  C   . LEU A 1 52  ? -6.000  27.555  0.294   1.00  34.75 ? 51  LEU A C   1 
ATOM   407  O  O   . LEU A 1 52  ? -6.458  28.148  1.277   1.00  34.72 ? 51  LEU A O   1 
ATOM   408  C  CB  . LEU A 1 52  ? -3.535  27.859  0.134   1.00  35.60 ? 51  LEU A CB  1 
ATOM   409  C  CG  . LEU A 1 52  ? -2.248  28.033  -0.675  1.00  36.12 ? 51  LEU A CG  1 
ATOM   410  C  CD1 . LEU A 1 52  ? -1.049  27.916  0.251   1.00  36.95 ? 51  LEU A CD1 1 
ATOM   411  C  CD2 . LEU A 1 52  ? -2.169  27.002  -1.792  1.00  37.69 ? 51  LEU A CD2 1 
ATOM   412  N  N   . PRO A 1 53  ? -6.460  26.354  -0.110  1.00  34.33 ? 52  PRO A N   1 
ATOM   413  C  CA  . PRO A 1 53  ? -7.306  25.605  0.811   1.00  34.00 ? 52  PRO A CA  1 
ATOM   414  C  C   . PRO A 1 53  ? -6.537  25.420  2.121   1.00  33.69 ? 52  PRO A C   1 
ATOM   415  O  O   . PRO A 1 53  ? -5.307  25.289  2.093   1.00  33.06 ? 52  PRO A O   1 
ATOM   416  C  CB  . PRO A 1 53  ? -7.490  24.260  0.104   1.00  34.17 ? 52  PRO A CB  1 
ATOM   417  C  CG  . PRO A 1 53  ? -7.305  24.556  -1.330  1.00  34.49 ? 52  PRO A CG  1 
ATOM   418  C  CD  . PRO A 1 53  ? -6.260  25.637  -1.384  1.00  34.29 ? 52  PRO A CD  1 
ATOM   419  N  N   . VAL A 1 54  ? -7.247  25.432  3.246   1.00  33.16 ? 53  VAL A N   1 
ATOM   420  C  CA  . VAL A 1 54  ? -6.594  25.373  4.555   1.00  33.29 ? 53  VAL A CA  1 
ATOM   421  C  C   . VAL A 1 54  ? -5.715  24.123  4.705   1.00  33.56 ? 53  VAL A C   1 
ATOM   422  O  O   . VAL A 1 54  ? -4.610  24.200  5.245   1.00  33.36 ? 53  VAL A O   1 
ATOM   423  C  CB  . VAL A 1 54  ? -7.611  25.538  5.734   1.00  33.13 ? 53  VAL A CB  1 
ATOM   424  C  CG1 . VAL A 1 54  ? -8.503  24.297  5.900   1.00  32.96 ? 53  VAL A CG1 1 
ATOM   425  C  CG2 . VAL A 1 54  ? -6.892  25.873  7.028   1.00  32.52 ? 53  VAL A CG2 1 
ATOM   426  N  N   . GLU A 1 55  ? -6.187  22.988  4.184   1.00  33.88 ? 54  GLU A N   1 
ATOM   427  C  CA  . GLU A 1 55  ? -5.446  21.727  4.298   1.00  34.65 ? 54  GLU A CA  1 
ATOM   428  C  C   . GLU A 1 55  ? -4.132  21.736  3.507   1.00  34.42 ? 54  GLU A C   1 
ATOM   429  O  O   . GLU A 1 55  ? -3.221  20.965  3.810   1.00  34.87 ? 54  GLU A O   1 
ATOM   430  C  CB  . GLU A 1 55  ? -6.324  20.514  3.941   1.00  34.82 ? 54  GLU A CB  1 
ATOM   431  C  CG  . GLU A 1 55  ? -6.654  20.357  2.454   1.00  36.21 ? 54  GLU A CG  1 
ATOM   432  C  CD  . GLU A 1 55  ? -7.900  21.131  2.016   1.00  37.56 ? 54  GLU A CD  1 
ATOM   433  O  OE1 . GLU A 1 55  ? -8.343  22.046  2.761   1.00  36.49 ? 54  GLU A OE1 1 
ATOM   434  O  OE2 . GLU A 1 55  ? -8.429  20.818  0.916   1.00  36.37 ? 54  GLU A OE2 1 
ATOM   435  N  N   . GLN A 1 56  ? -4.039  22.608  2.504   1.00  34.16 ? 55  GLN A N   1 
ATOM   436  C  CA  . GLN A 1 56  ? -2.796  22.808  1.770   1.00  34.08 ? 55  GLN A CA  1 
ATOM   437  C  C   . GLN A 1 56  ? -1.898  23.799  2.505   1.00  33.34 ? 55  GLN A C   1 
ATOM   438  O  O   . GLN A 1 56  ? -0.686  23.610  2.571   1.00  32.96 ? 55  GLN A O   1 
ATOM   439  C  CB  . GLN A 1 56  ? -3.069  23.306  0.346   1.00  34.43 ? 55  GLN A CB  1 
ATOM   440  C  CG  . GLN A 1 56  ? -3.889  22.328  -0.497  1.00  36.88 ? 55  GLN A CG  1 
ATOM   441  C  CD  . GLN A 1 56  ? -3.211  20.975  -0.653  1.00  40.40 ? 55  GLN A CD  1 
ATOM   442  O  OE1 . GLN A 1 56  ? -2.073  20.892  -1.115  1.00  43.00 ? 55  GLN A OE1 1 
ATOM   443  N  NE2 . GLN A 1 56  ? -3.913  19.908  -0.275  1.00  42.21 ? 55  GLN A NE2 1 
ATOM   444  N  N   . LEU A 1 57  ? -2.503  24.852  3.049   1.00  32.60 ? 56  LEU A N   1 
ATOM   445  C  CA  . LEU A 1 57  ? -1.751  25.875  3.774   1.00  32.36 ? 56  LEU A CA  1 
ATOM   446  C  C   . LEU A 1 57  ? -0.954  25.251  4.918   1.00  32.14 ? 56  LEU A C   1 
ATOM   447  O  O   . LEU A 1 57  ? 0.241   25.519  5.060   1.00  31.88 ? 56  LEU A O   1 
ATOM   448  C  CB  . LEU A 1 57  ? -2.670  26.978  4.306   1.00  32.21 ? 56  LEU A CB  1 
ATOM   449  C  CG  . LEU A 1 57  ? -1.958  28.050  5.139   1.00  32.09 ? 56  LEU A CG  1 
ATOM   450  C  CD1 . LEU A 1 57  ? -1.111  28.967  4.265   1.00  31.69 ? 56  LEU A CD1 1 
ATOM   451  C  CD2 . LEU A 1 57  ? -2.941  28.850  5.948   1.00  33.18 ? 56  LEU A CD2 1 
ATOM   452  N  N   . ILE A 1 58  ? -1.606  24.395  5.707   1.00  31.78 ? 57  ILE A N   1 
ATOM   453  C  CA  . ILE A 1 58  ? -0.943  23.782  6.868   1.00  32.02 ? 57  ILE A CA  1 
ATOM   454  C  C   . ILE A 1 58  ? 0.184   22.826  6.469   1.00  32.10 ? 57  ILE A C   1 
ATOM   455  O  O   . ILE A 1 58  ? 1.020   22.480  7.298   1.00  32.40 ? 57  ILE A O   1 
ATOM   456  C  CB  . ILE A 1 58  ? -1.930  23.093  7.853   1.00  31.91 ? 57  ILE A CB  1 
ATOM   457  C  CG1 . ILE A 1 58  ? -2.671  21.916  7.188   1.00  31.21 ? 57  ILE A CG1 1 
ATOM   458  C  CG2 . ILE A 1 58  ? -2.891  24.126  8.462   1.00  32.05 ? 57  ILE A CG2 1 
ATOM   459  C  CD1 . ILE A 1 58  ? -3.354  20.963  8.187   1.00  31.66 ? 57  ILE A CD1 1 
ATOM   460  N  N   . GLN A 1 59  ? 0.196   22.413  5.201   1.00  32.58 ? 58  GLN A N   1 
ATOM   461  C  CA  . GLN A 1 59  ? 1.285   21.607  4.655   1.00  33.24 ? 58  GLN A CA  1 
ATOM   462  C  C   . GLN A 1 59  ? 2.442   22.471  4.153   1.00  34.04 ? 58  GLN A C   1 
ATOM   463  O  O   . GLN A 1 59  ? 3.494   21.946  3.786   1.00  34.12 ? 58  GLN A O   1 
ATOM   464  C  CB  . GLN A 1 59  ? 0.779   20.686  3.538   1.00  33.27 ? 58  GLN A CB  1 
ATOM   465  C  CG  . GLN A 1 59  ? -0.268  19.681  4.003   1.00  32.53 ? 58  GLN A CG  1 
ATOM   466  C  CD  . GLN A 1 59  ? -0.740  18.768  2.883   1.00  33.04 ? 58  GLN A CD  1 
ATOM   467  O  OE1 . GLN A 1 59  ? 0.019   17.949  2.376   1.00  34.33 ? 58  GLN A OE1 1 
ATOM   468  N  NE2 . GLN A 1 59  ? -1.994  18.914  2.491   1.00  32.20 ? 58  GLN A NE2 1 
ATOM   469  N  N   . GLN A 1 60  ? 2.248   23.789  4.162   1.00  34.99 ? 59  GLN A N   1 
ATOM   470  C  CA  . GLN A 1 60  ? 3.226   24.734  3.616   1.00  36.17 ? 59  GLN A CA  1 
ATOM   471  C  C   . GLN A 1 60  ? 3.749   25.757  4.637   1.00  36.12 ? 59  GLN A C   1 
ATOM   472  O  O   . GLN A 1 60  ? 4.178   26.853  4.258   1.00  36.21 ? 59  GLN A O   1 
ATOM   473  C  CB  . GLN A 1 60  ? 2.625   25.469  2.409   1.00  36.21 ? 59  GLN A CB  1 
ATOM   474  C  CG  . GLN A 1 60  ? 2.232   24.568  1.247   1.00  37.36 ? 59  GLN A CG  1 
ATOM   475  C  CD  . GLN A 1 60  ? 1.793   25.338  0.008   1.00  37.94 ? 59  GLN A CD  1 
ATOM   476  O  OE1 . GLN A 1 60  ? 2.281   26.436  -0.269  1.00  39.55 ? 59  GLN A OE1 1 
ATOM   477  N  NE2 . GLN A 1 60  ? 0.873   24.750  -0.755  1.00  40.67 ? 59  GLN A NE2 1 
ATOM   478  N  N   . LEU A 1 61  ? 3.754   25.393  5.916   1.00  36.17 ? 60  LEU A N   1 
ATOM   479  C  CA  . LEU A 1 61  ? 4.038   26.352  6.997   1.00  36.64 ? 60  LEU A CA  1 
ATOM   480  C  C   . LEU A 1 61  ? 5.479   26.895  7.047   1.00  37.22 ? 60  LEU A C   1 
ATOM   481  O  O   . LEU A 1 61  ? 5.716   27.951  7.638   1.00  37.39 ? 60  LEU A O   1 
ATOM   482  C  CB  . LEU A 1 61  ? 3.597   25.798  8.366   1.00  36.47 ? 60  LEU A CB  1 
ATOM   483  C  CG  . LEU A 1 61  ? 2.089   25.704  8.657   1.00  35.99 ? 60  LEU A CG  1 
ATOM   484  C  CD1 . LEU A 1 61  ? 1.826   24.898  9.918   1.00  35.43 ? 60  LEU A CD1 1 
ATOM   485  C  CD2 . LEU A 1 61  ? 1.427   27.080  8.759   1.00  36.44 ? 60  LEU A CD2 1 
ATOM   486  N  N   . ASP A 1 62  ? 6.430   26.196  6.422   1.00  37.78 ? 61  ASP A N   1 
ATOM   487  C  CA  . ASP A 1 62  ? 7.800   26.706  6.313   1.00  38.35 ? 61  ASP A CA  1 
ATOM   488  C  C   . ASP A 1 62  ? 7.899   27.860  5.314   1.00  38.10 ? 61  ASP A C   1 
ATOM   489  O  O   . ASP A 1 62  ? 8.750   28.740  5.457   1.00  38.07 ? 61  ASP A O   1 
ATOM   490  C  CB  . ASP A 1 62  ? 8.778   25.601  5.899   1.00  39.02 ? 61  ASP A CB  1 
ATOM   491  C  CG  . ASP A 1 62  ? 8.961   24.540  6.968   1.00  40.90 ? 61  ASP A CG  1 
ATOM   492  O  OD1 . ASP A 1 62  ? 8.671   24.801  8.163   1.00  42.56 ? 61  ASP A OD1 1 
ATOM   493  O  OD2 . ASP A 1 62  ? 9.405   23.430  6.605   1.00  43.47 ? 61  ASP A OD2 1 
ATOM   494  N  N   . ARG A 1 63  ? 7.030   27.836  4.307   1.00  37.63 ? 62  ARG A N   1 
ATOM   495  C  CA  . ARG A 1 63  ? 6.972   28.865  3.265   1.00  37.15 ? 62  ARG A CA  1 
ATOM   496  C  C   . ARG A 1 63  ? 6.543   30.239  3.789   1.00  36.40 ? 62  ARG A C   1 
ATOM   497  O  O   . ARG A 1 63  ? 6.934   31.267  3.242   1.00  35.80 ? 62  ARG A O   1 
ATOM   498  C  CB  . ARG A 1 63  ? 5.982   28.446  2.179   1.00  37.41 ? 62  ARG A CB  1 
ATOM   499  C  CG  . ARG A 1 63  ? 6.362   27.220  1.358   1.00  38.97 ? 62  ARG A CG  1 
ATOM   500  C  CD  . ARG A 1 63  ? 5.446   27.126  0.144   1.00  40.62 ? 62  ARG A CD  1 
ATOM   501  N  NE  . ARG A 1 63  ? 5.469   28.375  -0.621  1.00  41.80 ? 62  ARG A NE  1 
ATOM   502  C  CZ  . ARG A 1 63  ? 4.443   28.878  -1.307  1.00  42.88 ? 62  ARG A CZ  1 
ATOM   503  N  NH1 . ARG A 1 63  ? 3.272   28.253  -1.341  1.00  43.91 ? 62  ARG A NH1 1 
ATOM   504  N  NH2 . ARG A 1 63  ? 4.587   30.024  -1.960  1.00  43.76 ? 62  ARG A NH2 1 
ATOM   505  N  N   . VAL A 1 64  ? 5.723   30.247  4.837   1.00  35.72 ? 63  VAL A N   1 
ATOM   506  C  CA  . VAL A 1 64  ? 5.126   31.483  5.346   1.00  35.29 ? 63  VAL A CA  1 
ATOM   507  C  C   . VAL A 1 64  ? 6.166   32.346  6.082   1.00  34.80 ? 63  VAL A C   1 
ATOM   508  O  O   . VAL A 1 64  ? 7.146   31.812  6.605   1.00  34.43 ? 63  VAL A O   1 
ATOM   509  C  CB  . VAL A 1 64  ? 3.888   31.200  6.253   1.00  35.16 ? 63  VAL A CB  1 
ATOM   510  C  CG1 . VAL A 1 64  ? 2.940   30.180  5.599   1.00  34.96 ? 63  VAL A CG1 1 
ATOM   511  C  CG2 . VAL A 1 64  ? 4.313   30.721  7.626   1.00  35.58 ? 63  VAL A CG2 1 
ATOM   512  N  N   . PRO A 1 65  ? 5.960   33.679  6.119   1.00  34.84 ? 64  PRO A N   1 
ATOM   513  C  CA  . PRO A 1 65  ? 6.884   34.541  6.867   1.00  34.71 ? 64  PRO A CA  1 
ATOM   514  C  C   . PRO A 1 65  ? 7.044   34.064  8.313   1.00  34.76 ? 64  PRO A C   1 
ATOM   515  O  O   . PRO A 1 65  ? 6.056   33.660  8.943   1.00  34.44 ? 64  PRO A O   1 
ATOM   516  C  CB  . PRO A 1 65  ? 6.199   35.913  6.823   1.00  34.89 ? 64  PRO A CB  1 
ATOM   517  C  CG  . PRO A 1 65  ? 5.361   35.878  5.591   1.00  34.84 ? 64  PRO A CG  1 
ATOM   518  C  CD  . PRO A 1 65  ? 4.878   34.455  5.480   1.00  34.91 ? 64  PRO A CD  1 
ATOM   519  N  N   . ALA A 1 66  ? 8.277   34.095  8.821   1.00  34.70 ? 65  ALA A N   1 
ATOM   520  C  CA  . ALA A 1 66  ? 8.602   33.569  10.157  1.00  35.10 ? 65  ALA A CA  1 
ATOM   521  C  C   . ALA A 1 66  ? 7.736   34.174  11.264  1.00  35.21 ? 65  ALA A C   1 
ATOM   522  O  O   . ALA A 1 66  ? 7.400   33.503  12.243  1.00  35.27 ? 65  ALA A O   1 
ATOM   523  C  CB  . ALA A 1 66  ? 10.088  33.773  10.470  1.00  35.05 ? 65  ALA A CB  1 
ATOM   524  N  N   . ASP A 1 67  ? 7.374   35.442  11.091  1.00  35.40 ? 66  ASP A N   1 
ATOM   525  C  CA  . ASP A 1 67  ? 6.552   36.156  12.067  1.00  35.61 ? 66  ASP A CA  1 
ATOM   526  C  C   . ASP A 1 67  ? 5.079   35.727  12.056  1.00  34.95 ? 66  ASP A C   1 
ATOM   527  O  O   . ASP A 1 67  ? 4.360   35.973  13.023  1.00  35.11 ? 66  ASP A O   1 
ATOM   528  C  CB  . ASP A 1 67  ? 6.679   37.674  11.875  1.00  35.93 ? 66  ASP A CB  1 
ATOM   529  C  CG  . ASP A 1 67  ? 6.617   38.086  10.413  1.00  38.10 ? 66  ASP A CG  1 
ATOM   530  O  OD1 . ASP A 1 67  ? 7.690   38.159  9.758   1.00  39.91 ? 66  ASP A OD1 1 
ATOM   531  O  OD2 . ASP A 1 67  ? 5.498   38.353  9.924   1.00  39.67 ? 66  ASP A OD2 1 
ATOM   532  N  N   . LYS A 1 68  ? 4.643   35.081  10.974  1.00  34.43 ? 67  LYS A N   1 
ATOM   533  C  CA  . LYS A 1 68  ? 3.263   34.580  10.849  1.00  33.85 ? 67  LYS A CA  1 
ATOM   534  C  C   . LYS A 1 68  ? 3.154   33.080  11.133  1.00  33.14 ? 67  LYS A C   1 
ATOM   535  O  O   . LYS A 1 68  ? 2.048   32.554  11.289  1.00  32.77 ? 67  LYS A O   1 
ATOM   536  C  CB  . LYS A 1 68  ? 2.711   34.834  9.436   1.00  34.02 ? 67  LYS A CB  1 
ATOM   537  C  CG  . LYS A 1 68  ? 2.730   36.278  8.954   1.00  35.31 ? 67  LYS A CG  1 
ATOM   538  C  CD  . LYS A 1 68  ? 1.461   37.029  9.323   1.00  36.84 ? 67  LYS A CD  1 
ATOM   539  C  CE  . LYS A 1 68  ? 1.344   38.315  8.506   1.00  37.79 ? 67  LYS A CE  1 
ATOM   540  N  NZ  . LYS A 1 68  ? -0.005  38.946  8.594   1.00  37.59 ? 67  LYS A NZ  1 
ATOM   541  N  N   . LYS A 1 69  ? 4.296   32.396  11.185  1.00  32.52 ? 68  LYS A N   1 
ATOM   542  C  CA  . LYS A 1 69  ? 4.319   30.933  11.259  1.00  32.29 ? 68  LYS A CA  1 
ATOM   543  C  C   . LYS A 1 69  ? 3.526   30.395  12.446  1.00  31.78 ? 68  LYS A C   1 
ATOM   544  O  O   . LYS A 1 69  ? 2.672   29.525  12.269  1.00  31.43 ? 68  LYS A O   1 
ATOM   545  C  CB  . LYS A 1 69  ? 5.755   30.383  11.258  1.00  32.25 ? 68  LYS A CB  1 
ATOM   546  C  CG  . LYS A 1 69  ? 5.812   28.863  11.246  1.00  32.63 ? 68  LYS A CG  1 
ATOM   547  C  CD  . LYS A 1 69  ? 7.214   28.321  11.036  1.00  33.08 ? 68  LYS A CD  1 
ATOM   548  C  CE  . LYS A 1 69  ? 7.202   26.799  11.118  1.00  35.59 ? 68  LYS A CE  1 
ATOM   549  N  NZ  . LYS A 1 69  ? 8.422   26.201  10.514  1.00  37.57 ? 68  LYS A NZ  1 
ATOM   550  N  N   . GLY A 1 70  ? 3.797   30.933  13.636  1.00  31.24 ? 69  GLY A N   1 
ATOM   551  C  CA  . GLY A 1 70  ? 3.134   30.494  14.864  1.00  31.04 ? 69  GLY A CA  1 
ATOM   552  C  C   . GLY A 1 70  ? 1.632   30.702  14.824  1.00  30.48 ? 69  GLY A C   1 
ATOM   553  O  O   . GLY A 1 70  ? 0.863   29.797  15.156  1.00  30.05 ? 69  GLY A O   1 
ATOM   554  N  N   . ALA A 1 71  ? 1.227   31.898  14.394  1.00  30.19 ? 70  ALA A N   1 
ATOM   555  C  CA  . ALA A 1 71  ? -0.185  32.266  14.279  1.00  29.79 ? 70  ALA A CA  1 
ATOM   556  C  C   . ALA A 1 71  ? -0.928  31.361  13.304  1.00  29.36 ? 70  ALA A C   1 
ATOM   557  O  O   . ALA A 1 71  ? -2.064  30.976  13.555  1.00  28.85 ? 70  ALA A O   1 
ATOM   558  C  CB  . ALA A 1 71  ? -0.322  33.725  13.859  1.00  29.78 ? 70  ALA A CB  1 
ATOM   559  N  N   . LEU A 1 72  ? -0.275  31.008  12.201  1.00  29.03 ? 71  LEU A N   1 
ATOM   560  C  CA  . LEU A 1 72  ? -0.906  30.169  11.195  1.00  29.08 ? 71  LEU A CA  1 
ATOM   561  C  C   . LEU A 1 72  ? -0.928  28.713  11.608  1.00  29.07 ? 71  LEU A C   1 
ATOM   562  O  O   . LEU A 1 72  ? -1.938  28.043  11.429  1.00  29.48 ? 71  LEU A O   1 
ATOM   563  C  CB  . LEU A 1 72  ? -0.255  30.340  9.825   1.00  28.95 ? 71  LEU A CB  1 
ATOM   564  C  CG  . LEU A 1 72  ? -0.559  31.659  9.101   1.00  29.35 ? 71  LEU A CG  1 
ATOM   565  C  CD1 . LEU A 1 72  ? 0.184   31.705  7.787   1.00  29.10 ? 71  LEU A CD1 1 
ATOM   566  C  CD2 . LEU A 1 72  ? -2.050  31.830  8.868   1.00  28.59 ? 71  LEU A CD2 1 
ATOM   567  N  N   . ARG A 1 73  ? 0.179   28.227  12.161  1.00  28.75 ? 72  ARG A N   1 
ATOM   568  C  CA  . ARG A 1 73  ? 0.202   26.912  12.806  1.00  28.63 ? 72  ARG A CA  1 
ATOM   569  C  C   . ARG A 1 73  ? -0.986  26.711  13.761  1.00  28.64 ? 72  ARG A C   1 
ATOM   570  O  O   . ARG A 1 73  ? -1.701  25.709  13.683  1.00  28.47 ? 72  ARG A O   1 
ATOM   571  C  CB  . ARG A 1 73  ? 1.519   26.734  13.566  1.00  29.00 ? 72  ARG A CB  1 
ATOM   572  C  CG  . ARG A 1 73  ? 1.608   25.457  14.378  1.00  29.89 ? 72  ARG A CG  1 
ATOM   573  C  CD  . ARG A 1 73  ? 2.897   25.444  15.154  1.00  31.33 ? 72  ARG A CD  1 
ATOM   574  N  NE  . ARG A 1 73  ? 3.036   24.234  15.957  1.00  31.94 ? 72  ARG A NE  1 
ATOM   575  C  CZ  . ARG A 1 73  ? 4.189   23.824  16.473  1.00  32.96 ? 72  ARG A CZ  1 
ATOM   576  N  NH1 . ARG A 1 73  ? 5.284   24.530  16.266  1.00  31.72 ? 72  ARG A NH1 1 
ATOM   577  N  NH2 . ARG A 1 73  ? 4.247   22.711  17.192  1.00  33.88 ? 72  ARG A NH2 1 
ATOM   578  N  N   . ASN A 1 74  ? -1.190  27.672  14.662  1.00  28.03 ? 73  ASN A N   1 
ATOM   579  C  CA  . ASN A 1 74  ? -2.245  27.569  15.670  1.00  27.28 ? 73  ASN A CA  1 
ATOM   580  C  C   . ASN A 1 74  ? -3.651  27.751  15.116  1.00  27.50 ? 73  ASN A C   1 
ATOM   581  O  O   . ASN A 1 74  ? -4.557  26.975  15.440  1.00  27.06 ? 73  ASN A O   1 
ATOM   582  C  CB  . ASN A 1 74  ? -2.003  28.573  16.798  1.00  27.19 ? 73  ASN A CB  1 
ATOM   583  C  CG  . ASN A 1 74  ? -0.785  28.238  17.620  1.00  28.10 ? 73  ASN A CG  1 
ATOM   584  O  OD1 . ASN A 1 74  ? -0.310  27.101  17.607  1.00  28.88 ? 73  ASN A OD1 1 
ATOM   585  N  ND2 . ASN A 1 74  ? -0.268  29.226  18.354  1.00  27.77 ? 73  ASN A ND2 1 
ATOM   586  N  N   . ASN A 1 75  ? -3.830  28.775  14.288  1.00  26.91 ? 74  ASN A N   1 
ATOM   587  C  CA  . ASN A 1 75  ? -5.169  29.172  13.843  1.00  27.26 ? 74  ASN A CA  1 
ATOM   588  C  C   . ASN A 1 75  ? -5.621  28.513  12.557  1.00  27.06 ? 74  ASN A C   1 
ATOM   589  O  O   . ASN A 1 75  ? -6.777  28.069  12.450  1.00  27.50 ? 74  ASN A O   1 
ATOM   590  C  CB  . ASN A 1 75  ? -5.257  30.696  13.759  1.00  27.54 ? 74  ASN A CB  1 
ATOM   591  C  CG  . ASN A 1 75  ? -5.118  31.332  15.110  1.00  27.64 ? 74  ASN A CG  1 
ATOM   592  O  OD1 . ASN A 1 75  ? -5.980  31.147  15.970  1.00  29.58 ? 74  ASN A OD1 1 
ATOM   593  N  ND2 . ASN A 1 75  ? -4.019  32.061  15.326  1.00  27.46 ? 74  ASN A ND2 1 
ATOM   594  N  N   . ALA A 1 76  ? -4.722  28.433  11.581  1.00  26.67 ? 75  ALA A N   1 
ATOM   595  C  CA  . ALA A 1 76  ? -4.994  27.613  10.394  1.00  26.15 ? 75  ALA A CA  1 
ATOM   596  C  C   . ALA A 1 76  ? -5.136  26.138  10.803  1.00  25.83 ? 75  ALA A C   1 
ATOM   597  O  O   . ALA A 1 76  ? -6.039  25.437  10.328  1.00  25.17 ? 75  ALA A O   1 
ATOM   598  C  CB  . ALA A 1 76  ? -3.911  27.790  9.357   1.00  26.67 ? 75  ALA A CB  1 
ATOM   599  N  N   . GLY A 1 77  ? -4.268  25.684  11.711  1.00  25.32 ? 76  GLY A N   1 
ATOM   600  C  CA  . GLY A 1 77  ? -4.380  24.335  12.274  1.00  24.42 ? 76  GLY A CA  1 
ATOM   601  C  C   . GLY A 1 77  ? -5.730  24.150  12.954  1.00  24.55 ? 76  GLY A C   1 
ATOM   602  O  O   . GLY A 1 77  ? -6.429  23.152  12.715  1.00  24.34 ? 76  GLY A O   1 
ATOM   603  N  N   . GLY A 1 78  ? -6.100  25.106  13.806  1.00  23.78 ? 77  GLY A N   1 
ATOM   604  C  CA  . GLY A 1 78  ? -7.417  25.106  14.471  1.00  24.07 ? 77  GLY A CA  1 
ATOM   605  C  C   . GLY A 1 78  ? -8.590  25.013  13.500  1.00  24.49 ? 77  GLY A C   1 
ATOM   606  O  O   . GLY A 1 78  ? -9.552  24.255  13.732  1.00  24.18 ? 77  GLY A O   1 
ATOM   607  N  N   . HIS A 1 79  ? -8.522  25.777  12.416  1.00  24.08 ? 78  HIS A N   1 
ATOM   608  C  CA  . HIS A 1 79  ? -9.593  25.780  11.396  1.00  24.63 ? 78  HIS A CA  1 
ATOM   609  C  C   . HIS A 1 79  ? -9.667  24.439  10.658  1.00  24.33 ? 78  HIS A C   1 
ATOM   610  O  O   . HIS A 1 79  ? -10.750 23.861  10.531  1.00  24.36 ? 78  HIS A O   1 
ATOM   611  C  CB  . HIS A 1 79  ? -9.413  26.971  10.433  1.00  25.08 ? 78  HIS A CB  1 
ATOM   612  C  CG  . HIS A 1 79  ? -10.389 27.000  9.291   1.00  26.63 ? 78  HIS A CG  1 
ATOM   613  N  ND1 . HIS A 1 79  ? -11.742 26.772  9.450   1.00  27.11 ? 78  HIS A ND1 1 
ATOM   614  C  CD2 . HIS A 1 79  ? -10.206 27.263  7.974   1.00  26.88 ? 78  HIS A CD2 1 
ATOM   615  C  CE1 . HIS A 1 79  ? -12.346 26.882  8.279   1.00  27.69 ? 78  HIS A CE1 1 
ATOM   616  N  NE2 . HIS A 1 79  ? -11.436 27.174  7.367   1.00  27.36 ? 78  HIS A NE2 1 
ATOM   617  N  N   . ALA A 1 80  ? -8.518  23.934  10.203  1.00  23.83 ? 79  ALA A N   1 
ATOM   618  C  CA  . ALA A 1 80  ? -8.425  22.612  9.541   1.00  24.37 ? 79  ALA A CA  1 
ATOM   619  C  C   . ALA A 1 80  ? -8.946  21.477  10.420  1.00  24.33 ? 79  ALA A C   1 
ATOM   620  O  O   . ALA A 1 80  ? -9.721  20.626  9.966   1.00  23.94 ? 79  ALA A O   1 
ATOM   621  C  CB  . ALA A 1 80  ? -6.979  22.325  9.117   1.00  24.52 ? 79  ALA A CB  1 
ATOM   622  N  N   . ASN A 1 81  ? -8.525  21.473  11.682  1.00  24.15 ? 80  ASN A N   1 
ATOM   623  C  CA  . ASN A 1 81  ? -8.933  20.432  12.643  1.00  24.08 ? 80  ASN A CA  1 
ATOM   624  C  C   . ASN A 1 81  ? -10.430 20.397  12.901  1.00  24.08 ? 80  ASN A C   1 
ATOM   625  O  O   . ASN A 1 81  ? -11.050 19.335  12.828  1.00  23.52 ? 80  ASN A O   1 
ATOM   626  C  CB  . ASN A 1 81  ? -8.170  20.602  13.971  1.00  24.17 ? 80  ASN A CB  1 
ATOM   627  C  CG  . ASN A 1 81  ? -6.678  20.330  13.829  1.00  24.47 ? 80  ASN A CG  1 
ATOM   628  O  OD1 . ASN A 1 81  ? -6.213  19.856  12.790  1.00  25.26 ? 80  ASN A OD1 1 
ATOM   629  N  ND2 . ASN A 1 81  ? -5.923  20.626  14.882  1.00  25.02 ? 80  ASN A ND2 1 
ATOM   630  N  N   . HIS A 1 82  ? -11.021 21.554  13.197  1.00  23.98 ? 81  HIS A N   1 
ATOM   631  C  CA  . HIS A 1 82  ? -12.442 21.589  13.531  1.00  24.93 ? 81  HIS A CA  1 
ATOM   632  C  C   . HIS A 1 82  ? -13.301 21.355  12.305  1.00  25.17 ? 81  HIS A C   1 
ATOM   633  O  O   . HIS A 1 82  ? -14.340 20.724  12.408  1.00  26.37 ? 81  HIS A O   1 
ATOM   634  C  CB  . HIS A 1 82  ? -12.814 22.895  14.219  1.00  24.80 ? 81  HIS A CB  1 
ATOM   635  C  CG  . HIS A 1 82  ? -12.281 22.988  15.612  1.00  26.16 ? 81  HIS A CG  1 
ATOM   636  N  ND1 . HIS A 1 82  ? -11.007 23.436  15.895  1.00  26.99 ? 81  HIS A ND1 1 
ATOM   637  C  CD2 . HIS A 1 82  ? -12.822 22.623  16.795  1.00  27.07 ? 81  HIS A CD2 1 
ATOM   638  C  CE1 . HIS A 1 82  ? -10.799 23.368  17.200  1.00  28.08 ? 81  HIS A CE1 1 
ATOM   639  N  NE2 . HIS A 1 82  ? -11.887 22.882  17.769  1.00  27.54 ? 81  HIS A NE2 1 
ATOM   640  N  N   . SER A 1 83  ? -12.859 21.857  11.156  1.00  25.77 ? 82  SER A N   1 
ATOM   641  C  CA  . SER A 1 83  ? -13.593 21.639  9.907   1.00  26.73 ? 82  SER A CA  1 
ATOM   642  C  C   . SER A 1 83  ? -13.734 20.143  9.647   1.00  27.00 ? 82  SER A C   1 
ATOM   643  O  O   . SER A 1 83  ? -14.808 19.668  9.291   1.00  27.00 ? 82  SER A O   1 
ATOM   644  C  CB  . SER A 1 83  ? -12.909 22.345  8.739   1.00  26.15 ? 82  SER A CB  1 
ATOM   645  O  OG  . SER A 1 83  ? -12.986 23.751  8.909   1.00  27.80 ? 82  SER A OG  1 
ATOM   646  N  N   . MET A 1 84  ? -12.648 19.399  9.867   1.00  27.10 ? 83  MET A N   1 
ATOM   647  C  CA  . MET A 1 84  ? -12.693 17.938  9.735   1.00  28.33 ? 83  MET A CA  1 
ATOM   648  C  C   . MET A 1 84  ? -13.541 17.272  10.814  1.00  26.64 ? 83  MET A C   1 
ATOM   649  O  O   . MET A 1 84  ? -14.344 16.385  10.518  1.00  25.90 ? 83  MET A O   1 
ATOM   650  C  CB  . MET A 1 84  ? -11.286 17.351  9.763   1.00  28.48 ? 83  MET A CB  1 
ATOM   651  C  CG  . MET A 1 84  ? -11.260 15.878  9.476   1.00  29.57 ? 83  MET A CG  1 
ATOM   652  S  SD  . MET A 1 84  ? -9.686  15.151  9.899   1.00  34.34 ? 83  MET A SD  1 
ATOM   653  C  CE  . MET A 1 84  ? -9.976  13.514  9.304   1.00  31.96 ? 83  MET A CE  1 
ATOM   654  N  N   . PHE A 1 85  ? -13.330 17.681  12.064  1.00  26.11 ? 84  PHE A N   1 
ATOM   655  C  CA  . PHE A 1 85  ? -14.098 17.184  13.213  1.00  25.68 ? 84  PHE A CA  1 
ATOM   656  C  C   . PHE A 1 85  ? -15.609 17.165  12.970  1.00  25.42 ? 84  PHE A C   1 
ATOM   657  O  O   . PHE A 1 85  ? -16.261 16.128  13.173  1.00  24.49 ? 84  PHE A O   1 
ATOM   658  C  CB  . PHE A 1 85  ? -13.739 18.024  14.449  1.00  25.46 ? 84  PHE A CB  1 
ATOM   659  C  CG  . PHE A 1 85  ? -14.196 17.446  15.760  1.00  26.44 ? 84  PHE A CG  1 
ATOM   660  C  CD1 . PHE A 1 85  ? -13.895 16.129  16.117  1.00  26.56 ? 84  PHE A CD1 1 
ATOM   661  C  CD2 . PHE A 1 85  ? -14.887 18.249  16.669  1.00  27.72 ? 84  PHE A CD2 1 
ATOM   662  C  CE1 . PHE A 1 85  ? -14.314 15.615  17.355  1.00  27.57 ? 84  PHE A CE1 1 
ATOM   663  C  CE2 . PHE A 1 85  ? -15.293 17.745  17.915  1.00  27.24 ? 84  PHE A CE2 1 
ATOM   664  C  CZ  . PHE A 1 85  ? -15.004 16.432  18.251  1.00  27.66 ? 84  PHE A CZ  1 
ATOM   665  N  N   . TRP A 1 86  ? -16.178 18.285  12.508  1.00  25.39 ? 85  TRP A N   1 
ATOM   666  C  CA  . TRP A 1 86  ? -17.625 18.319  12.283  1.00  25.59 ? 85  TRP A CA  1 
ATOM   667  C  C   . TRP A 1 86  ? -18.045 17.286  11.246  1.00  25.93 ? 85  TRP A C   1 
ATOM   668  O  O   . TRP A 1 86  ? -19.108 16.687  11.374  1.00  25.53 ? 85  TRP A O   1 
ATOM   669  C  CB  . TRP A 1 86  ? -18.134 19.694  11.858  1.00  25.99 ? 85  TRP A CB  1 
ATOM   670  C  CG  . TRP A 1 86  ? -17.614 20.849  12.678  1.00  27.08 ? 85  TRP A CG  1 
ATOM   671  C  CD1 . TRP A 1 86  ? -17.064 22.002  12.196  1.00  27.84 ? 85  TRP A CD1 1 
ATOM   672  C  CD2 . TRP A 1 86  ? -17.575 20.953  14.112  1.00  27.64 ? 85  TRP A CD2 1 
ATOM   673  N  NE1 . TRP A 1 86  ? -16.701 22.819  13.232  1.00  27.27 ? 85  TRP A NE1 1 
ATOM   674  C  CE2 . TRP A 1 86  ? -16.998 22.203  14.420  1.00  27.72 ? 85  TRP A CE2 1 
ATOM   675  C  CE3 . TRP A 1 86  ? -17.994 20.121  15.165  1.00  29.05 ? 85  TRP A CE3 1 
ATOM   676  C  CZ2 . TRP A 1 86  ? -16.808 22.645  15.742  1.00  27.48 ? 85  TRP A CZ2 1 
ATOM   677  C  CZ3 . TRP A 1 86  ? -17.807 20.559  16.484  1.00  28.09 ? 85  TRP A CZ3 1 
ATOM   678  C  CH2 . TRP A 1 86  ? -17.213 21.810  16.756  1.00  28.28 ? 85  TRP A CH2 1 
ATOM   679  N  N   . GLN A 1 87  ? -17.210 17.082  10.233  1.00  25.80 ? 86  GLN A N   1 
ATOM   680  C  CA  . GLN A 1 87  ? -17.597 16.247  9.099   1.00  27.37 ? 86  GLN A CA  1 
ATOM   681  C  C   . GLN A 1 87  ? -17.482 14.756  9.386   1.00  27.37 ? 86  GLN A C   1 
ATOM   682  O  O   . GLN A 1 87  ? -18.151 13.936  8.732   1.00  28.16 ? 86  GLN A O   1 
ATOM   683  C  CB  . GLN A 1 87  ? -16.790 16.628  7.856   1.00  27.38 ? 86  GLN A CB  1 
ATOM   684  C  CG  . GLN A 1 87  ? -17.096 18.025  7.357   1.00  29.87 ? 86  GLN A CG  1 
ATOM   685  C  CD  . GLN A 1 87  ? -16.316 18.374  6.110   1.00  33.92 ? 86  GLN A CD  1 
ATOM   686  O  OE1 . GLN A 1 87  ? -15.231 17.831  5.861   1.00  35.65 ? 86  GLN A OE1 1 
ATOM   687  N  NE2 . GLN A 1 87  ? -16.863 19.286  5.309   1.00  35.78 ? 86  GLN A NE2 1 
ATOM   688  N  N   . ILE A 1 88  ? -16.665 14.396  10.376  1.00  27.35 ? 87  ILE A N   1 
ATOM   689  C  CA  . ILE A 1 88  ? -16.480 12.975  10.714  1.00  27.18 ? 87  ILE A CA  1 
ATOM   690  C  C   . ILE A 1 88  ? -17.388 12.491  11.849  1.00  27.18 ? 87  ILE A C   1 
ATOM   691  O  O   . ILE A 1 88  ? -17.268 11.351  12.287  1.00  25.93 ? 87  ILE A O   1 
ATOM   692  C  CB  . ILE A 1 88  ? -14.983 12.570  10.975  1.00  27.61 ? 87  ILE A CB  1 
ATOM   693  C  CG1 . ILE A 1 88  ? -14.304 13.433  12.054  1.00  27.27 ? 87  ILE A CG1 1 
ATOM   694  C  CG2 . ILE A 1 88  ? -14.189 12.571  9.653   1.00  27.35 ? 87  ILE A CG2 1 
ATOM   695  C  CD1 . ILE A 1 88  ? -14.740 13.141  13.486  1.00  27.89 ? 87  ILE A CD1 1 
ATOM   696  N  N   . MET A 1 89  ? -18.289 13.362  12.316  1.00  27.16 ? 88  MET A N   1 
ATOM   697  C  CA  . MET A 1 89  ? -19.332 12.956  13.250  1.00  27.99 ? 88  MET A CA  1 
ATOM   698  C  C   . MET A 1 89  ? -20.698 13.030  12.572  1.00  28.09 ? 88  MET A C   1 
ATOM   699  O  O   . MET A 1 89  ? -20.861 13.681  11.537  1.00  28.08 ? 88  MET A O   1 
ATOM   700  C  CB  . MET A 1 89  ? -19.334 13.818  14.522  1.00  26.60 ? 88  MET A CB  1 
ATOM   701  C  CG  . MET A 1 89  ? -18.016 13.836  15.300  1.00  28.50 ? 88  MET A CG  1 
ATOM   702  S  SD  . MET A 1 89  ? -18.221 14.699  16.881  1.00  30.32 ? 88  MET A SD  1 
ATOM   703  C  CE  . MET A 1 89  ? -18.266 16.406  16.348  1.00  29.75 ? 88  MET A CE  1 
ATOM   704  N  N   . GLY A 1 90  ? -21.673 12.348  13.154  1.00  28.74 ? 89  GLY A N   1 
ATOM   705  C  CA  . GLY A 1 90  ? -23.023 12.341  12.612  1.00  29.95 ? 89  GLY A CA  1 
ATOM   706  C  C   . GLY A 1 90  ? -24.043 11.786  13.586  1.00  31.48 ? 89  GLY A C   1 
ATOM   707  O  O   . GLY A 1 90  ? -23.693 11.146  14.580  1.00  30.45 ? 89  GLY A O   1 
ATOM   708  N  N   . GLN A 1 91  ? -25.314 12.033  13.289  1.00  32.99 ? 90  GLN A N   1 
ATOM   709  C  CA  . GLN A 1 91  ? -26.413 11.547  14.116  1.00  35.66 ? 90  GLN A CA  1 
ATOM   710  C  C   . GLN A 1 91  ? -26.925 10.204  13.601  1.00  36.74 ? 90  GLN A C   1 
ATOM   711  O  O   . GLN A 1 91  ? -26.941 9.962   12.387  1.00  36.87 ? 90  GLN A O   1 
ATOM   712  C  CB  . GLN A 1 91  ? -27.571 12.550  14.099  1.00  35.73 ? 90  GLN A CB  1 
ATOM   713  C  CG  . GLN A 1 91  ? -28.801 12.084  14.872  1.00  37.94 ? 90  GLN A CG  1 
ATOM   714  C  CD  . GLN A 1 91  ? -30.047 12.854  14.516  1.00  40.78 ? 90  GLN A CD  1 
ATOM   715  O  OE1 . GLN A 1 91  ? -30.002 14.062  14.254  1.00  42.65 ? 90  GLN A OE1 1 
ATOM   716  N  NE2 . GLN A 1 91  ? -31.178 12.158  14.504  1.00  42.41 ? 90  GLN A NE2 1 
ATOM   717  N  N   . GLY A 1 92  ? -27.377 9.356   14.528  1.00  38.29 ? 91  GLY A N   1 
ATOM   718  C  CA  . GLY A 1 92  ? -28.013 8.078   14.190  1.00  39.71 ? 91  GLY A CA  1 
ATOM   719  C  C   . GLY A 1 92  ? -27.106 7.204   13.348  1.00  40.98 ? 91  GLY A C   1 
ATOM   720  O  O   . GLY A 1 92  ? -27.559 6.553   12.396  1.00  40.96 ? 91  GLY A O   1 
ATOM   721  N  N   . GLN A 1 93  ? -25.822 7.207   13.707  1.00  41.90 ? 92  GLN A N   1 
ATOM   722  C  CA  . GLN A 1 93  ? -24.781 6.481   12.978  1.00  43.13 ? 92  GLN A CA  1 
ATOM   723  C  C   . GLN A 1 93  ? -24.759 5.005   13.358  1.00  43.93 ? 92  GLN A C   1 
ATOM   724  O  O   . GLN A 1 93  ? -24.960 4.652   14.527  1.00  44.44 ? 92  GLN A O   1 
ATOM   725  C  CB  . GLN A 1 93  ? -23.411 7.115   13.244  1.00  43.08 ? 92  GLN A CB  1 
ATOM   726  C  CG  . GLN A 1 93  ? -23.211 8.476   12.580  1.00  43.23 ? 92  GLN A CG  1 
ATOM   727  C  CD  . GLN A 1 93  ? -23.305 8.405   11.062  1.00  44.26 ? 92  GLN A CD  1 
ATOM   728  O  OE1 . GLN A 1 93  ? -22.685 7.546   10.435  1.00  45.11 ? 92  GLN A OE1 1 
ATOM   729  N  NE2 . GLN A 1 93  ? -24.085 9.305   10.466  1.00  43.32 ? 92  GLN A NE2 1 
ATOM   730  N  N   . GLY A 1 94  ? -24.520 4.147   12.368  1.00  44.62 ? 93  GLY A N   1 
ATOM   731  C  CA  . GLY A 1 94  ? -24.393 2.707   12.600  1.00  45.22 ? 93  GLY A CA  1 
ATOM   732  C  C   . GLY A 1 94  ? -25.713 2.023   12.906  1.00  45.84 ? 93  GLY A C   1 
ATOM   733  O  O   . GLY A 1 94  ? -26.789 2.552   12.603  1.00  46.36 ? 93  GLY A O   1 
ATOM   734  N  N   . ALA A 1 98  ? -23.981 -1.655  17.245  1.00  31.93 ? 97  ALA A N   1 
ATOM   735  C  CA  . ALA A 1 98  ? -23.022 -0.623  17.604  1.00  31.36 ? 97  ALA A CA  1 
ATOM   736  C  C   . ALA A 1 98  ? -22.387 -0.014  16.360  1.00  31.18 ? 97  ALA A C   1 
ATOM   737  O  O   . ALA A 1 98  ? -22.202 -0.676  15.336  1.00  31.81 ? 97  ALA A O   1 
ATOM   738  C  CB  . ALA A 1 98  ? -21.950 -1.181  18.529  1.00  31.99 ? 97  ALA A CB  1 
ATOM   739  N  N   . ASN A 1 99  ? -22.050 1.259   16.468  1.00  30.55 ? 98  ASN A N   1 
ATOM   740  C  CA  . ASN A 1 99  ? -21.488 2.016   15.367  1.00  29.56 ? 98  ASN A CA  1 
ATOM   741  C  C   . ASN A 1 99  ? -20.054 1.553   15.097  1.00  29.25 ? 98  ASN A C   1 
ATOM   742  O  O   . ASN A 1 99  ? -19.220 1.541   16.005  1.00  29.17 ? 98  ASN A O   1 
ATOM   743  C  CB  . ASN A 1 99  ? -21.549 3.499   15.738  1.00  29.18 ? 98  ASN A CB  1 
ATOM   744  C  CG  . ASN A 1 99  ? -21.168 4.418   14.597  1.00  27.57 ? 98  ASN A CG  1 
ATOM   745  O  OD1 . ASN A 1 99  ? -21.428 4.138   13.417  1.00  25.41 ? 98  ASN A OD1 1 
ATOM   746  N  ND2 . ASN A 1 99  ? -20.575 5.545   14.949  1.00  26.26 ? 98  ASN A ND2 1 
ATOM   747  N  N   . GLN A 1 100 ? -19.798 1.117   13.863  1.00  29.17 ? 99  GLN A N   1 
ATOM   748  C  CA  . GLN A 1 100 ? -18.463 0.679   13.433  1.00  29.22 ? 99  GLN A CA  1 
ATOM   749  C  C   . GLN A 1 100 ? -18.340 0.720   11.912  1.00  28.53 ? 99  GLN A C   1 
ATOM   750  O  O   . GLN A 1 100 ? -19.350 0.770   11.211  1.00  27.82 ? 99  GLN A O   1 
ATOM   751  C  CB  . GLN A 1 100 ? -18.115 -0.724  13.974  1.00  29.73 ? 99  GLN A CB  1 
ATOM   752  C  CG  . GLN A 1 100 ? -18.893 -1.866  13.390  1.00  30.36 ? 99  GLN A CG  1 
ATOM   753  C  CD  . GLN A 1 100 ? -18.367 -3.228  13.855  1.00  31.14 ? 99  GLN A CD  1 
ATOM   754  O  OE1 . GLN A 1 100 ? -17.999 -3.414  15.020  1.00  35.47 ? 99  GLN A OE1 1 
ATOM   755  N  NE2 . GLN A 1 100 ? -18.332 -4.174  12.945  1.00  35.00 ? 99  GLN A NE2 1 
ATOM   756  N  N   . PRO A 1 101 ? -17.099 0.719   11.393  1.00  28.30 ? 100 PRO A N   1 
ATOM   757  C  CA  . PRO A 1 101 ? -16.963 0.725   9.946   1.00  28.43 ? 100 PRO A CA  1 
ATOM   758  C  C   . PRO A 1 101 ? -17.185 -0.668  9.378   1.00  28.42 ? 100 PRO A C   1 
ATOM   759  O  O   . PRO A 1 101 ? -17.300 -1.636  10.134  1.00  28.16 ? 100 PRO A O   1 
ATOM   760  C  CB  . PRO A 1 101 ? -15.511 1.168   9.736   1.00  28.40 ? 100 PRO A CB  1 
ATOM   761  C  CG  . PRO A 1 101 ? -14.795 0.711   10.956  1.00  28.35 ? 100 PRO A CG  1 
ATOM   762  C  CD  . PRO A 1 101 ? -15.791 0.717   12.078  1.00  28.55 ? 100 PRO A CD  1 
ATOM   763  N  N   . SER A 1 102 ? -17.247 -0.753  8.054   1.00  29.19 ? 101 SER A N   1 
ATOM   764  C  CA  . SER A 1 102 ? -17.317 -2.029  7.362   1.00  29.76 ? 101 SER A CA  1 
ATOM   765  C  C   . SER A 1 102 ? -16.447 -1.936  6.112   1.00  29.49 ? 101 SER A C   1 
ATOM   766  O  O   . SER A 1 102 ? -15.744 -0.938  5.912   1.00  29.24 ? 101 SER A O   1 
ATOM   767  C  CB  . SER A 1 102 ? -18.768 -2.390  7.014   1.00  29.99 ? 101 SER A CB  1 
ATOM   768  O  OG  . SER A 1 102 ? -19.337 -1.423  6.147   1.00  32.88 ? 101 SER A OG  1 
ATOM   769  N  N   . GLY A 1 103 ? -16.464 -2.990  5.302   1.00  29.28 ? 102 GLY A N   1 
ATOM   770  C  CA  . GLY A 1 103 ? -15.765 -2.994  4.016   1.00  29.04 ? 102 GLY A CA  1 
ATOM   771  C  C   . GLY A 1 103 ? -14.261 -2.839  4.133   1.00  28.43 ? 102 GLY A C   1 
ATOM   772  O  O   . GLY A 1 103 ? -13.638 -3.351  5.073   1.00  28.13 ? 102 GLY A O   1 
ATOM   773  N  N   . GLU A 1 104 ? -13.691 -2.108  3.185   1.00  27.58 ? 103 GLU A N   1 
ATOM   774  C  CA  . GLU A 1 104 ? -12.247 -1.961  3.043   1.00  27.93 ? 103 GLU A CA  1 
ATOM   775  C  C   . GLU A 1 104 ? -11.592 -1.323  4.264   1.00  26.85 ? 103 GLU A C   1 
ATOM   776  O  O   . GLU A 1 104 ? -10.492 -1.709  4.667   1.00  26.56 ? 103 GLU A O   1 
ATOM   777  C  CB  . GLU A 1 104 ? -11.923 -1.123  1.800   1.00  28.51 ? 103 GLU A CB  1 
ATOM   778  C  CG  . GLU A 1 104 ? -12.652 -1.555  0.517   1.00  33.17 ? 103 GLU A CG  1 
ATOM   779  C  CD  . GLU A 1 104 ? -11.999 -2.737  -0.180  1.00  38.65 ? 103 GLU A CD  1 
ATOM   780  O  OE1 . GLU A 1 104 ? -11.202 -3.454  0.465   1.00  42.34 ? 103 GLU A OE1 1 
ATOM   781  O  OE2 . GLU A 1 104 ? -12.293 -2.955  -1.380  1.00  40.86 ? 103 GLU A OE2 1 
ATOM   782  N  N   . LEU A 1 105 ? -12.265 -0.341  4.851   1.00  26.18 ? 104 LEU A N   1 
ATOM   783  C  CA  . LEU A 1 105 ? -11.728 0.309   6.039   1.00  25.72 ? 104 LEU A CA  1 
ATOM   784  C  C   . LEU A 1 105 ? -11.639 -0.666  7.205   1.00  24.73 ? 104 LEU A C   1 
ATOM   785  O  O   . LEU A 1 105 ? -10.641 -0.679  7.928   1.00  24.09 ? 104 LEU A O   1 
ATOM   786  C  CB  . LEU A 1 105 ? -12.558 1.533   6.444   1.00  25.95 ? 104 LEU A CB  1 
ATOM   787  C  CG  . LEU A 1 105 ? -12.119 2.216   7.747   1.00  27.42 ? 104 LEU A CG  1 
ATOM   788  C  CD1 . LEU A 1 105 ? -10.658 2.706   7.687   1.00  27.70 ? 104 LEU A CD1 1 
ATOM   789  C  CD2 . LEU A 1 105 ? -13.062 3.374   8.112   1.00  26.91 ? 104 LEU A CD2 1 
ATOM   790  N  N   . LEU A 1 106 ? -12.682 -1.468  7.406   1.00  24.06 ? 105 LEU A N   1 
ATOM   791  C  CA  . LEU A 1 106 ? -12.647 -2.425  8.502   1.00  23.69 ? 105 LEU A CA  1 
ATOM   792  C  C   . LEU A 1 106 ? -11.547 -3.467  8.287   1.00  23.92 ? 105 LEU A C   1 
ATOM   793  O  O   . LEU A 1 106 ? -10.840 -3.846  9.233   1.00  22.69 ? 105 LEU A O   1 
ATOM   794  C  CB  . LEU A 1 106 ? -14.001 -3.095  8.698   1.00  23.98 ? 105 LEU A CB  1 
ATOM   795  C  CG  . LEU A 1 106 ? -14.066 -4.152  9.799   1.00  23.53 ? 105 LEU A CG  1 
ATOM   796  C  CD1 . LEU A 1 106 ? -13.634 -3.594  11.166  1.00  22.55 ? 105 LEU A CD1 1 
ATOM   797  C  CD2 . LEU A 1 106 ? -15.456 -4.747  9.869   1.00  25.97 ? 105 LEU A CD2 1 
ATOM   798  N  N   . ASP A 1 107 ? -11.406 -3.923  7.044   1.00  23.98 ? 106 ASP A N   1 
ATOM   799  C  CA  . ASP A 1 107 ? -10.341 -4.870  6.684   1.00  25.12 ? 106 ASP A CA  1 
ATOM   800  C  C   . ASP A 1 107 ? -8.969  -4.299  7.069   1.00  24.66 ? 106 ASP A C   1 
ATOM   801  O  O   . ASP A 1 107 ? -8.130  -5.001  7.646   1.00  24.40 ? 106 ASP A O   1 
ATOM   802  C  CB  . ASP A 1 107 ? -10.384 -5.193  5.182   1.00  25.60 ? 106 ASP A CB  1 
ATOM   803  C  CG  . ASP A 1 107 ? -11.539 -6.104  4.797   1.00  29.58 ? 106 ASP A CG  1 
ATOM   804  O  OD1 . ASP A 1 107 ? -12.018 -6.894  5.648   1.00  33.00 ? 106 ASP A OD1 1 
ATOM   805  O  OD2 . ASP A 1 107 ? -11.950 -6.063  3.612   1.00  33.20 ? 106 ASP A OD2 1 
ATOM   806  N  N   . ALA A 1 108 ? -8.765  -3.016  6.760   1.00  24.53 ? 107 ALA A N   1 
ATOM   807  C  CA  . ALA A 1 108 ? -7.511  -2.311  7.040   1.00  24.50 ? 107 ALA A CA  1 
ATOM   808  C  C   . ALA A 1 108 ? -7.268  -2.177  8.541   1.00  24.71 ? 107 ALA A C   1 
ATOM   809  O  O   . ALA A 1 108 ? -6.140  -2.358  8.997   1.00  24.96 ? 107 ALA A O   1 
ATOM   810  C  CB  . ALA A 1 108 ? -7.511  -0.945  6.392   1.00  24.74 ? 107 ALA A CB  1 
ATOM   811  N  N   . ILE A 1 109 ? -8.328  -1.876  9.296   1.00  24.41 ? 108 ILE A N   1 
ATOM   812  C  CA  . ILE A 1 109 ? -8.257  -1.816  10.766  1.00  24.30 ? 108 ILE A CA  1 
ATOM   813  C  C   . ILE A 1 109 ? -7.902  -3.188  11.360  1.00  24.28 ? 108 ILE A C   1 
ATOM   814  O  O   . ILE A 1 109 ? -7.033  -3.281  12.241  1.00  24.41 ? 108 ILE A O   1 
ATOM   815  C  CB  . ILE A 1 109 ? -9.570  -1.255  11.388  1.00  23.80 ? 108 ILE A CB  1 
ATOM   816  C  CG1 . ILE A 1 109 ? -9.699  0.251   11.107  1.00  23.67 ? 108 ILE A CG1 1 
ATOM   817  C  CG2 . ILE A 1 109 ? -9.626  -1.529  12.908  1.00  24.18 ? 108 ILE A CG2 1 
ATOM   818  C  CD1 . ILE A 1 109 ? -11.002 0.859   11.588  1.00  25.68 ? 108 ILE A CD1 1 
ATOM   819  N  N   . ASN A 1 110 ? -8.554  -4.248  10.876  1.00  23.87 ? 109 ASN A N   1 
ATOM   820  C  CA  . ASN A 1 110 ? -8.234  -5.608  11.318  1.00  24.03 ? 109 ASN A CA  1 
ATOM   821  C  C   . ASN A 1 110 ? -6.768  -5.934  11.052  1.00  24.53 ? 109 ASN A C   1 
ATOM   822  O  O   . ASN A 1 110 ? -6.092  -6.515  11.893  1.00  24.82 ? 109 ASN A O   1 
ATOM   823  C  CB  . ASN A 1 110 ? -9.136  -6.658  10.642  1.00  23.85 ? 109 ASN A CB  1 
ATOM   824  C  CG  . ASN A 1 110 ? -10.573 -6.621  11.145  1.00  22.85 ? 109 ASN A CG  1 
ATOM   825  O  OD1 . ASN A 1 110 ? -10.864 -6.064  12.196  1.00  22.88 ? 109 ASN A OD1 1 
ATOM   826  N  ND2 . ASN A 1 110 ? -11.477 -7.219  10.386  1.00  21.57 ? 109 ASN A ND2 1 
ATOM   827  N  N   . SER A 1 111 ? -6.288  -5.536  9.877   1.00  24.50 ? 110 SER A N   1 
ATOM   828  C  CA  . SER A 1 111 ? -4.909  -5.764  9.473   1.00  25.25 ? 110 SER A CA  1 
ATOM   829  C  C   . SER A 1 111 ? -3.933  -4.997  10.366  1.00  24.76 ? 110 SER A C   1 
ATOM   830  O  O   . SER A 1 111 ? -2.957  -5.573  10.857  1.00  24.41 ? 110 SER A O   1 
ATOM   831  C  CB  . SER A 1 111 ? -4.724  -5.336  8.016   1.00  25.89 ? 110 SER A CB  1 
ATOM   832  O  OG  . SER A 1 111 ? -3.421  -5.650  7.561   1.00  29.24 ? 110 SER A OG  1 
ATOM   833  N  N   . ALA A 1 112 ? -4.220  -3.715  10.599  1.00  24.32 ? 111 ALA A N   1 
ATOM   834  C  CA  . ALA A 1 112 ? -3.292  -2.827  11.309  1.00  24.41 ? 111 ALA A CA  1 
ATOM   835  C  C   . ALA A 1 112 ? -3.298  -3.042  12.818  1.00  24.50 ? 111 ALA A C   1 
ATOM   836  O  O   . ALA A 1 112 ? -2.248  -2.955  13.464  1.00  24.46 ? 111 ALA A O   1 
ATOM   837  C  CB  . ALA A 1 112 ? -3.604  -1.367  10.991  1.00  24.51 ? 111 ALA A CB  1 
ATOM   838  N  N   . PHE A 1 113 ? -4.480  -3.320  13.375  1.00  23.48 ? 112 PHE A N   1 
ATOM   839  C  CA  . PHE A 1 113 ? -4.679  -3.264  14.821  1.00  23.23 ? 112 PHE A CA  1 
ATOM   840  C  C   . PHE A 1 113 ? -5.172  -4.564  15.436  1.00  23.16 ? 112 PHE A C   1 
ATOM   841  O  O   . PHE A 1 113 ? -5.149  -4.705  16.651  1.00  23.55 ? 112 PHE A O   1 
ATOM   842  C  CB  . PHE A 1 113 ? -5.651  -2.128  15.181  1.00  23.21 ? 112 PHE A CB  1 
ATOM   843  C  CG  . PHE A 1 113 ? -5.250  -0.791  14.631  1.00  23.71 ? 112 PHE A CG  1 
ATOM   844  C  CD1 . PHE A 1 113 ? -4.163  -0.095  15.172  1.00  26.20 ? 112 PHE A CD1 1 
ATOM   845  C  CD2 . PHE A 1 113 ? -5.963  -0.214  13.591  1.00  23.89 ? 112 PHE A CD2 1 
ATOM   846  C  CE1 . PHE A 1 113 ? -3.781  1.155   14.660  1.00  26.01 ? 112 PHE A CE1 1 
ATOM   847  C  CE2 . PHE A 1 113 ? -5.598  1.044   13.074  1.00  24.58 ? 112 PHE A CE2 1 
ATOM   848  C  CZ  . PHE A 1 113 ? -4.501  1.723   13.611  1.00  25.35 ? 112 PHE A CZ  1 
ATOM   849  N  N   . GLY A 1 114 ? -5.608  -5.502  14.599  1.00  22.20 ? 113 GLY A N   1 
ATOM   850  C  CA  . GLY A 1 114 ? -6.079  -6.819  15.065  1.00  21.98 ? 113 GLY A CA  1 
ATOM   851  C  C   . GLY A 1 114 ? -7.593  -6.950  14.988  1.00  21.44 ? 113 GLY A C   1 
ATOM   852  O  O   . GLY A 1 114 ? -8.134  -8.009  14.619  1.00  21.74 ? 113 GLY A O   1 
ATOM   853  N  N   . SER A 1 115 ? -8.271  -5.862  15.335  1.00  21.34 ? 114 SER A N   1 
ATOM   854  C  CA  . SER A 1 115 ? -9.736  -5.811  15.361  1.00  21.15 ? 114 SER A CA  1 
ATOM   855  C  C   . SER A 1 115 ? -10.186 -4.373  15.578  1.00  21.55 ? 114 SER A C   1 
ATOM   856  O  O   . SER A 1 115 ? -9.398  -3.496  15.996  1.00  21.00 ? 114 SER A O   1 
ATOM   857  C  CB  . SER A 1 115 ? -10.288 -6.690  16.491  1.00  20.46 ? 114 SER A CB  1 
ATOM   858  O  OG  . SER A 1 115 ? -9.833  -6.238  17.764  1.00  20.73 ? 114 SER A OG  1 
ATOM   859  N  N   . PHE A 1 116 ? -11.462 -4.129  15.314  1.00  21.56 ? 115 PHE A N   1 
ATOM   860  C  CA  . PHE A 1 116 ? -12.028 -2.820  15.613  1.00  22.43 ? 115 PHE A CA  1 
ATOM   861  C  C   . PHE A 1 116 ? -11.928 -2.526  17.112  1.00  22.55 ? 115 PHE A C   1 
ATOM   862  O  O   . PHE A 1 116 ? -11.558 -1.413  17.499  1.00  21.99 ? 115 PHE A O   1 
ATOM   863  C  CB  . PHE A 1 116 ? -13.471 -2.701  15.122  1.00  22.81 ? 115 PHE A CB  1 
ATOM   864  C  CG  . PHE A 1 116 ? -14.068 -1.333  15.344  1.00  24.05 ? 115 PHE A CG  1 
ATOM   865  C  CD1 . PHE A 1 116 ? -13.498 -0.206  14.748  1.00  25.99 ? 115 PHE A CD1 1 
ATOM   866  C  CD2 . PHE A 1 116 ? -15.184 -1.177  16.157  1.00  25.79 ? 115 PHE A CD2 1 
ATOM   867  C  CE1 . PHE A 1 116 ? -14.038 1.053   14.946  1.00  26.98 ? 115 PHE A CE1 1 
ATOM   868  C  CE2 . PHE A 1 116 ? -15.741 0.080   16.362  1.00  25.71 ? 115 PHE A CE2 1 
ATOM   869  C  CZ  . PHE A 1 116 ? -15.162 1.199   15.759  1.00  25.92 ? 115 PHE A CZ  1 
ATOM   870  N  N   . ASP A 1 117 ? -12.224 -3.519  17.951  1.00  23.15 ? 116 ASP A N   1 
ATOM   871  C  CA  . ASP A 1 117 ? -12.154 -3.303  19.409  1.00  24.07 ? 116 ASP A CA  1 
ATOM   872  C  C   . ASP A 1 117 ? -10.728 -2.948  19.880  1.00  24.11 ? 116 ASP A C   1 
ATOM   873  O  O   . ASP A 1 117 ? -10.548 -2.060  20.713  1.00  23.82 ? 116 ASP A O   1 
ATOM   874  C  CB  . ASP A 1 117 ? -12.734 -4.485  20.182  1.00  24.85 ? 116 ASP A CB  1 
ATOM   875  C  CG  . ASP A 1 117 ? -14.265 -4.571  20.070  1.00  27.61 ? 116 ASP A CG  1 
ATOM   876  O  OD1 . ASP A 1 117 ? -14.904 -3.602  19.594  1.00  31.14 ? 116 ASP A OD1 1 
ATOM   877  O  OD2 . ASP A 1 117 ? -14.826 -5.617  20.462  1.00  31.51 ? 116 ASP A OD2 1 
ATOM   878  N  N   . ALA A 1 118 ? -9.725  -3.628  19.330  1.00  23.37 ? 117 ALA A N   1 
ATOM   879  C  CA  . ALA A 1 118 ? -8.325  -3.304  19.622  1.00  23.54 ? 117 ALA A CA  1 
ATOM   880  C  C   . ALA A 1 118 ? -7.948  -1.902  19.131  1.00  23.60 ? 117 ALA A C   1 
ATOM   881  O  O   . ALA A 1 118 ? -7.217  -1.186  19.816  1.00  23.79 ? 117 ALA A O   1 
ATOM   882  C  CB  . ALA A 1 118 ? -7.394  -4.353  19.034  1.00  23.55 ? 117 ALA A CB  1 
ATOM   883  N  N   . PHE A 1 119 ? -8.442  -1.518  17.953  1.00  23.39 ? 118 PHE A N   1 
ATOM   884  C  CA  . PHE A 1 119 ? -8.222  -0.180  17.434  1.00  24.10 ? 118 PHE A CA  1 
ATOM   885  C  C   . PHE A 1 119 ? -8.804  0.859   18.392  1.00  24.50 ? 118 PHE A C   1 
ATOM   886  O  O   . PHE A 1 119 ? -8.162  1.857   18.692  1.00  24.88 ? 118 PHE A O   1 
ATOM   887  C  CB  . PHE A 1 119 ? -8.851  0.008   16.046  1.00  23.67 ? 118 PHE A CB  1 
ATOM   888  C  CG  . PHE A 1 119 ? -9.184  1.461   15.741  1.00  24.13 ? 118 PHE A CG  1 
ATOM   889  C  CD1 . PHE A 1 119 ? -8.167  2.384   15.492  1.00  24.43 ? 118 PHE A CD1 1 
ATOM   890  C  CD2 . PHE A 1 119 ? -10.505 1.911   15.763  1.00  25.69 ? 118 PHE A CD2 1 
ATOM   891  C  CE1 . PHE A 1 119 ? -8.453  3.733   15.266  1.00  23.03 ? 118 PHE A CE1 1 
ATOM   892  C  CE2 . PHE A 1 119 ? -10.803 3.259   15.528  1.00  24.81 ? 118 PHE A CE2 1 
ATOM   893  C  CZ  . PHE A 1 119 ? -9.783  4.167   15.271  1.00  25.13 ? 118 PHE A CZ  1 
ATOM   894  N  N   . LYS A 1 120 ? -10.023 0.620   18.869  1.00  24.60 ? 119 LYS A N   1 
ATOM   895  C  CA  . LYS A 1 120 ? -10.672 1.586   19.744  1.00  25.97 ? 119 LYS A CA  1 
ATOM   896  C  C   . LYS A 1 120 ? -9.814  1.767   20.987  1.00  26.29 ? 119 LYS A C   1 
ATOM   897  O  O   . LYS A 1 120 ? -9.613  2.884   21.439  1.00  26.19 ? 119 LYS A O   1 
ATOM   898  C  CB  . LYS A 1 120 ? -12.084 1.136   20.112  1.00  26.10 ? 119 LYS A CB  1 
ATOM   899  C  CG  . LYS A 1 120 ? -13.080 1.303   18.959  1.00  27.79 ? 119 LYS A CG  1 
ATOM   900  C  CD  . LYS A 1 120 ? -14.523 1.301   19.446  1.00  29.44 ? 119 LYS A CD  1 
ATOM   901  C  CE  . LYS A 1 120 ? -14.922 -0.038  20.006  1.00  31.97 ? 119 LYS A CE  1 
ATOM   902  N  NZ  . LYS A 1 120 ? -16.394 -0.067  20.242  1.00  33.11 ? 119 LYS A NZ  1 
ATOM   903  N  N   . GLN A 1 121 ? -9.292  0.656   21.513  1.00  26.70 ? 120 GLN A N   1 
ATOM   904  C  CA  . GLN A 1 121 ? -8.427  0.686   22.694  1.00  27.85 ? 120 GLN A CA  1 
ATOM   905  C  C   . GLN A 1 121 ? -7.173  1.521   22.467  1.00  27.36 ? 120 GLN A C   1 
ATOM   906  O  O   . GLN A 1 121 ? -6.779  2.324   23.317  1.00  26.66 ? 120 GLN A O   1 
ATOM   907  C  CB  . GLN A 1 121 ? -8.022  -0.736  23.087  1.00  28.33 ? 120 GLN A CB  1 
ATOM   908  C  CG  . GLN A 1 121 ? -8.965  -1.373  24.097  1.00  33.75 ? 120 GLN A CG  1 
ATOM   909  C  CD  . GLN A 1 121 ? -8.957  -0.648  25.435  1.00  40.30 ? 120 GLN A CD  1 
ATOM   910  O  OE1 . GLN A 1 121 ? -7.924  -0.565  26.105  1.00  44.74 ? 120 GLN A OE1 1 
ATOM   911  N  NE2 . GLN A 1 121 ? -10.114 -0.113  25.831  1.00  42.94 ? 120 GLN A NE2 1 
ATOM   912  N  N   . LYS A 1 122 ? -6.553  1.311   21.312  1.00  27.27 ? 121 LYS A N   1 
ATOM   913  C  CA  . LYS A 1 122 ? -5.331  2.025   20.920  1.00  27.44 ? 121 LYS A CA  1 
ATOM   914  C  C   . LYS A 1 122 ? -5.581  3.527   20.712  1.00  27.24 ? 121 LYS A C   1 
ATOM   915  O  O   . LYS A 1 122 ? -4.759  4.383   21.099  1.00  26.10 ? 121 LYS A O   1 
ATOM   916  C  CB  . LYS A 1 122 ? -4.818  1.392   19.635  1.00  28.26 ? 121 LYS A CB  1 
ATOM   917  C  CG  . LYS A 1 122 ? -3.687  2.124   18.960  1.00  31.48 ? 121 LYS A CG  1 
ATOM   918  C  CD  . LYS A 1 122 ? -2.358  1.544   19.362  1.00  36.99 ? 121 LYS A CD  1 
ATOM   919  C  CE  . LYS A 1 122 ? -1.314  1.856   18.320  1.00  38.31 ? 121 LYS A CE  1 
ATOM   920  N  NZ  . LYS A 1 122 ? 0.036   1.744   18.903  1.00  41.90 ? 121 LYS A NZ  1 
ATOM   921  N  N   . PHE A 1 123 ? -6.722  3.838   20.102  1.00  26.12 ? 122 PHE A N   1 
ATOM   922  C  CA  . PHE A 1 123 ? -7.109  5.220   19.841  1.00  26.89 ? 122 PHE A CA  1 
ATOM   923  C  C   . PHE A 1 123 ? -7.459  5.928   21.159  1.00  27.20 ? 122 PHE A C   1 
ATOM   924  O  O   . PHE A 1 123 ? -7.017  7.057   21.398  1.00  27.85 ? 122 PHE A O   1 
ATOM   925  C  CB  . PHE A 1 123 ? -8.281  5.243   18.868  1.00  27.15 ? 122 PHE A CB  1 
ATOM   926  C  CG  . PHE A 1 123 ? -8.670  6.613   18.401  1.00  27.24 ? 122 PHE A CG  1 
ATOM   927  C  CD1 . PHE A 1 123 ? -8.058  7.182   17.283  1.00  27.39 ? 122 PHE A CD1 1 
ATOM   928  C  CD2 . PHE A 1 123 ? -9.680  7.319   19.052  1.00  27.65 ? 122 PHE A CD2 1 
ATOM   929  C  CE1 . PHE A 1 123 ? -8.435  8.451   16.822  1.00  27.53 ? 122 PHE A CE1 1 
ATOM   930  C  CE2 . PHE A 1 123 ? -10.072 8.577   18.606  1.00  28.33 ? 122 PHE A CE2 1 
ATOM   931  C  CZ  . PHE A 1 123 ? -9.448  9.146   17.481  1.00  29.62 ? 122 PHE A CZ  1 
ATOM   932  N  N   . GLU A 1 124 ? -8.229  5.258   22.019  1.00  27.24 ? 123 GLU A N   1 
ATOM   933  C  CA  . GLU A 1 124 ? -8.538  5.810   23.340  1.00  28.02 ? 123 GLU A CA  1 
ATOM   934  C  C   . GLU A 1 124 ? -7.274  6.034   24.177  1.00  28.17 ? 123 GLU A C   1 
ATOM   935  O  O   . GLU A 1 124 ? -7.189  7.023   24.912  1.00  27.82 ? 123 GLU A O   1 
ATOM   936  C  CB  . GLU A 1 124 ? -9.529  4.924   24.086  1.00  28.52 ? 123 GLU A CB  1 
ATOM   937  C  CG  . GLU A 1 124 ? -10.935 5.036   23.525  1.00  30.52 ? 123 GLU A CG  1 
ATOM   938  C  CD  . GLU A 1 124 ? -11.947 4.317   24.375  1.00  36.32 ? 123 GLU A CD  1 
ATOM   939  O  OE1 . GLU A 1 124 ? -11.745 4.240   25.613  1.00  38.81 ? 123 GLU A OE1 1 
ATOM   940  O  OE2 . GLU A 1 124 ? -12.939 3.831   23.804  1.00  36.56 ? 123 GLU A OE2 1 
ATOM   941  N  N   . ASP A 1 125 ? -6.304  5.126   24.066  1.00  27.78 ? 124 ASP A N   1 
ATOM   942  C  CA  . ASP A 1 125 ? -5.039  5.256   24.808  1.00  28.19 ? 124 ASP A CA  1 
ATOM   943  C  C   . ASP A 1 125 ? -4.227  6.468   24.354  1.00  27.64 ? 124 ASP A C   1 
ATOM   944  O  O   . ASP A 1 125 ? -3.690  7.200   25.187  1.00  26.72 ? 124 ASP A O   1 
ATOM   945  C  CB  . ASP A 1 125 ? -4.199  3.974   24.740  1.00  29.16 ? 124 ASP A CB  1 
ATOM   946  C  CG  . ASP A 1 125 ? -4.805  2.836   25.552  1.00  33.06 ? 124 ASP A CG  1 
ATOM   947  O  OD1 . ASP A 1 125 ? -5.757  3.101   26.330  1.00  36.52 ? 124 ASP A OD1 1 
ATOM   948  O  OD2 . ASP A 1 125 ? -4.339  1.672   25.412  1.00  36.16 ? 124 ASP A OD2 1 
ATOM   949  N  N   . ALA A 1 126 ? -4.155  6.683   23.040  1.00  26.73 ? 125 ALA A N   1 
ATOM   950  C  CA  . ALA A 1 126 ? -3.469  7.854   22.492  1.00  26.85 ? 125 ALA A CA  1 
ATOM   951  C  C   . ALA A 1 126 ? -4.148  9.154   22.927  1.00  26.88 ? 125 ALA A C   1 
ATOM   952  O  O   . ALA A 1 126 ? -3.474  10.139  23.235  1.00  27.17 ? 125 ALA A O   1 
ATOM   953  C  CB  . ALA A 1 126 ? -3.382  7.773   20.961  1.00  26.34 ? 125 ALA A CB  1 
ATOM   954  N  N   . ALA A 1 127 ? -5.476  9.145   22.966  1.00  26.94 ? 126 ALA A N   1 
ATOM   955  C  CA  . ALA A 1 127 ? -6.234  10.325  23.389  1.00  27.24 ? 126 ALA A CA  1 
ATOM   956  C  C   . ALA A 1 127 ? -6.081  10.561  24.897  1.00  28.25 ? 126 ALA A C   1 
ATOM   957  O  O   . ALA A 1 127 ? -6.028  11.706  25.346  1.00  28.68 ? 126 ALA A O   1 
ATOM   958  C  CB  . ALA A 1 127 ? -7.697  10.170  23.007  1.00  27.11 ? 126 ALA A CB  1 
ATOM   959  N  N   . LYS A 1 128 ? -5.986  9.483   25.670  1.00  28.52 ? 127 LYS A N   1 
ATOM   960  C  CA  . LYS A 1 128 ? -5.889  9.605   27.127  1.00  29.92 ? 127 LYS A CA  1 
ATOM   961  C  C   . LYS A 1 128 ? -4.514  10.110  27.558  1.00  29.52 ? 127 LYS A C   1 
ATOM   962  O  O   . LYS A 1 128 ? -4.387  10.848  28.549  1.00  30.55 ? 127 LYS A O   1 
ATOM   963  C  CB  . LYS A 1 128 ? -6.221  8.273   27.807  1.00  30.19 ? 127 LYS A CB  1 
ATOM   964  C  CG  . LYS A 1 128 ? -7.722  7.974   27.881  1.00  30.72 ? 127 LYS A CG  1 
ATOM   965  C  CD  . LYS A 1 128 ? -8.034  6.774   28.795  1.00  32.12 ? 127 LYS A CD  1 
ATOM   966  C  CE  . LYS A 1 128 ? -7.788  5.432   28.119  1.00  35.23 ? 127 LYS A CE  1 
ATOM   967  N  NZ  . LYS A 1 128 ? -8.313  4.321   28.970  1.00  37.61 ? 127 LYS A NZ  1 
ATOM   968  N  N   . THR A 1 129 ? -3.491  9.732   26.796  1.00  28.64 ? 128 THR A N   1 
ATOM   969  C  CA  . THR A 1 129 ? -2.105  10.007  27.157  1.00  28.72 ? 128 THR A CA  1 
ATOM   970  C  C   . THR A 1 129 ? -1.596  11.319  26.555  1.00  28.27 ? 128 THR A C   1 
ATOM   971  O  O   . THR A 1 129 ? -0.465  11.733  26.820  1.00  28.53 ? 128 THR A O   1 
ATOM   972  C  CB  . THR A 1 129 ? -1.184  8.857   26.733  1.00  28.34 ? 128 THR A CB  1 
ATOM   973  O  OG1 . THR A 1 129 ? -1.352  8.613   25.338  1.00  29.63 ? 128 THR A OG1 1 
ATOM   974  C  CG2 . THR A 1 129 ? -1.535  7.589   27.495  1.00  28.57 ? 128 THR A CG2 1 
ATOM   975  N  N   . ARG A 1 130 ? -2.431  11.964  25.740  1.00  27.78 ? 129 ARG A N   1 
ATOM   976  C  CA  . ARG A 1 130 ? -2.149  13.310  25.267  1.00  27.20 ? 129 ARG A CA  1 
ATOM   977  C  C   . ARG A 1 130 ? -2.306  14.290  26.442  1.00  26.94 ? 129 ARG A C   1 
ATOM   978  O  O   . ARG A 1 130 ? -3.424  14.643  26.852  1.00  27.99 ? 129 ARG A O   1 
ATOM   979  C  CB  . ARG A 1 130 ? -3.049  13.657  24.060  1.00  26.66 ? 129 ARG A CB  1 
ATOM   980  C  CG  . ARG A 1 130 ? -3.089  15.127  23.602  1.00  27.17 ? 129 ARG A CG  1 
ATOM   981  C  CD  . ARG A 1 130 ? -1.702  15.763  23.480  1.00  25.17 ? 129 ARG A CD  1 
ATOM   982  N  NE  . ARG A 1 130 ? -0.804  15.019  22.601  1.00  25.03 ? 129 ARG A NE  1 
ATOM   983  C  CZ  . ARG A 1 130 ? 0.455   15.375  22.351  1.00  28.33 ? 129 ARG A CZ  1 
ATOM   984  N  NH1 . ARG A 1 130 ? 0.964   16.464  22.918  1.00  27.63 ? 129 ARG A NH1 1 
ATOM   985  N  NH2 . ARG A 1 130 ? 1.219   14.639  21.544  1.00  24.94 ? 129 ARG A NH2 1 
ATOM   986  N  N   . PHE A 1 131 ? -1.176  14.712  26.988  1.00  25.99 ? 130 PHE A N   1 
ATOM   987  C  CA  . PHE A 1 131 ? -1.164  15.564  28.171  1.00  25.69 ? 130 PHE A CA  1 
ATOM   988  C  C   . PHE A 1 131 ? -1.328  17.024  27.773  1.00  25.73 ? 130 PHE A C   1 
ATOM   989  O  O   . PHE A 1 131 ? -0.583  17.524  26.922  1.00  26.48 ? 130 PHE A O   1 
ATOM   990  C  CB  . PHE A 1 131 ? 0.130   15.364  28.955  1.00  24.83 ? 130 PHE A CB  1 
ATOM   991  C  CG  . PHE A 1 131 ? 0.107   15.968  30.325  1.00  24.78 ? 130 PHE A CG  1 
ATOM   992  C  CD1 . PHE A 1 131 ? -0.500  15.293  31.385  1.00  26.30 ? 130 PHE A CD1 1 
ATOM   993  C  CD2 . PHE A 1 131 ? 0.702   17.204  30.569  1.00  24.43 ? 130 PHE A CD2 1 
ATOM   994  C  CE1 . PHE A 1 131 ? -0.525  15.857  32.670  1.00  25.01 ? 130 PHE A CE1 1 
ATOM   995  C  CE2 . PHE A 1 131 ? 0.671   17.779  31.840  1.00  23.43 ? 130 PHE A CE2 1 
ATOM   996  C  CZ  . PHE A 1 131 ? 0.069   17.099  32.892  1.00  25.15 ? 130 PHE A CZ  1 
ATOM   997  N  N   . GLY A 1 132 ? -2.292  17.701  28.393  1.00  25.44 ? 131 GLY A N   1 
ATOM   998  C  CA  . GLY A 1 132 ? -2.630  19.077  28.020  1.00  25.33 ? 131 GLY A CA  1 
ATOM   999  C  C   . GLY A 1 132 ? -3.663  19.058  26.902  1.00  25.03 ? 131 GLY A C   1 
ATOM   1000 O  O   . GLY A 1 132 ? -4.481  18.140  26.817  1.00  25.42 ? 131 GLY A O   1 
ATOM   1001 N  N   . SER A 1 133 ? -3.619  20.068  26.042  1.00  24.90 ? 132 SER A N   1 
ATOM   1002 C  CA  . SER A 1 133 ? -4.561  20.177  24.926  1.00  24.66 ? 132 SER A CA  1 
ATOM   1003 C  C   . SER A 1 133 ? -4.026  19.462  23.680  1.00  24.22 ? 132 SER A C   1 
ATOM   1004 O  O   . SER A 1 133 ? -2.822  19.428  23.431  1.00  24.70 ? 132 SER A O   1 
ATOM   1005 C  CB  . SER A 1 133 ? -4.838  21.652  24.591  1.00  24.73 ? 132 SER A CB  1 
ATOM   1006 O  OG  . SER A 1 133 ? -5.199  22.394  25.746  1.00  24.71 ? 132 SER A OG  1 
ATOM   1007 N  N   . GLY A 1 134 ? -4.928  18.909  22.877  1.00  24.70 ? 133 GLY A N   1 
ATOM   1008 C  CA  . GLY A 1 134 ? -4.504  18.344  21.594  1.00  23.92 ? 133 GLY A CA  1 
ATOM   1009 C  C   . GLY A 1 134 ? -5.580  17.464  20.979  1.00  23.79 ? 133 GLY A C   1 
ATOM   1010 O  O   . GLY A 1 134 ? -6.766  17.573  21.322  1.00  22.72 ? 133 GLY A O   1 
ATOM   1011 N  N   . TRP A 1 135 ? -5.132  16.571  20.100  1.00  23.65 ? 134 TRP A N   1 
ATOM   1012 C  CA  . TRP A 1 135 ? -5.999  15.739  19.274  1.00  24.21 ? 134 TRP A CA  1 
ATOM   1013 C  C   . TRP A 1 135 ? -5.384  14.350  19.163  1.00  23.84 ? 134 TRP A C   1 
ATOM   1014 O  O   . TRP A 1 135 ? -4.165  14.210  19.169  1.00  24.21 ? 134 TRP A O   1 
ATOM   1015 C  CB  . TRP A 1 135 ? -6.095  16.320  17.849  1.00  24.73 ? 134 TRP A CB  1 
ATOM   1016 C  CG  . TRP A 1 135 ? -6.855  17.619  17.760  1.00  25.58 ? 134 TRP A CG  1 
ATOM   1017 C  CD1 . TRP A 1 135 ? -6.409  18.864  18.134  1.00  26.87 ? 134 TRP A CD1 1 
ATOM   1018 C  CD2 . TRP A 1 135 ? -8.168  17.805  17.242  1.00  26.14 ? 134 TRP A CD2 1 
ATOM   1019 N  NE1 . TRP A 1 135 ? -7.374  19.803  17.910  1.00  26.08 ? 134 TRP A NE1 1 
ATOM   1020 C  CE2 . TRP A 1 135 ? -8.472  19.183  17.364  1.00  26.76 ? 134 TRP A CE2 1 
ATOM   1021 C  CE3 . TRP A 1 135 ? -9.135  16.939  16.710  1.00  26.11 ? 134 TRP A CE3 1 
ATOM   1022 C  CZ2 . TRP A 1 135 ? -9.695  19.719  16.959  1.00  25.49 ? 134 TRP A CZ2 1 
ATOM   1023 C  CZ3 . TRP A 1 135 ? -10.366 17.478  16.310  1.00  26.78 ? 134 TRP A CZ3 1 
ATOM   1024 C  CH2 . TRP A 1 135 ? -10.626 18.857  16.427  1.00  26.32 ? 134 TRP A CH2 1 
ATOM   1025 N  N   . ALA A 1 136 ? -6.233  13.326  19.067  1.00  24.37 ? 135 ALA A N   1 
ATOM   1026 C  CA  . ALA A 1 136 ? -5.774  11.999  18.664  1.00  23.33 ? 135 ALA A CA  1 
ATOM   1027 C  C   . ALA A 1 136 ? -6.293  11.711  17.259  1.00  23.87 ? 135 ALA A C   1 
ATOM   1028 O  O   . ALA A 1 136 ? -7.396  12.128  16.897  1.00  24.26 ? 135 ALA A O   1 
ATOM   1029 C  CB  . ALA A 1 136 ? -6.242  10.936  19.648  1.00  24.05 ? 135 ALA A CB  1 
ATOM   1030 N  N   . TRP A 1 137 ? -5.499  11.000  16.470  1.00  23.63 ? 136 TRP A N   1 
ATOM   1031 C  CA  . TRP A 1 137 ? -5.808  10.814  15.062  1.00  24.23 ? 136 TRP A CA  1 
ATOM   1032 C  C   . TRP A 1 137 ? -5.659  9.374   14.611  1.00  24.63 ? 136 TRP A C   1 
ATOM   1033 O  O   . TRP A 1 137 ? -4.783  8.655   15.098  1.00  25.32 ? 136 TRP A O   1 
ATOM   1034 C  CB  . TRP A 1 137 ? -4.829  11.624  14.216  1.00  23.84 ? 136 TRP A CB  1 
ATOM   1035 C  CG  . TRP A 1 137 ? -4.715  13.082  14.561  1.00  24.91 ? 136 TRP A CG  1 
ATOM   1036 C  CD1 . TRP A 1 137 ? -3.779  13.667  15.365  1.00  25.34 ? 136 TRP A CD1 1 
ATOM   1037 C  CD2 . TRP A 1 137 ? -5.553  14.136  14.082  1.00  23.86 ? 136 TRP A CD2 1 
ATOM   1038 N  NE1 . TRP A 1 137 ? -3.987  15.033  15.422  1.00  23.71 ? 136 TRP A NE1 1 
ATOM   1039 C  CE2 . TRP A 1 137 ? -5.063  15.347  14.637  1.00  23.53 ? 136 TRP A CE2 1 
ATOM   1040 C  CE3 . TRP A 1 137 ? -6.662  14.181  13.227  1.00  24.14 ? 136 TRP A CE3 1 
ATOM   1041 C  CZ2 . TRP A 1 137 ? -5.656  16.590  14.375  1.00  24.96 ? 136 TRP A CZ2 1 
ATOM   1042 C  CZ3 . TRP A 1 137 ? -7.255  15.412  12.963  1.00  25.21 ? 136 TRP A CZ3 1 
ATOM   1043 C  CH2 . TRP A 1 137 ? -6.751  16.606  13.537  1.00  25.37 ? 136 TRP A CH2 1 
ATOM   1044 N  N   . LEU A 1 138 ? -6.495  8.980   13.655  1.00  24.37 ? 137 LEU A N   1 
ATOM   1045 C  CA  . LEU A 1 138 ? -6.247  7.793   12.841  1.00  24.08 ? 137 LEU A CA  1 
ATOM   1046 C  C   . LEU A 1 138 ? -5.714  8.327   11.510  1.00  24.81 ? 137 LEU A C   1 
ATOM   1047 O  O   . LEU A 1 138 ? -6.400  9.099   10.832  1.00  24.59 ? 137 LEU A O   1 
ATOM   1048 C  CB  . LEU A 1 138 ? -7.533  6.981   12.639  1.00  23.93 ? 137 LEU A CB  1 
ATOM   1049 C  CG  . LEU A 1 138 ? -7.477  5.744   11.735  1.00  24.38 ? 137 LEU A CG  1 
ATOM   1050 C  CD1 . LEU A 1 138 ? -6.411  4.706   12.185  1.00  23.90 ? 137 LEU A CD1 1 
ATOM   1051 C  CD2 . LEU A 1 138 ? -8.883  5.117   11.642  1.00  23.68 ? 137 LEU A CD2 1 
ATOM   1052 N  N   . VAL A 1 139 ? -4.490  7.936   11.156  1.00  24.99 ? 138 VAL A N   1 
ATOM   1053 C  CA  . VAL A 1 139 ? -3.836  8.439   9.931   1.00  26.27 ? 138 VAL A CA  1 
ATOM   1054 C  C   . VAL A 1 139 ? -3.483  7.312   8.966   1.00  26.34 ? 138 VAL A C   1 
ATOM   1055 O  O   . VAL A 1 139 ? -3.283  6.168   9.384   1.00  26.09 ? 138 VAL A O   1 
ATOM   1056 C  CB  . VAL A 1 139 ? -2.542  9.269   10.219  1.00  25.75 ? 138 VAL A CB  1 
ATOM   1057 C  CG1 . VAL A 1 139 ? -2.858  10.521  11.046  1.00  26.64 ? 138 VAL A CG1 1 
ATOM   1058 C  CG2 . VAL A 1 139 ? -1.486  8.421   10.913  1.00  27.84 ? 138 VAL A CG2 1 
ATOM   1059 N  N   . VAL A 1 140 ? -3.428  7.641   7.679   1.00  26.95 ? 139 VAL A N   1 
ATOM   1060 C  CA  . VAL A 1 140 ? -2.844  6.746   6.686   1.00  28.50 ? 139 VAL A CA  1 
ATOM   1061 C  C   . VAL A 1 140 ? -1.446  7.276   6.394   1.00  29.50 ? 139 VAL A C   1 
ATOM   1062 O  O   . VAL A 1 140 ? -1.273  8.409   5.933   1.00  29.61 ? 139 VAL A O   1 
ATOM   1063 C  CB  . VAL A 1 140 ? -3.672  6.666   5.382   1.00  28.36 ? 139 VAL A CB  1 
ATOM   1064 C  CG1 . VAL A 1 140 ? -3.002  5.716   4.383   1.00  28.60 ? 139 VAL A CG1 1 
ATOM   1065 C  CG2 . VAL A 1 140 ? -5.097  6.214   5.676   1.00  28.53 ? 139 VAL A CG2 1 
ATOM   1066 N  N   . LYS A 1 141 ? -0.458  6.447   6.696   1.00  30.79 ? 140 LYS A N   1 
ATOM   1067 C  CA  . LYS A 1 141 ? 0.944   6.786   6.550   1.00  32.52 ? 140 LYS A CA  1 
ATOM   1068 C  C   . LYS A 1 141 ? 1.573   5.676   5.714   1.00  33.11 ? 140 LYS A C   1 
ATOM   1069 O  O   . LYS A 1 141 ? 1.587   4.512   6.128   1.00  33.39 ? 140 LYS A O   1 
ATOM   1070 C  CB  . LYS A 1 141 ? 1.586   6.880   7.942   1.00  32.96 ? 140 LYS A CB  1 
ATOM   1071 C  CG  . LYS A 1 141 ? 3.107   7.010   7.975   1.00  34.28 ? 140 LYS A CG  1 
ATOM   1072 C  CD  . LYS A 1 141 ? 3.577   8.436   7.758   1.00  36.28 ? 140 LYS A CD  1 
ATOM   1073 C  CE  . LYS A 1 141 ? 5.065   8.464   7.417   1.00  36.89 ? 140 LYS A CE  1 
ATOM   1074 N  NZ  . LYS A 1 141 ? 5.504   9.787   6.894   1.00  36.69 ? 140 LYS A NZ  1 
ATOM   1075 N  N   . ASP A 1 142 ? 2.061   6.037   4.526   1.00  34.12 ? 141 ASP A N   1 
ATOM   1076 C  CA  . ASP A 1 142 ? 2.621   5.074   3.565   1.00  34.75 ? 141 ASP A CA  1 
ATOM   1077 C  C   . ASP A 1 142 ? 1.680   3.899   3.296   1.00  34.36 ? 141 ASP A C   1 
ATOM   1078 O  O   . ASP A 1 142 ? 2.098   2.740   3.293   1.00  34.68 ? 141 ASP A O   1 
ATOM   1079 C  CB  . ASP A 1 142 ? 4.001   4.581   4.023   1.00  35.59 ? 141 ASP A CB  1 
ATOM   1080 C  CG  . ASP A 1 142 ? 4.988   5.720   4.216   1.00  37.50 ? 141 ASP A CG  1 
ATOM   1081 O  OD1 . ASP A 1 142 ? 5.163   6.525   3.271   1.00  39.67 ? 141 ASP A OD1 1 
ATOM   1082 O  OD2 . ASP A 1 142 ? 5.577   5.815   5.319   1.00  40.46 ? 141 ASP A OD2 1 
ATOM   1083 N  N   . GLY A 1 143 ? 0.403   4.215   3.096   1.00  34.13 ? 142 GLY A N   1 
ATOM   1084 C  CA  . GLY A 1 143 ? -0.620  3.216   2.789   1.00  33.37 ? 142 GLY A CA  1 
ATOM   1085 C  C   . GLY A 1 143 ? -1.096  2.376   3.957   1.00  32.94 ? 142 GLY A C   1 
ATOM   1086 O  O   . GLY A 1 143 ? -1.945  1.506   3.779   1.00  33.30 ? 142 GLY A O   1 
ATOM   1087 N  N   . LYS A 1 144 ? -0.562  2.636   5.150   1.00  32.22 ? 143 LYS A N   1 
ATOM   1088 C  CA  . LYS A 1 144 ? -0.915  1.858   6.340   1.00  31.34 ? 143 LYS A CA  1 
ATOM   1089 C  C   . LYS A 1 144 ? -1.501  2.728   7.452   1.00  30.31 ? 143 LYS A C   1 
ATOM   1090 O  O   . LYS A 1 144 ? -1.139  3.897   7.593   1.00  29.71 ? 143 LYS A O   1 
ATOM   1091 C  CB  . LYS A 1 144 ? 0.308   1.092   6.840   1.00  31.81 ? 143 LYS A CB  1 
ATOM   1092 C  CG  . LYS A 1 144 ? 0.653   -0.107  5.962   1.00  32.96 ? 143 LYS A CG  1 
ATOM   1093 C  CD  . LYS A 1 144 ? 2.148   -0.383  5.942   1.00  36.38 ? 143 LYS A CD  1 
ATOM   1094 C  CE  . LYS A 1 144 ? 2.434   -1.673  5.186   1.00  37.30 ? 143 LYS A CE  1 
ATOM   1095 N  NZ  . LYS A 1 144 ? 3.881   -1.821  4.847   1.00  39.59 ? 143 LYS A NZ  1 
ATOM   1096 N  N   . LEU A 1 145 ? -2.405  2.149   8.238   1.00  29.60 ? 144 LEU A N   1 
ATOM   1097 C  CA  . LEU A 1 145 ? -3.057  2.875   9.321   1.00  29.16 ? 144 LEU A CA  1 
ATOM   1098 C  C   . LEU A 1 145 ? -2.175  2.935   10.564  1.00  29.22 ? 144 LEU A C   1 
ATOM   1099 O  O   . LEU A 1 145 ? -1.469  1.977   10.892  1.00  28.43 ? 144 LEU A O   1 
ATOM   1100 C  CB  . LEU A 1 145 ? -4.404  2.234   9.678   1.00  29.24 ? 144 LEU A CB  1 
ATOM   1101 C  CG  . LEU A 1 145 ? -5.541  2.268   8.650   1.00  28.81 ? 144 LEU A CG  1 
ATOM   1102 C  CD1 . LEU A 1 145 ? -6.707  1.414   9.140   1.00  28.81 ? 144 LEU A CD1 1 
ATOM   1103 C  CD2 . LEU A 1 145 ? -6.010  3.711   8.387   1.00  29.92 ? 144 LEU A CD2 1 
ATOM   1104 N  N   . ASP A 1 146 ? -2.236  4.065   11.258  1.00  28.87 ? 145 ASP A N   1 
ATOM   1105 C  CA  . ASP A 1 146 ? -1.553  4.231   12.536  1.00  29.35 ? 145 ASP A CA  1 
ATOM   1106 C  C   . ASP A 1 146 ? -2.362  5.177   13.417  1.00  28.60 ? 145 ASP A C   1 
ATOM   1107 O  O   . ASP A 1 146 ? -3.188  5.936   12.916  1.00  28.44 ? 145 ASP A O   1 
ATOM   1108 C  CB  . ASP A 1 146 ? -0.149  4.782   12.318  1.00  30.10 ? 145 ASP A CB  1 
ATOM   1109 C  CG  . ASP A 1 146 ? 0.806   4.435   13.461  1.00  33.93 ? 145 ASP A CG  1 
ATOM   1110 O  OD1 . ASP A 1 146 ? 0.385   3.790   14.463  1.00  37.24 ? 145 ASP A OD1 1 
ATOM   1111 O  OD2 . ASP A 1 146 ? 1.994   4.810   13.347  1.00  38.04 ? 145 ASP A OD2 1 
ATOM   1112 N  N   . VAL A 1 147 ? -2.144  5.111   14.727  1.00  27.64 ? 146 VAL A N   1 
ATOM   1113 C  CA  . VAL A 1 147 ? -2.807  6.027   15.653  1.00  27.06 ? 146 VAL A CA  1 
ATOM   1114 C  C   . VAL A 1 147 ? -1.730  6.921   16.288  1.00  26.52 ? 146 VAL A C   1 
ATOM   1115 O  O   . VAL A 1 147 ? -0.711  6.427   16.782  1.00  25.35 ? 146 VAL A O   1 
ATOM   1116 C  CB  . VAL A 1 147 ? -3.609  5.255   16.723  1.00  27.42 ? 146 VAL A CB  1 
ATOM   1117 C  CG1 . VAL A 1 147 ? -3.970  6.154   17.859  1.00  27.80 ? 146 VAL A CG1 1 
ATOM   1118 C  CG2 . VAL A 1 147 ? -4.875  4.619   16.116  1.00  27.36 ? 146 VAL A CG2 1 
ATOM   1119 N  N   . VAL A 1 148 ? -1.945  8.233   16.234  1.00  25.90 ? 147 VAL A N   1 
ATOM   1120 C  CA  . VAL A 1 148 ? -0.956  9.200   16.708  1.00  25.68 ? 147 VAL A CA  1 
ATOM   1121 C  C   . VAL A 1 148 ? -1.684  10.302  17.487  1.00  25.79 ? 147 VAL A C   1 
ATOM   1122 O  O   . VAL A 1 148 ? -2.911  10.388  17.444  1.00  25.77 ? 147 VAL A O   1 
ATOM   1123 C  CB  . VAL A 1 148 ? -0.130  9.830   15.534  1.00  25.93 ? 147 VAL A CB  1 
ATOM   1124 C  CG1 . VAL A 1 148 ? 0.741   8.766   14.815  1.00  25.67 ? 147 VAL A CG1 1 
ATOM   1125 C  CG2 . VAL A 1 148 ? -1.042  10.571  14.529  1.00  25.46 ? 147 VAL A CG2 1 
ATOM   1126 N  N   . SER A 1 149 ? -0.944  11.135  18.212  1.00  25.39 ? 148 SER A N   1 
ATOM   1127 C  CA  . SER A 1 149 ? -1.573  12.335  18.767  1.00  25.40 ? 148 SER A CA  1 
ATOM   1128 C  C   . SER A 1 149 ? -0.745  13.578  18.512  1.00  25.19 ? 148 SER A C   1 
ATOM   1129 O  O   . SER A 1 149 ? 0.461   13.494  18.235  1.00  24.71 ? 148 SER A O   1 
ATOM   1130 C  CB  . SER A 1 149 ? -1.911  12.182  20.263  1.00  25.73 ? 148 SER A CB  1 
ATOM   1131 O  OG  . SER A 1 149 ? -0.775  12.383  21.078  1.00  28.23 ? 148 SER A OG  1 
ATOM   1132 N  N   . THR A 1 150 ? -1.403  14.731  18.611  1.00  25.25 ? 149 THR A N   1 
ATOM   1133 C  CA  . THR A 1 150 ? -0.746  16.025  18.436  1.00  25.07 ? 149 THR A CA  1 
ATOM   1134 C  C   . THR A 1 150 ? -1.060  16.962  19.587  1.00  24.56 ? 149 THR A C   1 
ATOM   1135 O  O   . THR A 1 150 ? -2.099  16.817  20.258  1.00  24.35 ? 149 THR A O   1 
ATOM   1136 C  CB  . THR A 1 150 ? -1.148  16.739  17.108  1.00  24.67 ? 149 THR A CB  1 
ATOM   1137 O  OG1 . THR A 1 150 ? -2.571  16.853  17.010  1.00  27.12 ? 149 THR A OG1 1 
ATOM   1138 C  CG2 . THR A 1 150 ? -0.550  16.012  15.854  1.00  25.64 ? 149 THR A CG2 1 
ATOM   1139 N  N   . ALA A 1 151 ? -0.163  17.920  19.800  1.00  24.71 ? 150 ALA A N   1 
ATOM   1140 C  CA  . ALA A 1 151 ? -0.352  19.003  20.774  1.00  24.97 ? 150 ALA A CA  1 
ATOM   1141 C  C   . ALA A 1 151 ? -1.160  20.158  20.178  1.00  25.10 ? 150 ALA A C   1 
ATOM   1142 O  O   . ALA A 1 151 ? -1.050  20.456  18.983  1.00  25.40 ? 150 ALA A O   1 
ATOM   1143 C  CB  . ALA A 1 151 ? 1.019   19.517  21.274  1.00  24.85 ? 150 ALA A CB  1 
ATOM   1144 N  N   . ASN A 1 152 ? -1.998  20.770  21.014  1.00  24.72 ? 151 ASN A N   1 
ATOM   1145 C  CA  . ASN A 1 152 ? -2.700  22.011  20.697  1.00  24.50 ? 151 ASN A CA  1 
ATOM   1146 C  C   . ASN A 1 152 ? -3.509  21.922  19.404  1.00  24.73 ? 151 ASN A C   1 
ATOM   1147 O  O   . ASN A 1 152 ? -4.399  21.079  19.323  1.00  24.28 ? 151 ASN A O   1 
ATOM   1148 C  CB  . ASN A 1 152 ? -1.725  23.199  20.757  1.00  24.57 ? 151 ASN A CB  1 
ATOM   1149 C  CG  . ASN A 1 152 ? -0.992  23.245  22.080  1.00  25.34 ? 151 ASN A CG  1 
ATOM   1150 O  OD1 . ASN A 1 152 ? -1.578  22.925  23.116  1.00  26.11 ? 151 ASN A OD1 1 
ATOM   1151 N  ND2 . ASN A 1 152 ? 0.287   23.613  22.058  1.00  24.21 ? 151 ASN A ND2 1 
ATOM   1152 N  N   . GLN A 1 153 ? -3.214  22.758  18.408  1.00  25.18 ? 152 GLN A N   1 
ATOM   1153 C  CA  . GLN A 1 153 ? -3.920  22.628  17.115  1.00  25.92 ? 152 GLN A CA  1 
ATOM   1154 C  C   . GLN A 1 153 ? -3.042  22.077  16.003  1.00  26.34 ? 152 GLN A C   1 
ATOM   1155 O  O   . GLN A 1 153 ? -3.337  22.260  14.826  1.00  27.03 ? 152 GLN A O   1 
ATOM   1156 C  CB  . GLN A 1 153 ? -4.597  23.929  16.692  1.00  26.06 ? 152 GLN A CB  1 
ATOM   1157 C  CG  . GLN A 1 153 ? -5.672  24.416  17.670  1.00  25.70 ? 152 GLN A CG  1 
ATOM   1158 C  CD  . GLN A 1 153 ? -6.847  23.452  17.827  1.00  27.40 ? 152 GLN A CD  1 
ATOM   1159 O  OE1 . GLN A 1 153 ? -7.042  22.545  17.017  1.00  26.57 ? 152 GLN A OE1 1 
ATOM   1160 N  NE2 . GLN A 1 153 ? -7.650  23.668  18.868  1.00  27.89 ? 152 GLN A NE2 1 
ATOM   1161 N  N   . ASP A 1 154 ? -1.974  21.384  16.374  1.00  26.72 ? 153 ASP A N   1 
ATOM   1162 C  CA  . ASP A 1 154 ? -1.139  20.730  15.377  1.00  27.56 ? 153 ASP A CA  1 
ATOM   1163 C  C   . ASP A 1 154 ? -1.916  19.602  14.698  1.00  26.94 ? 153 ASP A C   1 
ATOM   1164 O  O   . ASP A 1 154 ? -2.861  19.039  15.261  1.00  28.01 ? 153 ASP A O   1 
ATOM   1165 C  CB  . ASP A 1 154 ? 0.191   20.221  15.973  1.00  27.33 ? 153 ASP A CB  1 
ATOM   1166 C  CG  . ASP A 1 154 ? 1.069   21.348  16.528  1.00  29.30 ? 153 ASP A CG  1 
ATOM   1167 O  OD1 . ASP A 1 154 ? 0.770   22.545  16.292  1.00  31.05 ? 153 ASP A OD1 1 
ATOM   1168 O  OD2 . ASP A 1 154 ? 2.075   21.040  17.208  1.00  29.68 ? 153 ASP A OD2 1 
ATOM   1169 N  N   . ASN A 1 155 ? -1.516  19.307  13.467  1.00  27.03 ? 154 ASN A N   1 
ATOM   1170 C  CA  . ASN A 1 155 ? -2.185  18.326  12.626  1.00  26.86 ? 154 ASN A CA  1 
ATOM   1171 C  C   . ASN A 1 155 ? -1.083  17.522  11.947  1.00  26.36 ? 154 ASN A C   1 
ATOM   1172 O  O   . ASN A 1 155 ? -0.086  18.102  11.522  1.00  25.68 ? 154 ASN A O   1 
ATOM   1173 C  CB  . ASN A 1 155 ? -3.063  19.069  11.599  1.00  27.09 ? 154 ASN A CB  1 
ATOM   1174 C  CG  . ASN A 1 155 ? -3.867  18.137  10.714  1.00  28.23 ? 154 ASN A CG  1 
ATOM   1175 O  OD1 . ASN A 1 155 ? -3.308  17.381  9.926   1.00  26.86 ? 154 ASN A OD1 1 
ATOM   1176 N  ND2 . ASN A 1 155 ? -5.192  18.200  10.832  1.00  27.33 ? 154 ASN A ND2 1 
ATOM   1177 N  N   . PRO A 1 156 ? -1.246  16.179  11.844  1.00  26.31 ? 155 PRO A N   1 
ATOM   1178 C  CA  . PRO A 1 156 ? -0.234  15.360  11.165  1.00  26.31 ? 155 PRO A CA  1 
ATOM   1179 C  C   . PRO A 1 156 ? 0.125   15.802  9.733   1.00  26.36 ? 155 PRO A C   1 
ATOM   1180 O  O   . PRO A 1 156 ? 1.221   15.512  9.282   1.00  26.24 ? 155 PRO A O   1 
ATOM   1181 C  CB  . PRO A 1 156 ? -0.860  13.964  11.151  1.00  26.04 ? 155 PRO A CB  1 
ATOM   1182 C  CG  . PRO A 1 156 ? -1.738  13.948  12.349  1.00  26.68 ? 155 PRO A CG  1 
ATOM   1183 C  CD  . PRO A 1 156 ? -2.348  15.340  12.352  1.00  26.24 ? 155 PRO A CD  1 
ATOM   1184 N  N   . LEU A 1 157 ? -0.771  16.501  9.039   1.00  26.92 ? 156 LEU A N   1 
ATOM   1185 C  CA  . LEU A 1 157 ? -0.450  17.042  7.691   1.00  26.86 ? 156 LEU A CA  1 
ATOM   1186 C  C   . LEU A 1 157 ? 0.674   18.072  7.708   1.00  27.27 ? 156 LEU A C   1 
ATOM   1187 O  O   . LEU A 1 157 ? 1.327   18.299  6.676   1.00  26.56 ? 156 LEU A O   1 
ATOM   1188 C  CB  . LEU A 1 157 ? -1.683  17.687  7.050   1.00  27.27 ? 156 LEU A CB  1 
ATOM   1189 C  CG  . LEU A 1 157 ? -2.856  16.775  6.669   1.00  27.99 ? 156 LEU A CG  1 
ATOM   1190 C  CD1 . LEU A 1 157 ? -4.069  17.617  6.297   1.00  28.52 ? 156 LEU A CD1 1 
ATOM   1191 C  CD2 . LEU A 1 157 ? -2.491  15.798  5.542   1.00  26.67 ? 156 LEU A CD2 1 
ATOM   1192 N  N   . MET A 1 158 ? 0.895   18.703  8.864   1.00  26.88 ? 157 MET A N   1 
ATOM   1193 C  CA  . MET A 1 158 ? 1.978   19.676  9.008   1.00  27.67 ? 157 MET A CA  1 
ATOM   1194 C  C   . MET A 1 158 ? 3.354   19.033  8.891   1.00  28.21 ? 157 MET A C   1 
ATOM   1195 O  O   . MET A 1 158 ? 4.336   19.724  8.646   1.00  27.89 ? 157 MET A O   1 
ATOM   1196 C  CB  . MET A 1 158 ? 1.886   20.436  10.331  1.00  27.16 ? 157 MET A CB  1 
ATOM   1197 C  CG  . MET A 1 158 ? 0.624   21.253  10.489  1.00  26.44 ? 157 MET A CG  1 
ATOM   1198 S  SD  . MET A 1 158 ? 0.513   21.896  12.155  1.00  28.03 ? 157 MET A SD  1 
ATOM   1199 C  CE  . MET A 1 158 ? -1.065  22.752  12.067  1.00  26.55 ? 157 MET A CE  1 
ATOM   1200 N  N   . GLY A 1 159 ? 3.423   17.718  9.090   1.00  28.98 ? 158 GLY A N   1 
ATOM   1201 C  CA  . GLY A 1 159 ? 4.688   16.989  8.930   1.00  29.90 ? 158 GLY A CA  1 
ATOM   1202 C  C   . GLY A 1 159 ? 5.355   16.764  10.269  1.00  30.62 ? 158 GLY A C   1 
ATOM   1203 O  O   . GLY A 1 159 ? 4.996   17.394  11.277  1.00  30.66 ? 158 GLY A O   1 
ATOM   1204 N  N   . GLU A 1 160 ? 6.323   15.858  10.291  1.00  31.02 ? 159 GLU A N   1 
ATOM   1205 C  CA  . GLU A 1 160 ? 6.938   15.445  11.549  1.00  32.17 ? 159 GLU A CA  1 
ATOM   1206 C  C   . GLU A 1 160 ? 7.655   16.578  12.287  1.00  31.66 ? 159 GLU A C   1 
ATOM   1207 O  O   . GLU A 1 160 ? 7.581   16.665  13.514  1.00  31.40 ? 159 GLU A O   1 
ATOM   1208 C  CB  . GLU A 1 160 ? 7.890   14.263  11.331  1.00  33.05 ? 159 GLU A CB  1 
ATOM   1209 C  CG  . GLU A 1 160 ? 8.011   13.376  12.566  1.00  36.36 ? 159 GLU A CG  1 
ATOM   1210 C  CD  . GLU A 1 160 ? 9.114   12.343  12.451  1.00  40.35 ? 159 GLU A CD  1 
ATOM   1211 O  OE1 . GLU A 1 160 ? 9.106   11.556  11.474  1.00  42.15 ? 159 GLU A OE1 1 
ATOM   1212 O  OE2 . GLU A 1 160 ? 9.985   12.312  13.351  1.00  42.58 ? 159 GLU A OE2 1 
ATOM   1213 N  N   . ALA A 1 161 ? 8.345   17.446  11.551  1.00  31.61 ? 160 ALA A N   1 
ATOM   1214 C  CA  . ALA A 1 161 ? 9.160   18.485  12.184  1.00  31.66 ? 160 ALA A CA  1 
ATOM   1215 C  C   . ALA A 1 161 ? 8.324   19.467  13.008  1.00  31.94 ? 160 ALA A C   1 
ATOM   1216 O  O   . ALA A 1 161 ? 8.754   19.897  14.081  1.00  32.26 ? 160 ALA A O   1 
ATOM   1217 C  CB  . ALA A 1 161 ? 10.024  19.220  11.155  1.00  31.95 ? 160 ALA A CB  1 
ATOM   1218 N  N   . ILE A 1 162 ? 7.126   19.798  12.529  1.00  31.56 ? 161 ILE A N   1 
ATOM   1219 C  CA  . ILE A 1 162 ? 6.249   20.716  13.261  1.00  31.36 ? 161 ILE A CA  1 
ATOM   1220 C  C   . ILE A 1 162 ? 5.394   19.962  14.288  1.00  31.03 ? 161 ILE A C   1 
ATOM   1221 O  O   . ILE A 1 162 ? 5.395   20.311  15.471  1.00  30.90 ? 161 ILE A O   1 
ATOM   1222 C  CB  . ILE A 1 162 ? 5.334   21.550  12.311  1.00  31.25 ? 161 ILE A CB  1 
ATOM   1223 C  CG1 . ILE A 1 162 ? 6.175   22.427  11.370  1.00  32.94 ? 161 ILE A CG1 1 
ATOM   1224 C  CG2 . ILE A 1 162 ? 4.355   22.412  13.123  1.00  32.15 ? 161 ILE A CG2 1 
ATOM   1225 C  CD1 . ILE A 1 162 ? 5.385   23.021  10.200  1.00  32.46 ? 161 ILE A CD1 1 
ATOM   1226 N  N   . ALA A 1 163 ? 4.692   18.926  13.830  1.00  30.25 ? 162 ALA A N   1 
ATOM   1227 C  CA  . ALA A 1 163 ? 3.662   18.257  14.636  1.00  30.26 ? 162 ALA A CA  1 
ATOM   1228 C  C   . ALA A 1 163 ? 4.171   17.083  15.466  1.00  29.92 ? 162 ALA A C   1 
ATOM   1229 O  O   . ALA A 1 163 ? 3.469   16.609  16.374  1.00  30.24 ? 162 ALA A O   1 
ATOM   1230 C  CB  . ALA A 1 163 ? 2.504   17.829  13.761  1.00  30.01 ? 162 ALA A CB  1 
ATOM   1231 N  N   . GLY A 1 164 ? 5.373   16.606  15.151  1.00  29.64 ? 163 GLY A N   1 
ATOM   1232 C  CA  . GLY A 1 164 ? 5.966   15.483  15.869  1.00  29.47 ? 163 GLY A CA  1 
ATOM   1233 C  C   . GLY A 1 164 ? 5.547   14.131  15.322  1.00  29.27 ? 163 GLY A C   1 
ATOM   1234 O  O   . GLY A 1 164 ? 6.107   13.110  15.708  1.00  29.34 ? 163 GLY A O   1 
ATOM   1235 N  N   . VAL A 1 165 ? 4.550   14.133  14.436  1.00  29.65 ? 164 VAL A N   1 
ATOM   1236 C  CA  . VAL A 1 165 ? 4.037   12.928  13.765  1.00  29.93 ? 164 VAL A CA  1 
ATOM   1237 C  C   . VAL A 1 165 ? 3.603   13.282  12.344  1.00  30.24 ? 164 VAL A C   1 
ATOM   1238 O  O   . VAL A 1 165 ? 3.564   14.457  11.980  1.00  30.27 ? 164 VAL A O   1 
ATOM   1239 C  CB  . VAL A 1 165 ? 2.839   12.273  14.522  1.00  29.69 ? 164 VAL A CB  1 
ATOM   1240 C  CG1 . VAL A 1 165 ? 3.283   11.706  15.872  1.00  29.88 ? 164 VAL A CG1 1 
ATOM   1241 C  CG2 . VAL A 1 165 ? 1.693   13.264  14.703  1.00  30.39 ? 164 VAL A CG2 1 
ATOM   1242 N  N   . SER A 1 166 ? 3.258   12.272  11.545  1.00  30.55 ? 165 SER A N   1 
ATOM   1243 C  CA  . SER A 1 166 ? 2.851   12.520  10.155  1.00  31.08 ? 165 SER A CA  1 
ATOM   1244 C  C   . SER A 1 166 ? 1.817   11.527  9.639   1.00  30.61 ? 165 SER A C   1 
ATOM   1245 O  O   . SER A 1 166 ? 1.416   10.613  10.347  1.00  31.54 ? 165 SER A O   1 
ATOM   1246 C  CB  . SER A 1 166 ? 4.078   12.526  9.236   1.00  30.94 ? 165 SER A CB  1 
ATOM   1247 O  OG  . SER A 1 166 ? 4.740   11.277  9.281   1.00  32.69 ? 165 SER A OG  1 
ATOM   1248 N  N   . GLY A 1 167 ? 1.396   11.712  8.394   1.00  30.51 ? 166 GLY A N   1 
ATOM   1249 C  CA  . GLY A 1 167 ? 0.353   10.878  7.800   1.00  29.91 ? 166 GLY A CA  1 
ATOM   1250 C  C   . GLY A 1 167 ? -0.862  11.723  7.491   1.00  29.88 ? 166 GLY A C   1 
ATOM   1251 O  O   . GLY A 1 167 ? -0.947  12.870  7.939   1.00  29.93 ? 166 GLY A O   1 
ATOM   1252 N  N   . THR A 1 168 ? -1.796  11.159  6.723   1.00  29.60 ? 167 THR A N   1 
ATOM   1253 C  CA  . THR A 1 168 ? -3.035  11.840  6.361   1.00  29.55 ? 167 THR A CA  1 
ATOM   1254 C  C   . THR A 1 168 ? -4.147  11.438  7.329   1.00  29.08 ? 167 THR A C   1 
ATOM   1255 O  O   . THR A 1 168 ? -4.525  10.266  7.375   1.00  27.75 ? 167 THR A O   1 
ATOM   1256 C  CB  . THR A 1 168 ? -3.473  11.462  4.932   1.00  29.88 ? 167 THR A CB  1 
ATOM   1257 O  OG1 . THR A 1 168 ? -2.448  11.840  4.010   1.00  31.21 ? 167 THR A OG1 1 
ATOM   1258 C  CG2 . THR A 1 168 ? -4.791  12.163  4.553   1.00  30.42 ? 167 THR A CG2 1 
ATOM   1259 N  N   . PRO A 1 169 ? -4.685  12.410  8.091   1.00  29.17 ? 168 PRO A N   1 
ATOM   1260 C  CA  . PRO A 1 169 ? -5.727  12.037  9.047   1.00  28.77 ? 168 PRO A CA  1 
ATOM   1261 C  C   . PRO A 1 169 ? -7.026  11.689  8.332   1.00  28.58 ? 168 PRO A C   1 
ATOM   1262 O  O   . PRO A 1 169 ? -7.393  12.344  7.338   1.00  28.50 ? 168 PRO A O   1 
ATOM   1263 C  CB  . PRO A 1 169 ? -5.913  13.295  9.906   1.00  29.49 ? 168 PRO A CB  1 
ATOM   1264 C  CG  . PRO A 1 169 ? -4.813  14.257  9.491   1.00  29.50 ? 168 PRO A CG  1 
ATOM   1265 C  CD  . PRO A 1 169 ? -4.403  13.859  8.109   1.00  29.58 ? 168 PRO A CD  1 
ATOM   1266 N  N   . ILE A 1 170 ? -7.703  10.660  8.826   1.00  26.74 ? 169 ILE A N   1 
ATOM   1267 C  CA  . ILE A 1 170 ? -9.015  10.290  8.302   1.00  26.35 ? 169 ILE A CA  1 
ATOM   1268 C  C   . ILE A 1 170 ? -10.053 10.291  9.427   1.00  26.41 ? 169 ILE A C   1 
ATOM   1269 O  O   . ILE A 1 170 ? -11.259 10.267  9.177   1.00  26.66 ? 169 ILE A O   1 
ATOM   1270 C  CB  . ILE A 1 170 ? -8.976  8.935   7.580   1.00  26.54 ? 169 ILE A CB  1 
ATOM   1271 C  CG1 . ILE A 1 170 ? -8.591  7.818   8.553   1.00  24.82 ? 169 ILE A CG1 1 
ATOM   1272 C  CG2 . ILE A 1 170 ? -8.009  9.003   6.354   1.00  25.85 ? 169 ILE A CG2 1 
ATOM   1273 C  CD1 . ILE A 1 170 ? -8.813  6.424   7.957   1.00  26.66 ? 169 ILE A CD1 1 
ATOM   1274 N  N   . LEU A 1 171 ? -9.569  10.329  10.666  1.00  25.74 ? 170 LEU A N   1 
ATOM   1275 C  CA  . LEU A 1 171 ? -10.438 10.502  11.830  1.00  25.98 ? 170 LEU A CA  1 
ATOM   1276 C  C   . LEU A 1 171 ? -9.638  11.199  12.918  1.00  25.69 ? 170 LEU A C   1 
ATOM   1277 O  O   . LEU A 1 171 ? -8.458  10.914  13.095  1.00  25.73 ? 170 LEU A O   1 
ATOM   1278 C  CB  . LEU A 1 171 ? -10.940 9.143   12.352  1.00  24.92 ? 170 LEU A CB  1 
ATOM   1279 C  CG  . LEU A 1 171 ? -11.717 9.107   13.678  1.00  26.94 ? 170 LEU A CG  1 
ATOM   1280 C  CD1 . LEU A 1 171 ? -13.050 9.801   13.526  1.00  26.57 ? 170 LEU A CD1 1 
ATOM   1281 C  CD2 . LEU A 1 171 ? -11.935 7.691   14.147  1.00  26.72 ? 170 LEU A CD2 1 
ATOM   1282 N  N   . GLY A 1 172 ? -10.293 12.082  13.665  1.00  25.68 ? 171 GLY A N   1 
ATOM   1283 C  CA  . GLY A 1 172 ? -9.648  12.759  14.788  1.00  25.90 ? 171 GLY A CA  1 
ATOM   1284 C  C   . GLY A 1 172 ? -10.668 13.081  15.861  1.00  27.12 ? 171 GLY A C   1 
ATOM   1285 O  O   . GLY A 1 172 ? -11.844 13.286  15.557  1.00  26.62 ? 171 GLY A O   1 
ATOM   1286 N  N   . VAL A 1 173 ? -10.208 13.113  17.111  1.00  26.37 ? 172 VAL A N   1 
ATOM   1287 C  CA  . VAL A 1 173 ? -11.047 13.502  18.226  1.00  25.96 ? 172 VAL A CA  1 
ATOM   1288 C  C   . VAL A 1 173 ? -10.334 14.644  18.946  1.00  26.13 ? 172 VAL A C   1 
ATOM   1289 O  O   . VAL A 1 173 ? -9.119  14.588  19.179  1.00  25.68 ? 172 VAL A O   1 
ATOM   1290 C  CB  . VAL A 1 173 ? -11.347 12.313  19.183  1.00  26.57 ? 172 VAL A CB  1 
ATOM   1291 C  CG1 . VAL A 1 173 ? -10.058 11.779  19.862  1.00  25.14 ? 172 VAL A CG1 1 
ATOM   1292 C  CG2 . VAL A 1 173 ? -12.384 12.710  20.230  1.00  25.75 ? 172 VAL A CG2 1 
ATOM   1293 N  N   . ASP A 1 174 ? -11.102 15.692  19.225  1.00  25.05 ? 173 ASP A N   1 
ATOM   1294 C  CA  . ASP A 1 174 ? -10.659 16.853  19.977  1.00  25.24 ? 173 ASP A CA  1 
ATOM   1295 C  C   . ASP A 1 174 ? -10.589 16.488  21.471  1.00  24.86 ? 173 ASP A C   1 
ATOM   1296 O  O   . ASP A 1 174 ? -11.607 16.133  22.077  1.00  24.73 ? 173 ASP A O   1 
ATOM   1297 C  CB  . ASP A 1 174 ? -11.682 17.975  19.774  1.00  24.99 ? 173 ASP A CB  1 
ATOM   1298 C  CG  . ASP A 1 174 ? -11.171 19.327  20.222  1.00  26.53 ? 173 ASP A CG  1 
ATOM   1299 O  OD1 . ASP A 1 174 ? -10.081 19.415  20.846  1.00  24.77 ? 173 ASP A OD1 1 
ATOM   1300 O  OD2 . ASP A 1 174 ? -11.873 20.324  19.940  1.00  27.34 ? 173 ASP A OD2 1 
ATOM   1301 N  N   . VAL A 1 175 ? -9.411  16.588  22.072  1.00  24.23 ? 174 VAL A N   1 
ATOM   1302 C  CA  . VAL A 1 175 ? -9.308  16.394  23.539  1.00  24.29 ? 174 VAL A CA  1 
ATOM   1303 C  C   . VAL A 1 175 ? -8.872  17.659  24.290  1.00  24.20 ? 174 VAL A C   1 
ATOM   1304 O  O   . VAL A 1 175 ? -8.386  17.593  25.421  1.00  24.86 ? 174 VAL A O   1 
ATOM   1305 C  CB  . VAL A 1 175 ? -8.423  15.161  23.947  1.00  25.07 ? 174 VAL A CB  1 
ATOM   1306 C  CG1 . VAL A 1 175 ? -9.061  13.854  23.478  1.00  25.72 ? 174 VAL A CG1 1 
ATOM   1307 C  CG2 . VAL A 1 175 ? -6.988  15.303  23.440  1.00  25.77 ? 174 VAL A CG2 1 
ATOM   1308 N  N   . TRP A 1 176 ? -9.043  18.824  23.670  1.00  23.91 ? 175 TRP A N   1 
ATOM   1309 C  CA  . TRP A 1 176 ? -9.030  20.058  24.455  1.00  24.14 ? 175 TRP A CA  1 
ATOM   1310 C  C   . TRP A 1 176 ? -10.166 19.913  25.443  1.00  24.24 ? 175 TRP A C   1 
ATOM   1311 O  O   . TRP A 1 176 ? -11.216 19.349  25.091  1.00  24.02 ? 175 TRP A O   1 
ATOM   1312 C  CB  . TRP A 1 176 ? -9.315  21.270  23.584  1.00  24.31 ? 175 TRP A CB  1 
ATOM   1313 C  CG  . TRP A 1 176 ? -8.145  21.704  22.753  1.00  23.74 ? 175 TRP A CG  1 
ATOM   1314 C  CD1 . TRP A 1 176 ? -7.480  20.955  21.820  1.00  24.35 ? 175 TRP A CD1 1 
ATOM   1315 C  CD2 . TRP A 1 176 ? -7.522  22.994  22.762  1.00  24.71 ? 175 TRP A CD2 1 
ATOM   1316 N  NE1 . TRP A 1 176 ? -6.474  21.695  21.256  1.00  24.65 ? 175 TRP A NE1 1 
ATOM   1317 C  CE2 . TRP A 1 176 ? -6.474  22.952  21.810  1.00  24.84 ? 175 TRP A CE2 1 
ATOM   1318 C  CE3 . TRP A 1 176 ? -7.730  24.175  23.498  1.00  23.63 ? 175 TRP A CE3 1 
ATOM   1319 C  CZ2 . TRP A 1 176 ? -5.647  24.056  21.546  1.00  25.18 ? 175 TRP A CZ2 1 
ATOM   1320 C  CZ3 . TRP A 1 176 ? -6.903  25.287  23.235  1.00  24.64 ? 175 TRP A CZ3 1 
ATOM   1321 C  CH2 . TRP A 1 176 ? -5.869  25.209  22.263  1.00  24.39 ? 175 TRP A CH2 1 
ATOM   1322 N  N   . GLU A 1 177 ? -9.973  20.413  26.661  1.00  23.92 ? 176 GLU A N   1 
ATOM   1323 C  CA  . GLU A 1 177 ? -11.038 20.330  27.670  1.00  24.73 ? 176 GLU A CA  1 
ATOM   1324 C  C   . GLU A 1 177 ? -12.340 21.020  27.246  1.00  24.99 ? 176 GLU A C   1 
ATOM   1325 O  O   . GLU A 1 177 ? -13.413 20.553  27.601  1.00  24.57 ? 176 GLU A O   1 
ATOM   1326 C  CB  . GLU A 1 177 ? -10.547 20.789  29.049  1.00  24.61 ? 176 GLU A CB  1 
ATOM   1327 C  CG  . GLU A 1 177 ? -9.513  19.785  29.628  1.00  25.10 ? 176 GLU A CG  1 
ATOM   1328 C  CD  . GLU A 1 177 ? -8.809  20.248  30.886  1.00  25.27 ? 176 GLU A CD  1 
ATOM   1329 O  OE1 . GLU A 1 177 ? -8.468  21.449  30.988  1.00  25.11 ? 176 GLU A OE1 1 
ATOM   1330 O  OE2 . GLU A 1 177 ? -8.569  19.386  31.762  1.00  26.37 ? 176 GLU A OE2 1 
ATOM   1331 N  N   . HIS A 1 178 ? -12.259 22.092  26.457  1.00  24.94 ? 177 HIS A N   1 
ATOM   1332 C  CA  . HIS A 1 178 ? -13.497 22.717  25.948  1.00  24.99 ? 177 HIS A CA  1 
ATOM   1333 C  C   . HIS A 1 178 ? -14.406 21.751  25.169  1.00  25.15 ? 177 HIS A C   1 
ATOM   1334 O  O   . HIS A 1 178 ? -15.635 21.937  25.143  1.00  24.17 ? 177 HIS A O   1 
ATOM   1335 C  CB  . HIS A 1 178 ? -13.229 24.006  25.151  1.00  25.37 ? 177 HIS A CB  1 
ATOM   1336 C  CG  . HIS A 1 178 ? -12.527 23.800  23.843  1.00  25.05 ? 177 HIS A CG  1 
ATOM   1337 N  ND1 . HIS A 1 178 ? -11.297 24.364  23.569  1.00  27.61 ? 177 HIS A ND1 1 
ATOM   1338 C  CD2 . HIS A 1 178 ? -12.895 23.132  22.722  1.00  26.27 ? 177 HIS A CD2 1 
ATOM   1339 C  CE1 . HIS A 1 178 ? -10.937 24.045  22.337  1.00  26.76 ? 177 HIS A CE1 1 
ATOM   1340 N  NE2 . HIS A 1 178 ? -11.893 23.302  21.802  1.00  26.75 ? 177 HIS A NE2 1 
ATOM   1341 N  N   . ALA A 1 179 ? -13.814 20.716  24.571  1.00  23.91 ? 178 ALA A N   1 
ATOM   1342 C  CA  . ALA A 1 179 ? -14.598 19.727  23.798  1.00  24.09 ? 178 ALA A CA  1 
ATOM   1343 C  C   . ALA A 1 179 ? -15.478 18.815  24.661  1.00  24.18 ? 178 ALA A C   1 
ATOM   1344 O  O   . ALA A 1 179 ? -16.444 18.227  24.144  1.00  24.96 ? 178 ALA A O   1 
ATOM   1345 C  CB  . ALA A 1 179 ? -13.693 18.903  22.885  1.00  23.33 ? 178 ALA A CB  1 
ATOM   1346 N  N   . TYR A 1 180 ? -15.169 18.705  25.957  1.00  23.50 ? 179 TYR A N   1 
ATOM   1347 C  CA  . TYR A 1 180 ? -15.867 17.743  26.828  1.00  23.84 ? 179 TYR A CA  1 
ATOM   1348 C  C   . TYR A 1 180 ? -16.194 18.193  28.253  1.00  23.58 ? 179 TYR A C   1 
ATOM   1349 O  O   . TYR A 1 180 ? -16.924 17.501  28.957  1.00  23.30 ? 179 TYR A O   1 
ATOM   1350 C  CB  . TYR A 1 180 ? -15.116 16.401  26.885  1.00  24.05 ? 179 TYR A CB  1 
ATOM   1351 C  CG  . TYR A 1 180 ? -13.717 16.433  27.503  1.00  24.16 ? 179 TYR A CG  1 
ATOM   1352 C  CD1 . TYR A 1 180 ? -13.530 16.286  28.882  1.00  23.75 ? 179 TYR A CD1 1 
ATOM   1353 C  CD2 . TYR A 1 180 ? -12.582 16.562  26.696  1.00  23.08 ? 179 TYR A CD2 1 
ATOM   1354 C  CE1 . TYR A 1 180 ? -12.239 16.300  29.444  1.00  23.16 ? 179 TYR A CE1 1 
ATOM   1355 C  CE2 . TYR A 1 180 ? -11.297 16.557  27.237  1.00  23.73 ? 179 TYR A CE2 1 
ATOM   1356 C  CZ  . TYR A 1 180 ? -11.133 16.430  28.608  1.00  23.84 ? 179 TYR A CZ  1 
ATOM   1357 O  OH  . TYR A 1 180 ? -9.867  16.424  29.142  1.00  24.84 ? 179 TYR A OH  1 
ATOM   1358 N  N   . TYR A 1 181 ? -15.644 19.330  28.685  1.00  23.17 ? 180 TYR A N   1 
ATOM   1359 C  CA  . TYR A 1 181 ? -15.754 19.724  30.096  1.00  23.66 ? 180 TYR A CA  1 
ATOM   1360 C  C   . TYR A 1 181 ? -17.177 19.998  30.631  1.00  24.40 ? 180 TYR A C   1 
ATOM   1361 O  O   . TYR A 1 181 ? -17.493 19.687  31.791  1.00  23.27 ? 180 TYR A O   1 
ATOM   1362 C  CB  . TYR A 1 181 ? -14.799 20.874  30.447  1.00  23.58 ? 180 TYR A CB  1 
ATOM   1363 C  CG  . TYR A 1 181 ? -14.235 20.654  31.829  1.00  23.63 ? 180 TYR A CG  1 
ATOM   1364 C  CD1 . TYR A 1 181 ? -13.211 19.732  32.028  1.00  24.45 ? 180 TYR A CD1 1 
ATOM   1365 C  CD2 . TYR A 1 181 ? -14.743 21.326  32.929  1.00  22.86 ? 180 TYR A CD2 1 
ATOM   1366 C  CE1 . TYR A 1 181 ? -12.700 19.480  33.291  1.00  23.06 ? 180 TYR A CE1 1 
ATOM   1367 C  CE2 . TYR A 1 181 ? -14.234 21.087  34.212  1.00  23.46 ? 180 TYR A CE2 1 
ATOM   1368 C  CZ  . TYR A 1 181 ? -13.213 20.148  34.377  1.00  23.18 ? 180 TYR A CZ  1 
ATOM   1369 O  OH  . TYR A 1 181 ? -12.700 19.886  35.630  1.00  22.52 ? 180 TYR A OH  1 
ATOM   1370 N  N   . LEU A 1 182 ? -18.036 20.584  29.802  1.00  24.83 ? 181 LEU A N   1 
ATOM   1371 C  CA  . LEU A 1 182 ? -19.386 20.908  30.277  1.00  25.94 ? 181 LEU A CA  1 
ATOM   1372 C  C   . LEU A 1 182 ? -20.181 19.652  30.618  1.00  26.34 ? 181 LEU A C   1 
ATOM   1373 O  O   . LEU A 1 182 ? -20.875 19.621  31.630  1.00  27.19 ? 181 LEU A O   1 
ATOM   1374 C  CB  . LEU A 1 182 ? -20.143 21.792  29.279  1.00  26.01 ? 181 LEU A CB  1 
ATOM   1375 C  CG  . LEU A 1 182 ? -19.660 23.238  29.091  1.00  26.84 ? 181 LEU A CG  1 
ATOM   1376 C  CD1 . LEU A 1 182 ? -20.532 23.941  28.064  1.00  27.43 ? 181 LEU A CD1 1 
ATOM   1377 C  CD2 . LEU A 1 182 ? -19.635 24.017  30.401  1.00  24.56 ? 181 LEU A CD2 1 
ATOM   1378 N  N   . ASN A 1 183 ? -20.027 18.615  29.798  1.00  27.10 ? 182 ASN A N   1 
ATOM   1379 C  CA  . ASN A 1 183 ? -20.804 17.361  29.897  1.00  27.41 ? 182 ASN A CA  1 
ATOM   1380 C  C   . ASN A 1 183 ? -20.092 16.298  30.744  1.00  26.90 ? 182 ASN A C   1 
ATOM   1381 O  O   . ASN A 1 183 ? -20.752 15.516  31.431  1.00  27.34 ? 182 ASN A O   1 
ATOM   1382 C  CB  . ASN A 1 183 ? -21.063 16.807  28.475  1.00  27.85 ? 182 ASN A CB  1 
ATOM   1383 C  CG  . ASN A 1 183 ? -22.317 15.941  28.371  1.00  31.31 ? 182 ASN A CG  1 
ATOM   1384 O  OD1 . ASN A 1 183 ? -23.223 16.020  29.199  1.00  33.96 ? 182 ASN A OD1 1 
ATOM   1385 N  ND2 . ASN A 1 183 ? -22.387 15.136  27.306  1.00  33.36 ? 182 ASN A ND2 1 
ATOM   1386 N  N   . TYR A 1 184 ? -18.754 16.277  30.708  1.00  25.16 ? 183 TYR A N   1 
ATOM   1387 C  CA  . TYR A 1 184 ? -17.976 15.184  31.318  1.00  24.36 ? 183 TYR A CA  1 
ATOM   1388 C  C   . TYR A 1 184 ? -16.983 15.622  32.388  1.00  24.18 ? 183 TYR A C   1 
ATOM   1389 O  O   . TYR A 1 184 ? -16.420 14.779  33.098  1.00  23.34 ? 183 TYR A O   1 
ATOM   1390 C  CB  . TYR A 1 184 ? -17.213 14.393  30.244  1.00  24.52 ? 183 TYR A CB  1 
ATOM   1391 C  CG  . TYR A 1 184 ? -18.121 13.713  29.259  1.00  24.32 ? 183 TYR A CG  1 
ATOM   1392 C  CD1 . TYR A 1 184 ? -18.427 14.314  28.051  1.00  24.76 ? 183 TYR A CD1 1 
ATOM   1393 C  CD2 . TYR A 1 184 ? -18.716 12.485  29.566  1.00  25.19 ? 183 TYR A CD2 1 
ATOM   1394 C  CE1 . TYR A 1 184 ? -19.276 13.695  27.136  1.00  24.93 ? 183 TYR A CE1 1 
ATOM   1395 C  CE2 . TYR A 1 184 ? -19.581 11.859  28.670  1.00  27.08 ? 183 TYR A CE2 1 
ATOM   1396 C  CZ  . TYR A 1 184 ? -19.858 12.475  27.458  1.00  26.77 ? 183 TYR A CZ  1 
ATOM   1397 O  OH  . TYR A 1 184 ? -20.719 11.868  26.567  1.00  25.84 ? 183 TYR A OH  1 
ATOM   1398 N  N   . GLN A 1 185 ? -16.759 16.931  32.484  1.00  24.03 ? 184 GLN A N   1 
ATOM   1399 C  CA  . GLN A 1 185 ? -15.749 17.495  33.386  1.00  24.13 ? 184 GLN A CA  1 
ATOM   1400 C  C   . GLN A 1 185 ? -14.411 16.763  33.219  1.00  24.21 ? 184 GLN A C   1 
ATOM   1401 O  O   . GLN A 1 185 ? -13.932 16.638  32.098  1.00  23.84 ? 184 GLN A O   1 
ATOM   1402 C  CB  . GLN A 1 185 ? -16.240 17.523  34.841  1.00  24.77 ? 184 GLN A CB  1 
ATOM   1403 C  CG  . GLN A 1 185 ? -17.498 18.359  35.048  1.00  24.54 ? 184 GLN A CG  1 
ATOM   1404 C  CD  . GLN A 1 185 ? -18.779 17.589  34.731  1.00  27.45 ? 184 GLN A CD  1 
ATOM   1405 O  OE1 . GLN A 1 185 ? -18.988 16.479  35.229  1.00  27.08 ? 184 GLN A OE1 1 
ATOM   1406 N  NE2 . GLN A 1 185 ? -19.628 18.168  33.882  1.00  25.91 ? 184 GLN A NE2 1 
ATOM   1407 N  N   . ASN A 1 186 ? -13.834 16.263  34.311  1.00  24.13 ? 185 ASN A N   1 
ATOM   1408 C  CA  . ASN A 1 186 ? -12.526 15.578  34.262  1.00  25.05 ? 185 ASN A CA  1 
ATOM   1409 C  C   . ASN A 1 186 ? -12.547 14.220  33.555  1.00  24.75 ? 185 ASN A C   1 
ATOM   1410 O  O   . ASN A 1 186 ? -11.497 13.638  33.282  1.00  25.11 ? 185 ASN A O   1 
ATOM   1411 C  CB  . ASN A 1 186 ? -11.997 15.371  35.680  1.00  25.06 ? 185 ASN A CB  1 
ATOM   1412 C  CG  . ASN A 1 186 ? -12.887 14.478  36.502  1.00  25.78 ? 185 ASN A CG  1 
ATOM   1413 O  OD1 . ASN A 1 186 ? -14.007 14.851  36.854  1.00  24.66 ? 185 ASN A OD1 1 
ATOM   1414 N  ND2 . ASN A 1 186 ? -12.391 13.292  36.836  1.00  26.74 ? 185 ASN A ND2 1 
ATOM   1415 N  N   . ARG A 1 187 ? -13.743 13.708  33.266  1.00  24.14 ? 186 ARG A N   1 
ATOM   1416 C  CA  . ARG A 1 187 ? -13.896 12.323  32.796  1.00  23.52 ? 186 ARG A CA  1 
ATOM   1417 C  C   . ARG A 1 187 ? -13.635 12.153  31.299  1.00  22.74 ? 186 ARG A C   1 
ATOM   1418 O  O   . ARG A 1 187 ? -14.500 11.717  30.548  1.00  21.88 ? 186 ARG A O   1 
ATOM   1419 C  CB  . ARG A 1 187 ? -15.291 11.797  33.177  1.00  22.83 ? 186 ARG A CB  1 
ATOM   1420 C  CG  . ARG A 1 187 ? -15.512 11.727  34.684  1.00  24.49 ? 186 ARG A CG  1 
ATOM   1421 C  CD  . ARG A 1 187 ? -16.940 11.298  35.036  1.00  25.39 ? 186 ARG A CD  1 
ATOM   1422 N  NE  . ARG A 1 187 ? -17.911 12.371  34.812  1.00  29.50 ? 186 ARG A NE  1 
ATOM   1423 C  CZ  . ARG A 1 187 ? -18.917 12.315  33.941  1.00  31.99 ? 186 ARG A CZ  1 
ATOM   1424 N  NH1 . ARG A 1 187 ? -19.098 11.237  33.181  1.00  32.39 ? 186 ARG A NH1 1 
ATOM   1425 N  NH2 . ARG A 1 187 ? -19.743 13.347  33.825  1.00  31.93 ? 186 ARG A NH2 1 
ATOM   1426 N  N   . ARG A 1 188 ? -12.422 12.483  30.863  1.00  23.39 ? 187 ARG A N   1 
ATOM   1427 C  CA  . ARG A 1 188 ? -12.080 12.347  29.455  1.00  23.85 ? 187 ARG A CA  1 
ATOM   1428 C  C   . ARG A 1 188 ? -12.346 10.934  28.895  1.00  24.36 ? 187 ARG A C   1 
ATOM   1429 O  O   . ARG A 1 188 ? -12.819 10.804  27.770  1.00  24.73 ? 187 ARG A O   1 
ATOM   1430 C  CB  . ARG A 1 188 ? -10.626 12.789  29.187  1.00  24.05 ? 187 ARG A CB  1 
ATOM   1431 C  CG  . ARG A 1 188 ? -10.313 12.849  27.697  1.00  24.41 ? 187 ARG A CG  1 
ATOM   1432 C  CD  . ARG A 1 188 ? -8.822  12.995  27.439  1.00  26.47 ? 187 ARG A CD  1 
ATOM   1433 N  NE  . ARG A 1 188 ? -8.323  14.327  27.791  1.00  26.53 ? 187 ARG A NE  1 
ATOM   1434 C  CZ  . ARG A 1 188 ? -7.070  14.729  27.584  1.00  29.15 ? 187 ARG A CZ  1 
ATOM   1435 N  NH1 . ARG A 1 188 ? -6.192  13.911  27.016  1.00  28.28 ? 187 ARG A NH1 1 
ATOM   1436 N  NH2 . ARG A 1 188 ? -6.696  15.953  27.931  1.00  29.43 ? 187 ARG A NH2 1 
ATOM   1437 N  N   . PRO A 1 189 ? -12.022 9.876   29.658  1.00  25.20 ? 188 PRO A N   1 
ATOM   1438 C  CA  . PRO A 1 189 ? -12.360 8.515   29.195  1.00  26.06 ? 188 PRO A CA  1 
ATOM   1439 C  C   . PRO A 1 189 ? -13.857 8.302   28.875  1.00  26.56 ? 188 PRO A C   1 
ATOM   1440 O  O   . PRO A 1 189 ? -14.176 7.606   27.900  1.00  26.85 ? 188 PRO A O   1 
ATOM   1441 C  CB  . PRO A 1 189 ? -11.921 7.640   30.367  1.00  26.42 ? 188 PRO A CB  1 
ATOM   1442 C  CG  . PRO A 1 189 ? -10.815 8.441   31.018  1.00  26.44 ? 188 PRO A CG  1 
ATOM   1443 C  CD  . PRO A 1 189 ? -11.288 9.842   30.939  1.00  25.49 ? 188 PRO A CD  1 
ATOM   1444 N  N   . ASP A 1 190 ? -14.752 8.900   29.662  1.00  26.23 ? 189 ASP A N   1 
ATOM   1445 C  CA  . ASP A 1 190 ? -16.207 8.790   29.414  1.00  26.53 ? 189 ASP A CA  1 
ATOM   1446 C  C   . ASP A 1 190 ? -16.598 9.488   28.105  1.00  26.09 ? 189 ASP A C   1 
ATOM   1447 O  O   . ASP A 1 190 ? -17.427 8.995   27.338  1.00  24.88 ? 189 ASP A O   1 
ATOM   1448 C  CB  . ASP A 1 190 ? -17.023 9.366   30.574  1.00  27.41 ? 189 ASP A CB  1 
ATOM   1449 C  CG  . ASP A 1 190 ? -17.073 8.443   31.799  1.00  29.36 ? 189 ASP A CG  1 
ATOM   1450 O  OD1 . ASP A 1 190 ? -16.773 7.235   31.696  1.00  31.11 ? 189 ASP A OD1 1 
ATOM   1451 O  OD2 . ASP A 1 190 ? -17.441 8.940   32.881  1.00  31.56 ? 189 ASP A OD2 1 
ATOM   1452 N  N   . TYR A 1 191 ? -15.984 10.640  27.860  1.00  25.34 ? 190 TYR A N   1 
ATOM   1453 C  CA  . TYR A 1 191 ? -16.116 11.357  26.596  1.00  25.45 ? 190 TYR A CA  1 
ATOM   1454 C  C   . TYR A 1 191 ? -15.652 10.494  25.426  1.00  25.20 ? 190 TYR A C   1 
ATOM   1455 O  O   . TYR A 1 191 ? -16.346 10.394  24.420  1.00  24.72 ? 190 TYR A O   1 
ATOM   1456 C  CB  . TYR A 1 191 ? -15.294 12.637  26.661  1.00  25.50 ? 190 TYR A CB  1 
ATOM   1457 C  CG  . TYR A 1 191 ? -15.059 13.360  25.344  1.00  25.96 ? 190 TYR A CG  1 
ATOM   1458 C  CD1 . TYR A 1 191 ? -16.129 13.812  24.540  1.00  26.50 ? 190 TYR A CD1 1 
ATOM   1459 C  CD2 . TYR A 1 191 ? -13.752 13.637  24.924  1.00  27.23 ? 190 TYR A CD2 1 
ATOM   1460 C  CE1 . TYR A 1 191 ? -15.874 14.514  23.321  1.00  26.02 ? 190 TYR A CE1 1 
ATOM   1461 C  CE2 . TYR A 1 191 ? -13.499 14.314  23.728  1.00  26.97 ? 190 TYR A CE2 1 
ATOM   1462 C  CZ  . TYR A 1 191 ? -14.553 14.758  22.941  1.00  26.89 ? 190 TYR A CZ  1 
ATOM   1463 O  OH  . TYR A 1 191 ? -14.246 15.436  21.764  1.00  26.68 ? 190 TYR A OH  1 
ATOM   1464 N  N   . LEU A 1 192 ? -14.487 9.874   25.569  1.00  25.55 ? 191 LEU A N   1 
ATOM   1465 C  CA  . LEU A 1 192 ? -13.913 9.062   24.496  1.00  26.16 ? 191 LEU A CA  1 
ATOM   1466 C  C   . LEU A 1 192 ? -14.799 7.858   24.158  1.00  26.94 ? 191 LEU A C   1 
ATOM   1467 O  O   . LEU A 1 192 ? -15.006 7.544   22.975  1.00  27.22 ? 191 LEU A O   1 
ATOM   1468 C  CB  . LEU A 1 192 ? -12.489 8.636   24.848  1.00  26.43 ? 191 LEU A CB  1 
ATOM   1469 C  CG  . LEU A 1 192 ? -11.487 9.797   24.878  1.00  26.58 ? 191 LEU A CG  1 
ATOM   1470 C  CD1 . LEU A 1 192 ? -10.144 9.314   25.405  1.00  28.20 ? 191 LEU A CD1 1 
ATOM   1471 C  CD2 . LEU A 1 192 ? -11.347 10.431  23.482  1.00  28.94 ? 191 LEU A CD2 1 
ATOM   1472 N  N   . ALA A 1 193 ? -15.344 7.222   25.194  1.00  26.84 ? 192 ALA A N   1 
ATOM   1473 C  CA  . ALA A 1 193 ? -16.285 6.110   25.015  1.00  27.16 ? 192 ALA A CA  1 
ATOM   1474 C  C   . ALA A 1 193 ? -17.576 6.546   24.307  1.00  27.31 ? 192 ALA A C   1 
ATOM   1475 O  O   . ALA A 1 193 ? -18.051 5.848   23.417  1.00  27.40 ? 192 ALA A O   1 
ATOM   1476 C  CB  . ALA A 1 193 ? -16.591 5.437   26.351  1.00  27.48 ? 192 ALA A CB  1 
ATOM   1477 N  N   . ALA A 1 194 ? -18.121 7.707   24.678  1.00  27.05 ? 193 ALA A N   1 
ATOM   1478 C  CA  . ALA A 1 194 ? -19.299 8.267   23.998  1.00  26.93 ? 193 ALA A CA  1 
ATOM   1479 C  C   . ALA A 1 194 ? -19.013 8.650   22.536  1.00  26.62 ? 193 ALA A C   1 
ATOM   1480 O  O   . ALA A 1 194 ? -19.880 8.520   21.672  1.00  26.09 ? 193 ALA A O   1 
ATOM   1481 C  CB  . ALA A 1 194 ? -19.810 9.472   24.753  1.00  27.21 ? 193 ALA A CB  1 
ATOM   1482 N  N   . PHE A 1 195 ? -17.797 9.117   22.259  1.00  25.84 ? 194 PHE A N   1 
ATOM   1483 C  CA  . PHE A 1 195 ? -17.422 9.549   20.908  1.00  25.82 ? 194 PHE A CA  1 
ATOM   1484 C  C   . PHE A 1 195 ? -17.665 8.471   19.842  1.00  25.44 ? 194 PHE A C   1 
ATOM   1485 O  O   . PHE A 1 195 ? -18.086 8.774   18.716  1.00  24.73 ? 194 PHE A O   1 
ATOM   1486 C  CB  . PHE A 1 195 ? -15.947 10.014  20.891  1.00  25.62 ? 194 PHE A CB  1 
ATOM   1487 C  CG  . PHE A 1 195 ? -15.451 10.440  19.532  1.00  28.43 ? 194 PHE A CG  1 
ATOM   1488 C  CD1 . PHE A 1 195 ? -15.906 11.628  18.950  1.00  29.95 ? 194 PHE A CD1 1 
ATOM   1489 C  CD2 . PHE A 1 195 ? -14.504 9.664   18.844  1.00  29.07 ? 194 PHE A CD2 1 
ATOM   1490 C  CE1 . PHE A 1 195 ? -15.448 12.029  17.684  1.00  29.55 ? 194 PHE A CE1 1 
ATOM   1491 C  CE2 . PHE A 1 195 ? -14.033 10.053  17.581  1.00  30.19 ? 194 PHE A CE2 1 
ATOM   1492 C  CZ  . PHE A 1 195 ? -14.493 11.245  17.007  1.00  29.38 ? 194 PHE A CZ  1 
ATOM   1493 N  N   . TRP A 1 196 ? -17.435 7.210   20.191  1.00  25.49 ? 195 TRP A N   1 
ATOM   1494 C  CA  . TRP A 1 196 ? -17.660 6.124   19.232  1.00  25.57 ? 195 TRP A CA  1 
ATOM   1495 C  C   . TRP A 1 196 ? -19.093 6.081   18.669  1.00  25.92 ? 195 TRP A C   1 
ATOM   1496 O  O   . TRP A 1 196 ? -19.296 5.647   17.532  1.00  25.66 ? 195 TRP A O   1 
ATOM   1497 C  CB  . TRP A 1 196 ? -17.252 4.766   19.815  1.00  26.19 ? 195 TRP A CB  1 
ATOM   1498 C  CG  . TRP A 1 196 ? -15.806 4.719   20.209  1.00  26.01 ? 195 TRP A CG  1 
ATOM   1499 C  CD1 . TRP A 1 196 ? -15.307 4.525   21.468  1.00  27.26 ? 195 TRP A CD1 1 
ATOM   1500 C  CD2 . TRP A 1 196 ? -14.672 4.891   19.347  1.00  26.52 ? 195 TRP A CD2 1 
ATOM   1501 N  NE1 . TRP A 1 196 ? -13.933 4.566   21.445  1.00  27.62 ? 195 TRP A NE1 1 
ATOM   1502 C  CE2 . TRP A 1 196 ? -13.515 4.780   20.154  1.00  26.42 ? 195 TRP A CE2 1 
ATOM   1503 C  CE3 . TRP A 1 196 ? -14.519 5.119   17.969  1.00  25.84 ? 195 TRP A CE3 1 
ATOM   1504 C  CZ2 . TRP A 1 196 ? -12.222 4.892   19.634  1.00  26.57 ? 195 TRP A CZ2 1 
ATOM   1505 C  CZ3 . TRP A 1 196 ? -13.225 5.241   17.451  1.00  27.40 ? 195 TRP A CZ3 1 
ATOM   1506 C  CH2 . TRP A 1 196 ? -12.095 5.112   18.287  1.00  26.72 ? 195 TRP A CH2 1 
ATOM   1507 N  N   . ASN A 1 197 ? -20.063 6.549   19.453  1.00  25.79 ? 196 ASN A N   1 
ATOM   1508 C  CA  . ASN A 1 197 ? -21.468 6.577   19.033  1.00  26.21 ? 196 ASN A CA  1 
ATOM   1509 C  C   . ASN A 1 197 ? -21.799 7.604   17.964  1.00  25.91 ? 196 ASN A C   1 
ATOM   1510 O  O   . ASN A 1 197 ? -22.847 7.513   17.325  1.00  26.06 ? 196 ASN A O   1 
ATOM   1511 C  CB  . ASN A 1 197 ? -22.390 6.786   20.235  1.00  26.26 ? 196 ASN A CB  1 
ATOM   1512 C  CG  . ASN A 1 197 ? -22.256 5.686   21.256  1.00  28.23 ? 196 ASN A CG  1 
ATOM   1513 O  OD1 . ASN A 1 197 ? -22.488 4.504   20.960  1.00  29.66 ? 196 ASN A OD1 1 
ATOM   1514 N  ND2 . ASN A 1 197 ? -21.872 6.059   22.463  1.00  26.19 ? 196 ASN A ND2 1 
ATOM   1515 N  N   . VAL A 1 198 ? -20.927 8.588   17.784  1.00  25.23 ? 197 VAL A N   1 
ATOM   1516 C  CA  . VAL A 1 198 ? -21.192 9.655   16.804  1.00  25.76 ? 197 VAL A CA  1 
ATOM   1517 C  C   . VAL A 1 198 ? -20.249 9.684   15.598  1.00  25.02 ? 197 VAL A C   1 
ATOM   1518 O  O   . VAL A 1 198 ? -20.406 10.530  14.729  1.00  25.67 ? 197 VAL A O   1 
ATOM   1519 C  CB  . VAL A 1 198 ? -21.280 11.066  17.464  1.00  25.32 ? 197 VAL A CB  1 
ATOM   1520 C  CG1 . VAL A 1 198 ? -22.505 11.146  18.370  1.00  26.54 ? 197 VAL A CG1 1 
ATOM   1521 C  CG2 . VAL A 1 198 ? -20.005 11.424  18.229  1.00  25.89 ? 197 VAL A CG2 1 
ATOM   1522 N  N   . VAL A 1 199 ? -19.290 8.769   15.520  1.00  24.69 ? 198 VAL A N   1 
ATOM   1523 C  CA  . VAL A 1 199 ? -18.390 8.748   14.365  1.00  24.42 ? 198 VAL A CA  1 
ATOM   1524 C  C   . VAL A 1 199 ? -19.167 8.420   13.087  1.00  24.92 ? 198 VAL A C   1 
ATOM   1525 O  O   . VAL A 1 199 ? -19.937 7.444   13.035  1.00  24.98 ? 198 VAL A O   1 
ATOM   1526 C  CB  . VAL A 1 199 ? -17.193 7.761   14.540  1.00  24.61 ? 198 VAL A CB  1 
ATOM   1527 C  CG1 . VAL A 1 199 ? -16.335 7.720   13.270  1.00  24.09 ? 198 VAL A CG1 1 
ATOM   1528 C  CG2 . VAL A 1 199 ? -16.336 8.139   15.746  1.00  23.58 ? 198 VAL A CG2 1 
ATOM   1529 N  N   . ASN A 1 200 ? -18.958 9.232   12.054  1.00  24.51 ? 199 ASN A N   1 
ATOM   1530 C  CA  . ASN A 1 200 ? -19.529 8.927   10.738  1.00  25.03 ? 199 ASN A CA  1 
ATOM   1531 C  C   . ASN A 1 200 ? -18.558 8.084   9.926   1.00  25.26 ? 199 ASN A C   1 
ATOM   1532 O  O   . ASN A 1 200 ? -17.684 8.628   9.232   1.00  25.01 ? 199 ASN A O   1 
ATOM   1533 C  CB  . ASN A 1 200 ? -19.862 10.224  9.999   1.00  24.85 ? 199 ASN A CB  1 
ATOM   1534 C  CG  . ASN A 1 200 ? -20.559 9.987   8.662   1.00  26.04 ? 199 ASN A CG  1 
ATOM   1535 O  OD1 . ASN A 1 200 ? -20.489 8.904   8.073   1.00  26.32 ? 199 ASN A OD1 1 
ATOM   1536 N  ND2 . ASN A 1 200 ? -21.243 11.012  8.181   1.00  28.04 ? 199 ASN A ND2 1 
ATOM   1537 N  N   . TRP A 1 201 ? -18.693 6.762   10.016  1.00  25.38 ? 200 TRP A N   1 
ATOM   1538 C  CA  . TRP A 1 201 ? -17.727 5.864   9.368   1.00  25.83 ? 200 TRP A CA  1 
ATOM   1539 C  C   . TRP A 1 201 ? -17.810 5.887   7.841   1.00  26.49 ? 200 TRP A C   1 
ATOM   1540 O  O   . TRP A 1 201 ? -16.834 5.558   7.173   1.00  26.64 ? 200 TRP A O   1 
ATOM   1541 C  CB  . TRP A 1 201 ? -17.818 4.429   9.903   1.00  25.36 ? 200 TRP A CB  1 
ATOM   1542 C  CG  . TRP A 1 201 ? -17.332 4.343   11.331  1.00  25.47 ? 200 TRP A CG  1 
ATOM   1543 C  CD1 . TRP A 1 201 ? -18.097 4.208   12.452  1.00  25.46 ? 200 TRP A CD1 1 
ATOM   1544 C  CD2 . TRP A 1 201 ? -15.980 4.416   11.772  1.00  24.74 ? 200 TRP A CD2 1 
ATOM   1545 N  NE1 . TRP A 1 201 ? -17.293 4.184   13.577  1.00  26.78 ? 200 TRP A NE1 1 
ATOM   1546 C  CE2 . TRP A 1 201 ? -15.988 4.306   13.181  1.00  25.28 ? 200 TRP A CE2 1 
ATOM   1547 C  CE3 . TRP A 1 201 ? -14.752 4.558   11.112  1.00  25.68 ? 200 TRP A CE3 1 
ATOM   1548 C  CZ2 . TRP A 1 201 ? -14.813 4.343   13.943  1.00  26.25 ? 200 TRP A CZ2 1 
ATOM   1549 C  CZ3 . TRP A 1 201 ? -13.593 4.586   11.864  1.00  26.22 ? 200 TRP A CZ3 1 
ATOM   1550 C  CH2 . TRP A 1 201 ? -13.632 4.485   13.270  1.00  25.82 ? 200 TRP A CH2 1 
ATOM   1551 N  N   . ASP A 1 202 ? -18.961 6.282   7.296   1.00  27.27 ? 201 ASP A N   1 
ATOM   1552 C  CA  . ASP A 1 202 ? -19.080 6.468   5.843   1.00  28.34 ? 201 ASP A CA  1 
ATOM   1553 C  C   . ASP A 1 202 ? -18.123 7.563   5.371   1.00  28.22 ? 201 ASP A C   1 
ATOM   1554 O  O   . ASP A 1 202 ? -17.417 7.396   4.369   1.00  27.48 ? 201 ASP A O   1 
ATOM   1555 C  CB  . ASP A 1 202 ? -20.514 6.798   5.448   1.00  29.36 ? 201 ASP A CB  1 
ATOM   1556 C  CG  . ASP A 1 202 ? -21.462 5.635   5.663   1.00  32.67 ? 201 ASP A CG  1 
ATOM   1557 O  OD1 . ASP A 1 202 ? -21.011 4.462   5.676   1.00  35.91 ? 201 ASP A OD1 1 
ATOM   1558 O  OD2 . ASP A 1 202 ? -22.676 5.895   5.812   1.00  38.28 ? 201 ASP A OD2 1 
ATOM   1559 N  N   . GLU A 1 203 ? -18.081 8.668   6.114   1.00  28.26 ? 202 GLU A N   1 
ATOM   1560 C  CA  . GLU A 1 203 ? -17.142 9.754   5.814   1.00  28.52 ? 202 GLU A CA  1 
ATOM   1561 C  C   . GLU A 1 203 ? -15.686 9.334   6.039   1.00  27.70 ? 202 GLU A C   1 
ATOM   1562 O  O   . GLU A 1 203 ? -14.818 9.641   5.221   1.00  27.33 ? 202 GLU A O   1 
ATOM   1563 C  CB  . GLU A 1 203 ? -17.494 11.019  6.605   1.00  28.97 ? 202 GLU A CB  1 
ATOM   1564 C  CG  . GLU A 1 203 ? -16.494 12.181  6.484   1.00  31.99 ? 202 GLU A CG  1 
ATOM   1565 C  CD  . GLU A 1 203 ? -16.531 12.919  5.156   1.00  35.39 ? 202 GLU A CD  1 
ATOM   1566 O  OE1 . GLU A 1 203 ? -17.520 12.805  4.399   1.00  35.98 ? 202 GLU A OE1 1 
ATOM   1567 O  OE2 . GLU A 1 203 ? -15.550 13.645  4.874   1.00  38.64 ? 202 GLU A OE2 1 
ATOM   1568 N  N   . VAL A 1 204 ? -15.419 8.635   7.138   1.00  27.12 ? 203 VAL A N   1 
ATOM   1569 C  CA  . VAL A 1 204 ? -14.063 8.138   7.390   1.00  27.20 ? 203 VAL A CA  1 
ATOM   1570 C  C   . VAL A 1 204 ? -13.625 7.192   6.254   1.00  27.45 ? 203 VAL A C   1 
ATOM   1571 O  O   . VAL A 1 204 ? -12.503 7.302   5.752   1.00  27.49 ? 203 VAL A O   1 
ATOM   1572 C  CB  . VAL A 1 204 ? -13.921 7.454   8.778   1.00  26.93 ? 203 VAL A CB  1 
ATOM   1573 C  CG1 . VAL A 1 204 ? -12.490 6.954   8.993   1.00  26.36 ? 203 VAL A CG1 1 
ATOM   1574 C  CG2 . VAL A 1 204 ? -14.357 8.399   9.928   1.00  26.52 ? 203 VAL A CG2 1 
ATOM   1575 N  N   . SER A 1 205 ? -14.523 6.299   5.833   1.00  27.80 ? 204 SER A N   1 
ATOM   1576 C  CA  . SER A 1 205 ? -14.236 5.374   4.730   1.00  28.75 ? 204 SER A CA  1 
ATOM   1577 C  C   . SER A 1 205 ? -13.967 6.107   3.413   1.00  28.46 ? 204 SER A C   1 
ATOM   1578 O  O   . SER A 1 205 ? -13.097 5.686   2.646   1.00  28.23 ? 204 SER A O   1 
ATOM   1579 C  CB  . SER A 1 205 ? -15.366 4.363   4.534   1.00  28.75 ? 204 SER A CB  1 
ATOM   1580 O  OG  . SER A 1 205 ? -15.388 3.420   5.592   1.00  31.92 ? 204 SER A OG  1 
ATOM   1581 N  N   . LYS A 1 206 ? -14.709 7.190   3.156   1.00  28.69 ? 205 LYS A N   1 
ATOM   1582 C  CA  . LYS A 1 206 ? -14.458 8.031   1.974   1.00  28.95 ? 205 LYS A CA  1 
ATOM   1583 C  C   . LYS A 1 206 ? -13.027 8.591   2.020   1.00  28.16 ? 205 LYS A C   1 
ATOM   1584 O  O   . LYS A 1 206 ? -12.289 8.516   1.028   1.00  28.07 ? 205 LYS A O   1 
ATOM   1585 C  CB  . LYS A 1 206 ? -15.515 9.160   1.822   1.00  29.30 ? 205 LYS A CB  1 
ATOM   1586 C  CG  . LYS A 1 206 ? -15.345 10.058  0.557   1.00  29.97 ? 205 LYS A CG  1 
ATOM   1587 C  CD  . LYS A 1 206 ? -16.426 11.195  0.400   1.00  30.56 ? 205 LYS A CD  1 
ATOM   1588 C  CE  . LYS A 1 206 ? -15.820 12.524  -0.200  1.00  32.43 ? 205 LYS A CE  1 
ATOM   1589 N  NZ  . LYS A 1 206 ? -16.796 13.616  -0.708  1.00  31.61 ? 205 LYS A NZ  1 
ATOM   1590 N  N   . ARG A 1 207 ? -12.625 9.102   3.185   1.00  27.16 ? 206 ARG A N   1 
ATOM   1591 C  CA  . ARG A 1 207 ? -11.284 9.670   3.370   1.00  26.77 ? 206 ARG A CA  1 
ATOM   1592 C  C   . ARG A 1 207 ? -10.192 8.613   3.269   1.00  26.64 ? 206 ARG A C   1 
ATOM   1593 O  O   . ARG A 1 207 ? -9.129  8.866   2.691   1.00  26.30 ? 206 ARG A O   1 
ATOM   1594 C  CB  . ARG A 1 207 ? -11.192 10.417  4.705   1.00  26.89 ? 206 ARG A CB  1 
ATOM   1595 C  CG  . ARG A 1 207 ? -12.030 11.679  4.724   1.00  27.65 ? 206 ARG A CG  1 
ATOM   1596 C  CD  . ARG A 1 207 ? -12.232 12.238  6.123   1.00  29.58 ? 206 ARG A CD  1 
ATOM   1597 N  NE  . ARG A 1 207 ? -13.026 13.469  6.084   1.00  30.45 ? 206 ARG A NE  1 
ATOM   1598 C  CZ  . ARG A 1 207 ? -12.521 14.697  6.028   1.00  32.95 ? 206 ARG A CZ  1 
ATOM   1599 N  NH1 . ARG A 1 207 ? -11.204 14.895  6.007   1.00  33.27 ? 206 ARG A NH1 1 
ATOM   1600 N  NH2 . ARG A 1 207 ? -13.341 15.745  5.985   1.00  34.43 ? 206 ARG A NH2 1 
ATOM   1601 N  N   . TYR A 1 208 ? -10.457 7.430   3.823   1.00  26.10 ? 207 TYR A N   1 
ATOM   1602 C  CA  . TYR A 1 208 ? -9.539  6.288   3.675   1.00  25.82 ? 207 TYR A CA  1 
ATOM   1603 C  C   . TYR A 1 208 ? -9.293  5.914   2.199   1.00  26.06 ? 207 TYR A C   1 
ATOM   1604 O  O   . TYR A 1 208 ? -8.138  5.782   1.757   1.00  25.61 ? 207 TYR A O   1 
ATOM   1605 C  CB  . TYR A 1 208 ? -10.054 5.071   4.469   1.00  25.94 ? 207 TYR A CB  1 
ATOM   1606 C  CG  . TYR A 1 208 ? -9.170  3.859   4.283   1.00  25.43 ? 207 TYR A CG  1 
ATOM   1607 C  CD1 . TYR A 1 208 ? -7.890  3.825   4.832   1.00  25.09 ? 207 TYR A CD1 1 
ATOM   1608 C  CD2 . TYR A 1 208 ? -9.594  2.772   3.525   1.00  25.73 ? 207 TYR A CD2 1 
ATOM   1609 C  CE1 . TYR A 1 208 ? -7.058  2.735   4.641   1.00  25.02 ? 207 TYR A CE1 1 
ATOM   1610 C  CE2 . TYR A 1 208 ? -8.766  1.672   3.338   1.00  25.62 ? 207 TYR A CE2 1 
ATOM   1611 C  CZ  . TYR A 1 208 ? -7.499  1.673   3.893   1.00  25.14 ? 207 TYR A CZ  1 
ATOM   1612 O  OH  . TYR A 1 208 ? -6.669  0.597   3.700   1.00  26.86 ? 207 TYR A OH  1 
ATOM   1613 N  N   . ALA A 1 209 ? -10.381 5.736   1.446   1.00  25.80 ? 208 ALA A N   1 
ATOM   1614 C  CA  . ALA A 1 209 ? -10.300 5.330   0.053   1.00  27.16 ? 208 ALA A CA  1 
ATOM   1615 C  C   . ALA A 1 209 ? -9.446  6.322   -0.731  1.00  27.79 ? 208 ALA A C   1 
ATOM   1616 O  O   . ALA A 1 209 ? -8.579  5.917   -1.502  1.00  27.91 ? 208 ALA A O   1 
ATOM   1617 C  CB  . ALA A 1 209 ? -11.696 5.185   -0.559  1.00  26.84 ? 208 ALA A CB  1 
ATOM   1618 N  N   . ALA A 1 210 ? -9.669  7.614   -0.490  1.00  28.76 ? 209 ALA A N   1 
ATOM   1619 C  CA  . ALA A 1 210 ? -8.913  8.682   -1.148  1.00  30.52 ? 209 ALA A CA  1 
ATOM   1620 C  C   . ALA A 1 210 ? -7.432  8.650   -0.771  1.00  31.68 ? 209 ALA A C   1 
ATOM   1621 O  O   . ALA A 1 210 ? -6.567  8.729   -1.642  1.00  31.87 ? 209 ALA A O   1 
ATOM   1622 C  CB  . ALA A 1 210 ? -9.513  10.039  -0.811  1.00  29.94 ? 209 ALA A CB  1 
ATOM   1623 N  N   . ALA A 1 211 ? -7.149  8.536   0.527   1.00  33.24 ? 210 ALA A N   1 
ATOM   1624 C  CA  . ALA A 1 211 ? -5.772  8.500   1.029   1.00  34.96 ? 210 ALA A CA  1 
ATOM   1625 C  C   . ALA A 1 211 ? -4.965  7.321   0.472   1.00  36.49 ? 210 ALA A C   1 
ATOM   1626 O  O   . ALA A 1 211 ? -3.757  7.445   0.247   1.00  36.94 ? 210 ALA A O   1 
ATOM   1627 C  CB  . ALA A 1 211 ? -5.757  8.495   2.561   1.00  34.66 ? 210 ALA A CB  1 
ATOM   1628 N  N   . LYS A 1 212 ? -5.636  6.196   0.229   1.00  38.01 ? 211 LYS A N   1 
ATOM   1629 C  CA  . LYS A 1 212 ? -4.979  5.008   -0.315  1.00  40.04 ? 211 LYS A CA  1 
ATOM   1630 C  C   . LYS A 1 212 ? -4.739  5.072   -1.826  1.00  41.16 ? 211 LYS A C   1 
ATOM   1631 O  O   . LYS A 1 212 ? -4.003  4.247   -2.377  1.00  41.49 ? 211 LYS A O   1 
ATOM   1632 C  CB  . LYS A 1 212 ? -5.753  3.739   0.050   1.00  40.23 ? 211 LYS A CB  1 
ATOM   1633 C  CG  . LYS A 1 212 ? -5.168  2.994   1.231   1.00  40.82 ? 211 LYS A CG  1 
ATOM   1634 C  CD  . LYS A 1 212 ? -5.106  1.513   0.905   1.00  43.19 ? 211 LYS A CD  1 
ATOM   1635 C  CE  . LYS A 1 212 ? -3.725  0.949   1.188   1.00  43.11 ? 211 LYS A CE  1 
ATOM   1636 N  NZ  . LYS A 1 212 ? -3.442  -0.248  0.341   1.00  46.39 ? 211 LYS A NZ  1 
ATOM   1637 N  N   . LEU A 1 213 ? -5.355  6.048   -2.494  1.00  42.48 ? 212 LEU A N   1 
ATOM   1638 C  CA  . LEU A 1 213 ? -5.153  6.245   -3.932  1.00  43.84 ? 212 LEU A CA  1 
ATOM   1639 C  C   . LEU A 1 213 ? -3.824  6.942   -4.251  1.00  44.39 ? 212 LEU A C   1 
ATOM   1640 O  O   . LEU A 1 213 ? -3.587  7.345   -5.395  1.00  44.88 ? 212 LEU A O   1 
ATOM   1641 C  CB  . LEU A 1 213 ? -6.341  6.988   -4.564  1.00  43.94 ? 212 LEU A CB  1 
ATOM   1642 C  CG  . LEU A 1 213 ? -7.658  6.212   -4.662  1.00  44.47 ? 212 LEU A CG  1 
ATOM   1643 C  CD1 . LEU A 1 213 ? -8.749  7.082   -5.264  1.00  45.39 ? 212 LEU A CD1 1 
ATOM   1644 C  CD2 . LEU A 1 213 ? -7.495  4.913   -5.455  1.00  45.57 ? 212 LEU A CD2 1 
ATOM   1645 N  N   . VAL A 1 214 ? -2.964  7.057   -3.236  1.00  44.90 ? 213 VAL A N   1 
ATOM   1646 C  CA  . VAL A 1 214 ? -1.606  7.606   -3.364  1.00  45.40 ? 213 VAL A CA  1 
ATOM   1647 C  C   . VAL A 1 214 ? -1.652  9.129   -3.395  1.00  45.49 ? 213 VAL A C   1 
ATOM   1648 O  O   . VAL A 1 214 ? -2.108  9.748   -2.434  1.00  45.59 ? 213 VAL A O   1 
ATOM   1649 C  CB  . VAL A 1 214 ? -0.823  7.006   -4.582  1.00  45.57 ? 213 VAL A CB  1 
ATOM   1650 C  CG1 . VAL A 1 214 ? 0.456   7.800   -4.892  1.00  45.54 ? 213 VAL A CG1 1 
ATOM   1651 C  CG2 . VAL A 1 214 ? -0.504  5.526   -4.334  1.00  46.07 ? 213 VAL A CG2 1 
ATOM   1652 N  N   . ALA B 1 2   ? 3.458   7.019   47.974  1.00  39.27 ? 1   ALA B N   1 
ATOM   1653 C  CA  . ALA B 1 2   ? 3.450   7.489   49.384  1.00  38.55 ? 1   ALA B CA  1 
ATOM   1654 C  C   . ALA B 1 2   ? 4.204   8.801   49.555  1.00  38.25 ? 1   ALA B C   1 
ATOM   1655 O  O   . ALA B 1 2   ? 4.124   9.420   50.615  1.00  38.73 ? 1   ALA B O   1 
ATOM   1656 C  CB  . ALA B 1 2   ? 4.042   6.417   50.300  1.00  38.95 ? 1   ALA B CB  1 
ATOM   1657 N  N   . ALA B 1 3   ? 4.928   9.226   48.518  1.00  37.25 ? 2   ALA B N   1 
ATOM   1658 C  CA  . ALA B 1 3   ? 5.774   10.420  48.595  1.00  36.43 ? 2   ALA B CA  1 
ATOM   1659 C  C   . ALA B 1 3   ? 4.989   11.695  48.922  1.00  36.09 ? 2   ALA B C   1 
ATOM   1660 O  O   . ALA B 1 3   ? 5.354   12.435  49.843  1.00  35.73 ? 2   ALA B O   1 
ATOM   1661 C  CB  . ALA B 1 3   ? 6.572   10.599  47.305  1.00  36.37 ? 2   ALA B CB  1 
ATOM   1662 N  N   . TYR B 1 4   ? 3.919   11.936  48.162  1.00  34.92 ? 3   TYR B N   1 
ATOM   1663 C  CA  . TYR B 1 4   ? 3.100   13.134  48.304  1.00  34.55 ? 3   TYR B CA  1 
ATOM   1664 C  C   . TYR B 1 4   ? 1.667   12.785  48.672  1.00  34.02 ? 3   TYR B C   1 
ATOM   1665 O  O   . TYR B 1 4   ? 1.185   11.700  48.344  1.00  33.32 ? 3   TYR B O   1 
ATOM   1666 C  CB  . TYR B 1 4   ? 3.066   13.919  46.989  1.00  35.10 ? 3   TYR B CB  1 
ATOM   1667 C  CG  . TYR B 1 4   ? 4.409   14.252  46.381  1.00  35.30 ? 3   TYR B CG  1 
ATOM   1668 C  CD1 . TYR B 1 4   ? 5.434   14.796  47.154  1.00  36.36 ? 3   TYR B CD1 1 
ATOM   1669 C  CD2 . TYR B 1 4   ? 4.630   14.075  45.013  1.00  36.52 ? 3   TYR B CD2 1 
ATOM   1670 C  CE1 . TYR B 1 4   ? 6.660   15.121  46.592  1.00  37.42 ? 3   TYR B CE1 1 
ATOM   1671 C  CE2 . TYR B 1 4   ? 5.852   14.400  44.439  1.00  36.35 ? 3   TYR B CE2 1 
ATOM   1672 C  CZ  . TYR B 1 4   ? 6.858   14.917  45.239  1.00  36.94 ? 3   TYR B CZ  1 
ATOM   1673 O  OH  . TYR B 1 4   ? 8.063   15.250  44.684  1.00  37.67 ? 3   TYR B OH  1 
ATOM   1674 N  N   . THR B 1 5   ? 0.996   13.724  49.344  1.00  33.70 ? 4   THR B N   1 
ATOM   1675 C  CA  . THR B 1 5   ? -0.439  13.637  49.644  1.00  33.54 ? 4   THR B CA  1 
ATOM   1676 C  C   . THR B 1 5   ? -1.131  14.894  49.123  1.00  33.30 ? 4   THR B C   1 
ATOM   1677 O  O   . THR B 1 5   ? -0.483  15.921  48.919  1.00  33.12 ? 4   THR B O   1 
ATOM   1678 C  CB  . THR B 1 5   ? -0.736  13.511  51.171  1.00  33.79 ? 4   THR B CB  1 
ATOM   1679 O  OG1 . THR B 1 5   ? -0.076  14.564  51.885  1.00  34.01 ? 4   THR B OG1 1 
ATOM   1680 C  CG2 . THR B 1 5   ? -0.287  12.163  51.722  1.00  34.11 ? 4   THR B CG2 1 
ATOM   1681 N  N   . LEU B 1 6   ? -2.442  14.814  48.912  1.00  32.55 ? 5   LEU B N   1 
ATOM   1682 C  CA  . LEU B 1 6   ? -3.222  15.985  48.512  1.00  32.50 ? 5   LEU B CA  1 
ATOM   1683 C  C   . LEU B 1 6   ? -3.330  16.958  49.689  1.00  32.36 ? 5   LEU B C   1 
ATOM   1684 O  O   . LEU B 1 6   ? -3.757  16.562  50.765  1.00  31.91 ? 5   LEU B O   1 
ATOM   1685 C  CB  . LEU B 1 6   ? -4.625  15.566  48.055  1.00  32.57 ? 5   LEU B CB  1 
ATOM   1686 C  CG  . LEU B 1 6   ? -5.492  16.679  47.460  1.00  32.59 ? 5   LEU B CG  1 
ATOM   1687 C  CD1 . LEU B 1 6   ? -4.982  17.061  46.071  1.00  31.60 ? 5   LEU B CD1 1 
ATOM   1688 C  CD2 . LEU B 1 6   ? -6.944  16.260  47.395  1.00  33.37 ? 5   LEU B CD2 1 
ATOM   1689 N  N   . PRO B 1 7   ? -2.934  18.231  49.488  1.00  32.37 ? 6   PRO B N   1 
ATOM   1690 C  CA  . PRO B 1 7   ? -3.028  19.168  50.592  1.00  32.77 ? 6   PRO B CA  1 
ATOM   1691 C  C   . PRO B 1 7   ? -4.465  19.620  50.802  1.00  33.26 ? 6   PRO B C   1 
ATOM   1692 O  O   . PRO B 1 7   ? -5.260  19.669  49.857  1.00  33.23 ? 6   PRO B O   1 
ATOM   1693 C  CB  . PRO B 1 7   ? -2.165  20.341  50.126  1.00  32.24 ? 6   PRO B CB  1 
ATOM   1694 C  CG  . PRO B 1 7   ? -2.326  20.332  48.633  1.00  32.91 ? 6   PRO B CG  1 
ATOM   1695 C  CD  . PRO B 1 7   ? -2.399  18.869  48.268  1.00  32.40 ? 6   PRO B CD  1 
ATOM   1696 N  N   . GLN B 1 8   ? -4.797  19.922  52.047  1.00  33.23 ? 7   GLN B N   1 
ATOM   1697 C  CA  . GLN B 1 8   ? -6.070  20.536  52.363  1.00  34.02 ? 7   GLN B CA  1 
ATOM   1698 C  C   . GLN B 1 8   ? -6.058  21.965  51.829  1.00  33.76 ? 7   GLN B C   1 
ATOM   1699 O  O   . GLN B 1 8   ? -5.010  22.611  51.802  1.00  34.14 ? 7   GLN B O   1 
ATOM   1700 C  CB  . GLN B 1 8   ? -6.274  20.528  53.877  1.00  34.18 ? 7   GLN B CB  1 
ATOM   1701 C  CG  . GLN B 1 8   ? -7.660  20.930  54.333  1.00  37.06 ? 7   GLN B CG  1 
ATOM   1702 C  CD  . GLN B 1 8   ? -7.789  20.935  55.840  1.00  39.46 ? 7   GLN B CD  1 
ATOM   1703 O  OE1 . GLN B 1 8   ? -6.837  21.264  56.557  1.00  41.49 ? 7   GLN B OE1 1 
ATOM   1704 N  NE2 . GLN B 1 8   ? -8.974  20.575  56.335  1.00  40.73 ? 7   GLN B NE2 1 
ATOM   1705 N  N   . LEU B 1 9   ? -7.213  22.443  51.375  1.00  33.76 ? 8   LEU B N   1 
ATOM   1706 C  CA  . LEU B 1 9   ? -7.374  23.853  50.996  1.00  33.87 ? 8   LEU B CA  1 
ATOM   1707 C  C   . LEU B 1 9   ? -7.407  24.753  52.242  1.00  33.17 ? 8   LEU B C   1 
ATOM   1708 O  O   . LEU B 1 9   ? -7.805  24.301  53.320  1.00  33.14 ? 8   LEU B O   1 
ATOM   1709 C  CB  . LEU B 1 9   ? -8.659  24.043  50.181  1.00  33.83 ? 8   LEU B CB  1 
ATOM   1710 C  CG  . LEU B 1 9   ? -8.631  24.197  48.656  1.00  35.02 ? 8   LEU B CG  1 
ATOM   1711 C  CD1 . LEU B 1 9   ? -7.666  23.263  47.940  1.00  35.21 ? 8   LEU B CD1 1 
ATOM   1712 C  CD2 . LEU B 1 9   ? -10.046 24.097  48.093  1.00  34.35 ? 8   LEU B CD2 1 
ATOM   1713 N  N   . PRO B 1 10  ? -6.982  26.027  52.103  1.00  32.62 ? 9   PRO B N   1 
ATOM   1714 C  CA  . PRO B 1 10  ? -7.055  26.994  53.209  1.00  32.44 ? 9   PRO B CA  1 
ATOM   1715 C  C   . PRO B 1 10  ? -8.453  27.582  53.458  1.00  31.99 ? 9   PRO B C   1 
ATOM   1716 O  O   . PRO B 1 10  ? -8.616  28.434  54.335  1.00  32.11 ? 9   PRO B O   1 
ATOM   1717 C  CB  . PRO B 1 10  ? -6.098  28.115  52.762  1.00  32.61 ? 9   PRO B CB  1 
ATOM   1718 C  CG  . PRO B 1 10  ? -5.421  27.620  51.516  1.00  32.64 ? 9   PRO B CG  1 
ATOM   1719 C  CD  . PRO B 1 10  ? -6.359  26.628  50.913  1.00  32.81 ? 9   PRO B CD  1 
ATOM   1720 N  N   . TYR B 1 11  ? -9.450  27.123  52.706  1.00  31.33 ? 10  TYR B N   1 
ATOM   1721 C  CA  . TYR B 1 11  ? -10.809 27.674  52.760  1.00  31.05 ? 10  TYR B CA  1 
ATOM   1722 C  C   . TYR B 1 11  ? -11.767 26.626  52.202  1.00  30.80 ? 10  TYR B C   1 
ATOM   1723 O  O   . TYR B 1 11  ? -11.319 25.633  51.614  1.00  30.90 ? 10  TYR B O   1 
ATOM   1724 C  CB  . TYR B 1 11  ? -10.881 28.964  51.931  1.00  30.98 ? 10  TYR B CB  1 
ATOM   1725 C  CG  . TYR B 1 11  ? -10.005 28.888  50.693  1.00  31.17 ? 10  TYR B CG  1 
ATOM   1726 C  CD1 . TYR B 1 11  ? -10.387 28.112  49.604  1.00  30.37 ? 10  TYR B CD1 1 
ATOM   1727 C  CD2 . TYR B 1 11  ? -8.782  29.559  50.631  1.00  30.93 ? 10  TYR B CD2 1 
ATOM   1728 C  CE1 . TYR B 1 11  ? -9.596  28.009  48.480  1.00  30.57 ? 10  TYR B CE1 1 
ATOM   1729 C  CE2 . TYR B 1 11  ? -7.969  29.461  49.494  1.00  30.68 ? 10  TYR B CE2 1 
ATOM   1730 C  CZ  . TYR B 1 11  ? -8.387  28.677  48.426  1.00  30.56 ? 10  TYR B CZ  1 
ATOM   1731 O  OH  . TYR B 1 11  ? -7.619  28.553  47.296  1.00  30.77 ? 10  TYR B OH  1 
ATOM   1732 N  N   . ALA B 1 12  ? -13.071 26.844  52.388  1.00  30.44 ? 11  ALA B N   1 
ATOM   1733 C  CA  . ALA B 1 12  ? -14.105 25.947  51.865  1.00  30.26 ? 11  ALA B CA  1 
ATOM   1734 C  C   . ALA B 1 12  ? -14.188 26.047  50.337  1.00  30.19 ? 11  ALA B C   1 
ATOM   1735 O  O   . ALA B 1 12  ? -13.723 27.026  49.750  1.00  29.76 ? 11  ALA B O   1 
ATOM   1736 C  CB  . ALA B 1 12  ? -15.462 26.260  52.504  1.00  30.48 ? 11  ALA B CB  1 
ATOM   1737 N  N   . TYR B 1 13  ? -14.780 25.038  49.702  1.00  30.46 ? 12  TYR B N   1 
ATOM   1738 C  CA  . TYR B 1 13  ? -14.879 24.989  48.236  1.00  31.19 ? 12  TYR B CA  1 
ATOM   1739 C  C   . TYR B 1 13  ? -15.636 26.184  47.643  1.00  31.43 ? 12  TYR B C   1 
ATOM   1740 O  O   . TYR B 1 13  ? -15.384 26.579  46.503  1.00  31.40 ? 12  TYR B O   1 
ATOM   1741 C  CB  . TYR B 1 13  ? -15.503 23.663  47.769  1.00  31.48 ? 12  TYR B CB  1 
ATOM   1742 C  CG  . TYR B 1 13  ? -14.582 22.463  47.919  1.00  31.95 ? 12  TYR B CG  1 
ATOM   1743 C  CD1 . TYR B 1 13  ? -13.308 22.464  47.348  1.00  31.78 ? 12  TYR B CD1 1 
ATOM   1744 C  CD2 . TYR B 1 13  ? -14.985 21.327  48.632  1.00  32.55 ? 12  TYR B CD2 1 
ATOM   1745 C  CE1 . TYR B 1 13  ? -12.454 21.372  47.483  1.00  31.66 ? 12  TYR B CE1 1 
ATOM   1746 C  CE2 . TYR B 1 13  ? -14.133 20.222  48.772  1.00  32.58 ? 12  TYR B CE2 1 
ATOM   1747 C  CZ  . TYR B 1 13  ? -12.873 20.255  48.195  1.00  32.30 ? 12  TYR B CZ  1 
ATOM   1748 O  OH  . TYR B 1 13  ? -12.023 19.180  48.327  1.00  33.24 ? 12  TYR B OH  1 
ATOM   1749 N  N   . ASP B 1 14  ? -16.543 26.762  48.429  1.00  31.61 ? 13  ASP B N   1 
ATOM   1750 C  CA  . ASP B 1 14  ? -17.378 27.878  47.975  1.00  32.03 ? 13  ASP B CA  1 
ATOM   1751 C  C   . ASP B 1 14  ? -16.877 29.264  48.401  1.00  31.73 ? 13  ASP B C   1 
ATOM   1752 O  O   . ASP B 1 14  ? -17.585 30.260  48.228  1.00  31.77 ? 13  ASP B O   1 
ATOM   1753 C  CB  . ASP B 1 14  ? -18.834 27.669  48.426  1.00  32.44 ? 13  ASP B CB  1 
ATOM   1754 C  CG  . ASP B 1 14  ? -18.983 27.554  49.946  1.00  33.57 ? 13  ASP B CG  1 
ATOM   1755 O  OD1 . ASP B 1 14  ? -17.989 27.736  50.682  1.00  35.33 ? 13  ASP B OD1 1 
ATOM   1756 O  OD2 . ASP B 1 14  ? -20.115 27.283  50.411  1.00  37.12 ? 13  ASP B OD2 1 
ATOM   1757 N  N   . ALA B 1 15  ? -15.661 29.325  48.943  1.00  31.33 ? 14  ALA B N   1 
ATOM   1758 C  CA  . ALA B 1 15  ? -15.131 30.564  49.534  1.00  31.36 ? 14  ALA B CA  1 
ATOM   1759 C  C   . ALA B 1 15  ? -14.751 31.628  48.503  1.00  31.29 ? 14  ALA B C   1 
ATOM   1760 O  O   . ALA B 1 15  ? -14.700 32.819  48.827  1.00  31.18 ? 14  ALA B O   1 
ATOM   1761 C  CB  . ALA B 1 15  ? -13.951 30.260  50.436  1.00  30.84 ? 14  ALA B CB  1 
ATOM   1762 N  N   . LEU B 1 16  ? -14.504 31.194  47.268  1.00  31.07 ? 15  LEU B N   1 
ATOM   1763 C  CA  . LEU B 1 16  ? -14.049 32.087  46.201  1.00  30.77 ? 15  LEU B CA  1 
ATOM   1764 C  C   . LEU B 1 16  ? -15.165 32.478  45.225  1.00  30.90 ? 15  LEU B C   1 
ATOM   1765 O  O   . LEU B 1 16  ? -14.890 33.041  44.163  1.00  30.50 ? 15  LEU B O   1 
ATOM   1766 C  CB  . LEU B 1 16  ? -12.870 31.455  45.442  1.00  30.61 ? 15  LEU B CB  1 
ATOM   1767 C  CG  . LEU B 1 16  ? -11.735 30.861  46.288  1.00  30.07 ? 15  LEU B CG  1 
ATOM   1768 C  CD1 . LEU B 1 16  ? -10.633 30.346  45.377  1.00  29.41 ? 15  LEU B CD1 1 
ATOM   1769 C  CD2 . LEU B 1 16  ? -11.174 31.863  47.292  1.00  28.92 ? 15  LEU B CD2 1 
ATOM   1770 N  N   . GLU B 1 17  ? -16.410 32.171  45.595  1.00  31.03 ? 16  GLU B N   1 
ATOM   1771 C  CA  . GLU B 1 17  ? -17.605 32.540  44.819  1.00  31.53 ? 16  GLU B CA  1 
ATOM   1772 C  C   . GLU B 1 17  ? -17.870 34.050  44.916  1.00  31.28 ? 16  GLU B C   1 
ATOM   1773 O  O   . GLU B 1 17  ? -17.638 34.647  45.968  1.00  30.71 ? 16  GLU B O   1 
ATOM   1774 C  CB  . GLU B 1 17  ? -18.828 31.775  45.343  1.00  31.68 ? 16  GLU B CB  1 
ATOM   1775 C  CG  . GLU B 1 17  ? -18.820 30.268  45.068  1.00  34.09 ? 16  GLU B CG  1 
ATOM   1776 C  CD  . GLU B 1 17  ? -19.668 29.862  43.870  1.00  36.62 ? 16  GLU B CD  1 
ATOM   1777 O  OE1 . GLU B 1 17  ? -19.995 30.739  43.034  1.00  38.27 ? 16  GLU B OE1 1 
ATOM   1778 O  OE2 . GLU B 1 17  ? -20.012 28.659  43.763  1.00  36.95 ? 16  GLU B OE2 1 
ATOM   1779 N  N   . PRO B 1 18  ? -18.373 34.672  43.828  1.00  31.24 ? 17  PRO B N   1 
ATOM   1780 C  CA  . PRO B 1 18  ? -18.727 34.093  42.532  1.00  31.04 ? 17  PRO B CA  1 
ATOM   1781 C  C   . PRO B 1 18  ? -17.556 34.020  41.535  1.00  31.01 ? 17  PRO B C   1 
ATOM   1782 O  O   . PRO B 1 18  ? -17.752 33.660  40.372  1.00  31.20 ? 17  PRO B O   1 
ATOM   1783 C  CB  . PRO B 1 18  ? -19.812 35.047  42.026  1.00  31.45 ? 17  PRO B CB  1 
ATOM   1784 C  CG  . PRO B 1 18  ? -19.434 36.372  42.594  1.00  31.01 ? 17  PRO B CG  1 
ATOM   1785 C  CD  . PRO B 1 18  ? -18.659 36.122  43.867  1.00  31.25 ? 17  PRO B CD  1 
ATOM   1786 N  N   . HIS B 1 19  ? -16.350 34.335  41.996  1.00  30.70 ? 18  HIS B N   1 
ATOM   1787 C  CA  . HIS B 1 19  ? -15.197 34.437  41.105  1.00  30.60 ? 18  HIS B CA  1 
ATOM   1788 C  C   . HIS B 1 19  ? -14.806 33.061  40.554  1.00  30.78 ? 18  HIS B C   1 
ATOM   1789 O  O   . HIS B 1 19  ? -14.631 32.900  39.351  1.00  30.79 ? 18  HIS B O   1 
ATOM   1790 C  CB  . HIS B 1 19  ? -14.037 35.150  41.805  1.00  30.61 ? 18  HIS B CB  1 
ATOM   1791 C  CG  . HIS B 1 19  ? -14.466 36.357  42.589  1.00  30.92 ? 18  HIS B CG  1 
ATOM   1792 N  ND1 . HIS B 1 19  ? -15.102 37.434  42.008  1.00  30.18 ? 18  HIS B ND1 1 
ATOM   1793 C  CD2 . HIS B 1 19  ? -14.385 36.639  43.912  1.00  31.32 ? 18  HIS B CD2 1 
ATOM   1794 C  CE1 . HIS B 1 19  ? -15.371 38.338  42.935  1.00  30.86 ? 18  HIS B CE1 1 
ATOM   1795 N  NE2 . HIS B 1 19  ? -14.945 37.881  44.100  1.00  30.75 ? 18  HIS B NE2 1 
ATOM   1796 N  N   . ILE B 1 20  ? -14.699 32.076  41.439  1.00  31.02 ? 19  ILE B N   1 
ATOM   1797 C  CA  . ILE B 1 20  ? -14.516 30.682  41.029  1.00  31.47 ? 19  ILE B CA  1 
ATOM   1798 C  C   . ILE B 1 20  ? -15.648 29.868  41.665  1.00  31.54 ? 19  ILE B C   1 
ATOM   1799 O  O   . ILE B 1 20  ? -15.855 29.933  42.883  1.00  30.83 ? 19  ILE B O   1 
ATOM   1800 C  CB  . ILE B 1 20  ? -13.130 30.136  41.444  1.00  31.40 ? 19  ILE B CB  1 
ATOM   1801 C  CG1 . ILE B 1 20  ? -12.012 31.070  40.944  1.00  31.78 ? 19  ILE B CG1 1 
ATOM   1802 C  CG2 . ILE B 1 20  ? -12.922 28.715  40.908  1.00  31.92 ? 19  ILE B CG2 1 
ATOM   1803 C  CD1 . ILE B 1 20  ? -10.616 30.725  41.449  1.00  32.30 ? 19  ILE B CD1 1 
ATOM   1804 N  N   . ASP B 1 21  ? -16.398 29.133  40.842  1.00  31.25 ? 20  ASP B N   1 
ATOM   1805 C  CA  . ASP B 1 21  ? -17.508 28.328  41.353  1.00  31.32 ? 20  ASP B CA  1 
ATOM   1806 C  C   . ASP B 1 21  ? -17.023 27.172  42.230  1.00  30.70 ? 20  ASP B C   1 
ATOM   1807 O  O   . ASP B 1 21  ? -15.926 26.643  42.032  1.00  30.06 ? 20  ASP B O   1 
ATOM   1808 C  CB  . ASP B 1 21  ? -18.380 27.785  40.215  1.00  31.84 ? 20  ASP B CB  1 
ATOM   1809 C  CG  . ASP B 1 21  ? -17.577 27.040  39.172  1.00  34.21 ? 20  ASP B CG  1 
ATOM   1810 O  OD1 . ASP B 1 21  ? -16.705 27.674  38.532  1.00  36.33 ? 20  ASP B OD1 1 
ATOM   1811 O  OD2 . ASP B 1 21  ? -17.812 25.824  38.981  1.00  36.47 ? 20  ASP B OD2 1 
ATOM   1812 N  N   . ALA B 1 22  ? -17.867 26.790  43.187  1.00  30.21 ? 21  ALA B N   1 
ATOM   1813 C  CA  . ALA B 1 22  ? -17.575 25.718  44.135  1.00  29.46 ? 21  ALA B CA  1 
ATOM   1814 C  C   . ALA B 1 22  ? -17.405 24.358  43.463  1.00  28.91 ? 21  ALA B C   1 
ATOM   1815 O  O   . ALA B 1 22  ? -16.576 23.564  43.885  1.00  28.30 ? 21  ALA B O   1 
ATOM   1816 C  CB  . ALA B 1 22  ? -18.669 25.648  45.200  1.00  29.53 ? 21  ALA B CB  1 
ATOM   1817 N  N   . ARG B 1 23  ? -18.208 24.077  42.433  1.00  28.83 ? 22  ARG B N   1 
ATOM   1818 C  CA  . ARG B 1 23  ? -18.104 22.798  41.745  1.00  28.86 ? 22  ARG B CA  1 
ATOM   1819 C  C   . ARG B 1 23  ? -16.721 22.649  41.120  1.00  28.61 ? 22  ARG B C   1 
ATOM   1820 O  O   . ARG B 1 23  ? -16.084 21.605  41.248  1.00  28.62 ? 22  ARG B O   1 
ATOM   1821 C  CB  . ARG B 1 23  ? -19.171 22.638  40.668  1.00  28.78 ? 22  ARG B CB  1 
ATOM   1822 C  CG  . ARG B 1 23  ? -19.174 21.244  40.092  1.00  30.27 ? 22  ARG B CG  1 
ATOM   1823 C  CD  . ARG B 1 23  ? -20.137 21.109  38.943  1.00  31.97 ? 22  ARG B CD  1 
ATOM   1824 N  NE  . ARG B 1 23  ? -20.265 19.714  38.547  1.00  33.29 ? 22  ARG B NE  1 
ATOM   1825 C  CZ  . ARG B 1 23  ? -20.948 19.293  37.490  1.00  33.45 ? 22  ARG B CZ  1 
ATOM   1826 N  NH1 . ARG B 1 23  ? -21.570 20.167  36.708  1.00  33.72 ? 22  ARG B NH1 1 
ATOM   1827 N  NH2 . ARG B 1 23  ? -21.019 17.993  37.224  1.00  33.31 ? 22  ARG B NH2 1 
ATOM   1828 N  N   . THR B 1 24  ? -16.271 23.711  40.459  1.00  28.69 ? 23  THR B N   1 
ATOM   1829 C  CA  . THR B 1 24  ? -14.938 23.746  39.857  1.00  28.56 ? 23  THR B CA  1 
ATOM   1830 C  C   . THR B 1 24  ? -13.853 23.540  40.919  1.00  28.80 ? 23  THR B C   1 
ATOM   1831 O  O   . THR B 1 24  ? -12.964 22.728  40.723  1.00  29.65 ? 23  THR B O   1 
ATOM   1832 C  CB  . THR B 1 24  ? -14.711 25.050  39.069  1.00  28.47 ? 23  THR B CB  1 
ATOM   1833 O  OG1 . THR B 1 24  ? -15.528 25.030  37.887  1.00  28.66 ? 23  THR B OG1 1 
ATOM   1834 C  CG2 . THR B 1 24  ? -13.240 25.219  38.665  1.00  28.64 ? 23  THR B CG2 1 
ATOM   1835 N  N   . MET B 1 25  ? -13.948 24.247  42.041  1.00  28.60 ? 24  MET B N   1 
ATOM   1836 C  CA  . MET B 1 25  ? -12.969 24.100  43.121  1.00  28.66 ? 24  MET B CA  1 
ATOM   1837 C  C   . MET B 1 25  ? -12.840 22.647  43.585  1.00  28.57 ? 24  MET B C   1 
ATOM   1838 O  O   . MET B 1 25  ? -11.726 22.137  43.720  1.00  28.24 ? 24  MET B O   1 
ATOM   1839 C  CB  . MET B 1 25  ? -13.290 25.024  44.302  1.00  28.74 ? 24  MET B CB  1 
ATOM   1840 C  CG  . MET B 1 25  ? -13.037 26.515  44.050  1.00  29.78 ? 24  MET B CG  1 
ATOM   1841 S  SD  . MET B 1 25  ? -11.344 26.988  43.591  1.00  32.99 ? 24  MET B SD  1 
ATOM   1842 C  CE  . MET B 1 25  ? -10.433 26.384  45.010  1.00  32.61 ? 24  MET B CE  1 
ATOM   1843 N  N   . GLU B 1 26  ? -13.977 21.984  43.798  1.00  28.27 ? 25  GLU B N   1 
ATOM   1844 C  CA  . GLU B 1 26  ? -14.001 20.602  44.279  1.00  28.44 ? 25  GLU B CA  1 
ATOM   1845 C  C   . GLU B 1 26  ? -13.400 19.641  43.252  1.00  27.75 ? 25  GLU B C   1 
ATOM   1846 O  O   . GLU B 1 26  ? -12.486 18.868  43.568  1.00  28.65 ? 25  GLU B O   1 
ATOM   1847 C  CB  . GLU B 1 26  ? -15.430 20.186  44.681  1.00  28.80 ? 25  GLU B CB  1 
ATOM   1848 C  CG  . GLU B 1 26  ? -15.495 18.826  45.353  1.00  31.33 ? 25  GLU B CG  1 
ATOM   1849 C  CD  . GLU B 1 26  ? -16.748 18.618  46.175  1.00  37.19 ? 25  GLU B CD  1 
ATOM   1850 O  OE1 . GLU B 1 26  ? -17.733 19.380  45.996  1.00  39.24 ? 25  GLU B OE1 1 
ATOM   1851 O  OE2 . GLU B 1 26  ? -16.742 17.684  47.015  1.00  38.97 ? 25  GLU B OE2 1 
ATOM   1852 N  N   . ILE B 1 27  ? -13.875 19.713  42.012  1.00  26.93 ? 26  ILE B N   1 
ATOM   1853 C  CA  . ILE B 1 27  ? -13.289 18.893  40.945  1.00  26.63 ? 26  ILE B CA  1 
ATOM   1854 C  C   . ILE B 1 27  ? -11.795 19.181  40.747  1.00  26.48 ? 26  ILE B C   1 
ATOM   1855 O  O   . ILE B 1 27  ? -10.978 18.260  40.655  1.00  26.40 ? 26  ILE B O   1 
ATOM   1856 C  CB  . ILE B 1 27  ? -14.024 19.092  39.613  1.00  26.10 ? 26  ILE B CB  1 
ATOM   1857 C  CG1 . ILE B 1 27  ? -15.494 18.671  39.755  1.00  26.54 ? 26  ILE B CG1 1 
ATOM   1858 C  CG2 . ILE B 1 27  ? -13.353 18.284  38.528  1.00  25.12 ? 26  ILE B CG2 1 
ATOM   1859 C  CD1 . ILE B 1 27  ? -16.385 19.101  38.577  1.00  27.39 ? 26  ILE B CD1 1 
ATOM   1860 N  N   . HIS B 1 28  ? -11.447 20.462  40.654  1.00  26.72 ? 27  HIS B N   1 
ATOM   1861 C  CA  . HIS B 1 28  ? -10.059 20.873  40.422  1.00  26.89 ? 27  HIS B CA  1 
ATOM   1862 C  C   . HIS B 1 28  ? -9.168  20.268  41.492  1.00  27.18 ? 27  HIS B C   1 
ATOM   1863 O  O   . HIS B 1 28  ? -8.094  19.753  41.201  1.00  27.00 ? 27  HIS B O   1 
ATOM   1864 C  CB  . HIS B 1 28  ? -9.965  22.389  40.471  1.00  27.12 ? 27  HIS B CB  1 
ATOM   1865 C  CG  . HIS B 1 28  ? -8.787  22.951  39.741  1.00  27.15 ? 27  HIS B CG  1 
ATOM   1866 N  ND1 . HIS B 1 28  ? -8.610  24.306  39.568  1.00  26.72 ? 27  HIS B ND1 1 
ATOM   1867 C  CD2 . HIS B 1 28  ? -7.734  22.351  39.133  1.00  28.67 ? 27  HIS B CD2 1 
ATOM   1868 C  CE1 . HIS B 1 28  ? -7.492  24.519  38.895  1.00  28.27 ? 27  HIS B CE1 1 
ATOM   1869 N  NE2 . HIS B 1 28  ? -6.941  23.350  38.622  1.00  27.23 ? 27  HIS B NE2 1 
ATOM   1870 N  N   . HIS B 1 29  ? -9.653  20.294  42.732  1.00  27.35 ? 28  HIS B N   1 
ATOM   1871 C  CA  . HIS B 1 29  ? -8.896  19.789  43.864  1.00  27.65 ? 28  HIS B CA  1 
ATOM   1872 C  C   . HIS B 1 29  ? -8.923  18.260  43.994  1.00  27.68 ? 28  HIS B C   1 
ATOM   1873 O  O   . HIS B 1 29  ? -7.881  17.632  44.011  1.00  27.53 ? 28  HIS B O   1 
ATOM   1874 C  CB  . HIS B 1 29  ? -9.387  20.479  45.134  1.00  27.61 ? 28  HIS B CB  1 
ATOM   1875 C  CG  . HIS B 1 29  ? -8.625  20.119  46.372  1.00  28.94 ? 28  HIS B CG  1 
ATOM   1876 N  ND1 . HIS B 1 29  ? -9.245  19.629  47.499  1.00  29.44 ? 28  HIS B ND1 1 
ATOM   1877 C  CD2 . HIS B 1 29  ? -7.309  20.204  46.673  1.00  30.17 ? 28  HIS B CD2 1 
ATOM   1878 C  CE1 . HIS B 1 29  ? -8.342  19.414  48.440  1.00  29.28 ? 28  HIS B CE1 1 
ATOM   1879 N  NE2 . HIS B 1 29  ? -7.159  19.750  47.964  1.00  29.11 ? 28  HIS B NE2 1 
ATOM   1880 N  N   . THR B 1 30  ? -10.114 17.674  44.062  1.00  28.16 ? 29  THR B N   1 
ATOM   1881 C  CA  . THR B 1 30  ? -10.274 16.254  44.383  1.00  28.51 ? 29  THR B CA  1 
ATOM   1882 C  C   . THR B 1 30  ? -10.022 15.313  43.209  1.00  28.17 ? 29  THR B C   1 
ATOM   1883 O  O   . THR B 1 30  ? -9.821  14.115  43.411  1.00  28.07 ? 29  THR B O   1 
ATOM   1884 C  CB  . THR B 1 30  ? -11.679 15.953  44.958  1.00  28.79 ? 29  THR B CB  1 
ATOM   1885 O  OG1 . THR B 1 30  ? -12.677 16.243  43.972  1.00  29.87 ? 29  THR B OG1 1 
ATOM   1886 C  CG2 . THR B 1 30  ? -11.941 16.777  46.221  1.00  29.34 ? 29  THR B CG2 1 
ATOM   1887 N  N   . LYS B 1 31  ? -10.059 15.845  41.989  1.00  28.13 ? 30  LYS B N   1 
ATOM   1888 C  CA  . LYS B 1 31  ? -9.897  15.023  40.787  1.00  28.18 ? 30  LYS B CA  1 
ATOM   1889 C  C   . LYS B 1 31  ? -8.589  15.340  40.079  1.00  27.96 ? 30  LYS B C   1 
ATOM   1890 O  O   . LYS B 1 31  ? -7.695  14.484  40.006  1.00  28.00 ? 30  LYS B O   1 
ATOM   1891 C  CB  . LYS B 1 31  ? -11.099 15.172  39.836  1.00  28.91 ? 30  LYS B CB  1 
ATOM   1892 C  CG  . LYS B 1 31  ? -12.458 14.763  40.435  1.00  29.70 ? 30  LYS B CG  1 
ATOM   1893 C  CD  . LYS B 1 31  ? -12.605 13.245  40.564  1.00  32.08 ? 30  LYS B CD  1 
ATOM   1894 C  CE  . LYS B 1 31  ? -13.997 12.833  41.120  1.00  33.45 ? 30  LYS B CE  1 
ATOM   1895 N  NZ  . LYS B 1 31  ? -14.002 12.737  42.606  1.00  37.83 ? 30  LYS B NZ  1 
ATOM   1896 N  N   . HIS B 1 32  ? -8.467  16.569  39.579  1.00  26.97 ? 31  HIS B N   1 
ATOM   1897 C  CA  . HIS B 1 32  ? -7.277  16.977  38.822  1.00  27.61 ? 31  HIS B CA  1 
ATOM   1898 C  C   . HIS B 1 32  ? -6.014  16.948  39.679  1.00  27.67 ? 31  HIS B C   1 
ATOM   1899 O  O   . HIS B 1 32  ? -5.051  16.266  39.341  1.00  27.88 ? 31  HIS B O   1 
ATOM   1900 C  CB  . HIS B 1 32  ? -7.472  18.355  38.184  1.00  27.29 ? 31  HIS B CB  1 
ATOM   1901 C  CG  . HIS B 1 32  ? -8.533  18.374  37.125  1.00  29.70 ? 31  HIS B CG  1 
ATOM   1902 N  ND1 . HIS B 1 32  ? -8.346  17.821  35.875  1.00  31.05 ? 31  HIS B ND1 1 
ATOM   1903 C  CD2 . HIS B 1 32  ? -9.796  18.862  37.135  1.00  29.54 ? 31  HIS B CD2 1 
ATOM   1904 C  CE1 . HIS B 1 32  ? -9.448  17.974  35.159  1.00  31.08 ? 31  HIS B CE1 1 
ATOM   1905 N  NE2 . HIS B 1 32  ? -10.342 18.606  35.899  1.00  29.88 ? 31  HIS B NE2 1 
ATOM   1906 N  N   . HIS B 1 33  ? -6.018  17.677  40.793  1.00  27.83 ? 32  HIS B N   1 
ATOM   1907 C  CA  . HIS B 1 33  ? -4.827  17.722  41.646  1.00  27.97 ? 32  HIS B CA  1 
ATOM   1908 C  C   . HIS B 1 33  ? -4.519  16.335  42.235  1.00  28.55 ? 32  HIS B C   1 
ATOM   1909 O  O   . HIS B 1 33  ? -3.360  15.897  42.251  1.00  28.21 ? 32  HIS B O   1 
ATOM   1910 C  CB  . HIS B 1 33  ? -4.989  18.791  42.735  1.00  28.17 ? 32  HIS B CB  1 
ATOM   1911 C  CG  . HIS B 1 33  ? -3.731  19.085  43.492  1.00  27.53 ? 32  HIS B CG  1 
ATOM   1912 N  ND1 . HIS B 1 33  ? -3.699  19.939  44.572  1.00  27.51 ? 32  HIS B ND1 1 
ATOM   1913 C  CD2 . HIS B 1 33  ? -2.469  18.607  43.353  1.00  26.71 ? 32  HIS B CD2 1 
ATOM   1914 C  CE1 . HIS B 1 33  ? -2.470  19.997  45.051  1.00  27.31 ? 32  HIS B CE1 1 
ATOM   1915 N  NE2 . HIS B 1 33  ? -1.709  19.186  44.338  1.00  27.29 ? 32  HIS B NE2 1 
ATOM   1916 N  N   . GLN B 1 34  ? -5.560  15.626  42.671  1.00  28.11 ? 33  GLN B N   1 
ATOM   1917 C  CA  . GLN B 1 34  ? -5.386  14.259  43.170  1.00  29.10 ? 33  GLN B CA  1 
ATOM   1918 C  C   . GLN B 1 34  ? -4.676  13.364  42.147  1.00  29.24 ? 33  GLN B C   1 
ATOM   1919 O  O   . GLN B 1 34  ? -3.768  12.608  42.506  1.00  29.04 ? 33  GLN B O   1 
ATOM   1920 C  CB  . GLN B 1 34  ? -6.723  13.636  43.578  1.00  28.50 ? 33  GLN B CB  1 
ATOM   1921 C  CG  . GLN B 1 34  ? -6.590  12.252  44.242  1.00  29.91 ? 33  GLN B CG  1 
ATOM   1922 C  CD  . GLN B 1 34  ? -5.974  12.336  45.622  1.00  30.91 ? 33  GLN B CD  1 
ATOM   1923 O  OE1 . GLN B 1 34  ? -6.560  12.904  46.548  1.00  31.60 ? 33  GLN B OE1 1 
ATOM   1924 N  NE2 . GLN B 1 34  ? -4.783  11.773  45.770  1.00  30.49 ? 33  GLN B NE2 1 
ATOM   1925 N  N   . THR B 1 35  ? -5.077  13.466  40.881  1.00  29.65 ? 34  THR B N   1 
ATOM   1926 C  CA  . THR B 1 35  ? -4.457  12.676  39.818  1.00  30.27 ? 34  THR B CA  1 
ATOM   1927 C  C   . THR B 1 35  ? -2.950  12.947  39.674  1.00  30.31 ? 34  THR B C   1 
ATOM   1928 O  O   . THR B 1 35  ? -2.163  12.007  39.552  1.00  31.03 ? 34  THR B O   1 
ATOM   1929 C  CB  . THR B 1 35  ? -5.224  12.828  38.479  1.00  30.85 ? 34  THR B CB  1 
ATOM   1930 O  OG1 . THR B 1 35  ? -6.561  12.353  38.676  1.00  31.85 ? 34  THR B OG1 1 
ATOM   1931 C  CG2 . THR B 1 35  ? -4.576  11.988  37.383  1.00  31.52 ? 34  THR B CG2 1 
ATOM   1932 N  N   . TYR B 1 36  ? -2.545  14.216  39.714  1.00  29.72 ? 35  TYR B N   1 
ATOM   1933 C  CA  . TYR B 1 36  ? -1.115  14.547  39.664  1.00  30.08 ? 35  TYR B CA  1 
ATOM   1934 C  C   . TYR B 1 36  ? -0.336  13.945  40.842  1.00  29.83 ? 35  TYR B C   1 
ATOM   1935 O  O   . TYR B 1 36  ? 0.786   13.444  40.673  1.00  29.70 ? 35  TYR B O   1 
ATOM   1936 C  CB  . TYR B 1 36  ? -0.899  16.060  39.589  1.00  30.36 ? 35  TYR B CB  1 
ATOM   1937 C  CG  . TYR B 1 36  ? -1.501  16.701  38.355  1.00  30.87 ? 35  TYR B CG  1 
ATOM   1938 C  CD1 . TYR B 1 36  ? -1.239  16.183  37.083  1.00  30.37 ? 35  TYR B CD1 1 
ATOM   1939 C  CD2 . TYR B 1 36  ? -2.335  17.827  38.459  1.00  31.19 ? 35  TYR B CD2 1 
ATOM   1940 C  CE1 . TYR B 1 36  ? -1.782  16.776  35.933  1.00  32.91 ? 35  TYR B CE1 1 
ATOM   1941 C  CE2 . TYR B 1 36  ? -2.895  18.424  37.310  1.00  32.44 ? 35  TYR B CE2 1 
ATOM   1942 C  CZ  . TYR B 1 36  ? -2.624  17.886  36.061  1.00  33.65 ? 35  TYR B CZ  1 
ATOM   1943 O  OH  . TYR B 1 36  ? -3.148  18.468  34.927  1.00  34.28 ? 35  TYR B OH  1 
ATOM   1944 N  N   . VAL B 1 37  ? -0.932  13.996  42.029  1.00  29.11 ? 36  VAL B N   1 
ATOM   1945 C  CA  . VAL B 1 37  ? -0.322  13.408  43.217  1.00  29.17 ? 36  VAL B CA  1 
ATOM   1946 C  C   . VAL B 1 37  ? -0.140  11.897  42.998  1.00  29.41 ? 36  VAL B C   1 
ATOM   1947 O  O   . VAL B 1 37  ? 0.942   11.351  43.248  1.00  28.95 ? 36  VAL B O   1 
ATOM   1948 C  CB  . VAL B 1 37  ? -1.181  13.686  44.493  1.00  29.22 ? 36  VAL B CB  1 
ATOM   1949 C  CG1 . VAL B 1 37  ? -0.735  12.812  45.682  1.00  29.31 ? 36  VAL B CG1 1 
ATOM   1950 C  CG2 . VAL B 1 37  ? -1.143  15.168  44.856  1.00  29.06 ? 36  VAL B CG2 1 
ATOM   1951 N  N   . ASP B 1 38  ? -1.199  11.235  42.526  1.00  29.89 ? 37  ASP B N   1 
ATOM   1952 C  CA  . ASP B 1 38  ? -1.186  9.778   42.369  1.00  30.04 ? 37  ASP B CA  1 
ATOM   1953 C  C   . ASP B 1 38  ? -0.136  9.350   41.345  1.00  29.88 ? 37  ASP B C   1 
ATOM   1954 O  O   . ASP B 1 38  ? 0.625   8.397   41.569  1.00  28.97 ? 37  ASP B O   1 
ATOM   1955 C  CB  . ASP B 1 38  ? -2.580  9.268   41.976  1.00  30.73 ? 37  ASP B CB  1 
ATOM   1956 C  CG  . ASP B 1 38  ? -3.611  9.429   43.101  1.00  33.44 ? 37  ASP B CG  1 
ATOM   1957 O  OD1 . ASP B 1 38  ? -3.223  9.743   44.253  1.00  35.68 ? 37  ASP B OD1 1 
ATOM   1958 O  OD2 . ASP B 1 38  ? -4.819  9.232   42.834  1.00  36.63 ? 37  ASP B OD2 1 
ATOM   1959 N  N   . ASN B 1 39  ? -0.070  10.085  40.238  1.00  29.27 ? 38  ASN B N   1 
ATOM   1960 C  CA  . ASN B 1 39  ? 0.839   9.734   39.157  1.00  29.34 ? 38  ASN B CA  1 
ATOM   1961 C  C   . ASN B 1 39  ? 2.307   10.060  39.457  1.00  29.39 ? 38  ASN B C   1 
ATOM   1962 O  O   . ASN B 1 39  ? 3.223   9.330   39.032  1.00  29.44 ? 38  ASN B O   1 
ATOM   1963 C  CB  . ASN B 1 39  ? 0.344   10.355  37.847  1.00  29.45 ? 38  ASN B CB  1 
ATOM   1964 C  CG  . ASN B 1 39  ? -0.889  9.656   37.306  1.00  30.32 ? 38  ASN B CG  1 
ATOM   1965 O  OD1 . ASN B 1 39  ? -1.158  8.505   37.640  1.00  31.55 ? 38  ASN B OD1 1 
ATOM   1966 N  ND2 . ASN B 1 39  ? -1.646  10.346  36.467  1.00  32.58 ? 38  ASN B ND2 1 
ATOM   1967 N  N   . ALA B 1 40  ? 2.530   11.154  40.188  1.00  28.76 ? 39  ALA B N   1 
ATOM   1968 C  CA  . ALA B 1 40  ? 3.867   11.495  40.661  1.00  28.66 ? 39  ALA B CA  1 
ATOM   1969 C  C   . ALA B 1 40  ? 4.367   10.423  41.639  1.00  28.42 ? 39  ALA B C   1 
ATOM   1970 O  O   . ALA B 1 40  ? 5.506   9.981   41.543  1.00  28.00 ? 39  ALA B O   1 
ATOM   1971 C  CB  . ALA B 1 40  ? 3.873   12.861  41.302  1.00  28.32 ? 39  ALA B CB  1 
ATOM   1972 N  N   . ASN B 1 41  ? 3.501   10.005  42.562  1.00  28.21 ? 40  ASN B N   1 
ATOM   1973 C  CA  . ASN B 1 41  ? 3.830   8.944   43.514  1.00  28.72 ? 40  ASN B CA  1 
ATOM   1974 C  C   . ASN B 1 41  ? 4.242   7.652   42.815  1.00  29.01 ? 40  ASN B C   1 
ATOM   1975 O  O   . ASN B 1 41  ? 5.264   7.063   43.155  1.00  28.65 ? 40  ASN B O   1 
ATOM   1976 C  CB  . ASN B 1 41  ? 2.665   8.695   44.481  1.00  28.36 ? 40  ASN B CB  1 
ATOM   1977 C  CG  . ASN B 1 41  ? 2.591   9.742   45.591  1.00  29.02 ? 40  ASN B CG  1 
ATOM   1978 O  OD1 . ASN B 1 41  ? 3.570   10.428  45.882  1.00  29.68 ? 40  ASN B OD1 1 
ATOM   1979 N  ND2 . ASN B 1 41  ? 1.424   9.856   46.225  1.00  28.23 ? 40  ASN B ND2 1 
ATOM   1980 N  N   . LYS B 1 42  ? 3.459   7.238   41.818  1.00  29.87 ? 41  LYS B N   1 
ATOM   1981 C  CA  . LYS B 1 42  ? 3.758   6.039   41.033  1.00  30.83 ? 41  LYS B CA  1 
ATOM   1982 C  C   . LYS B 1 42  ? 5.131   6.159   40.373  1.00  30.88 ? 41  LYS B C   1 
ATOM   1983 O  O   . LYS B 1 42  ? 5.932   5.217   40.420  1.00  30.62 ? 41  LYS B O   1 
ATOM   1984 C  CB  . LYS B 1 42  ? 2.661   5.821   39.986  1.00  31.47 ? 41  LYS B CB  1 
ATOM   1985 C  CG  . LYS B 1 42  ? 2.847   4.636   39.067  1.00  33.98 ? 41  LYS B CG  1 
ATOM   1986 C  CD  . LYS B 1 42  ? 1.817   4.714   37.933  1.00  37.62 ? 41  LYS B CD  1 
ATOM   1987 C  CE  . LYS B 1 42  ? 2.151   3.773   36.779  1.00  40.33 ? 41  LYS B CE  1 
ATOM   1988 N  NZ  . LYS B 1 42  ? 1.023   3.705   35.800  1.00  42.04 ? 41  LYS B NZ  1 
ATOM   1989 N  N   . ALA B 1 43  ? 5.401   7.330   39.793  1.00  31.02 ? 42  ALA B N   1 
ATOM   1990 C  CA  . ALA B 1 43  ? 6.670   7.615   39.119  1.00  31.42 ? 42  ALA B CA  1 
ATOM   1991 C  C   . ALA B 1 43  ? 7.873   7.640   40.067  1.00  31.49 ? 42  ALA B C   1 
ATOM   1992 O  O   . ALA B 1 43  ? 8.999   7.309   39.665  1.00  31.74 ? 42  ALA B O   1 
ATOM   1993 C  CB  . ALA B 1 43  ? 6.567   8.930   38.346  1.00  31.62 ? 42  ALA B CB  1 
ATOM   1994 N  N   . LEU B 1 44  ? 7.636   8.021   41.323  1.00  31.33 ? 43  LEU B N   1 
ATOM   1995 C  CA  . LEU B 1 44  ? 8.704   8.135   42.315  1.00  31.49 ? 43  LEU B CA  1 
ATOM   1996 C  C   . LEU B 1 44  ? 9.089   6.830   43.008  1.00  32.21 ? 43  LEU B C   1 
ATOM   1997 O  O   . LEU B 1 44  ? 10.171  6.729   43.597  1.00  31.60 ? 43  LEU B O   1 
ATOM   1998 C  CB  . LEU B 1 44  ? 8.339   9.181   43.371  1.00  31.44 ? 43  LEU B CB  1 
ATOM   1999 C  CG  . LEU B 1 44  ? 8.409   10.634  42.913  1.00  31.55 ? 43  LEU B CG  1 
ATOM   2000 C  CD1 . LEU B 1 44  ? 7.696   11.524  43.901  1.00  31.63 ? 43  LEU B CD1 1 
ATOM   2001 C  CD2 . LEU B 1 44  ? 9.865   11.088  42.705  1.00  32.08 ? 43  LEU B CD2 1 
ATOM   2002 N  N   . GLU B 1 45  ? 8.199   5.845   42.959  1.00  33.07 ? 44  GLU B N   1 
ATOM   2003 C  CA  . GLU B 1 45  ? 8.477   4.539   43.557  1.00  34.51 ? 44  GLU B CA  1 
ATOM   2004 C  C   . GLU B 1 45  ? 9.717   3.931   42.903  1.00  34.50 ? 44  GLU B C   1 
ATOM   2005 O  O   . GLU B 1 45  ? 9.819   3.893   41.677  1.00  34.45 ? 44  GLU B O   1 
ATOM   2006 C  CB  . GLU B 1 45  ? 7.277   3.610   43.389  1.00  34.93 ? 44  GLU B CB  1 
ATOM   2007 C  CG  . GLU B 1 45  ? 6.045   4.040   44.187  1.00  37.89 ? 44  GLU B CG  1 
ATOM   2008 C  CD  . GLU B 1 45  ? 4.775   3.334   43.734  1.00  41.87 ? 44  GLU B CD  1 
ATOM   2009 O  OE1 . GLU B 1 45  ? 4.855   2.150   43.327  1.00  43.31 ? 44  GLU B OE1 1 
ATOM   2010 O  OE2 . GLU B 1 45  ? 3.692   3.967   43.785  1.00  44.24 ? 44  GLU B OE2 1 
ATOM   2011 N  N   . GLY B 1 46  ? 10.665  3.497   43.727  1.00  34.97 ? 45  GLY B N   1 
ATOM   2012 C  CA  . GLY B 1 46  ? 11.887  2.863   43.233  1.00  35.69 ? 45  GLY B CA  1 
ATOM   2013 C  C   . GLY B 1 46  ? 13.044  3.811   42.946  1.00  36.16 ? 45  GLY B C   1 
ATOM   2014 O  O   . GLY B 1 46  ? 14.134  3.363   42.577  1.00  36.13 ? 45  GLY B O   1 
ATOM   2015 N  N   . THR B 1 47  ? 12.810  5.114   43.113  1.00  36.38 ? 46  THR B N   1 
ATOM   2016 C  CA  . THR B 1 47  ? 13.835  6.134   42.875  1.00  36.79 ? 46  THR B CA  1 
ATOM   2017 C  C   . THR B 1 47  ? 14.427  6.633   44.192  1.00  37.31 ? 46  THR B C   1 
ATOM   2018 O  O   . THR B 1 47  ? 13.915  6.319   45.267  1.00  37.43 ? 46  THR B O   1 
ATOM   2019 C  CB  . THR B 1 47  ? 13.285  7.350   42.077  1.00  36.72 ? 46  THR B CB  1 
ATOM   2020 O  OG1 . THR B 1 47  ? 12.385  8.112   42.894  1.00  36.45 ? 46  THR B OG1 1 
ATOM   2021 C  CG2 . THR B 1 47  ? 12.567  6.905   40.815  1.00  36.31 ? 46  THR B CG2 1 
ATOM   2022 N  N   . GLU B 1 48  ? 15.502  7.413   44.095  1.00  37.80 ? 47  GLU B N   1 
ATOM   2023 C  CA  . GLU B 1 48  ? 16.125  8.050   45.254  1.00  38.52 ? 47  GLU B CA  1 
ATOM   2024 C  C   . GLU B 1 48  ? 15.563  9.461   45.498  1.00  38.23 ? 47  GLU B C   1 
ATOM   2025 O  O   . GLU B 1 48  ? 16.147  10.241  46.253  1.00  38.30 ? 47  GLU B O   1 
ATOM   2026 C  CB  . GLU B 1 48  ? 17.652  8.108   45.076  1.00  38.44 ? 47  GLU B CB  1 
ATOM   2027 C  CG  . GLU B 1 48  ? 18.115  8.971   43.889  1.00  39.55 ? 47  GLU B CG  1 
ATOM   2028 C  CD  . GLU B 1 48  ? 19.632  9.146   43.787  1.00  40.03 ? 47  GLU B CD  1 
ATOM   2029 O  OE1 . GLU B 1 48  ? 20.396  8.450   44.504  1.00  41.32 ? 47  GLU B OE1 1 
ATOM   2030 O  OE2 . GLU B 1 48  ? 20.061  9.995   42.970  1.00  42.10 ? 47  GLU B OE2 1 
ATOM   2031 N  N   . PHE B 1 49  ? 14.427  9.773   44.869  1.00  38.01 ? 48  PHE B N   1 
ATOM   2032 C  CA  . PHE B 1 49  ? 13.882  11.134  44.858  1.00  37.90 ? 48  PHE B CA  1 
ATOM   2033 C  C   . PHE B 1 49  ? 12.557  11.310  45.614  1.00  37.99 ? 48  PHE B C   1 
ATOM   2034 O  O   . PHE B 1 49  ? 12.004  12.418  45.636  1.00  37.79 ? 48  PHE B O   1 
ATOM   2035 C  CB  . PHE B 1 49  ? 13.706  11.617  43.409  1.00  38.01 ? 48  PHE B CB  1 
ATOM   2036 C  CG  . PHE B 1 49  ? 14.998  11.822  42.677  1.00  37.83 ? 48  PHE B CG  1 
ATOM   2037 C  CD1 . PHE B 1 49  ? 15.650  13.050  42.724  1.00  38.53 ? 48  PHE B CD1 1 
ATOM   2038 C  CD2 . PHE B 1 49  ? 15.562  10.791  41.937  1.00  37.45 ? 48  PHE B CD2 1 
ATOM   2039 C  CE1 . PHE B 1 49  ? 16.856  13.245  42.048  1.00  38.54 ? 48  PHE B CE1 1 
ATOM   2040 C  CE2 . PHE B 1 49  ? 16.764  10.976  41.258  1.00  37.97 ? 48  PHE B CE2 1 
ATOM   2041 C  CZ  . PHE B 1 49  ? 17.411  12.206  41.313  1.00  38.25 ? 48  PHE B CZ  1 
ATOM   2042 N  N   . ALA B 1 50  ? 12.056  10.230  46.220  1.00  37.85 ? 49  ALA B N   1 
ATOM   2043 C  CA  . ALA B 1 50  ? 10.757  10.247  46.908  1.00  37.81 ? 49  ALA B CA  1 
ATOM   2044 C  C   . ALA B 1 50  ? 10.722  11.096  48.183  1.00  38.03 ? 49  ALA B C   1 
ATOM   2045 O  O   . ALA B 1 50  ? 9.638   11.480  48.636  1.00  38.53 ? 49  ALA B O   1 
ATOM   2046 C  CB  . ALA B 1 50  ? 10.287  8.830   47.206  1.00  37.83 ? 49  ALA B CB  1 
ATOM   2047 N  N   . ASP B 1 51  ? 11.897  11.403  48.739  1.00  37.65 ? 50  ASP B N   1 
ATOM   2048 C  CA  . ASP B 1 51  ? 12.003  12.171  49.985  1.00  37.79 ? 50  ASP B CA  1 
ATOM   2049 C  C   . ASP B 1 51  ? 12.198  13.679  49.808  1.00  37.17 ? 50  ASP B C   1 
ATOM   2050 O  O   . ASP B 1 51  ? 12.271  14.416  50.792  1.00  37.38 ? 50  ASP B O   1 
ATOM   2051 C  CB  . ASP B 1 51  ? 13.120  11.599  50.861  1.00  38.20 ? 50  ASP B CB  1 
ATOM   2052 C  CG  . ASP B 1 51  ? 12.812  10.198  51.356  1.00  40.16 ? 50  ASP B CG  1 
ATOM   2053 O  OD1 . ASP B 1 51  ? 11.635  9.914   51.679  1.00  42.15 ? 50  ASP B OD1 1 
ATOM   2054 O  OD2 . ASP B 1 51  ? 13.748  9.373   51.426  1.00  42.91 ? 50  ASP B OD2 1 
ATOM   2055 N  N   . LEU B 1 52  ? 12.287  14.147  48.569  1.00  36.14 ? 51  LEU B N   1 
ATOM   2056 C  CA  . LEU B 1 52  ? 12.450  15.581  48.335  1.00  35.56 ? 51  LEU B CA  1 
ATOM   2057 C  C   . LEU B 1 52  ? 11.099  16.285  48.360  1.00  34.81 ? 51  LEU B C   1 
ATOM   2058 O  O   . LEU B 1 52  ? 10.127  15.748  47.840  1.00  34.78 ? 51  LEU B O   1 
ATOM   2059 C  CB  . LEU B 1 52  ? 13.128  15.845  46.989  1.00  35.65 ? 51  LEU B CB  1 
ATOM   2060 C  CG  . LEU B 1 52  ? 14.620  15.559  46.793  1.00  36.26 ? 51  LEU B CG  1 
ATOM   2061 C  CD1 . LEU B 1 52  ? 14.947  15.618  45.306  1.00  36.10 ? 51  LEU B CD1 1 
ATOM   2062 C  CD2 . LEU B 1 52  ? 15.497  16.533  47.580  1.00  36.53 ? 51  LEU B CD2 1 
ATOM   2063 N  N   . PRO B 1 53  ? 11.024  17.481  48.980  1.00  34.34 ? 52  PRO B N   1 
ATOM   2064 C  CA  . PRO B 1 53  ? 9.881   18.369  48.737  1.00  33.90 ? 52  PRO B CA  1 
ATOM   2065 C  C   . PRO B 1 53  ? 9.665   18.533  47.243  1.00  33.37 ? 52  PRO B C   1 
ATOM   2066 O  O   . PRO B 1 53  ? 10.639  18.588  46.495  1.00  32.57 ? 52  PRO B O   1 
ATOM   2067 C  CB  . PRO B 1 53  ? 10.331  19.714  49.327  1.00  33.83 ? 52  PRO B CB  1 
ATOM   2068 C  CG  . PRO B 1 53  ? 11.734  19.510  49.829  1.00  34.63 ? 52  PRO B CG  1 
ATOM   2069 C  CD  . PRO B 1 53  ? 11.960  18.052  49.962  1.00  34.54 ? 52  PRO B CD  1 
ATOM   2070 N  N   . VAL B 1 54  ? 8.404   18.623  46.820  1.00  33.16 ? 53  VAL B N   1 
ATOM   2071 C  CA  . VAL B 1 54  ? 8.068   18.670  45.392  1.00  32.93 ? 53  VAL B CA  1 
ATOM   2072 C  C   . VAL B 1 54  ? 8.767   19.834  44.677  1.00  33.23 ? 53  VAL B C   1 
ATOM   2073 O  O   . VAL B 1 54  ? 9.248   19.670  43.557  1.00  32.88 ? 53  VAL B O   1 
ATOM   2074 C  CB  . VAL B 1 54  ? 6.512   18.651  45.143  1.00  32.87 ? 53  VAL B CB  1 
ATOM   2075 C  CG1 . VAL B 1 54  ? 5.859   19.979  45.531  1.00  32.51 ? 53  VAL B CG1 1 
ATOM   2076 C  CG2 . VAL B 1 54  ? 6.178   18.272  43.693  1.00  32.64 ? 53  VAL B CG2 1 
ATOM   2077 N  N   . GLU B 1 55  ? 8.847   20.993  45.336  1.00  33.61 ? 54  GLU B N   1 
ATOM   2078 C  CA  . GLU B 1 55  ? 9.456   22.180  44.720  1.00  34.36 ? 54  GLU B CA  1 
ATOM   2079 C  C   . GLU B 1 55  ? 10.962  22.021  44.492  1.00  34.21 ? 54  GLU B C   1 
ATOM   2080 O  O   . GLU B 1 55  ? 11.536  22.705  43.647  1.00  34.91 ? 54  GLU B O   1 
ATOM   2081 C  CB  . GLU B 1 55  ? 9.122   23.472  45.492  1.00  34.28 ? 54  GLU B CB  1 
ATOM   2082 C  CG  . GLU B 1 55  ? 9.858   23.664  46.822  1.00  37.26 ? 54  GLU B CG  1 
ATOM   2083 C  CD  . GLU B 1 55  ? 9.209   22.942  47.997  1.00  39.35 ? 54  GLU B CD  1 
ATOM   2084 O  OE1 . GLU B 1 55  ? 9.672   23.176  49.138  1.00  39.77 ? 54  GLU B OE1 1 
ATOM   2085 O  OE2 . GLU B 1 55  ? 8.248   22.152  47.790  1.00  39.52 ? 54  GLU B OE2 1 
ATOM   2086 N  N   . GLN B 1 56  ? 11.590  21.110  45.233  1.00  34.24 ? 55  GLN B N   1 
ATOM   2087 C  CA  . GLN B 1 56  ? 12.992  20.762  45.004  1.00  34.54 ? 55  GLN B CA  1 
ATOM   2088 C  C   . GLN B 1 56  ? 13.136  19.692  43.916  1.00  34.04 ? 55  GLN B C   1 
ATOM   2089 O  O   . GLN B 1 56  ? 14.041  19.770  43.088  1.00  34.39 ? 55  GLN B O   1 
ATOM   2090 C  CB  . GLN B 1 56  ? 13.663  20.292  46.298  1.00  34.91 ? 55  GLN B CB  1 
ATOM   2091 C  CG  . GLN B 1 56  ? 13.825  21.388  47.365  1.00  38.12 ? 55  GLN B CG  1 
ATOM   2092 C  CD  . GLN B 1 56  ? 14.568  22.622  46.870  1.00  42.67 ? 55  GLN B CD  1 
ATOM   2093 O  OE1 . GLN B 1 56  ? 15.720  22.540  46.423  1.00  45.22 ? 55  GLN B OE1 1 
ATOM   2094 N  NE2 . GLN B 1 56  ? 13.915  23.783  46.961  1.00  44.04 ? 55  GLN B NE2 1 
ATOM   2095 N  N   . LEU B 1 57  ? 12.253  18.694  43.930  1.00  33.25 ? 56  LEU B N   1 
ATOM   2096 C  CA  . LEU B 1 57  ? 12.233  17.667  42.879  1.00  32.91 ? 56  LEU B CA  1 
ATOM   2097 C  C   . LEU B 1 57  ? 12.162  18.269  41.475  1.00  32.39 ? 56  LEU B C   1 
ATOM   2098 O  O   . LEU B 1 57  ? 12.943  17.882  40.588  1.00  32.47 ? 56  LEU B O   1 
ATOM   2099 C  CB  . LEU B 1 57  ? 11.073  16.685  43.075  1.00  32.60 ? 56  LEU B CB  1 
ATOM   2100 C  CG  . LEU B 1 57  ? 10.926  15.595  42.005  1.00  33.37 ? 56  LEU B CG  1 
ATOM   2101 C  CD1 . LEU B 1 57  ? 12.172  14.703  41.917  1.00  33.67 ? 56  LEU B CD1 1 
ATOM   2102 C  CD2 . LEU B 1 57  ? 9.714   14.753  42.263  1.00  33.46 ? 56  LEU B CD2 1 
ATOM   2103 N  N   . ILE B 1 58  ? 11.255  19.226  41.281  1.00  31.69 ? 57  ILE B N   1 
ATOM   2104 C  CA  . ILE B 1 58  ? 11.030  19.798  39.945  1.00  31.83 ? 57  ILE B CA  1 
ATOM   2105 C  C   . ILE B 1 58  ? 12.221  20.602  39.442  1.00  31.57 ? 57  ILE B C   1 
ATOM   2106 O  O   . ILE B 1 58  ? 12.324  20.887  38.250  1.00  31.90 ? 57  ILE B O   1 
ATOM   2107 C  CB  . ILE B 1 58  ? 9.679   20.597  39.808  1.00  31.49 ? 57  ILE B CB  1 
ATOM   2108 C  CG1 . ILE B 1 58  ? 9.608   21.774  40.791  1.00  32.31 ? 57  ILE B CG1 1 
ATOM   2109 C  CG2 . ILE B 1 58  ? 8.488   19.648  39.942  1.00  31.87 ? 57  ILE B CG2 1 
ATOM   2110 C  CD1 . ILE B 1 58  ? 8.601   22.853  40.385  1.00  32.31 ? 57  ILE B CD1 1 
ATOM   2111 N  N   . GLN B 1 59  ? 13.119  20.955  40.357  1.00  31.35 ? 58  GLN B N   1 
ATOM   2112 C  CA  . GLN B 1 59  ? 14.364  21.628  40.009  1.00  31.17 ? 58  GLN B CA  1 
ATOM   2113 C  C   . GLN B 1 59  ? 15.473  20.626  39.666  1.00  31.08 ? 58  GLN B C   1 
ATOM   2114 O  O   . GLN B 1 59  ? 16.576  21.020  39.294  1.00  31.30 ? 58  GLN B O   1 
ATOM   2115 C  CB  . GLN B 1 59  ? 14.828  22.505  41.177  1.00  31.31 ? 58  GLN B CB  1 
ATOM   2116 C  CG  . GLN B 1 59  ? 13.911  23.675  41.479  1.00  31.17 ? 58  GLN B CG  1 
ATOM   2117 C  CD  . GLN B 1 59  ? 14.405  24.506  42.642  1.00  31.87 ? 58  GLN B CD  1 
ATOM   2118 O  OE1 . GLN B 1 59  ? 15.478  25.117  42.577  1.00  31.61 ? 58  GLN B OE1 1 
ATOM   2119 N  NE2 . GLN B 1 59  ? 13.625  24.537  43.719  1.00  33.19 ? 58  GLN B NE2 1 
ATOM   2120 N  N   . GLN B 1 60  ? 15.188  19.338  39.828  1.00  30.93 ? 59  GLN B N   1 
ATOM   2121 C  CA  . GLN B 1 60  ? 16.177  18.287  39.598  1.00  30.71 ? 59  GLN B CA  1 
ATOM   2122 C  C   . GLN B 1 60  ? 15.741  17.277  38.547  1.00  30.97 ? 59  GLN B C   1 
ATOM   2123 O  O   . GLN B 1 60  ? 16.164  16.119  38.574  1.00  30.47 ? 59  GLN B O   1 
ATOM   2124 C  CB  . GLN B 1 60  ? 16.505  17.566  40.908  1.00  30.96 ? 59  GLN B CB  1 
ATOM   2125 C  CG  . GLN B 1 60  ? 17.125  18.466  41.952  1.00  30.50 ? 59  GLN B CG  1 
ATOM   2126 C  CD  . GLN B 1 60  ? 17.587  17.712  43.183  1.00  31.55 ? 59  GLN B CD  1 
ATOM   2127 O  OE1 . GLN B 1 60  ? 17.778  16.492  43.154  1.00  30.13 ? 59  GLN B OE1 1 
ATOM   2128 N  NE2 . GLN B 1 60  ? 17.772  18.439  44.275  1.00  31.85 ? 59  GLN B NE2 1 
ATOM   2129 N  N   . LEU B 1 61  ? 14.901  17.719  37.612  1.00  31.30 ? 60  LEU B N   1 
ATOM   2130 C  CA  . LEU B 1 61  ? 14.352  16.826  36.593  1.00  32.21 ? 60  LEU B CA  1 
ATOM   2131 C  C   . LEU B 1 61  ? 15.412  16.206  35.662  1.00  33.10 ? 60  LEU B C   1 
ATOM   2132 O  O   . LEU B 1 61  ? 15.194  15.131  35.104  1.00  33.28 ? 60  LEU B O   1 
ATOM   2133 C  CB  . LEU B 1 61  ? 13.248  17.532  35.802  1.00  32.06 ? 60  LEU B CB  1 
ATOM   2134 C  CG  . LEU B 1 61  ? 11.935  17.782  36.562  1.00  31.73 ? 60  LEU B CG  1 
ATOM   2135 C  CD1 . LEU B 1 61  ? 10.944  18.557  35.697  1.00  31.32 ? 60  LEU B CD1 1 
ATOM   2136 C  CD2 . LEU B 1 61  ? 11.316  16.469  37.030  1.00  31.81 ? 60  LEU B CD2 1 
ATOM   2137 N  N   . ASP B 1 62  ? 16.555  16.878  35.517  1.00  34.05 ? 61  ASP B N   1 
ATOM   2138 C  CA  . ASP B 1 62  ? 17.661  16.371  34.704  1.00  34.78 ? 61  ASP B CA  1 
ATOM   2139 C  C   . ASP B 1 62  ? 18.488  15.286  35.407  1.00  34.73 ? 61  ASP B C   1 
ATOM   2140 O  O   . ASP B 1 62  ? 19.387  14.693  34.796  1.00  34.79 ? 61  ASP B O   1 
ATOM   2141 C  CB  . ASP B 1 62  ? 18.564  17.525  34.230  1.00  35.39 ? 61  ASP B CB  1 
ATOM   2142 C  CG  . ASP B 1 62  ? 19.443  18.102  35.344  1.00  37.72 ? 61  ASP B CG  1 
ATOM   2143 O  OD1 . ASP B 1 62  ? 18.944  18.322  36.473  1.00  40.62 ? 61  ASP B OD1 1 
ATOM   2144 O  OD2 . ASP B 1 62  ? 20.640  18.360  35.082  1.00  39.27 ? 61  ASP B OD2 1 
ATOM   2145 N  N   . ARG B 1 63  ? 18.188  15.039  36.683  1.00  34.51 ? 62  ARG B N   1 
ATOM   2146 C  CA  . ARG B 1 63  ? 18.912  14.053  37.487  1.00  34.46 ? 62  ARG B CA  1 
ATOM   2147 C  C   . ARG B 1 63  ? 18.120  12.763  37.682  1.00  34.37 ? 62  ARG B C   1 
ATOM   2148 O  O   . ARG B 1 63  ? 18.698  11.741  38.054  1.00  33.80 ? 62  ARG B O   1 
ATOM   2149 C  CB  . ARG B 1 63  ? 19.271  14.615  38.867  1.00  34.45 ? 62  ARG B CB  1 
ATOM   2150 C  CG  . ARG B 1 63  ? 19.905  15.987  38.871  1.00  35.24 ? 62  ARG B CG  1 
ATOM   2151 C  CD  . ARG B 1 63  ? 20.442  16.316  40.250  1.00  35.75 ? 62  ARG B CD  1 
ATOM   2152 N  NE  . ARG B 1 63  ? 20.526  17.759  40.466  1.00  35.99 ? 62  ARG B NE  1 
ATOM   2153 C  CZ  . ARG B 1 63  ? 21.126  18.333  41.506  1.00  35.81 ? 62  ARG B CZ  1 
ATOM   2154 N  NH1 . ARG B 1 63  ? 21.709  17.589  42.444  1.00  35.18 ? 62  ARG B NH1 1 
ATOM   2155 N  NH2 . ARG B 1 63  ? 21.148  19.657  41.606  1.00  35.99 ? 62  ARG B NH2 1 
ATOM   2156 N  N   . VAL B 1 64  ? 16.805  12.812  37.457  1.00  34.13 ? 63  VAL B N   1 
ATOM   2157 C  CA  . VAL B 1 64  ? 15.955  11.621  37.606  1.00  34.63 ? 63  VAL B CA  1 
ATOM   2158 C  C   . VAL B 1 64  ? 16.197  10.637  36.452  1.00  34.90 ? 63  VAL B C   1 
ATOM   2159 O  O   . VAL B 1 64  ? 16.760  11.030  35.424  1.00  35.01 ? 63  VAL B O   1 
ATOM   2160 C  CB  . VAL B 1 64  ? 14.429  11.968  37.730  1.00  34.47 ? 63  VAL B CB  1 
ATOM   2161 C  CG1 . VAL B 1 64  ? 14.176  12.938  38.878  1.00  34.75 ? 63  VAL B CG1 1 
ATOM   2162 C  CG2 . VAL B 1 64  ? 13.863  12.499  36.420  1.00  34.04 ? 63  VAL B CG2 1 
ATOM   2163 N  N   . PRO B 1 65  ? 15.799  9.352   36.619  1.00  35.23 ? 64  PRO B N   1 
ATOM   2164 C  CA  . PRO B 1 65  ? 15.948  8.406   35.509  1.00  35.34 ? 64  PRO B CA  1 
ATOM   2165 C  C   . PRO B 1 65  ? 15.251  8.901   34.243  1.00  35.70 ? 64  PRO B C   1 
ATOM   2166 O  O   . PRO B 1 65  ? 14.127  9.418   34.315  1.00  35.58 ? 64  PRO B O   1 
ATOM   2167 C  CB  . PRO B 1 65  ? 15.272  7.136   36.037  1.00  35.22 ? 64  PRO B CB  1 
ATOM   2168 C  CG  . PRO B 1 65  ? 15.419  7.235   37.522  1.00  35.29 ? 64  PRO B CG  1 
ATOM   2169 C  CD  . PRO B 1 65  ? 15.226  8.700   37.815  1.00  35.39 ? 64  PRO B CD  1 
ATOM   2170 N  N   . ALA B 1 66  ? 15.930  8.753   33.104  1.00  35.98 ? 65  ALA B N   1 
ATOM   2171 C  CA  . ALA B 1 66  ? 15.444  9.246   31.809  1.00  36.51 ? 65  ALA B CA  1 
ATOM   2172 C  C   . ALA B 1 66  ? 13.993  8.851   31.507  1.00  36.83 ? 65  ALA B C   1 
ATOM   2173 O  O   . ALA B 1 66  ? 13.225  9.648   30.961  1.00  36.75 ? 65  ALA B O   1 
ATOM   2174 C  CB  . ALA B 1 66  ? 16.366  8.784   30.686  1.00  36.55 ? 65  ALA B CB  1 
ATOM   2175 N  N   . ASP B 1 67  ? 13.626  7.627   31.880  1.00  37.06 ? 66  ASP B N   1 
ATOM   2176 C  CA  . ASP B 1 67  ? 12.291  7.102   31.614  1.00  37.35 ? 66  ASP B CA  1 
ATOM   2177 C  C   . ASP B 1 67  ? 11.226  7.646   32.571  1.00  36.89 ? 66  ASP B C   1 
ATOM   2178 O  O   . ASP B 1 67  ? 10.031  7.468   32.324  1.00  36.99 ? 66  ASP B O   1 
ATOM   2179 C  CB  . ASP B 1 67  ? 12.304  5.569   31.643  1.00  37.79 ? 66  ASP B CB  1 
ATOM   2180 C  CG  . ASP B 1 67  ? 12.625  5.007   33.025  1.00  40.49 ? 66  ASP B CG  1 
ATOM   2181 O  OD1 . ASP B 1 67  ? 13.685  5.365   33.597  1.00  42.15 ? 66  ASP B OD1 1 
ATOM   2182 O  OD2 . ASP B 1 67  ? 11.818  4.190   33.533  1.00  43.61 ? 66  ASP B OD2 1 
ATOM   2183 N  N   . LYS B 1 68  ? 11.655  8.298   33.653  1.00  35.88 ? 67  LYS B N   1 
ATOM   2184 C  CA  . LYS B 1 68  ? 10.725  8.895   34.616  1.00  35.59 ? 67  LYS B CA  1 
ATOM   2185 C  C   . LYS B 1 68  ? 10.562  10.406  34.424  1.00  34.98 ? 67  LYS B C   1 
ATOM   2186 O  O   . LYS B 1 68  ? 9.635   11.006  34.978  1.00  34.80 ? 67  LYS B O   1 
ATOM   2187 C  CB  . LYS B 1 68  ? 11.149  8.603   36.069  1.00  35.50 ? 67  LYS B CB  1 
ATOM   2188 C  CG  . LYS B 1 68  ? 11.222  7.119   36.454  1.00  36.79 ? 67  LYS B CG  1 
ATOM   2189 C  CD  . LYS B 1 68  ? 9.845   6.458   36.475  1.00  37.82 ? 67  LYS B CD  1 
ATOM   2190 C  CE  . LYS B 1 68  ? 9.914   5.054   37.075  1.00  38.64 ? 67  LYS B CE  1 
ATOM   2191 N  NZ  . LYS B 1 68  ? 10.302  5.073   38.518  1.00  38.93 ? 67  LYS B NZ  1 
ATOM   2192 N  N   . LYS B 1 69  ? 11.452  11.006  33.632  1.00  34.51 ? 68  LYS B N   1 
ATOM   2193 C  CA  . LYS B 1 69  ? 11.499  12.465  33.457  1.00  33.93 ? 68  LYS B CA  1 
ATOM   2194 C  C   . LYS B 1 69  ? 10.164  13.066  33.015  1.00  33.73 ? 68  LYS B C   1 
ATOM   2195 O  O   . LYS B 1 69  ? 9.672   14.017  33.631  1.00  33.51 ? 68  LYS B O   1 
ATOM   2196 C  CB  . LYS B 1 69  ? 12.611  12.859  32.473  1.00  34.23 ? 68  LYS B CB  1 
ATOM   2197 C  CG  . LYS B 1 69  ? 12.960  14.340  32.500  1.00  34.88 ? 68  LYS B CG  1 
ATOM   2198 C  CD  . LYS B 1 69  ? 13.914  14.714  31.380  1.00  35.73 ? 68  LYS B CD  1 
ATOM   2199 C  CE  . LYS B 1 69  ? 14.542  16.077  31.638  1.00  36.14 ? 68  LYS B CE  1 
ATOM   2200 N  NZ  . LYS B 1 69  ? 15.436  16.500  30.526  1.00  36.78 ? 68  LYS B NZ  1 
ATOM   2201 N  N   . GLY B 1 70  ? 9.590   12.503  31.954  1.00  33.12 ? 69  GLY B N   1 
ATOM   2202 C  CA  . GLY B 1 70  ? 8.303   12.956  31.421  1.00  32.84 ? 69  GLY B CA  1 
ATOM   2203 C  C   . GLY B 1 70  ? 7.190   12.905  32.452  1.00  32.46 ? 69  GLY B C   1 
ATOM   2204 O  O   . GLY B 1 70  ? 6.485   13.892  32.660  1.00  32.25 ? 69  GLY B O   1 
ATOM   2205 N  N   . ALA B 1 71  ? 7.050   11.757  33.116  1.00  32.09 ? 70  ALA B N   1 
ATOM   2206 C  CA  . ALA B 1 71  ? 5.979   11.566  34.090  1.00  31.40 ? 70  ALA B CA  1 
ATOM   2207 C  C   . ALA B 1 71  ? 6.123   12.530  35.272  1.00  30.94 ? 70  ALA B C   1 
ATOM   2208 O  O   . ALA B 1 71  ? 5.134   13.102  35.743  1.00  30.21 ? 70  ALA B O   1 
ATOM   2209 C  CB  . ALA B 1 71  ? 5.943   10.107  34.570  1.00  31.62 ? 70  ALA B CB  1 
ATOM   2210 N  N   . LEU B 1 72  ? 7.359   12.729  35.725  1.00  30.04 ? 71  LEU B N   1 
ATOM   2211 C  CA  . LEU B 1 72  ? 7.628   13.612  36.861  1.00  29.94 ? 71  LEU B CA  1 
ATOM   2212 C  C   . LEU B 1 72  ? 7.466   15.086  36.508  1.00  30.19 ? 71  LEU B C   1 
ATOM   2213 O  O   . LEU B 1 72  ? 6.900   15.856  37.291  1.00  30.41 ? 71  LEU B O   1 
ATOM   2214 C  CB  . LEU B 1 72  ? 8.998   13.319  37.471  1.00  29.67 ? 71  LEU B CB  1 
ATOM   2215 C  CG  . LEU B 1 72  ? 9.062   12.011  38.274  1.00  30.12 ? 71  LEU B CG  1 
ATOM   2216 C  CD1 . LEU B 1 72  ? 10.501  11.654  38.661  1.00  30.89 ? 71  LEU B CD1 1 
ATOM   2217 C  CD2 . LEU B 1 72  ? 8.154   12.057  39.508  1.00  31.78 ? 71  LEU B CD2 1 
ATOM   2218 N  N   . ARG B 1 73  ? 7.936   15.473  35.328  1.00  29.65 ? 72  ARG B N   1 
ATOM   2219 C  CA  . ARG B 1 73  ? 7.701   16.818  34.816  1.00  30.21 ? 72  ARG B CA  1 
ATOM   2220 C  C   . ARG B 1 73  ? 6.203   17.163  34.814  1.00  30.40 ? 72  ARG B C   1 
ATOM   2221 O  O   . ARG B 1 73  ? 5.798   18.203  35.340  1.00  30.18 ? 72  ARG B O   1 
ATOM   2222 C  CB  . ARG B 1 73  ? 8.300   16.938  33.415  1.00  30.83 ? 72  ARG B CB  1 
ATOM   2223 C  CG  . ARG B 1 73  ? 8.106   18.273  32.730  1.00  32.06 ? 72  ARG B CG  1 
ATOM   2224 C  CD  . ARG B 1 73  ? 8.546   18.143  31.282  1.00  35.17 ? 72  ARG B CD  1 
ATOM   2225 N  NE  . ARG B 1 73  ? 8.167   19.298  30.475  1.00  36.37 ? 72  ARG B NE  1 
ATOM   2226 C  CZ  . ARG B 1 73  ? 8.638   19.536  29.258  1.00  37.34 ? 72  ARG B CZ  1 
ATOM   2227 N  NH1 . ARG B 1 73  ? 9.515   18.703  28.709  1.00  37.16 ? 72  ARG B NH1 1 
ATOM   2228 N  NH2 . ARG B 1 73  ? 8.240   20.609  28.591  1.00  38.70 ? 72  ARG B NH2 1 
ATOM   2229 N  N   . ASN B 1 74  ? 5.384   16.281  34.241  1.00  30.10 ? 73  ASN B N   1 
ATOM   2230 C  CA  . ASN B 1 74  ? 3.941   16.528  34.162  1.00  29.76 ? 73  ASN B CA  1 
ATOM   2231 C  C   . ASN B 1 74  ? 3.255   16.484  35.519  1.00  30.03 ? 73  ASN B C   1 
ATOM   2232 O  O   . ASN B 1 74  ? 2.483   17.375  35.857  1.00  29.81 ? 73  ASN B O   1 
ATOM   2233 C  CB  . ASN B 1 74  ? 3.273   15.555  33.173  1.00  29.64 ? 73  ASN B CB  1 
ATOM   2234 C  CG  . ASN B 1 74  ? 3.731   15.785  31.728  1.00  30.75 ? 73  ASN B CG  1 
ATOM   2235 O  OD1 . ASN B 1 74  ? 4.307   16.829  31.409  1.00  29.38 ? 73  ASN B OD1 1 
ATOM   2236 N  ND2 . ASN B 1 74  ? 3.500   14.796  30.861  1.00  30.48 ? 73  ASN B ND2 1 
ATOM   2237 N  N   . ASN B 1 75  ? 3.562   15.459  36.306  1.00  29.93 ? 74  ASN B N   1 
ATOM   2238 C  CA  . ASN B 1 75  ? 2.817   15.203  37.530  1.00  30.47 ? 74  ASN B CA  1 
ATOM   2239 C  C   . ASN B 1 75  ? 3.373   15.852  38.780  1.00  30.39 ? 74  ASN B C   1 
ATOM   2240 O  O   . ASN B 1 75  ? 2.603   16.383  39.585  1.00  30.52 ? 74  ASN B O   1 
ATOM   2241 C  CB  . ASN B 1 75  ? 2.602   13.701  37.721  1.00  30.15 ? 74  ASN B CB  1 
ATOM   2242 C  CG  . ASN B 1 75  ? 1.759   13.112  36.611  1.00  30.63 ? 74  ASN B CG  1 
ATOM   2243 O  OD1 . ASN B 1 75  ? 0.550   13.362  36.536  1.00  30.15 ? 74  ASN B OD1 1 
ATOM   2244 N  ND2 . ASN B 1 75  ? 2.390   12.351  35.729  1.00  31.48 ? 74  ASN B ND2 1 
ATOM   2245 N  N   . ALA B 1 76  ? 4.695   15.842  38.938  1.00  29.83 ? 75  ALA B N   1 
ATOM   2246 C  CA  . ALA B 1 76  ? 5.304   16.611  40.028  1.00  29.48 ? 75  ALA B CA  1 
ATOM   2247 C  C   . ALA B 1 76  ? 5.099   18.100  39.741  1.00  28.94 ? 75  ALA B C   1 
ATOM   2248 O  O   . ALA B 1 76  ? 4.867   18.887  40.649  1.00  28.79 ? 75  ALA B O   1 
ATOM   2249 C  CB  . ALA B 1 76  ? 6.777   16.272  40.197  1.00  29.39 ? 75  ALA B CB  1 
ATOM   2250 N  N   . GLY B 1 77  ? 5.153   18.473  38.465  1.00  28.37 ? 76  GLY B N   1 
ATOM   2251 C  CA  . GLY B 1 77  ? 4.827   19.842  38.064  1.00  28.06 ? 76  GLY B CA  1 
ATOM   2252 C  C   . GLY B 1 77  ? 3.397   20.187  38.441  1.00  28.24 ? 76  GLY B C   1 
ATOM   2253 O  O   . GLY B 1 77  ? 3.159   21.224  39.056  1.00  28.69 ? 76  GLY B O   1 
ATOM   2254 N  N   . GLY B 1 78  ? 2.453   19.315  38.072  1.00  27.92 ? 77  GLY B N   1 
ATOM   2255 C  CA  . GLY B 1 78  ? 1.033   19.472  38.432  1.00  28.31 ? 77  GLY B CA  1 
ATOM   2256 C  C   . GLY B 1 78  ? 0.849   19.646  39.929  1.00  28.41 ? 77  GLY B C   1 
ATOM   2257 O  O   . GLY B 1 78  ? 0.094   20.513  40.376  1.00  28.50 ? 77  GLY B O   1 
ATOM   2258 N  N   . HIS B 1 79  ? 1.551   18.826  40.707  1.00  28.20 ? 78  HIS B N   1 
ATOM   2259 C  CA  . HIS B 1 79  ? 1.424   18.884  42.164  1.00  28.41 ? 78  HIS B CA  1 
ATOM   2260 C  C   . HIS B 1 79  ? 2.000   20.184  42.722  1.00  28.09 ? 78  HIS B C   1 
ATOM   2261 O  O   . HIS B 1 79  ? 1.370   20.845  43.522  1.00  28.32 ? 78  HIS B O   1 
ATOM   2262 C  CB  . HIS B 1 79  ? 2.065   17.647  42.810  1.00  28.53 ? 78  HIS B CB  1 
ATOM   2263 C  CG  . HIS B 1 79  ? 2.032   17.649  44.309  1.00  29.29 ? 78  HIS B CG  1 
ATOM   2264 N  ND1 . HIS B 1 79  ? 0.906   17.977  45.038  1.00  30.30 ? 78  HIS B ND1 1 
ATOM   2265 C  CD2 . HIS B 1 79  ? 2.982   17.315  45.216  1.00  30.69 ? 78  HIS B CD2 1 
ATOM   2266 C  CE1 . HIS B 1 79  ? 1.171   17.862  46.327  1.00  31.58 ? 78  HIS B CE1 1 
ATOM   2267 N  NE2 . HIS B 1 79  ? 2.425   17.465  46.462  1.00  31.03 ? 78  HIS B NE2 1 
ATOM   2268 N  N   . ALA B 1 80  ? 3.204   20.549  42.292  1.00  27.89 ? 79  ALA B N   1 
ATOM   2269 C  CA  . ALA B 1 80  ? 3.810   21.810  42.711  1.00  27.63 ? 79  ALA B CA  1 
ATOM   2270 C  C   . ALA B 1 80  ? 2.929   23.006  42.343  1.00  27.68 ? 79  ALA B C   1 
ATOM   2271 O  O   . ALA B 1 80  ? 2.700   23.899  43.173  1.00  27.29 ? 79  ALA B O   1 
ATOM   2272 C  CB  . ALA B 1 80  ? 5.169   21.963  42.084  1.00  27.66 ? 79  ALA B CB  1 
ATOM   2273 N  N   . ASN B 1 81  ? 2.449   23.028  41.099  1.00  27.13 ? 80  ASN B N   1 
ATOM   2274 C  CA  . ASN B 1 81  ? 1.670   24.167  40.605  1.00  27.14 ? 80  ASN B CA  1 
ATOM   2275 C  C   . ASN B 1 81  ? 0.377   24.365  41.378  1.00  27.05 ? 80  ASN B C   1 
ATOM   2276 O  O   . ASN B 1 81  ? 0.087   25.473  41.831  1.00  26.92 ? 80  ASN B O   1 
ATOM   2277 C  CB  . ASN B 1 81  ? 1.356   24.026  39.116  1.00  26.93 ? 80  ASN B CB  1 
ATOM   2278 C  CG  . ASN B 1 81  ? 2.588   24.059  38.249  1.00  28.54 ? 80  ASN B CG  1 
ATOM   2279 O  OD1 . ASN B 1 81  ? 3.665   24.422  38.704  1.00  27.96 ? 80  ASN B OD1 1 
ATOM   2280 N  ND2 . ASN B 1 81  ? 2.433   23.667  36.986  1.00  28.79 ? 80  ASN B ND2 1 
ATOM   2281 N  N   . HIS B 1 82  ? -0.378  23.288  41.555  1.00  27.30 ? 81  HIS B N   1 
ATOM   2282 C  CA  . HIS B 1 82  ? -1.644  23.368  42.258  1.00  27.93 ? 81  HIS B CA  1 
ATOM   2283 C  C   . HIS B 1 82  ? -1.474  23.651  43.736  1.00  28.20 ? 81  HIS B C   1 
ATOM   2284 O  O   . HIS B 1 82  ? -2.239  24.419  44.304  1.00  28.77 ? 81  HIS B O   1 
ATOM   2285 C  CB  . HIS B 1 82  ? -2.481  22.116  42.021  1.00  28.14 ? 81  HIS B CB  1 
ATOM   2286 C  CG  . HIS B 1 82  ? -3.032  22.053  40.636  1.00  29.84 ? 81  HIS B CG  1 
ATOM   2287 N  ND1 . HIS B 1 82  ? -2.302  21.569  39.572  1.00  32.10 ? 81  HIS B ND1 1 
ATOM   2288 C  CD2 . HIS B 1 82  ? -4.209  22.487  40.123  1.00  31.02 ? 81  HIS B CD2 1 
ATOM   2289 C  CE1 . HIS B 1 82  ? -3.021  21.668  38.466  1.00  32.17 ? 81  HIS B CE1 1 
ATOM   2290 N  NE2 . HIS B 1 82  ? -4.175  22.234  38.771  1.00  33.20 ? 81  HIS B NE2 1 
ATOM   2291 N  N   . SER B 1 83  ? -0.471  23.040  44.350  1.00  28.70 ? 82  SER B N   1 
ATOM   2292 C  CA  . SER B 1 83  ? -0.173  23.316  45.757  1.00  29.32 ? 82  SER B CA  1 
ATOM   2293 C  C   . SER B 1 83  ? 0.034   24.819  46.018  1.00  29.91 ? 82  SER B C   1 
ATOM   2294 O  O   . SER B 1 83  ? -0.490  25.373  46.992  1.00  29.89 ? 82  SER B O   1 
ATOM   2295 C  CB  . SER B 1 83  ? 1.039   22.500  46.208  1.00  29.11 ? 82  SER B CB  1 
ATOM   2296 O  OG  . SER B 1 83  ? 0.733   21.106  46.183  1.00  29.72 ? 82  SER B OG  1 
ATOM   2297 N  N   . MET B 1 84  ? 0.797   25.475  45.145  1.00  30.47 ? 83  MET B N   1 
ATOM   2298 C  CA  . MET B 1 84  ? 0.991   26.917  45.229  1.00  31.98 ? 83  MET B CA  1 
ATOM   2299 C  C   . MET B 1 84  ? -0.303  27.694  44.947  1.00  30.50 ? 83  MET B C   1 
ATOM   2300 O  O   . MET B 1 84  ? -0.645  28.645  45.661  1.00  30.62 ? 83  MET B O   1 
ATOM   2301 C  CB  . MET B 1 84  ? 2.071   27.351  44.248  1.00  31.82 ? 83  MET B CB  1 
ATOM   2302 C  CG  . MET B 1 84  ? 2.366   28.823  44.328  1.00  33.90 ? 83  MET B CG  1 
ATOM   2303 S  SD  . MET B 1 84  ? 3.464   29.306  43.015  1.00  37.79 ? 83  MET B SD  1 
ATOM   2304 C  CE  . MET B 1 84  ? 2.932   30.983  42.765  1.00  36.29 ? 83  MET B CE  1 
ATOM   2305 N  N   . PHE B 1 85  ? -1.012  27.267  43.907  1.00  29.76 ? 84  PHE B N   1 
ATOM   2306 C  CA  . PHE B 1 85  ? -2.238  27.915  43.446  1.00  29.34 ? 84  PHE B CA  1 
ATOM   2307 C  C   . PHE B 1 85  ? -3.264  28.099  44.582  1.00  28.88 ? 84  PHE B C   1 
ATOM   2308 O  O   . PHE B 1 85  ? -3.777  29.201  44.778  1.00  27.97 ? 84  PHE B O   1 
ATOM   2309 C  CB  . PHE B 1 85  ? -2.812  27.108  42.266  1.00  29.41 ? 84  PHE B CB  1 
ATOM   2310 C  CG  . PHE B 1 85  ? -3.977  27.766  41.557  1.00  30.43 ? 84  PHE B CG  1 
ATOM   2311 C  CD1 . PHE B 1 85  ? -3.889  29.077  41.086  1.00  29.02 ? 84  PHE B CD1 1 
ATOM   2312 C  CD2 . PHE B 1 85  ? -5.156  27.045  41.329  1.00  29.50 ? 84  PHE B CD2 1 
ATOM   2313 C  CE1 . PHE B 1 85  ? -4.983  29.676  40.423  1.00  29.53 ? 84  PHE B CE1 1 
ATOM   2314 C  CE2 . PHE B 1 85  ? -6.247  27.629  40.669  1.00  30.00 ? 84  PHE B CE2 1 
ATOM   2315 C  CZ  . PHE B 1 85  ? -6.154  28.950  40.215  1.00  29.93 ? 84  PHE B CZ  1 
ATOM   2316 N  N   . TRP B 1 86  ? -3.527  27.041  45.357  1.00  28.65 ? 85  TRP B N   1 
ATOM   2317 C  CA  . TRP B 1 86  ? -4.521  27.133  46.430  1.00  28.59 ? 85  TRP B CA  1 
ATOM   2318 C  C   . TRP B 1 86  ? -4.106  28.158  47.479  1.00  29.16 ? 85  TRP B C   1 
ATOM   2319 O  O   . TRP B 1 86  ? -4.945  28.876  48.024  1.00  28.85 ? 85  TRP B O   1 
ATOM   2320 C  CB  . TRP B 1 86  ? -4.761  25.781  47.119  1.00  29.08 ? 85  TRP B CB  1 
ATOM   2321 C  CG  . TRP B 1 86  ? -4.999  24.614  46.209  1.00  28.86 ? 85  TRP B CG  1 
ATOM   2322 C  CD1 . TRP B 1 86  ? -4.407  23.393  46.298  1.00  30.27 ? 85  TRP B CD1 1 
ATOM   2323 C  CD2 . TRP B 1 86  ? -5.896  24.546  45.089  1.00  30.39 ? 85  TRP B CD2 1 
ATOM   2324 N  NE1 . TRP B 1 86  ? -4.873  22.566  45.305  1.00  30.57 ? 85  TRP B NE1 1 
ATOM   2325 C  CE2 . TRP B 1 86  ? -5.785  23.249  44.546  1.00  29.90 ? 85  TRP B CE2 1 
ATOM   2326 C  CE3 . TRP B 1 86  ? -6.783  25.456  44.489  1.00  32.31 ? 85  TRP B CE3 1 
ATOM   2327 C  CZ2 . TRP B 1 86  ? -6.514  22.834  43.419  1.00  30.84 ? 85  TRP B CZ2 1 
ATOM   2328 C  CZ3 . TRP B 1 86  ? -7.519  25.038  43.367  1.00  30.83 ? 85  TRP B CZ3 1 
ATOM   2329 C  CH2 . TRP B 1 86  ? -7.379  23.742  42.851  1.00  30.02 ? 85  TRP B CH2 1 
ATOM   2330 N  N   . GLN B 1 87  ? -2.804  28.216  47.740  1.00  29.78 ? 86  GLN B N   1 
ATOM   2331 C  CA  . GLN B 1 87  ? -2.240  29.057  48.785  1.00  31.28 ? 86  GLN B CA  1 
ATOM   2332 C  C   . GLN B 1 87  ? -2.149  30.534  48.399  1.00  30.65 ? 86  GLN B C   1 
ATOM   2333 O  O   . GLN B 1 87  ? -2.193  31.407  49.275  1.00  30.40 ? 86  GLN B O   1 
ATOM   2334 C  CB  . GLN B 1 87  ? -0.871  28.520  49.204  1.00  31.36 ? 86  GLN B CB  1 
ATOM   2335 C  CG  . GLN B 1 87  ? -0.938  27.247  50.046  1.00  33.44 ? 86  GLN B CG  1 
ATOM   2336 C  CD  . GLN B 1 87  ? 0.443   26.704  50.396  1.00  34.73 ? 86  GLN B CD  1 
ATOM   2337 O  OE1 . GLN B 1 87  ? 1.434   27.015  49.732  1.00  40.79 ? 86  GLN B OE1 1 
ATOM   2338 N  NE2 . GLN B 1 87  ? 0.509   25.876  51.435  1.00  39.82 ? 86  GLN B NE2 1 
ATOM   2339 N  N   . ILE B 1 88  ? -2.041  30.826  47.104  1.00  30.25 ? 87  ILE B N   1 
ATOM   2340 C  CA  . ILE B 1 88  ? -1.992  32.229  46.671  1.00  30.64 ? 87  ILE B CA  1 
ATOM   2341 C  C   . ILE B 1 88  ? -3.382  32.837  46.395  1.00  30.63 ? 87  ILE B C   1 
ATOM   2342 O  O   . ILE B 1 88  ? -3.495  33.997  45.997  1.00  30.16 ? 87  ILE B O   1 
ATOM   2343 C  CB  . ILE B 1 88  ? -0.957  32.511  45.521  1.00  30.54 ? 87  ILE B CB  1 
ATOM   2344 C  CG1 . ILE B 1 88  ? -1.227  31.676  44.259  1.00  30.79 ? 87  ILE B CG1 1 
ATOM   2345 C  CG2 . ILE B 1 88  ? 0.487   32.287  46.029  1.00  30.78 ? 87  ILE B CG2 1 
ATOM   2346 C  CD1 . ILE B 1 88  ? -2.473  32.073  43.468  1.00  29.39 ? 87  ILE B CD1 1 
ATOM   2347 N  N   . MET B 1 89  ? -4.428  32.046  46.622  1.00  30.65 ? 88  MET B N   1 
ATOM   2348 C  CA  . MET B 1 89  ? -5.788  32.578  46.668  1.00  31.57 ? 88  MET B CA  1 
ATOM   2349 C  C   . MET B 1 89  ? -6.344  32.568  48.093  1.00  32.04 ? 88  MET B C   1 
ATOM   2350 O  O   . MET B 1 89  ? -5.856  31.836  48.959  1.00  32.34 ? 88  MET B O   1 
ATOM   2351 C  CB  . MET B 1 89  ? -6.729  31.810  45.739  1.00  31.07 ? 88  MET B CB  1 
ATOM   2352 C  CG  . MET B 1 89  ? -6.264  31.724  44.290  1.00  31.69 ? 88  MET B CG  1 
ATOM   2353 S  SD  . MET B 1 89  ? -7.470  30.903  43.233  1.00  32.11 ? 88  MET B SD  1 
ATOM   2354 C  CE  . MET B 1 89  ? -7.353  29.187  43.776  1.00  30.71 ? 88  MET B CE  1 
ATOM   2355 N  N   . GLY B 1 90  ? -7.365  33.391  48.319  1.00  32.52 ? 89  GLY B N   1 
ATOM   2356 C  CA  . GLY B 1 90  ? -8.072  33.448  49.601  1.00  33.67 ? 89  GLY B CA  1 
ATOM   2357 C  C   . GLY B 1 90  ? -9.413  34.134  49.435  1.00  34.40 ? 89  GLY B C   1 
ATOM   2358 O  O   . GLY B 1 90  ? -9.693  34.713  48.383  1.00  34.28 ? 89  GLY B O   1 
ATOM   2359 N  N   . GLN B 1 91  ? -10.245 34.077  50.473  1.00  35.23 ? 90  GLN B N   1 
ATOM   2360 C  CA  . GLN B 1 91  ? -11.584 34.678  50.418  1.00  36.22 ? 90  GLN B CA  1 
ATOM   2361 C  C   . GLN B 1 91  ? -11.617 36.089  50.995  1.00  35.98 ? 90  GLN B C   1 
ATOM   2362 O  O   . GLN B 1 91  ? -11.021 36.355  52.038  1.00  36.29 ? 90  GLN B O   1 
ATOM   2363 C  CB  . GLN B 1 91  ? -12.610 33.787  51.120  1.00  35.96 ? 90  GLN B CB  1 
ATOM   2364 C  CG  . GLN B 1 91  ? -12.182 33.291  52.494  1.00  37.56 ? 90  GLN B CG  1 
ATOM   2365 C  CD  . GLN B 1 91  ? -13.256 32.481  53.194  1.00  37.69 ? 90  GLN B CD  1 
ATOM   2366 O  OE1 . GLN B 1 91  ? -14.436 32.851  53.195  1.00  40.14 ? 90  GLN B OE1 1 
ATOM   2367 N  NE2 . GLN B 1 91  ? -12.851 31.368  53.805  1.00  39.06 ? 90  GLN B NE2 1 
ATOM   2368 N  N   . ASN B 1 99  ? -8.417  44.952  46.521  1.00  36.25 ? 98  ASN B N   1 
ATOM   2369 C  CA  . ASN B 1 99  ? -7.449  43.886  46.752  1.00  36.16 ? 98  ASN B CA  1 
ATOM   2370 C  C   . ASN B 1 99  ? -6.130  44.149  46.026  1.00  36.14 ? 98  ASN B C   1 
ATOM   2371 O  O   . ASN B 1 99  ? -6.023  43.936  44.817  1.00  36.16 ? 98  ASN B O   1 
ATOM   2372 C  CB  . ASN B 1 99  ? -8.030  42.524  46.346  1.00  35.97 ? 98  ASN B CB  1 
ATOM   2373 C  CG  . ASN B 1 99  ? -7.148  41.357  46.782  1.00  35.97 ? 98  ASN B CG  1 
ATOM   2374 O  OD1 . ASN B 1 99  ? -6.505  41.410  47.833  1.00  35.18 ? 98  ASN B OD1 1 
ATOM   2375 N  ND2 . ASN B 1 99  ? -7.116  40.302  45.976  1.00  35.72 ? 98  ASN B ND2 1 
ATOM   2376 N  N   . GLN B 1 100 ? -5.134  44.609  46.780  1.00  36.34 ? 99  GLN B N   1 
ATOM   2377 C  CA  . GLN B 1 100 ? -3.848  45.034  46.224  1.00  36.61 ? 99  GLN B CA  1 
ATOM   2378 C  C   . GLN B 1 100 ? -2.678  44.651  47.124  1.00  36.19 ? 99  GLN B C   1 
ATOM   2379 O  O   . GLN B 1 100 ? -2.864  44.453  48.329  1.00  36.50 ? 99  GLN B O   1 
ATOM   2380 C  CB  . GLN B 1 100 ? -3.837  46.553  46.039  1.00  36.77 ? 99  GLN B CB  1 
ATOM   2381 C  CG  . GLN B 1 100 ? -4.628  47.065  44.847  1.00  37.88 ? 99  GLN B CG  1 
ATOM   2382 C  CD  . GLN B 1 100 ? -4.411  48.550  44.600  1.00  37.52 ? 99  GLN B CD  1 
ATOM   2383 O  OE1 . GLN B 1 100 ? -4.897  49.099  43.610  1.00  40.00 ? 99  GLN B OE1 1 
ATOM   2384 N  NE2 . GLN B 1 100 ? -3.674  49.204  45.492  1.00  38.91 ? 99  GLN B NE2 1 
ATOM   2385 N  N   . PRO B 1 101 ? -1.460  44.559  46.551  1.00  35.89 ? 100 PRO B N   1 
ATOM   2386 C  CA  . PRO B 1 101 ? -0.275  44.369  47.385  1.00  35.84 ? 100 PRO B CA  1 
ATOM   2387 C  C   . PRO B 1 101 ? 0.182   45.682  48.023  1.00  35.92 ? 100 PRO B C   1 
ATOM   2388 O  O   . PRO B 1 101 ? -0.206  46.767  47.573  1.00  35.77 ? 100 PRO B O   1 
ATOM   2389 C  CB  . PRO B 1 101 ? 0.776   43.882  46.387  1.00  35.93 ? 100 PRO B CB  1 
ATOM   2390 C  CG  . PRO B 1 101 ? 0.384   44.517  45.101  1.00  35.76 ? 100 PRO B CG  1 
ATOM   2391 C  CD  . PRO B 1 101 ? -1.118  44.614  45.117  1.00  35.80 ? 100 PRO B CD  1 
ATOM   2392 N  N   . SER B 1 102 ? 0.998   45.570  49.066  1.00  35.91 ? 101 SER B N   1 
ATOM   2393 C  CA  . SER B 1 102 ? 1.582   46.731  49.726  1.00  35.98 ? 101 SER B CA  1 
ATOM   2394 C  C   . SER B 1 102 ? 3.016   46.417  50.156  1.00  35.72 ? 101 SER B C   1 
ATOM   2395 O  O   . SER B 1 102 ? 3.516   45.319  49.901  1.00  35.66 ? 101 SER B O   1 
ATOM   2396 C  CB  . SER B 1 102 ? 0.722   47.161  50.919  1.00  36.15 ? 101 SER B CB  1 
ATOM   2397 O  OG  . SER B 1 102 ? 0.522   46.082  51.819  1.00  37.17 ? 101 SER B OG  1 
ATOM   2398 N  N   . GLY B 1 103 ? 3.680   47.388  50.785  1.00  35.34 ? 102 GLY B N   1 
ATOM   2399 C  CA  . GLY B 1 103 ? 5.034   47.189  51.307  1.00  35.05 ? 102 GLY B CA  1 
ATOM   2400 C  C   . GLY B 1 103 ? 6.095   47.017  50.235  1.00  34.87 ? 102 GLY B C   1 
ATOM   2401 O  O   . GLY B 1 103 ? 6.070   47.717  49.200  1.00  34.86 ? 102 GLY B O   1 
ATOM   2402 N  N   . GLU B 1 104 ? 7.019   46.073  50.490  1.00  34.72 ? 103 GLU B N   1 
ATOM   2403 C  CA  . GLU B 1 104 ? 8.158   45.810  49.603  1.00  34.82 ? 103 GLU B CA  1 
ATOM   2404 C  C   . GLU B 1 104 ? 7.741   45.260  48.240  1.00  34.27 ? 103 GLU B C   1 
ATOM   2405 O  O   . GLU B 1 104 ? 8.353   45.586  47.219  1.00  34.29 ? 103 GLU B O   1 
ATOM   2406 C  CB  . GLU B 1 104 ? 9.153   44.840  50.263  1.00  35.16 ? 103 GLU B CB  1 
ATOM   2407 C  CG  . GLU B 1 104 ? 9.684   45.287  51.637  1.00  37.31 ? 103 GLU B CG  1 
ATOM   2408 C  CD  . GLU B 1 104 ? 10.699  46.437  51.582  1.00  40.16 ? 103 GLU B CD  1 
ATOM   2409 O  OE1 . GLU B 1 104 ? 10.661  47.268  50.642  1.00  41.60 ? 103 GLU B OE1 1 
ATOM   2410 O  OE2 . GLU B 1 104 ? 11.533  46.521  52.513  1.00  41.41 ? 103 GLU B OE2 1 
ATOM   2411 N  N   . LEU B 1 105 ? 6.708   44.423  48.227  1.00  33.69 ? 104 LEU B N   1 
ATOM   2412 C  CA  . LEU B 1 105 ? 6.243   43.809  46.979  1.00  33.09 ? 104 LEU B CA  1 
ATOM   2413 C  C   . LEU B 1 105 ? 5.665   44.846  46.011  1.00  32.99 ? 104 LEU B C   1 
ATOM   2414 O  O   . LEU B 1 105 ? 6.000   44.848  44.824  1.00  32.62 ? 104 LEU B O   1 
ATOM   2415 C  CB  . LEU B 1 105 ? 5.230   42.694  47.252  1.00  33.08 ? 104 LEU B CB  1 
ATOM   2416 C  CG  . LEU B 1 105 ? 4.647   41.969  46.027  1.00  32.57 ? 104 LEU B CG  1 
ATOM   2417 C  CD1 . LEU B 1 105 ? 5.746   41.422  45.121  1.00  32.87 ? 104 LEU B CD1 1 
ATOM   2418 C  CD2 . LEU B 1 105 ? 3.714   40.864  46.465  1.00  32.96 ? 104 LEU B CD2 1 
ATOM   2419 N  N   . LEU B 1 106 ? 4.806   45.722  46.526  1.00  33.07 ? 105 LEU B N   1 
ATOM   2420 C  CA  . LEU B 1 106 ? 4.227   46.795  45.722  1.00  33.34 ? 105 LEU B CA  1 
ATOM   2421 C  C   . LEU B 1 106 ? 5.333   47.674  45.127  1.00  33.48 ? 105 LEU B C   1 
ATOM   2422 O  O   . LEU B 1 106 ? 5.260   48.060  43.956  1.00  33.42 ? 105 LEU B O   1 
ATOM   2423 C  CB  . LEU B 1 106 ? 3.250   47.626  46.562  1.00  33.46 ? 105 LEU B CB  1 
ATOM   2424 C  CG  . LEU B 1 106 ? 2.544   48.846  45.954  1.00  33.27 ? 105 LEU B CG  1 
ATOM   2425 C  CD1 . LEU B 1 106 ? 1.599   48.459  44.822  1.00  32.99 ? 105 LEU B CD1 1 
ATOM   2426 C  CD2 . LEU B 1 106 ? 1.798   49.600  47.043  1.00  33.61 ? 105 LEU B CD2 1 
ATOM   2427 N  N   . ASP B 1 107 ? 6.357   47.963  45.933  1.00  33.33 ? 106 ASP B N   1 
ATOM   2428 C  CA  . ASP B 1 107 ? 7.526   48.730  45.483  1.00  33.70 ? 106 ASP B CA  1 
ATOM   2429 C  C   . ASP B 1 107 ? 8.248   48.039  44.323  1.00  33.31 ? 106 ASP B C   1 
ATOM   2430 O  O   . ASP B 1 107 ? 8.620   48.688  43.342  1.00  33.22 ? 106 ASP B O   1 
ATOM   2431 C  CB  . ASP B 1 107 ? 8.500   48.964  46.640  1.00  33.80 ? 106 ASP B CB  1 
ATOM   2432 C  CG  . ASP B 1 107 ? 7.957   49.928  47.687  1.00  35.94 ? 106 ASP B CG  1 
ATOM   2433 O  OD1 . ASP B 1 107 ? 7.073   50.753  47.352  1.00  38.09 ? 106 ASP B OD1 1 
ATOM   2434 O  OD2 . ASP B 1 107 ? 8.433   49.877  48.849  1.00  37.13 ? 106 ASP B OD2 1 
ATOM   2435 N  N   . ALA B 1 108 ? 8.435   46.725  44.443  1.00  32.76 ? 107 ALA B N   1 
ATOM   2436 C  CA  . ALA B 1 108 ? 9.061   45.925  43.395  1.00  32.60 ? 107 ALA B CA  1 
ATOM   2437 C  C   . ALA B 1 108 ? 8.206   45.920  42.130  1.00  32.42 ? 107 ALA B C   1 
ATOM   2438 O  O   . ALA B 1 108 ? 8.729   46.039  41.023  1.00  32.70 ? 107 ALA B O   1 
ATOM   2439 C  CB  . ALA B 1 108 ? 9.294   44.500  43.883  1.00  32.70 ? 107 ALA B CB  1 
ATOM   2440 N  N   . ILE B 1 109 ? 6.891   45.784  42.310  1.00  32.10 ? 108 ILE B N   1 
ATOM   2441 C  CA  . ILE B 1 109 ? 5.928   45.809  41.204  1.00  31.72 ? 108 ILE B CA  1 
ATOM   2442 C  C   . ILE B 1 109 ? 5.964   47.160  40.489  1.00  31.83 ? 108 ILE B C   1 
ATOM   2443 O  O   . ILE B 1 109 ? 5.980   47.220  39.259  1.00  31.83 ? 108 ILE B O   1 
ATOM   2444 C  CB  . ILE B 1 109 ? 4.494   45.463  41.699  1.00  31.88 ? 108 ILE B CB  1 
ATOM   2445 C  CG1 . ILE B 1 109 ? 4.378   43.952  41.945  1.00  31.33 ? 108 ILE B CG1 1 
ATOM   2446 C  CG2 . ILE B 1 109 ? 3.423   45.943  40.710  1.00  31.52 ? 108 ILE B CG2 1 
ATOM   2447 C  CD1 . ILE B 1 109 ? 3.099   43.514  42.631  1.00  31.93 ? 108 ILE B CD1 1 
ATOM   2448 N  N   . ASN B 1 110 ? 5.995   48.237  41.263  1.00  31.44 ? 109 ASN B N   1 
ATOM   2449 C  CA  . ASN B 1 110 ? 6.092   49.572  40.683  1.00  31.82 ? 109 ASN B CA  1 
ATOM   2450 C  C   . ASN B 1 110 ? 7.370   49.755  39.866  1.00  31.82 ? 109 ASN B C   1 
ATOM   2451 O  O   . ASN B 1 110 ? 7.319   50.248  38.743  1.00  32.15 ? 109 ASN B O   1 
ATOM   2452 C  CB  . ASN B 1 110 ? 5.948   50.653  41.761  1.00  31.82 ? 109 ASN B CB  1 
ATOM   2453 C  CG  . ASN B 1 110 ? 4.534   50.733  42.319  1.00  32.35 ? 109 ASN B CG  1 
ATOM   2454 O  OD1 . ASN B 1 110 ? 3.576   50.236  41.709  1.00  34.12 ? 109 ASN B OD1 1 
ATOM   2455 N  ND2 . ASN B 1 110 ? 4.394   51.353  43.483  1.00  33.50 ? 109 ASN B ND2 1 
ATOM   2456 N  N   . SER B 1 111 ? 8.502   49.327  40.419  1.00  31.70 ? 110 SER B N   1 
ATOM   2457 C  CA  . SER B 1 111 ? 9.795   49.458  39.745  1.00  32.22 ? 110 SER B CA  1 
ATOM   2458 C  C   . SER B 1 111 ? 9.863   48.644  38.449  1.00  31.72 ? 110 SER B C   1 
ATOM   2459 O  O   . SER B 1 111 ? 10.262  49.161  37.410  1.00  31.99 ? 110 SER B O   1 
ATOM   2460 C  CB  . SER B 1 111 ? 10.935  49.050  40.682  1.00  32.10 ? 110 SER B CB  1 
ATOM   2461 O  OG  . SER B 1 111 ? 10.870  47.655  40.934  1.00  35.01 ? 110 SER B OG  1 
ATOM   2462 N  N   . ALA B 1 112 ? 9.462   47.377  38.514  1.00  31.61 ? 111 ALA B N   1 
ATOM   2463 C  CA  . ALA B 1 112 ? 9.568   46.488  37.366  1.00  30.96 ? 111 ALA B CA  1 
ATOM   2464 C  C   . ALA B 1 112 ? 8.540   46.797  36.277  1.00  30.81 ? 111 ALA B C   1 
ATOM   2465 O  O   . ALA B 1 112 ? 8.831   46.652  35.087  1.00  30.46 ? 111 ALA B O   1 
ATOM   2466 C  CB  . ALA B 1 112 ? 9.466   45.039  37.809  1.00  30.84 ? 111 ALA B CB  1 
ATOM   2467 N  N   . PHE B 1 113 ? 7.350   47.232  36.686  1.00  30.82 ? 112 PHE B N   1 
ATOM   2468 C  CA  . PHE B 1 113 ? 6.207   47.325  35.767  1.00  30.69 ? 112 PHE B CA  1 
ATOM   2469 C  C   . PHE B 1 113 ? 5.603   48.721  35.640  1.00  30.88 ? 112 PHE B C   1 
ATOM   2470 O  O   . PHE B 1 113 ? 4.723   48.941  34.807  1.00  31.09 ? 112 PHE B O   1 
ATOM   2471 C  CB  . PHE B 1 113 ? 5.110   46.336  36.174  1.00  30.48 ? 112 PHE B CB  1 
ATOM   2472 C  CG  . PHE B 1 113 ? 5.570   44.902  36.225  1.00  30.70 ? 112 PHE B CG  1 
ATOM   2473 C  CD1 . PHE B 1 113 ? 5.729   44.164  35.057  1.00  31.03 ? 112 PHE B CD1 1 
ATOM   2474 C  CD2 . PHE B 1 113 ? 5.844   44.293  37.442  1.00  30.39 ? 112 PHE B CD2 1 
ATOM   2475 C  CE1 . PHE B 1 113 ? 6.155   42.833  35.104  1.00  30.50 ? 112 PHE B CE1 1 
ATOM   2476 C  CE2 . PHE B 1 113 ? 6.271   42.974  37.500  1.00  31.30 ? 112 PHE B CE2 1 
ATOM   2477 C  CZ  . PHE B 1 113 ? 6.427   42.239  36.328  1.00  31.33 ? 112 PHE B CZ  1 
ATOM   2478 N  N   . GLY B 1 114 ? 6.064   49.656  36.460  1.00  31.00 ? 113 GLY B N   1 
ATOM   2479 C  CA  . GLY B 1 114 ? 5.549   51.026  36.426  1.00  31.03 ? 113 GLY B CA  1 
ATOM   2480 C  C   . GLY B 1 114 ? 4.489   51.242  37.486  1.00  30.91 ? 113 GLY B C   1 
ATOM   2481 O  O   . GLY B 1 114 ? 4.597   52.157  38.299  1.00  30.81 ? 113 GLY B O   1 
ATOM   2482 N  N   . SER B 1 115 ? 3.471   50.382  37.476  1.00  30.74 ? 114 SER B N   1 
ATOM   2483 C  CA  . SER B 1 115 ? 2.363   50.448  38.428  1.00  30.64 ? 114 SER B CA  1 
ATOM   2484 C  C   . SER B 1 115 ? 1.732   49.064  38.575  1.00  30.85 ? 114 SER B C   1 
ATOM   2485 O  O   . SER B 1 115 ? 1.980   48.178  37.757  1.00  30.61 ? 114 SER B O   1 
ATOM   2486 C  CB  . SER B 1 115 ? 1.303   51.459  37.956  1.00  30.80 ? 114 SER B CB  1 
ATOM   2487 O  OG  . SER B 1 115 ? 0.568   50.944  36.853  1.00  29.77 ? 114 SER B OG  1 
ATOM   2488 N  N   . PHE B 1 116 ? 0.910   48.892  39.608  1.00  30.99 ? 115 PHE B N   1 
ATOM   2489 C  CA  . PHE B 1 116 ? 0.166   47.652  39.808  1.00  31.46 ? 115 PHE B CA  1 
ATOM   2490 C  C   . PHE B 1 116 ? -0.813  47.384  38.659  1.00  31.73 ? 115 PHE B C   1 
ATOM   2491 O  O   . PHE B 1 116 ? -0.946  46.248  38.200  1.00  31.36 ? 115 PHE B O   1 
ATOM   2492 C  CB  . PHE B 1 116 ? -0.561  47.668  41.155  1.00  31.70 ? 115 PHE B CB  1 
ATOM   2493 C  CG  . PHE B 1 116 ? -1.372  46.435  41.418  1.00  31.92 ? 115 PHE B CG  1 
ATOM   2494 C  CD1 . PHE B 1 116 ? -0.755  45.189  41.525  1.00  31.72 ? 115 PHE B CD1 1 
ATOM   2495 C  CD2 . PHE B 1 116 ? -2.754  46.514  41.554  1.00  32.46 ? 115 PHE B CD2 1 
ATOM   2496 C  CE1 . PHE B 1 116 ? -1.500  44.043  41.762  1.00  32.73 ? 115 PHE B CE1 1 
ATOM   2497 C  CE2 . PHE B 1 116 ? -3.511  45.369  41.797  1.00  32.31 ? 115 PHE B CE2 1 
ATOM   2498 C  CZ  . PHE B 1 116 ? -2.880  44.128  41.902  1.00  33.23 ? 115 PHE B CZ  1 
ATOM   2499 N  N   . ASP B 1 117 ? -1.480  48.435  38.188  1.00  32.05 ? 116 ASP B N   1 
ATOM   2500 C  CA  . ASP B 1 117 ? -2.378  48.325  37.041  1.00  32.63 ? 116 ASP B CA  1 
ATOM   2501 C  C   . ASP B 1 117 ? -1.669  47.847  35.773  1.00  32.15 ? 116 ASP B C   1 
ATOM   2502 O  O   . ASP B 1 117 ? -2.224  47.050  35.014  1.00  32.27 ? 116 ASP B O   1 
ATOM   2503 C  CB  . ASP B 1 117 ? -3.090  49.655  36.776  1.00  33.36 ? 116 ASP B CB  1 
ATOM   2504 C  CG  . ASP B 1 117 ? -4.465  49.720  37.414  1.00  35.36 ? 116 ASP B CG  1 
ATOM   2505 O  OD1 . ASP B 1 117 ? -4.673  49.084  38.470  1.00  37.62 ? 116 ASP B OD1 1 
ATOM   2506 O  OD2 . ASP B 1 117 ? -5.343  50.418  36.854  1.00  38.88 ? 116 ASP B OD2 1 
ATOM   2507 N  N   . ALA B 1 118 ? -0.451  48.334  35.551  1.00  31.48 ? 117 ALA B N   1 
ATOM   2508 C  CA  . ALA B 1 118 ? 0.338   47.924  34.394  1.00  31.24 ? 117 ALA B CA  1 
ATOM   2509 C  C   . ALA B 1 118 ? 0.814   46.479  34.546  1.00  30.96 ? 117 ALA B C   1 
ATOM   2510 O  O   . ALA B 1 118 ? 0.846   45.728  33.572  1.00  30.50 ? 117 ALA B O   1 
ATOM   2511 C  CB  . ALA B 1 118 ? 1.513   48.853  34.186  1.00  31.53 ? 117 ALA B CB  1 
ATOM   2512 N  N   . PHE B 1 119 ? 1.188   46.098  35.766  1.00  30.83 ? 118 PHE B N   1 
ATOM   2513 C  CA  . PHE B 1 119 ? 1.539   44.708  36.039  1.00  30.85 ? 118 PHE B CA  1 
ATOM   2514 C  C   . PHE B 1 119 ? 0.374   43.781  35.684  1.00  31.01 ? 118 PHE B C   1 
ATOM   2515 O  O   . PHE B 1 119 ? 0.567   42.766  35.016  1.00  31.02 ? 118 PHE B O   1 
ATOM   2516 C  CB  . PHE B 1 119 ? 1.945   44.498  37.505  1.00  30.78 ? 118 PHE B CB  1 
ATOM   2517 C  CG  . PHE B 1 119 ? 1.727   43.088  37.977  1.00  30.55 ? 118 PHE B CG  1 
ATOM   2518 C  CD1 . PHE B 1 119 ? 2.571   42.068  37.554  1.00  30.47 ? 118 PHE B CD1 1 
ATOM   2519 C  CD2 . PHE B 1 119 ? 0.639   42.769  38.786  1.00  31.14 ? 118 PHE B CD2 1 
ATOM   2520 C  CE1 . PHE B 1 119 ? 2.353   40.751  37.947  1.00  30.45 ? 118 PHE B CE1 1 
ATOM   2521 C  CE2 . PHE B 1 119 ? 0.412   41.459  39.189  1.00  31.02 ? 118 PHE B CE2 1 
ATOM   2522 C  CZ  . PHE B 1 119 ? 1.274   40.445  38.767  1.00  31.18 ? 118 PHE B CZ  1 
ATOM   2523 N  N   . LYS B 1 120 ? -0.826  44.135  36.144  1.00  31.38 ? 119 LYS B N   1 
ATOM   2524 C  CA  . LYS B 1 120 ? -2.035  43.354  35.883  1.00  32.03 ? 119 LYS B CA  1 
ATOM   2525 C  C   . LYS B 1 120 ? -2.254  43.104  34.399  1.00  32.39 ? 119 LYS B C   1 
ATOM   2526 O  O   . LYS B 1 120 ? -2.564  41.979  33.996  1.00  31.95 ? 119 LYS B O   1 
ATOM   2527 C  CB  . LYS B 1 120 ? -3.258  44.074  36.431  1.00  32.49 ? 119 LYS B CB  1 
ATOM   2528 C  CG  . LYS B 1 120 ? -3.570  43.818  37.879  1.00  33.40 ? 119 LYS B CG  1 
ATOM   2529 C  CD  . LYS B 1 120 ? -4.606  44.829  38.317  1.00  36.41 ? 119 LYS B CD  1 
ATOM   2530 C  CE  . LYS B 1 120 ? -5.542  44.265  39.355  1.00  38.25 ? 119 LYS B CE  1 
ATOM   2531 N  NZ  . LYS B 1 120 ? -6.463  45.344  39.810  1.00  37.99 ? 119 LYS B NZ  1 
ATOM   2532 N  N   . GLN B 1 121 ? -2.108  44.163  33.599  1.00  32.31 ? 120 GLN B N   1 
ATOM   2533 C  CA  . GLN B 1 121 ? -2.261  44.075  32.145  1.00  32.99 ? 120 GLN B CA  1 
ATOM   2534 C  C   . GLN B 1 121 ? -1.224  43.133  31.532  1.00  32.56 ? 120 GLN B C   1 
ATOM   2535 O  O   . GLN B 1 121 ? -1.557  42.330  30.658  1.00  32.70 ? 120 GLN B O   1 
ATOM   2536 C  CB  . GLN B 1 121 ? -2.183  45.471  31.507  1.00  32.96 ? 120 GLN B CB  1 
ATOM   2537 C  CG  . GLN B 1 121 ? -2.587  45.516  30.032  1.00  34.47 ? 120 GLN B CG  1 
ATOM   2538 C  CD  . GLN B 1 121 ? -2.982  46.909  29.562  1.00  34.74 ? 120 GLN B CD  1 
ATOM   2539 O  OE1 . GLN B 1 121 ? -2.622  47.924  30.175  1.00  37.42 ? 120 GLN B OE1 1 
ATOM   2540 N  NE2 . GLN B 1 121 ? -3.732  46.964  28.461  1.00  37.78 ? 120 GLN B NE2 1 
ATOM   2541 N  N   . LYS B 1 122 ? 0.022   43.227  31.997  1.00  32.38 ? 121 LYS B N   1 
ATOM   2542 C  CA  . LYS B 1 122 ? 1.099   42.359  31.515  1.00  32.69 ? 121 LYS B CA  1 
ATOM   2543 C  C   . LYS B 1 122 ? 0.858   40.893  31.891  1.00  31.86 ? 121 LYS B C   1 
ATOM   2544 O  O   . LYS B 1 122 ? 1.046   40.000  31.066  1.00  31.42 ? 121 LYS B O   1 
ATOM   2545 C  CB  . LYS B 1 122 ? 2.469   42.830  32.026  1.00  32.95 ? 121 LYS B CB  1 
ATOM   2546 C  CG  . LYS B 1 122 ? 3.634   42.276  31.200  1.00  34.39 ? 121 LYS B CG  1 
ATOM   2547 C  CD  . LYS B 1 122 ? 4.991   42.760  31.708  1.00  35.10 ? 121 LYS B CD  1 
ATOM   2548 C  CE  . LYS B 1 122 ? 6.084   41.739  31.363  1.00  39.06 ? 121 LYS B CE  1 
ATOM   2549 N  NZ  . LYS B 1 122 ? 7.193   41.673  32.383  1.00  39.95 ? 121 LYS B NZ  1 
ATOM   2550 N  N   . PHE B 1 123 ? 0.443   40.667  33.136  1.00  31.25 ? 122 PHE B N   1 
ATOM   2551 C  CA  . PHE B 1 123 ? 0.098   39.331  33.639  1.00  30.97 ? 122 PHE B CA  1 
ATOM   2552 C  C   . PHE B 1 123 ? -1.084  38.746  32.862  1.00  31.30 ? 122 PHE B C   1 
ATOM   2553 O  O   . PHE B 1 123 ? -1.047  37.587  32.434  1.00  31.04 ? 122 PHE B O   1 
ATOM   2554 C  CB  . PHE B 1 123 ? -0.214  39.417  35.138  1.00  30.75 ? 122 PHE B CB  1 
ATOM   2555 C  CG  . PHE B 1 123 ? -0.416  38.083  35.812  1.00  30.07 ? 122 PHE B CG  1 
ATOM   2556 C  CD1 . PHE B 1 123 ? 0.659   37.419  36.395  1.00  29.63 ? 122 PHE B CD1 1 
ATOM   2557 C  CD2 . PHE B 1 123 ? -1.685  37.510  35.895  1.00  30.82 ? 122 PHE B CD2 1 
ATOM   2558 C  CE1 . PHE B 1 123 ? 0.482   36.177  37.041  1.00  30.62 ? 122 PHE B CE1 1 
ATOM   2559 C  CE2 . PHE B 1 123 ? -1.881  36.277  36.533  1.00  30.18 ? 122 PHE B CE2 1 
ATOM   2560 C  CZ  . PHE B 1 123 ? -0.789  35.609  37.111  1.00  29.89 ? 122 PHE B CZ  1 
ATOM   2561 N  N   . GLU B 1 124 ? -2.127  39.550  32.677  1.00  31.34 ? 123 GLU B N   1 
ATOM   2562 C  CA  . GLU B 1 124 ? -3.282  39.122  31.888  1.00  32.30 ? 123 GLU B CA  1 
ATOM   2563 C  C   . GLU B 1 124 ? -2.917  38.793  30.447  1.00  32.26 ? 123 GLU B C   1 
ATOM   2564 O  O   . GLU B 1 124 ? -3.420  37.812  29.898  1.00  32.06 ? 123 GLU B O   1 
ATOM   2565 C  CB  . GLU B 1 124 ? -4.396  40.163  31.928  1.00  32.43 ? 123 GLU B CB  1 
ATOM   2566 C  CG  . GLU B 1 124 ? -5.169  40.170  33.235  1.00  34.85 ? 123 GLU B CG  1 
ATOM   2567 C  CD  . GLU B 1 124 ? -6.351  41.129  33.209  1.00  37.06 ? 123 GLU B CD  1 
ATOM   2568 O  OE1 . GLU B 1 124 ? -7.161  41.053  32.259  1.00  38.89 ? 123 GLU B OE1 1 
ATOM   2569 O  OE2 . GLU B 1 124 ? -6.470  41.949  34.142  1.00  38.35 ? 123 GLU B OE2 1 
ATOM   2570 N  N   . ASP B 1 125 ? -2.042  39.604  29.848  1.00  32.72 ? 124 ASP B N   1 
ATOM   2571 C  CA  . ASP B 1 125 ? -1.588  39.385  28.469  1.00  33.36 ? 124 ASP B CA  1 
ATOM   2572 C  C   . ASP B 1 125 ? -0.861  38.053  28.332  1.00  32.84 ? 124 ASP B C   1 
ATOM   2573 O  O   . ASP B 1 125 ? -1.082  37.314  27.363  1.00  32.93 ? 124 ASP B O   1 
ATOM   2574 C  CB  . ASP B 1 125 ? -0.687  40.528  27.986  1.00  34.03 ? 124 ASP B CB  1 
ATOM   2575 C  CG  . ASP B 1 125 ? 0.138   40.146  26.752  1.00  37.66 ? 124 ASP B CG  1 
ATOM   2576 O  OD1 . ASP B 1 125 ? -0.198  40.612  25.636  1.00  40.97 ? 124 ASP B OD1 1 
ATOM   2577 O  OD2 . ASP B 1 125 ? 1.119   39.364  26.894  1.00  41.85 ? 124 ASP B OD2 1 
ATOM   2578 N  N   . ALA B 1 126 ? 0.009   37.757  29.297  1.00  32.24 ? 125 ALA B N   1 
ATOM   2579 C  CA  . ALA B 1 126 ? 0.752   36.505  29.287  1.00  31.99 ? 125 ALA B CA  1 
ATOM   2580 C  C   . ALA B 1 126 ? -0.201  35.329  29.429  1.00  31.71 ? 125 ALA B C   1 
ATOM   2581 O  O   . ALA B 1 126 ? -0.042  34.328  28.745  1.00  32.24 ? 125 ALA B O   1 
ATOM   2582 C  CB  . ALA B 1 126 ? 1.809   36.480  30.370  1.00  31.62 ? 125 ALA B CB  1 
ATOM   2583 N  N   . ALA B 1 127 ? -1.198  35.458  30.300  1.00  31.39 ? 126 ALA B N   1 
ATOM   2584 C  CA  . ALA B 1 127 ? -2.209  34.397  30.453  1.00  31.57 ? 126 ALA B CA  1 
ATOM   2585 C  C   . ALA B 1 127 ? -3.082  34.224  29.202  1.00  31.69 ? 126 ALA B C   1 
ATOM   2586 O  O   . ALA B 1 127 ? -3.383  33.097  28.802  1.00  31.27 ? 126 ALA B O   1 
ATOM   2587 C  CB  . ALA B 1 127 ? -3.067  34.652  31.676  1.00  31.26 ? 126 ALA B CB  1 
ATOM   2588 N  N   . LYS B 1 128 ? -3.482  35.340  28.591  1.00  32.29 ? 127 LYS B N   1 
ATOM   2589 C  CA  . LYS B 1 128 ? -4.364  35.305  27.416  1.00  33.03 ? 127 LYS B CA  1 
ATOM   2590 C  C   . LYS B 1 128 ? -3.694  34.682  26.203  1.00  33.13 ? 127 LYS B C   1 
ATOM   2591 O  O   . LYS B 1 128 ? -4.330  33.930  25.453  1.00  32.79 ? 127 LYS B O   1 
ATOM   2592 C  CB  . LYS B 1 128 ? -4.816  36.707  27.028  1.00  33.22 ? 127 LYS B CB  1 
ATOM   2593 C  CG  . LYS B 1 128 ? -5.959  37.275  27.843  1.00  35.37 ? 127 LYS B CG  1 
ATOM   2594 C  CD  . LYS B 1 128 ? -6.352  38.601  27.233  1.00  37.14 ? 127 LYS B CD  1 
ATOM   2595 C  CE  . LYS B 1 128 ? -7.119  39.461  28.195  1.00  39.20 ? 127 LYS B CE  1 
ATOM   2596 N  NZ  . LYS B 1 128 ? -7.191  40.850  27.657  1.00  40.00 ? 127 LYS B NZ  1 
ATOM   2597 N  N   . THR B 1 129 ? -2.414  35.002  26.007  1.00  32.50 ? 128 THR B N   1 
ATOM   2598 C  CA  . THR B 1 129 ? -1.684  34.549  24.821  1.00  33.08 ? 128 THR B CA  1 
ATOM   2599 C  C   . THR B 1 129 ? -1.062  33.148  24.961  1.00  32.21 ? 128 THR B C   1 
ATOM   2600 O  O   . THR B 1 129 ? -0.437  32.649  24.025  1.00  32.57 ? 128 THR B O   1 
ATOM   2601 C  CB  . THR B 1 129 ? -0.600  35.572  24.385  1.00  32.86 ? 128 THR B CB  1 
ATOM   2602 O  OG1 . THR B 1 129 ? 0.252   35.876  25.492  1.00  34.82 ? 128 THR B OG1 1 
ATOM   2603 C  CG2 . THR B 1 129 ? -1.245  36.857  23.898  1.00  34.83 ? 128 THR B CG2 1 
ATOM   2604 N  N   . ARG B 1 130 ? -1.227  32.526  26.127  1.00  31.02 ? 129 ARG B N   1 
ATOM   2605 C  CA  . ARG B 1 130 ? -0.755  31.169  26.343  1.00  30.15 ? 129 ARG B CA  1 
ATOM   2606 C  C   . ARG B 1 130 ? -1.710  30.234  25.591  1.00  29.60 ? 129 ARG B C   1 
ATOM   2607 O  O   . ARG B 1 130 ? -2.852  30.041  25.998  1.00  30.18 ? 129 ARG B O   1 
ATOM   2608 C  CB  . ARG B 1 130 ? -0.682  30.859  27.855  1.00  29.94 ? 129 ARG B CB  1 
ATOM   2609 C  CG  . ARG B 1 130 ? -0.571  29.387  28.256  1.00  30.50 ? 129 ARG B CG  1 
ATOM   2610 C  CD  . ARG B 1 130 ? 0.464   28.626  27.441  1.00  29.70 ? 129 ARG B CD  1 
ATOM   2611 N  NE  . ARG B 1 130 ? 1.811   29.159  27.598  1.00  30.35 ? 129 ARG B NE  1 
ATOM   2612 C  CZ  . ARG B 1 130 ? 2.884   28.637  27.010  1.00  31.52 ? 129 ARG B CZ  1 
ATOM   2613 N  NH1 . ARG B 1 130 ? 2.767   27.559  26.237  1.00  33.02 ? 129 ARG B NH1 1 
ATOM   2614 N  NH2 . ARG B 1 130 ? 4.069   29.174  27.210  1.00  30.66 ? 129 ARG B NH2 1 
ATOM   2615 N  N   . PHE B 1 131 ? -1.242  29.687  24.475  1.00  28.89 ? 130 PHE B N   1 
ATOM   2616 C  CA  . PHE B 1 131 ? -2.108  28.900  23.591  1.00  28.00 ? 130 PHE B CA  1 
ATOM   2617 C  C   . PHE B 1 131 ? -2.144  27.453  24.058  1.00  27.81 ? 130 PHE B C   1 
ATOM   2618 O  O   . PHE B 1 131 ? -1.104  26.831  24.216  1.00  27.61 ? 130 PHE B O   1 
ATOM   2619 C  CB  . PHE B 1 131 ? -1.601  28.978  22.154  1.00  27.92 ? 130 PHE B CB  1 
ATOM   2620 C  CG  . PHE B 1 131 ? -2.551  28.419  21.141  1.00  27.53 ? 130 PHE B CG  1 
ATOM   2621 C  CD1 . PHE B 1 131 ? -3.617  29.192  20.670  1.00  28.10 ? 130 PHE B CD1 1 
ATOM   2622 C  CD2 . PHE B 1 131 ? -2.381  27.139  20.637  1.00  27.74 ? 130 PHE B CD2 1 
ATOM   2623 C  CE1 . PHE B 1 131 ? -4.497  28.696  19.724  1.00  28.63 ? 130 PHE B CE1 1 
ATOM   2624 C  CE2 . PHE B 1 131 ? -3.276  26.632  19.683  1.00  27.02 ? 130 PHE B CE2 1 
ATOM   2625 C  CZ  . PHE B 1 131 ? -4.325  27.413  19.234  1.00  27.77 ? 130 PHE B CZ  1 
ATOM   2626 N  N   . GLY B 1 132 ? -3.343  26.910  24.257  1.00  27.28 ? 131 GLY B N   1 
ATOM   2627 C  CA  . GLY B 1 132 ? -3.463  25.563  24.807  1.00  27.40 ? 131 GLY B CA  1 
ATOM   2628 C  C   . GLY B 1 132 ? -3.484  25.642  26.325  1.00  27.80 ? 131 GLY B C   1 
ATOM   2629 O  O   . GLY B 1 132 ? -3.923  26.653  26.891  1.00  28.10 ? 131 GLY B O   1 
ATOM   2630 N  N   . SER B 1 133 ? -3.003  24.585  26.979  1.00  27.08 ? 132 SER B N   1 
ATOM   2631 C  CA  . SER B 1 133 ? -3.006  24.512  28.439  1.00  26.51 ? 132 SER B CA  1 
ATOM   2632 C  C   . SER B 1 133 ? -1.723  25.089  29.026  1.00  26.58 ? 132 SER B C   1 
ATOM   2633 O  O   . SER B 1 133 ? -0.663  24.975  28.423  1.00  25.92 ? 132 SER B O   1 
ATOM   2634 C  CB  . SER B 1 133 ? -3.135  23.052  28.879  1.00  26.66 ? 132 SER B CB  1 
ATOM   2635 O  OG  . SER B 1 133 ? -4.250  22.435  28.258  1.00  26.96 ? 132 SER B OG  1 
ATOM   2636 N  N   . GLY B 1 134 ? -1.823  25.668  30.220  1.00  26.34 ? 133 GLY B N   1 
ATOM   2637 C  CA  . GLY B 1 134 ? -0.629  26.156  30.896  1.00  26.23 ? 133 GLY B CA  1 
ATOM   2638 C  C   . GLY B 1 134 ? -0.927  27.129  32.017  1.00  26.51 ? 133 GLY B C   1 
ATOM   2639 O  O   . GLY B 1 134 ? -2.037  27.153  32.563  1.00  26.28 ? 133 GLY B O   1 
ATOM   2640 N  N   . TRP B 1 135 ? 0.078   27.936  32.347  1.00  26.61 ? 134 TRP B N   1 
ATOM   2641 C  CA  . TRP B 1 135 ? 0.046   28.802  33.517  1.00  27.06 ? 134 TRP B CA  1 
ATOM   2642 C  C   . TRP B 1 135 ? 0.732   30.125  33.159  1.00  27.19 ? 134 TRP B C   1 
ATOM   2643 O  O   . TRP B 1 135 ? 1.651   30.148  32.339  1.00  27.49 ? 134 TRP B O   1 
ATOM   2644 C  CB  . TRP B 1 135 ? 0.838   28.148  34.663  1.00  27.08 ? 134 TRP B CB  1 
ATOM   2645 C  CG  . TRP B 1 135 ? 0.181   26.931  35.280  1.00  27.93 ? 134 TRP B CG  1 
ATOM   2646 C  CD1 . TRP B 1 135 ? 0.127   25.665  34.766  1.00  28.34 ? 134 TRP B CD1 1 
ATOM   2647 C  CD2 . TRP B 1 135 ? -0.495  26.883  36.540  1.00  28.36 ? 134 TRP B CD2 1 
ATOM   2648 N  NE1 . TRP B 1 135 ? -0.561  24.835  35.622  1.00  27.46 ? 134 TRP B NE1 1 
ATOM   2649 C  CE2 . TRP B 1 135 ? -0.957  25.558  36.718  1.00  28.77 ? 134 TRP B CE2 1 
ATOM   2650 C  CE3 . TRP B 1 135 ? -0.774  27.842  37.531  1.00  28.33 ? 134 TRP B CE3 1 
ATOM   2651 C  CZ2 . TRP B 1 135 ? -1.683  25.161  37.850  1.00  28.30 ? 134 TRP B CZ2 1 
ATOM   2652 C  CZ3 . TRP B 1 135 ? -1.491  27.443  38.669  1.00  29.09 ? 134 TRP B CZ3 1 
ATOM   2653 C  CH2 . TRP B 1 135 ? -1.940  26.111  38.811  1.00  28.07 ? 134 TRP B CH2 1 
ATOM   2654 N  N   . ALA B 1 136 ? 0.288   31.214  33.782  1.00  27.84 ? 135 ALA B N   1 
ATOM   2655 C  CA  . ALA B 1 136 ? 1.026   32.479  33.737  1.00  27.34 ? 135 ALA B CA  1 
ATOM   2656 C  C   . ALA B 1 136 ? 1.578   32.740  35.130  1.00  27.54 ? 135 ALA B C   1 
ATOM   2657 O  O   . ALA B 1 136 ? 0.908   32.445  36.127  1.00  27.31 ? 135 ALA B O   1 
ATOM   2658 C  CB  . ALA B 1 136 ? 0.130   33.621  33.293  1.00  27.61 ? 135 ALA B CB  1 
ATOM   2659 N  N   . TRP B 1 137 ? 2.787   33.305  35.186  1.00  27.47 ? 136 TRP B N   1 
ATOM   2660 C  CA  . TRP B 1 137 ? 3.538   33.462  36.433  1.00  27.65 ? 136 TRP B CA  1 
ATOM   2661 C  C   . TRP B 1 137 ? 4.104   34.861  36.624  1.00  28.02 ? 136 TRP B C   1 
ATOM   2662 O  O   . TRP B 1 137 ? 4.573   35.487  35.667  1.00  28.55 ? 136 TRP B O   1 
ATOM   2663 C  CB  . TRP B 1 137 ? 4.731   32.504  36.453  1.00  27.91 ? 136 TRP B CB  1 
ATOM   2664 C  CG  . TRP B 1 137 ? 4.407   31.075  36.154  1.00  28.10 ? 136 TRP B CG  1 
ATOM   2665 C  CD1 . TRP B 1 137 ? 4.493   30.447  34.943  1.00  28.87 ? 136 TRP B CD1 1 
ATOM   2666 C  CD2 . TRP B 1 137 ? 3.962   30.092  37.088  1.00  28.75 ? 136 TRP B CD2 1 
ATOM   2667 N  NE1 . TRP B 1 137 ? 4.132   29.122  35.070  1.00  27.11 ? 136 TRP B NE1 1 
ATOM   2668 C  CE2 . TRP B 1 137 ? 3.797   28.878  36.375  1.00  28.61 ? 136 TRP B CE2 1 
ATOM   2669 C  CE3 . TRP B 1 137 ? 3.688   30.112  38.460  1.00  29.21 ? 136 TRP B CE3 1 
ATOM   2670 C  CZ2 . TRP B 1 137 ? 3.361   27.695  36.993  1.00  29.03 ? 136 TRP B CZ2 1 
ATOM   2671 C  CZ3 . TRP B 1 137 ? 3.248   28.924  39.079  1.00  29.39 ? 136 TRP B CZ3 1 
ATOM   2672 C  CH2 . TRP B 1 137 ? 3.098   27.740  38.345  1.00  28.88 ? 136 TRP B CH2 1 
ATOM   2673 N  N   . LEU B 1 138 ? 4.085   35.327  37.870  1.00  27.99 ? 137 LEU B N   1 
ATOM   2674 C  CA  . LEU B 1 138 ? 4.955   36.409  38.312  1.00  27.85 ? 137 LEU B CA  1 
ATOM   2675 C  C   . LEU B 1 138 ? 6.148   35.737  38.984  1.00  28.04 ? 137 LEU B C   1 
ATOM   2676 O  O   . LEU B 1 138 ? 5.981   35.002  39.965  1.00  27.88 ? 137 LEU B O   1 
ATOM   2677 C  CB  . LEU B 1 138 ? 4.241   37.328  39.309  1.00  27.68 ? 137 LEU B CB  1 
ATOM   2678 C  CG  . LEU B 1 138 ? 5.030   38.460  39.994  1.00  27.90 ? 137 LEU B CG  1 
ATOM   2679 C  CD1 . LEU B 1 138 ? 5.584   39.469  38.985  1.00  26.92 ? 137 LEU B CD1 1 
ATOM   2680 C  CD2 . LEU B 1 138 ? 4.189   39.164  41.060  1.00  27.89 ? 137 LEU B CD2 1 
ATOM   2681 N  N   . VAL B 1 139 ? 7.339   35.964  38.442  1.00  27.62 ? 138 VAL B N   1 
ATOM   2682 C  CA  . VAL B 1 139 ? 8.556   35.358  38.985  1.00  28.33 ? 138 VAL B CA  1 
ATOM   2683 C  C   . VAL B 1 139 ? 9.558   36.393  39.497  1.00  28.88 ? 138 VAL B C   1 
ATOM   2684 O  O   . VAL B 1 139 ? 9.525   37.560  39.092  1.00  28.81 ? 138 VAL B O   1 
ATOM   2685 C  CB  . VAL B 1 139 ? 9.262   34.405  37.964  1.00  28.10 ? 138 VAL B CB  1 
ATOM   2686 C  CG1 . VAL B 1 139 ? 8.341   33.245  37.558  1.00  27.04 ? 138 VAL B CG1 1 
ATOM   2687 C  CG2 . VAL B 1 139 ? 9.741   35.163  36.729  1.00  28.98 ? 138 VAL B CG2 1 
ATOM   2688 N  N   . VAL B 1 140 ? 10.422  35.950  40.409  1.00  29.52 ? 139 VAL B N   1 
ATOM   2689 C  CA  . VAL B 1 140 ? 11.624  36.690  40.773  1.00  30.46 ? 139 VAL B CA  1 
ATOM   2690 C  C   . VAL B 1 140 ? 12.781  36.018  40.035  1.00  31.14 ? 139 VAL B C   1 
ATOM   2691 O  O   . VAL B 1 140 ? 13.027  34.810  40.205  1.00  30.65 ? 139 VAL B O   1 
ATOM   2692 C  CB  . VAL B 1 140 ? 11.890  36.681  42.302  1.00  30.45 ? 139 VAL B CB  1 
ATOM   2693 C  CG1 . VAL B 1 140 ? 13.145  37.472  42.631  1.00  30.12 ? 139 VAL B CG1 1 
ATOM   2694 C  CG2 . VAL B 1 140 ? 10.698  37.239  43.073  1.00  31.12 ? 139 VAL B CG2 1 
ATOM   2695 N  N   . LYS B 1 141 ? 13.463  36.807  39.206  1.00  32.35 ? 140 LYS B N   1 
ATOM   2696 C  CA  . LYS B 1 141 ? 14.570  36.349  38.372  1.00  33.49 ? 140 LYS B CA  1 
ATOM   2697 C  C   . LYS B 1 141 ? 15.718  37.326  38.561  1.00  34.00 ? 140 LYS B C   1 
ATOM   2698 O  O   . LYS B 1 141 ? 15.612  38.492  38.172  1.00  34.15 ? 140 LYS B O   1 
ATOM   2699 C  CB  . LYS B 1 141 ? 14.142  36.333  36.899  1.00  34.00 ? 140 LYS B CB  1 
ATOM   2700 C  CG  . LYS B 1 141 ? 14.613  35.134  36.079  1.00  35.44 ? 140 LYS B CG  1 
ATOM   2701 C  CD  . LYS B 1 141 ? 16.123  35.050  35.971  1.00  38.05 ? 140 LYS B CD  1 
ATOM   2702 C  CE  . LYS B 1 141 ? 16.526  33.859  35.126  1.00  40.02 ? 140 LYS B CE  1 
ATOM   2703 N  NZ  . LYS B 1 141 ? 17.924  33.423  35.401  1.00  42.32 ? 140 LYS B NZ  1 
ATOM   2704 N  N   . ASP B 1 142 ? 16.809  36.851  39.164  1.00  34.51 ? 141 ASP B N   1 
ATOM   2705 C  CA  . ASP B 1 142 ? 17.963  37.693  39.523  1.00  35.05 ? 141 ASP B CA  1 
ATOM   2706 C  C   . ASP B 1 142 ? 17.553  38.913  40.359  1.00  34.77 ? 141 ASP B C   1 
ATOM   2707 O  O   . ASP B 1 142 ? 18.048  40.018  40.140  1.00  34.78 ? 141 ASP B O   1 
ATOM   2708 C  CB  . ASP B 1 142 ? 18.753  38.120  38.273  1.00  35.35 ? 141 ASP B CB  1 
ATOM   2709 C  CG  . ASP B 1 142 ? 19.076  36.950  37.347  1.00  37.20 ? 141 ASP B CG  1 
ATOM   2710 O  OD1 . ASP B 1 142 ? 19.542  35.899  37.844  1.00  40.20 ? 141 ASP B OD1 1 
ATOM   2711 O  OD2 . ASP B 1 142 ? 18.867  37.081  36.119  1.00  38.71 ? 141 ASP B OD2 1 
ATOM   2712 N  N   . GLY B 1 143 ? 16.629  38.701  41.298  1.00  34.58 ? 142 GLY B N   1 
ATOM   2713 C  CA  . GLY B 1 143 ? 16.180  39.750  42.219  1.00  34.07 ? 142 GLY B CA  1 
ATOM   2714 C  C   . GLY B 1 143 ? 15.136  40.702  41.657  1.00  33.75 ? 142 GLY B C   1 
ATOM   2715 O  O   . GLY B 1 143 ? 14.641  41.585  42.363  1.00  33.94 ? 142 GLY B O   1 
ATOM   2716 N  N   . LYS B 1 144 ? 14.801  40.523  40.385  1.00  33.11 ? 143 LYS B N   1 
ATOM   2717 C  CA  . LYS B 1 144 ? 13.852  41.395  39.700  1.00  32.94 ? 143 LYS B CA  1 
ATOM   2718 C  C   . LYS B 1 144 ? 12.601  40.632  39.266  1.00  32.22 ? 143 LYS B C   1 
ATOM   2719 O  O   . LYS B 1 144 ? 12.675  39.448  38.919  1.00  32.42 ? 143 LYS B O   1 
ATOM   2720 C  CB  . LYS B 1 144 ? 14.520  42.036  38.486  1.00  32.92 ? 143 LYS B CB  1 
ATOM   2721 C  CG  . LYS B 1 144 ? 15.680  42.926  38.852  1.00  34.05 ? 143 LYS B CG  1 
ATOM   2722 C  CD  . LYS B 1 144 ? 16.771  42.868  37.816  1.00  36.15 ? 143 LYS B CD  1 
ATOM   2723 C  CE  . LYS B 1 144 ? 18.022  43.546  38.346  1.00  37.62 ? 143 LYS B CE  1 
ATOM   2724 N  NZ  . LYS B 1 144 ? 18.977  43.868  37.255  1.00  39.90 ? 143 LYS B NZ  1 
ATOM   2725 N  N   . LEU B 1 145 ? 11.465  41.327  39.265  1.00  31.67 ? 144 LEU B N   1 
ATOM   2726 C  CA  . LEU B 1 145 ? 10.181  40.745  38.856  1.00  31.23 ? 144 LEU B CA  1 
ATOM   2727 C  C   . LEU B 1 145 ? 10.011  40.671  37.338  1.00  31.03 ? 144 LEU B C   1 
ATOM   2728 O  O   . LEU B 1 145 ? 10.449  41.564  36.609  1.00  30.22 ? 144 LEU B O   1 
ATOM   2729 C  CB  . LEU B 1 145 ? 9.015   41.529  39.472  1.00  31.54 ? 144 LEU B CB  1 
ATOM   2730 C  CG  . LEU B 1 145 ? 8.822   41.494  40.995  1.00  31.32 ? 144 LEU B CG  1 
ATOM   2731 C  CD1 . LEU B 1 145 ? 7.644   42.363  41.365  1.00  31.93 ? 144 LEU B CD1 1 
ATOM   2732 C  CD2 . LEU B 1 145 ? 8.607   40.061  41.514  1.00  32.18 ? 144 LEU B CD2 1 
ATOM   2733 N  N   . ASP B 1 146 ? 9.379   39.593  36.876  1.00  30.35 ? 145 ASP B N   1 
ATOM   2734 C  CA  . ASP B 1 146 ? 9.030   39.419  35.465  1.00  30.48 ? 145 ASP B CA  1 
ATOM   2735 C  C   . ASP B 1 146 ? 7.766   38.576  35.344  1.00  29.96 ? 145 ASP B C   1 
ATOM   2736 O  O   . ASP B 1 146 ? 7.431   37.816  36.251  1.00  28.79 ? 145 ASP B O   1 
ATOM   2737 C  CB  . ASP B 1 146 ? 10.170  38.746  34.696  1.00  31.21 ? 145 ASP B CB  1 
ATOM   2738 C  CG  . ASP B 1 146 ? 10.156  39.070  33.195  1.00  34.26 ? 145 ASP B CG  1 
ATOM   2739 O  OD1 . ASP B 1 146 ? 9.131   39.569  32.653  1.00  36.38 ? 145 ASP B OD1 1 
ATOM   2740 O  OD2 . ASP B 1 146 ? 11.195  38.817  32.550  1.00  37.82 ? 145 ASP B OD2 1 
ATOM   2741 N  N   . VAL B 1 147 ? 7.070   38.736  34.223  1.00  29.32 ? 146 VAL B N   1 
ATOM   2742 C  CA  . VAL B 1 147 ? 5.884   37.957  33.918  1.00  29.49 ? 146 VAL B CA  1 
ATOM   2743 C  C   . VAL B 1 147 ? 6.226   36.983  32.795  1.00  29.24 ? 146 VAL B C   1 
ATOM   2744 O  O   . VAL B 1 147 ? 6.762   37.384  31.754  1.00  29.15 ? 146 VAL B O   1 
ATOM   2745 C  CB  . VAL B 1 147 ? 4.685   38.869  33.527  1.00  29.47 ? 146 VAL B CB  1 
ATOM   2746 C  CG1 . VAL B 1 147 ? 3.539   38.049  32.957  1.00  30.06 ? 146 VAL B CG1 1 
ATOM   2747 C  CG2 . VAL B 1 147 ? 4.209   39.670  34.737  1.00  30.34 ? 146 VAL B CG2 1 
ATOM   2748 N  N   . VAL B 1 148 ? 5.934   35.704  33.026  1.00  29.18 ? 147 VAL B N   1 
ATOM   2749 C  CA  . VAL B 1 148 ? 6.191   34.645  32.056  1.00  28.76 ? 147 VAL B CA  1 
ATOM   2750 C  C   . VAL B 1 148 ? 4.994   33.687  32.005  1.00  28.63 ? 147 VAL B C   1 
ATOM   2751 O  O   . VAL B 1 148 ? 4.139   33.693  32.904  1.00  28.43 ? 147 VAL B O   1 
ATOM   2752 C  CB  . VAL B 1 148 ? 7.500   33.843  32.397  1.00  28.80 ? 147 VAL B CB  1 
ATOM   2753 C  CG1 . VAL B 1 148 ? 8.750   34.723  32.270  1.00  29.02 ? 147 VAL B CG1 1 
ATOM   2754 C  CG2 . VAL B 1 148 ? 7.414   33.193  33.784  1.00  28.92 ? 147 VAL B CG2 1 
ATOM   2755 N  N   . SER B 1 149 ? 4.927   32.874  30.953  1.00  28.63 ? 148 SER B N   1 
ATOM   2756 C  CA  . SER B 1 149 ? 3.990   31.751  30.934  1.00  28.14 ? 148 SER B CA  1 
ATOM   2757 C  C   . SER B 1 149 ? 4.699   30.431  30.624  1.00  28.10 ? 148 SER B C   1 
ATOM   2758 O  O   . SER B 1 149 ? 5.807   30.427  30.083  1.00  27.89 ? 148 SER B O   1 
ATOM   2759 C  CB  . SER B 1 149 ? 2.830   32.002  29.965  1.00  29.15 ? 148 SER B CB  1 
ATOM   2760 O  OG  . SER B 1 149 ? 3.210   31.799  28.625  1.00  30.17 ? 148 SER B OG  1 
ATOM   2761 N  N   . THR B 1 150 ? 4.063   29.320  30.998  1.00  27.83 ? 149 THR B N   1 
ATOM   2762 C  CA  . THR B 1 150 ? 4.589   27.986  30.716  1.00  27.84 ? 149 THR B CA  1 
ATOM   2763 C  C   . THR B 1 150 ? 3.482   27.118  30.133  1.00  27.84 ? 149 THR B C   1 
ATOM   2764 O  O   . THR B 1 150 ? 2.299   27.395  30.353  1.00  27.18 ? 149 THR B O   1 
ATOM   2765 C  CB  . THR B 1 150 ? 5.111   27.296  31.997  1.00  27.41 ? 149 THR B CB  1 
ATOM   2766 O  OG1 . THR B 1 150 ? 4.079   27.277  32.994  1.00  29.13 ? 149 THR B OG1 1 
ATOM   2767 C  CG2 . THR B 1 150 ? 6.350   28.050  32.548  1.00  28.08 ? 149 THR B CG2 1 
ATOM   2768 N  N   . ALA B 1 151 ? 3.875   26.065  29.416  1.00  27.57 ? 150 ALA B N   1 
ATOM   2769 C  CA  . ALA B 1 151 ? 2.928   25.091  28.860  1.00  27.52 ? 150 ALA B CA  1 
ATOM   2770 C  C   . ALA B 1 151 ? 2.587   23.999  29.863  1.00  27.53 ? 150 ALA B C   1 
ATOM   2771 O  O   . ALA B 1 151 ? 3.423   23.605  30.683  1.00  27.57 ? 150 ALA B O   1 
ATOM   2772 C  CB  . ALA B 1 151 ? 3.512   24.455  27.603  1.00  27.59 ? 150 ALA B CB  1 
ATOM   2773 N  N   . ASN B 1 152 ? 1.356   23.501  29.768  1.00  26.68 ? 151 ASN B N   1 
ATOM   2774 C  CA  . ASN B 1 152 ? 0.899   22.341  30.526  1.00  26.57 ? 151 ASN B CA  1 
ATOM   2775 C  C   . ASN B 1 152 ? 1.186   22.460  32.023  1.00  26.22 ? 151 ASN B C   1 
ATOM   2776 O  O   . ASN B 1 152 ? 0.677   23.393  32.657  1.00  26.01 ? 151 ASN B O   1 
ATOM   2777 C  CB  . ASN B 1 152 ? 1.432   21.050  29.887  1.00  26.69 ? 151 ASN B CB  1 
ATOM   2778 C  CG  . ASN B 1 152 ? 1.129   20.981  28.375  1.00  28.06 ? 151 ASN B CG  1 
ATOM   2779 O  OD1 . ASN B 1 152 ? 0.028   21.293  27.944  1.00  26.78 ? 151 ASN B OD1 1 
ATOM   2780 N  ND2 . ASN B 1 152 ? 2.128   20.613  27.578  1.00  26.81 ? 151 ASN B ND2 1 
ATOM   2781 N  N   . GLN B 1 153 ? 1.946   21.535  32.609  1.00  25.88 ? 152 GLN B N   1 
ATOM   2782 C  CA  . GLN B 1 153 ? 2.267   21.667  34.045  1.00  26.42 ? 152 GLN B CA  1 
ATOM   2783 C  C   . GLN B 1 153 ? 3.711   22.069  34.318  1.00  27.21 ? 152 GLN B C   1 
ATOM   2784 O  O   . GLN B 1 153 ? 4.205   21.888  35.440  1.00  27.77 ? 152 GLN B O   1 
ATOM   2785 C  CB  . GLN B 1 153 ? 1.889   20.405  34.851  1.00  26.82 ? 152 GLN B CB  1 
ATOM   2786 C  CG  . GLN B 1 153 ? 0.381   20.070  34.863  1.00  25.68 ? 152 GLN B CG  1 
ATOM   2787 C  CD  . GLN B 1 153 ? -0.491  21.189  35.421  1.00  27.21 ? 152 GLN B CD  1 
ATOM   2788 O  OE1 . GLN B 1 153 ? -0.020  22.072  36.154  1.00  27.48 ? 152 GLN B OE1 1 
ATOM   2789 N  NE2 . GLN B 1 153 ? -1.776  21.147  35.095  1.00  29.08 ? 152 GLN B NE2 1 
ATOM   2790 N  N   . ASP B 1 154 ? 4.378   22.634  33.310  1.00  27.43 ? 153 ASP B N   1 
ATOM   2791 C  CA  . ASP B 1 154 ? 5.730   23.149  33.501  1.00  28.54 ? 153 ASP B CA  1 
ATOM   2792 C  C   . ASP B 1 154 ? 5.714   24.339  34.480  1.00  28.52 ? 153 ASP B C   1 
ATOM   2793 O  O   . ASP B 1 154 ? 4.720   25.059  34.600  1.00  28.52 ? 153 ASP B O   1 
ATOM   2794 C  CB  . ASP B 1 154 ? 6.362   23.558  32.163  1.00  28.96 ? 153 ASP B CB  1 
ATOM   2795 C  CG  . ASP B 1 154 ? 6.538   22.389  31.210  1.00  31.26 ? 153 ASP B CG  1 
ATOM   2796 O  OD1 . ASP B 1 154 ? 6.294   21.228  31.623  1.00  33.75 ? 153 ASP B OD1 1 
ATOM   2797 O  OD2 . ASP B 1 154 ? 6.923   22.636  30.041  1.00  34.26 ? 153 ASP B OD2 1 
ATOM   2798 N  N   . ASN B 1 155 ? 6.819   24.515  35.186  1.00  28.99 ? 154 ASN B N   1 
ATOM   2799 C  CA  . ASN B 1 155 ? 6.970   25.549  36.207  1.00  29.05 ? 154 ASN B CA  1 
ATOM   2800 C  C   . ASN B 1 155 ? 8.341   26.186  35.961  1.00  28.68 ? 154 ASN B C   1 
ATOM   2801 O  O   . ASN B 1 155 ? 9.290   25.467  35.664  1.00  28.99 ? 154 ASN B O   1 
ATOM   2802 C  CB  . ASN B 1 155 ? 6.877   24.873  37.591  1.00  29.58 ? 154 ASN B CB  1 
ATOM   2803 C  CG  . ASN B 1 155 ? 6.899   25.857  38.769  1.00  29.97 ? 154 ASN B CG  1 
ATOM   2804 O  OD1 . ASN B 1 155 ? 7.852   26.601  38.960  1.00  31.79 ? 154 ASN B OD1 1 
ATOM   2805 N  ND2 . ASN B 1 155 ? 5.847   25.816  39.596  1.00  31.93 ? 154 ASN B ND2 1 
ATOM   2806 N  N   . PRO B 1 156 ? 8.458   27.533  36.060  1.00  28.82 ? 155 PRO B N   1 
ATOM   2807 C  CA  . PRO B 1 156 ? 9.765   28.206  35.852  1.00  28.75 ? 155 PRO B CA  1 
ATOM   2808 C  C   . PRO B 1 156 ? 10.926  27.672  36.712  1.00  28.68 ? 155 PRO B C   1 
ATOM   2809 O  O   . PRO B 1 156 ? 12.093  27.804  36.312  1.00  28.76 ? 155 PRO B O   1 
ATOM   2810 C  CB  . PRO B 1 156 ? 9.469   29.675  36.193  1.00  28.63 ? 155 PRO B CB  1 
ATOM   2811 C  CG  . PRO B 1 156 ? 7.980   29.819  35.928  1.00  29.37 ? 155 PRO B CG  1 
ATOM   2812 C  CD  . PRO B 1 156 ? 7.385   28.503  36.358  1.00  28.49 ? 155 PRO B CD  1 
ATOM   2813 N  N   . LEU B 1 157 ? 10.619  27.091  37.873  1.00  29.24 ? 156 LEU B N   1 
ATOM   2814 C  CA  . LEU B 1 157 ? 11.630  26.417  38.717  1.00  29.76 ? 156 LEU B CA  1 
ATOM   2815 C  C   . LEU B 1 157 ? 12.306  25.240  38.009  1.00  29.86 ? 156 LEU B C   1 
ATOM   2816 O  O   . LEU B 1 157 ? 13.374  24.793  38.423  1.00  29.18 ? 156 LEU B O   1 
ATOM   2817 C  CB  . LEU B 1 157 ? 11.035  25.929  40.043  1.00  29.96 ? 156 LEU B CB  1 
ATOM   2818 C  CG  . LEU B 1 157 ? 10.639  26.975  41.096  1.00  31.53 ? 156 LEU B CG  1 
ATOM   2819 C  CD1 . LEU B 1 157 ? 9.809   26.335  42.222  1.00  33.35 ? 156 LEU B CD1 1 
ATOM   2820 C  CD2 . LEU B 1 157 ? 11.858  27.683  41.658  1.00  32.00 ? 156 LEU B CD2 1 
ATOM   2821 N  N   . MET B 1 158 ? 11.674  24.742  36.949  1.00  29.77 ? 157 MET B N   1 
ATOM   2822 C  CA  . MET B 1 158 ? 12.228  23.637  36.172  1.00  30.12 ? 157 MET B CA  1 
ATOM   2823 C  C   . MET B 1 158 ? 13.386  24.099  35.306  1.00  30.35 ? 157 MET B C   1 
ATOM   2824 O  O   . MET B 1 158 ? 14.148  23.276  34.814  1.00  30.80 ? 157 MET B O   1 
ATOM   2825 C  CB  . MET B 1 158 ? 11.160  23.002  35.286  1.00  29.75 ? 157 MET B CB  1 
ATOM   2826 C  CG  . MET B 1 158 ? 10.124  22.207  36.046  1.00  29.61 ? 157 MET B CG  1 
ATOM   2827 S  SD  . MET B 1 158 ? 8.887   21.601  34.889  1.00  30.42 ? 157 MET B SD  1 
ATOM   2828 C  CE  . MET B 1 158 ? 7.767   20.805  36.042  1.00  30.88 ? 157 MET B CE  1 
ATOM   2829 N  N   . GLY B 1 159 ? 13.491  25.409  35.101  1.00  30.35 ? 158 GLY B N   1 
ATOM   2830 C  CA  . GLY B 1 159 ? 14.608  25.989  34.373  1.00  31.08 ? 158 GLY B CA  1 
ATOM   2831 C  C   . GLY B 1 159 ? 14.335  26.178  32.896  1.00  31.08 ? 158 GLY B C   1 
ATOM   2832 O  O   . GLY B 1 159 ? 13.345  25.674  32.360  1.00  30.92 ? 158 GLY B O   1 
ATOM   2833 N  N   . GLU B 1 160 ? 15.243  26.900  32.247  1.00  31.68 ? 159 GLU B N   1 
ATOM   2834 C  CA  . GLU B 1 160 ? 15.125  27.304  30.849  1.00  32.49 ? 159 GLU B CA  1 
ATOM   2835 C  C   . GLU B 1 160 ? 14.908  26.124  29.908  1.00  32.11 ? 159 GLU B C   1 
ATOM   2836 O  O   . GLU B 1 160 ? 13.974  26.134  29.095  1.00  31.79 ? 159 GLU B O   1 
ATOM   2837 C  CB  . GLU B 1 160 ? 16.388  28.096  30.440  1.00  33.08 ? 159 GLU B CB  1 
ATOM   2838 C  CG  . GLU B 1 160 ? 16.280  28.892  29.133  1.00  37.21 ? 159 GLU B CG  1 
ATOM   2839 C  CD  . GLU B 1 160 ? 15.220  30.001  29.176  1.00  41.93 ? 159 GLU B CD  1 
ATOM   2840 O  OE1 . GLU B 1 160 ? 14.864  30.468  30.285  1.00  44.26 ? 159 GLU B OE1 1 
ATOM   2841 O  OE2 . GLU B 1 160 ? 14.750  30.411  28.089  1.00  43.74 ? 159 GLU B OE2 1 
ATOM   2842 N  N   . ALA B 1 161 ? 15.769  25.112  30.014  1.00  31.59 ? 160 ALA B N   1 
ATOM   2843 C  CA  . ALA B 1 161 ? 15.764  24.005  29.055  1.00  31.73 ? 160 ALA B CA  1 
ATOM   2844 C  C   . ALA B 1 161 ? 14.418  23.282  29.011  1.00  31.36 ? 160 ALA B C   1 
ATOM   2845 O  O   . ALA B 1 161 ? 13.911  22.978  27.931  1.00  31.04 ? 160 ALA B O   1 
ATOM   2846 C  CB  . ALA B 1 161 ? 16.903  23.023  29.336  1.00  31.84 ? 160 ALA B CB  1 
ATOM   2847 N  N   . ILE B 1 162 ? 13.832  23.031  30.180  1.00  31.08 ? 161 ILE B N   1 
ATOM   2848 C  CA  . ILE B 1 162 ? 12.563  22.298  30.250  1.00  31.04 ? 161 ILE B CA  1 
ATOM   2849 C  C   . ILE B 1 162 ? 11.348  23.212  30.065  1.00  31.20 ? 161 ILE B C   1 
ATOM   2850 O  O   . ILE B 1 162 ? 10.495  22.954  29.203  1.00  31.64 ? 161 ILE B O   1 
ATOM   2851 C  CB  . ILE B 1 162 ? 12.464  21.453  31.554  1.00  31.00 ? 161 ILE B CB  1 
ATOM   2852 C  CG1 . ILE B 1 162 ? 13.601  20.422  31.588  1.00  30.58 ? 161 ILE B CG1 1 
ATOM   2853 C  CG2 . ILE B 1 162 ? 11.114  20.766  31.659  1.00  30.91 ? 161 ILE B CG2 1 
ATOM   2854 C  CD1 . ILE B 1 162 ? 13.702  19.662  32.893  1.00  30.89 ? 161 ILE B CD1 1 
ATOM   2855 N  N   . ALA B 1 163 ? 11.286  24.289  30.843  1.00  30.88 ? 162 ALA B N   1 
ATOM   2856 C  CA  . ALA B 1 163 ? 10.085  25.134  30.913  1.00  30.89 ? 162 ALA B CA  1 
ATOM   2857 C  C   . ALA B 1 163 ? 10.030  26.263  29.888  1.00  31.13 ? 162 ALA B C   1 
ATOM   2858 O  O   . ALA B 1 163 ? 8.958   26.831  29.649  1.00  31.34 ? 162 ALA B O   1 
ATOM   2859 C  CB  . ALA B 1 163 ? 9.920   25.703  32.320  1.00  30.90 ? 162 ALA B CB  1 
ATOM   2860 N  N   . GLY B 1 164 ? 11.176  26.611  29.308  1.00  30.79 ? 163 GLY B N   1 
ATOM   2861 C  CA  . GLY B 1 164 ? 11.243  27.684  28.312  1.00  30.98 ? 163 GLY B CA  1 
ATOM   2862 C  C   . GLY B 1 164 ? 11.531  29.047  28.924  1.00  31.24 ? 163 GLY B C   1 
ATOM   2863 O  O   . GLY B 1 164 ? 11.867  30.000  28.212  1.00  30.69 ? 163 GLY B O   1 
ATOM   2864 N  N   . VAL B 1 165 ? 11.388  29.125  30.247  1.00  31.23 ? 164 VAL B N   1 
ATOM   2865 C  CA  . VAL B 1 165 ? 11.592  30.335  31.044  1.00  31.90 ? 164 VAL B CA  1 
ATOM   2866 C  C   . VAL B 1 165 ? 12.134  29.884  32.403  1.00  32.40 ? 164 VAL B C   1 
ATOM   2867 O  O   . VAL B 1 165 ? 12.120  28.693  32.713  1.00  32.36 ? 164 VAL B O   1 
ATOM   2868 C  CB  . VAL B 1 165 ? 10.268  31.120  31.263  1.00  32.34 ? 164 VAL B CB  1 
ATOM   2869 C  CG1 . VAL B 1 165 ? 9.717   31.658  29.941  1.00  32.39 ? 164 VAL B CG1 1 
ATOM   2870 C  CG2 . VAL B 1 165 ? 9.220   30.246  31.963  1.00  31.68 ? 164 VAL B CG2 1 
ATOM   2871 N  N   . SER B 1 166 ? 12.612  30.831  33.209  1.00  32.80 ? 165 SER B N   1 
ATOM   2872 C  CA  . SER B 1 166 ? 13.100  30.507  34.549  1.00  32.97 ? 165 SER B CA  1 
ATOM   2873 C  C   . SER B 1 166 ? 12.759  31.581  35.588  1.00  32.89 ? 165 SER B C   1 
ATOM   2874 O  O   . SER B 1 166 ? 12.112  32.582  35.269  1.00  33.04 ? 165 SER B O   1 
ATOM   2875 C  CB  . SER B 1 166 ? 14.606  30.238  34.510  1.00  33.45 ? 165 SER B CB  1 
ATOM   2876 O  OG  . SER B 1 166 ? 15.315  31.375  34.065  1.00  33.67 ? 165 SER B OG  1 
ATOM   2877 N  N   . GLY B 1 167 ? 13.189  31.355  36.828  1.00  32.53 ? 166 GLY B N   1 
ATOM   2878 C  CA  . GLY B 1 167 ? 12.878  32.248  37.940  1.00  32.50 ? 166 GLY B CA  1 
ATOM   2879 C  C   . GLY B 1 167 ? 12.010  31.565  38.979  1.00  32.25 ? 166 GLY B C   1 
ATOM   2880 O  O   . GLY B 1 167 ? 11.478  30.478  38.743  1.00  32.37 ? 166 GLY B O   1 
ATOM   2881 N  N   . THR B 1 168 ? 11.871  32.205  40.135  1.00  32.00 ? 167 THR B N   1 
ATOM   2882 C  CA  . THR B 1 168 ? 11.087  31.648  41.240  1.00  32.04 ? 167 THR B CA  1 
ATOM   2883 C  C   . THR B 1 168 ? 9.676   32.231  41.240  1.00  31.27 ? 167 THR B C   1 
ATOM   2884 O  O   . THR B 1 168 ? 9.518   33.427  41.489  1.00  31.08 ? 167 THR B O   1 
ATOM   2885 C  CB  . THR B 1 168 ? 11.748  31.946  42.601  1.00  32.22 ? 167 THR B CB  1 
ATOM   2886 O  OG1 . THR B 1 168 ? 13.065  31.384  42.628  1.00  33.88 ? 167 THR B OG1 1 
ATOM   2887 C  CG2 . THR B 1 168 ? 10.914  31.364  43.746  1.00  32.39 ? 167 THR B CG2 1 
ATOM   2888 N  N   . PRO B 1 169 ? 8.648   31.389  40.996  1.00  30.97 ? 168 PRO B N   1 
ATOM   2889 C  CA  . PRO B 1 169 ? 7.287   31.949  40.965  1.00  30.62 ? 168 PRO B CA  1 
ATOM   2890 C  C   . PRO B 1 169 ? 6.798   32.367  42.354  1.00  30.32 ? 168 PRO B C   1 
ATOM   2891 O  O   . PRO B 1 169 ? 7.057   31.669  43.344  1.00  30.38 ? 168 PRO B O   1 
ATOM   2892 C  CB  . PRO B 1 169 ? 6.426   30.801  40.421  1.00  30.85 ? 168 PRO B CB  1 
ATOM   2893 C  CG  . PRO B 1 169 ? 7.372   29.685  40.052  1.00  31.47 ? 168 PRO B CG  1 
ATOM   2894 C  CD  . PRO B 1 169 ? 8.647   29.927  40.793  1.00  30.69 ? 168 PRO B CD  1 
ATOM   2895 N  N   . ILE B 1 170 ? 6.134   33.517  42.430  1.00  29.04 ? 169 ILE B N   1 
ATOM   2896 C  CA  . ILE B 1 170 ? 5.529   33.965  43.686  1.00  28.87 ? 169 ILE B CA  1 
ATOM   2897 C  C   . ILE B 1 170 ? 4.013   34.106  43.536  1.00  29.03 ? 169 ILE B C   1 
ATOM   2898 O  O   . ILE B 1 170 ? 3.281   34.202  44.526  1.00  29.14 ? 169 ILE B O   1 
ATOM   2899 C  CB  . ILE B 1 170 ? 6.161   35.274  44.202  1.00  28.74 ? 169 ILE B CB  1 
ATOM   2900 C  CG1 . ILE B 1 170 ? 5.982   36.406  43.186  1.00  27.96 ? 169 ILE B CG1 1 
ATOM   2901 C  CG2 . ILE B 1 170 ? 7.643   35.044  44.533  1.00  28.37 ? 169 ILE B CG2 1 
ATOM   2902 C  CD1 . ILE B 1 170 ? 6.469   37.775  43.686  1.00  27.76 ? 169 ILE B CD1 1 
ATOM   2903 N  N   . LEU B 1 171 ? 3.565   34.108  42.284  1.00  28.75 ? 170 LEU B N   1 
ATOM   2904 C  CA  . LEU B 1 171 ? 2.147   34.098  41.938  1.00  29.07 ? 170 LEU B CA  1 
ATOM   2905 C  C   . LEU B 1 171 ? 1.975   33.369  40.609  1.00  28.89 ? 170 LEU B C   1 
ATOM   2906 O  O   . LEU B 1 171 ? 2.812   33.494  39.717  1.00  29.09 ? 170 LEU B O   1 
ATOM   2907 C  CB  . LEU B 1 171 ? 1.590   35.529  41.840  1.00  28.96 ? 170 LEU B CB  1 
ATOM   2908 C  CG  . LEU B 1 171 ? 0.135   35.681  41.367  1.00  29.65 ? 170 LEU B CG  1 
ATOM   2909 C  CD1 . LEU B 1 171 ? -0.835  35.105  42.381  1.00  30.69 ? 170 LEU B CD1 1 
ATOM   2910 C  CD2 . LEU B 1 171 ? -0.200  37.133  41.093  1.00  29.30 ? 170 LEU B CD2 1 
ATOM   2911 N  N   . GLY B 1 172 ? 0.895   32.596  40.490  1.00  29.21 ? 171 GLY B N   1 
ATOM   2912 C  CA  . GLY B 1 172 ? 0.554   31.949  39.220  1.00  28.64 ? 171 GLY B CA  1 
ATOM   2913 C  C   . GLY B 1 172 ? -0.940  31.799  39.070  1.00  28.72 ? 171 GLY B C   1 
ATOM   2914 O  O   . GLY B 1 172 ? -1.654  31.716  40.065  1.00  29.24 ? 171 GLY B O   1 
ATOM   2915 N  N   . VAL B 1 173 ? -1.414  31.783  37.824  1.00  28.22 ? 172 VAL B N   1 
ATOM   2916 C  CA  . VAL B 1 173 ? -2.813  31.501  37.537  1.00  27.84 ? 172 VAL B CA  1 
ATOM   2917 C  C   . VAL B 1 173 ? -2.901  30.325  36.557  1.00  27.57 ? 172 VAL B C   1 
ATOM   2918 O  O   . VAL B 1 173 ? -2.146  30.246  35.595  1.00  27.40 ? 172 VAL B O   1 
ATOM   2919 C  CB  . VAL B 1 173 ? -3.578  32.752  37.005  1.00  27.73 ? 172 VAL B CB  1 
ATOM   2920 C  CG1 . VAL B 1 173 ? -3.025  33.213  35.631  1.00  28.56 ? 172 VAL B CG1 1 
ATOM   2921 C  CG2 . VAL B 1 173 ? -5.079  32.471  36.918  1.00  29.34 ? 172 VAL B CG2 1 
ATOM   2922 N  N   . ASP B 1 174 ? -3.815  29.407  36.842  1.00  27.79 ? 173 ASP B N   1 
ATOM   2923 C  CA  . ASP B 1 174 ? -4.062  28.245  36.023  1.00  27.70 ? 173 ASP B CA  1 
ATOM   2924 C  C   . ASP B 1 174 ? -4.957  28.675  34.854  1.00  27.97 ? 173 ASP B C   1 
ATOM   2925 O  O   . ASP B 1 174 ? -6.065  29.165  35.083  1.00  27.76 ? 173 ASP B O   1 
ATOM   2926 C  CB  . ASP B 1 174 ? -4.773  27.200  36.893  1.00  28.45 ? 173 ASP B CB  1 
ATOM   2927 C  CG  . ASP B 1 174 ? -4.817  25.837  36.266  1.00  27.56 ? 173 ASP B CG  1 
ATOM   2928 O  OD1 . ASP B 1 174 ? -4.369  25.677  35.111  1.00  26.92 ? 173 ASP B OD1 1 
ATOM   2929 O  OD2 . ASP B 1 174 ? -5.336  24.905  36.942  1.00  29.05 ? 173 ASP B OD2 1 
ATOM   2930 N  N   . VAL B 1 175 ? -4.472  28.522  33.619  1.00  27.32 ? 174 VAL B N   1 
ATOM   2931 C  CA  . VAL B 1 175 ? -5.308  28.761  32.433  1.00  28.06 ? 174 VAL B CA  1 
ATOM   2932 C  C   . VAL B 1 175 ? -5.588  27.483  31.624  1.00  27.70 ? 174 VAL B C   1 
ATOM   2933 O  O   . VAL B 1 175 ? -5.919  27.534  30.441  1.00  27.45 ? 174 VAL B O   1 
ATOM   2934 C  CB  . VAL B 1 175 ? -4.791  29.914  31.507  1.00  27.99 ? 174 VAL B CB  1 
ATOM   2935 C  CG1 . VAL B 1 175 ? -4.865  31.251  32.226  1.00  28.69 ? 174 VAL B CG1 1 
ATOM   2936 C  CG2 . VAL B 1 175 ? -3.372  29.628  30.982  1.00  28.79 ? 174 VAL B CG2 1 
ATOM   2937 N  N   . TRP B 1 176 ? -5.474  26.325  32.269  1.00  27.91 ? 175 TRP B N   1 
ATOM   2938 C  CA  . TRP B 1 176 ? -6.082  25.132  31.693  1.00  26.94 ? 175 TRP B CA  1 
ATOM   2939 C  C   . TRP B 1 176 ? -7.589  25.398  31.675  1.00  27.01 ? 175 TRP B C   1 
ATOM   2940 O  O   . TRP B 1 176 ? -8.117  26.041  32.582  1.00  26.19 ? 175 TRP B O   1 
ATOM   2941 C  CB  . TRP B 1 176 ? -5.801  23.894  32.542  1.00  27.09 ? 175 TRP B CB  1 
ATOM   2942 C  CG  . TRP B 1 176 ? -4.407  23.301  32.424  1.00  26.56 ? 175 TRP B CG  1 
ATOM   2943 C  CD1 . TRP B 1 176 ? -3.222  23.917  32.674  1.00  27.61 ? 175 TRP B CD1 1 
ATOM   2944 C  CD2 . TRP B 1 176 ? -4.089  21.935  32.095  1.00  27.73 ? 175 TRP B CD2 1 
ATOM   2945 N  NE1 . TRP B 1 176 ? -2.176  23.033  32.494  1.00  27.71 ? 175 TRP B NE1 1 
ATOM   2946 C  CE2 . TRP B 1 176 ? -2.683  21.810  32.137  1.00  28.01 ? 175 TRP B CE2 1 
ATOM   2947 C  CE3 . TRP B 1 176 ? -4.857  20.818  31.731  1.00  26.69 ? 175 TRP B CE3 1 
ATOM   2948 C  CZ2 . TRP B 1 176 ? -2.025  20.599  31.857  1.00  28.11 ? 175 TRP B CZ2 1 
ATOM   2949 C  CZ3 . TRP B 1 176 ? -4.205  19.608  31.454  1.00  27.84 ? 175 TRP B CZ3 1 
ATOM   2950 C  CH2 . TRP B 1 176 ? -2.795  19.515  31.517  1.00  26.00 ? 175 TRP B CH2 1 
ATOM   2951 N  N   . GLU B 1 177 ? -8.274  24.915  30.640  1.00  26.98 ? 176 GLU B N   1 
ATOM   2952 C  CA  . GLU B 1 177 ? -9.721  25.124  30.539  1.00  27.40 ? 176 GLU B CA  1 
ATOM   2953 C  C   . GLU B 1 177 ? -10.490 24.577  31.741  1.00  27.28 ? 176 GLU B C   1 
ATOM   2954 O  O   . GLU B 1 177 ? -11.522 25.139  32.114  1.00  27.83 ? 176 GLU B O   1 
ATOM   2955 C  CB  . GLU B 1 177 ? -10.267 24.618  29.195  1.00  27.28 ? 176 GLU B CB  1 
ATOM   2956 C  CG  . GLU B 1 177 ? -9.932  25.606  28.055  1.00  27.58 ? 176 GLU B CG  1 
ATOM   2957 C  CD  . GLU B 1 177 ? -10.136 25.074  26.648  1.00  28.36 ? 176 GLU B CD  1 
ATOM   2958 O  OE1 . GLU B 1 177 ? -10.073 23.827  26.431  1.00  26.99 ? 176 GLU B OE1 1 
ATOM   2959 O  OE2 . GLU B 1 177 ? -10.324 25.930  25.737  1.00  28.48 ? 176 GLU B OE2 1 
ATOM   2960 N  N   . HIS B 1 178 ? -9.987  23.512  32.368  1.00  27.24 ? 177 HIS B N   1 
ATOM   2961 C  CA  . HIS B 1 178 ? -10.634 22.992  33.577  1.00  27.31 ? 177 HIS B CA  1 
ATOM   2962 C  C   . HIS B 1 178 ? -10.759 24.015  34.702  1.00  27.39 ? 177 HIS B C   1 
ATOM   2963 O  O   . HIS B 1 178 ? -11.693 23.940  35.503  1.00  27.60 ? 177 HIS B O   1 
ATOM   2964 C  CB  . HIS B 1 178 ? -10.064 21.646  34.066  1.00  27.01 ? 177 HIS B CB  1 
ATOM   2965 C  CG  . HIS B 1 178 ? -8.654  21.696  34.561  1.00  27.64 ? 177 HIS B CG  1 
ATOM   2966 N  ND1 . HIS B 1 178 ? -7.642  20.982  33.960  1.00  29.64 ? 177 HIS B ND1 1 
ATOM   2967 C  CD2 . HIS B 1 178 ? -8.088  22.336  35.616  1.00  29.20 ? 177 HIS B CD2 1 
ATOM   2968 C  CE1 . HIS B 1 178 ? -6.508  21.193  34.610  1.00  28.87 ? 177 HIS B CE1 1 
ATOM   2969 N  NE2 . HIS B 1 178 ? -6.752  22.019  35.611  1.00  28.24 ? 177 HIS B NE2 1 
ATOM   2970 N  N   . ALA B 1 179 ? -9.876  25.007  34.712  1.00  26.94 ? 178 ALA B N   1 
ATOM   2971 C  CA  . ALA B 1 179 ? -9.858  25.998  35.780  1.00  27.23 ? 178 ALA B CA  1 
ATOM   2972 C  C   . ALA B 1 179 ? -11.021 27.001  35.679  1.00  27.17 ? 178 ALA B C   1 
ATOM   2973 O  O   . ALA B 1 179 ? -11.378 27.653  36.671  1.00  27.70 ? 178 ALA B O   1 
ATOM   2974 C  CB  . ALA B 1 179 ? -8.504  26.717  35.813  1.00  27.16 ? 178 ALA B CB  1 
ATOM   2975 N  N   . TYR B 1 180 ? -11.611 27.117  34.491  1.00  26.73 ? 179 TYR B N   1 
ATOM   2976 C  CA  . TYR B 1 180 ? -12.579 28.191  34.209  1.00  26.65 ? 179 TYR B CA  1 
ATOM   2977 C  C   . TYR B 1 180 ? -13.774 27.816  33.341  1.00  25.89 ? 179 TYR B C   1 
ATOM   2978 O  O   . TYR B 1 180 ? -14.702 28.624  33.193  1.00  25.54 ? 179 TYR B O   1 
ATOM   2979 C  CB  . TYR B 1 180 ? -11.869 29.435  33.626  1.00  27.18 ? 179 TYR B CB  1 
ATOM   2980 C  CG  . TYR B 1 180 ? -11.201 29.277  32.258  1.00  27.02 ? 179 TYR B CG  1 
ATOM   2981 C  CD1 . TYR B 1 180 ? -11.944 29.387  31.077  1.00  26.87 ? 179 TYR B CD1 1 
ATOM   2982 C  CD2 . TYR B 1 180 ? -9.824  29.073  32.152  1.00  26.43 ? 179 TYR B CD2 1 
ATOM   2983 C  CE1 . TYR B 1 180 ? -11.343 29.264  29.828  1.00  28.06 ? 179 TYR B CE1 1 
ATOM   2984 C  CE2 . TYR B 1 180 ? -9.205  28.962  30.906  1.00  27.14 ? 179 TYR B CE2 1 
ATOM   2985 C  CZ  . TYR B 1 180 ? -9.974  29.056  29.753  1.00  27.45 ? 179 TYR B CZ  1 
ATOM   2986 O  OH  . TYR B 1 180 ? -9.364  28.933  28.531  1.00  29.16 ? 179 TYR B OH  1 
ATOM   2987 N  N   . TYR B 1 181 ? -13.780 26.612  32.765  1.00  25.24 ? 180 TYR B N   1 
ATOM   2988 C  CA  . TYR B 1 181 ? -14.799 26.317  31.746  1.00  25.00 ? 180 TYR B CA  1 
ATOM   2989 C  C   . TYR B 1 181 ? -16.228 26.260  32.289  1.00  25.36 ? 180 TYR B C   1 
ATOM   2990 O  O   . TYR B 1 181 ? -17.167 26.723  31.640  1.00  25.13 ? 180 TYR B O   1 
ATOM   2991 C  CB  . TYR B 1 181 ? -14.487 25.069  30.914  1.00  24.90 ? 180 TYR B CB  1 
ATOM   2992 C  CG  . TYR B 1 181 ? -14.920 25.273  29.467  1.00  25.24 ? 180 TYR B CG  1 
ATOM   2993 C  CD1 . TYR B 1 181 ? -14.157 26.066  28.612  1.00  25.91 ? 180 TYR B CD1 1 
ATOM   2994 C  CD2 . TYR B 1 181 ? -16.107 24.722  28.974  1.00  24.37 ? 180 TYR B CD2 1 
ATOM   2995 C  CE1 . TYR B 1 181 ? -14.548 26.294  27.302  1.00  24.48 ? 180 TYR B CE1 1 
ATOM   2996 C  CE2 . TYR B 1 181 ? -16.510 24.940  27.648  1.00  23.47 ? 180 TYR B CE2 1 
ATOM   2997 C  CZ  . TYR B 1 181 ? -15.707 25.739  26.824  1.00  25.08 ? 180 TYR B CZ  1 
ATOM   2998 O  OH  . TYR B 1 181 ? -16.059 25.996  25.519  1.00  25.65 ? 180 TYR B OH  1 
ATOM   2999 N  N   . LEU B 1 182 ? -16.391 25.696  33.477  1.00  25.54 ? 181 LEU B N   1 
ATOM   3000 C  CA  . LEU B 1 182 ? -17.742 25.561  34.045  1.00  26.22 ? 181 LEU B CA  1 
ATOM   3001 C  C   . LEU B 1 182 ? -18.459 26.899  34.263  1.00  26.79 ? 181 LEU B C   1 
ATOM   3002 O  O   . LEU B 1 182 ? -19.673 26.994  34.058  1.00  26.90 ? 181 LEU B O   1 
ATOM   3003 C  CB  . LEU B 1 182 ? -17.719 24.735  35.337  1.00  26.27 ? 181 LEU B CB  1 
ATOM   3004 C  CG  . LEU B 1 182 ? -17.447 23.231  35.180  1.00  27.18 ? 181 LEU B CG  1 
ATOM   3005 C  CD1 . LEU B 1 182 ? -17.659 22.492  36.498  1.00  26.68 ? 181 LEU B CD1 1 
ATOM   3006 C  CD2 . LEU B 1 182 ? -18.266 22.584  34.070  1.00  24.67 ? 181 LEU B CD2 1 
ATOM   3007 N  N   . ASN B 1 183 ? -17.707 27.919  34.673  1.00  27.31 ? 182 ASN B N   1 
ATOM   3008 C  CA  . ASN B 1 183 ? -18.262 29.241  34.994  1.00  27.78 ? 182 ASN B CA  1 
ATOM   3009 C  C   . ASN B 1 183 ? -18.160 30.252  33.845  1.00  27.78 ? 182 ASN B C   1 
ATOM   3010 O  O   . ASN B 1 183 ? -19.035 31.127  33.693  1.00  28.16 ? 182 ASN B O   1 
ATOM   3011 C  CB  . ASN B 1 183 ? -17.563 29.801  36.238  1.00  28.14 ? 182 ASN B CB  1 
ATOM   3012 C  CG  . ASN B 1 183 ? -18.404 30.812  36.995  1.00  30.51 ? 182 ASN B CG  1 
ATOM   3013 O  OD1 . ASN B 1 183 ? -19.630 30.816  36.914  1.00  32.09 ? 182 ASN B OD1 1 
ATOM   3014 N  ND2 . ASN B 1 183 ? -17.737 31.665  37.766  1.00  33.70 ? 182 ASN B ND2 1 
ATOM   3015 N  N   . TYR B 1 184 ? -17.100 30.129  33.042  1.00  27.07 ? 183 TYR B N   1 
ATOM   3016 C  CA  . TYR B 1 184 ? -16.758 31.141  32.034  1.00  26.91 ? 183 TYR B CA  1 
ATOM   3017 C  C   . TYR B 1 184 ? -16.759 30.615  30.610  1.00  26.45 ? 183 TYR B C   1 
ATOM   3018 O  O   . TYR B 1 184 ? -16.715 31.394  29.660  1.00  25.81 ? 183 TYR B O   1 
ATOM   3019 C  CB  . TYR B 1 184 ? -15.395 31.765  32.333  1.00  27.24 ? 183 TYR B CB  1 
ATOM   3020 C  CG  . TYR B 1 184 ? -15.350 32.492  33.657  1.00  27.63 ? 183 TYR B CG  1 
ATOM   3021 C  CD1 . TYR B 1 184 ? -14.885 31.854  34.801  1.00  27.94 ? 183 TYR B CD1 1 
ATOM   3022 C  CD2 . TYR B 1 184 ? -15.788 33.809  33.764  1.00  27.37 ? 183 TYR B CD2 1 
ATOM   3023 C  CE1 . TYR B 1 184 ? -14.843 32.516  36.020  1.00  28.99 ? 183 TYR B CE1 1 
ATOM   3024 C  CE2 . TYR B 1 184 ? -15.757 34.477  34.977  1.00  28.02 ? 183 TYR B CE2 1 
ATOM   3025 C  CZ  . TYR B 1 184 ? -15.286 33.828  36.097  1.00  28.09 ? 183 TYR B CZ  1 
ATOM   3026 O  OH  . TYR B 1 184 ? -15.254 34.483  37.304  1.00  28.49 ? 183 TYR B OH  1 
ATOM   3027 N  N   . GLN B 1 185 ? -16.807 29.295  30.460  1.00  26.32 ? 184 GLN B N   1 
ATOM   3028 C  CA  . GLN B 1 185 ? -16.691 28.678  29.141  1.00  26.65 ? 184 GLN B CA  1 
ATOM   3029 C  C   . GLN B 1 185 ? -15.492 29.272  28.388  1.00  26.61 ? 184 GLN B C   1 
ATOM   3030 O  O   . GLN B 1 185 ? -14.395 29.294  28.935  1.00  26.95 ? 184 GLN B O   1 
ATOM   3031 C  CB  . GLN B 1 185 ? -18.009 28.765  28.351  1.00  26.78 ? 184 GLN B CB  1 
ATOM   3032 C  CG  . GLN B 1 185 ? -19.176 28.028  29.003  1.00  27.13 ? 184 GLN B CG  1 
ATOM   3033 C  CD  . GLN B 1 185 ? -19.847 28.871  30.067  1.00  28.07 ? 184 GLN B CD  1 
ATOM   3034 O  OE1 . GLN B 1 185 ? -20.242 30.003  29.803  1.00  28.39 ? 184 GLN B OE1 1 
ATOM   3035 N  NE2 . GLN B 1 185 ? -19.946 28.338  31.283  1.00  26.55 ? 184 GLN B NE2 1 
ATOM   3036 N  N   . ASN B 1 186 ? -15.692 29.759  27.163  1.00  26.67 ? 185 ASN B N   1 
ATOM   3037 C  CA  . ASN B 1 186 ? -14.593 30.315  26.349  1.00  26.87 ? 185 ASN B CA  1 
ATOM   3038 C  C   . ASN B 1 186 ? -13.984 31.625  26.865  1.00  27.00 ? 185 ASN B C   1 
ATOM   3039 O  O   . ASN B 1 186 ? -12.938 32.060  26.380  1.00  27.46 ? 185 ASN B O   1 
ATOM   3040 C  CB  . ASN B 1 186 ? -15.080 30.548  24.912  1.00  26.79 ? 185 ASN B CB  1 
ATOM   3041 C  CG  . ASN B 1 186 ? -16.307 31.420  24.860  1.00  26.55 ? 185 ASN B CG  1 
ATOM   3042 O  OD1 . ASN B 1 186 ? -17.404 30.980  25.214  1.00  25.97 ? 185 ASN B OD1 1 
ATOM   3043 N  ND2 . ASN B 1 186 ? -16.141 32.663  24.410  1.00  27.24 ? 185 ASN B ND2 1 
ATOM   3044 N  N   . ARG B 1 187 ? -14.636 32.254  27.840  1.00  27.54 ? 186 ARG B N   1 
ATOM   3045 C  CA  . ARG B 1 187 ? -14.291 33.621  28.253  1.00  27.53 ? 186 ARG B CA  1 
ATOM   3046 C  C   . ARG B 1 187 ? -13.138 33.671  29.257  1.00  27.41 ? 186 ARG B C   1 
ATOM   3047 O  O   . ARG B 1 187 ? -13.303 34.110  30.392  1.00  26.78 ? 186 ARG B O   1 
ATOM   3048 C  CB  . ARG B 1 187 ? -15.534 34.352  28.775  1.00  27.23 ? 186 ARG B CB  1 
ATOM   3049 C  CG  . ARG B 1 187 ? -16.698 34.351  27.780  1.00  27.64 ? 186 ARG B CG  1 
ATOM   3050 C  CD  . ARG B 1 187 ? -17.936 35.095  28.281  1.00  29.30 ? 186 ARG B CD  1 
ATOM   3051 N  NE  . ARG B 1 187 ? -18.333 34.712  29.637  1.00  34.94 ? 186 ARG B NE  1 
ATOM   3052 C  CZ  . ARG B 1 187 ? -19.153 33.704  29.934  1.00  36.68 ? 186 ARG B CZ  1 
ATOM   3053 N  NH1 . ARG B 1 187 ? -19.683 32.954  28.971  1.00  38.53 ? 186 ARG B NH1 1 
ATOM   3054 N  NH2 . ARG B 1 187 ? -19.444 33.446  31.204  1.00  37.81 ? 186 ARG B NH2 1 
ATOM   3055 N  N   . ARG B 1 188 ? -11.962 33.224  28.815  1.00  27.44 ? 187 ARG B N   1 
ATOM   3056 C  CA  . ARG B 1 188 ? -10.774 33.243  29.657  1.00  28.11 ? 187 ARG B CA  1 
ATOM   3057 C  C   . ARG B 1 188 ? -10.462 34.645  30.195  1.00  28.12 ? 187 ARG B C   1 
ATOM   3058 O  O   . ARG B 1 188 ? -10.113 34.771  31.368  1.00  28.67 ? 187 ARG B O   1 
ATOM   3059 C  CB  . ARG B 1 188 ? -9.552  32.643  28.934  1.00  27.81 ? 187 ARG B CB  1 
ATOM   3060 C  CG  . ARG B 1 188 ? -8.344  32.423  29.849  1.00  28.41 ? 187 ARG B CG  1 
ATOM   3061 C  CD  . ARG B 1 188 ? -7.049  32.188  29.059  1.00  28.72 ? 187 ARG B CD  1 
ATOM   3062 N  NE  . ARG B 1 188 ? -6.994  30.863  28.438  1.00  29.64 ? 187 ARG B NE  1 
ATOM   3063 C  CZ  . ARG B 1 188 ? -5.926  30.367  27.811  1.00  30.27 ? 187 ARG B CZ  1 
ATOM   3064 N  NH1 . ARG B 1 188 ? -4.810  31.085  27.718  1.00  28.52 ? 187 ARG B NH1 1 
ATOM   3065 N  NH2 . ARG B 1 188 ? -5.975  29.148  27.266  1.00  30.08 ? 187 ARG B NH2 1 
ATOM   3066 N  N   . PRO B 1 189 ? -10.581 35.700  29.352  1.00  28.50 ? 188 PRO B N   1 
ATOM   3067 C  CA  . PRO B 1 189 ? -10.336 37.052  29.891  1.00  28.58 ? 188 PRO B CA  1 
ATOM   3068 C  C   . PRO B 1 189 ? -11.239 37.469  31.066  1.00  28.93 ? 188 PRO B C   1 
ATOM   3069 O  O   . PRO B 1 189 ? -10.786 38.209  31.932  1.00  28.85 ? 188 PRO B O   1 
ATOM   3070 C  CB  . PRO B 1 189 ? -10.550 37.964  28.678  1.00  28.55 ? 188 PRO B CB  1 
ATOM   3071 C  CG  . PRO B 1 189 ? -10.309 37.067  27.485  1.00  28.93 ? 188 PRO B CG  1 
ATOM   3072 C  CD  . PRO B 1 189 ? -10.886 35.747  27.907  1.00  28.38 ? 188 PRO B CD  1 
ATOM   3073 N  N   . ASP B 1 190 ? -12.484 36.989  31.100  1.00  29.19 ? 189 ASP B N   1 
ATOM   3074 C  CA  . ASP B 1 190 ? -13.393 37.255  32.229  1.00  29.43 ? 189 ASP B CA  1 
ATOM   3075 C  C   . ASP B 1 190 ? -12.961 36.528  33.496  1.00  29.08 ? 189 ASP B C   1 
ATOM   3076 O  O   . ASP B 1 190 ? -13.061 37.068  34.597  1.00  28.43 ? 189 ASP B O   1 
ATOM   3077 C  CB  . ASP B 1 190 ? -14.832 36.869  31.884  1.00  29.75 ? 189 ASP B CB  1 
ATOM   3078 C  CG  . ASP B 1 190 ? -15.441 37.774  30.846  1.00  31.61 ? 189 ASP B CG  1 
ATOM   3079 O  OD1 . ASP B 1 190 ? -14.902 38.883  30.640  1.00  36.05 ? 189 ASP B OD1 1 
ATOM   3080 O  OD2 . ASP B 1 190 ? -16.467 37.386  30.243  1.00  32.48 ? 189 ASP B OD2 1 
ATOM   3081 N  N   . TYR B 1 191 ? -12.507 35.289  33.329  1.00  28.49 ? 190 TYR B N   1 
ATOM   3082 C  CA  . TYR B 1 191 ? -11.900 34.527  34.416  1.00  28.39 ? 190 TYR B CA  1 
ATOM   3083 C  C   . TYR B 1 191 ? -10.688 35.260  34.978  1.00  28.44 ? 190 TYR B C   1 
ATOM   3084 O  O   . TYR B 1 191 ? -10.528 35.363  36.199  1.00  28.35 ? 190 TYR B O   1 
ATOM   3085 C  CB  . TYR B 1 191 ? -11.504 33.138  33.904  1.00  28.08 ? 190 TYR B CB  1 
ATOM   3086 C  CG  . TYR B 1 191 ? -10.527 32.354  34.754  1.00  27.62 ? 190 TYR B CG  1 
ATOM   3087 C  CD1 . TYR B 1 191 ? -10.841 31.963  36.059  1.00  28.11 ? 190 TYR B CD1 1 
ATOM   3088 C  CD2 . TYR B 1 191 ? -9.305  31.952  34.223  1.00  28.13 ? 190 TYR B CD2 1 
ATOM   3089 C  CE1 . TYR B 1 191 ? -9.937  31.205  36.823  1.00  28.62 ? 190 TYR B CE1 1 
ATOM   3090 C  CE2 . TYR B 1 191 ? -8.405  31.207  34.974  1.00  29.44 ? 190 TYR B CE2 1 
ATOM   3091 C  CZ  . TYR B 1 191 ? -8.727  30.831  36.264  1.00  28.60 ? 190 TYR B CZ  1 
ATOM   3092 O  OH  . TYR B 1 191 ? -7.816  30.086  36.981  1.00  28.29 ? 190 TYR B OH  1 
ATOM   3093 N  N   . LEU B 1 192 ? -9.843  35.768  34.083  1.00  28.43 ? 191 LEU B N   1 
ATOM   3094 C  CA  . LEU B 1 192 ? -8.599  36.425  34.488  1.00  28.95 ? 191 LEU B CA  1 
ATOM   3095 C  C   . LEU B 1 192 ? -8.837  37.747  35.211  1.00  29.06 ? 191 LEU B C   1 
ATOM   3096 O  O   . LEU B 1 192 ? -8.106  38.095  36.138  1.00  28.63 ? 191 LEU B O   1 
ATOM   3097 C  CB  . LEU B 1 192 ? -7.675  36.628  33.285  1.00  29.06 ? 191 LEU B CB  1 
ATOM   3098 C  CG  . LEU B 1 192 ? -7.098  35.332  32.690  1.00  28.47 ? 191 LEU B CG  1 
ATOM   3099 C  CD1 . LEU B 1 192 ? -6.480  35.609  31.325  1.00  30.74 ? 191 LEU B CD1 1 
ATOM   3100 C  CD2 . LEU B 1 192 ? -6.100  34.686  33.643  1.00  29.31 ? 191 LEU B CD2 1 
ATOM   3101 N  N   . ALA B 1 193 ? -9.857  38.479  34.779  1.00  29.21 ? 192 ALA B N   1 
ATOM   3102 C  CA  . ALA B 1 193 ? -10.229 39.716  35.461  1.00  29.78 ? 192 ALA B CA  1 
ATOM   3103 C  C   . ALA B 1 193 ? -10.742 39.411  36.868  1.00  29.92 ? 192 ALA B C   1 
ATOM   3104 O  O   . ALA B 1 193 ? -10.435 40.132  37.814  1.00  30.63 ? 192 ALA B O   1 
ATOM   3105 C  CB  . ALA B 1 193 ? -11.270 40.479  34.652  1.00  29.36 ? 192 ALA B CB  1 
ATOM   3106 N  N   . ALA B 1 194 ? -11.508 38.331  37.001  1.00  30.22 ? 193 ALA B N   1 
ATOM   3107 C  CA  . ALA B 1 194 ? -12.134 37.973  38.278  1.00  30.19 ? 193 ALA B CA  1 
ATOM   3108 C  C   . ALA B 1 194 ? -11.130 37.392  39.278  1.00  30.37 ? 193 ALA B C   1 
ATOM   3109 O  O   . ALA B 1 194 ? -11.343 37.469  40.493  1.00  30.44 ? 193 ALA B O   1 
ATOM   3110 C  CB  . ALA B 1 194 ? -13.269 37.001  38.046  1.00  30.10 ? 193 ALA B CB  1 
ATOM   3111 N  N   . PHE B 1 195 ? -10.054 36.809  38.750  1.00  30.28 ? 194 PHE B N   1 
ATOM   3112 C  CA  . PHE B 1 195 ? -8.948  36.253  39.538  1.00  30.67 ? 194 PHE B CA  1 
ATOM   3113 C  C   . PHE B 1 195 ? -8.307  37.278  40.489  1.00  30.53 ? 194 PHE B C   1 
ATOM   3114 O  O   . PHE B 1 195 ? -7.933  36.933  41.609  1.00  30.71 ? 194 PHE B O   1 
ATOM   3115 C  CB  . PHE B 1 195 ? -7.885  35.669  38.602  1.00  30.26 ? 194 PHE B CB  1 
ATOM   3116 C  CG  . PHE B 1 195 ? -6.678  35.090  39.310  1.00  30.97 ? 194 PHE B CG  1 
ATOM   3117 C  CD1 . PHE B 1 195 ? -6.779  33.910  40.049  1.00  30.28 ? 194 PHE B CD1 1 
ATOM   3118 C  CD2 . PHE B 1 195 ? -5.433  35.712  39.204  1.00  30.20 ? 194 PHE B CD2 1 
ATOM   3119 C  CE1 . PHE B 1 195 ? -5.662  33.359  40.687  1.00  31.32 ? 194 PHE B CE1 1 
ATOM   3120 C  CE2 . PHE B 1 195 ? -4.305  35.175  39.835  1.00  31.49 ? 194 PHE B CE2 1 
ATOM   3121 C  CZ  . PHE B 1 195 ? -4.422  33.993  40.583  1.00  30.76 ? 194 PHE B CZ  1 
ATOM   3122 N  N   . TRP B 1 196 ? -8.189  38.530  40.051  1.00  30.75 ? 195 TRP B N   1 
ATOM   3123 C  CA  . TRP B 1 196 ? -7.605  39.577  40.893  1.00  31.09 ? 195 TRP B CA  1 
ATOM   3124 C  C   . TRP B 1 196 ? -8.334  39.760  42.229  1.00  31.22 ? 195 TRP B C   1 
ATOM   3125 O  O   . TRP B 1 196 ? -7.748  40.230  43.205  1.00  31.25 ? 195 TRP B O   1 
ATOM   3126 C  CB  . TRP B 1 196 ? -7.507  40.912  40.139  1.00  31.34 ? 195 TRP B CB  1 
ATOM   3127 C  CG  . TRP B 1 196 ? -6.634  40.836  38.925  1.00  31.25 ? 195 TRP B CG  1 
ATOM   3128 C  CD1 . TRP B 1 196 ? -7.012  41.056  37.629  1.00  32.05 ? 195 TRP B CD1 1 
ATOM   3129 C  CD2 . TRP B 1 196 ? -5.240  40.492  38.884  1.00  31.90 ? 195 TRP B CD2 1 
ATOM   3130 N  NE1 . TRP B 1 196 ? -5.938  40.879  36.785  1.00  32.45 ? 195 TRP B NE1 1 
ATOM   3131 C  CE2 . TRP B 1 196 ? -4.841  40.524  37.527  1.00  31.89 ? 195 TRP B CE2 1 
ATOM   3132 C  CE3 . TRP B 1 196 ? -4.291  40.156  39.861  1.00  31.12 ? 195 TRP B CE3 1 
ATOM   3133 C  CZ2 . TRP B 1 196 ? -3.531  40.246  37.121  1.00  31.33 ? 195 TRP B CZ2 1 
ATOM   3134 C  CZ3 . TRP B 1 196 ? -2.986  39.870  39.455  1.00  32.12 ? 195 TRP B CZ3 1 
ATOM   3135 C  CH2 . TRP B 1 196 ? -2.621  39.922  38.094  1.00  31.57 ? 195 TRP B CH2 1 
ATOM   3136 N  N   . ASN B 1 197 ? -9.609  39.381  42.259  1.00  31.18 ? 196 ASN B N   1 
ATOM   3137 C  CA  . ASN B 1 197 ? -10.442 39.502  43.456  1.00  31.27 ? 196 ASN B CA  1 
ATOM   3138 C  C   . ASN B 1 197 ? -10.173 38.443  44.519  1.00  31.16 ? 196 ASN B C   1 
ATOM   3139 O  O   . ASN B 1 197 ? -10.605 38.592  45.664  1.00  31.29 ? 196 ASN B O   1 
ATOM   3140 C  CB  . ASN B 1 197 ? -11.922 39.477  43.069  1.00  31.41 ? 196 ASN B CB  1 
ATOM   3141 C  CG  . ASN B 1 197 ? -12.296 40.617  42.153  1.00  31.80 ? 196 ASN B CG  1 
ATOM   3142 O  OD1 . ASN B 1 197 ? -12.151 41.786  42.506  1.00  33.06 ? 196 ASN B OD1 1 
ATOM   3143 N  ND2 . ASN B 1 197 ? -12.779 40.285  40.970  1.00  32.10 ? 196 ASN B ND2 1 
ATOM   3144 N  N   . VAL B 1 198 ? -9.458  37.383  44.143  1.00  30.99 ? 197 VAL B N   1 
ATOM   3145 C  CA  . VAL B 1 198 ? -9.183  36.275  45.058  1.00  30.95 ? 197 VAL B CA  1 
ATOM   3146 C  C   . VAL B 1 198 ? -7.700  36.064  45.382  1.00  30.72 ? 197 VAL B C   1 
ATOM   3147 O  O   . VAL B 1 198 ? -7.367  35.188  46.177  1.00  31.33 ? 197 VAL B O   1 
ATOM   3148 C  CB  . VAL B 1 198 ? -9.818  34.924  44.582  1.00  30.99 ? 197 VAL B CB  1 
ATOM   3149 C  CG1 . VAL B 1 198 ? -11.342 34.980  44.658  1.00  31.14 ? 197 VAL B CG1 1 
ATOM   3150 C  CG2 . VAL B 1 198 ? -9.339  34.540  43.188  1.00  31.80 ? 197 VAL B CG2 1 
ATOM   3151 N  N   . VAL B 1 199 ? -6.813  36.860  44.791  1.00  30.37 ? 198 VAL B N   1 
ATOM   3152 C  CA  . VAL B 1 199 ? -5.388  36.742  45.107  1.00  30.35 ? 198 VAL B CA  1 
ATOM   3153 C  C   . VAL B 1 199 ? -5.124  37.101  46.576  1.00  30.33 ? 198 VAL B C   1 
ATOM   3154 O  O   . VAL B 1 199 ? -5.592  38.128  47.066  1.00  30.32 ? 198 VAL B O   1 
ATOM   3155 C  CB  . VAL B 1 199 ? -4.491  37.615  44.188  1.00  30.44 ? 198 VAL B CB  1 
ATOM   3156 C  CG1 . VAL B 1 199 ? -3.029  37.531  44.624  1.00  29.96 ? 198 VAL B CG1 1 
ATOM   3157 C  CG2 . VAL B 1 199 ? -4.629  37.187  42.735  1.00  30.08 ? 198 VAL B CG2 1 
ATOM   3158 N  N   . ASN B 1 200 ? -4.398  36.228  47.272  1.00  30.77 ? 199 ASN B N   1 
ATOM   3159 C  CA  . ASN B 1 200 ? -3.903  36.512  48.619  1.00  30.84 ? 199 ASN B CA  1 
ATOM   3160 C  C   . ASN B 1 200 ? -2.531  37.178  48.526  1.00  30.87 ? 199 ASN B C   1 
ATOM   3161 O  O   . ASN B 1 200 ? -1.495  36.496  48.479  1.00  30.46 ? 199 ASN B O   1 
ATOM   3162 C  CB  . ASN B 1 200 ? -3.825  35.233  49.470  1.00  30.88 ? 199 ASN B CB  1 
ATOM   3163 C  CG  . ASN B 1 200 ? -3.480  35.513  50.930  1.00  31.69 ? 199 ASN B CG  1 
ATOM   3164 O  OD1 . ASN B 1 200 ? -2.910  36.550  51.261  1.00  31.41 ? 199 ASN B OD1 1 
ATOM   3165 N  ND2 . ASN B 1 200 ? -3.835  34.584  51.809  1.00  32.63 ? 199 ASN B ND2 1 
ATOM   3166 N  N   . TRP B 1 201 ? -2.534  38.508  48.506  1.00  30.53 ? 200 TRP B N   1 
ATOM   3167 C  CA  . TRP B 1 201 ? -1.304  39.282  48.387  1.00  30.82 ? 200 TRP B CA  1 
ATOM   3168 C  C   . TRP B 1 201 ? -0.371  39.169  49.589  1.00  31.21 ? 200 TRP B C   1 
ATOM   3169 O  O   . TRP B 1 201 ? 0.824   39.410  49.460  1.00  31.06 ? 200 TRP B O   1 
ATOM   3170 C  CB  . TRP B 1 201 ? -1.613  40.750  48.069  1.00  30.56 ? 200 TRP B CB  1 
ATOM   3171 C  CG  . TRP B 1 201 ? -2.099  40.916  46.657  1.00  30.07 ? 200 TRP B CG  1 
ATOM   3172 C  CD1 . TRP B 1 201 ? -3.362  41.252  46.258  1.00  29.99 ? 200 TRP B CD1 1 
ATOM   3173 C  CD2 . TRP B 1 201 ? -1.342  40.704  45.458  1.00  30.10 ? 200 TRP B CD2 1 
ATOM   3174 N  NE1 . TRP B 1 201 ? -3.435  41.281  44.883  1.00  29.98 ? 200 TRP B NE1 1 
ATOM   3175 C  CE2 . TRP B 1 201 ? -2.211  40.943  44.368  1.00  30.04 ? 200 TRP B CE2 1 
ATOM   3176 C  CE3 . TRP B 1 201 ? -0.013  40.336  45.196  1.00  29.78 ? 200 TRP B CE3 1 
ATOM   3177 C  CZ2 . TRP B 1 201 ? -1.792  40.835  43.037  1.00  30.43 ? 200 TRP B CZ2 1 
ATOM   3178 C  CZ3 . TRP B 1 201 ? 0.400   40.226  43.870  1.00  29.60 ? 200 TRP B CZ3 1 
ATOM   3179 C  CH2 . TRP B 1 201 ? -0.488  40.477  42.809  1.00  30.22 ? 200 TRP B CH2 1 
ATOM   3180 N  N   . ASP B 1 202 ? -0.919  38.807  50.746  1.00  32.08 ? 201 ASP B N   1 
ATOM   3181 C  CA  . ASP B 1 202 ? -0.106  38.586  51.944  1.00  33.22 ? 201 ASP B CA  1 
ATOM   3182 C  C   . ASP B 1 202 ? 0.805   37.368  51.729  1.00  32.99 ? 201 ASP B C   1 
ATOM   3183 O  O   . ASP B 1 202 ? 1.981   37.379  52.097  1.00  33.05 ? 201 ASP B O   1 
ATOM   3184 C  CB  . ASP B 1 202 ? -0.993  38.398  53.183  1.00  33.56 ? 201 ASP B CB  1 
ATOM   3185 C  CG  . ASP B 1 202 ? -1.583  39.707  53.703  1.00  36.03 ? 201 ASP B CG  1 
ATOM   3186 O  OD1 . ASP B 1 202 ? -1.152  40.803  53.269  1.00  38.90 ? 201 ASP B OD1 1 
ATOM   3187 O  OD2 . ASP B 1 202 ? -2.480  39.644  54.576  1.00  37.84 ? 201 ASP B OD2 1 
ATOM   3188 N  N   . GLU B 1 203 ? 0.253   36.330  51.106  1.00  33.08 ? 202 GLU B N   1 
ATOM   3189 C  CA  . GLU B 1 203 ? 1.014   35.129  50.788  1.00  32.83 ? 202 GLU B CA  1 
ATOM   3190 C  C   . GLU B 1 203 ? 2.037   35.400  49.680  1.00  32.27 ? 202 GLU B C   1 
ATOM   3191 O  O   . GLU B 1 203 ? 3.175   34.941  49.759  1.00  32.09 ? 202 GLU B O   1 
ATOM   3192 C  CB  . GLU B 1 203 ? 0.063   33.982  50.419  1.00  33.26 ? 202 GLU B CB  1 
ATOM   3193 C  CG  . GLU B 1 203 ? 0.735   32.739  49.827  1.00  34.98 ? 202 GLU B CG  1 
ATOM   3194 C  CD  . GLU B 1 203 ? 1.500   31.903  50.840  1.00  37.80 ? 202 GLU B CD  1 
ATOM   3195 O  OE1 . GLU B 1 203 ? 1.386   32.165  52.061  1.00  39.24 ? 202 GLU B OE1 1 
ATOM   3196 O  OE2 . GLU B 1 203 ? 2.219   30.971  50.409  1.00  37.42 ? 202 GLU B OE2 1 
ATOM   3197 N  N   . VAL B 1 204 ? 1.638   36.151  48.655  1.00  31.80 ? 203 VAL B N   1 
ATOM   3198 C  CA  . VAL B 1 204 ? 2.565   36.492  47.570  1.00  31.56 ? 203 VAL B CA  1 
ATOM   3199 C  C   . VAL B 1 204 ? 3.758   37.289  48.124  1.00  31.76 ? 203 VAL B C   1 
ATOM   3200 O  O   . VAL B 1 204 ? 4.904   37.025  47.756  1.00  31.95 ? 203 VAL B O   1 
ATOM   3201 C  CB  . VAL B 1 204 ? 1.865   37.234  46.390  1.00  31.29 ? 203 VAL B CB  1 
ATOM   3202 C  CG1 . VAL B 1 204 ? 2.861   37.559  45.275  1.00  30.92 ? 203 VAL B CG1 1 
ATOM   3203 C  CG2 . VAL B 1 204 ? 0.719   36.385  45.818  1.00  30.82 ? 203 VAL B CG2 1 
ATOM   3204 N  N   . SER B 1 205 ? 3.486   38.228  49.034  1.00  31.86 ? 204 SER B N   1 
ATOM   3205 C  CA  . SER B 1 205 ? 4.548   39.012  49.687  1.00  32.45 ? 204 SER B CA  1 
ATOM   3206 C  C   . SER B 1 205 ? 5.522   38.146  50.492  1.00  32.69 ? 204 SER B C   1 
ATOM   3207 O  O   . SER B 1 205 ? 6.733   38.372  50.464  1.00  32.46 ? 204 SER B O   1 
ATOM   3208 C  CB  . SER B 1 205 ? 3.961   40.105  50.580  1.00  32.35 ? 204 SER B CB  1 
ATOM   3209 O  OG  . SER B 1 205 ? 3.462   41.178  49.800  1.00  33.56 ? 204 SER B OG  1 
ATOM   3210 N  N   . LYS B 1 206 ? 4.984   37.156  51.199  1.00  33.08 ? 205 LYS B N   1 
ATOM   3211 C  CA  . LYS B 1 206 ? 5.793   36.199  51.948  1.00  33.61 ? 205 LYS B CA  1 
ATOM   3212 C  C   . LYS B 1 206 ? 6.755   35.482  50.997  1.00  33.31 ? 205 LYS B C   1 
ATOM   3213 O  O   . LYS B 1 206 ? 7.941   35.328  51.296  1.00  33.19 ? 205 LYS B O   1 
ATOM   3214 C  CB  . LYS B 1 206 ? 4.889   35.175  52.636  1.00  33.99 ? 205 LYS B CB  1 
ATOM   3215 C  CG  . LYS B 1 206 ? 5.033   35.118  54.145  1.00  36.30 ? 205 LYS B CG  1 
ATOM   3216 C  CD  . LYS B 1 206 ? 4.375   33.873  54.735  1.00  40.13 ? 205 LYS B CD  1 
ATOM   3217 C  CE  . LYS B 1 206 ? 2.865   33.833  54.494  1.00  42.15 ? 205 LYS B CE  1 
ATOM   3218 N  NZ  . LYS B 1 206 ? 2.290   32.492  54.832  1.00  44.44 ? 205 LYS B NZ  1 
ATOM   3219 N  N   . ARG B 1 207 ? 6.235   35.068  49.844  1.00  33.06 ? 206 ARG B N   1 
ATOM   3220 C  CA  . ARG B 1 207 ? 7.027   34.379  48.824  1.00  33.04 ? 206 ARG B CA  1 
ATOM   3221 C  C   . ARG B 1 207 ? 8.062   35.275  48.141  1.00  33.24 ? 206 ARG B C   1 
ATOM   3222 O  O   . ARG B 1 207 ? 9.141   34.807  47.767  1.00  33.18 ? 206 ARG B O   1 
ATOM   3223 C  CB  . ARG B 1 207 ? 6.114   33.739  47.786  1.00  32.81 ? 206 ARG B CB  1 
ATOM   3224 C  CG  . ARG B 1 207 ? 5.380   32.525  48.317  1.00  32.65 ? 206 ARG B CG  1 
ATOM   3225 C  CD  . ARG B 1 207 ? 4.266   32.105  47.384  1.00  33.45 ? 206 ARG B CD  1 
ATOM   3226 N  NE  . ARG B 1 207 ? 3.517   30.984  47.938  1.00  33.12 ? 206 ARG B NE  1 
ATOM   3227 C  CZ  . ARG B 1 207 ? 3.811   29.701  47.742  1.00  33.25 ? 206 ARG B CZ  1 
ATOM   3228 N  NH1 . ARG B 1 207 ? 4.843   29.350  46.984  1.00  33.04 ? 206 ARG B NH1 1 
ATOM   3229 N  NH2 . ARG B 1 207 ? 3.061   28.763  48.306  1.00  33.58 ? 206 ARG B NH2 1 
ATOM   3230 N  N   . TYR B 1 208 ? 7.732   36.553  47.978  1.00  33.19 ? 207 TYR B N   1 
ATOM   3231 C  CA  . TYR B 1 208 ? 8.675   37.515  47.416  1.00  33.75 ? 207 TYR B CA  1 
ATOM   3232 C  C   . TYR B 1 208 ? 9.873   37.714  48.351  1.00  34.56 ? 207 TYR B C   1 
ATOM   3233 O  O   . TYR B 1 208 ? 11.031  37.611  47.935  1.00  34.26 ? 207 TYR B O   1 
ATOM   3234 C  CB  . TYR B 1 208 ? 7.987   38.859  47.162  1.00  33.61 ? 207 TYR B CB  1 
ATOM   3235 C  CG  . TYR B 1 208 ? 8.940   39.926  46.676  1.00  33.54 ? 207 TYR B CG  1 
ATOM   3236 C  CD1 . TYR B 1 208 ? 9.397   39.927  45.359  1.00  33.36 ? 207 TYR B CD1 1 
ATOM   3237 C  CD2 . TYR B 1 208 ? 9.395   40.922  47.534  1.00  33.30 ? 207 TYR B CD2 1 
ATOM   3238 C  CE1 . TYR B 1 208 ? 10.282  40.895  44.907  1.00  33.32 ? 207 TYR B CE1 1 
ATOM   3239 C  CE2 . TYR B 1 208 ? 10.282  41.901  47.092  1.00  33.82 ? 207 TYR B CE2 1 
ATOM   3240 C  CZ  . TYR B 1 208 ? 10.720  41.875  45.778  1.00  33.98 ? 207 TYR B CZ  1 
ATOM   3241 O  OH  . TYR B 1 208 ? 11.592  42.835  45.329  1.00  34.06 ? 207 TYR B OH  1 
ATOM   3242 N  N   . ALA B 1 209 ? 9.573   38.003  49.615  1.00  35.58 ? 208 ALA B N   1 
ATOM   3243 C  CA  . ALA B 1 209 ? 10.597  38.218  50.638  1.00  36.96 ? 208 ALA B CA  1 
ATOM   3244 C  C   . ALA B 1 209 ? 11.531  37.008  50.697  1.00  37.85 ? 208 ALA B C   1 
ATOM   3245 O  O   . ALA B 1 209 ? 12.752  37.163  50.785  1.00  38.43 ? 208 ALA B O   1 
ATOM   3246 C  CB  . ALA B 1 209 ? 9.946   38.473  51.991  1.00  36.51 ? 208 ALA B CB  1 
ATOM   3247 N  N   . ALA B 1 210 ? 10.939  35.818  50.614  1.00  38.73 ? 209 ALA B N   1 
ATOM   3248 C  CA  . ALA B 1 210 ? 11.666  34.550  50.610  1.00  39.68 ? 209 ALA B CA  1 
ATOM   3249 C  C   . ALA B 1 210 ? 12.573  34.394  49.389  1.00  40.40 ? 209 ALA B C   1 
ATOM   3250 O  O   . ALA B 1 210 ? 13.747  34.045  49.532  1.00  40.68 ? 209 ALA B O   1 
ATOM   3251 C  CB  . ALA B 1 210 ? 10.693  33.394  50.692  1.00  39.64 ? 209 ALA B CB  1 
ATOM   3252 N  N   . ALA B 1 211 ? 12.024  34.659  48.202  1.00  40.89 ? 210 ALA B N   1 
ATOM   3253 C  CA  . ALA B 1 211 ? 12.765  34.551  46.940  1.00  41.36 ? 210 ALA B CA  1 
ATOM   3254 C  C   . ALA B 1 211 ? 13.884  35.582  46.848  1.00  41.76 ? 210 ALA B C   1 
ATOM   3255 O  O   . ALA B 1 211 ? 14.848  35.403  46.100  1.00  41.89 ? 210 ALA B O   1 
ATOM   3256 C  CB  . ALA B 1 211 ? 11.820  34.688  45.751  1.00  41.06 ? 210 ALA B CB  1 
ATOM   3257 N  N   . LYS B 1 212 ? 13.746  36.660  47.612  1.00  42.36 ? 211 LYS B N   1 
ATOM   3258 C  CA  . LYS B 1 212 ? 14.751  37.705  47.667  1.00  42.66 ? 211 LYS B CA  1 
ATOM   3259 C  C   . LYS B 1 212 ? 15.623  37.568  48.909  1.00  42.91 ? 211 LYS B C   1 
ATOM   3260 O  O   . LYS B 1 212 ? 16.775  38.000  48.917  1.00  43.10 ? 211 LYS B O   1 
ATOM   3261 C  CB  . LYS B 1 212 ? 14.089  39.077  47.634  1.00  42.89 ? 211 LYS B CB  1 
ATOM   3262 C  CG  . LYS B 1 212 ? 14.055  39.696  46.260  1.00  43.25 ? 211 LYS B CG  1 
ATOM   3263 C  CD  . LYS B 1 212 ? 14.299  41.183  46.379  1.00  44.91 ? 211 LYS B CD  1 
ATOM   3264 C  CE  . LYS B 1 212 ? 15.369  41.637  45.412  1.00  45.29 ? 211 LYS B CE  1 
ATOM   3265 N  NZ  . LYS B 1 212 ? 15.813  43.018  45.724  1.00  46.80 ? 211 LYS B NZ  1 
ATOM   3266 N  N   . ALA C 1 3   ? 12.487  47.449  74.156  1.00  34.94 ? 2   ALA C N   1 
ATOM   3267 C  CA  . ALA C 1 3   ? 13.015  46.340  73.305  1.00  34.99 ? 2   ALA C CA  1 
ATOM   3268 C  C   . ALA C 1 3   ? 11.947  45.282  73.031  1.00  34.70 ? 2   ALA C C   1 
ATOM   3269 O  O   . ALA C 1 3   ? 11.534  45.094  71.884  1.00  35.50 ? 2   ALA C O   1 
ATOM   3270 C  CB  . ALA C 1 3   ? 14.256  45.703  73.942  1.00  35.07 ? 2   ALA C CB  1 
ATOM   3271 N  N   . TYR C 1 4   ? 11.505  44.591  74.076  1.00  33.87 ? 3   TYR C N   1 
ATOM   3272 C  CA  . TYR C 1 4   ? 10.515  43.537  73.918  1.00  32.85 ? 3   TYR C CA  1 
ATOM   3273 C  C   . TYR C 1 4   ? 9.233   43.894  74.642  1.00  32.30 ? 3   TYR C C   1 
ATOM   3274 O  O   . TYR C 1 4   ? 9.259   44.581  75.661  1.00  31.69 ? 3   TYR C O   1 
ATOM   3275 C  CB  . TYR C 1 4   ? 11.023  42.219  74.490  1.00  33.10 ? 3   TYR C CB  1 
ATOM   3276 C  CG  . TYR C 1 4   ? 12.291  41.658  73.884  1.00  33.26 ? 3   TYR C CG  1 
ATOM   3277 C  CD1 . TYR C 1 4   ? 12.569  41.780  72.522  1.00  33.93 ? 3   TYR C CD1 1 
ATOM   3278 C  CD2 . TYR C 1 4   ? 13.188  40.951  74.679  1.00  33.63 ? 3   TYR C CD2 1 
ATOM   3279 C  CE1 . TYR C 1 4   ? 13.736  41.240  71.974  1.00  33.21 ? 3   TYR C CE1 1 
ATOM   3280 C  CE2 . TYR C 1 4   ? 14.340  40.397  74.146  1.00  34.44 ? 3   TYR C CE2 1 
ATOM   3281 C  CZ  . TYR C 1 4   ? 14.613  40.552  72.799  1.00  33.77 ? 3   TYR C CZ  1 
ATOM   3282 O  OH  . TYR C 1 4   ? 15.761  39.994  72.293  1.00  33.51 ? 3   TYR C OH  1 
ATOM   3283 N  N   . THR C 1 5   ? 8.117   43.403  74.116  1.00  31.80 ? 4   THR C N   1 
ATOM   3284 C  CA  . THR C 1 5   ? 6.835   43.544  74.780  1.00  31.79 ? 4   THR C CA  1 
ATOM   3285 C  C   . THR C 1 5   ? 6.152   42.188  74.876  1.00  31.33 ? 4   THR C C   1 
ATOM   3286 O  O   . THR C 1 5   ? 6.421   41.274  74.066  1.00  31.10 ? 4   THR C O   1 
ATOM   3287 C  CB  . THR C 1 5   ? 5.913   44.566  74.070  1.00  31.97 ? 4   THR C CB  1 
ATOM   3288 O  OG1 . THR C 1 5   ? 5.593   44.103  72.753  1.00  33.60 ? 4   THR C OG1 1 
ATOM   3289 C  CG2 . THR C 1 5   ? 6.581   45.931  73.971  1.00  32.72 ? 4   THR C CG2 1 
ATOM   3290 N  N   . LEU C 1 6   ? 5.298   42.040  75.884  1.00  30.37 ? 5   LEU C N   1 
ATOM   3291 C  CA  . LEU C 1 6   ? 4.506   40.822  76.021  1.00  30.25 ? 5   LEU C CA  1 
ATOM   3292 C  C   . LEU C 1 6   ? 3.502   40.784  74.868  1.00  29.90 ? 5   LEU C C   1 
ATOM   3293 O  O   . LEU C 1 6   ? 2.727   41.719  74.698  1.00  29.51 ? 5   LEU C O   1 
ATOM   3294 C  CB  . LEU C 1 6   ? 3.791   40.765  77.380  1.00  30.24 ? 5   LEU C CB  1 
ATOM   3295 C  CG  . LEU C 1 6   ? 3.114   39.427  77.714  1.00  30.76 ? 5   LEU C CG  1 
ATOM   3296 C  CD1 . LEU C 1 6   ? 4.164   38.352  78.045  1.00  30.37 ? 5   LEU C CD1 1 
ATOM   3297 C  CD2 . LEU C 1 6   ? 2.111   39.573  78.856  1.00  30.24 ? 5   LEU C CD2 1 
ATOM   3298 N  N   . PRO C 1 7   ? 3.554   39.729  74.035  1.00  30.23 ? 6   PRO C N   1 
ATOM   3299 C  CA  . PRO C 1 7   ? 2.588   39.640  72.936  1.00  30.55 ? 6   PRO C CA  1 
ATOM   3300 C  C   . PRO C 1 7   ? 1.178   39.336  73.453  1.00  31.36 ? 6   PRO C C   1 
ATOM   3301 O  O   . PRO C 1 7   ? 1.029   38.672  74.480  1.00  31.57 ? 6   PRO C O   1 
ATOM   3302 C  CB  . PRO C 1 7   ? 3.104   38.466  72.107  1.00  30.34 ? 6   PRO C CB  1 
ATOM   3303 C  CG  . PRO C 1 7   ? 3.902   37.622  73.066  1.00  30.80 ? 6   PRO C CG  1 
ATOM   3304 C  CD  . PRO C 1 7   ? 4.499   38.597  74.049  1.00  30.24 ? 6   PRO C CD  1 
ATOM   3305 N  N   . GLN C 1 8   ? 0.160   39.836  72.760  1.00  32.15 ? 7   GLN C N   1 
ATOM   3306 C  CA  . GLN C 1 8   ? -1.217  39.410  73.010  1.00  33.61 ? 7   GLN C CA  1 
ATOM   3307 C  C   . GLN C 1 8   ? -1.365  37.970  72.520  1.00  33.04 ? 7   GLN C C   1 
ATOM   3308 O  O   . GLN C 1 8   ? -0.788  37.600  71.498  1.00  32.91 ? 7   GLN C O   1 
ATOM   3309 C  CB  . GLN C 1 8   ? -2.216  40.276  72.241  1.00  33.42 ? 7   GLN C CB  1 
ATOM   3310 C  CG  . GLN C 1 8   ? -1.977  41.778  72.289  1.00  35.47 ? 7   GLN C CG  1 
ATOM   3311 C  CD  . GLN C 1 8   ? -2.664  42.511  71.136  1.00  36.16 ? 7   GLN C CD  1 
ATOM   3312 O  OE1 . GLN C 1 8   ? -3.819  42.225  70.789  1.00  39.78 ? 7   GLN C OE1 1 
ATOM   3313 N  NE2 . GLN C 1 8   ? -1.950  43.466  70.534  1.00  39.86 ? 7   GLN C NE2 1 
ATOM   3314 N  N   . LEU C 1 9   ? -2.121  37.163  73.259  1.00  33.07 ? 8   LEU C N   1 
ATOM   3315 C  CA  . LEU C 1 9   ? -2.511  35.825  72.811  1.00  33.19 ? 8   LEU C CA  1 
ATOM   3316 C  C   . LEU C 1 9   ? -3.400  35.902  71.564  1.00  32.51 ? 8   LEU C C   1 
ATOM   3317 O  O   . LEU C 1 9   ? -4.127  36.885  71.386  1.00  32.40 ? 8   LEU C O   1 
ATOM   3318 C  CB  . LEU C 1 9   ? -3.262  35.097  73.933  1.00  33.17 ? 8   LEU C CB  1 
ATOM   3319 C  CG  . LEU C 1 9   ? -2.559  34.019  74.757  1.00  34.37 ? 8   LEU C CG  1 
ATOM   3320 C  CD1 . LEU C 1 9   ? -1.124  34.358  75.079  1.00  33.91 ? 8   LEU C CD1 1 
ATOM   3321 C  CD2 . LEU C 1 9   ? -3.349  33.693  76.021  1.00  34.13 ? 8   LEU C CD2 1 
ATOM   3322 N  N   . PRO C 1 10  ? -3.342  34.874  70.693  1.00  32.43 ? 9   PRO C N   1 
ATOM   3323 C  CA  . PRO C 1 10  ? -4.241  34.794  69.534  1.00  32.34 ? 9   PRO C CA  1 
ATOM   3324 C  C   . PRO C 1 10  ? -5.674  34.367  69.881  1.00  32.43 ? 9   PRO C C   1 
ATOM   3325 O  O   . PRO C 1 10  ? -6.511  34.243  68.982  1.00  32.45 ? 9   PRO C O   1 
ATOM   3326 C  CB  . PRO C 1 10  ? -3.582  33.723  68.647  1.00  32.54 ? 9   PRO C CB  1 
ATOM   3327 C  CG  . PRO C 1 10  ? -2.239  33.450  69.260  1.00  32.59 ? 9   PRO C CG  1 
ATOM   3328 C  CD  . PRO C 1 10  ? -2.393  33.750  70.708  1.00  32.28 ? 9   PRO C CD  1 
ATOM   3329 N  N   . TYR C 1 11  ? -5.946  34.160  71.169  1.00  31.99 ? 10  TYR C N   1 
ATOM   3330 C  CA  . TYR C 1 11  ? -7.236  33.650  71.650  1.00  31.66 ? 10  TYR C CA  1 
ATOM   3331 C  C   . TYR C 1 11  ? -7.401  34.062  73.120  1.00  31.13 ? 10  TYR C C   1 
ATOM   3332 O  O   . TYR C 1 11  ? -6.451  34.562  73.734  1.00  31.61 ? 10  TYR C O   1 
ATOM   3333 C  CB  . TYR C 1 11  ? -7.285  32.118  71.494  1.00  31.20 ? 10  TYR C CB  1 
ATOM   3334 C  CG  . TYR C 1 11  ? -5.943  31.494  71.770  1.00  30.99 ? 10  TYR C CG  1 
ATOM   3335 C  CD1 . TYR C 1 11  ? -5.451  31.416  73.078  1.00  29.89 ? 10  TYR C CD1 1 
ATOM   3336 C  CD2 . TYR C 1 11  ? -5.135  31.032  70.727  1.00  30.57 ? 10  TYR C CD2 1 
ATOM   3337 C  CE1 . TYR C 1 11  ? -4.203  30.886  73.343  1.00  29.86 ? 10  TYR C CE1 1 
ATOM   3338 C  CE2 . TYR C 1 11  ? -3.874  30.491  70.987  1.00  30.17 ? 10  TYR C CE2 1 
ATOM   3339 C  CZ  . TYR C 1 11  ? -3.423  30.421  72.301  1.00  31.30 ? 10  TYR C CZ  1 
ATOM   3340 O  OH  . TYR C 1 11  ? -2.181  29.913  72.586  1.00  30.22 ? 10  TYR C OH  1 
ATOM   3341 N  N   . ALA C 1 12  ? -8.600  33.863  73.671  1.00  30.44 ? 11  ALA C N   1 
ATOM   3342 C  CA  . ALA C 1 12  ? -8.880  34.124  75.088  1.00  29.69 ? 11  ALA C CA  1 
ATOM   3343 C  C   . ALA C 1 12  ? -8.179  33.097  75.996  1.00  29.76 ? 11  ALA C C   1 
ATOM   3344 O  O   . ALA C 1 12  ? -7.789  32.017  75.531  1.00  29.52 ? 11  ALA C O   1 
ATOM   3345 C  CB  . ALA C 1 12  ? -10.391 34.117  75.336  1.00  29.59 ? 11  ALA C CB  1 
ATOM   3346 N  N   . TYR C 1 13  ? -8.030  33.429  77.284  1.00  29.38 ? 12  TYR C N   1 
ATOM   3347 C  CA  . TYR C 1 13  ? -7.354  32.538  78.240  1.00  29.94 ? 12  TYR C CA  1 
ATOM   3348 C  C   . TYR C 1 13  ? -8.025  31.162  78.371  1.00  30.01 ? 12  TYR C C   1 
ATOM   3349 O  O   . TYR C 1 13  ? -7.353  30.168  78.660  1.00  30.08 ? 12  TYR C O   1 
ATOM   3350 C  CB  . TYR C 1 13  ? -7.202  33.207  79.623  1.00  29.70 ? 12  TYR C CB  1 
ATOM   3351 C  CG  . TYR C 1 13  ? -6.176  34.328  79.644  1.00  29.87 ? 12  TYR C CG  1 
ATOM   3352 C  CD1 . TYR C 1 13  ? -4.886  34.127  79.147  1.00  29.56 ? 12  TYR C CD1 1 
ATOM   3353 C  CD2 . TYR C 1 13  ? -6.489  35.579  80.168  1.00  31.24 ? 12  TYR C CD2 1 
ATOM   3354 C  CE1 . TYR C 1 13  ? -3.943  35.148  79.151  1.00  29.90 ? 12  TYR C CE1 1 
ATOM   3355 C  CE2 . TYR C 1 13  ? -5.541  36.611  80.185  1.00  30.92 ? 12  TYR C CE2 1 
ATOM   3356 C  CZ  . TYR C 1 13  ? -4.277  36.382  79.671  1.00  31.06 ? 12  TYR C CZ  1 
ATOM   3357 O  OH  . TYR C 1 13  ? -3.337  37.387  79.670  1.00  31.77 ? 12  TYR C OH  1 
ATOM   3358 N  N   . ASP C 1 14  ? -9.339  31.113  78.145  1.00  30.13 ? 13  ASP C N   1 
ATOM   3359 C  CA  . ASP C 1 14  ? -10.104 29.866  78.269  1.00  30.49 ? 13  ASP C CA  1 
ATOM   3360 C  C   . ASP C 1 14  ? -10.324 29.132  76.930  1.00  30.53 ? 13  ASP C C   1 
ATOM   3361 O  O   . ASP C 1 14  ? -11.104 28.181  76.863  1.00  30.60 ? 13  ASP C O   1 
ATOM   3362 C  CB  . ASP C 1 14  ? -11.451 30.137  78.959  1.00  30.88 ? 13  ASP C CB  1 
ATOM   3363 C  CG  . ASP C 1 14  ? -12.417 30.930  78.086  1.00  32.12 ? 13  ASP C CG  1 
ATOM   3364 O  OD1 . ASP C 1 14  ? -12.011 31.442  77.020  1.00  34.13 ? 13  ASP C OD1 1 
ATOM   3365 O  OD2 . ASP C 1 14  ? -13.602 31.044  78.469  1.00  33.06 ? 13  ASP C OD2 1 
ATOM   3366 N  N   . ALA C 1 15  ? -9.645  29.579  75.877  1.00  30.19 ? 14  ALA C N   1 
ATOM   3367 C  CA  . ALA C 1 15  ? -9.865  29.038  74.531  1.00  30.25 ? 14  ALA C CA  1 
ATOM   3368 C  C   . ALA C 1 15  ? -9.367  27.600  74.369  1.00  30.24 ? 14  ALA C C   1 
ATOM   3369 O  O   . ALA C 1 15  ? -9.814  26.888  73.470  1.00  29.92 ? 14  ALA C O   1 
ATOM   3370 C  CB  . ALA C 1 15  ? -9.226  29.935  73.481  1.00  30.15 ? 14  ALA C CB  1 
ATOM   3371 N  N   . LEU C 1 16  ? -8.450  27.177  75.239  1.00  30.04 ? 15  LEU C N   1 
ATOM   3372 C  CA  . LEU C 1 16  ? -7.825  25.861  75.112  1.00  30.55 ? 15  LEU C CA  1 
ATOM   3373 C  C   . LEU C 1 16  ? -8.381  24.843  76.113  1.00  30.65 ? 15  LEU C C   1 
ATOM   3374 O  O   . LEU C 1 16  ? -7.853  23.738  76.260  1.00  30.87 ? 15  LEU C O   1 
ATOM   3375 C  CB  . LEU C 1 16  ? -6.295  25.986  75.218  1.00  30.17 ? 15  LEU C CB  1 
ATOM   3376 C  CG  . LEU C 1 16  ? -5.595  27.063  74.362  1.00  30.72 ? 15  LEU C CG  1 
ATOM   3377 C  CD1 . LEU C 1 16  ? -4.090  27.010  74.564  1.00  31.69 ? 15  LEU C CD1 1 
ATOM   3378 C  CD2 . LEU C 1 16  ? -5.916  26.952  72.871  1.00  29.95 ? 15  LEU C CD2 1 
ATOM   3379 N  N   . GLU C 1 17  ? -9.459  25.223  76.788  1.00  31.22 ? 16  GLU C N   1 
ATOM   3380 C  CA  . GLU C 1 17  ? -10.151 24.344  77.726  1.00  31.35 ? 16  GLU C CA  1 
ATOM   3381 C  C   . GLU C 1 17  ? -10.763 23.162  76.976  1.00  31.31 ? 16  GLU C C   1 
ATOM   3382 O  O   . GLU C 1 17  ? -11.198 23.324  75.833  1.00  31.06 ? 16  GLU C O   1 
ATOM   3383 C  CB  . GLU C 1 17  ? -11.243 25.126  78.459  1.00  31.82 ? 16  GLU C CB  1 
ATOM   3384 C  CG  . GLU C 1 17  ? -10.714 26.173  79.445  1.00  33.57 ? 16  GLU C CG  1 
ATOM   3385 C  CD  . GLU C 1 17  ? -10.473 25.622  80.841  1.00  37.77 ? 16  GLU C CD  1 
ATOM   3386 O  OE1 . GLU C 1 17  ? -10.424 24.376  81.011  1.00  39.07 ? 16  GLU C OE1 1 
ATOM   3387 O  OE2 . GLU C 1 17  ? -10.321 26.445  81.777  1.00  38.67 ? 16  GLU C OE2 1 
ATOM   3388 N  N   . PRO C 1 18  ? -10.799 21.970  77.603  1.00  31.18 ? 17  PRO C N   1 
ATOM   3389 C  CA  . PRO C 1 18  ? -10.268 21.602  78.917  1.00  31.17 ? 17  PRO C CA  1 
ATOM   3390 C  C   . PRO C 1 18  ? -8.817  21.106  78.904  1.00  31.17 ? 17  PRO C C   1 
ATOM   3391 O  O   . PRO C 1 18  ? -8.307  20.651  79.942  1.00  31.27 ? 17  PRO C O   1 
ATOM   3392 C  CB  . PRO C 1 18  ? -11.206 20.472  79.349  1.00  31.01 ? 17  PRO C CB  1 
ATOM   3393 C  CG  . PRO C 1 18  ? -11.639 19.829  78.065  1.00  31.11 ? 17  PRO C CG  1 
ATOM   3394 C  CD  . PRO C 1 18  ? -11.495 20.834  76.961  1.00  31.19 ? 17  PRO C CD  1 
ATOM   3395 N  N   . HIS C 1 19  ? -8.156  21.216  77.753  1.00  30.72 ? 18  HIS C N   1 
ATOM   3396 C  CA  . HIS C 1 19  ? -6.787  20.716  77.581  1.00  30.80 ? 18  HIS C CA  1 
ATOM   3397 C  C   . HIS C 1 19  ? -5.775  21.506  78.399  1.00  30.82 ? 18  HIS C C   1 
ATOM   3398 O  O   . HIS C 1 19  ? -4.893  20.920  79.034  1.00  30.92 ? 18  HIS C O   1 
ATOM   3399 C  CB  . HIS C 1 19  ? -6.427  20.676  76.091  1.00  30.55 ? 18  HIS C CB  1 
ATOM   3400 C  CG  . HIS C 1 19  ? -7.541  20.152  75.239  1.00  30.94 ? 18  HIS C CG  1 
ATOM   3401 N  ND1 . HIS C 1 19  ? -8.035  18.874  75.378  1.00  30.58 ? 18  HIS C ND1 1 
ATOM   3402 C  CD2 . HIS C 1 19  ? -8.298  20.745  74.286  1.00  31.11 ? 18  HIS C CD2 1 
ATOM   3403 C  CE1 . HIS C 1 19  ? -9.031  18.693  74.529  1.00  31.38 ? 18  HIS C CE1 1 
ATOM   3404 N  NE2 . HIS C 1 19  ? -9.207  19.812  73.852  1.00  31.00 ? 18  HIS C NE2 1 
ATOM   3405 N  N   . ILE C 1 20  ? -5.910  22.833  78.388  1.00  30.71 ? 19  ILE C N   1 
ATOM   3406 C  CA  . ILE C 1 20  ? -5.141  23.704  79.273  1.00  30.53 ? 19  ILE C CA  1 
ATOM   3407 C  C   . ILE C 1 20  ? -6.103  24.692  79.925  1.00  30.16 ? 19  ILE C C   1 
ATOM   3408 O  O   . ILE C 1 20  ? -6.858  25.382  79.224  1.00  29.59 ? 19  ILE C O   1 
ATOM   3409 C  CB  . ILE C 1 20  ? -4.010  24.485  78.527  1.00  30.25 ? 19  ILE C CB  1 
ATOM   3410 C  CG1 . ILE C 1 20  ? -3.124  23.527  77.713  1.00  31.74 ? 19  ILE C CG1 1 
ATOM   3411 C  CG2 . ILE C 1 20  ? -3.176  25.283  79.532  1.00  30.78 ? 19  ILE C CG2 1 
ATOM   3412 C  CD1 . ILE C 1 20  ? -2.070  24.201  76.860  1.00  30.80 ? 19  ILE C CD1 1 
ATOM   3413 N  N   . ASP C 1 21  ? -6.064  24.753  81.259  1.00  29.65 ? 20  ASP C N   1 
ATOM   3414 C  CA  . ASP C 1 21  ? -6.986  25.568  82.042  1.00  29.60 ? 20  ASP C CA  1 
ATOM   3415 C  C   . ASP C 1 21  ? -6.709  27.055  81.887  1.00  29.32 ? 20  ASP C C   1 
ATOM   3416 O  O   . ASP C 1 21  ? -5.555  27.469  81.743  1.00  28.32 ? 20  ASP C O   1 
ATOM   3417 C  CB  . ASP C 1 21  ? -6.933  25.182  83.528  1.00  30.28 ? 20  ASP C CB  1 
ATOM   3418 C  CG  . ASP C 1 21  ? -5.514  25.203  84.088  1.00  31.93 ? 20  ASP C CG  1 
ATOM   3419 O  OD1 . ASP C 1 21  ? -4.685  24.396  83.616  1.00  35.46 ? 20  ASP C OD1 1 
ATOM   3420 O  OD2 . ASP C 1 21  ? -5.216  26.014  85.002  1.00  32.91 ? 20  ASP C OD2 1 
ATOM   3421 N  N   . ALA C 1 22  ? -7.776  27.852  81.950  1.00  28.83 ? 21  ALA C N   1 
ATOM   3422 C  CA  . ALA C 1 22  ? -7.688  29.305  81.809  1.00  28.57 ? 21  ALA C CA  1 
ATOM   3423 C  C   . ALA C 1 22  ? -6.783  29.940  82.853  1.00  28.38 ? 21  ALA C C   1 
ATOM   3424 O  O   . ALA C 1 22  ? -6.099  30.920  82.568  1.00  28.12 ? 21  ALA C O   1 
ATOM   3425 C  CB  . ALA C 1 22  ? -9.095  29.926  81.873  1.00  28.25 ? 21  ALA C CB  1 
ATOM   3426 N  N   . ARG C 1 23  ? -6.792  29.393  84.068  1.00  28.74 ? 22  ARG C N   1 
ATOM   3427 C  CA  . ARG C 1 23  ? -6.006  29.964  85.164  1.00  28.87 ? 22  ARG C CA  1 
ATOM   3428 C  C   . ARG C 1 23  ? -4.513  29.869  84.849  1.00  28.74 ? 22  ARG C C   1 
ATOM   3429 O  O   . ARG C 1 23  ? -3.770  30.849  84.996  1.00  27.89 ? 22  ARG C O   1 
ATOM   3430 C  CB  . ARG C 1 23  ? -6.341  29.281  86.502  1.00  28.69 ? 22  ARG C CB  1 
ATOM   3431 C  CG  . ARG C 1 23  ? -5.671  29.940  87.700  1.00  29.61 ? 22  ARG C CG  1 
ATOM   3432 C  CD  . ARG C 1 23  ? -5.884  29.156  88.985  1.00  29.58 ? 22  ARG C CD  1 
ATOM   3433 N  NE  . ARG C 1 23  ? -5.298  29.859  90.127  1.00  30.93 ? 22  ARG C NE  1 
ATOM   3434 C  CZ  . ARG C 1 23  ? -4.917  29.279  91.266  1.00  31.07 ? 22  ARG C CZ  1 
ATOM   3435 N  NH1 . ARG C 1 23  ? -5.032  27.963  91.425  1.00  30.24 ? 22  ARG C NH1 1 
ATOM   3436 N  NH2 . ARG C 1 23  ? -4.398  30.020  92.240  1.00  28.76 ? 22  ARG C NH2 1 
ATOM   3437 N  N   . THR C 1 24  ? -4.097  28.681  84.418  1.00  28.82 ? 23  THR C N   1 
ATOM   3438 C  CA  . THR C 1 24  ? -2.724  28.413  84.004  1.00  29.36 ? 23  THR C CA  1 
ATOM   3439 C  C   . THR C 1 24  ? -2.335  29.304  82.830  1.00  29.28 ? 23  THR C C   1 
ATOM   3440 O  O   . THR C 1 24  ? -1.267  29.919  82.855  1.00  28.76 ? 23  THR C O   1 
ATOM   3441 C  CB  . THR C 1 24  ? -2.549  26.921  83.633  1.00  29.92 ? 23  THR C CB  1 
ATOM   3442 O  OG1 . THR C 1 24  ? -2.577  26.128  84.832  1.00  29.59 ? 23  THR C OG1 1 
ATOM   3443 C  CG2 . THR C 1 24  ? -1.231  26.678  82.876  1.00  30.74 ? 23  THR C CG2 1 
ATOM   3444 N  N   . MET C 1 25  ? -3.204  29.391  81.813  1.00  28.66 ? 24  MET C N   1 
ATOM   3445 C  CA  . MET C 1 25  ? -2.931  30.274  80.675  1.00  28.32 ? 24  MET C CA  1 
ATOM   3446 C  C   . MET C 1 25  ? -2.667  31.710  81.124  1.00  28.46 ? 24  MET C C   1 
ATOM   3447 O  O   . MET C 1 25  ? -1.676  32.314  80.699  1.00  28.51 ? 24  MET C O   1 
ATOM   3448 C  CB  . MET C 1 25  ? -4.044  30.232  79.621  1.00  28.66 ? 24  MET C CB  1 
ATOM   3449 C  CG  . MET C 1 25  ? -4.161  28.901  78.873  1.00  29.76 ? 24  MET C CG  1 
ATOM   3450 S  SD  . MET C 1 25  ? -2.701  28.473  77.866  1.00  32.96 ? 24  MET C SD  1 
ATOM   3451 C  CE  . MET C 1 25  ? -2.683  29.825  76.675  1.00  34.19 ? 24  MET C CE  1 
ATOM   3452 N  N   . GLU C 1 26  ? -3.520  32.241  82.002  1.00  27.85 ? 25  GLU C N   1 
ATOM   3453 C  CA  . GLU C 1 26  ? -3.347  33.611  82.493  1.00  28.39 ? 25  GLU C CA  1 
ATOM   3454 C  C   . GLU C 1 26  ? -2.025  33.812  83.264  1.00  28.02 ? 25  GLU C C   1 
ATOM   3455 O  O   . GLU C 1 26  ? -1.266  34.756  82.982  1.00  27.96 ? 25  GLU C O   1 
ATOM   3456 C  CB  . GLU C 1 26  ? -4.556  34.059  83.325  1.00  28.64 ? 25  GLU C CB  1 
ATOM   3457 C  CG  . GLU C 1 26  ? -4.449  35.495  83.810  1.00  30.74 ? 25  GLU C CG  1 
ATOM   3458 C  CD  . GLU C 1 26  ? -5.767  36.084  84.277  1.00  34.36 ? 25  GLU C CD  1 
ATOM   3459 O  OE1 . GLU C 1 26  ? -6.830  35.471  84.032  1.00  33.51 ? 25  GLU C OE1 1 
ATOM   3460 O  OE2 . GLU C 1 26  ? -5.730  37.177  84.886  1.00  36.10 ? 25  GLU C OE2 1 
ATOM   3461 N  N   . ILE C 1 27  ? -1.754  32.936  84.230  1.00  27.41 ? 26  ILE C N   1 
ATOM   3462 C  CA  . ILE C 1 27  ? -0.520  33.035  85.027  1.00  27.58 ? 26  ILE C CA  1 
ATOM   3463 C  C   . ILE C 1 27  ? 0.710   32.839  84.134  1.00  27.21 ? 26  ILE C C   1 
ATOM   3464 O  O   . ILE C 1 27  ? 1.688   33.600  84.207  1.00  26.75 ? 26  ILE C O   1 
ATOM   3465 C  CB  . ILE C 1 27  ? -0.487  32.012  86.205  1.00  26.90 ? 26  ILE C CB  1 
ATOM   3466 C  CG1 . ILE C 1 27  ? -1.607  32.315  87.210  1.00  28.38 ? 26  ILE C CG1 1 
ATOM   3467 C  CG2 . ILE C 1 27  ? 0.887   32.046  86.910  1.00  26.82 ? 26  ILE C CG2 1 
ATOM   3468 C  CD1 . ILE C 1 27  ? -1.888  31.186  88.213  1.00  28.26 ? 26  ILE C CD1 1 
ATOM   3469 N  N   . HIS C 1 28  ? 0.642   31.822  83.278  1.00  27.14 ? 27  HIS C N   1 
ATOM   3470 C  CA  . HIS C 1 28  ? 1.738   31.509  82.374  1.00  27.75 ? 27  HIS C CA  1 
ATOM   3471 C  C   . HIS C 1 28  ? 2.087   32.715  81.512  1.00  28.08 ? 27  HIS C C   1 
ATOM   3472 O  O   . HIS C 1 28  ? 3.257   33.036  81.323  1.00  28.41 ? 27  HIS C O   1 
ATOM   3473 C  CB  . HIS C 1 28  ? 1.343   30.338  81.481  1.00  27.94 ? 27  HIS C CB  1 
ATOM   3474 C  CG  . HIS C 1 28  ? 2.507   29.577  80.937  1.00  28.72 ? 27  HIS C CG  1 
ATOM   3475 N  ND1 . HIS C 1 28  ? 2.354   28.385  80.274  1.00  29.31 ? 27  HIS C ND1 1 
ATOM   3476 C  CD2 . HIS C 1 28  ? 3.839   29.827  80.964  1.00  29.65 ? 27  HIS C CD2 1 
ATOM   3477 C  CE1 . HIS C 1 28  ? 3.539   27.936  79.898  1.00  29.69 ? 27  HIS C CE1 1 
ATOM   3478 N  NE2 . HIS C 1 28  ? 4.456   28.789  80.312  1.00  27.94 ? 27  HIS C NE2 1 
ATOM   3479 N  N   . HIS C 1 29  ? 1.056   33.390  81.009  1.00  28.31 ? 28  HIS C N   1 
ATOM   3480 C  CA  . HIS C 1 29  ? 1.242   34.533  80.114  1.00  27.99 ? 28  HIS C CA  1 
ATOM   3481 C  C   . HIS C 1 29  ? 1.628   35.796  80.912  1.00  27.95 ? 28  HIS C C   1 
ATOM   3482 O  O   . HIS C 1 29  ? 2.690   36.389  80.673  1.00  27.26 ? 28  HIS C O   1 
ATOM   3483 C  CB  . HIS C 1 29  ? -0.026  34.712  79.263  1.00  27.90 ? 28  HIS C CB  1 
ATOM   3484 C  CG  . HIS C 1 29  ? 0.026   35.859  78.302  1.00  30.00 ? 28  HIS C CG  1 
ATOM   3485 N  ND1 . HIS C 1 29  ? -0.869  36.905  78.351  1.00  30.88 ? 28  HIS C ND1 1 
ATOM   3486 C  CD2 . HIS C 1 29  ? 0.855   36.120  77.263  1.00  30.80 ? 28  HIS C CD2 1 
ATOM   3487 C  CE1 . HIS C 1 29  ? -0.590  37.766  77.387  1.00  31.37 ? 28  HIS C CE1 1 
ATOM   3488 N  NE2 . HIS C 1 29  ? 0.448   37.310  76.710  1.00  29.85 ? 28  HIS C NE2 1 
ATOM   3489 N  N   . THR C 1 30  ? 0.800   36.174  81.886  1.00  27.14 ? 29  THR C N   1 
ATOM   3490 C  CA  . THR C 1 30  ? 0.978   37.464  82.583  1.00  27.68 ? 29  THR C CA  1 
ATOM   3491 C  C   . THR C 1 30  ? 2.056   37.514  83.671  1.00  27.91 ? 29  THR C C   1 
ATOM   3492 O  O   . THR C 1 30  ? 2.479   38.604  84.063  1.00  27.92 ? 29  THR C O   1 
ATOM   3493 C  CB  . THR C 1 30  ? -0.344  38.010  83.184  1.00  27.92 ? 29  THR C CB  1 
ATOM   3494 O  OG1 . THR C 1 30  ? -0.751  37.196  84.298  1.00  27.23 ? 29  THR C OG1 1 
ATOM   3495 C  CG2 . THR C 1 30  ? -1.438  38.061  82.118  1.00  28.67 ? 29  THR C CG2 1 
ATOM   3496 N  N   . LYS C 1 31  ? 2.466   36.355  84.181  1.00  27.90 ? 30  LYS C N   1 
ATOM   3497 C  CA  . LYS C 1 31  ? 3.499   36.308  85.220  1.00  28.49 ? 30  LYS C CA  1 
ATOM   3498 C  C   . LYS C 1 31  ? 4.790   35.735  84.662  1.00  28.38 ? 30  LYS C C   1 
ATOM   3499 O  O   . LYS C 1 31  ? 5.804   36.423  84.648  1.00  29.40 ? 30  LYS C O   1 
ATOM   3500 C  CB  . LYS C 1 31  ? 3.046   35.520  86.468  1.00  27.90 ? 30  LYS C CB  1 
ATOM   3501 C  CG  . LYS C 1 31  ? 1.665   35.904  87.024  1.00  29.06 ? 30  LYS C CG  1 
ATOM   3502 C  CD  . LYS C 1 31  ? 1.625   37.325  87.573  1.00  31.58 ? 30  LYS C CD  1 
ATOM   3503 C  CE  . LYS C 1 31  ? 0.281   37.607  88.248  1.00  34.62 ? 30  LYS C CE  1 
ATOM   3504 N  NZ  . LYS C 1 31  ? 0.139   39.062  88.544  1.00  37.10 ? 30  LYS C NZ  1 
ATOM   3505 N  N   . HIS C 1 32  ? 4.745   34.493  84.176  1.00  28.85 ? 31  HIS C N   1 
ATOM   3506 C  CA  . HIS C 1 32  ? 5.956   33.810  83.703  1.00  28.02 ? 31  HIS C CA  1 
ATOM   3507 C  C   . HIS C 1 32  ? 6.535   34.470  82.461  1.00  27.99 ? 31  HIS C C   1 
ATOM   3508 O  O   . HIS C 1 32  ? 7.680   34.913  82.475  1.00  26.27 ? 31  HIS C O   1 
ATOM   3509 C  CB  . HIS C 1 32  ? 5.718   32.306  83.483  1.00  28.54 ? 31  HIS C CB  1 
ATOM   3510 C  CG  . HIS C 1 32  ? 5.466   31.548  84.749  1.00  29.43 ? 31  HIS C CG  1 
ATOM   3511 N  ND1 . HIS C 1 32  ? 6.478   31.174  85.605  1.00  31.02 ? 31  HIS C ND1 1 
ATOM   3512 C  CD2 . HIS C 1 32  ? 4.317   31.110  85.313  1.00  29.67 ? 31  HIS C CD2 1 
ATOM   3513 C  CE1 . HIS C 1 32  ? 5.964   30.538  86.644  1.00  31.10 ? 31  HIS C CE1 1 
ATOM   3514 N  NE2 . HIS C 1 32  ? 4.654   30.486  86.492  1.00  30.42 ? 31  HIS C NE2 1 
ATOM   3515 N  N   . HIS C 1 33  ? 5.739   34.578  81.402  1.00  27.46 ? 32  HIS C N   1 
ATOM   3516 C  CA  . HIS C 1 33  ? 6.237   35.189  80.177  1.00  27.60 ? 32  HIS C CA  1 
ATOM   3517 C  C   . HIS C 1 33  ? 6.619   36.661  80.383  1.00  27.45 ? 32  HIS C C   1 
ATOM   3518 O  O   . HIS C 1 33  ? 7.673   37.093  79.919  1.00  27.27 ? 32  HIS C O   1 
ATOM   3519 C  CB  . HIS C 1 33  ? 5.249   34.987  79.018  1.00  27.27 ? 32  HIS C CB  1 
ATOM   3520 C  CG  . HIS C 1 33  ? 5.802   35.347  77.669  1.00  28.68 ? 32  HIS C CG  1 
ATOM   3521 N  ND1 . HIS C 1 33  ? 5.054   35.259  76.515  1.00  29.05 ? 32  HIS C ND1 1 
ATOM   3522 C  CD2 . HIS C 1 33  ? 7.012   35.832  77.295  1.00  28.13 ? 32  HIS C CD2 1 
ATOM   3523 C  CE1 . HIS C 1 33  ? 5.789   35.641  75.484  1.00  28.70 ? 32  HIS C CE1 1 
ATOM   3524 N  NE2 . HIS C 1 33  ? 6.975   36.008  75.933  1.00  27.32 ? 32  HIS C NE2 1 
ATOM   3525 N  N   . GLN C 1 34  ? 5.787   37.405  81.112  1.00  27.55 ? 33  GLN C N   1 
ATOM   3526 C  CA  . GLN C 1 34  ? 6.068   38.807  81.433  1.00  27.92 ? 33  GLN C CA  1 
ATOM   3527 C  C   . GLN C 1 34  ? 7.425   38.989  82.112  1.00  27.58 ? 33  GLN C C   1 
ATOM   3528 O  O   . GLN C 1 34  ? 8.154   39.926  81.806  1.00  27.47 ? 33  GLN C O   1 
ATOM   3529 C  CB  . GLN C 1 34  ? 4.959   39.397  82.319  1.00  28.37 ? 33  GLN C CB  1 
ATOM   3530 C  CG  . GLN C 1 34  ? 5.154   40.870  82.635  1.00  29.83 ? 33  GLN C CG  1 
ATOM   3531 C  CD  . GLN C 1 34  ? 4.901   41.739  81.422  1.00  31.82 ? 33  GLN C CD  1 
ATOM   3532 O  OE1 . GLN C 1 34  ? 3.786   41.797  80.918  1.00  31.77 ? 33  GLN C OE1 1 
ATOM   3533 N  NE2 . GLN C 1 34  ? 5.943   42.403  80.933  1.00  32.19 ? 33  GLN C NE2 1 
ATOM   3534 N  N   . THR C 1 35  ? 7.755   38.082  83.028  1.00  27.64 ? 34  THR C N   1 
ATOM   3535 C  CA  . THR C 1 35  ? 9.026   38.130  83.752  1.00  28.48 ? 34  THR C CA  1 
ATOM   3536 C  C   . THR C 1 35  ? 10.220  37.953  82.801  1.00  28.10 ? 34  THR C C   1 
ATOM   3537 O  O   . THR C 1 35  ? 11.221  38.663  82.925  1.00  28.19 ? 34  THR C O   1 
ATOM   3538 C  CB  . THR C 1 35  ? 9.050   37.099  84.901  1.00  28.60 ? 34  THR C CB  1 
ATOM   3539 O  OG1 . THR C 1 35  ? 8.101   37.501  85.897  1.00  30.55 ? 34  THR C OG1 1 
ATOM   3540 C  CG2 . THR C 1 35  ? 10.449  36.992  85.541  1.00  30.95 ? 34  THR C CG2 1 
ATOM   3541 N  N   . TYR C 1 36  ? 10.097  37.042  81.834  1.00  27.39 ? 35  TYR C N   1 
ATOM   3542 C  CA  . TYR C 1 36  ? 11.158  36.857  80.842  1.00  27.53 ? 35  TYR C CA  1 
ATOM   3543 C  C   . TYR C 1 36  ? 11.343  38.121  80.003  1.00  27.16 ? 35  TYR C C   1 
ATOM   3544 O  O   . TYR C 1 36  ? 12.465  38.524  79.744  1.00  26.53 ? 35  TYR C O   1 
ATOM   3545 C  CB  . TYR C 1 36  ? 10.898  35.639  79.949  1.00  27.83 ? 35  TYR C CB  1 
ATOM   3546 C  CG  . TYR C 1 36  ? 10.893  34.332  80.713  1.00  28.17 ? 35  TYR C CG  1 
ATOM   3547 C  CD1 . TYR C 1 36  ? 11.914  34.031  81.626  1.00  28.76 ? 35  TYR C CD1 1 
ATOM   3548 C  CD2 . TYR C 1 36  ? 9.875   33.403  80.530  1.00  29.03 ? 35  TYR C CD2 1 
ATOM   3549 C  CE1 . TYR C 1 36  ? 11.916  32.819  82.330  1.00  30.18 ? 35  TYR C CE1 1 
ATOM   3550 C  CE2 . TYR C 1 36  ? 9.850   32.203  81.245  1.00  29.65 ? 35  TYR C CE2 1 
ATOM   3551 C  CZ  . TYR C 1 36  ? 10.872  31.918  82.136  1.00  31.04 ? 35  TYR C CZ  1 
ATOM   3552 O  OH  . TYR C 1 36  ? 10.856  30.727  82.831  1.00  32.72 ? 35  TYR C OH  1 
ATOM   3553 N  N   . VAL C 1 37  ? 10.230  38.740  79.607  1.00  26.80 ? 36  VAL C N   1 
ATOM   3554 C  CA  . VAL C 1 37  ? 10.255  39.996  78.851  1.00  27.21 ? 36  VAL C CA  1 
ATOM   3555 C  C   . VAL C 1 37  ? 10.984  41.101  79.628  1.00  27.59 ? 36  VAL C C   1 
ATOM   3556 O  O   . VAL C 1 37  ? 11.880  41.767  79.084  1.00  26.95 ? 36  VAL C O   1 
ATOM   3557 C  CB  . VAL C 1 37  ? 8.828   40.468  78.474  1.00  26.93 ? 36  VAL C CB  1 
ATOM   3558 C  CG1 . VAL C 1 37  ? 8.852   41.859  77.819  1.00  26.69 ? 36  VAL C CG1 1 
ATOM   3559 C  CG2 . VAL C 1 37  ? 8.186   39.470  77.544  1.00  26.93 ? 36  VAL C CG2 1 
ATOM   3560 N  N   . ASP C 1 38  ? 10.586  41.291  80.887  1.00  27.96 ? 37  ASP C N   1 
ATOM   3561 C  CA  . ASP C 1 38  ? 11.132  42.361  81.735  1.00  28.97 ? 37  ASP C CA  1 
ATOM   3562 C  C   . ASP C 1 38  ? 12.631  42.170  81.963  1.00  29.03 ? 37  ASP C C   1 
ATOM   3563 O  O   . ASP C 1 38  ? 13.419  43.120  81.861  1.00  28.98 ? 37  ASP C O   1 
ATOM   3564 C  CB  . ASP C 1 38  ? 10.421  42.391  83.093  1.00  29.24 ? 37  ASP C CB  1 
ATOM   3565 C  CG  . ASP C 1 38  ? 8.960   42.837  82.999  1.00  31.54 ? 37  ASP C CG  1 
ATOM   3566 O  OD1 . ASP C 1 38  ? 8.503   43.309  81.931  1.00  34.19 ? 37  ASP C OD1 1 
ATOM   3567 O  OD2 . ASP C 1 38  ? 8.258   42.694  84.019  1.00  34.55 ? 37  ASP C OD2 1 
ATOM   3568 N  N   . ASN C 1 39  ? 13.021  40.935  82.271  1.00  29.28 ? 38  ASN C N   1 
ATOM   3569 C  CA  . ASN C 1 39  ? 14.411  40.627  82.580  1.00  29.43 ? 38  ASN C CA  1 
ATOM   3570 C  C   . ASN C 1 39  ? 15.309  40.662  81.341  1.00  29.55 ? 38  ASN C C   1 
ATOM   3571 O  O   . ASN C 1 39  ? 16.469  41.073  81.431  1.00  29.91 ? 38  ASN C O   1 
ATOM   3572 C  CB  . ASN C 1 39  ? 14.511  39.275  83.287  1.00  29.42 ? 38  ASN C CB  1 
ATOM   3573 C  CG  . ASN C 1 39  ? 14.034  39.337  84.717  1.00  30.45 ? 38  ASN C CG  1 
ATOM   3574 O  OD1 . ASN C 1 39  ? 13.934  40.415  85.296  1.00  31.45 ? 38  ASN C OD1 1 
ATOM   3575 N  ND2 . ASN C 1 39  ? 13.739  38.180  85.299  1.00  31.92 ? 38  ASN C ND2 1 
ATOM   3576 N  N   . ALA C 1 40  ? 14.761  40.240  80.201  1.00  29.45 ? 39  ALA C N   1 
ATOM   3577 C  CA  . ALA C 1 40  ? 15.444  40.364  78.911  1.00  29.44 ? 39  ALA C CA  1 
ATOM   3578 C  C   . ALA C 1 40  ? 15.706  41.827  78.570  1.00  29.70 ? 39  ALA C C   1 
ATOM   3579 O  O   . ALA C 1 40  ? 16.817  42.186  78.163  1.00  29.80 ? 39  ALA C O   1 
ATOM   3580 C  CB  . ALA C 1 40  ? 14.631  39.700  77.801  1.00  29.42 ? 39  ALA C CB  1 
ATOM   3581 N  N   . ASN C 1 41  ? 14.677  42.663  78.729  1.00  29.82 ? 40  ASN C N   1 
ATOM   3582 C  CA  . ASN C 1 41  ? 14.788  44.102  78.467  1.00  30.12 ? 40  ASN C CA  1 
ATOM   3583 C  C   . ASN C 1 41  ? 15.879  44.760  79.300  1.00  30.68 ? 40  ASN C C   1 
ATOM   3584 O  O   . ASN C 1 41  ? 16.675  45.555  78.789  1.00  30.14 ? 40  ASN C O   1 
ATOM   3585 C  CB  . ASN C 1 41  ? 13.440  44.804  78.707  1.00  30.12 ? 40  ASN C CB  1 
ATOM   3586 C  CG  . ASN C 1 41  ? 12.471  44.624  77.548  1.00  29.92 ? 40  ASN C CG  1 
ATOM   3587 O  OD1 . ASN C 1 41  ? 12.879  44.372  76.412  1.00  30.88 ? 40  ASN C OD1 1 
ATOM   3588 N  ND2 . ASN C 1 41  ? 11.182  44.761  77.828  1.00  28.57 ? 40  ASN C ND2 1 
ATOM   3589 N  N   . LYS C 1 42  ? 15.926  44.410  80.582  1.00  31.23 ? 41  LYS C N   1 
ATOM   3590 C  CA  . LYS C 1 42  ? 16.943  44.952  81.482  1.00  32.24 ? 41  LYS C CA  1 
ATOM   3591 C  C   . LYS C 1 42  ? 18.353  44.552  81.029  1.00  32.00 ? 41  LYS C C   1 
ATOM   3592 O  O   . LYS C 1 42  ? 19.276  45.369  81.058  1.00  31.87 ? 41  LYS C O   1 
ATOM   3593 C  CB  . LYS C 1 42  ? 16.691  44.507  82.928  1.00  32.66 ? 41  LYS C CB  1 
ATOM   3594 C  CG  . LYS C 1 42  ? 17.601  45.196  83.945  1.00  35.80 ? 41  LYS C CG  1 
ATOM   3595 C  CD  . LYS C 1 42  ? 16.894  45.407  85.280  1.00  40.96 ? 41  LYS C CD  1 
ATOM   3596 C  CE  . LYS C 1 42  ? 17.667  46.371  86.182  1.00  42.54 ? 41  LYS C CE  1 
ATOM   3597 N  NZ  . LYS C 1 42  ? 16.936  46.656  87.468  1.00  44.77 ? 41  LYS C NZ  1 
ATOM   3598 N  N   . ALA C 1 43  ? 18.509  43.298  80.608  1.00  31.61 ? 42  ALA C N   1 
ATOM   3599 C  CA  . ALA C 1 43  ? 19.808  42.790  80.148  1.00  31.42 ? 42  ALA C CA  1 
ATOM   3600 C  C   . ALA C 1 43  ? 20.251  43.439  78.830  1.00  31.04 ? 42  ALA C C   1 
ATOM   3601 O  O   . ALA C 1 43  ? 21.443  43.665  78.606  1.00  31.48 ? 42  ALA C O   1 
ATOM   3602 C  CB  . ALA C 1 43  ? 19.765  41.260  80.018  1.00  31.16 ? 42  ALA C CB  1 
ATOM   3603 N  N   . LEU C 1 44  ? 19.283  43.769  77.981  1.00  30.80 ? 43  LEU C N   1 
ATOM   3604 C  CA  . LEU C 1 44  ? 19.564  44.361  76.675  1.00  31.14 ? 43  LEU C CA  1 
ATOM   3605 C  C   . LEU C 1 44  ? 19.878  45.854  76.711  1.00  31.55 ? 43  LEU C C   1 
ATOM   3606 O  O   . LEU C 1 44  ? 20.392  46.404  75.732  1.00  30.92 ? 43  LEU C O   1 
ATOM   3607 C  CB  . LEU C 1 44  ? 18.410  44.099  75.710  1.00  31.00 ? 43  LEU C CB  1 
ATOM   3608 C  CG  . LEU C 1 44  ? 18.329  42.689  75.124  1.00  31.04 ? 43  LEU C CG  1 
ATOM   3609 C  CD1 . LEU C 1 44  ? 17.054  42.564  74.353  1.00  32.06 ? 43  LEU C CD1 1 
ATOM   3610 C  CD2 . LEU C 1 44  ? 19.515  42.383  74.226  1.00  31.62 ? 43  LEU C CD2 1 
ATOM   3611 N  N   . GLU C 1 45  ? 19.554  46.507  77.828  1.00  32.05 ? 44  GLU C N   1 
ATOM   3612 C  CA  . GLU C 1 45  ? 19.860  47.924  78.003  1.00  32.85 ? 44  GLU C CA  1 
ATOM   3613 C  C   . GLU C 1 45  ? 21.371  48.127  77.942  1.00  32.70 ? 44  GLU C C   1 
ATOM   3614 O  O   . GLU C 1 45  ? 22.124  47.394  78.585  1.00  32.84 ? 44  GLU C O   1 
ATOM   3615 C  CB  . GLU C 1 45  ? 19.311  48.444  79.335  1.00  32.67 ? 44  GLU C CB  1 
ATOM   3616 C  CG  . GLU C 1 45  ? 17.791  48.602  79.381  1.00  34.53 ? 44  GLU C CG  1 
ATOM   3617 C  CD  . GLU C 1 45  ? 17.293  49.254  80.677  1.00  34.53 ? 44  GLU C CD  1 
ATOM   3618 O  OE1 . GLU C 1 45  ? 17.757  50.363  81.013  1.00  38.99 ? 44  GLU C OE1 1 
ATOM   3619 O  OE2 . GLU C 1 45  ? 16.425  48.664  81.355  1.00  38.16 ? 44  GLU C OE2 1 
ATOM   3620 N  N   . GLY C 1 46  ? 21.801  49.103  77.149  1.00  32.80 ? 45  GLY C N   1 
ATOM   3621 C  CA  . GLY C 1 46  ? 23.221  49.416  76.988  1.00  33.23 ? 45  GLY C CA  1 
ATOM   3622 C  C   . GLY C 1 46  ? 23.918  48.648  75.879  1.00  33.42 ? 45  GLY C C   1 
ATOM   3623 O  O   . GLY C 1 46  ? 25.025  49.016  75.461  1.00  33.53 ? 45  GLY C O   1 
ATOM   3624 N  N   . THR C 1 47  ? 23.274  47.588  75.399  1.00  33.52 ? 46  THR C N   1 
ATOM   3625 C  CA  . THR C 1 47  ? 23.831  46.737  74.350  1.00  33.91 ? 46  THR C CA  1 
ATOM   3626 C  C   . THR C 1 47  ? 23.445  47.275  72.972  1.00  34.44 ? 46  THR C C   1 
ATOM   3627 O  O   . THR C 1 47  ? 22.534  48.098  72.852  1.00  34.19 ? 46  THR C O   1 
ATOM   3628 C  CB  . THR C 1 47  ? 23.331  45.268  74.462  1.00  33.80 ? 46  THR C CB  1 
ATOM   3629 O  OG1 . THR C 1 47  ? 21.987  45.180  73.981  1.00  32.77 ? 46  THR C OG1 1 
ATOM   3630 C  CG2 . THR C 1 47  ? 23.387  44.764  75.900  1.00  33.79 ? 46  THR C CG2 1 
ATOM   3631 N  N   . GLU C 1 48  ? 24.125  46.794  71.936  1.00  35.08 ? 47  GLU C N   1 
ATOM   3632 C  CA  . GLU C 1 48  ? 23.770  47.147  70.566  1.00  36.46 ? 47  GLU C CA  1 
ATOM   3633 C  C   . GLU C 1 48  ? 22.751  46.166  69.968  1.00  36.78 ? 47  GLU C C   1 
ATOM   3634 O  O   . GLU C 1 48  ? 22.525  46.150  68.758  1.00  36.84 ? 47  GLU C O   1 
ATOM   3635 C  CB  . GLU C 1 48  ? 25.026  47.257  69.685  1.00  36.61 ? 47  GLU C CB  1 
ATOM   3636 C  CG  . GLU C 1 48  ? 25.860  45.981  69.576  1.00  37.41 ? 47  GLU C CG  1 
ATOM   3637 C  CD  . GLU C 1 48  ? 26.980  46.098  68.550  1.00  37.74 ? 47  GLU C CD  1 
ATOM   3638 O  OE1 . GLU C 1 48  ? 27.007  45.269  67.612  1.00  40.25 ? 47  GLU C OE1 1 
ATOM   3639 O  OE2 . GLU C 1 48  ? 27.826  47.013  68.672  1.00  38.33 ? 47  GLU C OE2 1 
ATOM   3640 N  N   . PHE C 1 49  ? 22.116  45.374  70.829  1.00  37.42 ? 48  PHE C N   1 
ATOM   3641 C  CA  . PHE C 1 49  ? 21.267  44.268  70.378  1.00  38.14 ? 48  PHE C CA  1 
ATOM   3642 C  C   . PHE C 1 49  ? 19.776  44.449  70.671  1.00  38.71 ? 48  PHE C C   1 
ATOM   3643 O  O   . PHE C 1 49  ? 18.973  43.567  70.356  1.00  38.66 ? 48  PHE C O   1 
ATOM   3644 C  CB  . PHE C 1 49  ? 21.767  42.950  70.976  1.00  38.08 ? 48  PHE C CB  1 
ATOM   3645 C  CG  . PHE C 1 49  ? 23.112  42.515  70.455  1.00  38.33 ? 48  PHE C CG  1 
ATOM   3646 C  CD1 . PHE C 1 49  ? 23.203  41.700  69.329  1.00  38.75 ? 48  PHE C CD1 1 
ATOM   3647 C  CD2 . PHE C 1 49  ? 24.287  42.917  71.088  1.00  38.38 ? 48  PHE C CD2 1 
ATOM   3648 C  CE1 . PHE C 1 49  ? 24.440  41.290  68.843  1.00  38.57 ? 48  PHE C CE1 1 
ATOM   3649 C  CE2 . PHE C 1 49  ? 25.531  42.515  70.607  1.00  38.21 ? 48  PHE C CE2 1 
ATOM   3650 C  CZ  . PHE C 1 49  ? 25.607  41.700  69.487  1.00  38.84 ? 48  PHE C CZ  1 
ATOM   3651 N  N   . ALA C 1 50  ? 19.408  45.593  71.247  1.00  39.35 ? 49  ALA C N   1 
ATOM   3652 C  CA  . ALA C 1 50  ? 18.033  45.831  71.709  1.00  40.19 ? 49  ALA C CA  1 
ATOM   3653 C  C   . ALA C 1 50  ? 16.974  45.806  70.600  1.00  40.65 ? 49  ALA C C   1 
ATOM   3654 O  O   . ALA C 1 50  ? 15.819  45.439  70.847  1.00  41.28 ? 49  ALA C O   1 
ATOM   3655 C  CB  . ALA C 1 50  ? 17.955  47.138  72.495  1.00  40.12 ? 49  ALA C CB  1 
ATOM   3656 N  N   . ASP C 1 51  ? 17.377  46.171  69.386  1.00  40.98 ? 50  ASP C N   1 
ATOM   3657 C  CA  . ASP C 1 51  ? 16.462  46.315  68.248  1.00  41.12 ? 50  ASP C CA  1 
ATOM   3658 C  C   . ASP C 1 51  ? 16.242  45.032  67.429  1.00  40.71 ? 50  ASP C C   1 
ATOM   3659 O  O   . ASP C 1 51  ? 15.435  45.023  66.494  1.00  40.75 ? 50  ASP C O   1 
ATOM   3660 C  CB  . ASP C 1 51  ? 16.952  47.441  67.328  1.00  41.63 ? 50  ASP C CB  1 
ATOM   3661 C  CG  . ASP C 1 51  ? 18.378  47.221  66.840  1.00  43.01 ? 50  ASP C CG  1 
ATOM   3662 O  OD1 . ASP C 1 51  ? 19.128  46.452  67.490  1.00  45.01 ? 50  ASP C OD1 1 
ATOM   3663 O  OD2 . ASP C 1 51  ? 18.750  47.820  65.806  1.00  44.96 ? 50  ASP C OD2 1 
ATOM   3664 N  N   . LEU C 1 52  ? 16.954  43.961  67.775  1.00  39.99 ? 51  LEU C N   1 
ATOM   3665 C  CA  . LEU C 1 52  ? 16.825  42.690  67.059  1.00  39.36 ? 51  LEU C CA  1 
ATOM   3666 C  C   . LEU C 1 52  ? 15.554  41.940  67.444  1.00  38.68 ? 51  LEU C C   1 
ATOM   3667 O  O   . LEU C 1 52  ? 15.149  41.978  68.609  1.00  38.62 ? 51  LEU C O   1 
ATOM   3668 C  CB  . LEU C 1 52  ? 18.027  41.784  67.337  1.00  39.58 ? 51  LEU C CB  1 
ATOM   3669 C  CG  . LEU C 1 52  ? 19.357  41.987  66.609  1.00  40.40 ? 51  LEU C CG  1 
ATOM   3670 C  CD1 . LEU C 1 52  ? 20.344  40.940  67.093  1.00  41.22 ? 51  LEU C CD1 1 
ATOM   3671 C  CD2 . LEU C 1 52  ? 19.200  41.897  65.093  1.00  41.41 ? 51  LEU C CD2 1 
ATOM   3672 N  N   . PRO C 1 53  ? 14.922  41.250  66.469  1.00  37.86 ? 52  PRO C N   1 
ATOM   3673 C  CA  . PRO C 1 53  ? 13.884  40.285  66.828  1.00  37.12 ? 52  PRO C CA  1 
ATOM   3674 C  C   . PRO C 1 53  ? 14.487  39.245  67.767  1.00  36.21 ? 52  PRO C C   1 
ATOM   3675 O  O   . PRO C 1 53  ? 15.631  38.843  67.573  1.00  35.79 ? 52  PRO C O   1 
ATOM   3676 C  CB  . PRO C 1 53  ? 13.524  39.640  65.486  1.00  37.19 ? 52  PRO C CB  1 
ATOM   3677 C  CG  . PRO C 1 53  ? 13.877  40.674  64.472  1.00  37.73 ? 52  PRO C CG  1 
ATOM   3678 C  CD  . PRO C 1 53  ? 15.117  41.325  65.008  1.00  37.92 ? 52  PRO C CD  1 
ATOM   3679 N  N   . VAL C 1 54  ? 13.734  38.831  68.782  1.00  35.51 ? 53  VAL C N   1 
ATOM   3680 C  CA  . VAL C 1 54  ? 14.258  37.913  69.808  1.00  34.99 ? 53  VAL C CA  1 
ATOM   3681 C  C   . VAL C 1 54  ? 14.801  36.587  69.238  1.00  34.96 ? 53  VAL C C   1 
ATOM   3682 O  O   . VAL C 1 54  ? 15.772  36.038  69.753  1.00  34.44 ? 53  VAL C O   1 
ATOM   3683 C  CB  . VAL C 1 54  ? 13.230  37.673  70.945  1.00  34.89 ? 53  VAL C CB  1 
ATOM   3684 C  CG1 . VAL C 1 54  ? 12.017  36.858  70.456  1.00  34.45 ? 53  VAL C CG1 1 
ATOM   3685 C  CG2 . VAL C 1 54  ? 13.895  36.999  72.148  1.00  34.27 ? 53  VAL C CG2 1 
ATOM   3686 N  N   . GLU C 1 55  ? 14.184  36.098  68.161  1.00  35.29 ? 54  GLU C N   1 
ATOM   3687 C  CA  . GLU C 1 55  ? 14.606  34.854  67.516  1.00  35.52 ? 54  GLU C CA  1 
ATOM   3688 C  C   . GLU C 1 55  ? 15.960  35.017  66.826  1.00  35.39 ? 54  GLU C C   1 
ATOM   3689 O  O   . GLU C 1 55  ? 16.678  34.036  66.610  1.00  35.60 ? 54  GLU C O   1 
ATOM   3690 C  CB  . GLU C 1 55  ? 13.543  34.369  66.516  1.00  35.99 ? 54  GLU C CB  1 
ATOM   3691 C  CG  . GLU C 1 55  ? 12.138  34.142  67.115  1.00  38.32 ? 54  GLU C CG  1 
ATOM   3692 C  CD  . GLU C 1 55  ? 11.307  35.429  67.269  1.00  41.77 ? 54  GLU C CD  1 
ATOM   3693 O  OE1 . GLU C 1 55  ? 11.724  36.506  66.767  1.00  41.24 ? 54  GLU C OE1 1 
ATOM   3694 O  OE2 . GLU C 1 55  ? 10.226  35.358  67.913  1.00  43.57 ? 54  GLU C OE2 1 
ATOM   3695 N  N   . GLN C 1 56  ? 16.297  36.258  66.474  1.00  35.07 ? 55  GLN C N   1 
ATOM   3696 C  CA  . GLN C 1 56  ? 17.612  36.585  65.939  1.00  34.89 ? 55  GLN C CA  1 
ATOM   3697 C  C   . GLN C 1 56  ? 18.641  36.801  67.057  1.00  34.25 ? 55  GLN C C   1 
ATOM   3698 O  O   . GLN C 1 56  ? 19.793  36.360  66.945  1.00  34.30 ? 55  GLN C O   1 
ATOM   3699 C  CB  . GLN C 1 56  ? 17.529  37.805  65.019  1.00  34.99 ? 55  GLN C CB  1 
ATOM   3700 C  CG  . GLN C 1 56  ? 16.669  37.572  63.777  1.00  35.83 ? 55  GLN C CG  1 
ATOM   3701 C  CD  . GLN C 1 56  ? 16.774  38.695  62.755  1.00  36.37 ? 55  GLN C CD  1 
ATOM   3702 O  OE1 . GLN C 1 56  ? 17.670  39.544  62.824  1.00  38.39 ? 55  GLN C OE1 1 
ATOM   3703 N  NE2 . GLN C 1 56  ? 15.859  38.692  61.782  1.00  38.14 ? 55  GLN C NE2 1 
ATOM   3704 N  N   . LEU C 1 57  ? 18.232  37.484  68.125  1.00  33.54 ? 56  LEU C N   1 
ATOM   3705 C  CA  . LEU C 1 57  ? 19.099  37.672  69.294  1.00  33.02 ? 56  LEU C CA  1 
ATOM   3706 C  C   . LEU C 1 57  ? 19.644  36.352  69.851  1.00  32.64 ? 56  LEU C C   1 
ATOM   3707 O  O   . LEU C 1 57  ? 20.842  36.233  70.100  1.00  32.21 ? 56  LEU C O   1 
ATOM   3708 C  CB  . LEU C 1 57  ? 18.383  38.444  70.415  1.00  33.17 ? 56  LEU C CB  1 
ATOM   3709 C  CG  . LEU C 1 57  ? 19.220  38.599  71.698  1.00  33.39 ? 56  LEU C CG  1 
ATOM   3710 C  CD1 . LEU C 1 57  ? 20.345  39.628  71.516  1.00  33.07 ? 56  LEU C CD1 1 
ATOM   3711 C  CD2 . LEU C 1 57  ? 18.379  38.941  72.895  1.00  35.60 ? 56  LEU C CD2 1 
ATOM   3712 N  N   . ILE C 1 58  ? 18.763  35.368  70.046  1.00  32.39 ? 57  ILE C N   1 
ATOM   3713 C  CA  . ILE C 1 58  ? 19.180  34.096  70.660  1.00  32.24 ? 57  ILE C CA  1 
ATOM   3714 C  C   . ILE C 1 58  ? 20.142  33.280  69.778  1.00  32.35 ? 57  ILE C C   1 
ATOM   3715 O  O   . ILE C 1 58  ? 20.778  32.338  70.248  1.00  31.86 ? 57  ILE C O   1 
ATOM   3716 C  CB  . ILE C 1 58  ? 17.984  33.255  71.168  1.00  32.43 ? 57  ILE C CB  1 
ATOM   3717 C  CG1 . ILE C 1 58  ? 17.103  32.764  70.009  1.00  32.11 ? 57  ILE C CG1 1 
ATOM   3718 C  CG2 . ILE C 1 58  ? 17.192  34.049  72.240  1.00  31.51 ? 57  ILE C CG2 1 
ATOM   3719 C  CD1 . ILE C 1 58  ? 16.135  31.654  70.420  1.00  32.84 ? 57  ILE C CD1 1 
ATOM   3720 N  N   . GLN C 1 59  ? 20.255  33.673  68.511  1.00  32.54 ? 58  GLN C N   1 
ATOM   3721 C  CA  . GLN C 1 59  ? 21.217  33.068  67.585  1.00  32.86 ? 58  GLN C CA  1 
ATOM   3722 C  C   . GLN C 1 59  ? 22.588  33.744  67.673  1.00  33.59 ? 58  GLN C C   1 
ATOM   3723 O  O   . GLN C 1 59  ? 23.555  33.283  67.059  1.00  33.58 ? 58  GLN C O   1 
ATOM   3724 C  CB  . GLN C 1 59  ? 20.697  33.137  66.145  1.00  32.71 ? 58  GLN C CB  1 
ATOM   3725 C  CG  . GLN C 1 59  ? 19.433  32.328  65.888  1.00  32.43 ? 58  GLN C CG  1 
ATOM   3726 C  CD  . GLN C 1 59  ? 18.931  32.473  64.469  1.00  32.71 ? 58  GLN C CD  1 
ATOM   3727 O  OE1 . GLN C 1 59  ? 19.616  32.106  63.513  1.00  32.89 ? 58  GLN C OE1 1 
ATOM   3728 N  NE2 . GLN C 1 59  ? 17.722  32.998  64.321  1.00  33.39 ? 58  GLN C NE2 1 
ATOM   3729 N  N   . GLN C 1 60  ? 22.667  34.831  68.443  1.00  33.94 ? 59  GLN C N   1 
ATOM   3730 C  CA  . GLN C 1 60  ? 23.883  35.642  68.530  1.00  35.07 ? 59  GLN C CA  1 
ATOM   3731 C  C   . GLN C 1 60  ? 24.370  35.835  69.963  1.00  34.88 ? 59  GLN C C   1 
ATOM   3732 O  O   . GLN C 1 60  ? 24.928  36.885  70.303  1.00  35.18 ? 59  GLN C O   1 
ATOM   3733 C  CB  . GLN C 1 60  ? 23.647  37.010  67.891  1.00  35.22 ? 59  GLN C CB  1 
ATOM   3734 C  CG  . GLN C 1 60  ? 23.449  36.973  66.399  1.00  37.87 ? 59  GLN C CG  1 
ATOM   3735 C  CD  . GLN C 1 60  ? 23.030  38.318  65.854  1.00  40.95 ? 59  GLN C CD  1 
ATOM   3736 O  OE1 . GLN C 1 60  ? 23.720  39.323  66.045  1.00  41.27 ? 59  GLN C OE1 1 
ATOM   3737 N  NE2 . GLN C 1 60  ? 21.888  38.347  65.170  1.00  41.88 ? 59  GLN C NE2 1 
ATOM   3738 N  N   . LEU C 1 61  ? 24.178  34.816  70.794  1.00  34.87 ? 60  LEU C N   1 
ATOM   3739 C  CA  . LEU C 1 61  ? 24.496  34.918  72.214  1.00  35.29 ? 60  LEU C CA  1 
ATOM   3740 C  C   . LEU C 1 61  ? 25.995  34.977  72.472  1.00  35.76 ? 60  LEU C C   1 
ATOM   3741 O  O   . LEU C 1 61  ? 26.420  35.424  73.535  1.00  35.94 ? 60  LEU C O   1 
ATOM   3742 C  CB  . LEU C 1 61  ? 23.847  33.783  73.009  1.00  34.86 ? 60  LEU C CB  1 
ATOM   3743 C  CG  . LEU C 1 61  ? 22.323  33.871  73.181  1.00  34.45 ? 60  LEU C CG  1 
ATOM   3744 C  CD1 . LEU C 1 61  ? 21.801  32.625  73.872  1.00  34.13 ? 60  LEU C CD1 1 
ATOM   3745 C  CD2 . LEU C 1 61  ? 21.903  35.131  73.938  1.00  33.76 ? 60  LEU C CD2 1 
ATOM   3746 N  N   . ASP C 1 62  ? 26.788  34.545  71.495  1.00  36.44 ? 61  ASP C N   1 
ATOM   3747 C  CA  . ASP C 1 62  ? 28.242  34.677  71.566  1.00  37.40 ? 61  ASP C CA  1 
ATOM   3748 C  C   . ASP C 1 62  ? 28.741  36.102  71.258  1.00  37.48 ? 61  ASP C C   1 
ATOM   3749 O  O   . ASP C 1 62  ? 29.880  36.445  71.584  1.00  37.41 ? 61  ASP C O   1 
ATOM   3750 C  CB  . ASP C 1 62  ? 28.932  33.644  70.661  1.00  37.66 ? 61  ASP C CB  1 
ATOM   3751 C  CG  . ASP C 1 62  ? 28.350  33.601  69.246  1.00  39.43 ? 61  ASP C CG  1 
ATOM   3752 O  OD1 . ASP C 1 62  ? 27.195  34.035  69.033  1.00  42.22 ? 61  ASP C OD1 1 
ATOM   3753 O  OD2 . ASP C 1 62  ? 29.047  33.108  68.336  1.00  41.76 ? 61  ASP C OD2 1 
ATOM   3754 N  N   . ARG C 1 63  ? 27.882  36.929  70.656  1.00  37.69 ? 62  ARG C N   1 
ATOM   3755 C  CA  . ARG C 1 63  ? 28.243  38.307  70.281  1.00  37.97 ? 62  ARG C CA  1 
ATOM   3756 C  C   . ARG C 1 63  ? 27.803  39.364  71.296  1.00  37.75 ? 62  ARG C C   1 
ATOM   3757 O  O   . ARG C 1 63  ? 28.240  40.512  71.216  1.00  37.85 ? 62  ARG C O   1 
ATOM   3758 C  CB  . ARG C 1 63  ? 27.678  38.674  68.905  1.00  37.87 ? 62  ARG C CB  1 
ATOM   3759 C  CG  . ARG C 1 63  ? 28.134  37.776  67.764  1.00  38.52 ? 62  ARG C CG  1 
ATOM   3760 C  CD  . ARG C 1 63  ? 27.628  38.289  66.425  1.00  38.91 ? 62  ARG C CD  1 
ATOM   3761 N  NE  . ARG C 1 63  ? 28.673  38.999  65.688  1.00  41.24 ? 62  ARG C NE  1 
ATOM   3762 C  CZ  . ARG C 1 63  ? 28.902  40.310  65.759  1.00  42.10 ? 62  ARG C CZ  1 
ATOM   3763 N  NH1 . ARG C 1 63  ? 28.153  41.092  66.535  1.00  42.15 ? 62  ARG C NH1 1 
ATOM   3764 N  NH2 . ARG C 1 63  ? 29.884  40.842  65.045  1.00  41.88 ? 62  ARG C NH2 1 
ATOM   3765 N  N   . VAL C 1 64  ? 26.930  38.985  72.227  1.00  37.72 ? 63  VAL C N   1 
ATOM   3766 C  CA  . VAL C 1 64  ? 26.460  39.908  73.266  1.00  37.77 ? 63  VAL C CA  1 
ATOM   3767 C  C   . VAL C 1 64  ? 27.512  40.041  74.377  1.00  37.84 ? 63  VAL C C   1 
ATOM   3768 O  O   . VAL C 1 64  ? 28.377  39.167  74.502  1.00  37.62 ? 63  VAL C O   1 
ATOM   3769 C  CB  . VAL C 1 64  ? 25.064  39.500  73.843  1.00  37.90 ? 63  VAL C CB  1 
ATOM   3770 C  CG1 . VAL C 1 64  ? 24.020  39.439  72.733  1.00  37.63 ? 63  VAL C CG1 1 
ATOM   3771 C  CG2 . VAL C 1 64  ? 25.123  38.174  74.608  1.00  37.88 ? 63  VAL C CG2 1 
ATOM   3772 N  N   . PRO C 1 65  ? 27.464  41.139  75.172  1.00  37.81 ? 64  PRO C N   1 
ATOM   3773 C  CA  . PRO C 1 65  ? 28.435  41.270  76.270  1.00  37.89 ? 64  PRO C CA  1 
ATOM   3774 C  C   . PRO C 1 65  ? 28.399  40.040  77.181  1.00  37.73 ? 64  PRO C C   1 
ATOM   3775 O  O   . PRO C 1 65  ? 27.320  39.511  77.452  1.00  37.24 ? 64  PRO C O   1 
ATOM   3776 C  CB  . PRO C 1 65  ? 27.953  42.519  77.023  1.00  37.99 ? 64  PRO C CB  1 
ATOM   3777 C  CG  . PRO C 1 65  ? 27.242  43.324  75.987  1.00  38.09 ? 64  PRO C CG  1 
ATOM   3778 C  CD  . PRO C 1 65  ? 26.557  42.303  75.107  1.00  37.93 ? 64  PRO C CD  1 
ATOM   3779 N  N   . ALA C 1 66  ? 29.572  39.593  77.631  1.00  37.54 ? 65  ALA C N   1 
ATOM   3780 C  CA  . ALA C 1 66  ? 29.692  38.347  78.397  1.00  37.44 ? 65  ALA C CA  1 
ATOM   3781 C  C   . ALA C 1 66  ? 28.940  38.360  79.728  1.00  37.45 ? 65  ALA C C   1 
ATOM   3782 O  O   . ALA C 1 66  ? 28.392  37.338  80.137  1.00  37.45 ? 65  ALA C O   1 
ATOM   3783 C  CB  . ALA C 1 66  ? 31.154  37.980  78.612  1.00  37.63 ? 65  ALA C CB  1 
ATOM   3784 N  N   . ASP C 1 67  ? 28.901  39.514  80.391  1.00  37.03 ? 66  ASP C N   1 
ATOM   3785 C  CA  . ASP C 1 67  ? 28.176  39.631  81.654  1.00  37.29 ? 66  ASP C CA  1 
ATOM   3786 C  C   . ASP C 1 67  ? 26.652  39.598  81.470  1.00  36.19 ? 66  ASP C C   1 
ATOM   3787 O  O   . ASP C 1 67  ? 25.916  39.523  82.455  1.00  36.44 ? 66  ASP C O   1 
ATOM   3788 C  CB  . ASP C 1 67  ? 28.607  40.881  82.442  1.00  37.82 ? 66  ASP C CB  1 
ATOM   3789 C  CG  . ASP C 1 67  ? 28.093  42.183  81.830  1.00  40.24 ? 66  ASP C CG  1 
ATOM   3790 O  OD1 . ASP C 1 67  ? 28.409  42.465  80.656  1.00  42.30 ? 66  ASP C OD1 1 
ATOM   3791 O  OD2 . ASP C 1 67  ? 27.384  42.939  82.537  1.00  43.85 ? 66  ASP C OD2 1 
ATOM   3792 N  N   . LYS C 1 68  ? 26.192  39.653  80.219  1.00  35.21 ? 67  LYS C N   1 
ATOM   3793 C  CA  . LYS C 1 68  ? 24.751  39.616  79.917  1.00  34.62 ? 67  LYS C CA  1 
ATOM   3794 C  C   . LYS C 1 68  ? 24.295  38.271  79.347  1.00  34.00 ? 67  LYS C C   1 
ATOM   3795 O  O   . LYS C 1 68  ? 23.087  38.021  79.237  1.00  33.85 ? 67  LYS C O   1 
ATOM   3796 C  CB  . LYS C 1 68  ? 24.348  40.739  78.945  1.00  34.54 ? 67  LYS C CB  1 
ATOM   3797 C  CG  . LYS C 1 68  ? 24.695  42.159  79.388  1.00  34.52 ? 67  LYS C CG  1 
ATOM   3798 C  CD  . LYS C 1 68  ? 23.877  42.622  80.597  1.00  34.77 ? 67  LYS C CD  1 
ATOM   3799 C  CE  . LYS C 1 68  ? 24.132  44.098  80.920  1.00  35.30 ? 67  LYS C CE  1 
ATOM   3800 N  NZ  . LYS C 1 68  ? 23.776  45.007  79.781  1.00  35.61 ? 67  LYS C NZ  1 
ATOM   3801 N  N   . LYS C 1 69  ? 25.253  37.411  79.003  1.00  33.10 ? 68  LYS C N   1 
ATOM   3802 C  CA  . LYS C 1 69  ? 24.961  36.182  78.258  1.00  32.57 ? 68  LYS C CA  1 
ATOM   3803 C  C   . LYS C 1 69  ? 24.034  35.240  79.021  1.00  32.02 ? 68  LYS C C   1 
ATOM   3804 O  O   . LYS C 1 69  ? 23.078  34.723  78.452  1.00  32.13 ? 68  LYS C O   1 
ATOM   3805 C  CB  . LYS C 1 69  ? 26.245  35.460  77.847  1.00  32.43 ? 68  LYS C CB  1 
ATOM   3806 C  CG  . LYS C 1 69  ? 26.007  34.214  76.995  1.00  33.29 ? 68  LYS C CG  1 
ATOM   3807 C  CD  . LYS C 1 69  ? 27.302  33.513  76.646  1.00  34.61 ? 68  LYS C CD  1 
ATOM   3808 C  CE  . LYS C 1 69  ? 27.047  32.294  75.775  1.00  34.99 ? 68  LYS C CE  1 
ATOM   3809 N  NZ  . LYS C 1 69  ? 28.341  31.692  75.328  1.00  35.69 ? 68  LYS C NZ  1 
ATOM   3810 N  N   . GLY C 1 70  ? 24.319  35.023  80.303  1.00  31.58 ? 69  GLY C N   1 
ATOM   3811 C  CA  . GLY C 1 70  ? 23.470  34.178  81.154  1.00  31.16 ? 69  GLY C CA  1 
ATOM   3812 C  C   . GLY C 1 70  ? 22.025  34.636  81.260  1.00  30.53 ? 69  GLY C C   1 
ATOM   3813 O  O   . GLY C 1 70  ? 21.103  33.846  81.058  1.00  30.36 ? 69  GLY C O   1 
ATOM   3814 N  N   . ALA C 1 71  ? 21.831  35.914  81.594  1.00  30.13 ? 70  ALA C N   1 
ATOM   3815 C  CA  . ALA C 1 71  ? 20.502  36.514  81.677  1.00  29.97 ? 70  ALA C CA  1 
ATOM   3816 C  C   . ALA C 1 71  ? 19.776  36.512  80.329  1.00  29.66 ? 70  ALA C C   1 
ATOM   3817 O  O   . ALA C 1 71  ? 18.560  36.290  80.271  1.00  29.35 ? 70  ALA C O   1 
ATOM   3818 C  CB  . ALA C 1 71  ? 20.587  37.919  82.239  1.00  30.08 ? 70  ALA C CB  1 
ATOM   3819 N  N   . LEU C 1 72  ? 20.518  36.731  79.243  1.00  29.67 ? 71  LEU C N   1 
ATOM   3820 C  CA  . LEU C 1 72  ? 19.913  36.709  77.903  1.00  29.38 ? 71  LEU C CA  1 
ATOM   3821 C  C   . LEU C 1 72  ? 19.540  35.298  77.455  1.00  29.23 ? 71  LEU C C   1 
ATOM   3822 O  O   . LEU C 1 72  ? 18.461  35.084  76.892  1.00  28.83 ? 71  LEU C O   1 
ATOM   3823 C  CB  . LEU C 1 72  ? 20.809  37.419  76.866  1.00  29.90 ? 71  LEU C CB  1 
ATOM   3824 C  CG  . LEU C 1 72  ? 20.827  38.954  76.996  1.00  30.32 ? 71  LEU C CG  1 
ATOM   3825 C  CD1 . LEU C 1 72  ? 21.843  39.579  76.068  1.00  31.50 ? 71  LEU C CD1 1 
ATOM   3826 C  CD2 . LEU C 1 72  ? 19.422  39.539  76.746  1.00  31.22 ? 71  LEU C CD2 1 
ATOM   3827 N  N   . ARG C 1 73  ? 20.419  34.335  77.719  1.00  28.91 ? 72  ARG C N   1 
ATOM   3828 C  CA  . ARG C 1 73  ? 20.124  32.941  77.432  1.00  28.56 ? 72  ARG C CA  1 
ATOM   3829 C  C   . ARG C 1 73  ? 18.803  32.523  78.091  1.00  28.28 ? 72  ARG C C   1 
ATOM   3830 O  O   . ARG C 1 73  ? 17.917  31.977  77.434  1.00  28.36 ? 72  ARG C O   1 
ATOM   3831 C  CB  . ARG C 1 73  ? 21.271  32.061  77.922  1.00  28.90 ? 72  ARG C CB  1 
ATOM   3832 C  CG  . ARG C 1 73  ? 20.997  30.578  77.883  1.00  29.89 ? 72  ARG C CG  1 
ATOM   3833 C  CD  . ARG C 1 73  ? 22.222  29.837  78.348  1.00  33.15 ? 72  ARG C CD  1 
ATOM   3834 N  NE  . ARG C 1 73  ? 22.035  28.387  78.283  1.00  34.27 ? 72  ARG C NE  1 
ATOM   3835 C  CZ  . ARG C 1 73  ? 22.990  27.509  78.572  1.00  35.12 ? 72  ARG C CZ  1 
ATOM   3836 N  NH1 . ARG C 1 73  ? 24.197  27.932  78.941  1.00  35.43 ? 72  ARG C NH1 1 
ATOM   3837 N  NH2 . ARG C 1 73  ? 22.744  26.213  78.490  1.00  35.26 ? 72  ARG C NH2 1 
ATOM   3838 N  N   . ASN C 1 74  ? 18.682  32.813  79.384  1.00  27.80 ? 73  ASN C N   1 
ATOM   3839 C  CA  . ASN C 1 74  ? 17.520  32.437  80.174  1.00  28.06 ? 73  ASN C CA  1 
ATOM   3840 C  C   . ASN C 1 74  ? 16.269  33.236  79.835  1.00  28.20 ? 73  ASN C C   1 
ATOM   3841 O  O   . ASN C 1 74  ? 15.190  32.664  79.686  1.00  28.21 ? 73  ASN C O   1 
ATOM   3842 C  CB  . ASN C 1 74  ? 17.838  32.575  81.662  1.00  28.61 ? 73  ASN C CB  1 
ATOM   3843 C  CG  . ASN C 1 74  ? 18.876  31.577  82.129  1.00  28.59 ? 73  ASN C CG  1 
ATOM   3844 O  OD1 . ASN C 1 74  ? 19.159  30.594  81.448  1.00  29.50 ? 73  ASN C OD1 1 
ATOM   3845 N  ND2 . ASN C 1 74  ? 19.436  31.817  83.314  1.00  29.04 ? 73  ASN C ND2 1 
ATOM   3846 N  N   . ASN C 1 75  ? 16.416  34.553  79.712  1.00  27.98 ? 74  ASN C N   1 
ATOM   3847 C  CA  . ASN C 1 75  ? 15.257  35.425  79.535  1.00  27.86 ? 74  ASN C CA  1 
ATOM   3848 C  C   . ASN C 1 75  ? 14.846  35.682  78.080  1.00  27.43 ? 74  ASN C C   1 
ATOM   3849 O  O   . ASN C 1 75  ? 13.658  35.587  77.750  1.00  27.30 ? 74  ASN C O   1 
ATOM   3850 C  CB  . ASN C 1 75  ? 15.411  36.694  80.366  1.00  27.98 ? 74  ASN C CB  1 
ATOM   3851 C  CG  . ASN C 1 75  ? 15.520  36.385  81.850  1.00  29.07 ? 74  ASN C CG  1 
ATOM   3852 O  OD1 . ASN C 1 75  ? 14.533  35.996  82.482  1.00  30.73 ? 74  ASN C OD1 1 
ATOM   3853 N  ND2 . ASN C 1 75  ? 16.723  36.540  82.412  1.00  29.62 ? 74  ASN C ND2 1 
ATOM   3854 N  N   . ALA C 1 76  ? 15.808  35.963  77.205  1.00  27.14 ? 75  ALA C N   1 
ATOM   3855 C  CA  . ALA C 1 76  ? 15.487  36.065  75.784  1.00  26.51 ? 75  ALA C CA  1 
ATOM   3856 C  C   . ALA C 1 76  ? 15.046  34.700  75.224  1.00  26.16 ? 75  ALA C C   1 
ATOM   3857 O  O   . ALA C 1 76  ? 14.161  34.632  74.377  1.00  25.21 ? 75  ALA C O   1 
ATOM   3858 C  CB  . ALA C 1 76  ? 16.653  36.644  74.991  1.00  26.73 ? 75  ALA C CB  1 
ATOM   3859 N  N   . GLY C 1 77  ? 15.675  33.624  75.697  1.00  26.05 ? 76  GLY C N   1 
ATOM   3860 C  CA  . GLY C 1 77  ? 15.204  32.260  75.433  1.00  25.75 ? 76  GLY C CA  1 
ATOM   3861 C  C   . GLY C 1 77  ? 13.767  32.057  75.887  1.00  26.06 ? 76  GLY C C   1 
ATOM   3862 O  O   . GLY C 1 77  ? 12.934  31.586  75.117  1.00  25.55 ? 76  GLY C O   1 
ATOM   3863 N  N   . GLY C 1 78  ? 13.477  32.437  77.133  1.00  25.78 ? 77  GLY C N   1 
ATOM   3864 C  CA  . GLY C 1 78  ? 12.110  32.397  77.668  1.00  26.86 ? 77  GLY C CA  1 
ATOM   3865 C  C   . GLY C 1 78  ? 11.113  33.159  76.803  1.00  26.83 ? 77  GLY C C   1 
ATOM   3866 O  O   . GLY C 1 78  ? 10.024  32.664  76.509  1.00  26.65 ? 77  GLY C O   1 
ATOM   3867 N  N   . HIS C 1 79  ? 11.487  34.363  76.386  1.00  26.86 ? 78  HIS C N   1 
ATOM   3868 C  CA  . HIS C 1 79  ? 10.625  35.186  75.525  1.00  27.01 ? 78  HIS C CA  1 
ATOM   3869 C  C   . HIS C 1 79  ? 10.406  34.525  74.159  1.00  27.18 ? 78  HIS C C   1 
ATOM   3870 O  O   . HIS C 1 79  ? 9.268   34.427  73.690  1.00  27.46 ? 78  HIS C O   1 
ATOM   3871 C  CB  . HIS C 1 79  ? 11.195  36.613  75.407  1.00  27.23 ? 78  HIS C CB  1 
ATOM   3872 C  CG  . HIS C 1 79  ? 10.398  37.536  74.528  1.00  27.98 ? 78  HIS C CG  1 
ATOM   3873 N  ND1 . HIS C 1 79  ? 9.018   37.586  74.539  1.00  28.74 ? 78  HIS C ND1 1 
ATOM   3874 C  CD2 . HIS C 1 79  ? 10.798  38.466  73.630  1.00  28.14 ? 78  HIS C CD2 1 
ATOM   3875 C  CE1 . HIS C 1 79  ? 8.604   38.502  73.680  1.00  27.84 ? 78  HIS C CE1 1 
ATOM   3876 N  NE2 . HIS C 1 79  ? 9.665   39.045  73.108  1.00  27.97 ? 78  HIS C NE2 1 
ATOM   3877 N  N   . ALA C 1 80  ? 11.480  34.039  73.538  1.00  27.12 ? 79  ALA C N   1 
ATOM   3878 C  CA  . ALA C 1 80  ? 11.366  33.364  72.238  1.00  26.36 ? 79  ALA C CA  1 
ATOM   3879 C  C   . ALA C 1 80  ? 10.497  32.101  72.302  1.00  26.53 ? 79  ALA C C   1 
ATOM   3880 O  O   . ALA C 1 80  ? 9.660   31.875  71.420  1.00  25.28 ? 79  ALA C O   1 
ATOM   3881 C  CB  . ALA C 1 80  ? 12.748  33.040  71.667  1.00  26.20 ? 79  ALA C CB  1 
ATOM   3882 N  N   . ASN C 1 81  ? 10.711  31.294  73.335  1.00  26.11 ? 80  ASN C N   1 
ATOM   3883 C  CA  . ASN C 1 81  ? 9.987   30.032  73.517  1.00  27.10 ? 80  ASN C CA  1 
ATOM   3884 C  C   . ASN C 1 81  ? 8.504   30.270  73.727  1.00  27.05 ? 80  ASN C C   1 
ATOM   3885 O  O   . ASN C 1 81  ? 7.683   29.698  73.014  1.00  27.11 ? 80  ASN C O   1 
ATOM   3886 C  CB  . ASN C 1 81  ? 10.568  29.231  74.695  1.00  26.10 ? 80  ASN C CB  1 
ATOM   3887 C  CG  . ASN C 1 81  ? 12.016  28.806  74.459  1.00  27.40 ? 80  ASN C CG  1 
ATOM   3888 O  OD1 . ASN C 1 81  ? 12.503  28.843  73.336  1.00  28.06 ? 80  ASN C OD1 1 
ATOM   3889 N  ND2 . ASN C 1 81  ? 12.709  28.428  75.526  1.00  28.06 ? 80  ASN C ND2 1 
ATOM   3890 N  N   . HIS C 1 82  ? 8.153   31.123  74.692  1.00  27.25 ? 81  HIS C N   1 
ATOM   3891 C  CA  . HIS C 1 82  ? 6.726   31.387  74.949  1.00  27.61 ? 81  HIS C CA  1 
ATOM   3892 C  C   . HIS C 1 82  ? 5.998   32.077  73.796  1.00  27.93 ? 81  HIS C C   1 
ATOM   3893 O  O   . HIS C 1 82  ? 4.848   31.731  73.507  1.00  27.32 ? 81  HIS C O   1 
ATOM   3894 C  CB  . HIS C 1 82  ? 6.532   32.130  76.271  1.00  28.10 ? 81  HIS C CB  1 
ATOM   3895 C  CG  . HIS C 1 82  ? 6.898   31.295  77.453  1.00  29.32 ? 81  HIS C CG  1 
ATOM   3896 N  ND1 . HIS C 1 82  ? 8.206   31.086  77.833  1.00  31.09 ? 81  HIS C ND1 1 
ATOM   3897 C  CD2 . HIS C 1 82  ? 6.138   30.563  78.301  1.00  31.83 ? 81  HIS C CD2 1 
ATOM   3898 C  CE1 . HIS C 1 82  ? 8.237   30.281  78.882  1.00  30.41 ? 81  HIS C CE1 1 
ATOM   3899 N  NE2 . HIS C 1 82  ? 6.996   29.951  79.188  1.00  32.04 ? 81  HIS C NE2 1 
ATOM   3900 N  N   . SER C 1 83  ? 6.664   33.027  73.137  1.00  27.52 ? 82  SER C N   1 
ATOM   3901 C  CA  . SER C 1 83  ? 6.096   33.677  71.955  1.00  28.47 ? 82  SER C CA  1 
ATOM   3902 C  C   . SER C 1 83  ? 5.699   32.664  70.889  1.00  29.22 ? 82  SER C C   1 
ATOM   3903 O  O   . SER C 1 83  ? 4.599   32.738  70.325  1.00  28.92 ? 82  SER C O   1 
ATOM   3904 C  CB  . SER C 1 83  ? 7.066   34.714  71.377  1.00  27.69 ? 82  SER C CB  1 
ATOM   3905 O  OG  . SER C 1 83  ? 7.186   35.809  72.272  1.00  29.14 ? 82  SER C OG  1 
ATOM   3906 N  N   . MET C 1 84  ? 6.583   31.704  70.622  1.00  30.15 ? 83  MET C N   1 
ATOM   3907 C  CA  . MET C 1 84  ? 6.264   30.630  69.688  1.00  31.57 ? 83  MET C CA  1 
ATOM   3908 C  C   . MET C 1 84  ? 5.127   29.744  70.211  1.00  30.30 ? 83  MET C C   1 
ATOM   3909 O  O   . MET C 1 84  ? 4.176   29.444  69.483  1.00  29.80 ? 83  MET C O   1 
ATOM   3910 C  CB  . MET C 1 84  ? 7.500   29.786  69.390  1.00  31.72 ? 83  MET C CB  1 
ATOM   3911 C  CG  . MET C 1 84  ? 7.201   28.612  68.480  1.00  34.62 ? 83  MET C CG  1 
ATOM   3912 S  SD  . MET C 1 84  ? 8.663   27.641  68.124  1.00  37.97 ? 83  MET C SD  1 
ATOM   3913 C  CE  . MET C 1 84  ? 9.377   28.555  66.777  1.00  40.83 ? 83  MET C CE  1 
ATOM   3914 N  N   . PHE C 1 85  ? 5.245   29.339  71.473  1.00  29.85 ? 84  PHE C N   1 
ATOM   3915 C  CA  . PHE C 1 85  ? 4.288   28.451  72.141  1.00  28.98 ? 84  PHE C CA  1 
ATOM   3916 C  C   . PHE C 1 85  ? 2.841   28.916  71.970  1.00  28.96 ? 84  PHE C C   1 
ATOM   3917 O  O   . PHE C 1 85  ? 2.007   28.125  71.528  1.00  28.49 ? 84  PHE C O   1 
ATOM   3918 C  CB  . PHE C 1 85  ? 4.664   28.307  73.628  1.00  28.34 ? 84  PHE C CB  1 
ATOM   3919 C  CG  . PHE C 1 85  ? 3.915   27.215  74.357  1.00  28.25 ? 84  PHE C CG  1 
ATOM   3920 C  CD1 . PHE C 1 85  ? 3.904   25.904  73.870  1.00  28.18 ? 84  PHE C CD1 1 
ATOM   3921 C  CD2 . PHE C 1 85  ? 3.258   27.489  75.557  1.00  28.20 ? 84  PHE C CD2 1 
ATOM   3922 C  CE1 . PHE C 1 85  ? 3.213   24.889  74.546  1.00  28.80 ? 84  PHE C CE1 1 
ATOM   3923 C  CE2 . PHE C 1 85  ? 2.581   26.464  76.253  1.00  28.72 ? 84  PHE C CE2 1 
ATOM   3924 C  CZ  . PHE C 1 85  ? 2.559   25.172  75.735  1.00  27.83 ? 84  PHE C CZ  1 
ATOM   3925 N  N   . TRP C 1 86  ? 2.547   30.190  72.272  1.00  28.63 ? 85  TRP C N   1 
ATOM   3926 C  CA  . TRP C 1 86  ? 1.171   30.711  72.121  1.00  29.17 ? 85  TRP C CA  1 
ATOM   3927 C  C   . TRP C 1 86  ? 0.661   30.598  70.677  1.00  29.29 ? 85  TRP C C   1 
ATOM   3928 O  O   . TRP C 1 86  ? -0.509  30.301  70.444  1.00  29.16 ? 85  TRP C O   1 
ATOM   3929 C  CB  . TRP C 1 86  ? 1.029   32.170  72.584  1.00  29.43 ? 85  TRP C CB  1 
ATOM   3930 C  CG  . TRP C 1 86  ? 1.671   32.514  73.915  1.00  29.54 ? 85  TRP C CG  1 
ATOM   3931 C  CD1 . TRP C 1 86  ? 2.478   33.585  74.173  1.00  29.89 ? 85  TRP C CD1 1 
ATOM   3932 C  CD2 . TRP C 1 86  ? 1.555   31.792  75.153  1.00  30.86 ? 85  TRP C CD2 1 
ATOM   3933 N  NE1 . TRP C 1 86  ? 2.884   33.571  75.490  1.00  28.28 ? 85  TRP C NE1 1 
ATOM   3934 C  CE2 . TRP C 1 86  ? 2.323   32.491  76.117  1.00  30.24 ? 85  TRP C CE2 1 
ATOM   3935 C  CE3 . TRP C 1 86  ? 0.879   30.624  75.542  1.00  30.80 ? 85  TRP C CE3 1 
ATOM   3936 C  CZ2 . TRP C 1 86  ? 2.450   32.055  77.439  1.00  30.87 ? 85  TRP C CZ2 1 
ATOM   3937 C  CZ3 . TRP C 1 86  ? 1.001   30.192  76.872  1.00  30.79 ? 85  TRP C CZ3 1 
ATOM   3938 C  CH2 . TRP C 1 86  ? 1.782   30.911  77.800  1.00  31.32 ? 85  TRP C CH2 1 
ATOM   3939 N  N   . GLN C 1 87  ? 1.554   30.840  69.721  1.00  29.32 ? 86  GLN C N   1 
ATOM   3940 C  CA  . GLN C 1 87  ? 1.182   30.868  68.311  1.00  30.08 ? 86  GLN C CA  1 
ATOM   3941 C  C   . GLN C 1 87  ? 0.957   29.479  67.707  1.00  29.83 ? 86  GLN C C   1 
ATOM   3942 O  O   . GLN C 1 87  ? 0.211   29.347  66.745  1.00  30.25 ? 86  GLN C O   1 
ATOM   3943 C  CB  . GLN C 1 87  ? 2.232   31.631  67.516  1.00  29.84 ? 86  GLN C CB  1 
ATOM   3944 C  CG  . GLN C 1 87  ? 2.200   33.124  67.796  1.00  32.40 ? 86  GLN C CG  1 
ATOM   3945 C  CD  . GLN C 1 87  ? 3.176   33.902  66.941  1.00  35.02 ? 86  GLN C CD  1 
ATOM   3946 O  OE1 . GLN C 1 87  ? 4.263   33.423  66.626  1.00  37.66 ? 86  GLN C OE1 1 
ATOM   3947 N  NE2 . GLN C 1 87  ? 2.800   35.118  66.576  1.00  36.62 ? 86  GLN C NE2 1 
ATOM   3948 N  N   . ILE C 1 88  ? 1.589   28.450  68.268  1.00  29.98 ? 87  ILE C N   1 
ATOM   3949 C  CA  . ILE C 1 88  ? 1.433   27.082  67.726  1.00  30.46 ? 87  ILE C CA  1 
ATOM   3950 C  C   . ILE C 1 88  ? 0.288   26.298  68.364  1.00  30.71 ? 87  ILE C C   1 
ATOM   3951 O  O   . ILE C 1 88  ? 0.083   25.113  68.066  1.00  31.12 ? 87  ILE C O   1 
ATOM   3952 C  CB  . ILE C 1 88  ? 2.774   26.268  67.677  1.00  30.33 ? 87  ILE C CB  1 
ATOM   3953 C  CG1 . ILE C 1 88  ? 3.437   26.144  69.063  1.00  30.59 ? 87  ILE C CG1 1 
ATOM   3954 C  CG2 . ILE C 1 88  ? 3.733   26.873  66.625  1.00  31.07 ? 87  ILE C CG2 1 
ATOM   3955 C  CD1 . ILE C 1 88  ? 2.758   25.175  70.005  1.00  32.02 ? 87  ILE C CD1 1 
ATOM   3956 N  N   . MET C 1 89  ? -0.447  26.964  69.247  1.00  30.90 ? 88  MET C N   1 
ATOM   3957 C  CA  . MET C 1 89  ? -1.682  26.419  69.789  1.00  30.97 ? 88  MET C CA  1 
ATOM   3958 C  C   . MET C 1 89  ? -2.899  27.176  69.250  1.00  30.96 ? 88  MET C C   1 
ATOM   3959 O  O   . MET C 1 89  ? -2.776  28.303  68.770  1.00  31.03 ? 88  MET C O   1 
ATOM   3960 C  CB  . MET C 1 89  ? -1.664  26.452  71.318  1.00  30.82 ? 88  MET C CB  1 
ATOM   3961 C  CG  . MET C 1 89  ? -0.523  25.680  71.950  1.00  31.05 ? 88  MET C CG  1 
ATOM   3962 S  SD  . MET C 1 89  ? -0.717  25.497  73.726  1.00  31.87 ? 88  MET C SD  1 
ATOM   3963 C  CE  . MET C 1 89  ? -0.415  27.174  74.281  1.00  31.90 ? 88  MET C CE  1 
ATOM   3964 N  N   . GLY C 1 90  ? -4.063  26.537  69.322  1.00  31.07 ? 89  GLY C N   1 
ATOM   3965 C  CA  . GLY C 1 90  ? -5.331  27.142  68.914  1.00  31.18 ? 89  GLY C CA  1 
ATOM   3966 C  C   . GLY C 1 90  ? -6.524  26.295  69.334  1.00  31.68 ? 89  GLY C C   1 
ATOM   3967 O  O   . GLY C 1 90  ? -6.358  25.178  69.849  1.00  31.64 ? 89  GLY C O   1 
ATOM   3968 N  N   . ASN C 1 99  ? -7.208  16.007  64.857  1.00  33.94 ? 98  ASN C N   1 
ATOM   3969 C  CA  . ASN C 1 99  ? -6.272  17.109  64.646  1.00  33.28 ? 98  ASN C CA  1 
ATOM   3970 C  C   . ASN C 1 99  ? -4.927  16.610  64.120  1.00  33.23 ? 98  ASN C C   1 
ATOM   3971 O  O   . ASN C 1 99  ? -4.156  15.996  64.854  1.00  33.45 ? 98  ASN C O   1 
ATOM   3972 C  CB  . ASN C 1 99  ? -6.073  17.901  65.947  1.00  33.22 ? 98  ASN C CB  1 
ATOM   3973 C  CG  . ASN C 1 99  ? -5.388  19.246  65.720  1.00  32.94 ? 98  ASN C CG  1 
ATOM   3974 O  OD1 . ASN C 1 99  ? -5.589  19.894  64.688  1.00  33.36 ? 98  ASN C OD1 1 
ATOM   3975 N  ND2 . ASN C 1 99  ? -4.588  19.676  66.689  1.00  31.19 ? 98  ASN C ND2 1 
ATOM   3976 N  N   . GLN C 1 100 ? -4.644  16.871  62.848  1.00  32.80 ? 99  GLN C N   1 
ATOM   3977 C  CA  . GLN C 1 100 ? -3.368  16.464  62.253  1.00  33.10 ? 99  GLN C CA  1 
ATOM   3978 C  C   . GLN C 1 100 ? -2.968  17.447  61.162  1.00  32.44 ? 99  GLN C C   1 
ATOM   3979 O  O   . GLN C 1 100 ? -3.825  18.151  60.621  1.00  32.42 ? 99  GLN C O   1 
ATOM   3980 C  CB  . GLN C 1 100 ? -3.438  15.066  61.613  1.00  33.37 ? 99  GLN C CB  1 
ATOM   3981 C  CG  . GLN C 1 100 ? -4.616  14.184  61.968  1.00  36.43 ? 99  GLN C CG  1 
ATOM   3982 C  CD  . GLN C 1 100 ? -4.959  13.228  60.840  1.00  39.44 ? 99  GLN C CD  1 
ATOM   3983 O  OE1 . GLN C 1 100 ? -4.071  12.678  60.175  1.00  41.79 ? 99  GLN C OE1 1 
ATOM   3984 N  NE2 . GLN C 1 100 ? -6.251  13.031  60.609  1.00  41.10 ? 99  GLN C NE2 1 
ATOM   3985 N  N   . PRO C 1 101 ? -1.668  17.480  60.809  1.00  32.27 ? 100 PRO C N   1 
ATOM   3986 C  CA  . PRO C 1 101 ? -1.250  18.316  59.692  1.00  31.87 ? 100 PRO C CA  1 
ATOM   3987 C  C   . PRO C 1 101 ? -1.670  17.695  58.368  1.00  31.71 ? 100 PRO C C   1 
ATOM   3988 O  O   . PRO C 1 101 ? -2.061  16.527  58.330  1.00  31.16 ? 100 PRO C O   1 
ATOM   3989 C  CB  . PRO C 1 101 ? 0.273   18.297  59.795  1.00  31.72 ? 100 PRO C CB  1 
ATOM   3990 C  CG  . PRO C 1 101 ? 0.580   16.990  60.418  1.00  32.40 ? 100 PRO C CG  1 
ATOM   3991 C  CD  . PRO C 1 101 ? -0.525  16.769  61.414  1.00  32.08 ? 100 PRO C CD  1 
ATOM   3992 N  N   . SER C 1 102 ? -1.584  18.481  57.301  1.00  31.99 ? 101 SER C N   1 
ATOM   3993 C  CA  . SER C 1 102 ? -1.789  17.987  55.942  1.00  31.95 ? 101 SER C CA  1 
ATOM   3994 C  C   . SER C 1 102 ? -0.731  18.583  55.016  1.00  31.57 ? 101 SER C C   1 
ATOM   3995 O  O   . SER C 1 102 ? 0.105   19.377  55.452  1.00  31.39 ? 101 SER C O   1 
ATOM   3996 C  CB  . SER C 1 102 ? -3.196  18.331  55.437  1.00  32.69 ? 101 SER C CB  1 
ATOM   3997 O  OG  . SER C 1 102 ? -3.428  19.728  55.502  1.00  34.76 ? 101 SER C OG  1 
ATOM   3998 N  N   . GLY C 1 103 ? -0.763  18.182  53.746  1.00  30.96 ? 102 GLY C N   1 
ATOM   3999 C  CA  . GLY C 1 103 ? 0.099   18.772  52.717  1.00  30.60 ? 102 GLY C CA  1 
ATOM   4000 C  C   . GLY C 1 103 ? 1.582   18.520  52.919  1.00  30.42 ? 102 GLY C C   1 
ATOM   4001 O  O   . GLY C 1 103 ? 1.983   17.418  53.312  1.00  30.09 ? 102 GLY C O   1 
ATOM   4002 N  N   . GLU C 1 104 ? 2.394   19.550  52.680  1.00  29.86 ? 103 GLU C N   1 
ATOM   4003 C  CA  . GLU C 1 104 ? 3.844   19.373  52.644  1.00  30.00 ? 103 GLU C CA  1 
ATOM   4004 C  C   . GLU C 1 104 ? 4.442   18.989  53.991  1.00  29.30 ? 103 GLU C C   1 
ATOM   4005 O  O   . GLU C 1 104 ? 5.381   18.193  54.043  1.00  29.63 ? 103 GLU C O   1 
ATOM   4006 C  CB  . GLU C 1 104 ? 4.567   20.574  52.016  1.00  29.93 ? 103 GLU C CB  1 
ATOM   4007 C  CG  . GLU C 1 104 ? 4.462   21.909  52.755  1.00  31.42 ? 103 GLU C CG  1 
ATOM   4008 C  CD  . GLU C 1 104 ? 5.482   22.939  52.252  1.00  31.53 ? 103 GLU C CD  1 
ATOM   4009 O  OE1 . GLU C 1 104 ? 5.708   23.012  51.027  1.00  34.75 ? 103 GLU C OE1 1 
ATOM   4010 O  OE2 . GLU C 1 104 ? 6.065   23.669  53.082  1.00  34.78 ? 103 GLU C OE2 1 
ATOM   4011 N  N   . LEU C 1 105 ? 3.889   19.534  55.074  1.00  28.54 ? 104 LEU C N   1 
ATOM   4012 C  CA  . LEU C 1 105 ? 4.359   19.175  56.414  1.00  27.95 ? 104 LEU C CA  1 
ATOM   4013 C  C   . LEU C 1 105 ? 4.055   17.714  56.741  1.00  27.96 ? 104 LEU C C   1 
ATOM   4014 O  O   . LEU C 1 105 ? 4.898   17.014  57.318  1.00  27.67 ? 104 LEU C O   1 
ATOM   4015 C  CB  . LEU C 1 105 ? 3.784   20.107  57.483  1.00  27.85 ? 104 LEU C CB  1 
ATOM   4016 C  CG  . LEU C 1 105 ? 4.119   19.752  58.940  1.00  28.23 ? 104 LEU C CG  1 
ATOM   4017 C  CD1 . LEU C 1 105 ? 5.615   19.792  59.198  1.00  28.44 ? 104 LEU C CD1 1 
ATOM   4018 C  CD2 . LEU C 1 105 ? 3.395   20.676  59.895  1.00  27.95 ? 104 LEU C CD2 1 
ATOM   4019 N  N   . LEU C 1 106 ? 2.863   17.249  56.373  1.00  27.67 ? 105 LEU C N   1 
ATOM   4020 C  CA  . LEU C 1 106 ? 2.521   15.849  56.589  1.00  28.08 ? 105 LEU C CA  1 
ATOM   4021 C  C   . LEU C 1 106 ? 3.466   14.942  55.792  1.00  28.40 ? 105 LEU C C   1 
ATOM   4022 O  O   . LEU C 1 106 ? 3.993   13.957  56.325  1.00  28.56 ? 105 LEU C O   1 
ATOM   4023 C  CB  . LEU C 1 106 ? 1.051   15.574  56.243  1.00  27.88 ? 105 LEU C CB  1 
ATOM   4024 C  CG  . LEU C 1 106 ? 0.545   14.131  56.405  1.00  28.20 ? 105 LEU C CG  1 
ATOM   4025 C  CD1 . LEU C 1 106 ? 0.581   13.666  57.877  1.00  28.70 ? 105 LEU C CD1 1 
ATOM   4026 C  CD2 . LEU C 1 106 ? -0.848  13.981  55.826  1.00  28.07 ? 105 LEU C CD2 1 
ATOM   4027 N  N   . ASP C 1 107 ? 3.693   15.291  54.527  1.00  28.30 ? 106 ASP C N   1 
ATOM   4028 C  CA  . ASP C 1 107 ? 4.623   14.549  53.669  1.00  28.69 ? 106 ASP C CA  1 
ATOM   4029 C  C   . ASP C 1 107 ? 6.034   14.474  54.262  1.00  28.33 ? 106 ASP C C   1 
ATOM   4030 O  O   . ASP C 1 107 ? 6.650   13.414  54.254  1.00  28.28 ? 106 ASP C O   1 
ATOM   4031 C  CB  . ASP C 1 107 ? 4.634   15.132  52.250  1.00  28.65 ? 106 ASP C CB  1 
ATOM   4032 C  CG  . ASP C 1 107 ? 3.285   14.998  51.559  1.00  30.49 ? 106 ASP C CG  1 
ATOM   4033 O  OD1 . ASP C 1 107 ? 2.463   14.182  52.040  1.00  32.02 ? 106 ASP C OD1 1 
ATOM   4034 O  OD2 . ASP C 1 107 ? 3.036   15.695  50.541  1.00  31.72 ? 106 ASP C OD2 1 
ATOM   4035 N  N   . ALA C 1 108 ? 6.519   15.591  54.796  1.00  28.49 ? 107 ALA C N   1 
ATOM   4036 C  CA  . ALA C 1 108 ? 7.822   15.640  55.458  1.00  28.87 ? 107 ALA C CA  1 
ATOM   4037 C  C   . ALA C 1 108 ? 7.872   14.840  56.772  1.00  29.18 ? 107 ALA C C   1 
ATOM   4038 O  O   . ALA C 1 108 ? 8.905   14.256  57.103  1.00  29.36 ? 107 ALA C O   1 
ATOM   4039 C  CB  . ALA C 1 108 ? 8.239   17.086  55.695  1.00  28.77 ? 107 ALA C CB  1 
ATOM   4040 N  N   . ILE C 1 109 ? 6.771   14.833  57.523  1.00  29.33 ? 108 ILE C N   1 
ATOM   4041 C  CA  . ILE C 1 109 ? 6.652   14.006  58.733  1.00  29.70 ? 108 ILE C CA  1 
ATOM   4042 C  C   . ILE C 1 109 ? 6.626   12.506  58.388  1.00  29.88 ? 108 ILE C C   1 
ATOM   4043 O  O   . ILE C 1 109 ? 7.249   11.683  59.068  1.00  29.83 ? 108 ILE C O   1 
ATOM   4044 C  CB  . ILE C 1 109 ? 5.407   14.399  59.570  1.00  29.61 ? 108 ILE C CB  1 
ATOM   4045 C  CG1 . ILE C 1 109 ? 5.668   15.723  60.306  1.00  29.63 ? 108 ILE C CG1 1 
ATOM   4046 C  CG2 . ILE C 1 109 ? 5.030   13.285  60.559  1.00  29.75 ? 108 ILE C CG2 1 
ATOM   4047 C  CD1 . ILE C 1 109 ? 4.436   16.337  60.972  1.00  30.31 ? 108 ILE C CD1 1 
ATOM   4048 N  N   . ASN C 1 110 ? 5.904   12.159  57.328  1.00  30.40 ? 109 ASN C N   1 
ATOM   4049 C  CA  . ASN C 1 110 ? 5.884   10.781  56.853  1.00  30.83 ? 109 ASN C CA  1 
ATOM   4050 C  C   . ASN C 1 110 ? 7.286   10.338  56.438  1.00  31.59 ? 109 ASN C C   1 
ATOM   4051 O  O   . ASN C 1 110 ? 7.730   9.242   56.787  1.00  31.64 ? 109 ASN C O   1 
ATOM   4052 C  CB  . ASN C 1 110 ? 4.881   10.614  55.711  1.00  30.72 ? 109 ASN C CB  1 
ATOM   4053 C  CG  . ASN C 1 110 ? 3.439   10.628  56.192  1.00  30.68 ? 109 ASN C CG  1 
ATOM   4054 O  OD1 . ASN C 1 110 ? 3.163   10.435  57.379  1.00  30.90 ? 109 ASN C OD1 1 
ATOM   4055 N  ND2 . ASN C 1 110 ? 2.508   10.843  55.264  1.00  29.47 ? 109 ASN C ND2 1 
ATOM   4056 N  N   . SER C 1 111 ? 7.988   11.219  55.730  1.00  32.07 ? 110 SER C N   1 
ATOM   4057 C  CA  . SER C 1 111 ? 9.338   10.939  55.254  1.00  32.99 ? 110 SER C CA  1 
ATOM   4058 C  C   . SER C 1 111 ? 10.306  10.722  56.416  1.00  32.96 ? 110 SER C C   1 
ATOM   4059 O  O   . SER C 1 111 ? 11.038  9.733   56.446  1.00  33.50 ? 110 SER C O   1 
ATOM   4060 C  CB  . SER C 1 111 ? 9.825   12.089  54.371  1.00  32.97 ? 110 SER C CB  1 
ATOM   4061 O  OG  . SER C 1 111 ? 10.956  11.707  53.612  1.00  34.57 ? 110 SER C OG  1 
ATOM   4062 N  N   . ALA C 1 112 ? 10.280  11.644  57.374  1.00  32.75 ? 111 ALA C N   1 
ATOM   4063 C  CA  . ALA C 1 112 ? 11.212  11.656  58.495  1.00  32.79 ? 111 ALA C CA  1 
ATOM   4064 C  C   . ALA C 1 112 ? 10.925  10.585  59.545  1.00  32.66 ? 111 ALA C C   1 
ATOM   4065 O  O   . ALA C 1 112 ? 11.858  9.963   60.055  1.00  32.75 ? 111 ALA C O   1 
ATOM   4066 C  CB  . ALA C 1 112 ? 11.236  13.042  59.144  1.00  32.75 ? 111 ALA C CB  1 
ATOM   4067 N  N   . PHE C 1 113 ? 9.645   10.364  59.849  1.00  32.30 ? 112 PHE C N   1 
ATOM   4068 C  CA  . PHE C 1 113 ? 9.244   9.539   60.995  1.00  31.68 ? 112 PHE C CA  1 
ATOM   4069 C  C   . PHE C 1 113 ? 8.415   8.300   60.660  1.00  31.80 ? 112 PHE C C   1 
ATOM   4070 O  O   . PHE C 1 113 ? 8.107   7.511   61.557  1.00  31.90 ? 112 PHE C O   1 
ATOM   4071 C  CB  . PHE C 1 113 ? 8.475   10.392  62.007  1.00  31.82 ? 112 PHE C CB  1 
ATOM   4072 C  CG  . PHE C 1 113 ? 9.223   11.610  62.469  1.00  31.40 ? 112 PHE C CG  1 
ATOM   4073 C  CD1 . PHE C 1 113 ? 10.286  11.497  63.366  1.00  31.05 ? 112 PHE C CD1 1 
ATOM   4074 C  CD2 . PHE C 1 113 ? 8.856   12.878  62.020  1.00  31.07 ? 112 PHE C CD2 1 
ATOM   4075 C  CE1 . PHE C 1 113 ? 10.979  12.633  63.806  1.00  31.29 ? 112 PHE C CE1 1 
ATOM   4076 C  CE2 . PHE C 1 113 ? 9.543   14.018  62.452  1.00  31.05 ? 112 PHE C CE2 1 
ATOM   4077 C  CZ  . PHE C 1 113 ? 10.605  13.896  63.346  1.00  31.02 ? 112 PHE C CZ  1 
ATOM   4078 N  N   . GLY C 1 114 ? 8.040   8.136   59.392  1.00  31.12 ? 113 GLY C N   1 
ATOM   4079 C  CA  . GLY C 1 114 ? 7.253   6.977   58.963  1.00  30.75 ? 113 GLY C CA  1 
ATOM   4080 C  C   . GLY C 1 114 ? 5.758   7.245   58.954  1.00  30.37 ? 113 GLY C C   1 
ATOM   4081 O  O   . GLY C 1 114 ? 5.068   6.846   58.029  1.00  30.44 ? 113 GLY C O   1 
ATOM   4082 N  N   . SER C 1 115 ? 5.264   7.920   59.993  1.00  30.34 ? 114 SER C N   1 
ATOM   4083 C  CA  . SER C 1 115 ? 3.851   8.286   60.106  1.00  29.94 ? 114 SER C CA  1 
ATOM   4084 C  C   . SER C 1 115 ? 3.650   9.403   61.129  1.00  30.07 ? 114 SER C C   1 
ATOM   4085 O  O   . SER C 1 115 ? 4.534   9.676   61.951  1.00  29.68 ? 114 SER C O   1 
ATOM   4086 C  CB  . SER C 1 115 ? 2.997   7.073   60.504  1.00  29.94 ? 114 SER C CB  1 
ATOM   4087 O  OG  . SER C 1 115 ? 3.244   6.692   61.851  1.00  29.51 ? 114 SER C OG  1 
ATOM   4088 N  N   . PHE C 1 116 ? 2.478   10.032  61.080  1.00  29.88 ? 115 PHE C N   1 
ATOM   4089 C  CA  . PHE C 1 116 ? 2.112   11.033  62.080  1.00  30.24 ? 115 PHE C CA  1 
ATOM   4090 C  C   . PHE C 1 116 ? 2.033   10.419  63.485  1.00  30.44 ? 115 PHE C C   1 
ATOM   4091 O  O   . PHE C 1 116 ? 2.516   11.011  64.450  1.00  30.16 ? 115 PHE C O   1 
ATOM   4092 C  CB  . PHE C 1 116 ? 0.811   11.745  61.685  1.00  30.25 ? 115 PHE C CB  1 
ATOM   4093 C  CG  . PHE C 1 116 ? 0.368   12.789  62.668  1.00  30.05 ? 115 PHE C CG  1 
ATOM   4094 C  CD1 . PHE C 1 116 ? 1.203   13.852  63.000  1.00  31.08 ? 115 PHE C CD1 1 
ATOM   4095 C  CD2 . PHE C 1 116 ? -0.892  12.715  63.258  1.00  30.61 ? 115 PHE C CD2 1 
ATOM   4096 C  CE1 . PHE C 1 116 ? 0.799   14.826  63.931  1.00  31.14 ? 115 PHE C CE1 1 
ATOM   4097 C  CE2 . PHE C 1 116 ? -1.307  13.686  64.181  1.00  29.85 ? 115 PHE C CE2 1 
ATOM   4098 C  CZ  . PHE C 1 116 ? -0.461  14.744  64.512  1.00  29.96 ? 115 PHE C CZ  1 
ATOM   4099 N  N   . ASP C 1 117 ? 1.464   9.216   63.596  1.00  30.66 ? 116 ASP C N   1 
ATOM   4100 C  CA  . ASP C 1 117 ? 1.406   8.535   64.899  1.00  31.26 ? 116 ASP C CA  1 
ATOM   4101 C  C   . ASP C 1 117 ? 2.795   8.227   65.479  1.00  30.74 ? 116 ASP C C   1 
ATOM   4102 O  O   . ASP C 1 117 ? 3.003   8.349   66.689  1.00  30.48 ? 116 ASP C O   1 
ATOM   4103 C  CB  . ASP C 1 117 ? 0.557   7.258   64.816  1.00  31.73 ? 116 ASP C CB  1 
ATOM   4104 C  CG  . ASP C 1 117 ? -0.930  7.550   64.691  1.00  33.71 ? 116 ASP C CG  1 
ATOM   4105 O  OD1 . ASP C 1 117 ? -1.366  8.663   65.073  1.00  37.61 ? 116 ASP C OD1 1 
ATOM   4106 O  OD2 . ASP C 1 117 ? -1.668  6.658   64.225  1.00  36.16 ? 116 ASP C OD2 1 
ATOM   4107 N  N   . ALA C 1 118 ? 3.734   7.842   64.612  1.00  30.64 ? 117 ALA C N   1 
ATOM   4108 C  CA  . ALA C 1 118 ? 5.128   7.590   65.011  1.00  30.57 ? 117 ALA C CA  1 
ATOM   4109 C  C   . ALA C 1 118 ? 5.840   8.867   65.461  1.00  30.60 ? 117 ALA C C   1 
ATOM   4110 O  O   . ALA C 1 118 ? 6.524   8.872   66.492  1.00  30.02 ? 117 ALA C O   1 
ATOM   4111 C  CB  . ALA C 1 118 ? 5.899   6.924   63.879  1.00  30.80 ? 117 ALA C CB  1 
ATOM   4112 N  N   . PHE C 1 119 ? 5.696   9.942   64.685  1.00  30.50 ? 118 PHE C N   1 
ATOM   4113 C  CA  . PHE C 1 119 ? 6.213   11.238  65.118  1.00  30.48 ? 118 PHE C CA  1 
ATOM   4114 C  C   . PHE C 1 119 ? 5.701   11.587  66.514  1.00  30.73 ? 118 PHE C C   1 
ATOM   4115 O  O   . PHE C 1 119 ? 6.496   11.933  67.405  1.00  30.87 ? 118 PHE C O   1 
ATOM   4116 C  CB  . PHE C 1 119 ? 5.870   12.358  64.126  1.00  30.41 ? 118 PHE C CB  1 
ATOM   4117 C  CG  . PHE C 1 119 ? 5.800   13.716  64.766  1.00  29.31 ? 118 PHE C CG  1 
ATOM   4118 C  CD1 . PHE C 1 119 ? 6.965   14.376  65.154  1.00  28.62 ? 118 PHE C CD1 1 
ATOM   4119 C  CD2 . PHE C 1 119 ? 4.569   14.313  65.025  1.00  29.14 ? 118 PHE C CD2 1 
ATOM   4120 C  CE1 . PHE C 1 119 ? 6.903   15.630  65.791  1.00  30.02 ? 118 PHE C CE1 1 
ATOM   4121 C  CE2 . PHE C 1 119 ? 4.494   15.565  65.643  1.00  29.33 ? 118 PHE C CE2 1 
ATOM   4122 C  CZ  . PHE C 1 119 ? 5.666   16.222  66.032  1.00  29.92 ? 118 PHE C CZ  1 
ATOM   4123 N  N   . LYS C 1 120 ? 4.383   11.510  66.710  1.00  31.09 ? 119 LYS C N   1 
ATOM   4124 C  CA  . LYS C 1 120 ? 3.783   11.868  68.002  1.00  31.45 ? 119 LYS C CA  1 
ATOM   4125 C  C   . LYS C 1 120 ? 4.412   11.095  69.144  1.00  31.92 ? 119 LYS C C   1 
ATOM   4126 O  O   . LYS C 1 120 ? 4.677   11.660  70.210  1.00  31.25 ? 119 LYS C O   1 
ATOM   4127 C  CB  . LYS C 1 120 ? 2.265   11.655  68.006  1.00  31.70 ? 119 LYS C CB  1 
ATOM   4128 C  CG  . LYS C 1 120 ? 1.480   12.705  67.231  1.00  31.86 ? 119 LYS C CG  1 
ATOM   4129 C  CD  . LYS C 1 120 ? 0.001   12.742  67.663  1.00  33.47 ? 119 LYS C CD  1 
ATOM   4130 C  CE  . LYS C 1 120 ? -0.792  11.540  67.180  1.00  34.78 ? 119 LYS C CE  1 
ATOM   4131 N  NZ  . LYS C 1 120 ? -2.193  11.612  67.695  1.00  35.00 ? 119 LYS C NZ  1 
ATOM   4132 N  N   . GLN C 1 121 ? 4.655   9.805   68.916  1.00  32.43 ? 120 GLN C N   1 
ATOM   4133 C  CA  . GLN C 1 121 ? 5.285   8.946   69.919  1.00  33.48 ? 120 GLN C CA  1 
ATOM   4134 C  C   . GLN C 1 121 ? 6.729   9.381   70.220  1.00  33.07 ? 120 GLN C C   1 
ATOM   4135 O  O   . GLN C 1 121 ? 7.143   9.398   71.386  1.00  32.77 ? 120 GLN C O   1 
ATOM   4136 C  CB  . GLN C 1 121 ? 5.229   7.480   69.479  1.00  33.43 ? 120 GLN C CB  1 
ATOM   4137 C  CG  . GLN C 1 121 ? 5.551   6.473   70.589  1.00  35.27 ? 120 GLN C CG  1 
ATOM   4138 C  CD  . GLN C 1 121 ? 5.584   5.032   70.095  1.00  36.01 ? 120 GLN C CD  1 
ATOM   4139 O  OE1 . GLN C 1 121 ? 5.027   4.704   69.037  1.00  40.61 ? 120 GLN C OE1 1 
ATOM   4140 N  NE2 . GLN C 1 121 ? 6.227   4.151   70.876  1.00  39.75 ? 120 GLN C NE2 1 
ATOM   4141 N  N   . LYS C 1 122 ? 7.483   9.742   69.176  1.00  33.07 ? 121 LYS C N   1 
ATOM   4142 C  CA  . LYS C 1 122 ? 8.852   10.252  69.343  1.00  33.24 ? 121 LYS C CA  1 
ATOM   4143 C  C   . LYS C 1 122 ? 8.860   11.591  70.090  1.00  32.57 ? 121 LYS C C   1 
ATOM   4144 O  O   . LYS C 1 122 ? 9.701   11.806  70.964  1.00  32.32 ? 121 LYS C O   1 
ATOM   4145 C  CB  . LYS C 1 122 ? 9.561   10.412  67.991  1.00  33.66 ? 121 LYS C CB  1 
ATOM   4146 C  CG  . LYS C 1 122 ? 9.916   9.095   67.283  1.00  36.32 ? 121 LYS C CG  1 
ATOM   4147 C  CD  . LYS C 1 122 ? 11.408  8.749   67.405  1.00  41.17 ? 121 LYS C CD  1 
ATOM   4148 C  CE  . LYS C 1 122 ? 12.239  9.435   66.311  1.00  42.95 ? 121 LYS C CE  1 
ATOM   4149 N  NZ  . LYS C 1 122 ? 13.664  8.978   66.282  1.00  45.72 ? 121 LYS C NZ  1 
ATOM   4150 N  N   . PHE C 1 123 ? 7.928   12.477  69.734  1.00  31.86 ? 122 PHE C N   1 
ATOM   4151 C  CA  . PHE C 1 123 ? 7.816   13.808  70.356  1.00  31.97 ? 122 PHE C CA  1 
ATOM   4152 C  C   . PHE C 1 123 ? 7.448   13.705  71.839  1.00  32.20 ? 122 PHE C C   1 
ATOM   4153 O  O   . PHE C 1 123 ? 8.079   14.357  72.683  1.00  31.76 ? 122 PHE C O   1 
ATOM   4154 C  CB  . PHE C 1 123 ? 6.795   14.661  69.593  1.00  31.59 ? 122 PHE C CB  1 
ATOM   4155 C  CG  . PHE C 1 123 ? 6.722   16.103  70.042  1.00  31.07 ? 122 PHE C CG  1 
ATOM   4156 C  CD1 . PHE C 1 123 ? 7.553   17.063  69.467  1.00  30.53 ? 122 PHE C CD1 1 
ATOM   4157 C  CD2 . PHE C 1 123 ? 5.790   16.504  71.008  1.00  29.98 ? 122 PHE C CD2 1 
ATOM   4158 C  CE1 . PHE C 1 123 ? 7.484   18.412  69.869  1.00  30.75 ? 122 PHE C CE1 1 
ATOM   4159 C  CE2 . PHE C 1 123 ? 5.693   17.853  71.412  1.00  29.60 ? 122 PHE C CE2 1 
ATOM   4160 C  CZ  . PHE C 1 123 ? 6.546   18.807  70.845  1.00  30.33 ? 122 PHE C CZ  1 
ATOM   4161 N  N   . GLU C 1 124 ? 6.438   12.890  72.149  1.00  32.51 ? 123 GLU C N   1 
ATOM   4162 C  CA  . GLU C 1 124 ? 6.044   12.627  73.540  1.00  33.72 ? 123 GLU C CA  1 
ATOM   4163 C  C   . GLU C 1 124 ? 7.172   12.000  74.363  1.00  33.62 ? 123 GLU C C   1 
ATOM   4164 O  O   . GLU C 1 124 ? 7.352   12.351  75.535  1.00  33.65 ? 123 GLU C O   1 
ATOM   4165 C  CB  . GLU C 1 124 ? 4.785   11.746  73.604  1.00  33.57 ? 123 GLU C CB  1 
ATOM   4166 C  CG  . GLU C 1 124 ? 3.489   12.489  73.288  1.00  34.90 ? 123 GLU C CG  1 
ATOM   4167 C  CD  . GLU C 1 124 ? 2.236   11.663  73.574  1.00  35.85 ? 123 GLU C CD  1 
ATOM   4168 O  OE1 . GLU C 1 124 ? 2.269   10.796  74.476  1.00  39.74 ? 123 GLU C OE1 1 
ATOM   4169 O  OE2 . GLU C 1 124 ? 1.211   11.880  72.894  1.00  39.12 ? 123 GLU C OE2 1 
ATOM   4170 N  N   . ASP C 1 125 ? 7.927   11.081  73.760  1.00  33.70 ? 124 ASP C N   1 
ATOM   4171 C  CA  . ASP C 1 125 ? 9.064   10.448  74.444  1.00  34.24 ? 124 ASP C CA  1 
ATOM   4172 C  C   . ASP C 1 125 ? 10.142  11.472  74.814  1.00  33.76 ? 124 ASP C C   1 
ATOM   4173 O  O   . ASP C 1 125 ? 10.611  11.498  75.960  1.00  33.41 ? 124 ASP C O   1 
ATOM   4174 C  CB  . ASP C 1 125 ? 9.659   9.302   73.617  1.00  34.77 ? 124 ASP C CB  1 
ATOM   4175 C  CG  . ASP C 1 125 ? 10.851  8.636   74.310  1.00  38.03 ? 124 ASP C CG  1 
ATOM   4176 O  OD1 . ASP C 1 125 ? 11.995  9.124   74.152  1.00  41.02 ? 124 ASP C OD1 1 
ATOM   4177 O  OD2 . ASP C 1 125 ? 10.647  7.625   75.020  1.00  41.27 ? 124 ASP C OD2 1 
ATOM   4178 N  N   . ALA C 1 126 ? 10.515  12.323  73.854  1.00  33.22 ? 125 ALA C N   1 
ATOM   4179 C  CA  . ALA C 1 126 ? 11.450  13.420  74.118  1.00  32.79 ? 125 ALA C CA  1 
ATOM   4180 C  C   . ALA C 1 126 ? 10.948  14.329  75.240  1.00  32.57 ? 125 ALA C C   1 
ATOM   4181 O  O   . ALA C 1 126 ? 11.723  14.743  76.092  1.00  32.29 ? 125 ALA C O   1 
ATOM   4182 C  CB  . ALA C 1 126 ? 11.696  14.224  72.864  1.00  32.89 ? 125 ALA C CB  1 
ATOM   4183 N  N   . ALA C 1 127 ? 9.654   14.645  75.225  1.00  32.39 ? 126 ALA C N   1 
ATOM   4184 C  CA  . ALA C 1 127 ? 9.053   15.475  76.268  1.00  32.33 ? 126 ALA C CA  1 
ATOM   4185 C  C   . ALA C 1 127 ? 9.014   14.784  77.633  1.00  32.81 ? 126 ALA C C   1 
ATOM   4186 O  O   . ALA C 1 127 ? 9.241   15.423  78.662  1.00  32.53 ? 126 ALA C O   1 
ATOM   4187 C  CB  . ALA C 1 127 ? 7.669   15.946  75.840  1.00  32.06 ? 126 ALA C CB  1 
ATOM   4188 N  N   . LYS C 1 128 ? 8.764   13.474  77.637  1.00  32.94 ? 127 LYS C N   1 
ATOM   4189 C  CA  . LYS C 1 128 ? 8.736   12.694  78.880  1.00  33.58 ? 127 LYS C CA  1 
ATOM   4190 C  C   . LYS C 1 128 ? 10.122  12.472  79.478  1.00  33.10 ? 127 LYS C C   1 
ATOM   4191 O  O   . LYS C 1 128 ? 10.279  12.465  80.706  1.00  33.73 ? 127 LYS C O   1 
ATOM   4192 C  CB  . LYS C 1 128 ? 8.069   11.329  78.660  1.00  33.38 ? 127 LYS C CB  1 
ATOM   4193 C  CG  . LYS C 1 128 ? 6.543   11.356  78.615  1.00  34.22 ? 127 LYS C CG  1 
ATOM   4194 C  CD  . LYS C 1 128 ? 5.971   9.931   78.556  1.00  34.80 ? 127 LYS C CD  1 
ATOM   4195 C  CE  . LYS C 1 128 ? 5.616   9.517   77.145  1.00  37.60 ? 127 LYS C CE  1 
ATOM   4196 N  NZ  . LYS C 1 128 ? 4.993   8.163   77.126  1.00  39.65 ? 127 LYS C NZ  1 
ATOM   4197 N  N   . THR C 1 129 ? 11.124  12.292  78.624  1.00  32.41 ? 128 THR C N   1 
ATOM   4198 C  CA  . THR C 1 129 ? 12.480  12.013  79.108  1.00  32.55 ? 128 THR C CA  1 
ATOM   4199 C  C   . THR C 1 129 ? 13.274  13.275  79.478  1.00  31.86 ? 128 THR C C   1 
ATOM   4200 O  O   . THR C 1 129 ? 14.391  13.178  79.979  1.00  31.53 ? 128 THR C O   1 
ATOM   4201 C  CB  . THR C 1 129 ? 13.293  11.166  78.110  1.00  32.57 ? 128 THR C CB  1 
ATOM   4202 O  OG1 . THR C 1 129 ? 13.257  11.787  76.823  1.00  33.71 ? 128 THR C OG1 1 
ATOM   4203 C  CG2 . THR C 1 129 ? 12.729  9.765   78.007  1.00  33.33 ? 128 THR C CG2 1 
ATOM   4204 N  N   . ARG C 1 130 ? 12.703  14.453  79.225  1.00  31.14 ? 129 ARG C N   1 
ATOM   4205 C  CA  . ARG C 1 130 ? 13.340  15.704  79.641  1.00  31.02 ? 129 ARG C CA  1 
ATOM   4206 C  C   . ARG C 1 130 ? 13.247  15.837  81.171  1.00  30.31 ? 129 ARG C C   1 
ATOM   4207 O  O   . ARG C 1 130 ? 12.182  16.131  81.727  1.00  30.52 ? 129 ARG C O   1 
ATOM   4208 C  CB  . ARG C 1 130 ? 12.717  16.907  78.906  1.00  31.10 ? 129 ARG C CB  1 
ATOM   4209 C  CG  . ARG C 1 130 ? 13.139  18.327  79.362  1.00  32.12 ? 129 ARG C CG  1 
ATOM   4210 C  CD  . ARG C 1 130 ? 14.645  18.492  79.607  1.00  32.35 ? 129 ARG C CD  1 
ATOM   4211 N  NE  . ARG C 1 130 ? 15.455  18.211  78.418  1.00  31.57 ? 129 ARG C NE  1 
ATOM   4212 C  CZ  . ARG C 1 130 ? 16.771  18.391  78.370  1.00  31.25 ? 129 ARG C CZ  1 
ATOM   4213 N  NH1 . ARG C 1 130 ? 17.415  18.859  79.438  1.00  30.53 ? 129 ARG C NH1 1 
ATOM   4214 N  NH2 . ARG C 1 130 ? 17.438  18.134  77.258  1.00  30.45 ? 129 ARG C NH2 1 
ATOM   4215 N  N   . PHE C 1 131 ? 14.377  15.610  81.835  1.00  29.50 ? 130 PHE C N   1 
ATOM   4216 C  CA  . PHE C 1 131 ? 14.429  15.619  83.290  1.00  28.54 ? 130 PHE C CA  1 
ATOM   4217 C  C   . PHE C 1 131 ? 14.634  17.025  83.814  1.00  28.44 ? 130 PHE C C   1 
ATOM   4218 O  O   . PHE C 1 131 ? 15.586  17.714  83.427  1.00  28.83 ? 130 PHE C O   1 
ATOM   4219 C  CB  . PHE C 1 131 ? 15.536  14.702  83.803  1.00  27.74 ? 130 PHE C CB  1 
ATOM   4220 C  CG  . PHE C 1 131 ? 15.441  14.405  85.264  1.00  26.97 ? 130 PHE C CG  1 
ATOM   4221 C  CD1 . PHE C 1 131 ? 14.561  13.437  85.729  1.00  26.30 ? 130 PHE C CD1 1 
ATOM   4222 C  CD2 . PHE C 1 131 ? 16.235  15.086  86.176  1.00  25.46 ? 130 PHE C CD2 1 
ATOM   4223 C  CE1 . PHE C 1 131 ? 14.480  13.147  87.088  1.00  26.58 ? 130 PHE C CE1 1 
ATOM   4224 C  CE2 . PHE C 1 131 ? 16.160  14.813  87.540  1.00  27.11 ? 130 PHE C CE2 1 
ATOM   4225 C  CZ  . PHE C 1 131 ? 15.279  13.833  87.997  1.00  26.64 ? 130 PHE C CZ  1 
ATOM   4226 N  N   . GLY C 1 132 ? 13.746  17.435  84.715  1.00  27.92 ? 131 GLY C N   1 
ATOM   4227 C  CA  . GLY C 1 132 ? 13.747  18.799  85.226  1.00  27.48 ? 131 GLY C CA  1 
ATOM   4228 C  C   . GLY C 1 132 ? 12.939  19.683  84.299  1.00  27.31 ? 131 GLY C C   1 
ATOM   4229 O  O   . GLY C 1 132 ? 11.996  19.217  83.646  1.00  27.57 ? 131 GLY C O   1 
ATOM   4230 N  N   . SER C 1 133 ? 13.332  20.951  84.210  1.00  27.25 ? 132 SER C N   1 
ATOM   4231 C  CA  . SER C 1 133 ? 12.612  21.930  83.388  1.00  27.19 ? 132 SER C CA  1 
ATOM   4232 C  C   . SER C 1 133 ? 13.144  21.949  81.970  1.00  26.93 ? 132 SER C C   1 
ATOM   4233 O  O   . SER C 1 133 ? 14.345  21.775  81.740  1.00  26.47 ? 132 SER C O   1 
ATOM   4234 C  CB  . SER C 1 133 ? 12.757  23.330  83.981  1.00  27.27 ? 132 SER C CB  1 
ATOM   4235 O  OG  . SER C 1 133 ? 12.263  23.376  85.308  1.00  28.10 ? 132 SER C OG  1 
ATOM   4236 N  N   . GLY C 1 134 ? 12.250  22.170  81.016  1.00  26.73 ? 133 GLY C N   1 
ATOM   4237 C  CA  . GLY C 1 134 ? 12.669  22.275  79.627  1.00  27.19 ? 133 GLY C CA  1 
ATOM   4238 C  C   . GLY C 1 134 ? 11.541  22.252  78.611  1.00  27.43 ? 133 GLY C C   1 
ATOM   4239 O  O   . GLY C 1 134 ? 10.382  22.515  78.941  1.00  27.93 ? 133 GLY C O   1 
ATOM   4240 N  N   . TRP C 1 135 ? 11.915  21.957  77.369  1.00  27.34 ? 134 TRP C N   1 
ATOM   4241 C  CA  . TRP C 1 135 ? 11.016  21.981  76.217  1.00  28.00 ? 134 TRP C CA  1 
ATOM   4242 C  C   . TRP C 1 135 ? 11.321  20.791  75.336  1.00  27.27 ? 134 TRP C C   1 
ATOM   4243 O  O   . TRP C 1 135 ? 12.454  20.329  75.316  1.00  27.55 ? 134 TRP C O   1 
ATOM   4244 C  CB  . TRP C 1 135 ? 11.274  23.246  75.390  1.00  27.97 ? 134 TRP C CB  1 
ATOM   4245 C  CG  . TRP C 1 135 ? 10.821  24.495  76.054  1.00  28.47 ? 134 TRP C CG  1 
ATOM   4246 C  CD1 . TRP C 1 135 ? 11.432  25.150  77.091  1.00  28.92 ? 134 TRP C CD1 1 
ATOM   4247 C  CD2 . TRP C 1 135 ? 9.651   25.241  75.742  1.00  28.60 ? 134 TRP C CD2 1 
ATOM   4248 N  NE1 . TRP C 1 135 ? 10.700  26.252  77.450  1.00  28.02 ? 134 TRP C NE1 1 
ATOM   4249 C  CE2 . TRP C 1 135 ? 9.598   26.329  76.639  1.00  29.03 ? 134 TRP C CE2 1 
ATOM   4250 C  CE3 . TRP C 1 135 ? 8.627   25.093  74.790  1.00  28.64 ? 134 TRP C CE3 1 
ATOM   4251 C  CZ2 . TRP C 1 135 ? 8.575   27.270  76.606  1.00  29.53 ? 134 TRP C CZ2 1 
ATOM   4252 C  CZ3 . TRP C 1 135 ? 7.598   26.025  74.770  1.00  28.89 ? 134 TRP C CZ3 1 
ATOM   4253 C  CH2 . TRP C 1 135 ? 7.588   27.107  75.666  1.00  29.48 ? 134 TRP C CH2 1 
ATOM   4254 N  N   . ALA C 1 136 ? 10.324  20.299  74.604  1.00  26.93 ? 135 ALA C N   1 
ATOM   4255 C  CA  . ALA C 1 136 ? 10.576  19.341  73.532  1.00  26.92 ? 135 ALA C CA  1 
ATOM   4256 C  C   . ALA C 1 136 ? 10.206  20.012  72.205  1.00  27.15 ? 135 ALA C C   1 
ATOM   4257 O  O   . ALA C 1 136 ? 9.280   20.814  72.162  1.00  26.48 ? 135 ALA C O   1 
ATOM   4258 C  CB  . ALA C 1 136 ? 9.795   18.065  73.743  1.00  27.60 ? 135 ALA C CB  1 
ATOM   4259 N  N   . TRP C 1 137 ? 10.957  19.710  71.148  1.00  27.07 ? 136 TRP C N   1 
ATOM   4260 C  CA  . TRP C 1 137 ? 10.844  20.438  69.891  1.00  27.62 ? 136 TRP C CA  1 
ATOM   4261 C  C   . TRP C 1 137 ? 10.779  19.542  68.668  1.00  27.84 ? 136 TRP C C   1 
ATOM   4262 O  O   . TRP C 1 137 ? 11.416  18.491  68.618  1.00  28.15 ? 136 TRP C O   1 
ATOM   4263 C  CB  . TRP C 1 137 ? 12.071  21.333  69.682  1.00  27.95 ? 136 TRP C CB  1 
ATOM   4264 C  CG  . TRP C 1 137 ? 12.415  22.249  70.813  1.00  27.82 ? 136 TRP C CG  1 
ATOM   4265 C  CD1 . TRP C 1 137 ? 13.341  22.035  71.798  1.00  27.96 ? 136 TRP C CD1 1 
ATOM   4266 C  CD2 . TRP C 1 137 ? 11.863  23.545  71.050  1.00  27.50 ? 136 TRP C CD2 1 
ATOM   4267 N  NE1 . TRP C 1 137 ? 13.392  23.119  72.639  1.00  27.50 ? 136 TRP C NE1 1 
ATOM   4268 C  CE2 . TRP C 1 137 ? 12.496  24.062  72.204  1.00  28.52 ? 136 TRP C CE2 1 
ATOM   4269 C  CE3 . TRP C 1 137 ? 10.887  24.317  70.401  1.00  28.44 ? 136 TRP C CE3 1 
ATOM   4270 C  CZ2 . TRP C 1 137 ? 12.189  25.325  72.728  1.00  28.96 ? 136 TRP C CZ2 1 
ATOM   4271 C  CZ3 . TRP C 1 137 ? 10.578  25.571  70.914  1.00  28.82 ? 136 TRP C CZ3 1 
ATOM   4272 C  CH2 . TRP C 1 137 ? 11.228  26.061  72.080  1.00  28.89 ? 136 TRP C CH2 1 
ATOM   4273 N  N   . LEU C 1 138 ? 10.043  20.007  67.668  1.00  27.78 ? 137 LEU C N   1 
ATOM   4274 C  CA  . LEU C 1 138 ? 10.177  19.518  66.304  1.00  28.23 ? 137 LEU C CA  1 
ATOM   4275 C  C   . LEU C 1 138 ? 10.980  20.564  65.535  1.00  28.39 ? 137 LEU C C   1 
ATOM   4276 O  O   . LEU C 1 138 ? 10.548  21.717  65.403  1.00  28.84 ? 137 LEU C O   1 
ATOM   4277 C  CB  . LEU C 1 138 ? 8.801   19.317  65.667  1.00  27.58 ? 137 LEU C CB  1 
ATOM   4278 C  CG  . LEU C 1 138 ? 8.765   18.863  64.199  1.00  28.13 ? 137 LEU C CG  1 
ATOM   4279 C  CD1 . LEU C 1 138 ? 9.537   17.552  63.971  1.00  26.55 ? 137 LEU C CD1 1 
ATOM   4280 C  CD2 . LEU C 1 138 ? 7.322   18.723  63.739  1.00  28.51 ? 137 LEU C CD2 1 
ATOM   4281 N  N   . VAL C 1 139 ? 12.164  20.175  65.069  1.00  28.74 ? 138 VAL C N   1 
ATOM   4282 C  CA  . VAL C 1 139 ? 13.056  21.114  64.387  1.00  28.75 ? 138 VAL C CA  1 
ATOM   4283 C  C   . VAL C 1 139 ? 13.300  20.719  62.928  1.00  29.25 ? 138 VAL C C   1 
ATOM   4284 O  O   . VAL C 1 139 ? 13.132  19.548  62.544  1.00  28.87 ? 138 VAL C O   1 
ATOM   4285 C  CB  . VAL C 1 139 ? 14.420  21.298  65.132  1.00  28.57 ? 138 VAL C CB  1 
ATOM   4286 C  CG1 . VAL C 1 139 ? 14.217  21.811  66.575  1.00  28.47 ? 138 VAL C CG1 1 
ATOM   4287 C  CG2 . VAL C 1 139 ? 15.250  20.013  65.103  1.00  29.05 ? 138 VAL C CG2 1 
ATOM   4288 N  N   . VAL C 1 140 ? 13.671  21.707  62.118  1.00  30.08 ? 139 VAL C N   1 
ATOM   4289 C  CA  . VAL C 1 140 ? 14.167  21.455  60.767  1.00  31.46 ? 139 VAL C CA  1 
ATOM   4290 C  C   . VAL C 1 140 ? 15.669  21.681  60.850  1.00  32.57 ? 139 VAL C C   1 
ATOM   4291 O  O   . VAL C 1 140 ? 16.128  22.760  61.240  1.00  32.36 ? 139 VAL C O   1 
ATOM   4292 C  CB  . VAL C 1 140 ? 13.557  22.412  59.714  1.00  31.32 ? 139 VAL C CB  1 
ATOM   4293 C  CG1 . VAL C 1 140 ? 14.007  22.020  58.289  1.00  31.50 ? 139 VAL C CG1 1 
ATOM   4294 C  CG2 . VAL C 1 140 ? 12.041  22.436  59.818  1.00  31.95 ? 139 VAL C CG2 1 
ATOM   4295 N  N   . LYS C 1 141 ? 16.419  20.638  60.519  1.00  34.28 ? 140 LYS C N   1 
ATOM   4296 C  CA  . LYS C 1 141 ? 17.868  20.664  60.576  1.00  35.88 ? 140 LYS C CA  1 
ATOM   4297 C  C   . LYS C 1 141 ? 18.402  20.049  59.289  1.00  36.61 ? 140 LYS C C   1 
ATOM   4298 O  O   . LYS C 1 141 ? 18.146  18.874  59.003  1.00  36.66 ? 140 LYS C O   1 
ATOM   4299 C  CB  . LYS C 1 141 ? 18.356  19.897  61.815  1.00  36.12 ? 140 LYS C CB  1 
ATOM   4300 C  CG  . LYS C 1 141 ? 19.868  19.693  61.911  1.00  37.48 ? 140 LYS C CG  1 
ATOM   4301 C  CD  . LYS C 1 141 ? 20.598  20.942  62.378  1.00  39.56 ? 140 LYS C CD  1 
ATOM   4302 C  CE  . LYS C 1 141 ? 22.107  20.763  62.247  1.00  40.67 ? 140 LYS C CE  1 
ATOM   4303 N  NZ  . LYS C 1 141 ? 22.846  22.008  62.624  1.00  41.48 ? 140 LYS C NZ  1 
ATOM   4304 N  N   . ASP C 1 142 ? 19.136  20.858  58.521  1.00  37.39 ? 141 ASP C N   1 
ATOM   4305 C  CA  . ASP C 1 142 ? 19.660  20.472  57.207  1.00  38.01 ? 141 ASP C CA  1 
ATOM   4306 C  C   . ASP C 1 142 ? 18.513  20.062  56.284  1.00  37.76 ? 141 ASP C C   1 
ATOM   4307 O  O   . ASP C 1 142 ? 18.604  19.062  55.572  1.00  37.82 ? 141 ASP C O   1 
ATOM   4308 C  CB  . ASP C 1 142 ? 20.692  19.335  57.320  1.00  38.50 ? 141 ASP C CB  1 
ATOM   4309 C  CG  . ASP C 1 142 ? 21.720  19.576  58.416  1.00  40.44 ? 141 ASP C CG  1 
ATOM   4310 O  OD1 . ASP C 1 142 ? 22.221  20.718  58.543  1.00  41.89 ? 141 ASP C OD1 1 
ATOM   4311 O  OD2 . ASP C 1 142 ? 22.030  18.610  59.151  1.00  42.76 ? 141 ASP C OD2 1 
ATOM   4312 N  N   . GLY C 1 143 ? 17.431  20.839  56.330  1.00  37.36 ? 142 GLY C N   1 
ATOM   4313 C  CA  . GLY C 1 143 ? 16.222  20.562  55.567  1.00  36.83 ? 142 GLY C CA  1 
ATOM   4314 C  C   . GLY C 1 143 ? 15.479  19.305  55.986  1.00  36.61 ? 142 GLY C C   1 
ATOM   4315 O  O   . GLY C 1 143 ? 14.512  18.917  55.336  1.00  37.05 ? 142 GLY C O   1 
ATOM   4316 N  N   . LYS C 1 144 ? 15.927  18.664  57.063  1.00  35.90 ? 143 LYS C N   1 
ATOM   4317 C  CA  . LYS C 1 144 ? 15.299  17.433  57.543  1.00  35.51 ? 143 LYS C CA  1 
ATOM   4318 C  C   . LYS C 1 144 ? 14.676  17.619  58.927  1.00  34.59 ? 143 LYS C C   1 
ATOM   4319 O  O   . LYS C 1 144 ? 15.231  18.317  59.777  1.00  34.32 ? 143 LYS C O   1 
ATOM   4320 C  CB  . LYS C 1 144 ? 16.311  16.288  57.574  1.00  35.73 ? 143 LYS C CB  1 
ATOM   4321 C  CG  . LYS C 1 144 ? 16.735  15.800  56.197  1.00  37.36 ? 143 LYS C CG  1 
ATOM   4322 C  CD  . LYS C 1 144 ? 17.953  14.895  56.277  1.00  39.38 ? 143 LYS C CD  1 
ATOM   4323 C  CE  . LYS C 1 144 ? 18.286  14.337  54.904  1.00  40.78 ? 143 LYS C CE  1 
ATOM   4324 N  NZ  . LYS C 1 144 ? 19.448  13.401  54.932  1.00  43.17 ? 143 LYS C NZ  1 
ATOM   4325 N  N   . LEU C 1 145 ? 13.529  16.985  59.143  1.00  33.59 ? 144 LEU C N   1 
ATOM   4326 C  CA  . LEU C 1 145 ? 12.830  17.083  60.431  1.00  33.15 ? 144 LEU C CA  1 
ATOM   4327 C  C   . LEU C 1 145 ? 13.443  16.175  61.496  1.00  32.78 ? 144 LEU C C   1 
ATOM   4328 O  O   . LEU C 1 145 ? 13.880  15.064  61.196  1.00  32.13 ? 144 LEU C O   1 
ATOM   4329 C  CB  . LEU C 1 145 ? 11.343  16.757  60.267  1.00  33.11 ? 144 LEU C CB  1 
ATOM   4330 C  CG  . LEU C 1 145 ? 10.452  17.726  59.477  1.00  33.11 ? 144 LEU C CG  1 
ATOM   4331 C  CD1 . LEU C 1 145 ? 9.071   17.128  59.305  1.00  32.52 ? 144 LEU C CD1 1 
ATOM   4332 C  CD2 . LEU C 1 145 ? 10.346  19.079  60.149  1.00  32.39 ? 144 LEU C CD2 1 
ATOM   4333 N  N   . ASP C 1 146 ? 13.461  16.651  62.742  1.00  32.54 ? 145 ASP C N   1 
ATOM   4334 C  CA  . ASP C 1 146 ? 13.925  15.847  63.872  1.00  32.67 ? 145 ASP C CA  1 
ATOM   4335 C  C   . ASP C 1 146 ? 13.259  16.294  65.179  1.00  32.00 ? 145 ASP C C   1 
ATOM   4336 O  O   . ASP C 1 146 ? 12.740  17.405  65.268  1.00  31.77 ? 145 ASP C O   1 
ATOM   4337 C  CB  . ASP C 1 146 ? 15.456  15.909  63.986  1.00  33.45 ? 145 ASP C CB  1 
ATOM   4338 C  CG  . ASP C 1 146 ? 16.038  14.743  64.777  1.00  36.38 ? 145 ASP C CG  1 
ATOM   4339 O  OD1 . ASP C 1 146 ? 15.371  13.682  64.879  1.00  38.95 ? 145 ASP C OD1 1 
ATOM   4340 O  OD2 . ASP C 1 146 ? 17.172  14.883  65.298  1.00  40.72 ? 145 ASP C OD2 1 
ATOM   4341 N  N   . VAL C 1 147 ? 13.256  15.411  66.176  1.00  31.09 ? 146 VAL C N   1 
ATOM   4342 C  CA  . VAL C 1 147 ? 12.730  15.741  67.497  1.00  30.60 ? 146 VAL C CA  1 
ATOM   4343 C  C   . VAL C 1 147 ? 13.897  15.818  68.491  1.00  30.27 ? 146 VAL C C   1 
ATOM   4344 O  O   . VAL C 1 147 ? 14.722  14.901  68.559  1.00  29.96 ? 146 VAL C O   1 
ATOM   4345 C  CB  . VAL C 1 147 ? 11.669  14.704  67.987  1.00  30.75 ? 146 VAL C CB  1 
ATOM   4346 C  CG1 . VAL C 1 147 ? 11.298  14.961  69.438  1.00  31.22 ? 146 VAL C CG1 1 
ATOM   4347 C  CG2 . VAL C 1 147 ? 10.415  14.726  67.113  1.00  30.50 ? 146 VAL C CG2 1 
ATOM   4348 N  N   . VAL C 1 148 ? 13.961  16.915  69.246  1.00  30.21 ? 147 VAL C N   1 
ATOM   4349 C  CA  . VAL C 1 148 ? 15.004  17.127  70.251  1.00  29.98 ? 147 VAL C CA  1 
ATOM   4350 C  C   . VAL C 1 148 ? 14.377  17.769  71.490  1.00  30.05 ? 147 VAL C C   1 
ATOM   4351 O  O   . VAL C 1 148 ? 13.215  18.196  71.459  1.00  29.45 ? 147 VAL C O   1 
ATOM   4352 C  CB  . VAL C 1 148 ? 16.155  18.042  69.721  1.00  30.00 ? 147 VAL C CB  1 
ATOM   4353 C  CG1 . VAL C 1 148 ? 16.923  17.367  68.573  1.00  30.69 ? 147 VAL C CG1 1 
ATOM   4354 C  CG2 . VAL C 1 148 ? 15.616  19.420  69.286  1.00  30.47 ? 147 VAL C CG2 1 
ATOM   4355 N  N   . SER C 1 149 ? 15.131  17.833  72.580  1.00  29.82 ? 148 SER C N   1 
ATOM   4356 C  CA  . SER C 1 149 ? 14.688  18.622  73.733  1.00  30.22 ? 148 SER C CA  1 
ATOM   4357 C  C   . SER C 1 149 ? 15.818  19.492  74.249  1.00  29.28 ? 148 SER C C   1 
ATOM   4358 O  O   . SER C 1 149 ? 16.989  19.234  73.958  1.00  28.50 ? 148 SER C O   1 
ATOM   4359 C  CB  . SER C 1 149 ? 14.124  17.732  74.856  1.00  30.48 ? 148 SER C CB  1 
ATOM   4360 O  OG  . SER C 1 149 ? 15.148  17.102  75.603  1.00  32.60 ? 148 SER C OG  1 
ATOM   4361 N  N   . THR C 1 150 ? 15.447  20.529  74.997  1.00  28.52 ? 149 THR C N   1 
ATOM   4362 C  CA  . THR C 1 150 ? 16.396  21.437  75.632  1.00  28.26 ? 149 THR C CA  1 
ATOM   4363 C  C   . THR C 1 150 ? 16.085  21.573  77.109  1.00  27.72 ? 149 THR C C   1 
ATOM   4364 O  O   . THR C 1 150 ? 14.945  21.317  77.538  1.00  27.90 ? 149 THR C O   1 
ATOM   4365 C  CB  . THR C 1 150 ? 16.347  22.861  75.021  1.00  27.87 ? 149 THR C CB  1 
ATOM   4366 O  OG1 . THR C 1 150 ? 15.002  23.368  75.056  1.00  29.27 ? 149 THR C OG1 1 
ATOM   4367 C  CG2 . THR C 1 150 ? 16.891  22.852  73.574  1.00  28.51 ? 149 THR C CG2 1 
ATOM   4368 N  N   . ALA C 1 151 ? 17.100  21.984  77.864  1.00  27.14 ? 150 ALA C N   1 
ATOM   4369 C  CA  . ALA C 1 151 ? 16.973  22.325  79.279  1.00  26.79 ? 150 ALA C CA  1 
ATOM   4370 C  C   . ALA C 1 151 ? 16.505  23.757  79.469  1.00  26.91 ? 150 ALA C C   1 
ATOM   4371 O  O   . ALA C 1 151 ? 16.868  24.650  78.697  1.00  27.38 ? 150 ALA C O   1 
ATOM   4372 C  CB  . ALA C 1 151 ? 18.292  22.147  79.982  1.00  26.38 ? 150 ALA C CB  1 
ATOM   4373 N  N   . ASN C 1 152 ? 15.723  23.967  80.525  1.00  26.41 ? 151 ASN C N   1 
ATOM   4374 C  CA  . ASN C 1 152 ? 15.340  25.307  80.988  1.00  26.57 ? 151 ASN C CA  1 
ATOM   4375 C  C   . ASN C 1 152 ? 14.712  26.150  79.888  1.00  26.45 ? 151 ASN C C   1 
ATOM   4376 O  O   . ASN C 1 152 ? 13.697  25.737  79.330  1.00  26.26 ? 151 ASN C O   1 
ATOM   4377 C  CB  . ASN C 1 152 ? 16.523  25.960  81.697  1.00  26.07 ? 151 ASN C CB  1 
ATOM   4378 C  CG  . ASN C 1 152 ? 17.024  25.092  82.838  1.00  27.45 ? 151 ASN C CG  1 
ATOM   4379 O  OD1 . ASN C 1 152 ? 16.219  24.475  83.525  1.00  27.92 ? 151 ASN C OD1 1 
ATOM   4380 N  ND2 . ASN C 1 152 ? 18.339  24.989  83.002  1.00  27.56 ? 151 ASN C ND2 1 
ATOM   4381 N  N   . GLN C 1 153 ? 15.284  27.304  79.558  1.00  26.28 ? 152 GLN C N   1 
ATOM   4382 C  CA  . GLN C 1 153 ? 14.738  28.075  78.421  1.00  27.01 ? 152 GLN C CA  1 
ATOM   4383 C  C   . GLN C 1 153 ? 15.656  28.056  77.199  1.00  26.77 ? 152 GLN C C   1 
ATOM   4384 O  O   . GLN C 1 153 ? 15.576  28.940  76.342  1.00  27.34 ? 152 GLN C O   1 
ATOM   4385 C  CB  . GLN C 1 153 ? 14.395  29.524  78.818  1.00  26.95 ? 152 GLN C CB  1 
ATOM   4386 C  CG  . GLN C 1 153 ? 13.320  29.687  79.905  1.00  26.85 ? 152 GLN C CG  1 
ATOM   4387 C  CD  . GLN C 1 153 ? 11.963  29.103  79.533  1.00  28.70 ? 152 GLN C CD  1 
ATOM   4388 O  OE1 . GLN C 1 153 ? 11.673  28.829  78.360  1.00  27.50 ? 152 GLN C OE1 1 
ATOM   4389 N  NE2 . GLN C 1 153 ? 11.121  28.916  80.538  1.00  29.09 ? 152 GLN C NE2 1 
ATOM   4390 N  N   . ASP C 1 154 ? 16.533  27.061  77.111  1.00  27.33 ? 153 ASP C N   1 
ATOM   4391 C  CA  . ASP C 1 154 ? 17.372  26.911  75.931  1.00  27.71 ? 153 ASP C CA  1 
ATOM   4392 C  C   . ASP C 1 154 ? 16.476  26.612  74.725  1.00  28.04 ? 153 ASP C C   1 
ATOM   4393 O  O   . ASP C 1 154 ? 15.388  26.034  74.858  1.00  28.48 ? 153 ASP C O   1 
ATOM   4394 C  CB  . ASP C 1 154 ? 18.420  25.798  76.118  1.00  27.75 ? 153 ASP C CB  1 
ATOM   4395 C  CG  . ASP C 1 154 ? 19.462  26.122  77.195  1.00  29.49 ? 153 ASP C CG  1 
ATOM   4396 O  OD1 . ASP C 1 154 ? 19.415  27.207  77.807  1.00  31.38 ? 153 ASP C OD1 1 
ATOM   4397 O  OD2 . ASP C 1 154 ? 20.353  25.275  77.423  1.00  35.20 ? 153 ASP C OD2 1 
ATOM   4398 N  N   . ASN C 1 155 ? 16.925  27.039  73.553  1.00  28.45 ? 154 ASN C N   1 
ATOM   4399 C  CA  . ASN C 1 155 ? 16.165  26.875  72.308  1.00  28.56 ? 154 ASN C CA  1 
ATOM   4400 C  C   . ASN C 1 155 ? 17.177  26.393  71.269  1.00  28.43 ? 154 ASN C C   1 
ATOM   4401 O  O   . ASN C 1 155 ? 18.316  26.858  71.276  1.00  28.64 ? 154 ASN C O   1 
ATOM   4402 C  CB  . ASN C 1 155 ? 15.551  28.238  71.930  1.00  28.31 ? 154 ASN C CB  1 
ATOM   4403 C  CG  . ASN C 1 155 ? 14.724  28.200  70.640  1.00  29.18 ? 154 ASN C CG  1 
ATOM   4404 O  OD1 . ASN C 1 155 ? 15.205  27.784  69.583  1.00  31.10 ? 154 ASN C OD1 1 
ATOM   4405 N  ND2 . ASN C 1 155 ? 13.493  28.681  70.719  1.00  30.11 ? 154 ASN C ND2 1 
ATOM   4406 N  N   . PRO C 1 156 ? 16.804  25.410  70.414  1.00  28.75 ? 155 PRO C N   1 
ATOM   4407 C  CA  . PRO C 1 156 ? 17.754  24.896  69.405  1.00  28.81 ? 155 PRO C CA  1 
ATOM   4408 C  C   . PRO C 1 156 ? 18.374  25.964  68.490  1.00  29.04 ? 155 PRO C C   1 
ATOM   4409 O  O   . PRO C 1 156 ? 19.430  25.723  67.897  1.00  28.81 ? 155 PRO C O   1 
ATOM   4410 C  CB  . PRO C 1 156 ? 16.909  23.919  68.574  1.00  28.74 ? 155 PRO C CB  1 
ATOM   4411 C  CG  . PRO C 1 156 ? 15.793  23.521  69.467  1.00  29.09 ? 155 PRO C CG  1 
ATOM   4412 C  CD  . PRO C 1 156 ? 15.503  24.711  70.352  1.00  28.68 ? 155 PRO C CD  1 
ATOM   4413 N  N   . LEU C 1 157 ? 17.715  27.116  68.364  1.00  28.95 ? 156 LEU C N   1 
ATOM   4414 C  CA  . LEU C 1 157 ? 18.248  28.256  67.601  1.00  29.71 ? 156 LEU C CA  1 
ATOM   4415 C  C   . LEU C 1 157 ? 19.567  28.783  68.165  1.00  29.73 ? 156 LEU C C   1 
ATOM   4416 O  O   . LEU C 1 157 ? 20.339  29.427  67.453  1.00  29.85 ? 156 LEU C O   1 
ATOM   4417 C  CB  . LEU C 1 157 ? 17.222  29.405  67.550  1.00  29.61 ? 156 LEU C CB  1 
ATOM   4418 C  CG  . LEU C 1 157 ? 15.989  29.209  66.654  1.00  30.43 ? 156 LEU C CG  1 
ATOM   4419 C  CD1 . LEU C 1 157 ? 14.940  30.295  66.890  1.00  31.70 ? 156 LEU C CD1 1 
ATOM   4420 C  CD2 . LEU C 1 157 ? 16.355  29.134  65.176  1.00  31.44 ? 156 LEU C CD2 1 
ATOM   4421 N  N   . MET C 1 158 ? 19.817  28.510  69.445  1.00  29.71 ? 157 MET C N   1 
ATOM   4422 C  CA  . MET C 1 158 ? 21.050  28.947  70.116  1.00  29.94 ? 157 MET C CA  1 
ATOM   4423 C  C   . MET C 1 158 ? 22.266  28.157  69.658  1.00  30.59 ? 157 MET C C   1 
ATOM   4424 O  O   . MET C 1 158 ? 23.398  28.582  69.883  1.00  30.12 ? 157 MET C O   1 
ATOM   4425 C  CB  . MET C 1 158 ? 20.913  28.810  71.632  1.00  29.61 ? 157 MET C CB  1 
ATOM   4426 C  CG  . MET C 1 158 ? 19.780  29.625  72.239  1.00  28.87 ? 157 MET C CG  1 
ATOM   4427 S  SD  . MET C 1 158 ? 19.598  29.384  74.031  1.00  29.48 ? 157 MET C SD  1 
ATOM   4428 C  CE  . MET C 1 158 ? 18.256  30.506  74.372  1.00  28.38 ? 157 MET C CE  1 
ATOM   4429 N  N   . GLY C 1 159 ? 22.019  26.999  69.049  1.00  31.26 ? 158 GLY C N   1 
ATOM   4430 C  CA  . GLY C 1 159 ? 23.079  26.133  68.537  1.00  32.67 ? 158 GLY C CA  1 
ATOM   4431 C  C   . GLY C 1 159 ? 23.541  25.085  69.532  1.00  33.34 ? 158 GLY C C   1 
ATOM   4432 O  O   . GLY C 1 159 ? 23.255  25.176  70.728  1.00  32.97 ? 158 GLY C O   1 
ATOM   4433 N  N   . GLU C 1 160 ? 24.291  24.108  69.028  1.00  33.97 ? 159 GLU C N   1 
ATOM   4434 C  CA  . GLU C 1 160 ? 24.664  22.918  69.791  1.00  35.25 ? 159 GLU C CA  1 
ATOM   4435 C  C   . GLU C 1 160 ? 25.553  23.206  71.002  1.00  34.75 ? 159 GLU C C   1 
ATOM   4436 O  O   . GLU C 1 160 ? 25.429  22.545  72.030  1.00  34.72 ? 159 GLU C O   1 
ATOM   4437 C  CB  . GLU C 1 160 ? 25.346  21.901  68.872  1.00  35.39 ? 159 GLU C CB  1 
ATOM   4438 C  CG  . GLU C 1 160 ? 25.180  20.447  69.307  1.00  37.60 ? 159 GLU C CG  1 
ATOM   4439 C  CD  . GLU C 1 160 ? 26.062  19.482  68.514  1.00  37.62 ? 159 GLU C CD  1 
ATOM   4440 O  OE1 . GLU C 1 160 ? 26.180  19.631  67.276  1.00  40.74 ? 159 GLU C OE1 1 
ATOM   4441 O  OE2 . GLU C 1 160 ? 26.632  18.557  69.132  1.00  41.09 ? 159 GLU C OE2 1 
ATOM   4442 N  N   . ALA C 1 161 ? 26.440  24.190  70.877  1.00  34.69 ? 160 ALA C N   1 
ATOM   4443 C  CA  . ALA C 1 161 ? 27.357  24.544  71.968  1.00  34.62 ? 160 ALA C CA  1 
ATOM   4444 C  C   . ALA C 1 161 ? 26.611  25.022  73.211  1.00  34.61 ? 160 ALA C C   1 
ATOM   4445 O  O   . ALA C 1 161 ? 26.985  24.687  74.334  1.00  35.01 ? 160 ALA C O   1 
ATOM   4446 C  CB  . ALA C 1 161 ? 28.363  25.592  71.511  1.00  34.44 ? 160 ALA C CB  1 
ATOM   4447 N  N   . ILE C 1 162 ? 25.560  25.808  73.012  1.00  34.57 ? 161 ILE C N   1 
ATOM   4448 C  CA  . ILE C 1 162 ? 24.769  26.311  74.133  1.00  34.28 ? 161 ILE C CA  1 
ATOM   4449 C  C   . ILE C 1 162 ? 23.620  25.362  74.500  1.00  34.39 ? 161 ILE C C   1 
ATOM   4450 O  O   . ILE C 1 162 ? 23.530  24.916  75.646  1.00  35.26 ? 161 ILE C O   1 
ATOM   4451 C  CB  . ILE C 1 162 ? 24.255  27.754  73.877  1.00  34.21 ? 161 ILE C CB  1 
ATOM   4452 C  CG1 . ILE C 1 162 ? 25.430  28.740  73.875  1.00  34.19 ? 161 ILE C CG1 1 
ATOM   4453 C  CG2 . ILE C 1 162 ? 23.191  28.152  74.911  1.00  34.25 ? 161 ILE C CG2 1 
ATOM   4454 C  CD1 . ILE C 1 162 ? 25.135  30.074  73.209  1.00  34.32 ? 161 ILE C CD1 1 
ATOM   4455 N  N   . ALA C 1 163 ? 22.765  25.045  73.528  1.00  33.68 ? 162 ALA C N   1 
ATOM   4456 C  CA  . ALA C 1 163 ? 21.520  24.311  73.777  1.00  33.40 ? 162 ALA C CA  1 
ATOM   4457 C  C   . ALA C 1 163 ? 21.670  22.791  73.868  1.00  33.23 ? 162 ALA C C   1 
ATOM   4458 O  O   . ALA C 1 163 ? 20.787  22.116  74.403  1.00  33.13 ? 162 ALA C O   1 
ATOM   4459 C  CB  . ALA C 1 163 ? 20.479  24.672  72.721  1.00  33.26 ? 162 ALA C CB  1 
ATOM   4460 N  N   . GLY C 1 164 ? 22.771  22.262  73.332  1.00  33.11 ? 163 GLY C N   1 
ATOM   4461 C  CA  . GLY C 1 164 ? 23.012  20.812  73.263  1.00  33.20 ? 163 GLY C CA  1 
ATOM   4462 C  C   . GLY C 1 164 ? 22.464  20.169  71.995  1.00  33.08 ? 163 GLY C C   1 
ATOM   4463 O  O   . GLY C 1 164 ? 22.840  19.047  71.637  1.00  33.09 ? 163 GLY C O   1 
ATOM   4464 N  N   . VAL C 1 165 ? 21.566  20.886  71.324  1.00  32.85 ? 164 VAL C N   1 
ATOM   4465 C  CA  . VAL C 1 165 ? 20.942  20.452  70.073  1.00  32.51 ? 164 VAL C CA  1 
ATOM   4466 C  C   . VAL C 1 165 ? 20.883  21.658  69.136  1.00  32.49 ? 164 VAL C C   1 
ATOM   4467 O  O   . VAL C 1 165 ? 21.179  22.772  69.558  1.00  32.41 ? 164 VAL C O   1 
ATOM   4468 C  CB  . VAL C 1 165 ? 19.515  19.870  70.316  1.00  32.49 ? 164 VAL C CB  1 
ATOM   4469 C  CG1 . VAL C 1 165 ? 19.597  18.562  71.095  1.00  32.59 ? 164 VAL C CG1 1 
ATOM   4470 C  CG2 . VAL C 1 165 ? 18.630  20.863  71.055  1.00  32.29 ? 164 VAL C CG2 1 
ATOM   4471 N  N   . SER C 1 166 ? 20.529  21.446  67.868  1.00  32.66 ? 165 SER C N   1 
ATOM   4472 C  CA  . SER C 1 166 ? 20.395  22.564  66.928  1.00  32.97 ? 165 SER C CA  1 
ATOM   4473 C  C   . SER C 1 166 ? 19.233  22.355  65.960  1.00  32.95 ? 165 SER C C   1 
ATOM   4474 O  O   . SER C 1 166 ? 18.610  21.294  65.963  1.00  33.22 ? 165 SER C O   1 
ATOM   4475 C  CB  . SER C 1 166 ? 21.709  22.848  66.185  1.00  33.08 ? 165 SER C CB  1 
ATOM   4476 O  OG  . SER C 1 166 ? 22.144  21.731  65.432  1.00  34.66 ? 165 SER C OG  1 
ATOM   4477 N  N   . GLY C 1 167 ? 18.943  23.369  65.147  1.00  32.74 ? 166 GLY C N   1 
ATOM   4478 C  CA  . GLY C 1 167 ? 17.808  23.328  64.221  1.00  32.33 ? 166 GLY C CA  1 
ATOM   4479 C  C   . GLY C 1 167 ? 16.836  24.466  64.460  1.00  32.17 ? 166 GLY C C   1 
ATOM   4480 O  O   . GLY C 1 167 ? 16.920  25.152  65.477  1.00  32.42 ? 166 GLY C O   1 
ATOM   4481 N  N   . THR C 1 168 ? 15.928  24.671  63.507  1.00  31.81 ? 167 THR C N   1 
ATOM   4482 C  CA  . THR C 1 168 ? 14.898  25.700  63.594  1.00  31.64 ? 167 THR C CA  1 
ATOM   4483 C  C   . THR C 1 168 ? 13.605  25.060  64.099  1.00  31.06 ? 167 THR C C   1 
ATOM   4484 O  O   . THR C 1 168 ? 13.056  24.195  63.419  1.00  30.32 ? 167 THR C O   1 
ATOM   4485 C  CB  . THR C 1 168 ? 14.656  26.357  62.214  1.00  31.75 ? 167 THR C CB  1 
ATOM   4486 O  OG1 . THR C 1 168 ? 15.904  26.826  61.681  1.00  32.93 ? 167 THR C OG1 1 
ATOM   4487 C  CG2 . THR C 1 168 ? 13.690  27.530  62.318  1.00  31.69 ? 167 THR C CG2 1 
ATOM   4488 N  N   . PRO C 1 169 ? 13.116  25.477  65.292  1.00  30.81 ? 168 PRO C N   1 
ATOM   4489 C  CA  . PRO C 1 169 ? 11.888  24.875  65.805  1.00  30.67 ? 168 PRO C CA  1 
ATOM   4490 C  C   . PRO C 1 169 ? 10.666  25.353  65.043  1.00  30.32 ? 168 PRO C C   1 
ATOM   4491 O  O   . PRO C 1 169 ? 10.549  26.535  64.709  1.00  30.04 ? 168 PRO C O   1 
ATOM   4492 C  CB  . PRO C 1 169 ? 11.825  25.350  67.267  1.00  31.21 ? 168 PRO C CB  1 
ATOM   4493 C  CG  . PRO C 1 169 ? 13.138  26.029  67.538  1.00  30.56 ? 168 PRO C CG  1 
ATOM   4494 C  CD  . PRO C 1 169 ? 13.633  26.503  66.214  1.00  31.15 ? 168 PRO C CD  1 
ATOM   4495 N  N   . ILE C 1 170 ? 9.765   24.421  64.762  1.00  29.65 ? 169 ILE C N   1 
ATOM   4496 C  CA  . ILE C 1 170 ? 8.503   24.757  64.123  1.00  28.90 ? 169 ILE C CA  1 
ATOM   4497 C  C   . ILE C 1 170 ? 7.334   24.384  65.036  1.00  29.11 ? 169 ILE C C   1 
ATOM   4498 O  O   . ILE C 1 170 ? 6.203   24.807  64.810  1.00  29.20 ? 169 ILE C O   1 
ATOM   4499 C  CB  . ILE C 1 170 ? 8.390   24.084  62.739  1.00  28.55 ? 169 ILE C CB  1 
ATOM   4500 C  CG1 . ILE C 1 170 ? 8.440   22.547  62.866  1.00  27.96 ? 169 ILE C CG1 1 
ATOM   4501 C  CG2 . ILE C 1 170 ? 9.488   24.632  61.808  1.00  27.98 ? 169 ILE C CG2 1 
ATOM   4502 C  CD1 . ILE C 1 170 ? 8.127   21.791  61.546  1.00  28.36 ? 169 ILE C CD1 1 
ATOM   4503 N  N   . LEU C 1 171 ? 7.642   23.596  66.071  1.00  29.10 ? 170 LEU C N   1 
ATOM   4504 C  CA  . LEU C 1 171 ? 6.704   23.203  67.112  1.00  29.46 ? 170 LEU C CA  1 
ATOM   4505 C  C   . LEU C 1 171 ? 7.483   22.928  68.398  1.00  29.52 ? 170 LEU C C   1 
ATOM   4506 O  O   . LEU C 1 171 ? 8.574   22.353  68.367  1.00  29.20 ? 170 LEU C O   1 
ATOM   4507 C  CB  . LEU C 1 171 ? 5.897   21.959  66.693  1.00  29.43 ? 170 LEU C CB  1 
ATOM   4508 C  CG  . LEU C 1 171 ? 4.983   21.251  67.711  1.00  29.43 ? 170 LEU C CG  1 
ATOM   4509 C  CD1 . LEU C 1 171 ? 3.830   22.145  68.166  1.00  30.95 ? 170 LEU C CD1 1 
ATOM   4510 C  CD2 . LEU C 1 171 ? 4.436   19.946  67.140  1.00  30.09 ? 170 LEU C CD2 1 
ATOM   4511 N  N   . GLY C 1 172 ? 6.922   23.350  69.524  1.00  29.51 ? 171 GLY C N   1 
ATOM   4512 C  CA  . GLY C 1 172 ? 7.538   23.098  70.827  1.00  29.56 ? 171 GLY C CA  1 
ATOM   4513 C  C   . GLY C 1 172 ? 6.461   22.961  71.877  1.00  29.85 ? 171 GLY C C   1 
ATOM   4514 O  O   . GLY C 1 172 ? 5.375   23.543  71.746  1.00  30.08 ? 171 GLY C O   1 
ATOM   4515 N  N   . VAL C 1 173 ? 6.750   22.163  72.900  1.00  29.36 ? 172 VAL C N   1 
ATOM   4516 C  CA  . VAL C 1 173 ? 5.874   22.019  74.048  1.00  28.71 ? 172 VAL C CA  1 
ATOM   4517 C  C   . VAL C 1 173 ? 6.666   22.329  75.320  1.00  28.59 ? 172 VAL C C   1 
ATOM   4518 O  O   . VAL C 1 173 ? 7.801   21.869  75.491  1.00  28.27 ? 172 VAL C O   1 
ATOM   4519 C  CB  . VAL C 1 173 ? 5.201   20.605  74.129  1.00  29.23 ? 172 VAL C CB  1 
ATOM   4520 C  CG1 . VAL C 1 173 ? 6.217   19.494  74.414  1.00  29.62 ? 172 VAL C CG1 1 
ATOM   4521 C  CG2 . VAL C 1 173 ? 4.109   20.593  75.205  1.00  29.50 ? 172 VAL C CG2 1 
ATOM   4522 N  N   . ASP C 1 174 ? 6.050   23.118  76.196  1.00  27.54 ? 173 ASP C N   1 
ATOM   4523 C  CA  . ASP C 1 174 ? 6.667   23.549  77.442  1.00  27.67 ? 173 ASP C CA  1 
ATOM   4524 C  C   . ASP C 1 174 ? 6.433   22.433  78.465  1.00  27.55 ? 173 ASP C C   1 
ATOM   4525 O  O   . ASP C 1 174 ? 5.287   22.050  78.718  1.00  28.03 ? 173 ASP C O   1 
ATOM   4526 C  CB  . ASP C 1 174 ? 5.985   24.854  77.871  1.00  28.03 ? 173 ASP C CB  1 
ATOM   4527 C  CG  . ASP C 1 174 ? 6.652   25.521  79.032  1.00  28.84 ? 173 ASP C CG  1 
ATOM   4528 O  OD1 . ASP C 1 174 ? 7.546   24.921  79.655  1.00  28.34 ? 173 ASP C OD1 1 
ATOM   4529 O  OD2 . ASP C 1 174 ? 6.242   26.668  79.334  1.00  30.62 ? 173 ASP C OD2 1 
ATOM   4530 N  N   . VAL C 1 175 ? 7.512   21.886  79.018  1.00  26.77 ? 174 VAL C N   1 
ATOM   4531 C  CA  . VAL C 1 175 ? 7.385   20.872  80.074  1.00  26.85 ? 174 VAL C CA  1 
ATOM   4532 C  C   . VAL C 1 175 ? 7.950   21.331  81.437  1.00  26.94 ? 174 VAL C C   1 
ATOM   4533 O  O   . VAL C 1 175 ? 8.202   20.514  82.336  1.00  28.06 ? 174 VAL C O   1 
ATOM   4534 C  CB  . VAL C 1 175 ? 7.913   19.443  79.651  1.00  26.47 ? 174 VAL C CB  1 
ATOM   4535 C  CG1 . VAL C 1 175 ? 7.183   18.931  78.405  1.00  28.36 ? 174 VAL C CG1 1 
ATOM   4536 C  CG2 . VAL C 1 175 ? 9.431   19.437  79.437  1.00  27.94 ? 174 VAL C CG2 1 
ATOM   4537 N  N   . TRP C 1 176 ? 8.145   22.641  81.596  1.00  26.54 ? 175 TRP C N   1 
ATOM   4538 C  CA  . TRP C 1 176 ? 8.281   23.205  82.932  1.00  26.62 ? 175 TRP C CA  1 
ATOM   4539 C  C   . TRP C 1 176 ? 7.009   22.824  83.669  1.00  26.61 ? 175 TRP C C   1 
ATOM   4540 O  O   . TRP C 1 176 ? 5.924   22.842  83.068  1.00  26.76 ? 175 TRP C O   1 
ATOM   4541 C  CB  . TRP C 1 176 ? 8.373   24.725  82.880  1.00  26.48 ? 175 TRP C CB  1 
ATOM   4542 C  CG  . TRP C 1 176 ? 9.712   25.236  82.436  1.00  26.16 ? 175 TRP C CG  1 
ATOM   4543 C  CD1 . TRP C 1 176 ? 10.335  24.995  81.237  1.00  25.68 ? 175 TRP C CD1 1 
ATOM   4544 C  CD2 . TRP C 1 176 ? 10.577  26.096  83.175  1.00  26.81 ? 175 TRP C CD2 1 
ATOM   4545 N  NE1 . TRP C 1 176 ? 11.542  25.658  81.193  1.00  26.49 ? 175 TRP C NE1 1 
ATOM   4546 C  CE2 . TRP C 1 176 ? 11.719  26.334  82.372  1.00  25.08 ? 175 TRP C CE2 1 
ATOM   4547 C  CE3 . TRP C 1 176 ? 10.510  26.677  84.452  1.00  25.68 ? 175 TRP C CE3 1 
ATOM   4548 C  CZ2 . TRP C 1 176 ? 12.776  27.140  82.797  1.00  24.93 ? 175 TRP C CZ2 1 
ATOM   4549 C  CZ3 . TRP C 1 176 ? 11.562  27.483  84.876  1.00  26.65 ? 175 TRP C CZ3 1 
ATOM   4550 C  CH2 . TRP C 1 176 ? 12.681  27.707  84.044  1.00  26.02 ? 175 TRP C CH2 1 
ATOM   4551 N  N   . GLU C 1 177 ? 7.131   22.495  84.953  1.00  26.59 ? 176 GLU C N   1 
ATOM   4552 C  CA  . GLU C 1 177 ? 5.960   22.145  85.761  1.00  27.39 ? 176 GLU C CA  1 
ATOM   4553 C  C   . GLU C 1 177 ? 4.886   23.252  85.785  1.00  27.24 ? 176 GLU C C   1 
ATOM   4554 O  O   . GLU C 1 177 ? 3.700   22.946  85.823  1.00  27.33 ? 176 GLU C O   1 
ATOM   4555 C  CB  . GLU C 1 177 ? 6.368   21.657  87.166  1.00  26.79 ? 176 GLU C CB  1 
ATOM   4556 C  CG  . GLU C 1 177 ? 6.902   20.214  87.114  1.00  28.63 ? 176 GLU C CG  1 
ATOM   4557 C  CD  . GLU C 1 177 ? 7.628   19.725  88.363  1.00  28.48 ? 176 GLU C CD  1 
ATOM   4558 O  OE1 . GLU C 1 177 ? 8.272   20.525  89.081  1.00  27.31 ? 176 GLU C OE1 1 
ATOM   4559 O  OE2 . GLU C 1 177 ? 7.570   18.496  88.610  1.00  31.05 ? 176 GLU C OE2 1 
ATOM   4560 N  N   . HIS C 1 178 ? 5.283   24.525  85.701  1.00  27.17 ? 177 HIS C N   1 
ATOM   4561 C  CA  . HIS C 1 178 ? 4.268   25.597  85.704  1.00  27.27 ? 177 HIS C CA  1 
ATOM   4562 C  C   . HIS C 1 178 ? 3.283   25.504  84.534  1.00  27.06 ? 177 HIS C C   1 
ATOM   4563 O  O   . HIS C 1 178 ? 2.180   26.026  84.613  1.00  27.56 ? 177 HIS C O   1 
ATOM   4564 C  CB  . HIS C 1 178 ? 4.885   27.006  85.779  1.00  27.68 ? 177 HIS C CB  1 
ATOM   4565 C  CG  . HIS C 1 178 ? 5.693   27.399  84.583  1.00  28.14 ? 177 HIS C CG  1 
ATOM   4566 N  ND1 . HIS C 1 178 ? 7.033   27.704  84.665  1.00  28.49 ? 177 HIS C ND1 1 
ATOM   4567 C  CD2 . HIS C 1 178 ? 5.347   27.576  83.283  1.00  29.94 ? 177 HIS C CD2 1 
ATOM   4568 C  CE1 . HIS C 1 178 ? 7.483   28.039  83.468  1.00  28.44 ? 177 HIS C CE1 1 
ATOM   4569 N  NE2 . HIS C 1 178 ? 6.481   27.957  82.610  1.00  29.19 ? 177 HIS C NE2 1 
ATOM   4570 N  N   . ALA C 1 179 ? 3.691   24.830  83.461  1.00  26.56 ? 178 ALA C N   1 
ATOM   4571 C  CA  . ALA C 1 179 ? 2.859   24.708  82.270  1.00  26.40 ? 178 ALA C CA  1 
ATOM   4572 C  C   . ALA C 1 179 ? 1.715   23.697  82.450  1.00  26.60 ? 178 ALA C C   1 
ATOM   4573 O  O   . ALA C 1 179 ? 0.738   23.706  81.683  1.00  27.38 ? 178 ALA C O   1 
ATOM   4574 C  CB  . ALA C 1 179 ? 3.719   24.331  81.085  1.00  26.48 ? 178 ALA C CB  1 
ATOM   4575 N  N   . TYR C 1 180 ? 1.824   22.821  83.447  1.00  25.77 ? 179 TYR C N   1 
ATOM   4576 C  CA  . TYR C 1 180 ? 0.822   21.764  83.591  1.00  25.74 ? 179 TYR C CA  1 
ATOM   4577 C  C   . TYR C 1 180 ? 0.377   21.413  85.006  1.00  25.50 ? 179 TYR C C   1 
ATOM   4578 O  O   . TYR C 1 180 ? -0.600  20.668  85.176  1.00  25.60 ? 179 TYR C O   1 
ATOM   4579 C  CB  . TYR C 1 180 ? 1.256   20.501  82.830  1.00  25.66 ? 179 TYR C CB  1 
ATOM   4580 C  CG  . TYR C 1 180 ? 2.529   19.840  83.322  1.00  26.44 ? 179 TYR C CG  1 
ATOM   4581 C  CD1 . TYR C 1 180 ? 2.499   18.915  84.377  1.00  26.12 ? 179 TYR C CD1 1 
ATOM   4582 C  CD2 . TYR C 1 180 ? 3.753   20.095  82.702  1.00  25.64 ? 179 TYR C CD2 1 
ATOM   4583 C  CE1 . TYR C 1 180 ? 3.672   18.282  84.814  1.00  26.45 ? 179 TYR C CE1 1 
ATOM   4584 C  CE2 . TYR C 1 180 ? 4.918   19.482  83.139  1.00  26.61 ? 179 TYR C CE2 1 
ATOM   4585 C  CZ  . TYR C 1 180 ? 4.873   18.577  84.180  1.00  26.08 ? 179 TYR C CZ  1 
ATOM   4586 O  OH  . TYR C 1 180 ? 6.031   17.960  84.591  1.00  26.07 ? 179 TYR C OH  1 
ATOM   4587 N  N   . TYR C 1 181 ? 1.054   21.956  86.021  1.00  25.65 ? 180 TYR C N   1 
ATOM   4588 C  CA  . TYR C 1 181 ? 0.815   21.486  87.393  1.00  25.15 ? 180 TYR C CA  1 
ATOM   4589 C  C   . TYR C 1 181 ? -0.583  21.725  87.962  1.00  25.30 ? 180 TYR C C   1 
ATOM   4590 O  O   . TYR C 1 181 ? -1.109  20.875  88.663  1.00  24.48 ? 180 TYR C O   1 
ATOM   4591 C  CB  . TYR C 1 181 ? 1.892   21.953  88.383  1.00  25.06 ? 180 TYR C CB  1 
ATOM   4592 C  CG  . TYR C 1 181 ? 2.231   20.853  89.366  1.00  25.68 ? 180 TYR C CG  1 
ATOM   4593 C  CD1 . TYR C 1 181 ? 3.024   19.774  88.970  1.00  25.65 ? 180 TYR C CD1 1 
ATOM   4594 C  CD2 . TYR C 1 181 ? 1.748   20.873  90.674  1.00  24.35 ? 180 TYR C CD2 1 
ATOM   4595 C  CE1 . TYR C 1 181 ? 3.322   18.734  89.842  1.00  25.07 ? 180 TYR C CE1 1 
ATOM   4596 C  CE2 . TYR C 1 181 ? 2.052   19.825  91.579  1.00  25.01 ? 180 TYR C CE2 1 
ATOM   4597 C  CZ  . TYR C 1 181 ? 2.836   18.755  91.134  1.00  24.85 ? 180 TYR C CZ  1 
ATOM   4598 O  OH  . TYR C 1 181 ? 3.158   17.720  91.976  1.00  25.41 ? 180 TYR C OH  1 
ATOM   4599 N  N   . LEU C 1 182 ? -1.172  22.885  87.676  1.00  26.30 ? 181 LEU C N   1 
ATOM   4600 C  CA  . LEU C 1 182 ? -2.475  23.223  88.264  1.00  26.94 ? 181 LEU C CA  1 
ATOM   4601 C  C   . LEU C 1 182 ? -3.565  22.262  87.781  1.00  27.25 ? 181 LEU C C   1 
ATOM   4602 O  O   . LEU C 1 182 ? -4.462  21.900  88.546  1.00  27.48 ? 181 LEU C O   1 
ATOM   4603 C  CB  . LEU C 1 182 ? -2.848  24.682  87.975  1.00  26.95 ? 181 LEU C CB  1 
ATOM   4604 C  CG  . LEU C 1 182 ? -2.009  25.779  88.648  1.00  26.80 ? 181 LEU C CG  1 
ATOM   4605 C  CD1 . LEU C 1 182 ? -2.483  27.138  88.199  1.00  28.24 ? 181 LEU C CD1 1 
ATOM   4606 C  CD2 . LEU C 1 182 ? -2.063  25.686  90.184  1.00  26.04 ? 181 LEU C CD2 1 
ATOM   4607 N  N   . ASN C 1 183 ? -3.459  21.828  86.525  1.00  27.85 ? 182 ASN C N   1 
ATOM   4608 C  CA  . ASN C 1 183 ? -4.457  20.932  85.934  1.00  29.04 ? 182 ASN C CA  1 
ATOM   4609 C  C   . ASN C 1 183 ? -4.094  19.442  85.949  1.00  28.57 ? 182 ASN C C   1 
ATOM   4610 O  O   . ASN C 1 183 ? -4.988  18.592  86.020  1.00  29.57 ? 182 ASN C O   1 
ATOM   4611 C  CB  . ASN C 1 183 ? -4.806  21.369  84.512  1.00  29.11 ? 182 ASN C CB  1 
ATOM   4612 C  CG  . ASN C 1 183 ? -6.152  20.822  84.045  1.00  30.84 ? 182 ASN C CG  1 
ATOM   4613 O  OD1 . ASN C 1 183 ? -7.124  20.787  84.802  1.00  32.90 ? 182 ASN C OD1 1 
ATOM   4614 N  ND2 . ASN C 1 183 ? -6.212  20.402  82.789  1.00  32.86 ? 182 ASN C ND2 1 
ATOM   4615 N  N   . TYR C 1 184 ? -2.800  19.126  85.900  1.00  27.66 ? 183 TYR C N   1 
ATOM   4616 C  CA  . TYR C 1 184 ? -2.360  17.729  85.771  1.00  26.85 ? 183 TYR C CA  1 
ATOM   4617 C  C   . TYR C 1 184 ? -1.456  17.230  86.900  1.00  26.73 ? 183 TYR C C   1 
ATOM   4618 O  O   . TYR C 1 184 ? -1.221  16.023  87.016  1.00  26.32 ? 183 TYR C O   1 
ATOM   4619 C  CB  . TYR C 1 184 ? -1.646  17.512  84.438  1.00  26.52 ? 183 TYR C CB  1 
ATOM   4620 C  CG  . TYR C 1 184 ? -2.527  17.737  83.232  1.00  27.12 ? 183 TYR C CG  1 
ATOM   4621 C  CD1 . TYR C 1 184 ? -2.536  18.967  82.581  1.00  27.72 ? 183 TYR C CD1 1 
ATOM   4622 C  CD2 . TYR C 1 184 ? -3.363  16.723  82.750  1.00  26.99 ? 183 TYR C CD2 1 
ATOM   4623 C  CE1 . TYR C 1 184 ? -3.355  19.190  81.469  1.00  27.19 ? 183 TYR C CE1 1 
ATOM   4624 C  CE2 . TYR C 1 184 ? -4.185  16.932  81.632  1.00  27.11 ? 183 TYR C CE2 1 
ATOM   4625 C  CZ  . TYR C 1 184 ? -4.166  18.168  81.005  1.00  27.13 ? 183 TYR C CZ  1 
ATOM   4626 O  OH  . TYR C 1 184 ? -4.959  18.403  79.920  1.00  26.57 ? 183 TYR C OH  1 
ATOM   4627 N  N   . GLN C 1 185 ? -0.956  18.153  87.718  1.00  26.78 ? 184 GLN C N   1 
ATOM   4628 C  CA  . GLN C 1 185 ? 0.017   17.829  88.767  1.00  27.23 ? 184 GLN C CA  1 
ATOM   4629 C  C   . GLN C 1 185 ? 1.187   17.020  88.170  1.00  26.95 ? 184 GLN C C   1 
ATOM   4630 O  O   . GLN C 1 185 ? 1.757   17.424  87.159  1.00  26.75 ? 184 GLN C O   1 
ATOM   4631 C  CB  . GLN C 1 185 ? -0.651  17.143  89.978  1.00  27.80 ? 184 GLN C CB  1 
ATOM   4632 C  CG  . GLN C 1 185 ? -1.704  18.006  90.721  1.00  28.77 ? 184 GLN C CG  1 
ATOM   4633 C  CD  . GLN C 1 185 ? -3.047  18.099  89.992  1.00  31.32 ? 184 GLN C CD  1 
ATOM   4634 O  OE1 . GLN C 1 185 ? -3.637  17.086  89.618  1.00  30.96 ? 184 GLN C OE1 1 
ATOM   4635 N  NE2 . GLN C 1 185 ? -3.531  19.324  89.789  1.00  31.63 ? 184 GLN C NE2 1 
ATOM   4636 N  N   . ASN C 1 186 ? 1.529   15.887  88.776  1.00  27.40 ? 185 ASN C N   1 
ATOM   4637 C  CA  . ASN C 1 186 ? 2.657   15.054  88.333  1.00  27.32 ? 185 ASN C CA  1 
ATOM   4638 C  C   . ASN C 1 186 ? 2.458   14.391  86.971  1.00  27.83 ? 185 ASN C C   1 
ATOM   4639 O  O   . ASN C 1 186 ? 3.416   13.880  86.375  1.00  27.75 ? 185 ASN C O   1 
ATOM   4640 C  CB  . ASN C 1 186 ? 2.901   13.951  89.357  1.00  27.25 ? 185 ASN C CB  1 
ATOM   4641 C  CG  . ASN C 1 186 ? 1.677   13.075  89.556  1.00  26.37 ? 185 ASN C CG  1 
ATOM   4642 O  OD1 . ASN C 1 186 ? 0.671   13.519  90.108  1.00  25.40 ? 185 ASN C OD1 1 
ATOM   4643 N  ND2 . ASN C 1 186 ? 1.760   11.826  89.113  1.00  26.05 ? 185 ASN C ND2 1 
ATOM   4644 N  N   . ARG C 1 187 ? 1.215   14.394  86.490  1.00  27.94 ? 186 ARG C N   1 
ATOM   4645 C  CA  . ARG C 1 187 ? 0.836   13.619  85.305  1.00  28.68 ? 186 ARG C CA  1 
ATOM   4646 C  C   . ARG C 1 187 ? 1.220   14.303  83.994  1.00  28.40 ? 186 ARG C C   1 
ATOM   4647 O  O   . ARG C 1 187 ? 0.361   14.600  83.159  1.00  28.64 ? 186 ARG C O   1 
ATOM   4648 C  CB  . ARG C 1 187 ? -0.665  13.282  85.333  1.00  28.07 ? 186 ARG C CB  1 
ATOM   4649 C  CG  . ARG C 1 187 ? -1.140  12.620  86.636  1.00  29.57 ? 186 ARG C CG  1 
ATOM   4650 C  CD  . ARG C 1 187 ? -2.602  12.201  86.604  1.00  29.56 ? 186 ARG C CD  1 
ATOM   4651 N  NE  . ARG C 1 187 ? -3.479  13.230  86.037  1.00  33.60 ? 186 ARG C NE  1 
ATOM   4652 C  CZ  . ARG C 1 187 ? -4.062  14.203  86.729  1.00  33.87 ? 186 ARG C CZ  1 
ATOM   4653 N  NH1 . ARG C 1 187 ? -3.873  14.312  88.040  1.00  36.24 ? 186 ARG C NH1 1 
ATOM   4654 N  NH2 . ARG C 1 187 ? -4.841  15.077  86.102  1.00  34.96 ? 186 ARG C NH2 1 
ATOM   4655 N  N   . ARG C 1 188 ? 2.520   14.532  83.801  1.00  28.62 ? 187 ARG C N   1 
ATOM   4656 C  CA  . ARG C 1 188 ? 3.021   15.112  82.551  1.00  28.68 ? 187 ARG C CA  1 
ATOM   4657 C  C   . ARG C 1 188 ? 2.570   14.350  81.280  1.00  29.06 ? 187 ARG C C   1 
ATOM   4658 O  O   . ARG C 1 188 ? 2.239   14.983  80.280  1.00  28.98 ? 187 ARG C O   1 
ATOM   4659 C  CB  . ARG C 1 188 ? 4.551   15.276  82.582  1.00  28.68 ? 187 ARG C CB  1 
ATOM   4660 C  CG  . ARG C 1 188 ? 5.100   16.162  81.457  1.00  27.83 ? 187 ARG C CG  1 
ATOM   4661 C  CD  . ARG C 1 188 ? 6.586   15.944  81.235  1.00  30.17 ? 187 ARG C CD  1 
ATOM   4662 N  NE  . ARG C 1 188 ? 7.382   16.576  82.287  1.00  28.26 ? 187 ARG C NE  1 
ATOM   4663 C  CZ  . ARG C 1 188 ? 8.710   16.696  82.273  1.00  30.49 ? 187 ARG C CZ  1 
ATOM   4664 N  NH1 . ARG C 1 188 ? 9.427   16.227  81.253  1.00  28.94 ? 187 ARG C NH1 1 
ATOM   4665 N  NH2 . ARG C 1 188 ? 9.325   17.288  83.296  1.00  31.00 ? 187 ARG C NH2 1 
ATOM   4666 N  N   . PRO C 1 189 ? 2.563   12.995  81.305  1.00  29.51 ? 188 PRO C N   1 
ATOM   4667 C  CA  . PRO C 1 189 ? 2.070   12.277  80.109  1.00  29.39 ? 188 PRO C CA  1 
ATOM   4668 C  C   . PRO C 1 189 ? 0.641   12.655  79.687  1.00  29.68 ? 188 PRO C C   1 
ATOM   4669 O  O   . PRO C 1 189 ? 0.371   12.760  78.491  1.00  29.86 ? 188 PRO C O   1 
ATOM   4670 C  CB  . PRO C 1 189 ? 2.134   10.810  80.526  1.00  29.62 ? 188 PRO C CB  1 
ATOM   4671 C  CG  . PRO C 1 189 ? 3.198   10.773  81.577  1.00  29.30 ? 188 PRO C CG  1 
ATOM   4672 C  CD  . PRO C 1 189 ? 3.023   12.056  82.345  1.00  29.50 ? 188 PRO C CD  1 
ATOM   4673 N  N   . ASP C 1 190 ? -0.248  12.888  80.652  1.00  29.51 ? 189 ASP C N   1 
ATOM   4674 C  CA  . ASP C 1 190 ? -1.642  13.277  80.361  1.00  29.71 ? 189 ASP C CA  1 
ATOM   4675 C  C   . ASP C 1 190 ? -1.734  14.674  79.731  1.00  29.49 ? 189 ASP C C   1 
ATOM   4676 O  O   . ASP C 1 190 ? -2.548  14.929  78.829  1.00  29.19 ? 189 ASP C O   1 
ATOM   4677 C  CB  . ASP C 1 190 ? -2.495  13.207  81.630  1.00  29.99 ? 189 ASP C CB  1 
ATOM   4678 C  CG  . ASP C 1 190 ? -2.762  11.775  82.089  1.00  31.67 ? 189 ASP C CG  1 
ATOM   4679 O  OD1 . ASP C 1 190 ? -2.664  10.832  81.273  1.00  34.24 ? 189 ASP C OD1 1 
ATOM   4680 O  OD2 . ASP C 1 190 ? -3.104  11.592  83.271  1.00  33.65 ? 189 ASP C OD2 1 
ATOM   4681 N  N   . TYR C 1 191 ? -0.880  15.573  80.197  1.00  28.78 ? 190 TYR C N   1 
ATOM   4682 C  CA  . TYR C 1 191 ? -0.791  16.907  79.631  1.00  28.45 ? 190 TYR C CA  1 
ATOM   4683 C  C   . TYR C 1 191 ? -0.316  16.822  78.194  1.00  28.68 ? 190 TYR C C   1 
ATOM   4684 O  O   . TYR C 1 191 ? -0.845  17.516  77.321  1.00  28.06 ? 190 TYR C O   1 
ATOM   4685 C  CB  . TYR C 1 191 ? 0.163   17.751  80.477  1.00  28.55 ? 190 TYR C CB  1 
ATOM   4686 C  CG  . TYR C 1 191 ? 0.772   18.972  79.818  1.00  29.35 ? 190 TYR C CG  1 
ATOM   4687 C  CD1 . TYR C 1 191 ? -0.013  20.051  79.416  1.00  28.72 ? 190 TYR C CD1 1 
ATOM   4688 C  CD2 . TYR C 1 191 ? 2.148   19.063  79.647  1.00  29.53 ? 190 TYR C CD2 1 
ATOM   4689 C  CE1 . TYR C 1 191 ? 0.560   21.190  78.836  1.00  29.52 ? 190 TYR C CE1 1 
ATOM   4690 C  CE2 . TYR C 1 191 ? 2.736   20.190  79.076  1.00  29.56 ? 190 TYR C CE2 1 
ATOM   4691 C  CZ  . TYR C 1 191 ? 1.941   21.247  78.667  1.00  29.82 ? 190 TYR C CZ  1 
ATOM   4692 O  OH  . TYR C 1 191 ? 2.533   22.369  78.115  1.00  30.94 ? 190 TYR C OH  1 
ATOM   4693 N  N   . LEU C 1 192 ? 0.666   15.954  77.954  1.00  28.51 ? 191 LEU C N   1 
ATOM   4694 C  CA  . LEU C 1 192 ? 1.244   15.786  76.617  1.00  29.21 ? 191 LEU C CA  1 
ATOM   4695 C  C   . LEU C 1 192 ? 0.257   15.177  75.625  1.00  29.12 ? 191 LEU C C   1 
ATOM   4696 O  O   . LEU C 1 192 ? 0.221   15.567  74.449  1.00  29.05 ? 191 LEU C O   1 
ATOM   4697 C  CB  . LEU C 1 192 ? 2.520   14.950  76.690  1.00  29.10 ? 191 LEU C CB  1 
ATOM   4698 C  CG  . LEU C 1 192 ? 3.707   15.648  77.365  1.00  29.45 ? 191 LEU C CG  1 
ATOM   4699 C  CD1 . LEU C 1 192 ? 4.797   14.619  77.644  1.00  29.86 ? 191 LEU C CD1 1 
ATOM   4700 C  CD2 . LEU C 1 192 ? 4.229   16.801  76.524  1.00  29.71 ? 191 LEU C CD2 1 
ATOM   4701 N  N   . ALA C 1 193 ? -0.556  14.237  76.104  1.00  29.27 ? 192 ALA C N   1 
ATOM   4702 C  CA  . ALA C 1 193 ? -1.623  13.660  75.278  1.00  29.50 ? 192 ALA C CA  1 
ATOM   4703 C  C   . ALA C 1 193 ? -2.665  14.722  74.921  1.00  29.83 ? 192 ALA C C   1 
ATOM   4704 O  O   . ALA C 1 193 ? -3.107  14.809  73.769  1.00  29.40 ? 192 ALA C O   1 
ATOM   4705 C  CB  . ALA C 1 193 ? -2.276  12.477  75.987  1.00  29.58 ? 192 ALA C CB  1 
ATOM   4706 N  N   . ALA C 1 194 ? -3.019  15.553  75.901  1.00  29.75 ? 193 ALA C N   1 
ATOM   4707 C  CA  . ALA C 1 194 ? -4.010  16.618  75.709  1.00  30.19 ? 193 ALA C CA  1 
ATOM   4708 C  C   . ALA C 1 194 ? -3.515  17.705  74.765  1.00  30.29 ? 193 ALA C C   1 
ATOM   4709 O  O   . ALA C 1 194 ? -4.308  18.333  74.059  1.00  30.34 ? 193 ALA C O   1 
ATOM   4710 C  CB  . ALA C 1 194 ? -4.393  17.236  77.050  1.00  30.72 ? 193 ALA C CB  1 
ATOM   4711 N  N   . PHE C 1 195 ? -2.203  17.916  74.768  1.00  29.71 ? 194 PHE C N   1 
ATOM   4712 C  CA  . PHE C 1 195 ? -1.559  18.944  73.954  1.00  30.26 ? 194 PHE C CA  1 
ATOM   4713 C  C   . PHE C 1 195 ? -1.842  18.778  72.459  1.00  30.18 ? 194 PHE C C   1 
ATOM   4714 O  O   . PHE C 1 195 ? -2.080  19.764  71.767  1.00  30.32 ? 194 PHE C O   1 
ATOM   4715 C  CB  . PHE C 1 195 ? -0.052  18.963  74.217  1.00  29.95 ? 194 PHE C CB  1 
ATOM   4716 C  CG  . PHE C 1 195 ? 0.703   19.984  73.395  1.00  31.51 ? 194 PHE C CG  1 
ATOM   4717 C  CD1 . PHE C 1 195 ? 0.615   21.339  73.684  1.00  31.14 ? 194 PHE C CD1 1 
ATOM   4718 C  CD2 . PHE C 1 195 ? 1.518   19.575  72.343  1.00  32.33 ? 194 PHE C CD2 1 
ATOM   4719 C  CE1 . PHE C 1 195 ? 1.322   22.281  72.925  1.00  32.40 ? 194 PHE C CE1 1 
ATOM   4720 C  CE2 . PHE C 1 195 ? 2.245   20.508  71.589  1.00  31.66 ? 194 PHE C CE2 1 
ATOM   4721 C  CZ  . PHE C 1 195 ? 2.141   21.857  71.879  1.00  31.25 ? 194 PHE C CZ  1 
ATOM   4722 N  N   . TRP C 1 196 ? -1.828  17.539  71.968  1.00  30.12 ? 195 TRP C N   1 
ATOM   4723 C  CA  . TRP C 1 196 ? -2.181  17.264  70.559  1.00  30.49 ? 195 TRP C CA  1 
ATOM   4724 C  C   . TRP C 1 196 ? -3.532  17.864  70.126  1.00  30.58 ? 195 TRP C C   1 
ATOM   4725 O  O   . TRP C 1 196 ? -3.716  18.206  68.957  1.00  30.63 ? 195 TRP C O   1 
ATOM   4726 C  CB  . TRP C 1 196 ? -2.142  15.759  70.264  1.00  30.15 ? 195 TRP C CB  1 
ATOM   4727 C  CG  . TRP C 1 196 ? -0.808  15.148  70.514  1.00  30.76 ? 195 TRP C CG  1 
ATOM   4728 C  CD1 . TRP C 1 196 ? -0.513  14.158  71.408  1.00  31.17 ? 195 TRP C CD1 1 
ATOM   4729 C  CD2 . TRP C 1 196 ? 0.431   15.508  69.890  1.00  30.63 ? 195 TRP C CD2 1 
ATOM   4730 N  NE1 . TRP C 1 196 ? 0.830   13.874  71.374  1.00  31.52 ? 195 TRP C NE1 1 
ATOM   4731 C  CE2 . TRP C 1 196 ? 1.434   14.684  70.449  1.00  30.78 ? 195 TRP C CE2 1 
ATOM   4732 C  CE3 . TRP C 1 196 ? 0.788   16.434  68.897  1.00  30.44 ? 195 TRP C CE3 1 
ATOM   4733 C  CZ2 . TRP C 1 196 ? 2.769   14.758  70.054  1.00  29.68 ? 195 TRP C CZ2 1 
ATOM   4734 C  CZ3 . TRP C 1 196 ? 2.124   16.519  68.516  1.00  30.32 ? 195 TRP C CZ3 1 
ATOM   4735 C  CH2 . TRP C 1 196 ? 3.096   15.681  69.089  1.00  30.78 ? 195 TRP C CH2 1 
ATOM   4736 N  N   . ASN C 1 197 ? -4.466  17.988  71.071  1.00  30.71 ? 196 ASN C N   1 
ATOM   4737 C  CA  . ASN C 1 197 ? -5.787  18.569  70.787  1.00  31.00 ? 196 ASN C CA  1 
ATOM   4738 C  C   . ASN C 1 197 ? -5.755  20.050  70.443  1.00  30.93 ? 196 ASN C C   1 
ATOM   4739 O  O   . ASN C 1 197 ? -6.659  20.548  69.756  1.00  31.51 ? 196 ASN C O   1 
ATOM   4740 C  CB  . ASN C 1 197 ? -6.750  18.347  71.956  1.00  31.26 ? 196 ASN C CB  1 
ATOM   4741 C  CG  . ASN C 1 197 ? -7.078  16.884  72.169  1.00  32.05 ? 196 ASN C CG  1 
ATOM   4742 O  OD1 . ASN C 1 197 ? -7.595  16.215  71.275  1.00  33.83 ? 196 ASN C OD1 1 
ATOM   4743 N  ND2 . ASN C 1 197 ? -6.777  16.379  73.354  1.00  33.45 ? 196 ASN C ND2 1 
ATOM   4744 N  N   . VAL C 1 198 ? -4.725  20.744  70.918  1.00  30.49 ? 197 VAL C N   1 
ATOM   4745 C  CA  . VAL C 1 198 ? -4.648  22.194  70.758  1.00  30.33 ? 197 VAL C CA  1 
ATOM   4746 C  C   . VAL C 1 198 ? -3.584  22.683  69.782  1.00  29.84 ? 197 VAL C C   1 
ATOM   4747 O  O   . VAL C 1 198 ? -3.489  23.873  69.547  1.00  30.57 ? 197 VAL C O   1 
ATOM   4748 C  CB  . VAL C 1 198 ? -4.557  22.953  72.125  1.00  30.51 ? 197 VAL C CB  1 
ATOM   4749 C  CG1 . VAL C 1 198 ? -5.848  22.773  72.909  1.00  30.91 ? 197 VAL C CG1 1 
ATOM   4750 C  CG2 . VAL C 1 198 ? -3.352  22.523  72.955  1.00  30.15 ? 197 VAL C CG2 1 
ATOM   4751 N  N   . VAL C 1 199 ? -2.801  21.781  69.193  1.00  29.47 ? 198 VAL C N   1 
ATOM   4752 C  CA  . VAL C 1 199 ? -1.795  22.207  68.215  1.00  29.02 ? 198 VAL C CA  1 
ATOM   4753 C  C   . VAL C 1 199 ? -2.450  22.837  66.982  1.00  29.04 ? 198 VAL C C   1 
ATOM   4754 O  O   . VAL C 1 199 ? -3.397  22.285  66.402  1.00  29.72 ? 198 VAL C O   1 
ATOM   4755 C  CB  . VAL C 1 199 ? -0.850  21.064  67.763  1.00  29.14 ? 198 VAL C CB  1 
ATOM   4756 C  CG1 . VAL C 1 199 ? 0.119   21.564  66.677  1.00  28.84 ? 198 VAL C CG1 1 
ATOM   4757 C  CG2 . VAL C 1 199 ? -0.084  20.501  68.945  1.00  28.10 ? 198 VAL C CG2 1 
ATOM   4758 N  N   . ASN C 1 200 ? -1.943  24.002  66.601  1.00  28.86 ? 199 ASN C N   1 
ATOM   4759 C  CA  . ASN C 1 200 ? -2.349  24.678  65.374  1.00  29.25 ? 199 ASN C CA  1 
ATOM   4760 C  C   . ASN C 1 200 ? -1.422  24.260  64.223  1.00  29.07 ? 199 ASN C C   1 
ATOM   4761 O  O   . ASN C 1 200 ? -0.366  24.855  64.022  1.00  28.75 ? 199 ASN C O   1 
ATOM   4762 C  CB  . ASN C 1 200 ? -2.336  26.207  65.585  1.00  29.43 ? 199 ASN C CB  1 
ATOM   4763 C  CG  . ASN C 1 200 ? -2.902  26.979  64.399  1.00  30.56 ? 199 ASN C CG  1 
ATOM   4764 O  OD1 . ASN C 1 200 ? -2.889  26.508  63.264  1.00  32.91 ? 199 ASN C OD1 1 
ATOM   4765 N  ND2 . ASN C 1 200 ? -3.384  28.186  64.661  1.00  32.81 ? 199 ASN C ND2 1 
ATOM   4766 N  N   . TRP C 1 201 ? -1.830  23.233  63.477  1.00  29.35 ? 200 TRP C N   1 
ATOM   4767 C  CA  . TRP C 1 201 ? -0.997  22.683  62.397  1.00  29.61 ? 200 TRP C CA  1 
ATOM   4768 C  C   . TRP C 1 201 ? -0.857  23.629  61.214  1.00  30.04 ? 200 TRP C C   1 
ATOM   4769 O  O   . TRP C 1 201 ? 0.124   23.553  60.486  1.00  30.45 ? 200 TRP C O   1 
ATOM   4770 C  CB  . TRP C 1 201 ? -1.461  21.283  61.960  1.00  29.04 ? 200 TRP C CB  1 
ATOM   4771 C  CG  . TRP C 1 201 ? -1.189  20.264  63.029  1.00  29.19 ? 200 TRP C CG  1 
ATOM   4772 C  CD1 . TRP C 1 201 ? -2.108  19.676  63.853  1.00  28.90 ? 200 TRP C CD1 1 
ATOM   4773 C  CD2 . TRP C 1 201 ? 0.093   19.758  63.431  1.00  28.62 ? 200 TRP C CD2 1 
ATOM   4774 N  NE1 . TRP C 1 201 ? -1.482  18.824  64.724  1.00  28.95 ? 200 TRP C NE1 1 
ATOM   4775 C  CE2 . TRP C 1 201 ? -0.132  18.857  64.495  1.00  28.19 ? 200 TRP C CE2 1 
ATOM   4776 C  CE3 . TRP C 1 201 ? 1.411   19.974  62.992  1.00  28.52 ? 200 TRP C CE3 1 
ATOM   4777 C  CZ2 . TRP C 1 201 ? 0.909   18.170  65.132  1.00  28.35 ? 200 TRP C CZ2 1 
ATOM   4778 C  CZ3 . TRP C 1 201 ? 2.444   19.288  63.625  1.00  28.69 ? 200 TRP C CZ3 1 
ATOM   4779 C  CH2 . TRP C 1 201 ? 2.186   18.398  64.683  1.00  28.51 ? 200 TRP C CH2 1 
ATOM   4780 N  N   . ASP C 1 202 ? -1.834  24.516  61.037  1.00  30.76 ? 201 ASP C N   1 
ATOM   4781 C  CA  . ASP C 1 202 ? -1.731  25.607  60.053  1.00  31.44 ? 201 ASP C CA  1 
ATOM   4782 C  C   . ASP C 1 202 ? -0.537  26.517  60.355  1.00  31.05 ? 201 ASP C C   1 
ATOM   4783 O  O   . ASP C 1 202 ? 0.222   26.870  59.448  1.00  30.48 ? 201 ASP C O   1 
ATOM   4784 C  CB  . ASP C 1 202 ? -3.024  26.427  60.005  1.00  31.85 ? 201 ASP C CB  1 
ATOM   4785 C  CG  . ASP C 1 202 ? -4.155  25.707  59.299  1.00  34.34 ? 201 ASP C CG  1 
ATOM   4786 O  OD1 . ASP C 1 202 ? -3.956  24.570  58.810  1.00  36.91 ? 201 ASP C OD1 1 
ATOM   4787 O  OD2 . ASP C 1 202 ? -5.257  26.295  59.216  1.00  38.21 ? 201 ASP C OD2 1 
ATOM   4788 N  N   . GLU C 1 203 ? -0.371  26.884  61.630  1.00  31.04 ? 202 GLU C N   1 
ATOM   4789 C  CA  . GLU C 1 203 ? 0.782   27.682  62.061  1.00  31.08 ? 202 GLU C CA  1 
ATOM   4790 C  C   . GLU C 1 203 ? 2.099   26.890  61.995  1.00  30.57 ? 202 GLU C C   1 
ATOM   4791 O  O   . GLU C 1 203 ? 3.122   27.429  61.570  1.00  30.66 ? 202 GLU C O   1 
ATOM   4792 C  CB  . GLU C 1 203 ? 0.556   28.286  63.457  1.00  31.36 ? 202 GLU C CB  1 
ATOM   4793 C  CG  . GLU C 1 203 ? 1.748   29.074  64.042  1.00  34.47 ? 202 GLU C CG  1 
ATOM   4794 C  CD  . GLU C 1 203 ? 2.111   30.342  63.269  1.00  37.85 ? 202 GLU C CD  1 
ATOM   4795 O  OE1 . GLU C 1 203 ? 1.291   30.833  62.461  1.00  38.64 ? 202 GLU C OE1 1 
ATOM   4796 O  OE2 . GLU C 1 203 ? 3.235   30.855  63.489  1.00  40.13 ? 202 GLU C OE2 1 
ATOM   4797 N  N   . VAL C 1 204 ? 2.075   25.617  62.390  1.00  29.77 ? 203 VAL C N   1 
ATOM   4798 C  CA  . VAL C 1 204 ? 3.268   24.764  62.265  1.00  29.33 ? 203 VAL C CA  1 
ATOM   4799 C  C   . VAL C 1 204 ? 3.718   24.608  60.796  1.00  29.47 ? 203 VAL C C   1 
ATOM   4800 O  O   . VAL C 1 204 ? 4.916   24.668  60.497  1.00  29.31 ? 203 VAL C O   1 
ATOM   4801 C  CB  . VAL C 1 204 ? 3.082   23.381  62.953  1.00  29.12 ? 203 VAL C CB  1 
ATOM   4802 C  CG1 . VAL C 1 204 ? 4.355   22.543  62.843  1.00  29.23 ? 203 VAL C CG1 1 
ATOM   4803 C  CG2 . VAL C 1 204 ? 2.718   23.562  64.433  1.00  27.89 ? 203 VAL C CG2 1 
ATOM   4804 N  N   . SER C 1 205 ? 2.757   24.431  59.893  1.00  30.00 ? 204 SER C N   1 
ATOM   4805 C  CA  . SER C 1 205 ? 3.051   24.355  58.455  1.00  30.70 ? 204 SER C CA  1 
ATOM   4806 C  C   . SER C 1 205 ? 3.667   25.648  57.926  1.00  31.07 ? 204 SER C C   1 
ATOM   4807 O  O   . SER C 1 205 ? 4.619   25.613  57.141  1.00  31.07 ? 204 SER C O   1 
ATOM   4808 C  CB  . SER C 1 205 ? 1.800   24.001  57.657  1.00  30.84 ? 204 SER C CB  1 
ATOM   4809 O  OG  . SER C 1 205 ? 1.534   22.614  57.758  1.00  31.36 ? 204 SER C OG  1 
ATOM   4810 N  N   . LYS C 1 206 ? 3.120   26.781  58.362  1.00  31.62 ? 205 LYS C N   1 
ATOM   4811 C  CA  . LYS C 1 206 ? 3.657   28.092  58.011  1.00  32.79 ? 205 LYS C CA  1 
ATOM   4812 C  C   . LYS C 1 206 ? 5.117   28.204  58.458  1.00  31.98 ? 205 LYS C C   1 
ATOM   4813 O  O   . LYS C 1 206 ? 5.974   28.659  57.703  1.00  31.30 ? 205 LYS C O   1 
ATOM   4814 C  CB  . LYS C 1 206 ? 2.814   29.212  58.633  1.00  32.80 ? 205 LYS C CB  1 
ATOM   4815 C  CG  . LYS C 1 206 ? 3.340   30.617  58.353  1.00  35.24 ? 205 LYS C CG  1 
ATOM   4816 C  CD  . LYS C 1 206 ? 2.704   31.666  59.270  1.00  35.85 ? 205 LYS C CD  1 
ATOM   4817 C  CE  . LYS C 1 206 ? 3.206   33.068  58.907  1.00  39.54 ? 205 LYS C CE  1 
ATOM   4818 N  NZ  . LYS C 1 206 ? 2.246   34.146  59.317  1.00  41.81 ? 205 LYS C NZ  1 
ATOM   4819 N  N   . ARG C 1 207 ? 5.393   27.777  59.686  1.00  31.67 ? 206 ARG C N   1 
ATOM   4820 C  CA  . ARG C 1 207 ? 6.755   27.797  60.209  1.00  31.54 ? 206 ARG C CA  1 
ATOM   4821 C  C   . ARG C 1 207 ? 7.692   26.859  59.444  1.00  31.55 ? 206 ARG C C   1 
ATOM   4822 O  O   . ARG C 1 207 ? 8.845   27.206  59.185  1.00  31.06 ? 206 ARG C O   1 
ATOM   4823 C  CB  . ARG C 1 207 ? 6.757   27.496  61.710  1.00  31.55 ? 206 ARG C CB  1 
ATOM   4824 C  CG  . ARG C 1 207 ? 6.276   28.680  62.518  1.00  32.09 ? 206 ARG C CG  1 
ATOM   4825 C  CD  . ARG C 1 207 ? 6.070   28.365  63.979  1.00  34.31 ? 206 ARG C CD  1 
ATOM   4826 N  NE  . ARG C 1 207 ? 5.608   29.559  64.684  1.00  36.59 ? 206 ARG C NE  1 
ATOM   4827 C  CZ  . ARG C 1 207 ? 6.400   30.473  65.244  1.00  38.30 ? 206 ARG C CZ  1 
ATOM   4828 N  NH1 . ARG C 1 207 ? 7.724   30.350  65.209  1.00  37.62 ? 206 ARG C NH1 1 
ATOM   4829 N  NH2 . ARG C 1 207 ? 5.860   31.523  65.850  1.00  38.78 ? 206 ARG C NH2 1 
ATOM   4830 N  N   . TYR C 1 208 ? 7.187   25.681  59.083  1.00  31.75 ? 207 TYR C N   1 
ATOM   4831 C  CA  . TYR C 1 208 ? 7.941   24.737  58.258  1.00  32.32 ? 207 TYR C CA  1 
ATOM   4832 C  C   . TYR C 1 208 ? 8.310   25.324  56.887  1.00  32.73 ? 207 TYR C C   1 
ATOM   4833 O  O   . TYR C 1 208 ? 9.453   25.177  56.441  1.00  32.94 ? 207 TYR C O   1 
ATOM   4834 C  CB  . TYR C 1 208 ? 7.191   23.405  58.108  1.00  32.25 ? 207 TYR C CB  1 
ATOM   4835 C  CG  . TYR C 1 208 ? 7.899   22.417  57.212  1.00  32.34 ? 207 TYR C CG  1 
ATOM   4836 C  CD1 . TYR C 1 208 ? 9.160   21.926  57.549  1.00  32.54 ? 207 TYR C CD1 1 
ATOM   4837 C  CD2 . TYR C 1 208 ? 7.317   21.982  56.020  1.00  32.34 ? 207 TYR C CD2 1 
ATOM   4838 C  CE1 . TYR C 1 208 ? 9.819   21.029  56.728  1.00  32.74 ? 207 TYR C CE1 1 
ATOM   4839 C  CE2 . TYR C 1 208 ? 7.973   21.086  55.188  1.00  32.08 ? 207 TYR C CE2 1 
ATOM   4840 C  CZ  . TYR C 1 208 ? 9.222   20.614  55.548  1.00  32.42 ? 207 TYR C CZ  1 
ATOM   4841 O  OH  . TYR C 1 208 ? 9.885   19.723  54.738  1.00  32.27 ? 207 TYR C OH  1 
ATOM   4842 N  N   . ALA C 1 209 ? 7.360   25.995  56.233  1.00  33.28 ? 208 ALA C N   1 
ATOM   4843 C  CA  . ALA C 1 209 ? 7.625   26.629  54.928  1.00  34.31 ? 208 ALA C CA  1 
ATOM   4844 C  C   . ALA C 1 209 ? 8.712   27.702  55.032  1.00  34.90 ? 208 ALA C C   1 
ATOM   4845 O  O   . ALA C 1 209 ? 9.583   27.787  54.174  1.00  34.62 ? 208 ALA C O   1 
ATOM   4846 C  CB  . ALA C 1 209 ? 6.352   27.205  54.328  1.00  34.26 ? 208 ALA C CB  1 
ATOM   4847 N  N   . ALA C 1 210 ? 8.653   28.508  56.091  1.00  35.50 ? 209 ALA C N   1 
ATOM   4848 C  CA  . ALA C 1 210 ? 9.668   29.524  56.366  1.00  36.75 ? 209 ALA C CA  1 
ATOM   4849 C  C   . ALA C 1 210 ? 11.033  28.921  56.715  1.00  37.62 ? 209 ALA C C   1 
ATOM   4850 O  O   . ALA C 1 210 ? 12.070  29.435  56.284  1.00  38.17 ? 209 ALA C O   1 
ATOM   4851 C  CB  . ALA C 1 210 ? 9.196   30.460  57.479  1.00  36.49 ? 209 ALA C CB  1 
ATOM   4852 N  N   . ALA C 1 211 ? 11.027  27.833  57.486  1.00  38.68 ? 210 ALA C N   1 
ATOM   4853 C  CA  . ALA C 1 211 ? 12.261  27.172  57.927  1.00  39.71 ? 210 ALA C CA  1 
ATOM   4854 C  C   . ALA C 1 211 ? 13.032  26.514  56.785  1.00  40.67 ? 210 ALA C C   1 
ATOM   4855 O  O   . ALA C 1 211 ? 14.254  26.382  56.863  1.00  40.95 ? 210 ALA C O   1 
ATOM   4856 C  CB  . ALA C 1 211 ? 11.967  26.151  59.012  1.00  39.52 ? 210 ALA C CB  1 
ATOM   4857 N  N   . LYS C 1 212 ? 12.318  26.093  55.738  1.00  41.82 ? 211 LYS C N   1 
ATOM   4858 C  CA  . LYS C 1 212 ? 12.947  25.472  54.567  1.00  43.16 ? 211 LYS C CA  1 
ATOM   4859 C  C   . LYS C 1 212 ? 13.847  26.456  53.825  1.00  44.20 ? 211 LYS C C   1 
ATOM   4860 O  O   . LYS C 1 212 ? 14.811  26.060  53.160  1.00  44.34 ? 211 LYS C O   1 
ATOM   4861 C  CB  . LYS C 1 212 ? 11.894  24.896  53.616  1.00  42.94 ? 211 LYS C CB  1 
ATOM   4862 C  CG  . LYS C 1 212 ? 11.245  23.620  54.126  1.00  42.79 ? 211 LYS C CG  1 
ATOM   4863 C  CD  . LYS C 1 212 ? 10.675  22.775  52.999  1.00  42.32 ? 211 LYS C CD  1 
ATOM   4864 C  CE  . LYS C 1 212 ? 9.313   23.270  52.532  1.00  41.90 ? 211 LYS C CE  1 
ATOM   4865 N  NZ  . LYS C 1 212 ? 8.694   22.299  51.575  1.00  41.49 ? 211 LYS C NZ  1 
ATOM   4866 N  N   . LEU C 1 213 ? 13.521  27.740  53.949  1.00  45.45 ? 212 LEU C N   1 
ATOM   4867 C  CA  . LEU C 1 213 ? 14.309  28.809  53.348  1.00  46.61 ? 212 LEU C CA  1 
ATOM   4868 C  C   . LEU C 1 213 ? 15.380  29.279  54.337  1.00  47.31 ? 212 LEU C C   1 
ATOM   4869 O  O   . LEU C 1 213 ? 15.154  30.204  55.125  1.00  47.66 ? 212 LEU C O   1 
ATOM   4870 C  CB  . LEU C 1 213 ? 13.391  29.956  52.906  1.00  46.55 ? 212 LEU C CB  1 
ATOM   4871 C  CG  . LEU C 1 213 ? 12.232  29.521  51.996  1.00  46.99 ? 212 LEU C CG  1 
ATOM   4872 C  CD1 . LEU C 1 213 ? 10.963  30.318  52.264  1.00  47.13 ? 212 LEU C CD1 1 
ATOM   4873 C  CD2 . LEU C 1 213 ? 12.612  29.554  50.513  1.00  46.91 ? 212 LEU C CD2 1 
ATOM   4874 N  N   . VAL C 1 214 ? 16.533  28.606  54.292  1.00  48.10 ? 213 VAL C N   1 
ATOM   4875 C  CA  . VAL C 1 214 ? 17.684  28.850  55.182  1.00  48.56 ? 213 VAL C CA  1 
ATOM   4876 C  C   . VAL C 1 214 ? 17.285  28.971  56.657  1.00  48.91 ? 213 VAL C C   1 
ATOM   4877 O  O   . VAL C 1 214 ? 17.673  28.148  57.491  1.00  49.04 ? 213 VAL C O   1 
ATOM   4878 C  CB  . VAL C 1 214 ? 18.536  30.083  54.727  1.00  48.69 ? 213 VAL C CB  1 
ATOM   4879 C  CG1 . VAL C 1 214 ? 19.618  30.418  55.752  1.00  48.97 ? 213 VAL C CG1 1 
ATOM   4880 C  CG2 . VAL C 1 214 ? 19.169  29.828  53.365  1.00  48.80 ? 213 VAL C CG2 1 
ATOM   4881 N  N   . ALA D 1 3   ? 16.632  -3.251  98.433  1.00  37.44 ? 2   ALA D N   1 
ATOM   4882 C  CA  . ALA D 1 3   ? 16.141  -2.173  97.533  1.00  37.27 ? 2   ALA D CA  1 
ATOM   4883 C  C   . ALA D 1 3   ? 15.810  -0.908  98.335  1.00  37.32 ? 2   ALA D C   1 
ATOM   4884 O  O   . ALA D 1 3   ? 15.577  -0.983  99.546  1.00  37.34 ? 2   ALA D O   1 
ATOM   4885 C  CB  . ALA D 1 3   ? 14.922  -2.660  96.773  1.00  37.49 ? 2   ALA D CB  1 
ATOM   4886 N  N   . TYR D 1 4   ? 15.801  0.251   97.671  1.00  36.76 ? 3   TYR D N   1 
ATOM   4887 C  CA  . TYR D 1 4   ? 15.311  1.474   98.303  1.00  36.51 ? 3   TYR D CA  1 
ATOM   4888 C  C   . TYR D 1 4   ? 13.807  1.377   98.511  1.00  36.09 ? 3   TYR D C   1 
ATOM   4889 O  O   . TYR D 1 4   ? 13.104  0.748   97.717  1.00  35.59 ? 3   TYR D O   1 
ATOM   4890 C  CB  . TYR D 1 4   ? 15.592  2.718   97.452  1.00  36.73 ? 3   TYR D CB  1 
ATOM   4891 C  CG  . TYR D 1 4   ? 17.040  3.023   97.143  1.00  37.03 ? 3   TYR D CG  1 
ATOM   4892 C  CD1 . TYR D 1 4   ? 18.073  2.626   97.998  1.00  37.40 ? 3   TYR D CD1 1 
ATOM   4893 C  CD2 . TYR D 1 4   ? 17.369  3.759   96.001  1.00  37.69 ? 3   TYR D CD2 1 
ATOM   4894 C  CE1 . TYR D 1 4   ? 19.402  2.929   97.701  1.00  37.89 ? 3   TYR D CE1 1 
ATOM   4895 C  CE2 . TYR D 1 4   ? 18.682  4.069   95.696  1.00  37.99 ? 3   TYR D CE2 1 
ATOM   4896 C  CZ  . TYR D 1 4   ? 19.694  3.649   96.545  1.00  37.85 ? 3   TYR D CZ  1 
ATOM   4897 O  OH  . TYR D 1 4   ? 20.992  3.966   96.229  1.00  37.97 ? 3   TYR D OH  1 
ATOM   4898 N  N   . THR D 1 5   ? 13.321  2.018   99.569  1.00  35.76 ? 4   THR D N   1 
ATOM   4899 C  CA  . THR D 1 5   ? 11.887  2.101   99.828  1.00  35.87 ? 4   THR D CA  1 
ATOM   4900 C  C   . THR D 1 5   ? 11.497  3.545   100.088 1.00  35.57 ? 4   THR D C   1 
ATOM   4901 O  O   . THR D 1 5   ? 12.346  4.370   100.454 1.00  35.39 ? 4   THR D O   1 
ATOM   4902 C  CB  . THR D 1 5   ? 11.457  1.225   101.041 1.00  35.92 ? 4   THR D CB  1 
ATOM   4903 O  OG1 . THR D 1 5   ? 12.263  1.542   102.182 1.00  37.50 ? 4   THR D OG1 1 
ATOM   4904 C  CG2 . THR D 1 5   ? 11.590  -0.259  100.724 1.00  36.12 ? 4   THR D CG2 1 
ATOM   4905 N  N   . LEU D 1 6   ? 10.221  3.862   99.887  1.00  35.28 ? 5   LEU D N   1 
ATOM   4906 C  CA  . LEU D 1 6   ? 9.714   5.181   100.244 1.00  35.07 ? 5   LEU D CA  1 
ATOM   4907 C  C   . LEU D 1 6   ? 9.605   5.272   101.769 1.00  35.09 ? 5   LEU D C   1 
ATOM   4908 O  O   . LEU D 1 6   ? 8.921   4.451   102.386 1.00  34.64 ? 5   LEU D O   1 
ATOM   4909 C  CB  . LEU D 1 6   ? 8.351   5.444   99.591  1.00  35.27 ? 5   LEU D CB  1 
ATOM   4910 C  CG  . LEU D 1 6   ? 7.837   6.886   99.684  1.00  35.16 ? 5   LEU D CG  1 
ATOM   4911 C  CD1 . LEU D 1 6   ? 8.651   7.806   98.777  1.00  34.47 ? 5   LEU D CD1 1 
ATOM   4912 C  CD2 . LEU D 1 6   ? 6.357   6.972   99.342  1.00  35.00 ? 5   LEU D CD2 1 
ATOM   4913 N  N   . PRO D 1 7   ? 10.293  6.257   102.381 1.00  35.08 ? 6   PRO D N   1 
ATOM   4914 C  CA  . PRO D 1 7   ? 10.195  6.401   103.832 1.00  35.46 ? 6   PRO D CA  1 
ATOM   4915 C  C   . PRO D 1 7   ? 8.849   7.009   104.200 1.00  35.83 ? 6   PRO D C   1 
ATOM   4916 O  O   . PRO D 1 7   ? 8.306   7.795   103.424 1.00  35.81 ? 6   PRO D O   1 
ATOM   4917 C  CB  . PRO D 1 7   ? 11.331  7.377   104.166 1.00  35.26 ? 6   PRO D CB  1 
ATOM   4918 C  CG  . PRO D 1 7   ? 11.496  8.206   102.922 1.00  35.01 ? 6   PRO D CG  1 
ATOM   4919 C  CD  . PRO D 1 7   ? 11.181  7.272   101.777 1.00  34.99 ? 6   PRO D CD  1 
ATOM   4920 N  N   . GLN D 1 8   ? 8.297   6.639   105.352 1.00  36.01 ? 7   GLN D N   1 
ATOM   4921 C  CA  . GLN D 1 8   ? 7.111   7.336   105.844 1.00  36.66 ? 7   GLN D CA  1 
ATOM   4922 C  C   . GLN D 1 8   ? 7.514   8.706   106.385 1.00  36.01 ? 7   GLN D C   1 
ATOM   4923 O  O   . GLN D 1 8   ? 8.627   8.876   106.879 1.00  35.76 ? 7   GLN D O   1 
ATOM   4924 C  CB  . GLN D 1 8   ? 6.355   6.526   106.898 1.00  36.76 ? 7   GLN D CB  1 
ATOM   4925 C  CG  . GLN D 1 8   ? 7.185   6.045   108.073 1.00  38.28 ? 7   GLN D CG  1 
ATOM   4926 C  CD  . GLN D 1 8   ? 6.428   5.052   108.942 1.00  38.65 ? 7   GLN D CD  1 
ATOM   4927 O  OE1 . GLN D 1 8   ? 5.472   5.415   109.638 1.00  41.91 ? 7   GLN D OE1 1 
ATOM   4928 N  NE2 . GLN D 1 8   ? 6.853   3.791   108.908 1.00  40.66 ? 7   GLN D NE2 1 
ATOM   4929 N  N   . LEU D 1 9   ? 6.607   9.671   106.267 1.00  35.61 ? 8   LEU D N   1 
ATOM   4930 C  CA  . LEU D 1 9   ? 6.820   11.023  106.782 1.00  35.69 ? 8   LEU D CA  1 
ATOM   4931 C  C   . LEU D 1 9   ? 6.815   11.056  108.314 1.00  35.04 ? 8   LEU D C   1 
ATOM   4932 O  O   . LEU D 1 9   ? 6.134   10.245  108.945 1.00  34.97 ? 8   LEU D O   1 
ATOM   4933 C  CB  . LEU D 1 9   ? 5.736   11.959  106.239 1.00  35.62 ? 8   LEU D CB  1 
ATOM   4934 C  CG  . LEU D 1 9   ? 6.018   12.871  105.041 1.00  37.01 ? 8   LEU D CG  1 
ATOM   4935 C  CD1 . LEU D 1 9   ? 6.866   12.216  103.962 1.00  37.62 ? 8   LEU D CD1 1 
ATOM   4936 C  CD2 . LEU D 1 9   ? 4.706   13.378  104.471 1.00  36.30 ? 8   LEU D CD2 1 
ATOM   4937 N  N   . PRO D 1 10  ? 7.584   11.984  108.919 1.00  34.74 ? 9   PRO D N   1 
ATOM   4938 C  CA  . PRO D 1 10  ? 7.543   12.173  110.378 1.00  34.44 ? 9   PRO D CA  1 
ATOM   4939 C  C   . PRO D 1 10  ? 6.238   12.791  110.919 1.00  33.91 ? 9   PRO D C   1 
ATOM   4940 O  O   . PRO D 1 10  ? 6.130   13.021  112.126 1.00  33.85 ? 9   PRO D O   1 
ATOM   4941 C  CB  . PRO D 1 10  ? 8.717   13.132  110.650 1.00  34.71 ? 9   PRO D CB  1 
ATOM   4942 C  CG  . PRO D 1 10  ? 9.501   13.220  109.378 1.00  34.64 ? 9   PRO D CG  1 
ATOM   4943 C  CD  . PRO D 1 10  ? 8.564   12.876  108.269 1.00  34.84 ? 9   PRO D CD  1 
ATOM   4944 N  N   . TYR D 1 11  ? 5.272   13.059  110.041 1.00  33.00 ? 10  TYR D N   1 
ATOM   4945 C  CA  . TYR D 1 11  ? 4.058   13.827  110.376 1.00  32.34 ? 10  TYR D CA  1 
ATOM   4946 C  C   . TYR D 1 11  ? 2.975   13.584  109.318 1.00  31.97 ? 10  TYR D C   1 
ATOM   4947 O  O   . TYR D 1 11  ? 3.259   13.029  108.248 1.00  31.90 ? 10  TYR D O   1 
ATOM   4948 C  CB  . TYR D 1 11  ? 4.388   15.334  110.456 1.00  32.17 ? 10  TYR D CB  1 
ATOM   4949 C  CG  . TYR D 1 11  ? 5.400   15.761  109.406 1.00  32.06 ? 10  TYR D CG  1 
ATOM   4950 C  CD1 . TYR D 1 11  ? 5.051   15.803  108.054 1.00  31.68 ? 10  TYR D CD1 1 
ATOM   4951 C  CD2 . TYR D 1 11  ? 6.716   16.065  109.756 1.00  31.26 ? 10  TYR D CD2 1 
ATOM   4952 C  CE1 . TYR D 1 11  ? 5.975   16.160  107.084 1.00  31.84 ? 10  TYR D CE1 1 
ATOM   4953 C  CE2 . TYR D 1 11  ? 7.655   16.426  108.785 1.00  31.01 ? 10  TYR D CE2 1 
ATOM   4954 C  CZ  . TYR D 1 11  ? 7.270   16.469  107.453 1.00  31.14 ? 10  TYR D CZ  1 
ATOM   4955 O  OH  . TYR D 1 11  ? 8.169   16.807  106.474 1.00  32.01 ? 10  TYR D OH  1 
ATOM   4956 N  N   . ALA D 1 12  ? 1.747   14.017  109.604 1.00  31.41 ? 11  ALA D N   1 
ATOM   4957 C  CA  . ALA D 1 12  ? 0.636   13.901  108.651 1.00  31.32 ? 11  ALA D CA  1 
ATOM   4958 C  C   . ALA D 1 12  ? 0.816   14.840  107.452 1.00  31.18 ? 11  ALA D C   1 
ATOM   4959 O  O   . ALA D 1 12  ? 1.590   15.794  107.520 1.00  30.72 ? 11  ALA D O   1 
ATOM   4960 C  CB  . ALA D 1 12  ? -0.690  14.167  109.348 1.00  31.28 ? 11  ALA D CB  1 
ATOM   4961 N  N   . TYR D 1 13  ? 0.097   14.570  106.364 1.00  31.16 ? 12  TYR D N   1 
ATOM   4962 C  CA  . TYR D 1 13  ? 0.204   15.388  105.148 1.00  31.31 ? 12  TYR D CA  1 
ATOM   4963 C  C   . TYR D 1 13  ? -0.216  16.842  105.356 1.00  31.50 ? 12  TYR D C   1 
ATOM   4964 O  O   . TYR D 1 13  ? 0.266   17.742  104.653 1.00  31.00 ? 12  TYR D O   1 
ATOM   4965 C  CB  . TYR D 1 13  ? -0.587  14.763  103.992 1.00  31.83 ? 12  TYR D CB  1 
ATOM   4966 C  CG  . TYR D 1 13  ? 0.034   13.495  103.445 1.00  31.85 ? 12  TYR D CG  1 
ATOM   4967 C  CD1 . TYR D 1 13  ? 1.356   13.476  103.004 1.00  32.07 ? 12  TYR D CD1 1 
ATOM   4968 C  CD2 . TYR D 1 13  ? -0.702  12.316  103.357 1.00  33.31 ? 12  TYR D CD2 1 
ATOM   4969 C  CE1 . TYR D 1 13  ? 1.935   12.316  102.499 1.00  32.07 ? 12  TYR D CE1 1 
ATOM   4970 C  CE2 . TYR D 1 13  ? -0.129  11.148  102.849 1.00  33.64 ? 12  TYR D CE2 1 
ATOM   4971 C  CZ  . TYR D 1 13  ? 1.196   11.162  102.426 1.00  32.84 ? 12  TYR D CZ  1 
ATOM   4972 O  OH  . TYR D 1 13  ? 1.776   10.011  101.927 1.00  33.56 ? 12  TYR D OH  1 
ATOM   4973 N  N   . ASP D 1 14  ? -1.096  17.069  106.330 1.00  31.43 ? 13  ASP D N   1 
ATOM   4974 C  CA  . ASP D 1 14  ? -1.572  18.416  106.632 1.00  31.89 ? 13  ASP D CA  1 
ATOM   4975 C  C   . ASP D 1 14  ? -0.818  19.119  107.772 1.00  31.62 ? 13  ASP D C   1 
ATOM   4976 O  O   . ASP D 1 14  ? -1.189  20.224  108.168 1.00  31.70 ? 13  ASP D O   1 
ATOM   4977 C  CB  . ASP D 1 14  ? -3.083  18.403  106.904 1.00  32.10 ? 13  ASP D CB  1 
ATOM   4978 C  CG  . ASP D 1 14  ? -3.475  17.511  108.082 1.00  33.64 ? 13  ASP D CG  1 
ATOM   4979 O  OD1 . ASP D 1 14  ? -2.731  16.562  108.424 1.00  34.09 ? 13  ASP D OD1 1 
ATOM   4980 O  OD2 . ASP D 1 14  ? -4.553  17.757  108.660 1.00  34.33 ? 13  ASP D OD2 1 
ATOM   4981 N  N   . ALA D 1 15  ? 0.246   18.493  108.274 1.00  31.46 ? 14  ALA D N   1 
ATOM   4982 C  CA  . ALA D 1 15  ? 0.981   19.006  109.435 1.00  31.49 ? 14  ALA D CA  1 
ATOM   4983 C  C   . ALA D 1 15  ? 1.712   20.338  109.199 1.00  31.46 ? 14  ALA D C   1 
ATOM   4984 O  O   . ALA D 1 15  ? 1.959   21.089  110.149 1.00  31.15 ? 14  ALA D O   1 
ATOM   4985 C  CB  . ALA D 1 15  ? 1.955   17.963  109.950 1.00  31.75 ? 14  ALA D CB  1 
ATOM   4986 N  N   . LEU D 1 16  ? 2.041   20.625  107.941 1.00  31.26 ? 15  LEU D N   1 
ATOM   4987 C  CA  . LEU D 1 16  ? 2.809   21.828  107.597 1.00  30.94 ? 15  LEU D CA  1 
ATOM   4988 C  C   . LEU D 1 16  ? 1.954   22.989  107.060 1.00  30.96 ? 15  LEU D C   1 
ATOM   4989 O  O   . LEU D 1 16  ? 2.498   24.013  106.617 1.00  30.87 ? 15  LEU D O   1 
ATOM   4990 C  CB  . LEU D 1 16  ? 3.946   21.479  106.623 1.00  30.80 ? 15  LEU D CB  1 
ATOM   4991 C  CG  . LEU D 1 16  ? 4.839   20.258  106.931 1.00  31.48 ? 15  LEU D CG  1 
ATOM   4992 C  CD1 . LEU D 1 16  ? 5.905   20.084  105.851 1.00  32.82 ? 15  LEU D CD1 1 
ATOM   4993 C  CD2 . LEU D 1 16  ? 5.495   20.325  108.317 1.00  31.22 ? 15  LEU D CD2 1 
ATOM   4994 N  N   . GLU D 1 17  ? 0.629   22.836  107.105 1.00  30.79 ? 16  GLU D N   1 
ATOM   4995 C  CA  . GLU D 1 17  ? -0.296  23.889  106.653 1.00  31.33 ? 16  GLU D CA  1 
ATOM   4996 C  C   . GLU D 1 17  ? -0.230  25.107  107.588 1.00  30.96 ? 16  GLU D C   1 
ATOM   4997 O  O   . GLU D 1 17  ? 0.056   24.951  108.770 1.00  30.72 ? 16  GLU D O   1 
ATOM   4998 C  CB  . GLU D 1 17  ? -1.732  23.347  106.543 1.00  31.92 ? 16  GLU D CB  1 
ATOM   4999 C  CG  . GLU D 1 17  ? -1.977  22.413  105.344 1.00  34.59 ? 16  GLU D CG  1 
ATOM   5000 C  CD  . GLU D 1 17  ? -2.793  23.040  104.198 1.00  39.09 ? 16  GLU D CD  1 
ATOM   5001 O  OE1 . GLU D 1 17  ? -2.761  24.288  104.012 1.00  41.15 ? 16  GLU D OE1 1 
ATOM   5002 O  OE2 . GLU D 1 17  ? -3.467  22.266  103.462 1.00  39.20 ? 16  GLU D OE2 1 
ATOM   5003 N  N   . PRO D 1 18  ? -0.459  26.328  107.056 1.00  30.64 ? 17  PRO D N   1 
ATOM   5004 C  CA  . PRO D 1 18  ? -0.728  26.658  105.650 1.00  30.30 ? 17  PRO D CA  1 
ATOM   5005 C  C   . PRO D 1 18  ? 0.547   26.907  104.839 1.00  29.78 ? 17  PRO D C   1 
ATOM   5006 O  O   . PRO D 1 18  ? 0.468   27.334  103.685 1.00  29.54 ? 17  PRO D O   1 
ATOM   5007 C  CB  . PRO D 1 18  ? -1.540  27.950  105.761 1.00  30.29 ? 17  PRO D CB  1 
ATOM   5008 C  CG  . PRO D 1 18  ? -1.008  28.619  106.992 1.00  30.63 ? 17  PRO D CG  1 
ATOM   5009 C  CD  . PRO D 1 18  ? -0.462  27.537  107.904 1.00  30.60 ? 17  PRO D CD  1 
ATOM   5010 N  N   . HIS D 1 19  ? 1.704   26.632  105.436 1.00  29.09 ? 18  HIS D N   1 
ATOM   5011 C  CA  . HIS D 1 19  ? 2.996   26.910  104.796 1.00  28.85 ? 18  HIS D CA  1 
ATOM   5012 C  C   . HIS D 1 19  ? 3.222   26.001  103.583 1.00  29.14 ? 18  HIS D C   1 
ATOM   5013 O  O   . HIS D 1 19  ? 3.649   26.459  102.518 1.00  28.59 ? 18  HIS D O   1 
ATOM   5014 C  CB  . HIS D 1 19  ? 4.124   26.804  105.825 1.00  28.92 ? 18  HIS D CB  1 
ATOM   5015 C  CG  . HIS D 1 19  ? 3.790   27.457  107.131 1.00  28.96 ? 18  HIS D CG  1 
ATOM   5016 N  ND1 . HIS D 1 19  ? 3.611   28.819  107.255 1.00  28.87 ? 18  HIS D ND1 1 
ATOM   5017 C  CD2 . HIS D 1 19  ? 3.550   26.933  108.355 1.00  28.72 ? 18  HIS D CD2 1 
ATOM   5018 C  CE1 . HIS D 1 19  ? 3.295   29.106  108.506 1.00  29.01 ? 18  HIS D CE1 1 
ATOM   5019 N  NE2 . HIS D 1 19  ? 3.253   27.980  109.194 1.00  28.08 ? 18  HIS D NE2 1 
ATOM   5020 N  N   . ILE D 1 20  ? 2.925   24.716  103.748 1.00  29.49 ? 19  ILE D N   1 
ATOM   5021 C  CA  . ILE D 1 20  ? 2.865   23.787  102.618 1.00  30.27 ? 19  ILE D CA  1 
ATOM   5022 C  C   . ILE D 1 20  ? 1.515   23.071  102.669 1.00  30.47 ? 19  ILE D C   1 
ATOM   5023 O  O   . ILE D 1 20  ? 1.112   22.559  103.717 1.00  31.13 ? 19  ILE D O   1 
ATOM   5024 C  CB  . ILE D 1 20  ? 4.067   22.786  102.607 1.00  30.30 ? 19  ILE D CB  1 
ATOM   5025 C  CG1 . ILE D 1 20  ? 5.404   23.546  102.684 1.00  30.06 ? 19  ILE D CG1 1 
ATOM   5026 C  CG2 . ILE D 1 20  ? 4.022   21.885  101.368 1.00  30.03 ? 19  ILE D CG2 1 
ATOM   5027 C  CD1 . ILE D 1 20  ? 6.630   22.640  102.780 1.00  30.78 ? 19  ILE D CD1 1 
ATOM   5028 N  N   . ASP D 1 21  ? 0.804   23.078  101.544 1.00  30.82 ? 20  ASP D N   1 
ATOM   5029 C  CA  . ASP D 1 21  ? -0.527  22.466  101.464 1.00  30.78 ? 20  ASP D CA  1 
ATOM   5030 C  C   . ASP D 1 21  ? -0.488  20.934  101.493 1.00  30.28 ? 20  ASP D C   1 
ATOM   5031 O  O   . ASP D 1 21  ? 0.442   20.314  100.971 1.00  29.90 ? 20  ASP D O   1 
ATOM   5032 C  CB  . ASP D 1 21  ? -1.284  22.957  100.230 1.00  31.05 ? 20  ASP D CB  1 
ATOM   5033 C  CG  . ASP D 1 21  ? -0.518  22.723  98.942  1.00  32.89 ? 20  ASP D CG  1 
ATOM   5034 O  OD1 . ASP D 1 21  ? 0.605   23.258  98.812  1.00  35.49 ? 20  ASP D OD1 1 
ATOM   5035 O  OD2 . ASP D 1 21  ? -1.044  22.019  98.051  1.00  35.39 ? 20  ASP D OD2 1 
ATOM   5036 N  N   . ALA D 1 22  ? -1.508  20.348  102.119 1.00  29.77 ? 21  ALA D N   1 
ATOM   5037 C  CA  . ALA D 1 22  ? -1.647  18.898  102.275 1.00  29.28 ? 21  ALA D CA  1 
ATOM   5038 C  C   . ALA D 1 22  ? -1.660  18.148  100.940 1.00  29.18 ? 21  ALA D C   1 
ATOM   5039 O  O   . ALA D 1 22  ? -1.077  17.070  100.827 1.00  28.96 ? 21  ALA D O   1 
ATOM   5040 C  CB  . ALA D 1 22  ? -2.910  18.579  103.063 1.00  28.99 ? 21  ALA D CB  1 
ATOM   5041 N  N   . ARG D 1 23  ? -2.322  18.716  99.934  1.00  29.44 ? 22  ARG D N   1 
ATOM   5042 C  CA  . ARG D 1 23  ? -2.352  18.093  98.601  1.00  30.04 ? 22  ARG D CA  1 
ATOM   5043 C  C   . ARG D 1 23  ? -0.943  17.964  98.025  1.00  30.00 ? 22  ARG D C   1 
ATOM   5044 O  O   . ARG D 1 23  ? -0.563  16.897  97.541  1.00  30.38 ? 22  ARG D O   1 
ATOM   5045 C  CB  . ARG D 1 23  ? -3.254  18.862  97.638  1.00  30.00 ? 22  ARG D CB  1 
ATOM   5046 C  CG  . ARG D 1 23  ? -3.584  18.097  96.367  1.00  31.25 ? 22  ARG D CG  1 
ATOM   5047 C  CD  . ARG D 1 23  ? -4.534  18.884  95.496  1.00  33.16 ? 22  ARG D CD  1 
ATOM   5048 N  NE  . ARG D 1 23  ? -4.949  18.139  94.308  1.00  35.25 ? 22  ARG D NE  1 
ATOM   5049 C  CZ  . ARG D 1 23  ? -5.406  18.706  93.195  1.00  36.14 ? 22  ARG D CZ  1 
ATOM   5050 N  NH1 . ARG D 1 23  ? -5.498  20.026  93.108  1.00  36.68 ? 22  ARG D NH1 1 
ATOM   5051 N  NH2 . ARG D 1 23  ? -5.763  17.956  92.164  1.00  35.69 ? 22  ARG D NH2 1 
ATOM   5052 N  N   . THR D 1 24  ? -0.181  19.054  98.081  1.00  29.81 ? 23  THR D N   1 
ATOM   5053 C  CA  . THR D 1 24  ? 1.217   19.049  97.651  1.00  29.86 ? 23  THR D CA  1 
ATOM   5054 C  C   . THR D 1 24  ? 2.048   18.006  98.396  1.00  29.65 ? 23  THR D C   1 
ATOM   5055 O  O   . THR D 1 24  ? 2.702   17.182  97.765  1.00  29.56 ? 23  THR D O   1 
ATOM   5056 C  CB  . THR D 1 24  ? 1.850   20.450  97.764  1.00  30.14 ? 23  THR D CB  1 
ATOM   5057 O  OG1 . THR D 1 24  ? 1.243   21.299  96.786  1.00  29.28 ? 23  THR D OG1 1 
ATOM   5058 C  CG2 . THR D 1 24  ? 3.350   20.407  97.521  1.00  30.43 ? 23  THR D CG2 1 
ATOM   5059 N  N   . MET D 1 25  ? 2.004   18.026  99.726  1.00  29.60 ? 24  MET D N   1 
ATOM   5060 C  CA  . MET D 1 25  ? 2.710   17.025  100.527 1.00  29.89 ? 24  MET D CA  1 
ATOM   5061 C  C   . MET D 1 25  ? 2.397   15.591  100.069 1.00  30.21 ? 24  MET D C   1 
ATOM   5062 O  O   . MET D 1 25  ? 3.308   14.770  99.915  1.00  30.44 ? 24  MET D O   1 
ATOM   5063 C  CB  . MET D 1 25  ? 2.383   17.190  102.016 1.00  30.19 ? 24  MET D CB  1 
ATOM   5064 C  CG  . MET D 1 25  ? 2.964   18.439  102.662 1.00  32.15 ? 24  MET D CG  1 
ATOM   5065 S  SD  . MET D 1 25  ? 4.756   18.584  102.520 1.00  35.65 ? 24  MET D SD  1 
ATOM   5066 C  CE  . MET D 1 25  ? 5.329   17.188  103.488 1.00  33.77 ? 24  MET D CE  1 
ATOM   5067 N  N   . GLU D 1 26  ? 1.119   15.303  99.833  1.00  29.89 ? 25  GLU D N   1 
ATOM   5068 C  CA  . GLU D 1 26  ? 0.706   13.963  99.402  1.00  30.62 ? 25  GLU D CA  1 
ATOM   5069 C  C   . GLU D 1 26  ? 1.279   13.590  98.031  1.00  29.80 ? 25  GLU D C   1 
ATOM   5070 O  O   . GLU D 1 26  ? 1.808   12.494  97.856  1.00  29.81 ? 25  GLU D O   1 
ATOM   5071 C  CB  . GLU D 1 26  ? -0.825  13.815  99.422  1.00  30.36 ? 25  GLU D CB  1 
ATOM   5072 C  CG  . GLU D 1 26  ? -1.314  12.395  99.133  1.00  32.32 ? 25  GLU D CG  1 
ATOM   5073 C  CD  . GLU D 1 26  ? -2.798  12.175  99.420  1.00  33.27 ? 25  GLU D CD  1 
ATOM   5074 O  OE1 . GLU D 1 26  ? -3.429  13.018  100.101 1.00  37.15 ? 25  GLU D OE1 1 
ATOM   5075 O  OE2 . GLU D 1 26  ? -3.333  11.136  98.968  1.00  36.12 ? 25  GLU D OE2 1 
ATOM   5076 N  N   . ILE D 1 27  ? 1.173   14.497  97.063  1.00  29.14 ? 26  ILE D N   1 
ATOM   5077 C  CA  . ILE D 1 27  ? 1.619   14.200  95.704  1.00  28.54 ? 26  ILE D CA  1 
ATOM   5078 C  C   . ILE D 1 27  ? 3.147   14.162  95.670  1.00  28.18 ? 26  ILE D C   1 
ATOM   5079 O  O   . ILE D 1 27  ? 3.746   13.287  95.044  1.00  27.15 ? 26  ILE D O   1 
ATOM   5080 C  CB  . ILE D 1 27  ? 1.056   15.214  94.657  1.00  28.45 ? 26  ILE D CB  1 
ATOM   5081 C  CG1 . ILE D 1 27  ? -0.479  15.162  94.627  1.00  28.97 ? 26  ILE D CG1 1 
ATOM   5082 C  CG2 . ILE D 1 27  ? 1.620   14.913  93.270  1.00  28.49 ? 26  ILE D CG2 1 
ATOM   5083 C  CD1 . ILE D 1 27  ? -1.141  16.384  93.973  1.00  29.30 ? 26  ILE D CD1 1 
ATOM   5084 N  N   . HIS D 1 28  ? 3.772   15.113  96.363  1.00  27.83 ? 27  HIS D N   1 
ATOM   5085 C  CA  . HIS D 1 28  ? 5.224   15.194  96.416  1.00  28.43 ? 27  HIS D CA  1 
ATOM   5086 C  C   . HIS D 1 28  ? 5.811   13.881  96.941  1.00  28.80 ? 27  HIS D C   1 
ATOM   5087 O  O   . HIS D 1 28  ? 6.790   13.350  96.401  1.00  28.83 ? 27  HIS D O   1 
ATOM   5088 C  CB  . HIS D 1 28  ? 5.638   16.326  97.342  1.00  28.43 ? 27  HIS D CB  1 
ATOM   5089 C  CG  . HIS D 1 28  ? 6.994   16.879  97.048  1.00  29.06 ? 27  HIS D CG  1 
ATOM   5090 N  ND1 . HIS D 1 28  ? 7.470   18.019  97.655  1.00  28.36 ? 27  HIS D ND1 1 
ATOM   5091 C  CD2 . HIS D 1 28  ? 7.969   16.465  96.202  1.00  29.51 ? 27  HIS D CD2 1 
ATOM   5092 C  CE1 . HIS D 1 28  ? 8.691   18.270  97.219  1.00  29.91 ? 27  HIS D CE1 1 
ATOM   5093 N  NE2 . HIS D 1 28  ? 9.013   17.352  96.324  1.00  29.37 ? 27  HIS D NE2 1 
ATOM   5094 N  N   . HIS D 1 29  ? 5.196   13.365  97.996  1.00  28.89 ? 28  HIS D N   1 
ATOM   5095 C  CA  . HIS D 1 29  ? 5.649   12.127  98.615  1.00  29.16 ? 28  HIS D CA  1 
ATOM   5096 C  C   . HIS D 1 29  ? 5.267   10.894  97.795  1.00  29.40 ? 28  HIS D C   1 
ATOM   5097 O  O   . HIS D 1 29  ? 6.143   10.107  97.416  1.00  29.26 ? 28  HIS D O   1 
ATOM   5098 C  CB  . HIS D 1 29  ? 5.106   12.041  100.042 1.00  29.59 ? 28  HIS D CB  1 
ATOM   5099 C  CG  . HIS D 1 29  ? 5.661   10.902  100.844 1.00  30.31 ? 28  HIS D CG  1 
ATOM   5100 N  ND1 . HIS D 1 29  ? 4.857   10.022  101.534 1.00  32.02 ? 28  HIS D ND1 1 
ATOM   5101 C  CD2 . HIS D 1 29  ? 6.935   10.499  101.062 1.00  30.37 ? 28  HIS D CD2 1 
ATOM   5102 C  CE1 . HIS D 1 29  ? 5.612   9.128   102.150 1.00  31.05 ? 28  HIS D CE1 1 
ATOM   5103 N  NE2 . HIS D 1 29  ? 6.877   9.395   101.879 1.00  31.79 ? 28  HIS D NE2 1 
ATOM   5104 N  N   . THR D 1 30  ? 3.973   10.729  97.514  1.00  29.28 ? 29  THR D N   1 
ATOM   5105 C  CA  . THR D 1 30  ? 3.469   9.454   96.967  1.00  29.34 ? 29  THR D CA  1 
ATOM   5106 C  C   . THR D 1 30  ? 3.682   9.302   95.462  1.00  29.38 ? 29  THR D C   1 
ATOM   5107 O  O   . THR D 1 30  ? 3.676   8.184   94.944  1.00  29.21 ? 29  THR D O   1 
ATOM   5108 C  CB  . THR D 1 30  ? 1.970   9.214   97.280  1.00  29.55 ? 29  THR D CB  1 
ATOM   5109 O  OG1 . THR D 1 30  ? 1.172   10.161  96.571  1.00  30.46 ? 29  THR D OG1 1 
ATOM   5110 C  CG2 . THR D 1 30  ? 1.684   9.316   98.785  1.00  29.89 ? 29  THR D CG2 1 
ATOM   5111 N  N   . LYS D 1 31  ? 3.846   10.424  94.764  1.00  29.06 ? 30  LYS D N   1 
ATOM   5112 C  CA  . LYS D 1 31  ? 4.092   10.394  93.319  1.00  29.61 ? 30  LYS D CA  1 
ATOM   5113 C  C   . LYS D 1 31  ? 5.555   10.692  92.971  1.00  29.54 ? 30  LYS D C   1 
ATOM   5114 O  O   . LYS D 1 31  ? 6.254   9.815   92.468  1.00  29.69 ? 30  LYS D O   1 
ATOM   5115 C  CB  . LYS D 1 31  ? 3.126   11.320  92.557  1.00  29.94 ? 30  LYS D CB  1 
ATOM   5116 C  CG  . LYS D 1 31  ? 1.636   11.016  92.777  1.00  30.54 ? 30  LYS D CG  1 
ATOM   5117 C  CD  . LYS D 1 31  ? 1.250   9.612   92.315  1.00  32.42 ? 30  LYS D CD  1 
ATOM   5118 C  CE  . LYS D 1 31  ? -0.230  9.316   92.539  1.00  32.48 ? 30  LYS D CE  1 
ATOM   5119 N  NZ  . LYS D 1 31  ? -0.583  7.969   92.011  1.00  34.21 ? 30  LYS D NZ  1 
ATOM   5120 N  N   . HIS D 1 32  ? 6.018   11.913  93.254  1.00  28.82 ? 31  HIS D N   1 
ATOM   5121 C  CA  . HIS D 1 32  ? 7.381   12.324  92.875  1.00  29.15 ? 31  HIS D CA  1 
ATOM   5122 C  C   . HIS D 1 32  ? 8.478   11.504  93.557  1.00  28.80 ? 31  HIS D C   1 
ATOM   5123 O  O   . HIS D 1 32  ? 9.302   10.888  92.879  1.00  28.96 ? 31  HIS D O   1 
ATOM   5124 C  CB  . HIS D 1 32  ? 7.604   13.829  93.103  1.00  29.04 ? 31  HIS D CB  1 
ATOM   5125 C  CG  . HIS D 1 32  ? 6.679   14.692  92.305  1.00  30.45 ? 31  HIS D CG  1 
ATOM   5126 N  ND1 . HIS D 1 32  ? 6.813   14.865  90.943  1.00  31.93 ? 31  HIS D ND1 1 
ATOM   5127 C  CD2 . HIS D 1 32  ? 5.578   15.394  92.666  1.00  30.55 ? 31  HIS D CD2 1 
ATOM   5128 C  CE1 . HIS D 1 32  ? 5.854   15.663  90.507  1.00  31.08 ? 31  HIS D CE1 1 
ATOM   5129 N  NE2 . HIS D 1 32  ? 5.088   15.994  91.531  1.00  29.96 ? 31  HIS D NE2 1 
ATOM   5130 N  N   . HIS D 1 33  ? 8.492   11.490  94.888  1.00  27.93 ? 32  HIS D N   1 
ATOM   5131 C  CA  . HIS D 1 33  ? 9.530   10.752  95.606  1.00  28.03 ? 32  HIS D CA  1 
ATOM   5132 C  C   . HIS D 1 33  ? 9.478   9.254   95.284  1.00  28.34 ? 32  HIS D C   1 
ATOM   5133 O  O   . HIS D 1 33  ? 10.517  8.631   95.043  1.00  27.90 ? 32  HIS D O   1 
ATOM   5134 C  CB  . HIS D 1 33  ? 9.439   11.006  97.113  1.00  27.81 ? 32  HIS D CB  1 
ATOM   5135 C  CG  . HIS D 1 33  ? 10.612  10.491  97.894  1.00  28.38 ? 32  HIS D CG  1 
ATOM   5136 N  ND1 . HIS D 1 33  ? 10.689  10.598  99.263  1.00  28.77 ? 32  HIS D ND1 1 
ATOM   5137 C  CD2 . HIS D 1 33  ? 11.744  9.854   97.504  1.00  27.82 ? 32  HIS D CD2 1 
ATOM   5138 C  CE1 . HIS D 1 33  ? 11.823  10.065  99.685  1.00  28.77 ? 32  HIS D CE1 1 
ATOM   5139 N  NE2 . HIS D 1 33  ? 12.477  9.598   98.637  1.00  28.55 ? 32  HIS D NE2 1 
ATOM   5140 N  N   . GLN D 1 34  ? 8.269   8.691   95.265  1.00  28.58 ? 33  GLN D N   1 
ATOM   5141 C  CA  . GLN D 1 34  ? 8.077   7.284   94.911  1.00  29.49 ? 33  GLN D CA  1 
ATOM   5142 C  C   . GLN D 1 34  ? 8.712   6.936   93.560  1.00  29.57 ? 33  GLN D C   1 
ATOM   5143 O  O   . GLN D 1 34  ? 9.387   5.910   93.426  1.00  29.80 ? 33  GLN D O   1 
ATOM   5144 C  CB  . GLN D 1 34  ? 6.585   6.927   94.900  1.00  29.72 ? 33  GLN D CB  1 
ATOM   5145 C  CG  . GLN D 1 34  ? 6.290   5.437   94.660  1.00  30.84 ? 33  GLN D CG  1 
ATOM   5146 C  CD  . GLN D 1 34  ? 6.726   4.567   95.823  1.00  33.02 ? 33  GLN D CD  1 
ATOM   5147 O  OE1 . GLN D 1 34  ? 6.157   4.637   96.915  1.00  33.98 ? 33  GLN D OE1 1 
ATOM   5148 N  NE2 . GLN D 1 34  ? 7.750   3.748   95.600  1.00  32.67 ? 33  GLN D NE2 1 
ATOM   5149 N  N   . THR D 1 35  ? 8.477   7.791   92.569  1.00  29.53 ? 34  THR D N   1 
ATOM   5150 C  CA  . THR D 1 35  ? 9.051   7.627   91.237  1.00  29.84 ? 34  THR D CA  1 
ATOM   5151 C  C   . THR D 1 35  ? 10.584  7.547   91.269  1.00  29.88 ? 34  THR D C   1 
ATOM   5152 O  O   . THR D 1 35  ? 11.164  6.668   90.634  1.00  29.85 ? 34  THR D O   1 
ATOM   5153 C  CB  . THR D 1 35  ? 8.554   8.731   90.287  1.00  30.11 ? 34  THR D CB  1 
ATOM   5154 O  OG1 . THR D 1 35  ? 7.139   8.591   90.137  1.00  30.28 ? 34  THR D OG1 1 
ATOM   5155 C  CG2 . THR D 1 35  ? 9.213   8.622   88.912  1.00  30.63 ? 34  THR D CG2 1 
ATOM   5156 N  N   . TYR D 1 36  ? 11.231  8.444   92.019  1.00  29.65 ? 35  TYR D N   1 
ATOM   5157 C  CA  . TYR D 1 36  ? 12.687  8.402   92.150  1.00  29.79 ? 35  TYR D CA  1 
ATOM   5158 C  C   . TYR D 1 36  ? 13.174  7.090   92.776  1.00  29.90 ? 35  TYR D C   1 
ATOM   5159 O  O   . TYR D 1 36  ? 14.157  6.525   92.306  1.00  29.96 ? 35  TYR D O   1 
ATOM   5160 C  CB  . TYR D 1 36  ? 13.236  9.603   92.938  1.00  29.67 ? 35  TYR D CB  1 
ATOM   5161 C  CG  . TYR D 1 36  ? 12.927  10.950  92.328  1.00  30.11 ? 35  TYR D CG  1 
ATOM   5162 C  CD1 . TYR D 1 36  ? 13.237  11.225  90.994  1.00  29.23 ? 35  TYR D CD1 1 
ATOM   5163 C  CD2 . TYR D 1 36  ? 12.351  11.960  93.091  1.00  30.38 ? 35  TYR D CD2 1 
ATOM   5164 C  CE1 . TYR D 1 36  ? 12.965  12.459  90.429  1.00  30.06 ? 35  TYR D CE1 1 
ATOM   5165 C  CE2 . TYR D 1 36  ? 12.062  13.209  92.529  1.00  30.83 ? 35  TYR D CE2 1 
ATOM   5166 C  CZ  . TYR D 1 36  ? 12.374  13.444  91.198  1.00  29.99 ? 35  TYR D CZ  1 
ATOM   5167 O  OH  . TYR D 1 36  ? 12.102  14.666  90.638  1.00  32.01 ? 35  TYR D OH  1 
ATOM   5168 N  N   . VAL D 1 37  ? 12.490  6.627   93.828  1.00  29.82 ? 36  VAL D N   1 
ATOM   5169 C  CA  . VAL D 1 37  ? 12.790  5.334   94.470  1.00  30.71 ? 36  VAL D CA  1 
ATOM   5170 C  C   . VAL D 1 37  ? 12.664  4.197   93.463  1.00  31.02 ? 36  VAL D C   1 
ATOM   5171 O  O   . VAL D 1 37  ? 13.575  3.373   93.321  1.00  31.18 ? 36  VAL D O   1 
ATOM   5172 C  CB  . VAL D 1 37  ? 11.870  5.049   95.704  1.00  30.33 ? 36  VAL D CB  1 
ATOM   5173 C  CG1 . VAL D 1 37  ? 11.961  3.585   96.155  1.00  30.82 ? 36  VAL D CG1 1 
ATOM   5174 C  CG2 . VAL D 1 37  ? 12.230  5.962   96.854  1.00  30.44 ? 36  VAL D CG2 1 
ATOM   5175 N  N   . ASP D 1 38  ? 11.530  4.171   92.766  1.00  31.45 ? 37  ASP D N   1 
ATOM   5176 C  CA  . ASP D 1 38  ? 11.237  3.143   91.773  1.00  31.98 ? 37  ASP D CA  1 
ATOM   5177 C  C   . ASP D 1 38  ? 12.270  3.125   90.663  1.00  31.95 ? 37  ASP D C   1 
ATOM   5178 O  O   . ASP D 1 38  ? 12.755  2.062   90.277  1.00  31.67 ? 37  ASP D O   1 
ATOM   5179 C  CB  . ASP D 1 38  ? 9.841   3.361   91.184  1.00  32.36 ? 37  ASP D CB  1 
ATOM   5180 C  CG  . ASP D 1 38  ? 8.735   2.946   92.142  1.00  34.54 ? 37  ASP D CG  1 
ATOM   5181 O  OD1 . ASP D 1 38  ? 9.050   2.364   93.206  1.00  37.17 ? 37  ASP D OD1 1 
ATOM   5182 O  OD2 . ASP D 1 38  ? 7.548   3.197   91.829  1.00  37.38 ? 37  ASP D OD2 1 
ATOM   5183 N  N   . ASN D 1 39  ? 12.610  4.304   90.154  1.00  31.86 ? 38  ASN D N   1 
ATOM   5184 C  CA  . ASN D 1 39  ? 13.571  4.398   89.063  1.00  32.08 ? 38  ASN D CA  1 
ATOM   5185 C  C   . ASN D 1 39  ? 15.018  4.101   89.454  1.00  31.99 ? 38  ASN D C   1 
ATOM   5186 O  O   . ASN D 1 39  ? 15.778  3.566   88.646  1.00  32.22 ? 38  ASN D O   1 
ATOM   5187 C  CB  . ASN D 1 39  ? 13.440  5.731   88.330  1.00  31.83 ? 38  ASN D CB  1 
ATOM   5188 C  CG  . ASN D 1 39  ? 12.262  5.751   87.379  1.00  32.36 ? 38  ASN D CG  1 
ATOM   5189 O  OD1 . ASN D 1 39  ? 11.778  4.698   86.955  1.00  32.76 ? 38  ASN D OD1 1 
ATOM   5190 N  ND2 . ASN D 1 39  ? 11.793  6.948   87.034  1.00  33.66 ? 38  ASN D ND2 1 
ATOM   5191 N  N   . ALA D 1 40  ? 15.390  4.434   90.690  1.00  32.14 ? 39  ALA D N   1 
ATOM   5192 C  CA  . ALA D 1 40  ? 16.720  4.101   91.196  1.00  32.34 ? 39  ALA D CA  1 
ATOM   5193 C  C   . ALA D 1 40  ? 16.877  2.579   91.348  1.00  32.88 ? 39  ALA D C   1 
ATOM   5194 O  O   . ALA D 1 40  ? 17.902  2.007   90.951  1.00  32.57 ? 39  ALA D O   1 
ATOM   5195 C  CB  . ALA D 1 40  ? 16.994  4.820   92.511  1.00  32.25 ? 39  ALA D CB  1 
ATOM   5196 N  N   . ASN D 1 41  ? 15.852  1.924   91.893  1.00  33.32 ? 40  ASN D N   1 
ATOM   5197 C  CA  . ASN D 1 41  ? 15.864  0.460   92.029  1.00  34.20 ? 40  ASN D CA  1 
ATOM   5198 C  C   . ASN D 1 41  ? 16.024  -0.268  90.691  1.00  34.55 ? 40  ASN D C   1 
ATOM   5199 O  O   . ASN D 1 41  ? 16.750  -1.263  90.606  1.00  34.71 ? 40  ASN D O   1 
ATOM   5200 C  CB  . ASN D 1 41  ? 14.629  -0.045  92.790  1.00  34.11 ? 40  ASN D CB  1 
ATOM   5201 C  CG  . ASN D 1 41  ? 14.645  0.332   94.272  1.00  34.52 ? 40  ASN D CG  1 
ATOM   5202 O  OD1 . ASN D 1 41  ? 15.705  0.538   94.879  1.00  35.61 ? 40  ASN D OD1 1 
ATOM   5203 N  ND2 . ASN D 1 41  ? 13.460  0.414   94.864  1.00  33.97 ? 40  ASN D ND2 1 
ATOM   5204 N  N   . LYS D 1 42  ? 15.359  0.240   89.654  1.00  35.15 ? 41  LYS D N   1 
ATOM   5205 C  CA  . LYS D 1 42  ? 15.488  -0.293  88.294  1.00  35.91 ? 41  LYS D CA  1 
ATOM   5206 C  C   . LYS D 1 42  ? 16.915  -0.171  87.746  1.00  36.05 ? 41  LYS D C   1 
ATOM   5207 O  O   . LYS D 1 42  ? 17.428  -1.098  87.109  1.00  35.64 ? 41  LYS D O   1 
ATOM   5208 C  CB  . LYS D 1 42  ? 14.485  0.390   87.352  1.00  36.23 ? 41  LYS D CB  1 
ATOM   5209 C  CG  . LYS D 1 42  ? 13.081  -0.195  87.439  1.00  37.92 ? 41  LYS D CG  1 
ATOM   5210 C  CD  . LYS D 1 42  ? 12.003  0.827   87.100  1.00  41.07 ? 41  LYS D CD  1 
ATOM   5211 C  CE  . LYS D 1 42  ? 10.615  0.273   87.408  1.00  42.02 ? 41  LYS D CE  1 
ATOM   5212 N  NZ  . LYS D 1 42  ? 9.540   1.285   87.178  1.00  44.36 ? 41  LYS D NZ  1 
ATOM   5213 N  N   . ALA D 1 43  ? 17.548  0.971   88.006  1.00  36.09 ? 42  ALA D N   1 
ATOM   5214 C  CA  . ALA D 1 43  ? 18.913  1.232   87.561  1.00  36.65 ? 42  ALA D CA  1 
ATOM   5215 C  C   . ALA D 1 43  ? 19.963  0.365   88.279  1.00  37.05 ? 42  ALA D C   1 
ATOM   5216 O  O   . ALA D 1 43  ? 21.078  0.155   87.678  1.00  36.84 ? 42  ALA D O   1 
ATOM   5217 C  CB  . ALA D 1 43  ? 19.244  2.719   87.715  1.00  36.33 ? 42  ALA D CB  1 
ATOM   5218 N  N   . LEU D 1 44  ? 19.608  -0.052  89.532  1.00  38.09 ? 43  LEU D N   1 
ATOM   5219 C  CA  . LEU D 1 44  ? 20.577  -0.789  90.366  1.00  38.88 ? 43  LEU D CA  1 
ATOM   5220 C  C   . LEU D 1 44  ? 20.517  -2.296  90.225  1.00  39.96 ? 43  LEU D C   1 
ATOM   5221 O  O   . LEU D 1 44  ? 21.532  -2.963  90.383  1.00  39.66 ? 43  LEU D O   1 
ATOM   5222 C  CB  . LEU D 1 44  ? 20.409  -0.443  91.841  1.00  39.69 ? 43  LEU D CB  1 
ATOM   5223 C  CG  . LEU D 1 44  ? 20.812  0.965   92.209  1.00  38.94 ? 43  LEU D CG  1 
ATOM   5224 C  CD1 . LEU D 1 44  ? 20.183  1.405   93.543  1.00  41.11 ? 43  LEU D CD1 1 
ATOM   5225 C  CD2 . LEU D 1 44  ? 22.332  1.137   92.253  1.00  40.49 ? 43  LEU D CD2 1 
ATOM   5226 N  N   . GLU D 1 45  ? 19.325  -2.834  89.942  1.00  40.28 ? 44  GLU D N   1 
ATOM   5227 C  CA  . GLU D 1 45  ? 19.143  -4.253  89.728  1.00  41.46 ? 44  GLU D CA  1 
ATOM   5228 C  C   . GLU D 1 45  ? 20.091  -4.754  88.608  1.00  41.37 ? 44  GLU D C   1 
ATOM   5229 O  O   . GLU D 1 45  ? 19.909  -4.135  87.432  1.00  41.72 ? 44  GLU D O   1 
ATOM   5230 C  CB  . GLU D 1 45  ? 17.684  -4.559  89.382  1.00  41.29 ? 44  GLU D CB  1 
ATOM   5231 C  CG  . GLU D 1 45  ? 17.179  -5.983  89.973  1.00  42.08 ? 44  GLU D CG  1 
ATOM   5232 C  CD  . GLU D 1 45  ? 15.656  -6.033  90.031  1.00  42.25 ? 44  GLU D CD  1 
ATOM   5233 O  OE1 . GLU D 1 45  ? 14.997  -5.070  89.544  1.00  43.93 ? 44  GLU D OE1 1 
ATOM   5234 O  OE2 . GLU D 1 45  ? 15.116  -7.029  90.571  1.00  43.17 ? 44  GLU D OE2 1 
ATOM   5235 N  N   . GLY D 1 46  ? 21.159  -5.608  89.007  1.00  41.78 ? 45  GLY D N   1 
ATOM   5236 C  CA  . GLY D 1 46  ? 22.245  -6.021  88.089  1.00  41.93 ? 45  GLY D CA  1 
ATOM   5237 C  C   . GLY D 1 46  ? 23.605  -5.424  88.501  1.00  42.01 ? 45  GLY D C   1 
ATOM   5238 O  O   . GLY D 1 46  ? 24.652  -6.119  88.421  1.00  42.23 ? 45  GLY D O   1 
ATOM   5239 N  N   . THR D 1 47  ? 23.588  -4.135  88.943  1.00  42.13 ? 46  THR D N   1 
ATOM   5240 C  CA  . THR D 1 47  ? 24.828  -3.456  89.393  1.00  42.01 ? 46  THR D CA  1 
ATOM   5241 C  C   . THR D 1 47  ? 25.243  -3.973  90.779  1.00  42.23 ? 46  THR D C   1 
ATOM   5242 O  O   . THR D 1 47  ? 24.415  -4.609  91.546  1.00  42.51 ? 46  THR D O   1 
ATOM   5243 C  CB  . THR D 1 47  ? 24.671  -1.911  89.441  1.00  42.11 ? 46  THR D CB  1 
ATOM   5244 O  OG1 . THR D 1 47  ? 23.934  -1.528  90.613  1.00  40.85 ? 46  THR D OG1 1 
ATOM   5245 C  CG2 . THR D 1 47  ? 23.962  -1.397  88.187  1.00  42.23 ? 46  THR D CG2 1 
ATOM   5246 N  N   . GLU D 1 48  ? 26.577  -3.780  91.085  1.00  42.16 ? 47  GLU D N   1 
ATOM   5247 C  CA  . GLU D 1 48  ? 27.100  -4.211  92.381  1.00  42.56 ? 47  GLU D CA  1 
ATOM   5248 C  C   . GLU D 1 48  ? 26.896  -3.157  93.470  1.00  42.22 ? 47  GLU D C   1 
ATOM   5249 O  O   . GLU D 1 48  ? 27.421  -3.281  94.580  1.00  42.26 ? 47  GLU D O   1 
ATOM   5250 C  CB  . GLU D 1 48  ? 28.578  -4.617  92.265  1.00  42.62 ? 47  GLU D CB  1 
ATOM   5251 C  CG  . GLU D 1 48  ? 29.538  -3.484  91.888  1.00  43.36 ? 47  GLU D CG  1 
ATOM   5252 C  CD  . GLU D 1 48  ? 30.994  -3.814  92.209  1.00  43.67 ? 47  GLU D CD  1 
ATOM   5253 O  OE1 . GLU D 1 48  ? 31.439  -4.948  91.903  1.00  45.09 ? 47  GLU D OE1 1 
ATOM   5254 O  OE2 . GLU D 1 48  ? 31.692  -2.935  92.771  1.00  45.33 ? 47  GLU D OE2 1 
ATOM   5255 N  N   . PHE D 1 49  ? 26.107  -2.135  93.147  1.00  41.75 ? 48  PHE D N   1 
ATOM   5256 C  CA  . PHE D 1 49  ? 25.932  -0.976  94.017  1.00  41.53 ? 48  PHE D CA  1 
ATOM   5257 C  C   . PHE D 1 49  ? 24.571  -0.968  94.713  1.00  41.61 ? 48  PHE D C   1 
ATOM   5258 O  O   . PHE D 1 49  ? 24.241  -0.021  95.433  1.00  41.33 ? 48  PHE D O   1 
ATOM   5259 C  CB  . PHE D 1 49  ? 26.118  0.313   93.209  1.00  41.18 ? 48  PHE D CB  1 
ATOM   5260 C  CG  . PHE D 1 49  ? 27.524  0.529   92.721  1.00  40.51 ? 48  PHE D CG  1 
ATOM   5261 C  CD1 . PHE D 1 49  ? 28.428  1.272   93.476  1.00  39.44 ? 48  PHE D CD1 1 
ATOM   5262 C  CD2 . PHE D 1 49  ? 27.944  -0.005  91.502  1.00  40.13 ? 48  PHE D CD2 1 
ATOM   5263 C  CE1 . PHE D 1 49  ? 29.726  1.481   93.028  1.00  39.52 ? 48  PHE D CE1 1 
ATOM   5264 C  CE2 . PHE D 1 49  ? 29.244  0.194   91.047  1.00  40.04 ? 48  PHE D CE2 1 
ATOM   5265 C  CZ  . PHE D 1 49  ? 30.137  0.942   91.814  1.00  40.33 ? 48  PHE D CZ  1 
ATOM   5266 N  N   . ALA D 1 50  ? 23.804  -2.041  94.517  1.00  41.69 ? 49  ALA D N   1 
ATOM   5267 C  CA  . ALA D 1 50  ? 22.422  -2.122  95.001  1.00  41.89 ? 49  ALA D CA  1 
ATOM   5268 C  C   . ALA D 1 50  ? 22.291  -2.199  96.527  1.00  41.95 ? 49  ALA D C   1 
ATOM   5269 O  O   . ALA D 1 50  ? 21.194  -2.046  97.067  1.00  42.43 ? 49  ALA D O   1 
ATOM   5270 C  CB  . ALA D 1 50  ? 21.708  -3.298  94.350  1.00  41.84 ? 49  ALA D CB  1 
ATOM   5271 N  N   . ASP D 1 51  ? 23.411  -2.413  97.210  1.00  41.68 ? 50  ASP D N   1 
ATOM   5272 C  CA  . ASP D 1 51  ? 23.430  -2.648  98.654  1.00  41.38 ? 50  ASP D CA  1 
ATOM   5273 C  C   . ASP D 1 51  ? 23.729  -1.408  99.505  1.00  40.93 ? 50  ASP D C   1 
ATOM   5274 O  O   . ASP D 1 51  ? 23.505  -1.414  100.719 1.00  41.13 ? 50  ASP D O   1 
ATOM   5275 C  CB  . ASP D 1 51  ? 24.413  -3.788  98.983  1.00  42.00 ? 50  ASP D CB  1 
ATOM   5276 C  CG  . ASP D 1 51  ? 25.558  -3.909  97.962  1.00  43.00 ? 50  ASP D CG  1 
ATOM   5277 O  OD1 . ASP D 1 51  ? 25.692  -3.038  97.064  1.00  44.39 ? 50  ASP D OD1 1 
ATOM   5278 O  OD2 . ASP D 1 51  ? 26.329  -4.887  98.059  1.00  43.73 ? 50  ASP D OD2 1 
ATOM   5279 N  N   . LEU D 1 52  ? 24.215  -0.345  98.865  1.00  39.76 ? 51  LEU D N   1 
ATOM   5280 C  CA  . LEU D 1 52  ? 24.692  0.846   99.569  1.00  38.99 ? 51  LEU D CA  1 
ATOM   5281 C  C   . LEU D 1 52  ? 23.566  1.762   100.038 1.00  38.14 ? 51  LEU D C   1 
ATOM   5282 O  O   . LEU D 1 52  ? 22.538  1.867   99.367  1.00  38.03 ? 51  LEU D O   1 
ATOM   5283 C  CB  . LEU D 1 52  ? 25.636  1.648   98.668  1.00  39.06 ? 51  LEU D CB  1 
ATOM   5284 C  CG  . LEU D 1 52  ? 26.907  0.975   98.150  1.00  39.60 ? 51  LEU D CG  1 
ATOM   5285 C  CD1 . LEU D 1 52  ? 27.591  1.891   97.146  1.00  40.41 ? 51  LEU D CD1 1 
ATOM   5286 C  CD2 . LEU D 1 52  ? 27.850  0.622   99.293  1.00  40.09 ? 51  LEU D CD2 1 
ATOM   5287 N  N   . PRO D 1 53  ? 23.756  2.434   101.194 1.00  37.40 ? 52  PRO D N   1 
ATOM   5288 C  CA  . PRO D 1 53  ? 22.853  3.524   101.544 1.00  36.86 ? 52  PRO D CA  1 
ATOM   5289 C  C   . PRO D 1 53  ? 22.909  4.583   100.446 1.00  36.21 ? 52  PRO D C   1 
ATOM   5290 O  O   . PRO D 1 53  ? 23.968  4.792   99.843  1.00  35.70 ? 52  PRO D O   1 
ATOM   5291 C  CB  . PRO D 1 53  ? 23.445  4.067   102.845 1.00  36.89 ? 52  PRO D CB  1 
ATOM   5292 C  CG  . PRO D 1 53  ? 24.224  2.923   103.415 1.00  37.07 ? 52  PRO D CG  1 
ATOM   5293 C  CD  . PRO D 1 53  ? 24.789  2.224   102.227 1.00  37.36 ? 52  PRO D CD  1 
ATOM   5294 N  N   . VAL D 1 54  ? 21.780  5.231   100.180 1.00  35.97 ? 53  VAL D N   1 
ATOM   5295 C  CA  . VAL D 1 54  ? 21.683  6.137   99.034  1.00  35.64 ? 53  VAL D CA  1 
ATOM   5296 C  C   . VAL D 1 54  ? 22.700  7.284   99.128  1.00  35.86 ? 53  VAL D C   1 
ATOM   5297 O  O   . VAL D 1 54  ? 23.279  7.690   98.119  1.00  35.83 ? 53  VAL D O   1 
ATOM   5298 C  CB  . VAL D 1 54  ? 20.214  6.615   98.771  1.00  35.62 ? 53  VAL D CB  1 
ATOM   5299 C  CG1 . VAL D 1 54  ? 19.709  7.555   99.868  1.00  35.14 ? 53  VAL D CG1 1 
ATOM   5300 C  CG2 . VAL D 1 54  ? 20.096  7.271   97.400  1.00  35.44 ? 53  VAL D CG2 1 
ATOM   5301 N  N   . GLU D 1 55  ? 22.946  7.767   100.345 1.00  36.34 ? 54  GLU D N   1 
ATOM   5302 C  CA  . GLU D 1 55  ? 23.892  8.866   100.578 1.00  36.75 ? 54  GLU D CA  1 
ATOM   5303 C  C   . GLU D 1 55  ? 25.330  8.485   100.207 1.00  36.47 ? 54  GLU D C   1 
ATOM   5304 O  O   . GLU D 1 55  ? 26.136  9.350   99.853  1.00  36.33 ? 54  GLU D O   1 
ATOM   5305 C  CB  . GLU D 1 55  ? 23.832  9.342   102.037 1.00  37.72 ? 54  GLU D CB  1 
ATOM   5306 C  CG  . GLU D 1 55  ? 22.470  9.907   102.485 1.00  39.79 ? 54  GLU D CG  1 
ATOM   5307 C  CD  . GLU D 1 55  ? 21.405  8.824   102.734 1.00  43.52 ? 54  GLU D CD  1 
ATOM   5308 O  OE1 . GLU D 1 55  ? 21.759  7.625   102.903 1.00  43.09 ? 54  GLU D OE1 1 
ATOM   5309 O  OE2 . GLU D 1 55  ? 20.200  9.183   102.744 1.00  45.30 ? 54  GLU D OE2 1 
ATOM   5310 N  N   . GLN D 1 56  ? 25.639  7.190   100.296 1.00  35.91 ? 55  GLN D N   1 
ATOM   5311 C  CA  . GLN D 1 56  ? 26.948  6.663   99.917  1.00  35.68 ? 55  GLN D CA  1 
ATOM   5312 C  C   . GLN D 1 56  ? 27.042  6.431   98.414  1.00  34.72 ? 55  GLN D C   1 
ATOM   5313 O  O   . GLN D 1 56  ? 28.084  6.697   97.811  1.00  34.71 ? 55  GLN D O   1 
ATOM   5314 C  CB  . GLN D 1 56  ? 27.251  5.365   100.676 1.00  35.84 ? 55  GLN D CB  1 
ATOM   5315 C  CG  . GLN D 1 56  ? 27.621  5.583   102.140 1.00  36.76 ? 55  GLN D CG  1 
ATOM   5316 C  CD  . GLN D 1 56  ? 27.894  4.287   102.894 1.00  37.38 ? 55  GLN D CD  1 
ATOM   5317 O  OE1 . GLN D 1 56  ? 28.362  3.291   102.324 1.00  39.84 ? 55  GLN D OE1 1 
ATOM   5318 N  NE2 . GLN D 1 56  ? 27.614  4.299   104.193 1.00  39.75 ? 55  GLN D NE2 1 
ATOM   5319 N  N   . LEU D 1 57  ? 25.959  5.928   97.819  1.00  33.66 ? 56  LEU D N   1 
ATOM   5320 C  CA  . LEU D 1 57  ? 25.884  5.732   96.371  1.00  32.98 ? 56  LEU D CA  1 
ATOM   5321 C  C   . LEU D 1 57  ? 26.147  7.022   95.587  1.00  32.51 ? 56  LEU D C   1 
ATOM   5322 O  O   . LEU D 1 57  ? 26.950  7.027   94.659  1.00  32.04 ? 56  LEU D O   1 
ATOM   5323 C  CB  . LEU D 1 57  ? 24.536  5.134   95.960  1.00  33.07 ? 56  LEU D CB  1 
ATOM   5324 C  CG  . LEU D 1 57  ? 24.388  4.904   94.446  1.00  33.61 ? 56  LEU D CG  1 
ATOM   5325 C  CD1 . LEU D 1 57  ? 25.108  3.653   94.002  1.00  33.54 ? 56  LEU D CD1 1 
ATOM   5326 C  CD2 . LEU D 1 57  ? 22.938  4.875   94.007  1.00  34.70 ? 56  LEU D CD2 1 
ATOM   5327 N  N   . ILE D 1 58  ? 25.484  8.116   95.967  1.00  32.48 ? 57  ILE D N   1 
ATOM   5328 C  CA  . ILE D 1 58  ? 25.637  9.380   95.234  1.00  32.41 ? 57  ILE D CA  1 
ATOM   5329 C  C   . ILE D 1 58  ? 27.044  9.986   95.357  1.00  32.91 ? 57  ILE D C   1 
ATOM   5330 O  O   . ILE D 1 58  ? 27.403  10.896  94.607  1.00  33.06 ? 57  ILE D O   1 
ATOM   5331 C  CB  . ILE D 1 58  ? 24.527  10.416  95.573  1.00  32.53 ? 57  ILE D CB  1 
ATOM   5332 C  CG1 . ILE D 1 58  ? 24.553  10.815  97.057  1.00  32.53 ? 57  ILE D CG1 1 
ATOM   5333 C  CG2 . ILE D 1 58  ? 23.160  9.889   95.123  1.00  32.03 ? 57  ILE D CG2 1 
ATOM   5334 C  CD1 . ILE D 1 58  ? 23.719  12.079  97.357  1.00  32.11 ? 57  ILE D CD1 1 
ATOM   5335 N  N   . GLN D 1 59  ? 27.835  9.462   96.291  1.00  33.19 ? 58  GLN D N   1 
ATOM   5336 C  CA  . GLN D 1 59  ? 29.246  9.809   96.407  1.00  33.69 ? 58  GLN D CA  1 
ATOM   5337 C  C   . GLN D 1 59  ? 30.147  8.911   95.538  1.00  33.88 ? 58  GLN D C   1 
ATOM   5338 O  O   . GLN D 1 59  ? 31.364  9.097   95.510  1.00  33.92 ? 58  GLN D O   1 
ATOM   5339 C  CB  . GLN D 1 59  ? 29.685  9.733   97.870  1.00  33.89 ? 58  GLN D CB  1 
ATOM   5340 C  CG  . GLN D 1 59  ? 29.036  10.783  98.756  1.00  34.38 ? 58  GLN D CG  1 
ATOM   5341 C  CD  . GLN D 1 59  ? 29.476  10.682  100.193 1.00  37.05 ? 58  GLN D CD  1 
ATOM   5342 O  OE1 . GLN D 1 59  ? 30.538  11.185  100.569 1.00  38.19 ? 58  GLN D OE1 1 
ATOM   5343 N  NE2 . GLN D 1 59  ? 28.659  10.032  101.015 1.00  37.68 ? 58  GLN D NE2 1 
ATOM   5344 N  N   . GLN D 1 60  ? 29.545  7.956   94.826  1.00  33.91 ? 59  GLN D N   1 
ATOM   5345 C  CA  . GLN D 1 60  ? 30.296  6.973   94.031  1.00  34.37 ? 59  GLN D CA  1 
ATOM   5346 C  C   . GLN D 1 60  ? 29.838  6.885   92.575  1.00  34.24 ? 59  GLN D C   1 
ATOM   5347 O  O   . GLN D 1 60  ? 30.024  5.853   91.920  1.00  34.19 ? 59  GLN D O   1 
ATOM   5348 C  CB  . GLN D 1 60  ? 30.206  5.588   94.677  1.00  34.37 ? 59  GLN D CB  1 
ATOM   5349 C  CG  . GLN D 1 60  ? 30.904  5.480   96.012  1.00  35.63 ? 59  GLN D CG  1 
ATOM   5350 C  CD  . GLN D 1 60  ? 30.713  4.125   96.658  1.00  37.68 ? 59  GLN D CD  1 
ATOM   5351 O  OE1 . GLN D 1 60  ? 30.761  3.088   95.990  1.00  37.89 ? 59  GLN D OE1 1 
ATOM   5352 N  NE2 . GLN D 1 60  ? 30.501  4.124   97.967  1.00  38.66 ? 59  GLN D NE2 1 
ATOM   5353 N  N   . LEU D 1 61  ? 29.258  7.971   92.066  1.00  34.32 ? 60  LEU D N   1 
ATOM   5354 C  CA  . LEU D 1 61  ? 28.672  7.971   90.724  1.00  34.38 ? 60  LEU D CA  1 
ATOM   5355 C  C   . LEU D 1 61  ? 29.728  7.818   89.631  1.00  34.91 ? 60  LEU D C   1 
ATOM   5356 O  O   . LEU D 1 61  ? 29.422  7.362   88.530  1.00  34.90 ? 60  LEU D O   1 
ATOM   5357 C  CB  . LEU D 1 61  ? 27.796  9.212   90.497  1.00  33.96 ? 60  LEU D CB  1 
ATOM   5358 C  CG  . LEU D 1 61  ? 26.508  9.320   91.327  1.00  33.28 ? 60  LEU D CG  1 
ATOM   5359 C  CD1 . LEU D 1 61  ? 25.881  10.713  91.173  1.00  33.29 ? 60  LEU D CD1 1 
ATOM   5360 C  CD2 . LEU D 1 61  ? 25.489  8.242   90.976  1.00  32.82 ? 60  LEU D CD2 1 
ATOM   5361 N  N   . ASP D 1 62  ? 30.975  8.169   89.947  1.00  35.48 ? 61  ASP D N   1 
ATOM   5362 C  CA  . ASP D 1 62  ? 32.079  7.958   89.011  1.00  36.29 ? 61  ASP D CA  1 
ATOM   5363 C  C   . ASP D 1 62  ? 32.458  6.476   88.862  1.00  36.11 ? 61  ASP D C   1 
ATOM   5364 O  O   . ASP D 1 62  ? 33.196  6.115   87.942  1.00  36.04 ? 61  ASP D O   1 
ATOM   5365 C  CB  . ASP D 1 62  ? 33.304  8.787   89.414  1.00  36.85 ? 61  ASP D CB  1 
ATOM   5366 C  CG  . ASP D 1 62  ? 33.877  8.374   90.756  1.00  38.80 ? 61  ASP D CG  1 
ATOM   5367 O  OD1 . ASP D 1 62  ? 33.112  8.335   91.749  1.00  41.75 ? 61  ASP D OD1 1 
ATOM   5368 O  OD2 . ASP D 1 62  ? 35.097  8.106   90.824  1.00  41.92 ? 61  ASP D OD2 1 
ATOM   5369 N  N   . ARG D 1 63  ? 31.942  5.629   89.754  1.00  36.02 ? 62  ARG D N   1 
ATOM   5370 C  CA  . ARG D 1 63  ? 32.253  4.196   89.743  1.00  36.19 ? 62  ARG D CA  1 
ATOM   5371 C  C   . ARG D 1 63  ? 31.166  3.289   89.153  1.00  35.87 ? 62  ARG D C   1 
ATOM   5372 O  O   . ARG D 1 63  ? 31.446  2.142   88.807  1.00  35.48 ? 62  ARG D O   1 
ATOM   5373 C  CB  . ARG D 1 63  ? 32.611  3.710   91.145  1.00  36.40 ? 62  ARG D CB  1 
ATOM   5374 C  CG  . ARG D 1 63  ? 33.761  4.455   91.778  1.00  37.76 ? 62  ARG D CG  1 
ATOM   5375 C  CD  . ARG D 1 63  ? 34.183  3.790   93.068  1.00  40.24 ? 62  ARG D CD  1 
ATOM   5376 N  NE  . ARG D 1 63  ? 34.573  4.788   94.062  1.00  42.04 ? 62  ARG D NE  1 
ATOM   5377 C  CZ  . ARG D 1 63  ? 34.855  4.520   95.334  1.00  43.22 ? 62  ARG D CZ  1 
ATOM   5378 N  NH1 . ARG D 1 63  ? 34.798  3.274   95.791  1.00  43.71 ? 62  ARG D NH1 1 
ATOM   5379 N  NH2 . ARG D 1 63  ? 35.195  5.505   96.155  1.00  43.75 ? 62  ARG D NH2 1 
ATOM   5380 N  N   . VAL D 1 64  ? 29.936  3.788   89.044  1.00  35.52 ? 63  VAL D N   1 
ATOM   5381 C  CA  . VAL D 1 64  ? 28.825  2.985   88.515  1.00  35.57 ? 63  VAL D CA  1 
ATOM   5382 C  C   . VAL D 1 64  ? 28.974  2.764   87.000  1.00  35.64 ? 63  VAL D C   1 
ATOM   5383 O  O   . VAL D 1 64  ? 29.711  3.504   86.345  1.00  35.53 ? 63  VAL D O   1 
ATOM   5384 C  CB  . VAL D 1 64  ? 27.438  3.605   88.863  1.00  35.64 ? 63  VAL D CB  1 
ATOM   5385 C  CG1 . VAL D 1 64  ? 27.303  3.821   90.368  1.00  35.74 ? 63  VAL D CG1 1 
ATOM   5386 C  CG2 . VAL D 1 64  ? 27.208  4.917   88.109  1.00  35.42 ? 63  VAL D CG2 1 
ATOM   5387 N  N   . PRO D 1 65  ? 28.305  1.728   86.439  1.00  35.81 ? 64  PRO D N   1 
ATOM   5388 C  CA  . PRO D 1 65  ? 28.310  1.551   84.979  1.00  35.92 ? 64  PRO D CA  1 
ATOM   5389 C  C   . PRO D 1 65  ? 27.952  2.843   84.253  1.00  36.14 ? 64  PRO D C   1 
ATOM   5390 O  O   . PRO D 1 65  ? 27.020  3.545   84.664  1.00  36.03 ? 64  PRO D O   1 
ATOM   5391 C  CB  . PRO D 1 65  ? 27.231  0.489   84.755  1.00  35.99 ? 64  PRO D CB  1 
ATOM   5392 C  CG  . PRO D 1 65  ? 27.273  -0.330  85.999  1.00  36.04 ? 64  PRO D CG  1 
ATOM   5393 C  CD  . PRO D 1 65  ? 27.555  0.650   87.114  1.00  35.87 ? 64  PRO D CD  1 
ATOM   5394 N  N   . ALA D 1 66  ? 28.693  3.155   83.191  1.00  36.21 ? 65  ALA D N   1 
ATOM   5395 C  CA  . ALA D 1 66  ? 28.609  4.474   82.552  1.00  36.45 ? 65  ALA D CA  1 
ATOM   5396 C  C   . ALA D 1 66  ? 27.206  4.792   82.040  1.00  36.60 ? 65  ALA D C   1 
ATOM   5397 O  O   . ALA D 1 66  ? 26.747  5.938   82.127  1.00  36.51 ? 65  ALA D O   1 
ATOM   5398 C  CB  . ALA D 1 66  ? 29.627  4.592   81.435  1.00  36.52 ? 65  ALA D CB  1 
ATOM   5399 N  N   . ASP D 1 67  ? 26.529  3.766   81.527  1.00  36.70 ? 66  ASP D N   1 
ATOM   5400 C  CA  . ASP D 1 67  ? 25.168  3.910   81.019  1.00  36.83 ? 66  ASP D CA  1 
ATOM   5401 C  C   . ASP D 1 67  ? 24.118  4.144   82.110  1.00  36.30 ? 66  ASP D C   1 
ATOM   5402 O  O   . ASP D 1 67  ? 23.005  4.566   81.810  1.00  36.48 ? 66  ASP D O   1 
ATOM   5403 C  CB  . ASP D 1 67  ? 24.785  2.693   80.173  1.00  37.17 ? 66  ASP D CB  1 
ATOM   5404 C  CG  . ASP D 1 67  ? 24.884  1.386   80.943  1.00  38.82 ? 66  ASP D CG  1 
ATOM   5405 O  OD1 . ASP D 1 67  ? 26.018  0.954   81.277  1.00  39.68 ? 66  ASP D OD1 1 
ATOM   5406 O  OD2 . ASP D 1 67  ? 23.821  0.775   81.191  1.00  41.33 ? 66  ASP D OD2 1 
ATOM   5407 N  N   . LYS D 1 68  ? 24.473  3.867   83.364  1.00  35.68 ? 67  LYS D N   1 
ATOM   5408 C  CA  . LYS D 1 68  ? 23.553  4.034   84.493  1.00  35.19 ? 67  LYS D CA  1 
ATOM   5409 C  C   . LYS D 1 68  ? 23.817  5.309   85.299  1.00  34.56 ? 67  LYS D C   1 
ATOM   5410 O  O   . LYS D 1 68  ? 23.038  5.650   86.193  1.00  34.55 ? 67  LYS D O   1 
ATOM   5411 C  CB  . LYS D 1 68  ? 23.614  2.819   85.430  1.00  35.20 ? 67  LYS D CB  1 
ATOM   5412 C  CG  . LYS D 1 68  ? 23.253  1.486   84.788  1.00  35.61 ? 67  LYS D CG  1 
ATOM   5413 C  CD  . LYS D 1 68  ? 21.753  1.342   84.550  1.00  36.17 ? 67  LYS D CD  1 
ATOM   5414 C  CE  . LYS D 1 68  ? 21.397  -0.059  84.036  1.00  36.45 ? 67  LYS D CE  1 
ATOM   5415 N  NZ  . LYS D 1 68  ? 21.619  -1.123  85.060  1.00  36.74 ? 67  LYS D NZ  1 
ATOM   5416 N  N   . LYS D 1 69  ? 24.915  5.998   84.989  1.00  34.03 ? 68  LYS D N   1 
ATOM   5417 C  CA  . LYS D 1 69  ? 25.335  7.182   85.748  1.00  33.81 ? 68  LYS D CA  1 
ATOM   5418 C  C   . LYS D 1 69  ? 24.266  8.281   85.739  1.00  33.22 ? 68  LYS D C   1 
ATOM   5419 O  O   . LYS D 1 69  ? 23.964  8.865   86.778  1.00  33.12 ? 68  LYS D O   1 
ATOM   5420 C  CB  . LYS D 1 69  ? 26.686  7.709   85.236  1.00  33.73 ? 68  LYS D CB  1 
ATOM   5421 C  CG  . LYS D 1 69  ? 27.214  8.937   85.986  1.00  34.47 ? 68  LYS D CG  1 
ATOM   5422 C  CD  . LYS D 1 69  ? 28.645  9.274   85.595  1.00  34.13 ? 68  LYS D CD  1 
ATOM   5423 C  CE  . LYS D 1 69  ? 29.083  10.584  86.232  1.00  35.80 ? 68  LYS D CE  1 
ATOM   5424 N  NZ  . LYS D 1 69  ? 30.563  10.751  86.214  1.00  36.79 ? 68  LYS D NZ  1 
ATOM   5425 N  N   . GLY D 1 70  ? 23.689  8.536   84.565  1.00  32.88 ? 69  GLY D N   1 
ATOM   5426 C  CA  . GLY D 1 70  ? 22.626  9.523   84.410  1.00  32.74 ? 69  GLY D CA  1 
ATOM   5427 C  C   . GLY D 1 70  ? 21.381  9.196   85.216  1.00  32.46 ? 69  GLY D C   1 
ATOM   5428 O  O   . GLY D 1 70  ? 20.887  10.036  85.967  1.00  32.31 ? 69  GLY D O   1 
ATOM   5429 N  N   . ALA D 1 71  ? 20.879  7.974   85.056  1.00  32.15 ? 70  ALA D N   1 
ATOM   5430 C  CA  . ALA D 1 71  ? 19.696  7.506   85.783  1.00  32.38 ? 70  ALA D CA  1 
ATOM   5431 C  C   . ALA D 1 71  ? 19.886  7.535   87.303  1.00  32.41 ? 70  ALA D C   1 
ATOM   5432 O  O   . ALA D 1 71  ? 18.974  7.917   88.037  1.00  32.68 ? 70  ALA D O   1 
ATOM   5433 C  CB  . ALA D 1 71  ? 19.300  6.107   85.323  1.00  32.51 ? 70  ALA D CB  1 
ATOM   5434 N  N   . LEU D 1 72  ? 21.070  7.148   87.769  1.00  32.24 ? 71  LEU D N   1 
ATOM   5435 C  CA  . LEU D 1 72  ? 21.348  7.135   89.209  1.00  32.22 ? 71  LEU D CA  1 
ATOM   5436 C  C   . LEU D 1 72  ? 21.521  8.532   89.785  1.00  32.09 ? 71  LEU D C   1 
ATOM   5437 O  O   . LEU D 1 72  ? 21.011  8.832   90.863  1.00  32.26 ? 71  LEU D O   1 
ATOM   5438 C  CB  . LEU D 1 72  ? 22.556  6.254   89.525  1.00  32.13 ? 71  LEU D CB  1 
ATOM   5439 C  CG  . LEU D 1 72  ? 22.296  4.747   89.397  1.00  32.75 ? 71  LEU D CG  1 
ATOM   5440 C  CD1 . LEU D 1 72  ? 23.586  3.972   89.584  1.00  32.55 ? 71  LEU D CD1 1 
ATOM   5441 C  CD2 . LEU D 1 72  ? 21.231  4.281   90.393  1.00  32.32 ? 71  LEU D CD2 1 
ATOM   5442 N  N   . ARG D 1 73  ? 22.245  9.386   89.066  1.00  31.82 ? 72  ARG D N   1 
ATOM   5443 C  CA  . ARG D 1 73  ? 22.396  10.786  89.455  1.00  31.54 ? 72  ARG D CA  1 
ATOM   5444 C  C   . ARG D 1 73  ? 21.020  11.426  89.678  1.00  31.23 ? 72  ARG D C   1 
ATOM   5445 O  O   . ARG D 1 73  ? 20.774  12.056  90.715  1.00  31.29 ? 72  ARG D O   1 
ATOM   5446 C  CB  . ARG D 1 73  ? 23.189  11.538  88.379  1.00  31.32 ? 72  ARG D CB  1 
ATOM   5447 C  CG  . ARG D 1 73  ? 23.220  13.059  88.512  1.00  32.15 ? 72  ARG D CG  1 
ATOM   5448 C  CD  . ARG D 1 73  ? 23.938  13.661  87.321  1.00  32.91 ? 72  ARG D CD  1 
ATOM   5449 N  NE  . ARG D 1 73  ? 24.112  15.112  87.431  1.00  33.53 ? 72  ARG D NE  1 
ATOM   5450 C  CZ  . ARG D 1 73  ? 24.781  15.844  86.543  1.00  33.52 ? 72  ARG D CZ  1 
ATOM   5451 N  NH1 . ARG D 1 73  ? 25.344  15.257  85.487  1.00  34.15 ? 72  ARG D NH1 1 
ATOM   5452 N  NH2 . ARG D 1 73  ? 24.888  17.155  86.702  1.00  32.18 ? 72  ARG D NH2 1 
ATOM   5453 N  N   . ASN D 1 74  ? 20.125  11.246  88.706  1.00  30.58 ? 73  ASN D N   1 
ATOM   5454 C  CA  . ASN D 1 74  ? 18.771  11.810  88.760  1.00  30.22 ? 73  ASN D CA  1 
ATOM   5455 C  C   . ASN D 1 74  ? 17.884  11.179  89.827  1.00  30.23 ? 73  ASN D C   1 
ATOM   5456 O  O   . ASN D 1 74  ? 17.240  11.881  90.610  1.00  29.77 ? 73  ASN D O   1 
ATOM   5457 C  CB  . ASN D 1 74  ? 18.085  11.672  87.400  1.00  30.00 ? 73  ASN D CB  1 
ATOM   5458 C  CG  . ASN D 1 74  ? 18.694  12.574  86.333  1.00  30.20 ? 73  ASN D CG  1 
ATOM   5459 O  OD1 . ASN D 1 74  ? 19.518  13.439  86.628  1.00  29.14 ? 73  ASN D OD1 1 
ATOM   5460 N  ND2 . ASN D 1 74  ? 18.268  12.381  85.081  1.00  27.63 ? 73  ASN D ND2 1 
ATOM   5461 N  N   . ASN D 1 75  ? 17.855  9.853   89.863  1.00  29.38 ? 74  ASN D N   1 
ATOM   5462 C  CA  . ASN D 1 75  ? 16.911  9.153   90.739  1.00  29.73 ? 74  ASN D CA  1 
ATOM   5463 C  C   . ASN D 1 75  ? 17.395  8.835   92.151  1.00  29.35 ? 74  ASN D C   1 
ATOM   5464 O  O   . ASN D 1 75  ? 16.643  9.006   93.109  1.00  29.20 ? 74  ASN D O   1 
ATOM   5465 C  CB  . ASN D 1 75  ? 16.349  7.916   90.038  1.00  29.47 ? 74  ASN D CB  1 
ATOM   5466 C  CG  . ASN D 1 75  ? 15.566  8.279   88.790  1.00  29.39 ? 74  ASN D CG  1 
ATOM   5467 O  OD1 . ASN D 1 75  ? 14.472  8.839   88.872  1.00  30.93 ? 74  ASN D OD1 1 
ATOM   5468 N  ND2 . ASN D 1 75  ? 16.129  7.978   87.632  1.00  29.00 ? 74  ASN D ND2 1 
ATOM   5469 N  N   . ALA D 1 76  ? 18.636  8.371   92.287  1.00  29.71 ? 75  ALA D N   1 
ATOM   5470 C  CA  . ALA D 1 76  ? 19.237  8.236   93.618  1.00  29.68 ? 75  ALA D CA  1 
ATOM   5471 C  C   . ALA D 1 76  ? 19.429  9.619   94.251  1.00  29.74 ? 75  ALA D C   1 
ATOM   5472 O  O   . ALA D 1 76  ? 19.234  9.802   95.459  1.00  29.90 ? 75  ALA D O   1 
ATOM   5473 C  CB  . ALA D 1 76  ? 20.556  7.469   93.548  1.00  29.41 ? 75  ALA D CB  1 
ATOM   5474 N  N   . GLY D 1 77  ? 19.799  10.597  93.427  1.00  29.57 ? 76  GLY D N   1 
ATOM   5475 C  CA  . GLY D 1 77  ? 19.828  11.989  93.854  1.00  28.60 ? 76  GLY D CA  1 
ATOM   5476 C  C   . GLY D 1 77  ? 18.475  12.405  94.405  1.00  28.67 ? 76  GLY D C   1 
ATOM   5477 O  O   . GLY D 1 77  ? 18.394  12.947  95.505  1.00  28.04 ? 76  GLY D O   1 
ATOM   5478 N  N   . GLY D 1 78  ? 17.406  12.123  93.653  1.00  28.46 ? 77  GLY D N   1 
ATOM   5479 C  CA  . GLY D 1 78  ? 16.052  12.506  94.071  1.00  28.56 ? 77  GLY D CA  1 
ATOM   5480 C  C   . GLY D 1 78  ? 15.644  11.826  95.373  1.00  28.62 ? 77  GLY D C   1 
ATOM   5481 O  O   . GLY D 1 78  ? 15.061  12.458  96.259  1.00  28.47 ? 77  GLY D O   1 
ATOM   5482 N  N   . HIS D 1 79  ? 15.961  10.538  95.485  1.00  28.50 ? 78  HIS D N   1 
ATOM   5483 C  CA  . HIS D 1 79  ? 15.706  9.790   96.719  1.00  28.45 ? 78  HIS D CA  1 
ATOM   5484 C  C   . HIS D 1 79  ? 16.456  10.399  97.907  1.00  28.35 ? 78  HIS D C   1 
ATOM   5485 O  O   . HIS D 1 79  ? 15.861  10.648  98.956  1.00  28.63 ? 78  HIS D O   1 
ATOM   5486 C  CB  . HIS D 1 79  ? 16.060  8.305   96.553  1.00  28.27 ? 78  HIS D CB  1 
ATOM   5487 C  CG  . HIS D 1 79  ? 15.777  7.472   97.768  1.00  28.75 ? 78  HIS D CG  1 
ATOM   5488 N  ND1 . HIS D 1 79  ? 14.697  7.696   98.592  1.00  29.53 ? 78  HIS D ND1 1 
ATOM   5489 C  CD2 . HIS D 1 79  ? 16.417  6.391   98.276  1.00  30.17 ? 78  HIS D CD2 1 
ATOM   5490 C  CE1 . HIS D 1 79  ? 14.688  6.800   99.563  1.00  29.77 ? 78  HIS D CE1 1 
ATOM   5491 N  NE2 . HIS D 1 79  ? 15.725  5.999   99.399  1.00  29.96 ? 78  HIS D NE2 1 
ATOM   5492 N  N   . ALA D 1 80  ? 17.756  10.627  97.745  1.00  28.64 ? 79  ALA D N   1 
ATOM   5493 C  CA  . ALA D 1 80  ? 18.564  11.234  98.811  1.00  29.17 ? 79  ALA D CA  1 
ATOM   5494 C  C   . ALA D 1 80  ? 18.032  12.609  99.208  1.00  29.33 ? 79  ALA D C   1 
ATOM   5495 O  O   . ALA D 1 80  ? 17.894  12.920  100.403 1.00  29.31 ? 79  ALA D O   1 
ATOM   5496 C  CB  . ALA D 1 80  ? 20.021  11.330  98.391  1.00  29.49 ? 79  ALA D CB  1 
ATOM   5497 N  N   . ASN D 1 81  ? 17.728  13.433  98.205  1.00  29.30 ? 80  ASN D N   1 
ATOM   5498 C  CA  . ASN D 1 81  ? 17.269  14.801  98.455  1.00  29.49 ? 80  ASN D CA  1 
ATOM   5499 C  C   . ASN D 1 81  ? 15.959  14.839  99.223  1.00  29.78 ? 80  ASN D C   1 
ATOM   5500 O  O   . ASN D 1 81  ? 15.852  15.522  100.243 1.00  29.52 ? 80  ASN D O   1 
ATOM   5501 C  CB  . ASN D 1 81  ? 17.133  15.576  97.145  1.00  29.43 ? 80  ASN D CB  1 
ATOM   5502 C  CG  . ASN D 1 81  ? 18.457  15.767  96.435  1.00  29.56 ? 80  ASN D CG  1 
ATOM   5503 O  OD1 . ASN D 1 81  ? 19.526  15.546  97.006  1.00  29.94 ? 80  ASN D OD1 1 
ATOM   5504 N  ND2 . ASN D 1 81  ? 18.392  16.175  95.172  1.00  29.43 ? 80  ASN D ND2 1 
ATOM   5505 N  N   . HIS D 1 82  ? 14.969  14.091  98.740  1.00  29.55 ? 81  HIS D N   1 
ATOM   5506 C  CA  . HIS D 1 82  ? 13.647  14.088  99.358  1.00  30.17 ? 81  HIS D CA  1 
ATOM   5507 C  C   . HIS D 1 82  ? 13.631  13.458  100.743 1.00  30.27 ? 81  HIS D C   1 
ATOM   5508 O  O   . HIS D 1 82  ? 12.952  13.950  101.638 1.00  29.98 ? 81  HIS D O   1 
ATOM   5509 C  CB  . HIS D 1 82  ? 12.616  13.447  98.433  1.00  30.33 ? 81  HIS D CB  1 
ATOM   5510 C  CG  . HIS D 1 82  ? 12.275  14.313  97.267  1.00  31.92 ? 81  HIS D CG  1 
ATOM   5511 N  ND1 . HIS D 1 82  ? 13.006  14.300  96.102  1.00  33.74 ? 81  HIS D ND1 1 
ATOM   5512 C  CD2 . HIS D 1 82  ? 11.329  15.271  97.109  1.00  33.90 ? 81  HIS D CD2 1 
ATOM   5513 C  CE1 . HIS D 1 82  ? 12.499  15.183  95.257  1.00  34.30 ? 81  HIS D CE1 1 
ATOM   5514 N  NE2 . HIS D 1 82  ? 11.482  15.785  95.844  1.00  33.84 ? 81  HIS D NE2 1 
ATOM   5515 N  N   . SER D 1 83  ? 14.398  12.392  100.925 1.00  30.28 ? 82  SER D N   1 
ATOM   5516 C  CA  . SER D 1 83  ? 14.476  11.746  102.228 1.00  30.97 ? 82  SER D CA  1 
ATOM   5517 C  C   . SER D 1 83  ? 14.963  12.736  103.290 1.00  31.49 ? 82  SER D C   1 
ATOM   5518 O  O   . SER D 1 83  ? 14.390  12.829  104.379 1.00  31.24 ? 82  SER D O   1 
ATOM   5519 C  CB  . SER D 1 83  ? 15.367  10.509  102.163 1.00  30.98 ? 82  SER D CB  1 
ATOM   5520 O  OG  . SER D 1 83  ? 14.759  9.495   101.371 1.00  31.08 ? 82  SER D OG  1 
ATOM   5521 N  N   . MET D 1 84  ? 15.999  13.501  102.953 1.00  31.87 ? 83  MET D N   1 
ATOM   5522 C  CA  . MET D 1 84  ? 16.485  14.545  103.851 1.00  33.53 ? 83  MET D CA  1 
ATOM   5523 C  C   . MET D 1 84  ? 15.429  15.651  104.023 1.00  32.03 ? 83  MET D C   1 
ATOM   5524 O  O   . MET D 1 84  ? 15.135  16.053  105.143 1.00  31.10 ? 83  MET D O   1 
ATOM   5525 C  CB  . MET D 1 84  ? 17.805  15.114  103.330 1.00  33.40 ? 83  MET D CB  1 
ATOM   5526 C  CG  . MET D 1 84  ? 18.510  16.064  104.294 1.00  35.22 ? 83  MET D CG  1 
ATOM   5527 S  SD  . MET D 1 84  ? 19.690  17.143  103.462 1.00  40.12 ? 83  MET D SD  1 
ATOM   5528 C  CE  . MET D 1 84  ? 20.646  15.979  102.468 1.00  41.57 ? 83  MET D CE  1 
ATOM   5529 N  N   . PHE D 1 85  ? 14.851  16.112  102.910 1.00  31.42 ? 84  PHE D N   1 
ATOM   5530 C  CA  . PHE D 1 85  ? 13.812  17.156  102.918 1.00  31.11 ? 84  PHE D CA  1 
ATOM   5531 C  C   . PHE D 1 85  ? 12.700  16.913  103.957 1.00  30.64 ? 84  PHE D C   1 
ATOM   5532 O  O   . PHE D 1 85  ? 12.389  17.802  104.746 1.00  30.40 ? 84  PHE D O   1 
ATOM   5533 C  CB  . PHE D 1 85  ? 13.223  17.335  101.503 1.00  30.91 ? 84  PHE D CB  1 
ATOM   5534 C  CG  . PHE D 1 85  ? 12.382  18.588  101.326 1.00  31.58 ? 84  PHE D CG  1 
ATOM   5535 C  CD1 . PHE D 1 85  ? 12.867  19.851  101.708 1.00  30.87 ? 84  PHE D CD1 1 
ATOM   5536 C  CD2 . PHE D 1 85  ? 11.111  18.505  100.749 1.00  31.66 ? 84  PHE D CD2 1 
ATOM   5537 C  CE1 . PHE D 1 85  ? 12.082  21.001  101.536 1.00  32.14 ? 84  PHE D CE1 1 
ATOM   5538 C  CE2 . PHE D 1 85  ? 10.330  19.653  100.560 1.00  31.70 ? 84  PHE D CE2 1 
ATOM   5539 C  CZ  . PHE D 1 85  ? 10.814  20.899  100.960 1.00  30.92 ? 84  PHE D CZ  1 
ATOM   5540 N  N   . TRP D 1 86  ? 12.128  15.709  103.977 1.00  30.40 ? 85  TRP D N   1 
ATOM   5541 C  CA  . TRP D 1 86  ? 11.033  15.407  104.901 1.00  30.29 ? 85  TRP D CA  1 
ATOM   5542 C  C   . TRP D 1 86  ? 11.441  15.551  106.369 1.00  30.37 ? 85  TRP D C   1 
ATOM   5543 O  O   . TRP D 1 86  ? 10.649  16.010  107.191 1.00  30.17 ? 85  TRP D O   1 
ATOM   5544 C  CB  . TRP D 1 86  ? 10.467  13.997  104.677 1.00  30.24 ? 85  TRP D CB  1 
ATOM   5545 C  CG  . TRP D 1 86  ? 10.125  13.632  103.254 1.00  31.09 ? 85  TRP D CG  1 
ATOM   5546 C  CD1 . TRP D 1 86  ? 10.432  12.457  102.623 1.00  31.26 ? 85  TRP D CD1 1 
ATOM   5547 C  CD2 . TRP D 1 86  ? 9.408   14.428  102.293 1.00  30.35 ? 85  TRP D CD2 1 
ATOM   5548 N  NE1 . TRP D 1 86  ? 9.959   12.476  101.336 1.00  31.05 ? 85  TRP D NE1 1 
ATOM   5549 C  CE2 . TRP D 1 86  ? 9.321   13.667  101.108 1.00  31.09 ? 85  TRP D CE2 1 
ATOM   5550 C  CE3 . TRP D 1 86  ? 8.824   15.705  102.322 1.00  31.83 ? 85  TRP D CE3 1 
ATOM   5551 C  CZ2 . TRP D 1 86  ? 8.685   14.140  99.953  1.00  30.39 ? 85  TRP D CZ2 1 
ATOM   5552 C  CZ3 . TRP D 1 86  ? 8.197   16.185  101.163 1.00  31.30 ? 85  TRP D CZ3 1 
ATOM   5553 C  CH2 . TRP D 1 86  ? 8.127   15.392  100.000 1.00  31.70 ? 85  TRP D CH2 1 
ATOM   5554 N  N   . GLN D 1 87  ? 12.675  15.160  106.678 1.00  30.38 ? 86  GLN D N   1 
ATOM   5555 C  CA  . GLN D 1 87  ? 13.165  15.123  108.050 1.00  31.44 ? 86  GLN D CA  1 
ATOM   5556 C  C   . GLN D 1 87  ? 13.584  16.481  108.603 1.00  31.08 ? 86  GLN D C   1 
ATOM   5557 O  O   . GLN D 1 87  ? 13.574  16.684  109.825 1.00  31.07 ? 86  GLN D O   1 
ATOM   5558 C  CB  . GLN D 1 87  ? 14.321  14.131  108.159 1.00  31.32 ? 86  GLN D CB  1 
ATOM   5559 C  CG  . GLN D 1 87  ? 13.880  12.678  107.993 1.00  32.39 ? 86  GLN D CG  1 
ATOM   5560 C  CD  . GLN D 1 87  ? 15.037  11.695  108.036 1.00  33.21 ? 86  GLN D CD  1 
ATOM   5561 O  OE1 . GLN D 1 87  ? 16.204  12.078  107.953 1.00  35.79 ? 86  GLN D OE1 1 
ATOM   5562 N  NE2 . GLN D 1 87  ? 14.715  10.415  108.154 1.00  35.61 ? 86  GLN D NE2 1 
ATOM   5563 N  N   . ILE D 1 88  ? 13.956  17.410  107.722 1.00  31.31 ? 87  ILE D N   1 
ATOM   5564 C  CA  . ILE D 1 88  ? 14.364  18.753  108.180 1.00  31.56 ? 87  ILE D CA  1 
ATOM   5565 C  C   . ILE D 1 88  ? 13.200  19.744  108.283 1.00  31.89 ? 87  ILE D C   1 
ATOM   5566 O  O   . ILE D 1 88  ? 13.399  20.916  108.625 1.00  31.63 ? 87  ILE D O   1 
ATOM   5567 C  CB  . ILE D 1 88  ? 15.588  19.342  107.402 1.00  31.79 ? 87  ILE D CB  1 
ATOM   5568 C  CG1 . ILE D 1 88  ? 15.367  19.380  105.879 1.00  31.51 ? 87  ILE D CG1 1 
ATOM   5569 C  CG2 . ILE D 1 88  ? 16.850  18.550  107.730 1.00  31.61 ? 87  ILE D CG2 1 
ATOM   5570 C  CD1 . ILE D 1 88  ? 14.414  20.447  105.381 1.00  30.46 ? 87  ILE D CD1 1 
ATOM   5571 N  N   . MET D 1 89  ? 11.993  19.268  107.992 1.00  32.16 ? 88  MET D N   1 
ATOM   5572 C  CA  . MET D 1 89  ? 10.776  20.023  108.275 1.00  32.65 ? 88  MET D CA  1 
ATOM   5573 C  C   . MET D 1 89  ? 10.020  19.400  109.445 1.00  32.76 ? 88  MET D C   1 
ATOM   5574 O  O   . MET D 1 89  ? 10.272  18.249  109.826 1.00  32.48 ? 88  MET D O   1 
ATOM   5575 C  CB  . MET D 1 89  ? 9.872   20.118  107.044 1.00  32.06 ? 88  MET D CB  1 
ATOM   5576 C  CG  . MET D 1 89  ? 10.507  20.788  105.842 1.00  33.03 ? 88  MET D CG  1 
ATOM   5577 S  SD  . MET D 1 89  ? 9.336   20.931  104.485 1.00  33.95 ? 88  MET D SD  1 
ATOM   5578 C  CE  . MET D 1 89  ? 9.114   19.220  103.993 1.00  32.81 ? 88  MET D CE  1 
ATOM   5579 N  N   . GLY D 1 90  ? 9.101   20.167  110.024 1.00  33.16 ? 89  GLY D N   1 
ATOM   5580 C  CA  . GLY D 1 90  ? 8.295   19.683  111.143 1.00  34.00 ? 89  GLY D CA  1 
ATOM   5581 C  C   . GLY D 1 90  ? 7.122   20.578  111.485 1.00  34.69 ? 89  GLY D C   1 
ATOM   5582 O  O   . GLY D 1 90  ? 7.088   21.743  111.094 1.00  34.89 ? 89  GLY D O   1 
ATOM   5583 N  N   . GLN D 1 91  ? 6.164   20.023  112.226 1.00  35.46 ? 90  GLN D N   1 
ATOM   5584 C  CA  . GLN D 1 91  ? 4.943   20.739  112.631 1.00  36.10 ? 90  GLN D CA  1 
ATOM   5585 C  C   . GLN D 1 91  ? 5.091   21.528  113.937 1.00  36.20 ? 90  GLN D C   1 
ATOM   5586 O  O   . GLN D 1 91  ? 5.839   21.130  114.830 1.00  35.82 ? 90  GLN D O   1 
ATOM   5587 C  CB  . GLN D 1 91  ? 3.772   19.757  112.755 1.00  36.07 ? 90  GLN D CB  1 
ATOM   5588 C  CG  . GLN D 1 91  ? 4.098   18.482  113.540 1.00  36.52 ? 90  GLN D CG  1 
ATOM   5589 C  CD  . GLN D 1 91  ? 2.911   17.541  113.650 1.00  37.04 ? 90  GLN D CD  1 
ATOM   5590 O  OE1 . GLN D 1 91  ? 1.759   17.958  113.499 1.00  38.12 ? 90  GLN D OE1 1 
ATOM   5591 N  NE2 . GLN D 1 91  ? 3.187   16.265  113.916 1.00  37.31 ? 90  GLN D NE2 1 
ATOM   5592 N  N   . GLY D 1 92  ? 4.365   22.644  114.033 1.00  36.56 ? 91  GLY D N   1 
ATOM   5593 C  CA  . GLY D 1 92  ? 4.363   23.499  115.231 1.00  37.31 ? 91  GLY D CA  1 
ATOM   5594 C  C   . GLY D 1 92  ? 5.743   23.897  115.733 1.00  37.88 ? 91  GLY D C   1 
ATOM   5595 O  O   . GLY D 1 92  ? 5.995   23.894  116.942 1.00  37.65 ? 91  GLY D O   1 
ATOM   5596 N  N   . GLN D 1 93  ? 6.633   24.252  114.803 1.00  38.40 ? 92  GLN D N   1 
ATOM   5597 C  CA  . GLN D 1 93  ? 8.035   24.532  115.127 1.00  38.93 ? 92  GLN D CA  1 
ATOM   5598 C  C   . GLN D 1 93  ? 8.252   25.912  115.737 1.00  39.71 ? 92  GLN D C   1 
ATOM   5599 O  O   . GLN D 1 93  ? 7.560   26.880  115.405 1.00  39.58 ? 92  GLN D O   1 
ATOM   5600 C  CB  . GLN D 1 93  ? 8.930   24.379  113.888 1.00  38.82 ? 92  GLN D CB  1 
ATOM   5601 C  CG  . GLN D 1 93  ? 9.056   22.953  113.347 1.00  38.20 ? 92  GLN D CG  1 
ATOM   5602 C  CD  . GLN D 1 93  ? 9.662   21.975  114.346 1.00  37.78 ? 92  GLN D CD  1 
ATOM   5603 O  OE1 . GLN D 1 93  ? 10.788  22.155  114.808 1.00  36.77 ? 92  GLN D OE1 1 
ATOM   5604 N  NE2 . GLN D 1 93  ? 8.915   20.922  114.673 1.00  37.30 ? 92  GLN D NE2 1 
ATOM   5605 N  N   . GLY D 1 94  ? 9.228   25.992  116.631 1.00  40.47 ? 93  GLY D N   1 
ATOM   5606 C  CA  . GLY D 1 94  ? 9.686   27.272  117.140 1.00  41.57 ? 93  GLY D CA  1 
ATOM   5607 C  C   . GLY D 1 94  ? 9.505   27.406  118.630 1.00  42.45 ? 93  GLY D C   1 
ATOM   5608 O  O   . GLY D 1 94  ? 9.076   26.469  119.311 1.00  42.45 ? 93  GLY D O   1 
ATOM   5609 N  N   . GLN D 1 95  ? 9.850   28.581  119.135 1.00  43.12 ? 94  GLN D N   1 
ATOM   5610 C  CA  . GLN D 1 95  ? 9.700   28.882  120.545 1.00  43.95 ? 94  GLN D CA  1 
ATOM   5611 C  C   . GLN D 1 95  ? 9.376   30.361  120.697 1.00  44.03 ? 94  GLN D C   1 
ATOM   5612 O  O   . GLN D 1 95  ? 9.997   31.215  120.054 1.00  44.10 ? 94  GLN D O   1 
ATOM   5613 C  CB  . GLN D 1 95  ? 10.970  28.517  121.304 1.00  44.10 ? 94  GLN D CB  1 
ATOM   5614 C  CG  . GLN D 1 95  ? 10.754  28.258  122.776 1.00  45.62 ? 94  GLN D CG  1 
ATOM   5615 C  CD  . GLN D 1 95  ? 12.040  27.881  123.476 1.00  47.80 ? 94  GLN D CD  1 
ATOM   5616 O  OE1 . GLN D 1 95  ? 13.041  28.593  123.383 1.00  49.59 ? 94  GLN D OE1 1 
ATOM   5617 N  NE2 . GLN D 1 95  ? 12.023  26.756  124.184 1.00  48.99 ? 94  GLN D NE2 1 
ATOM   5618 N  N   . ASN D 1 96  ? 8.395   30.640  121.551 1.00  44.12 ? 95  ASN D N   1 
ATOM   5619 C  CA  . ASN D 1 96  ? 7.820   31.976  121.746 1.00  44.37 ? 95  ASN D CA  1 
ATOM   5620 C  C   . ASN D 1 96  ? 8.008   33.014  120.625 1.00  43.87 ? 95  ASN D C   1 
ATOM   5621 O  O   . ASN D 1 96  ? 8.744   33.997  120.770 1.00  43.98 ? 95  ASN D O   1 
ATOM   5622 C  CB  . ASN D 1 96  ? 8.132   32.539  123.152 1.00  44.86 ? 95  ASN D CB  1 
ATOM   5623 C  CG  . ASN D 1 96  ? 9.618   32.818  123.387 1.00  46.47 ? 95  ASN D CG  1 
ATOM   5624 O  OD1 . ASN D 1 96  ? 10.001  33.951  123.706 1.00  47.26 ? 95  ASN D OD1 1 
ATOM   5625 N  ND2 . ASN D 1 96  ? 10.452  31.786  123.264 1.00  47.75 ? 95  ASN D ND2 1 
ATOM   5626 N  N   . GLY D 1 97  ? 7.333   32.764  119.505 1.00  43.13 ? 96  GLY D N   1 
ATOM   5627 C  CA  . GLY D 1 97  ? 7.217   33.734  118.425 1.00  42.51 ? 96  GLY D CA  1 
ATOM   5628 C  C   . GLY D 1 97  ? 8.242   33.617  117.313 1.00  41.96 ? 96  GLY D C   1 
ATOM   5629 O  O   . GLY D 1 97  ? 8.114   34.279  116.277 1.00  42.62 ? 96  GLY D O   1 
ATOM   5630 N  N   . ALA D 1 98  ? 9.259   32.780  117.514 1.00  40.91 ? 97  ALA D N   1 
ATOM   5631 C  CA  . ALA D 1 98  ? 10.338  32.661  116.536 1.00  39.47 ? 97  ALA D CA  1 
ATOM   5632 C  C   . ALA D 1 98  ? 10.839  31.233  116.394 1.00  38.33 ? 97  ALA D C   1 
ATOM   5633 O  O   . ALA D 1 98  ? 10.937  30.499  117.382 1.00  38.82 ? 97  ALA D O   1 
ATOM   5634 C  CB  . ALA D 1 98  ? 11.495  33.592  116.899 1.00  39.56 ? 97  ALA D CB  1 
ATOM   5635 N  N   . ASN D 1 99  ? 11.168  30.865  115.159 1.00  36.61 ? 98  ASN D N   1 
ATOM   5636 C  CA  . ASN D 1 99  ? 11.768  29.575  114.840 1.00  35.01 ? 98  ASN D CA  1 
ATOM   5637 C  C   . ASN D 1 99  ? 13.206  29.804  114.383 1.00  34.24 ? 98  ASN D C   1 
ATOM   5638 O  O   . ASN D 1 99  ? 13.451  30.422  113.348 1.00  33.66 ? 98  ASN D O   1 
ATOM   5639 C  CB  . ASN D 1 99  ? 10.951  28.862  113.752 1.00  34.92 ? 98  ASN D CB  1 
ATOM   5640 C  CG  . ASN D 1 99  ? 11.379  27.421  113.545 1.00  33.42 ? 98  ASN D CG  1 
ATOM   5641 O  OD1 . ASN D 1 99  ? 11.675  26.710  114.499 1.00  31.34 ? 98  ASN D OD1 1 
ATOM   5642 N  ND2 . ASN D 1 99  ? 11.413  26.985  112.291 1.00  30.56 ? 98  ASN D ND2 1 
ATOM   5643 N  N   . GLN D 1 100 ? 14.159  29.344  115.186 1.00  33.38 ? 99  GLN D N   1 
ATOM   5644 C  CA  . GLN D 1 100 ? 15.574  29.632  114.940 1.00  33.22 ? 99  GLN D CA  1 
ATOM   5645 C  C   . GLN D 1 100 ? 16.467  28.570  115.584 1.00  32.33 ? 99  GLN D C   1 
ATOM   5646 O  O   . GLN D 1 100 ? 16.066  27.935  116.561 1.00  31.82 ? 99  GLN D O   1 
ATOM   5647 C  CB  . GLN D 1 100 ? 15.947  31.033  115.471 1.00  32.89 ? 99  GLN D CB  1 
ATOM   5648 C  CG  . GLN D 1 100 ? 15.624  31.256  116.944 1.00  34.39 ? 99  GLN D CG  1 
ATOM   5649 C  CD  . GLN D 1 100 ? 15.666  32.723  117.351 1.00  34.76 ? 99  GLN D CD  1 
ATOM   5650 O  OE1 . GLN D 1 100 ? 16.147  33.582  116.607 1.00  38.02 ? 99  GLN D OE1 1 
ATOM   5651 N  NE2 . GLN D 1 100 ? 15.156  33.013  118.539 1.00  39.15 ? 99  GLN D NE2 1 
ATOM   5652 N  N   . PRO D 1 101 ? 17.678  28.368  115.033 1.00  31.93 ? 100 PRO D N   1 
ATOM   5653 C  CA  . PRO D 1 101 ? 18.605  27.434  115.669 1.00  31.67 ? 100 PRO D CA  1 
ATOM   5654 C  C   . PRO D 1 101 ? 19.201  28.008  116.959 1.00  31.41 ? 100 PRO D C   1 
ATOM   5655 O  O   . PRO D 1 101 ? 19.088  29.207  117.229 1.00  31.21 ? 100 PRO D O   1 
ATOM   5656 C  CB  . PRO D 1 101 ? 19.697  27.256  114.610 1.00  31.52 ? 100 PRO D CB  1 
ATOM   5657 C  CG  . PRO D 1 101 ? 19.697  28.560  113.875 1.00  32.53 ? 100 PRO D CG  1 
ATOM   5658 C  CD  . PRO D 1 101 ? 18.248  28.956  113.806 1.00  31.69 ? 100 PRO D CD  1 
ATOM   5659 N  N   . SER D 1 102 ? 19.826  27.148  117.750 1.00  31.30 ? 101 SER D N   1 
ATOM   5660 C  CA  . SER D 1 102 ? 20.513  27.590  118.953 1.00  31.09 ? 101 SER D CA  1 
ATOM   5661 C  C   . SER D 1 102 ? 21.822  26.819  119.112 1.00  30.44 ? 101 SER D C   1 
ATOM   5662 O  O   . SER D 1 102 ? 22.148  25.976  118.276 1.00  30.46 ? 101 SER D O   1 
ATOM   5663 C  CB  . SER D 1 102 ? 19.610  27.415  120.176 1.00  31.78 ? 101 SER D CB  1 
ATOM   5664 O  OG  . SER D 1 102 ? 19.267  26.056  120.365 1.00  34.05 ? 101 SER D OG  1 
ATOM   5665 N  N   . GLY D 1 103 ? 22.567  27.112  120.178 1.00  29.41 ? 102 GLY D N   1 
ATOM   5666 C  CA  . GLY D 1 103 ? 23.792  26.375  120.478 1.00  28.34 ? 102 GLY D CA  1 
ATOM   5667 C  C   . GLY D 1 103 ? 24.836  26.427  119.378 1.00  27.67 ? 102 GLY D C   1 
ATOM   5668 O  O   . GLY D 1 103 ? 25.033  27.469  118.744 1.00  26.83 ? 102 GLY D O   1 
ATOM   5669 N  N   . GLU D 1 104 ? 25.491  25.293  119.139 1.00  27.28 ? 103 GLU D N   1 
ATOM   5670 C  CA  . GLU D 1 104 ? 26.653  25.245  118.251 1.00  27.95 ? 103 GLU D CA  1 
ATOM   5671 C  C   . GLU D 1 104 ? 26.343  25.631  116.808 1.00  27.09 ? 103 GLU D C   1 
ATOM   5672 O  O   . GLU D 1 104 ? 27.170  26.255  116.146 1.00  27.28 ? 103 GLU D O   1 
ATOM   5673 C  CB  . GLU D 1 104 ? 27.392  23.892  118.338 1.00  27.73 ? 103 GLU D CB  1 
ATOM   5674 C  CG  . GLU D 1 104 ? 26.716  22.704  117.703 1.00  29.90 ? 103 GLU D CG  1 
ATOM   5675 C  CD  . GLU D 1 104 ? 27.557  21.428  117.805 1.00  30.76 ? 103 GLU D CD  1 
ATOM   5676 O  OE1 . GLU D 1 104 ? 27.010  20.332  117.559 1.00  35.42 ? 103 GLU D OE1 1 
ATOM   5677 O  OE2 . GLU D 1 104 ? 28.757  21.515  118.156 1.00  34.91 ? 103 GLU D OE2 1 
ATOM   5678 N  N   . LEU D 1 105 ? 25.159  25.257  116.329 1.00  26.63 ? 104 LEU D N   1 
ATOM   5679 C  CA  . LEU D 1 105 ? 24.765  25.587  114.962 1.00  26.58 ? 104 LEU D CA  1 
ATOM   5680 C  C   . LEU D 1 105 ? 24.542  27.085  114.798 1.00  26.23 ? 104 LEU D C   1 
ATOM   5681 O  O   . LEU D 1 105 ? 24.944  27.675  113.788 1.00  25.64 ? 104 LEU D O   1 
ATOM   5682 C  CB  . LEU D 1 105 ? 23.519  24.808  114.535 1.00  26.39 ? 104 LEU D CB  1 
ATOM   5683 C  CG  . LEU D 1 105 ? 22.913  25.201  113.179 1.00  26.95 ? 104 LEU D CG  1 
ATOM   5684 C  CD1 . LEU D 1 105 ? 23.877  24.986  112.017 1.00  27.72 ? 104 LEU D CD1 1 
ATOM   5685 C  CD2 . LEU D 1 105 ? 21.625  24.442  112.946 1.00  27.36 ? 104 LEU D CD2 1 
ATOM   5686 N  N   . LEU D 1 106 ? 23.885  27.695  115.781 1.00  26.69 ? 105 LEU D N   1 
ATOM   5687 C  CA  . LEU D 1 106 ? 23.683  29.143  115.766 1.00  26.88 ? 105 LEU D CA  1 
ATOM   5688 C  C   . LEU D 1 106 ? 25.024  29.876  115.776 1.00  27.15 ? 105 LEU D C   1 
ATOM   5689 O  O   . LEU D 1 106 ? 25.216  30.835  115.033 1.00  26.62 ? 105 LEU D O   1 
ATOM   5690 C  CB  . LEU D 1 106 ? 22.826  29.606  116.946 1.00  27.05 ? 105 LEU D CB  1 
ATOM   5691 C  CG  . LEU D 1 106 ? 22.570  31.122  117.033 1.00  26.93 ? 105 LEU D CG  1 
ATOM   5692 C  CD1 . LEU D 1 106 ? 21.909  31.662  115.760 1.00  28.29 ? 105 LEU D CD1 1 
ATOM   5693 C  CD2 . LEU D 1 106 ? 21.726  31.442  118.238 1.00  27.31 ? 105 LEU D CD2 1 
ATOM   5694 N  N   . ASP D 1 107 ? 25.941  29.411  116.622 1.00  27.53 ? 106 ASP D N   1 
ATOM   5695 C  CA  . ASP D 1 107 ? 27.283  29.985  116.699 1.00  28.17 ? 106 ASP D CA  1 
ATOM   5696 C  C   . ASP D 1 107 ? 28.013  29.891  115.349 1.00  27.99 ? 106 ASP D C   1 
ATOM   5697 O  O   . ASP D 1 107 ? 28.676  30.850  114.930 1.00  28.23 ? 106 ASP D O   1 
ATOM   5698 C  CB  . ASP D 1 107 ? 28.080  29.340  117.848 1.00  28.33 ? 106 ASP D CB  1 
ATOM   5699 C  CG  . ASP D 1 107 ? 27.483  29.659  119.231 1.00  30.46 ? 106 ASP D CG  1 
ATOM   5700 O  OD1 . ASP D 1 107 ? 26.654  30.597  119.297 1.00  31.73 ? 106 ASP D OD1 1 
ATOM   5701 O  OD2 . ASP D 1 107 ? 27.843  28.992  120.247 1.00  32.15 ? 106 ASP D OD2 1 
ATOM   5702 N  N   . ALA D 1 108 ? 27.853  28.759  114.668 1.00  28.03 ? 107 ALA D N   1 
ATOM   5703 C  CA  . ALA D 1 108 ? 28.442  28.528  113.342 1.00  28.00 ? 107 ALA D CA  1 
ATOM   5704 C  C   . ALA D 1 108 ? 27.815  29.429  112.279 1.00  28.13 ? 107 ALA D C   1 
ATOM   5705 O  O   . ALA D 1 108 ? 28.520  30.002  111.441 1.00  28.60 ? 107 ALA D O   1 
ATOM   5706 C  CB  . ALA D 1 108 ? 28.297  27.066  112.949 1.00  27.57 ? 107 ALA D CB  1 
ATOM   5707 N  N   . ILE D 1 109 ? 26.494  29.571  112.331 1.00  28.00 ? 108 ILE D N   1 
ATOM   5708 C  CA  . ILE D 1 109 ? 25.768  30.474  111.423 1.00  28.23 ? 108 ILE D CA  1 
ATOM   5709 C  C   . ILE D 1 109 ? 26.216  31.929  111.618 1.00  28.37 ? 108 ILE D C   1 
ATOM   5710 O  O   . ILE D 1 109 ? 26.493  32.639  110.646 1.00  28.73 ? 108 ILE D O   1 
ATOM   5711 C  CB  . ILE D 1 109 ? 24.235  30.318  111.580 1.00  27.99 ? 108 ILE D CB  1 
ATOM   5712 C  CG1 . ILE D 1 109 ? 23.765  29.060  110.851 1.00  28.19 ? 108 ILE D CG1 1 
ATOM   5713 C  CG2 . ILE D 1 109 ? 23.473  31.551  111.036 1.00  28.07 ? 108 ILE D CG2 1 
ATOM   5714 C  CD1 . ILE D 1 109 ? 22.413  28.535  111.305 1.00  29.76 ? 108 ILE D CD1 1 
ATOM   5715 N  N   . ASN D 1 110 ? 26.292  32.362  112.872 1.00  28.68 ? 109 ASN D N   1 
ATOM   5716 C  CA  . ASN D 1 110 ? 26.793  33.696  113.196 1.00  29.15 ? 109 ASN D CA  1 
ATOM   5717 C  C   . ASN D 1 110 ? 28.210  33.925  112.682 1.00  29.42 ? 109 ASN D C   1 
ATOM   5718 O  O   . ASN D 1 110 ? 28.511  34.985  112.150 1.00  29.14 ? 109 ASN D O   1 
ATOM   5719 C  CB  . ASN D 1 110 ? 26.748  33.940  114.708 1.00  29.26 ? 109 ASN D CB  1 
ATOM   5720 C  CG  . ASN D 1 110 ? 25.338  34.165  115.226 1.00  29.70 ? 109 ASN D CG  1 
ATOM   5721 O  OD1 . ASN D 1 110 ? 24.405  34.441  114.462 1.00  30.29 ? 109 ASN D OD1 1 
ATOM   5722 N  ND2 . ASN D 1 110 ? 25.179  34.062  116.539 1.00  29.75 ? 109 ASN D ND2 1 
ATOM   5723 N  N   . SER D 1 111 ? 29.070  32.923  112.848 1.00  29.66 ? 110 SER D N   1 
ATOM   5724 C  CA  . SER D 1 111 ? 30.446  32.980  112.364 1.00  30.73 ? 110 SER D CA  1 
ATOM   5725 C  C   . SER D 1 111 ? 30.536  33.076  110.841 1.00  30.62 ? 110 SER D C   1 
ATOM   5726 O  O   . SER D 1 111 ? 31.276  33.905  110.315 1.00  31.15 ? 110 SER D O   1 
ATOM   5727 C  CB  . SER D 1 111 ? 31.223  31.751  112.845 1.00  31.12 ? 110 SER D CB  1 
ATOM   5728 O  OG  . SER D 1 111 ? 32.562  31.781  112.383 1.00  33.04 ? 110 SER D OG  1 
ATOM   5729 N  N   . ALA D 1 112 ? 29.777  32.237  110.145 1.00  30.75 ? 111 ALA D N   1 
ATOM   5730 C  CA  . ALA D 1 112 ? 29.841  32.165  108.685 1.00  30.81 ? 111 ALA D CA  1 
ATOM   5731 C  C   . ALA D 1 112 ? 29.078  33.279  107.966 1.00  30.91 ? 111 ALA D C   1 
ATOM   5732 O  O   . ALA D 1 112 ? 29.490  33.710  106.889 1.00  31.36 ? 111 ALA D O   1 
ATOM   5733 C  CB  . ALA D 1 112 ? 29.355  30.810  108.202 1.00  30.75 ? 111 ALA D CB  1 
ATOM   5734 N  N   . PHE D 1 113 ? 27.960  33.722  108.539 1.00  30.61 ? 112 PHE D N   1 
ATOM   5735 C  CA  . PHE D 1 113 ? 27.042  34.617  107.832 1.00  30.40 ? 112 PHE D CA  1 
ATOM   5736 C  C   . PHE D 1 113 ? 26.814  35.956  108.538 1.00  30.55 ? 112 PHE D C   1 
ATOM   5737 O  O   . PHE D 1 113 ? 26.202  36.861  107.965 1.00  29.97 ? 112 PHE D O   1 
ATOM   5738 C  CB  . PHE D 1 113 ? 25.704  33.907  107.549 1.00  30.43 ? 112 PHE D CB  1 
ATOM   5739 C  CG  . PHE D 1 113 ? 25.855  32.585  106.835 1.00  31.16 ? 112 PHE D CG  1 
ATOM   5740 C  CD1 . PHE D 1 113 ? 26.211  32.538  105.483 1.00  32.25 ? 112 PHE D CD1 1 
ATOM   5741 C  CD2 . PHE D 1 113 ? 25.636  31.384  107.513 1.00  30.42 ? 112 PHE D CD2 1 
ATOM   5742 C  CE1 . PHE D 1 113 ? 26.358  31.308  104.820 1.00  32.29 ? 112 PHE D CE1 1 
ATOM   5743 C  CE2 . PHE D 1 113 ? 25.779  30.161  106.869 1.00  29.95 ? 112 PHE D CE2 1 
ATOM   5744 C  CZ  . PHE D 1 113 ? 26.141  30.124  105.512 1.00  30.74 ? 112 PHE D CZ  1 
ATOM   5745 N  N   . GLY D 1 114 ? 27.312  36.090  109.764 1.00  29.84 ? 113 GLY D N   1 
ATOM   5746 C  CA  . GLY D 1 114 ? 27.121  37.330  110.521 1.00  30.63 ? 113 GLY D CA  1 
ATOM   5747 C  C   . GLY D 1 114 ? 25.965  37.251  111.497 1.00  30.81 ? 113 GLY D C   1 
ATOM   5748 O  O   . GLY D 1 114 ? 26.074  37.707  112.638 1.00  30.92 ? 113 GLY D O   1 
ATOM   5749 N  N   . SER D 1 115 ? 24.859  36.656  111.052 1.00  30.43 ? 114 SER D N   1 
ATOM   5750 C  CA  . SER D 1 115 ? 23.646  36.534  111.865 1.00  29.92 ? 114 SER D CA  1 
ATOM   5751 C  C   . SER D 1 115 ? 22.691  35.545  111.212 1.00  29.69 ? 114 SER D C   1 
ATOM   5752 O  O   . SER D 1 115 ? 22.848  35.210  110.024 1.00  28.71 ? 114 SER D O   1 
ATOM   5753 C  CB  . SER D 1 115 ? 22.957  37.900  112.028 1.00  29.93 ? 114 SER D CB  1 
ATOM   5754 O  OG  . SER D 1 115 ? 22.423  38.354  110.791 1.00  29.39 ? 114 SER D OG  1 
ATOM   5755 N  N   . PHE D 1 116 ? 21.701  35.090  111.980 1.00  29.67 ? 115 PHE D N   1 
ATOM   5756 C  CA  . PHE D 1 116 ? 20.652  34.203  111.450 1.00  29.96 ? 115 PHE D CA  1 
ATOM   5757 C  C   . PHE D 1 116 ? 19.815  34.886  110.352 1.00  29.95 ? 115 PHE D C   1 
ATOM   5758 O  O   . PHE D 1 116 ? 19.484  34.267  109.337 1.00  29.62 ? 115 PHE D O   1 
ATOM   5759 C  CB  . PHE D 1 116 ? 19.747  33.686  112.579 1.00  30.02 ? 115 PHE D CB  1 
ATOM   5760 C  CG  . PHE D 1 116 ? 18.659  32.754  112.109 1.00  31.10 ? 115 PHE D CG  1 
ATOM   5761 C  CD1 . PHE D 1 116 ? 18.971  31.605  111.375 1.00  32.55 ? 115 PHE D CD1 1 
ATOM   5762 C  CD2 . PHE D 1 116 ? 17.324  33.012  112.406 1.00  32.22 ? 115 PHE D CD2 1 
ATOM   5763 C  CE1 . PHE D 1 116 ? 17.958  30.736  110.926 1.00  32.14 ? 115 PHE D CE1 1 
ATOM   5764 C  CE2 . PHE D 1 116 ? 16.306  32.138  111.965 1.00  31.35 ? 115 PHE D CE2 1 
ATOM   5765 C  CZ  . PHE D 1 116 ? 16.627  31.019  111.223 1.00  30.99 ? 115 PHE D CZ  1 
ATOM   5766 N  N   . ASP D 1 117 ? 19.487  36.159  110.549 1.00  30.87 ? 116 ASP D N   1 
ATOM   5767 C  CA  . ASP D 1 117 ? 18.776  36.913  109.507 1.00  31.49 ? 116 ASP D CA  1 
ATOM   5768 C  C   . ASP D 1 117 ? 19.567  37.009  108.197 1.00  31.09 ? 116 ASP D C   1 
ATOM   5769 O  O   . ASP D 1 117 ? 18.987  36.872  107.115 1.00  30.76 ? 116 ASP D O   1 
ATOM   5770 C  CB  . ASP D 1 117 ? 18.376  38.309  110.006 1.00  32.69 ? 116 ASP D CB  1 
ATOM   5771 C  CG  . ASP D 1 117 ? 17.284  38.263  111.071 1.00  35.23 ? 116 ASP D CG  1 
ATOM   5772 O  OD1 . ASP D 1 117 ? 16.578  37.232  111.172 1.00  39.38 ? 116 ASP D OD1 1 
ATOM   5773 O  OD2 . ASP D 1 117 ? 17.127  39.265  111.805 1.00  39.40 ? 116 ASP D OD2 1 
ATOM   5774 N  N   . ALA D 1 118 ? 20.876  37.256  108.291 1.00  30.35 ? 117 ALA D N   1 
ATOM   5775 C  CA  . ALA D 1 118 ? 21.728  37.356  107.095 1.00  29.66 ? 117 ALA D CA  1 
ATOM   5776 C  C   . ALA D 1 118 ? 21.877  36.004  106.390 1.00  29.29 ? 117 ALA D C   1 
ATOM   5777 O  O   . ALA D 1 118 ? 21.904  35.927  105.155 1.00  28.79 ? 117 ALA D O   1 
ATOM   5778 C  CB  . ALA D 1 118 ? 23.097  37.939  107.450 1.00  30.47 ? 117 ALA D CB  1 
ATOM   5779 N  N   . PHE D 1 119 ? 21.965  34.935  107.178 1.00  28.60 ? 118 PHE D N   1 
ATOM   5780 C  CA  . PHE D 1 119 ? 21.957  33.600  106.613 1.00  28.47 ? 118 PHE D CA  1 
ATOM   5781 C  C   . PHE D 1 119 ? 20.670  33.368  105.828 1.00  28.57 ? 118 PHE D C   1 
ATOM   5782 O  O   . PHE D 1 119 ? 20.717  32.811  104.730 1.00  28.52 ? 118 PHE D O   1 
ATOM   5783 C  CB  . PHE D 1 119 ? 22.093  32.516  107.688 1.00  28.72 ? 118 PHE D CB  1 
ATOM   5784 C  CG  . PHE D 1 119 ? 21.507  31.197  107.267 1.00  28.46 ? 118 PHE D CG  1 
ATOM   5785 C  CD1 . PHE D 1 119 ? 22.156  30.403  106.321 1.00  28.87 ? 118 PHE D CD1 1 
ATOM   5786 C  CD2 . PHE D 1 119 ? 20.279  30.772  107.774 1.00  29.01 ? 118 PHE D CD2 1 
ATOM   5787 C  CE1 . PHE D 1 119 ? 21.607  29.189  105.894 1.00  28.97 ? 118 PHE D CE1 1 
ATOM   5788 C  CE2 . PHE D 1 119 ? 19.718  29.562  107.358 1.00  29.14 ? 118 PHE D CE2 1 
ATOM   5789 C  CZ  . PHE D 1 119 ? 20.383  28.760  106.411 1.00  29.10 ? 118 PHE D CZ  1 
ATOM   5790 N  N   . LYS D 1 120 ? 19.528  33.758  106.396 1.00  28.42 ? 119 LYS D N   1 
ATOM   5791 C  CA  . LYS D 1 120 ? 18.239  33.518  105.718 1.00  29.49 ? 119 LYS D CA  1 
ATOM   5792 C  C   . LYS D 1 120 ? 18.173  34.223  104.375 1.00  29.30 ? 119 LYS D C   1 
ATOM   5793 O  O   . LYS D 1 120 ? 17.709  33.639  103.394 1.00  28.42 ? 119 LYS D O   1 
ATOM   5794 C  CB  . LYS D 1 120 ? 17.037  33.897  106.591 1.00  29.56 ? 119 LYS D CB  1 
ATOM   5795 C  CG  . LYS D 1 120 ? 16.759  32.893  107.712 1.00  29.86 ? 119 LYS D CG  1 
ATOM   5796 C  CD  . LYS D 1 120 ? 15.367  33.077  108.339 1.00  31.03 ? 119 LYS D CD  1 
ATOM   5797 C  CE  . LYS D 1 120 ? 15.287  34.303  109.250 1.00  32.30 ? 119 LYS D CE  1 
ATOM   5798 N  NZ  . LYS D 1 120 ? 13.981  34.350  109.976 1.00  32.29 ? 119 LYS D NZ  1 
ATOM   5799 N  N   . GLN D 1 121 ? 18.653  35.466  104.326 1.00  29.90 ? 120 GLN D N   1 
ATOM   5800 C  CA  . GLN D 1 121 ? 18.731  36.202  103.057 1.00  30.58 ? 120 GLN D CA  1 
ATOM   5801 C  C   . GLN D 1 121 ? 19.637  35.498  102.042 1.00  30.96 ? 120 GLN D C   1 
ATOM   5802 O  O   . GLN D 1 121 ? 19.267  35.352  100.876 1.00  30.56 ? 120 GLN D O   1 
ATOM   5803 C  CB  . GLN D 1 121 ? 19.201  37.641  103.284 1.00  31.57 ? 120 GLN D CB  1 
ATOM   5804 C  CG  . GLN D 1 121 ? 19.353  38.435  101.996 1.00  33.04 ? 120 GLN D CG  1 
ATOM   5805 C  CD  . GLN D 1 121 ? 19.520  39.920  102.235 1.00  36.41 ? 120 GLN D CD  1 
ATOM   5806 O  OE1 . GLN D 1 121 ? 19.831  40.362  103.353 1.00  37.93 ? 120 GLN D OE1 1 
ATOM   5807 N  NE2 . GLN D 1 121 ? 19.300  40.707  101.185 1.00  35.87 ? 120 GLN D NE2 1 
ATOM   5808 N  N   . LYS D 1 122 ? 20.817  35.070  102.484 1.00  31.05 ? 121 LYS D N   1 
ATOM   5809 C  CA  . LYS D 1 122 ? 21.750  34.380  101.589 1.00  31.72 ? 121 LYS D CA  1 
ATOM   5810 C  C   . LYS D 1 122 ? 21.153  33.074  101.067 1.00  31.01 ? 121 LYS D C   1 
ATOM   5811 O  O   . LYS D 1 122 ? 21.266  32.766  99.878  1.00  31.07 ? 121 LYS D O   1 
ATOM   5812 C  CB  . LYS D 1 122 ? 23.104  34.132  102.257 1.00  32.23 ? 121 LYS D CB  1 
ATOM   5813 C  CG  . LYS D 1 122 ? 24.117  33.535  101.295 1.00  35.35 ? 121 LYS D CG  1 
ATOM   5814 C  CD  . LYS D 1 122 ? 25.551  33.759  101.723 1.00  41.59 ? 121 LYS D CD  1 
ATOM   5815 C  CE  . LYS D 1 122 ? 26.491  33.364  100.584 1.00  44.03 ? 121 LYS D CE  1 
ATOM   5816 N  NZ  . LYS D 1 122 ? 27.860  33.082  101.085 1.00  46.61 ? 121 LYS D NZ  1 
ATOM   5817 N  N   . PHE D 1 123 ? 20.507  32.319  101.952 1.00  30.62 ? 122 PHE D N   1 
ATOM   5818 C  CA  . PHE D 1 123 ? 19.878  31.049  101.572 1.00  30.45 ? 122 PHE D CA  1 
ATOM   5819 C  C   . PHE D 1 123 ? 18.759  31.285  100.554 1.00  30.68 ? 122 PHE D C   1 
ATOM   5820 O  O   . PHE D 1 123 ? 18.714  30.631  99.498  1.00  30.67 ? 122 PHE D O   1 
ATOM   5821 C  CB  . PHE D 1 123 ? 19.357  30.342  102.825 1.00  30.44 ? 122 PHE D CB  1 
ATOM   5822 C  CG  . PHE D 1 123 ? 18.828  28.958  102.580 1.00  30.59 ? 122 PHE D CG  1 
ATOM   5823 C  CD1 . PHE D 1 123 ? 19.690  27.857  102.581 1.00  28.21 ? 122 PHE D CD1 1 
ATOM   5824 C  CD2 . PHE D 1 123 ? 17.471  28.747  102.382 1.00  29.74 ? 122 PHE D CD2 1 
ATOM   5825 C  CE1 . PHE D 1 123 ? 19.205  26.570  102.371 1.00  31.28 ? 122 PHE D CE1 1 
ATOM   5826 C  CE2 . PHE D 1 123 ? 16.974  27.459  102.179 1.00  32.34 ? 122 PHE D CE2 1 
ATOM   5827 C  CZ  . PHE D 1 123 ? 17.843  26.369  102.168 1.00  31.40 ? 122 PHE D CZ  1 
ATOM   5828 N  N   . GLU D 1 124 ? 17.868  32.227  100.864 1.00  31.10 ? 123 GLU D N   1 
ATOM   5829 C  CA  . GLU D 1 124 ? 16.780  32.587  99.949  1.00  31.27 ? 123 GLU D CA  1 
ATOM   5830 C  C   . GLU D 1 124 ? 17.289  33.057  98.587  1.00  31.60 ? 123 GLU D C   1 
ATOM   5831 O  O   . GLU D 1 124 ? 16.694  32.735  97.546  1.00  31.00 ? 123 GLU D O   1 
ATOM   5832 C  CB  . GLU D 1 124 ? 15.866  33.636  100.585 1.00  32.16 ? 123 GLU D CB  1 
ATOM   5833 C  CG  . GLU D 1 124 ? 14.925  33.059  101.639 1.00  34.41 ? 123 GLU D CG  1 
ATOM   5834 C  CD  . GLU D 1 124 ? 13.740  33.970  101.915 1.00  37.64 ? 123 GLU D CD  1 
ATOM   5835 O  OE1 . GLU D 1 124 ? 13.342  34.715  100.998 1.00  38.69 ? 123 GLU D OE1 1 
ATOM   5836 O  OE2 . GLU D 1 124 ? 13.208  33.946  103.046 1.00  39.36 ? 123 GLU D OE2 1 
ATOM   5837 N  N   . ASP D 1 125 ? 18.393  33.805  98.582  1.00  31.21 ? 124 ASP D N   1 
ATOM   5838 C  CA  . ASP D 1 125 ? 18.950  34.303  97.323  1.00  32.24 ? 124 ASP D CA  1 
ATOM   5839 C  C   . ASP D 1 125 ? 19.458  33.161  96.437  1.00  31.36 ? 124 ASP D C   1 
ATOM   5840 O  O   . ASP D 1 125 ? 19.231  33.168  95.221  1.00  30.13 ? 124 ASP D O   1 
ATOM   5841 C  CB  . ASP D 1 125 ? 20.059  35.328  97.554  1.00  32.52 ? 124 ASP D CB  1 
ATOM   5842 C  CG  . ASP D 1 125 ? 20.593  35.916  96.242  1.00  37.32 ? 124 ASP D CG  1 
ATOM   5843 O  OD1 . ASP D 1 125 ? 19.790  36.451  95.431  1.00  39.57 ? 124 ASP D OD1 1 
ATOM   5844 O  OD2 . ASP D 1 125 ? 21.824  35.840  96.016  1.00  42.79 ? 124 ASP D OD2 1 
ATOM   5845 N  N   . ALA D 1 126 ? 20.136  32.191  97.052  1.00  31.22 ? 125 ALA D N   1 
ATOM   5846 C  CA  . ALA D 1 126 ? 20.592  31.007  96.329  1.00  31.40 ? 125 ALA D CA  1 
ATOM   5847 C  C   . ALA D 1 126 ? 19.387  30.265  95.740  1.00  31.50 ? 125 ALA D C   1 
ATOM   5848 O  O   . ALA D 1 126 ? 19.407  29.835  94.587  1.00  31.83 ? 125 ALA D O   1 
ATOM   5849 C  CB  . ALA D 1 126 ? 21.383  30.106  97.243  1.00  31.42 ? 125 ALA D CB  1 
ATOM   5850 N  N   . ALA D 1 127 ? 18.327  30.152  96.535  1.00  30.96 ? 126 ALA D N   1 
ATOM   5851 C  CA  . ALA D 1 127 ? 17.096  29.495  96.090  1.00  30.85 ? 126 ALA D CA  1 
ATOM   5852 C  C   . ALA D 1 127 ? 16.385  30.272  94.977  1.00  31.29 ? 126 ALA D C   1 
ATOM   5853 O  O   . ALA D 1 127 ? 15.869  29.671  94.041  1.00  31.03 ? 126 ALA D O   1 
ATOM   5854 C  CB  . ALA D 1 127 ? 16.171  29.267  97.277  1.00  30.13 ? 126 ALA D CB  1 
ATOM   5855 N  N   . LYS D 1 128 ? 16.361  31.600  95.082  1.00  31.69 ? 127 LYS D N   1 
ATOM   5856 C  CA  . LYS D 1 128 ? 15.678  32.438  94.083  1.00  32.45 ? 127 LYS D CA  1 
ATOM   5857 C  C   . LYS D 1 128 ? 16.417  32.480  92.748  1.00  32.65 ? 127 LYS D C   1 
ATOM   5858 O  O   . LYS D 1 128 ? 15.789  32.528  91.680  1.00  33.15 ? 127 LYS D O   1 
ATOM   5859 C  CB  . LYS D 1 128 ? 15.456  33.859  94.621  1.00  32.50 ? 127 LYS D CB  1 
ATOM   5860 C  CG  . LYS D 1 128 ? 14.396  33.930  95.715  1.00  32.55 ? 127 LYS D CG  1 
ATOM   5861 C  CD  . LYS D 1 128 ? 14.077  35.347  96.133  1.00  33.61 ? 127 LYS D CD  1 
ATOM   5862 C  CE  . LYS D 1 128 ? 15.156  35.949  97.015  1.00  36.37 ? 127 LYS D CE  1 
ATOM   5863 N  NZ  . LYS D 1 128 ? 14.938  37.410  97.247  1.00  38.87 ? 127 LYS D NZ  1 
ATOM   5864 N  N   . THR D 1 129 ? 17.746  32.447  92.797  1.00  32.56 ? 128 THR D N   1 
ATOM   5865 C  CA  . THR D 1 129 ? 18.538  32.551  91.575  1.00  33.19 ? 128 THR D CA  1 
ATOM   5866 C  C   . THR D 1 129 ? 18.756  31.203  90.876  1.00  32.50 ? 128 THR D C   1 
ATOM   5867 O  O   . THR D 1 129 ? 19.332  31.164  89.795  1.00  33.53 ? 128 THR D O   1 
ATOM   5868 C  CB  . THR D 1 129 ? 19.911  33.227  91.807  1.00  33.04 ? 128 THR D CB  1 
ATOM   5869 O  OG1 . THR D 1 129 ? 20.687  32.441  92.718  1.00  35.00 ? 128 THR D OG1 1 
ATOM   5870 C  CG2 . THR D 1 129 ? 19.735  34.643  92.350  1.00  34.17 ? 128 THR D CG2 1 
ATOM   5871 N  N   . ARG D 1 130 ? 18.295  30.110  91.482  1.00  31.68 ? 129 ARG D N   1 
ATOM   5872 C  CA  . ARG D 1 130 ? 18.366  28.801  90.840  1.00  30.68 ? 129 ARG D CA  1 
ATOM   5873 C  C   . ARG D 1 130 ? 17.359  28.780  89.686  1.00  30.66 ? 129 ARG D C   1 
ATOM   5874 O  O   . ARG D 1 130 ? 16.156  28.686  89.899  1.00  30.42 ? 129 ARG D O   1 
ATOM   5875 C  CB  . ARG D 1 130 ? 18.138  27.672  91.865  1.00  31.13 ? 129 ARG D CB  1 
ATOM   5876 C  CG  . ARG D 1 130 ? 17.951  26.244  91.313  1.00  31.08 ? 129 ARG D CG  1 
ATOM   5877 C  CD  . ARG D 1 130 ? 18.961  25.872  90.225  1.00  30.45 ? 129 ARG D CD  1 
ATOM   5878 N  NE  . ARG D 1 130 ? 20.330  25.913  90.719  1.00  30.20 ? 129 ARG D NE  1 
ATOM   5879 C  CZ  . ARG D 1 130 ? 21.393  25.607  89.987  1.00  31.25 ? 129 ARG D CZ  1 
ATOM   5880 N  NH1 . ARG D 1 130 ? 21.234  25.240  88.713  1.00  31.03 ? 129 ARG D NH1 1 
ATOM   5881 N  NH2 . ARG D 1 130 ? 22.603  25.660  90.529  1.00  30.20 ? 129 ARG D NH2 1 
ATOM   5882 N  N   . PHE D 1 131 ? 17.866  28.895  88.462  1.00  29.77 ? 130 PHE D N   1 
ATOM   5883 C  CA  . PHE D 1 131 ? 17.004  28.953  87.287  1.00  28.90 ? 130 PHE D CA  1 
ATOM   5884 C  C   . PHE D 1 131 ? 16.604  27.553  86.829  1.00  28.49 ? 130 PHE D C   1 
ATOM   5885 O  O   . PHE D 1 131 ? 17.454  26.684  86.652  1.00  29.14 ? 130 PHE D O   1 
ATOM   5886 C  CB  . PHE D 1 131 ? 17.671  29.733  86.155  1.00  28.61 ? 130 PHE D CB  1 
ATOM   5887 C  CG  . PHE D 1 131 ? 16.728  30.107  85.044  1.00  28.54 ? 130 PHE D CG  1 
ATOM   5888 C  CD1 . PHE D 1 131 ? 15.857  31.186  85.182  1.00  28.06 ? 130 PHE D CD1 1 
ATOM   5889 C  CD2 . PHE D 1 131 ? 16.722  29.388  83.849  1.00  27.04 ? 130 PHE D CD2 1 
ATOM   5890 C  CE1 . PHE D 1 131 ? 14.990  31.545  84.144  1.00  28.52 ? 130 PHE D CE1 1 
ATOM   5891 C  CE2 . PHE D 1 131 ? 15.863  29.720  82.824  1.00  26.35 ? 130 PHE D CE2 1 
ATOM   5892 C  CZ  . PHE D 1 131 ? 14.991  30.805  82.963  1.00  28.83 ? 130 PHE D CZ  1 
ATOM   5893 N  N   . GLY D 1 132 ? 15.307  27.354  86.611  1.00  27.41 ? 131 GLY D N   1 
ATOM   5894 C  CA  . GLY D 1 132 ? 14.764  26.015  86.349  1.00  27.71 ? 131 GLY D CA  1 
ATOM   5895 C  C   . GLY D 1 132 ? 14.573  25.218  87.644  1.00  27.51 ? 131 GLY D C   1 
ATOM   5896 O  O   . GLY D 1 132 ? 14.290  25.786  88.708  1.00  27.98 ? 131 GLY D O   1 
ATOM   5897 N  N   . SER D 1 133 ? 14.742  23.902  87.554  1.00  27.20 ? 132 SER D N   1 
ATOM   5898 C  CA  . SER D 1 133 ? 14.531  23.013  88.682  1.00  27.31 ? 132 SER D CA  1 
ATOM   5899 C  C   . SER D 1 133 ? 15.798  22.846  89.501  1.00  27.91 ? 132 SER D C   1 
ATOM   5900 O  O   . SER D 1 133 ? 16.910  22.816  88.957  1.00  28.23 ? 132 SER D O   1 
ATOM   5901 C  CB  . SER D 1 133 ? 14.077  21.624  88.204  1.00  27.60 ? 132 SER D CB  1 
ATOM   5902 O  OG  . SER D 1 133 ? 12.862  21.705  87.487  1.00  28.57 ? 132 SER D OG  1 
ATOM   5903 N  N   . GLY D 1 134 ? 15.630  22.711  90.808  1.00  27.93 ? 133 GLY D N   1 
ATOM   5904 C  CA  . GLY D 1 134 ? 16.770  22.383  91.664  1.00  27.95 ? 133 GLY D CA  1 
ATOM   5905 C  C   . GLY D 1 134 ? 16.542  22.600  93.146  1.00  27.73 ? 133 GLY D C   1 
ATOM   5906 O  O   . GLY D 1 134 ? 15.401  22.614  93.612  1.00  28.18 ? 133 GLY D O   1 
ATOM   5907 N  N   . TRP D 1 135 ? 17.651  22.759  93.874  1.00  27.31 ? 134 TRP D N   1 
ATOM   5908 C  CA  . TRP D 1 135 ? 17.677  22.813  95.338  1.00  27.58 ? 134 TRP D CA  1 
ATOM   5909 C  C   . TRP D 1 135 ? 18.637  23.900  95.798  1.00  27.30 ? 134 TRP D C   1 
ATOM   5910 O  O   . TRP D 1 135 ? 19.610  24.185  95.108  1.00  28.11 ? 134 TRP D O   1 
ATOM   5911 C  CB  . TRP D 1 135 ? 18.163  21.467  95.917  1.00  27.39 ? 134 TRP D CB  1 
ATOM   5912 C  CG  . TRP D 1 135 ? 17.185  20.339  95.732  1.00  27.56 ? 134 TRP D CG  1 
ATOM   5913 C  CD1 . TRP D 1 135 ? 16.919  19.666  94.572  1.00  27.89 ? 134 TRP D CD1 1 
ATOM   5914 C  CD2 . TRP D 1 135 ? 16.336  19.761  96.732  1.00  28.17 ? 134 TRP D CD2 1 
ATOM   5915 N  NE1 . TRP D 1 135 ? 15.947  18.717  94.785  1.00  28.58 ? 134 TRP D NE1 1 
ATOM   5916 C  CE2 . TRP D 1 135 ? 15.571  18.751  96.101  1.00  28.48 ? 134 TRP D CE2 1 
ATOM   5917 C  CE3 . TRP D 1 135 ? 16.139  20.002  98.095  1.00  28.47 ? 134 TRP D CE3 1 
ATOM   5918 C  CZ2 . TRP D 1 135 ? 14.630  17.977  96.790  1.00  28.97 ? 134 TRP D CZ2 1 
ATOM   5919 C  CZ3 . TRP D 1 135 ? 15.204  19.227  98.785  1.00  28.64 ? 134 TRP D CZ3 1 
ATOM   5920 C  CH2 . TRP D 1 135 ? 14.460  18.233  98.130  1.00  27.79 ? 134 TRP D CH2 1 
ATOM   5921 N  N   . ALA D 1 136 ? 18.362  24.494  96.962  1.00  28.00 ? 135 ALA D N   1 
ATOM   5922 C  CA  . ALA D 1 136 ? 19.334  25.356  97.647  1.00  27.49 ? 135 ALA D CA  1 
ATOM   5923 C  C   . ALA D 1 136 ? 19.736  24.641  98.928  1.00  27.75 ? 135 ALA D C   1 
ATOM   5924 O  O   . ALA D 1 136 ? 18.902  23.996  99.560  1.00  27.45 ? 135 ALA D O   1 
ATOM   5925 C  CB  . ALA D 1 136 ? 18.745  26.730  97.951  1.00  27.66 ? 135 ALA D CB  1 
ATOM   5926 N  N   . TRP D 1 137 ? 21.008  24.764  99.302  1.00  27.71 ? 136 TRP D N   1 
ATOM   5927 C  CA  . TRP D 1 137 ? 21.583  23.961  100.386 1.00  27.94 ? 136 TRP D CA  1 
ATOM   5928 C  C   . TRP D 1 137 ? 22.365  24.800  101.382 1.00  27.99 ? 136 TRP D C   1 
ATOM   5929 O  O   . TRP D 1 137 ? 23.000  25.792  101.014 1.00  27.76 ? 136 TRP D O   1 
ATOM   5930 C  CB  . TRP D 1 137 ? 22.546  22.917  99.816  1.00  28.13 ? 136 TRP D CB  1 
ATOM   5931 C  CG  . TRP D 1 137 ? 21.975  22.024  98.760  1.00  28.31 ? 136 TRP D CG  1 
ATOM   5932 C  CD1 . TRP D 1 137 ? 22.122  22.153  97.418  1.00  28.91 ? 136 TRP D CD1 1 
ATOM   5933 C  CD2 . TRP D 1 137 ? 21.197  20.843  98.974  1.00  28.87 ? 136 TRP D CD2 1 
ATOM   5934 N  NE1 . TRP D 1 137 ? 21.473  21.132  96.771  1.00  28.90 ? 136 TRP D NE1 1 
ATOM   5935 C  CE2 . TRP D 1 137 ? 20.892  20.312  97.705  1.00  27.72 ? 136 TRP D CE2 1 
ATOM   5936 C  CE3 . TRP D 1 137 ? 20.716  20.189  100.121 1.00  28.85 ? 136 TRP D CE3 1 
ATOM   5937 C  CZ2 . TRP D 1 137 ? 20.124  19.158  97.539  1.00  28.69 ? 136 TRP D CZ2 1 
ATOM   5938 C  CZ3 . TRP D 1 137 ? 19.949  19.027  99.961  1.00  28.97 ? 136 TRP D CZ3 1 
ATOM   5939 C  CH2 . TRP D 1 137 ? 19.666  18.524  98.677  1.00  28.60 ? 136 TRP D CH2 1 
ATOM   5940 N  N   . LEU D 1 138 ? 22.313  24.389  102.643 1.00  28.22 ? 137 LEU D N   1 
ATOM   5941 C  CA  . LEU D 1 138 ? 23.302  24.819  103.631 1.00  28.86 ? 137 LEU D CA  1 
ATOM   5942 C  C   . LEU D 1 138 ? 24.237  23.626  103.786 1.00  29.15 ? 137 LEU D C   1 
ATOM   5943 O  O   . LEU D 1 138 ? 23.785  22.520  104.076 1.00  29.12 ? 137 LEU D O   1 
ATOM   5944 C  CB  . LEU D 1 138 ? 22.638  25.181  104.973 1.00  29.01 ? 137 LEU D CB  1 
ATOM   5945 C  CG  . LEU D 1 138 ? 23.543  25.476  106.188 1.00  28.80 ? 137 LEU D CG  1 
ATOM   5946 C  CD1 . LEU D 1 138 ? 24.393  26.714  105.960 1.00  28.96 ? 137 LEU D CD1 1 
ATOM   5947 C  CD2 . LEU D 1 138 ? 22.731  25.624  107.471 1.00  28.84 ? 137 LEU D CD2 1 
ATOM   5948 N  N   . VAL D 1 139 ? 25.531  23.840  103.555 1.00  29.86 ? 138 VAL D N   1 
ATOM   5949 C  CA  . VAL D 1 139 ? 26.506  22.739  103.592 1.00  30.69 ? 138 VAL D CA  1 
ATOM   5950 C  C   . VAL D 1 139 ? 27.622  23.014  104.583 1.00  31.47 ? 138 VAL D C   1 
ATOM   5951 O  O   . VAL D 1 139 ? 27.857  24.170  104.960 1.00  31.24 ? 138 VAL D O   1 
ATOM   5952 C  CB  . VAL D 1 139 ? 27.166  22.464  102.209 1.00  30.47 ? 138 VAL D CB  1 
ATOM   5953 C  CG1 . VAL D 1 139 ? 26.168  21.837  101.231 1.00  30.46 ? 138 VAL D CG1 1 
ATOM   5954 C  CG2 . VAL D 1 139 ? 27.791  23.748  101.624 1.00  31.46 ? 138 VAL D CG2 1 
ATOM   5955 N  N   . VAL D 1 140 ? 28.300  21.940  104.989 1.00  32.39 ? 139 VAL D N   1 
ATOM   5956 C  CA  . VAL D 1 140 ? 29.581  22.030  105.685 1.00  33.52 ? 139 VAL D CA  1 
ATOM   5957 C  C   . VAL D 1 140 ? 30.670  21.697  104.663 1.00  34.40 ? 139 VAL D C   1 
ATOM   5958 O  O   . VAL D 1 140 ? 30.677  20.602  104.087 1.00  34.24 ? 139 VAL D O   1 
ATOM   5959 C  CB  . VAL D 1 140 ? 29.665  21.053  106.884 1.00  33.64 ? 139 VAL D CB  1 
ATOM   5960 C  CG1 . VAL D 1 140 ? 30.981  21.252  107.643 1.00  33.92 ? 139 VAL D CG1 1 
ATOM   5961 C  CG2 . VAL D 1 140 ? 28.478  21.248  107.827 1.00  34.28 ? 139 VAL D CG2 1 
ATOM   5962 N  N   . LYS D 1 141 ? 31.568  22.651  104.429 1.00  35.48 ? 140 LYS D N   1 
ATOM   5963 C  CA  . LYS D 1 141 ? 32.614  22.522  103.413 1.00  36.59 ? 140 LYS D CA  1 
ATOM   5964 C  C   . LYS D 1 141 ? 33.890  23.214  103.885 1.00  37.22 ? 140 LYS D C   1 
ATOM   5965 O  O   . LYS D 1 141 ? 33.843  24.370  104.324 1.00  37.21 ? 140 LYS D O   1 
ATOM   5966 C  CB  . LYS D 1 141 ? 32.128  23.149  102.100 1.00  37.11 ? 140 LYS D CB  1 
ATOM   5967 C  CG  . LYS D 1 141 ? 33.160  23.231  100.980 1.00  38.16 ? 140 LYS D CG  1 
ATOM   5968 C  CD  . LYS D 1 141 ? 33.478  21.869  100.405 1.00  39.92 ? 140 LYS D CD  1 
ATOM   5969 C  CE  . LYS D 1 141 ? 34.709  21.933  99.529  1.00  41.10 ? 140 LYS D CE  1 
ATOM   5970 N  NZ  . LYS D 1 141 ? 35.182  20.567  99.152  1.00  42.95 ? 140 LYS D NZ  1 
ATOM   5971 N  N   . ASP D 1 142 ? 35.023  22.513  103.780 1.00  37.45 ? 141 ASP D N   1 
ATOM   5972 C  CA  . ASP D 1 142 ? 36.328  23.011  104.258 1.00  37.99 ? 141 ASP D CA  1 
ATOM   5973 C  C   . ASP D 1 142 ? 36.259  23.487  105.717 1.00  37.74 ? 141 ASP D C   1 
ATOM   5974 O  O   . ASP D 1 142 ? 36.909  24.469  106.097 1.00  37.70 ? 141 ASP D O   1 
ATOM   5975 C  CB  . ASP D 1 142 ? 36.874  24.127  103.347 1.00  38.32 ? 141 ASP D CB  1 
ATOM   5976 C  CG  . ASP D 1 142 ? 37.129  23.659  101.926 1.00  39.89 ? 141 ASP D CG  1 
ATOM   5977 O  OD1 . ASP D 1 142 ? 37.878  22.677  101.745 1.00  43.17 ? 141 ASP D OD1 1 
ATOM   5978 O  OD2 . ASP D 1 142 ? 36.587  24.281  100.983 1.00  41.86 ? 141 ASP D OD2 1 
ATOM   5979 N  N   . GLY D 1 143 ? 35.452  22.783  106.512 1.00  37.57 ? 142 GLY D N   1 
ATOM   5980 C  CA  . GLY D 1 143 ? 35.269  23.071  107.929 1.00  37.33 ? 142 GLY D CA  1 
ATOM   5981 C  C   . GLY D 1 143 ? 34.488  24.335  108.229 1.00  37.31 ? 142 GLY D C   1 
ATOM   5982 O  O   . GLY D 1 143 ? 34.592  24.880  109.334 1.00  37.64 ? 142 GLY D O   1 
ATOM   5983 N  N   . LYS D 1 144 ? 33.718  24.809  107.246 1.00  36.52 ? 143 LYS D N   1 
ATOM   5984 C  CA  . LYS D 1 144 ? 32.928  26.036  107.375 1.00  36.25 ? 143 LYS D CA  1 
ATOM   5985 C  C   . LYS D 1 144 ? 31.534  25.828  106.784 1.00  35.03 ? 143 LYS D C   1 
ATOM   5986 O  O   . LYS D 1 144 ? 31.334  24.939  105.962 1.00  34.85 ? 143 LYS D O   1 
ATOM   5987 C  CB  . LYS D 1 144 ? 33.602  27.205  106.638 1.00  36.26 ? 143 LYS D CB  1 
ATOM   5988 C  CG  . LYS D 1 144 ? 34.958  27.631  107.181 1.00  37.45 ? 143 LYS D CG  1 
ATOM   5989 C  CD  . LYS D 1 144 ? 35.513  28.785  106.359 1.00  38.01 ? 143 LYS D CD  1 
ATOM   5990 C  CE  . LYS D 1 144 ? 36.823  29.314  106.946 1.00  41.37 ? 143 LYS D CE  1 
ATOM   5991 N  NZ  . LYS D 1 144 ? 37.221  30.609  106.309 1.00  42.83 ? 143 LYS D NZ  1 
ATOM   5992 N  N   . LEU D 1 145 ? 30.578  26.653  107.202 1.00  33.96 ? 144 LEU D N   1 
ATOM   5993 C  CA  . LEU D 1 145 ? 29.247  26.645  106.591 1.00  33.18 ? 144 LEU D CA  1 
ATOM   5994 C  C   . LEU D 1 145 ? 29.231  27.510  105.341 1.00  32.67 ? 144 LEU D C   1 
ATOM   5995 O  O   . LEU D 1 145 ? 29.924  28.529  105.262 1.00  31.79 ? 144 LEU D O   1 
ATOM   5996 C  CB  . LEU D 1 145 ? 28.182  27.132  107.580 1.00  33.18 ? 144 LEU D CB  1 
ATOM   5997 C  CG  . LEU D 1 145 ? 27.858  26.257  108.793 1.00  33.55 ? 144 LEU D CG  1 
ATOM   5998 C  CD1 . LEU D 1 145 ? 26.841  26.967  109.660 1.00  33.58 ? 144 LEU D CD1 1 
ATOM   5999 C  CD2 . LEU D 1 145 ? 27.336  24.883  108.373 1.00  32.68 ? 144 LEU D CD2 1 
ATOM   6000 N  N   . ASP D 1 146 ? 28.435  27.096  104.363 1.00  32.53 ? 145 ASP D N   1 
ATOM   6001 C  CA  . ASP D 1 146 ? 28.290  27.847  103.126 1.00  32.94 ? 145 ASP D CA  1 
ATOM   6002 C  C   . ASP D 1 146 ? 26.917  27.554  102.536 1.00  31.85 ? 145 ASP D C   1 
ATOM   6003 O  O   . ASP D 1 146 ? 26.265  26.567  102.888 1.00  31.37 ? 145 ASP D O   1 
ATOM   6004 C  CB  . ASP D 1 146 ? 29.408  27.479  102.133 1.00  33.71 ? 145 ASP D CB  1 
ATOM   6005 C  CG  . ASP D 1 146 ? 29.532  28.469  100.955 1.00  37.71 ? 145 ASP D CG  1 
ATOM   6006 O  OD1 . ASP D 1 146 ? 29.160  29.675  101.074 1.00  40.78 ? 145 ASP D OD1 1 
ATOM   6007 O  OD2 . ASP D 1 146 ? 30.022  28.032  99.886  1.00  42.41 ? 145 ASP D OD2 1 
ATOM   6008 N  N   . VAL D 1 147 ? 26.468  28.442  101.669 1.00  30.94 ? 146 VAL D N   1 
ATOM   6009 C  CA  . VAL D 1 147 ? 25.201  28.253  100.973 1.00  30.59 ? 146 VAL D CA  1 
ATOM   6010 C  C   . VAL D 1 147 ? 25.491  28.031  99.495  1.00  30.12 ? 146 VAL D C   1 
ATOM   6011 O  O   . VAL D 1 147 ? 26.224  28.809  98.879  1.00  29.59 ? 146 VAL D O   1 
ATOM   6012 C  CB  . VAL D 1 147 ? 24.249  29.463  101.194 1.00  30.80 ? 146 VAL D CB  1 
ATOM   6013 C  CG1 . VAL D 1 147 ? 23.076  29.418  100.238 1.00  32.62 ? 146 VAL D CG1 1 
ATOM   6014 C  CG2 . VAL D 1 147 ? 23.750  29.476  102.639 1.00  30.84 ? 146 VAL D CG2 1 
ATOM   6015 N  N   . VAL D 1 148 ? 24.907  26.971  98.934  1.00  29.31 ? 147 VAL D N   1 
ATOM   6016 C  CA  . VAL D 1 148 ? 25.069  26.649  97.517  1.00  29.47 ? 147 VAL D CA  1 
ATOM   6017 C  C   . VAL D 1 148 ? 23.743  26.180  96.908  1.00  29.69 ? 147 VAL D C   1 
ATOM   6018 O  O   . VAL D 1 148 ? 22.793  25.859  97.636  1.00  29.70 ? 147 VAL D O   1 
ATOM   6019 C  CB  . VAL D 1 148 ? 26.163  25.552  97.289  1.00  29.55 ? 147 VAL D CB  1 
ATOM   6020 C  CG1 . VAL D 1 148 ? 27.533  26.021  97.805  1.00  29.95 ? 147 VAL D CG1 1 
ATOM   6021 C  CG2 . VAL D 1 148 ? 25.766  24.213  97.958  1.00  29.90 ? 147 VAL D CG2 1 
ATOM   6022 N  N   . SER D 1 149 ? 23.686  26.133  95.577  1.00  29.45 ? 148 SER D N   1 
ATOM   6023 C  CA  . SER D 1 149 ? 22.556  25.518  94.890  1.00  29.76 ? 148 SER D CA  1 
ATOM   6024 C  C   . SER D 1 149 ? 22.999  24.484  93.839  1.00  29.26 ? 148 SER D C   1 
ATOM   6025 O  O   . SER D 1 149 ? 24.146  24.494  93.369  1.00  28.70 ? 148 SER D O   1 
ATOM   6026 C  CB  . SER D 1 149 ? 21.591  26.571  94.299  1.00  30.32 ? 148 SER D CB  1 
ATOM   6027 O  OG  . SER D 1 149 ? 21.981  27.005  93.010  1.00  31.78 ? 148 SER D OG  1 
ATOM   6028 N  N   . THR D 1 150 ? 22.085  23.575  93.515  1.00  29.00 ? 149 THR D N   1 
ATOM   6029 C  CA  . THR D 1 150 ? 22.313  22.536  92.509  1.00  28.80 ? 149 THR D CA  1 
ATOM   6030 C  C   . THR D 1 150 ? 21.158  22.488  91.522  1.00  28.36 ? 149 THR D C   1 
ATOM   6031 O  O   . THR D 1 150 ? 20.048  22.928  91.846  1.00  27.19 ? 149 THR D O   1 
ATOM   6032 C  CB  . THR D 1 150 ? 22.444  21.127  93.141  1.00  29.33 ? 149 THR D CB  1 
ATOM   6033 O  OG1 . THR D 1 150 ? 21.286  20.835  93.943  1.00  30.67 ? 149 THR D OG1 1 
ATOM   6034 C  CG2 . THR D 1 150 ? 23.730  20.999  93.988  1.00  29.47 ? 149 THR D CG2 1 
ATOM   6035 N  N   . ALA D 1 151 ? 21.438  21.970  90.322  1.00  27.65 ? 150 ALA D N   1 
ATOM   6036 C  CA  . ALA D 1 151 ? 20.425  21.755  89.293  1.00  28.21 ? 150 ALA D CA  1 
ATOM   6037 C  C   . ALA D 1 151 ? 19.726  20.419  89.489  1.00  28.38 ? 150 ALA D C   1 
ATOM   6038 O  O   . ALA D 1 151 ? 20.347  19.444  89.929  1.00  28.95 ? 150 ALA D O   1 
ATOM   6039 C  CB  . ALA D 1 151 ? 21.062  21.797  87.896  1.00  28.23 ? 150 ALA D CB  1 
ATOM   6040 N  N   . ASN D 1 152 ? 18.440  20.387  89.153  1.00  28.06 ? 151 ASN D N   1 
ATOM   6041 C  CA  . ASN D 1 152 ? 17.642  19.157  89.102  1.00  28.10 ? 151 ASN D CA  1 
ATOM   6042 C  C   . ASN D 1 152 ? 17.683  18.351  90.402  1.00  27.86 ? 151 ASN D C   1 
ATOM   6043 O  O   . ASN D 1 152 ? 17.259  18.861  91.427  1.00  27.20 ? 151 ASN D O   1 
ATOM   6044 C  CB  . ASN D 1 152 ? 17.992  18.350  87.836  1.00  27.63 ? 151 ASN D CB  1 
ATOM   6045 C  CG  . ASN D 1 152 ? 17.860  19.197  86.591  1.00  28.95 ? 151 ASN D CG  1 
ATOM   6046 O  OD1 . ASN D 1 152 ? 16.919  19.988  86.480  1.00  27.42 ? 151 ASN D OD1 1 
ATOM   6047 N  ND2 . ASN D 1 152 ? 18.819  19.085  85.674  1.00  29.87 ? 151 ASN D ND2 1 
ATOM   6048 N  N   . GLN D 1 153 ? 18.169  17.113  90.379  1.00  28.22 ? 152 GLN D N   1 
ATOM   6049 C  CA  . GLN D 1 153 ? 18.275  16.350  91.633  1.00  28.57 ? 152 GLN D CA  1 
ATOM   6050 C  C   . GLN D 1 153 ? 19.718  16.148  92.095  1.00  28.86 ? 152 GLN D C   1 
ATOM   6051 O  O   . GLN D 1 153 ? 19.999  15.274  92.926  1.00  28.77 ? 152 GLN D O   1 
ATOM   6052 C  CB  . GLN D 1 153 ? 17.550  14.997  91.541  1.00  28.93 ? 152 GLN D CB  1 
ATOM   6053 C  CG  . GLN D 1 153 ? 16.037  15.090  91.327  1.00  29.01 ? 152 GLN D CG  1 
ATOM   6054 C  CD  . GLN D 1 153 ? 15.288  15.820  92.439  1.00  29.64 ? 152 GLN D CD  1 
ATOM   6055 O  OE1 . GLN D 1 153 ? 15.813  16.053  93.540  1.00  29.50 ? 152 GLN D OE1 1 
ATOM   6056 N  NE2 . GLN D 1 153 ? 14.039  16.170  92.156  1.00  28.23 ? 152 GLN D NE2 1 
ATOM   6057 N  N   . ASP D 1 154 ? 20.633  16.956  91.564  1.00  29.42 ? 153 ASP D N   1 
ATOM   6058 C  CA  . ASP D 1 154 ? 22.026  16.932  92.018  1.00  29.76 ? 153 ASP D CA  1 
ATOM   6059 C  C   . ASP D 1 154 ? 22.120  17.298  93.504  1.00  29.60 ? 153 ASP D C   1 
ATOM   6060 O  O   . ASP D 1 154 ? 21.307  18.065  94.017  1.00  29.77 ? 153 ASP D O   1 
ATOM   6061 C  CB  . ASP D 1 154 ? 22.892  17.885  91.186  1.00  29.88 ? 153 ASP D CB  1 
ATOM   6062 C  CG  . ASP D 1 154 ? 22.978  17.487  89.725  1.00  32.01 ? 153 ASP D CG  1 
ATOM   6063 O  OD1 . ASP D 1 154 ? 22.577  16.358  89.358  1.00  35.41 ? 153 ASP D OD1 1 
ATOM   6064 O  OD2 . ASP D 1 154 ? 23.461  18.317  88.927  1.00  35.83 ? 153 ASP D OD2 1 
ATOM   6065 N  N   . ASN D 1 155 ? 23.109  16.734  94.186  1.00  29.79 ? 154 ASN D N   1 
ATOM   6066 C  CA  . ASN D 1 155 ? 23.297  16.930  95.621  1.00  30.19 ? 154 ASN D CA  1 
ATOM   6067 C  C   . ASN D 1 155 ? 24.780  17.271  95.814  1.00  29.91 ? 154 ASN D C   1 
ATOM   6068 O  O   . ASN D 1 155 ? 25.624  16.700  95.123  1.00  30.32 ? 154 ASN D O   1 
ATOM   6069 C  CB  . ASN D 1 155 ? 22.867  15.642  96.362  1.00  30.23 ? 154 ASN D CB  1 
ATOM   6070 C  CG  . ASN D 1 155 ? 22.973  15.748  97.887  1.00  31.38 ? 154 ASN D CG  1 
ATOM   6071 O  OD1 . ASN D 1 155 ? 24.045  15.997  98.430  1.00  32.16 ? 154 ASN D OD1 1 
ATOM   6072 N  ND2 . ASN D 1 155 ? 21.859  15.518  98.579  1.00  32.43 ? 154 ASN D ND2 1 
ATOM   6073 N  N   . PRO D 1 156 ? 25.111  18.215  96.716  1.00  30.32 ? 155 PRO D N   1 
ATOM   6074 C  CA  . PRO D 1 156 ? 26.524  18.566  96.917  1.00  30.09 ? 155 PRO D CA  1 
ATOM   6075 C  C   . PRO D 1 156 ? 27.430  17.387  97.312  1.00  29.91 ? 155 PRO D C   1 
ATOM   6076 O  O   . PRO D 1 156 ? 28.652  17.482  97.164  1.00  29.70 ? 155 PRO D O   1 
ATOM   6077 C  CB  . PRO D 1 156 ? 26.476  19.615  98.038  1.00  30.05 ? 155 PRO D CB  1 
ATOM   6078 C  CG  . PRO D 1 156 ? 25.091  20.177  97.969  1.00  31.15 ? 155 PRO D CG  1 
ATOM   6079 C  CD  . PRO D 1 156 ? 24.222  19.024  97.571  1.00  30.12 ? 155 PRO D CD  1 
ATOM   6080 N  N   . LEU D 1 157 ? 26.832  16.305  97.810  1.00  29.77 ? 156 LEU D N   1 
ATOM   6081 C  CA  . LEU D 1 157 ? 27.560  15.064  98.122  1.00  29.90 ? 156 LEU D CA  1 
ATOM   6082 C  C   . LEU D 1 157 ? 28.179  14.402  96.891  1.00  29.49 ? 156 LEU D C   1 
ATOM   6083 O  O   . LEU D 1 157 ? 29.164  13.658  97.005  1.00  29.08 ? 156 LEU D O   1 
ATOM   6084 C  CB  . LEU D 1 157 ? 26.646  14.062  98.839  1.00  30.15 ? 156 LEU D CB  1 
ATOM   6085 C  CG  . LEU D 1 157 ? 26.275  14.382  100.299 1.00  30.96 ? 156 LEU D CG  1 
ATOM   6086 C  CD1 . LEU D 1 157 ? 25.237  13.383  100.810 1.00  31.49 ? 156 LEU D CD1 1 
ATOM   6087 C  CD2 . LEU D 1 157 ? 27.507  14.387  101.219 1.00  31.46 ? 156 LEU D CD2 1 
ATOM   6088 N  N   . MET D 1 158 ? 27.596  14.674  95.726  1.00  29.22 ? 157 MET D N   1 
ATOM   6089 C  CA  . MET D 1 158 ? 28.089  14.154  94.456  1.00  29.54 ? 157 MET D CA  1 
ATOM   6090 C  C   . MET D 1 158 ? 29.463  14.712  94.085  1.00  30.06 ? 157 MET D C   1 
ATOM   6091 O  O   . MET D 1 158 ? 30.200  14.105  93.298  1.00  29.80 ? 157 MET D O   1 
ATOM   6092 C  CB  . MET D 1 158 ? 27.084  14.440  93.340  1.00  29.62 ? 157 MET D CB  1 
ATOM   6093 C  CG  . MET D 1 158 ? 25.764  13.702  93.504  1.00  29.39 ? 157 MET D CG  1 
ATOM   6094 S  SD  . MET D 1 158 ? 24.544  14.231  92.293  1.00  29.60 ? 157 MET D SD  1 
ATOM   6095 C  CE  . MET D 1 158 ? 23.123  13.238  92.748  1.00  29.89 ? 157 MET D CE  1 
ATOM   6096 N  N   . GLY D 1 159 ? 29.794  15.867  94.658  1.00  30.03 ? 158 GLY D N   1 
ATOM   6097 C  CA  . GLY D 1 159 ? 31.080  16.512  94.437  1.00  30.84 ? 158 GLY D CA  1 
ATOM   6098 C  C   . GLY D 1 159 ? 31.058  17.512  93.301  1.00  31.18 ? 158 GLY D C   1 
ATOM   6099 O  O   . GLY D 1 159 ? 30.135  17.522  92.484  1.00  31.16 ? 158 GLY D O   1 
ATOM   6100 N  N   . GLU D 1 160 ? 32.101  18.339  93.256  1.00  31.70 ? 159 GLU D N   1 
ATOM   6101 C  CA  . GLU D 1 160 ? 32.212  19.473  92.339  1.00  32.81 ? 159 GLU D CA  1 
ATOM   6102 C  C   . GLU D 1 160 ? 32.055  19.097  90.866  1.00  31.90 ? 159 GLU D C   1 
ATOM   6103 O  O   . GLU D 1 160 ? 31.315  19.754  90.140  1.00  32.14 ? 159 GLU D O   1 
ATOM   6104 C  CB  . GLU D 1 160 ? 33.562  20.163  92.552  1.00  32.90 ? 159 GLU D CB  1 
ATOM   6105 C  CG  . GLU D 1 160 ? 33.601  21.649  92.216  1.00  35.42 ? 159 GLU D CG  1 
ATOM   6106 C  CD  . GLU D 1 160 ? 35.026  22.194  92.223  1.00  35.63 ? 159 GLU D CD  1 
ATOM   6107 O  OE1 . GLU D 1 160 ? 35.288  23.173  92.964  1.00  39.97 ? 159 GLU D OE1 1 
ATOM   6108 O  OE2 . GLU D 1 160 ? 35.890  21.624  91.502  1.00  40.04 ? 159 GLU D OE2 1 
ATOM   6109 N  N   . ALA D 1 161 ? 32.749  18.048  90.433  1.00  31.74 ? 160 ALA D N   1 
ATOM   6110 C  CA  . ALA D 1 161 ? 32.728  17.627  89.035  1.00  31.62 ? 160 ALA D CA  1 
ATOM   6111 C  C   . ALA D 1 161 ? 31.314  17.361  88.514  1.00  31.72 ? 160 ALA D C   1 
ATOM   6112 O  O   . ALA D 1 161 ? 30.964  17.775  87.407  1.00  31.61 ? 160 ALA D O   1 
ATOM   6113 C  CB  . ALA D 1 161 ? 33.632  16.400  88.823  1.00  31.98 ? 160 ALA D CB  1 
ATOM   6114 N  N   . ILE D 1 162 ? 30.499  16.683  89.313  1.00  31.47 ? 161 ILE D N   1 
ATOM   6115 C  CA  . ILE D 1 162 ? 29.134  16.357  88.902  1.00  31.54 ? 161 ILE D CA  1 
ATOM   6116 C  C   . ILE D 1 162 ? 28.133  17.481  89.233  1.00  31.56 ? 161 ILE D C   1 
ATOM   6117 O  O   . ILE D 1 162 ? 27.399  17.936  88.359  1.00  31.81 ? 161 ILE D O   1 
ATOM   6118 C  CB  . ILE D 1 162 ? 28.672  15.012  89.506  1.00  31.58 ? 161 ILE D CB  1 
ATOM   6119 C  CG1 . ILE D 1 162 ? 29.480  13.855  88.902  1.00  31.82 ? 161 ILE D CG1 1 
ATOM   6120 C  CG2 . ILE D 1 162 ? 27.185  14.786  89.251  1.00  32.48 ? 161 ILE D CG2 1 
ATOM   6121 C  CD1 . ILE D 1 162 ? 29.524  12.599  89.768  1.00  32.62 ? 161 ILE D CD1 1 
ATOM   6122 N  N   . ALA D 1 163 ? 28.117  17.928  90.488  1.00  31.37 ? 162 ALA D N   1 
ATOM   6123 C  CA  . ALA D 1 163 ? 27.090  18.859  90.962  1.00  31.48 ? 162 ALA D CA  1 
ATOM   6124 C  C   . ALA D 1 163 ? 27.439  20.349  90.823  1.00  31.79 ? 162 ALA D C   1 
ATOM   6125 O  O   . ALA D 1 163 ? 26.567  21.205  91.006  1.00  32.25 ? 162 ALA D O   1 
ATOM   6126 C  CB  . ALA D 1 163 ? 26.712  18.525  92.419  1.00  31.86 ? 162 ALA D CB  1 
ATOM   6127 N  N   . GLY D 1 164 ? 28.697  20.660  90.511  1.00  32.05 ? 163 GLY D N   1 
ATOM   6128 C  CA  . GLY D 1 164 ? 29.152  22.057  90.400  1.00  32.32 ? 163 GLY D CA  1 
ATOM   6129 C  C   . GLY D 1 164 ? 29.536  22.694  91.732  1.00  32.72 ? 163 GLY D C   1 
ATOM   6130 O  O   . GLY D 1 164 ? 30.213  23.725  91.764  1.00  32.91 ? 163 GLY D O   1 
ATOM   6131 N  N   . VAL D 1 165 ? 29.096  22.076  92.827  1.00  32.79 ? 164 VAL D N   1 
ATOM   6132 C  CA  . VAL D 1 165 ? 29.375  22.530  94.198  1.00  33.48 ? 164 VAL D CA  1 
ATOM   6133 C  C   . VAL D 1 165 ? 29.611  21.275  95.044  1.00  33.56 ? 164 VAL D C   1 
ATOM   6134 O  O   . VAL D 1 165 ? 29.320  20.168  94.601  1.00  33.29 ? 164 VAL D O   1 
ATOM   6135 C  CB  . VAL D 1 165 ? 28.193  23.328  94.811  1.00  33.31 ? 164 VAL D CB  1 
ATOM   6136 C  CG1 . VAL D 1 165 ? 27.851  24.557  93.966  1.00  34.47 ? 164 VAL D CG1 1 
ATOM   6137 C  CG2 . VAL D 1 165 ? 26.965  22.434  94.975  1.00  34.24 ? 164 VAL D CG2 1 
ATOM   6138 N  N   . SER D 1 166 ? 30.119  21.446  96.261  1.00  33.75 ? 165 SER D N   1 
ATOM   6139 C  CA  . SER D 1 166 ? 30.345  20.295  97.134  1.00  34.25 ? 165 SER D CA  1 
ATOM   6140 C  C   . SER D 1 166 ? 30.059  20.630  98.598  1.00  34.04 ? 165 SER D C   1 
ATOM   6141 O  O   . SER D 1 166 ? 29.695  21.763  98.918  1.00  34.64 ? 165 SER D O   1 
ATOM   6142 C  CB  . SER D 1 166 ? 31.765  19.758  96.959  1.00  34.42 ? 165 SER D CB  1 
ATOM   6143 O  OG  . SER D 1 166 ? 32.717  20.758  97.268  1.00  35.76 ? 165 SER D OG  1 
ATOM   6144 N  N   . GLY D 1 167 ? 30.215  19.635  99.468  1.00  33.92 ? 166 GLY D N   1 
ATOM   6145 C  CA  . GLY D 1 167 ? 29.983  19.789  100.908 1.00  33.30 ? 166 GLY D CA  1 
ATOM   6146 C  C   . GLY D 1 167 ? 28.907  18.832  101.385 1.00  33.11 ? 166 GLY D C   1 
ATOM   6147 O  O   . GLY D 1 167 ? 28.236  18.182  100.573 1.00  33.11 ? 166 GLY D O   1 
ATOM   6148 N  N   . THR D 1 168 ? 28.755  18.720  102.701 1.00  32.71 ? 167 THR D N   1 
ATOM   6149 C  CA  . THR D 1 168 ? 27.698  17.889  103.271 1.00  32.22 ? 167 THR D CA  1 
ATOM   6150 C  C   . THR D 1 168 ? 26.494  18.764  103.610 1.00  31.53 ? 167 THR D C   1 
ATOM   6151 O  O   . THR D 1 168 ? 26.605  19.650  104.460 1.00  31.20 ? 167 THR D O   1 
ATOM   6152 C  CB  . THR D 1 168 ? 28.149  17.170  104.552 1.00  32.53 ? 167 THR D CB  1 
ATOM   6153 O  OG1 . THR D 1 168 ? 29.324  16.397  104.285 1.00  33.51 ? 167 THR D OG1 1 
ATOM   6154 C  CG2 . THR D 1 168 ? 27.036  16.247  105.064 1.00  32.64 ? 167 THR D CG2 1 
ATOM   6155 N  N   . PRO D 1 169 ? 25.343  18.518  102.955 1.00  31.36 ? 168 PRO D N   1 
ATOM   6156 C  CA  . PRO D 1 169 ? 24.148  19.311  103.258 1.00  31.40 ? 168 PRO D CA  1 
ATOM   6157 C  C   . PRO D 1 169 ? 23.555  18.948  104.607 1.00  31.05 ? 168 PRO D C   1 
ATOM   6158 O  O   . PRO D 1 169 ? 23.476  17.767  104.959 1.00  30.68 ? 168 PRO D O   1 
ATOM   6159 C  CB  . PRO D 1 169 ? 23.163  18.929  102.151 1.00  30.87 ? 168 PRO D CB  1 
ATOM   6160 C  CG  . PRO D 1 169 ? 23.932  18.144  101.168 1.00  32.17 ? 168 PRO D CG  1 
ATOM   6161 C  CD  . PRO D 1 169 ? 25.075  17.527  101.902 1.00  31.61 ? 168 PRO D CD  1 
ATOM   6162 N  N   . ILE D 1 170 ? 23.152  19.970  105.353 1.00  30.52 ? 169 ILE D N   1 
ATOM   6163 C  CA  . ILE D 1 170 ? 22.463  19.783  106.627 1.00  30.20 ? 169 ILE D CA  1 
ATOM   6164 C  C   . ILE D 1 170 ? 21.056  20.378  106.589 1.00  30.35 ? 169 ILE D C   1 
ATOM   6165 O  O   . ILE D 1 170 ? 20.230  20.110  107.461 1.00  30.50 ? 169 ILE D O   1 
ATOM   6166 C  CB  . ILE D 1 170 ? 23.278  20.356  107.812 1.00  29.98 ? 169 ILE D CB  1 
ATOM   6167 C  CG1 . ILE D 1 170 ? 23.496  21.871  107.656 1.00  29.58 ? 169 ILE D CG1 1 
ATOM   6168 C  CG2 . ILE D 1 170 ? 24.588  19.574  107.961 1.00  29.32 ? 169 ILE D CG2 1 
ATOM   6169 C  CD1 . ILE D 1 170 ? 24.001  22.556  108.940 1.00  30.01 ? 169 ILE D CD1 1 
ATOM   6170 N  N   . LEU D 1 171 ? 20.799  21.177  105.554 1.00  30.56 ? 170 LEU D N   1 
ATOM   6171 C  CA  . LEU D 1 171 ? 19.483  21.723  105.279 1.00  30.27 ? 170 LEU D CA  1 
ATOM   6172 C  C   . LEU D 1 171 ? 19.374  21.964  103.779 1.00  30.14 ? 170 LEU D C   1 
ATOM   6173 O  O   . LEU D 1 171 ? 20.317  22.435  103.142 1.00  29.88 ? 170 LEU D O   1 
ATOM   6174 C  CB  . LEU D 1 171 ? 19.256  23.040  106.050 1.00  30.30 ? 170 LEU D CB  1 
ATOM   6175 C  CG  . LEU D 1 171 ? 18.031  23.902  105.697 1.00  30.88 ? 170 LEU D CG  1 
ATOM   6176 C  CD1 . LEU D 1 171 ? 16.720  23.194  106.068 1.00  32.14 ? 170 LEU D CD1 1 
ATOM   6177 C  CD2 . LEU D 1 171 ? 18.107  25.284  106.349 1.00  31.38 ? 170 LEU D CD2 1 
ATOM   6178 N  N   . GLY D 1 172 ? 18.220  21.635  103.217 1.00  30.23 ? 171 GLY D N   1 
ATOM   6179 C  CA  . GLY D 1 172 ? 17.935  22.036  101.839 1.00  29.92 ? 171 GLY D CA  1 
ATOM   6180 C  C   . GLY D 1 172 ? 16.483  22.373  101.624 1.00  30.05 ? 171 GLY D C   1 
ATOM   6181 O  O   . GLY D 1 172 ? 15.625  21.910  102.364 1.00  30.51 ? 171 GLY D O   1 
ATOM   6182 N  N   . VAL D 1 173 ? 16.207  23.168  100.586 1.00  29.37 ? 172 VAL D N   1 
ATOM   6183 C  CA  . VAL D 1 173 ? 14.838  23.453  100.186 1.00  29.23 ? 172 VAL D CA  1 
ATOM   6184 C  C   . VAL D 1 173 ? 14.678  23.083  98.712  1.00  28.66 ? 172 VAL D C   1 
ATOM   6185 O  O   . VAL D 1 173 ? 15.548  23.362  97.895  1.00  28.30 ? 172 VAL D O   1 
ATOM   6186 C  CB  . VAL D 1 173 ? 14.433  24.938  100.449 1.00  29.38 ? 172 VAL D CB  1 
ATOM   6187 C  CG1 . VAL D 1 173 ? 15.267  25.932  99.596  1.00  29.21 ? 172 VAL D CG1 1 
ATOM   6188 C  CG2 . VAL D 1 173 ? 12.943  25.149  100.205 1.00  29.89 ? 172 VAL D CG2 1 
ATOM   6189 N  N   . ASP D 1 174 ? 13.564  22.436  98.407  1.00  28.20 ? 173 ASP D N   1 
ATOM   6190 C  CA  . ASP D 1 174 ? 13.230  22.004  97.061  1.00  28.32 ? 173 ASP D CA  1 
ATOM   6191 C  C   . ASP D 1 174 ? 12.644  23.191  96.310  1.00  27.73 ? 173 ASP D C   1 
ATOM   6192 O  O   . ASP D 1 174 ? 11.625  23.737  96.730  1.00  28.01 ? 173 ASP D O   1 
ATOM   6193 C  CB  . ASP D 1 174 ? 12.184  20.889  97.170  1.00  28.11 ? 173 ASP D CB  1 
ATOM   6194 C  CG  . ASP D 1 174 ? 11.944  20.153  95.864  1.00  29.86 ? 173 ASP D CG  1 
ATOM   6195 O  OD1 . ASP D 1 174 ? 12.522  20.507  94.818  1.00  29.71 ? 173 ASP D OD1 1 
ATOM   6196 O  OD2 . ASP D 1 174 ? 11.165  19.180  95.907  1.00  31.12 ? 173 ASP D OD2 1 
ATOM   6197 N  N   . VAL D 1 175 ? 13.277  23.606  95.210  1.00  27.31 ? 174 VAL D N   1 
ATOM   6198 C  CA  . VAL D 1 175 ? 12.671  24.664  94.376  1.00  27.54 ? 174 VAL D CA  1 
ATOM   6199 C  C   . VAL D 1 175 ? 12.160  24.195  93.007  1.00  27.24 ? 174 VAL D C   1 
ATOM   6200 O  O   . VAL D 1 175 ? 11.896  25.006  92.117  1.00  27.71 ? 174 VAL D O   1 
ATOM   6201 C  CB  . VAL D 1 175 ? 13.519  25.971  94.272  1.00  27.67 ? 174 VAL D CB  1 
ATOM   6202 C  CG1 . VAL D 1 175 ? 13.647  26.617  95.645  1.00  28.08 ? 174 VAL D CG1 1 
ATOM   6203 C  CG2 . VAL D 1 175 ? 14.903  25.705  93.642  1.00  28.24 ? 174 VAL D CG2 1 
ATOM   6204 N  N   . TRP D 1 176 ? 11.999  22.886  92.846  1.00  27.45 ? 175 TRP D N   1 
ATOM   6205 C  CA  . TRP D 1 176 ? 11.199  22.384  91.723  1.00  26.92 ? 175 TRP D CA  1 
ATOM   6206 C  C   . TRP D 1 176 ? 9.806   22.993  91.859  1.00  27.52 ? 175 TRP D C   1 
ATOM   6207 O  O   . TRP D 1 176 ? 9.284   23.113  92.972  1.00  26.81 ? 175 TRP D O   1 
ATOM   6208 C  CB  . TRP D 1 176 ? 11.082  20.859  91.769  1.00  27.42 ? 175 TRP D CB  1 
ATOM   6209 C  CG  . TRP D 1 176 ? 12.328  20.128  91.341  1.00  27.11 ? 175 TRP D CG  1 
ATOM   6210 C  CD1 . TRP D 1 176 ? 13.569  20.197  91.930  1.00  27.74 ? 175 TRP D CD1 1 
ATOM   6211 C  CD2 . TRP D 1 176 ? 12.448  19.189  90.260  1.00  27.55 ? 175 TRP D CD2 1 
ATOM   6212 N  NE1 . TRP D 1 176 ? 14.451  19.370  91.267  1.00  28.10 ? 175 TRP D NE1 1 
ATOM   6213 C  CE2 . TRP D 1 176 ? 13.793  18.738  90.244  1.00  26.61 ? 175 TRP D CE2 1 
ATOM   6214 C  CE3 . TRP D 1 176 ? 11.551  18.681  89.305  1.00  26.14 ? 175 TRP D CE3 1 
ATOM   6215 C  CZ2 . TRP D 1 176 ? 14.269  17.807  89.295  1.00  27.20 ? 175 TRP D CZ2 1 
ATOM   6216 C  CZ3 . TRP D 1 176 ? 12.020  17.744  88.364  1.00  27.82 ? 175 TRP D CZ3 1 
ATOM   6217 C  CH2 . TRP D 1 176 ? 13.367  17.314  88.373  1.00  26.69 ? 175 TRP D CH2 1 
ATOM   6218 N  N   . GLU D 1 177 ? 9.204   23.377  90.739  1.00  27.20 ? 176 GLU D N   1 
ATOM   6219 C  CA  . GLU D 1 177 ? 7.862   23.951  90.782  1.00  28.03 ? 176 GLU D CA  1 
ATOM   6220 C  C   . GLU D 1 177 ? 6.824   23.029  91.442  1.00  28.08 ? 176 GLU D C   1 
ATOM   6221 O  O   . GLU D 1 177 ? 5.883   23.522  92.061  1.00  28.79 ? 176 GLU D O   1 
ATOM   6222 C  CB  . GLU D 1 177 ? 7.429   24.453  89.399  1.00  27.70 ? 176 GLU D CB  1 
ATOM   6223 C  CG  . GLU D 1 177 ? 8.215   25.720  89.002  1.00  29.02 ? 176 GLU D CG  1 
ATOM   6224 C  CD  . GLU D 1 177 ? 7.962   26.191  87.585  1.00  28.78 ? 176 GLU D CD  1 
ATOM   6225 O  OE1 . GLU D 1 177 ? 7.847   25.334  86.677  1.00  27.71 ? 176 GLU D OE1 1 
ATOM   6226 O  OE2 . GLU D 1 177 ? 7.888   27.430  87.386  1.00  30.89 ? 176 GLU D OE2 1 
ATOM   6227 N  N   . HIS D 1 178 ? 7.018   21.705  91.381  1.00  28.19 ? 177 HIS D N   1 
ATOM   6228 C  CA  . HIS D 1 178 ? 6.069   20.794  92.050  1.00  28.01 ? 177 HIS D CA  1 
ATOM   6229 C  C   . HIS D 1 178 ? 6.014   20.974  93.565  1.00  27.66 ? 177 HIS D C   1 
ATOM   6230 O  O   . HIS D 1 178 ? 4.998   20.651  94.185  1.00  27.49 ? 177 HIS D O   1 
ATOM   6231 C  CB  . HIS D 1 178 ? 6.275   19.313  91.680  1.00  28.29 ? 177 HIS D CB  1 
ATOM   6232 C  CG  . HIS D 1 178 ? 7.578   18.725  92.133  1.00  29.07 ? 177 HIS D CG  1 
ATOM   6233 N  ND1 . HIS D 1 178 ? 8.469   18.148  91.254  1.00  29.86 ? 177 HIS D ND1 1 
ATOM   6234 C  CD2 . HIS D 1 178 ? 8.119   18.578  93.367  1.00  29.79 ? 177 HIS D CD2 1 
ATOM   6235 C  CE1 . HIS D 1 178 ? 9.508   17.682  91.923  1.00  30.26 ? 177 HIS D CE1 1 
ATOM   6236 N  NE2 . HIS D 1 178 ? 9.325   17.936  93.206  1.00  28.93 ? 177 HIS D NE2 1 
ATOM   6237 N  N   . ALA D 1 179 ? 7.092   21.501  94.150  1.00  27.37 ? 178 ALA D N   1 
ATOM   6238 C  CA  . ALA D 1 179 ? 7.148   21.727  95.595  1.00  27.46 ? 178 ALA D CA  1 
ATOM   6239 C  C   . ALA D 1 179 ? 6.281   22.909  96.048  1.00  27.22 ? 178 ALA D C   1 
ATOM   6240 O  O   . ALA D 1 179 ? 5.972   23.029  97.235  1.00  26.86 ? 178 ALA D O   1 
ATOM   6241 C  CB  . ALA D 1 179 ? 8.606   21.924  96.062  1.00  27.66 ? 178 ALA D CB  1 
ATOM   6242 N  N   . TYR D 1 180 ? 5.911   23.798  95.124  1.00  26.75 ? 179 TYR D N   1 
ATOM   6243 C  CA  . TYR D 1 180 ? 5.219   25.017  95.540  1.00  26.64 ? 179 TYR D CA  1 
ATOM   6244 C  C   . TYR D 1 180 ? 4.092   25.519  94.644  1.00  26.28 ? 179 TYR D C   1 
ATOM   6245 O  O   . TYR D 1 180 ? 3.380   26.461  95.018  1.00  26.01 ? 179 TYR D O   1 
ATOM   6246 C  CB  . TYR D 1 180 ? 6.227   26.152  95.841  1.00  27.05 ? 179 TYR D CB  1 
ATOM   6247 C  CG  . TYR D 1 180 ? 7.047   26.650  94.665  1.00  26.83 ? 179 TYR D CG  1 
ATOM   6248 C  CD1 . TYR D 1 180 ? 6.553   27.646  93.818  1.00  26.39 ? 179 TYR D CD1 1 
ATOM   6249 C  CD2 . TYR D 1 180 ? 8.333   26.156  94.419  1.00  27.47 ? 179 TYR D CD2 1 
ATOM   6250 C  CE1 . TYR D 1 180 ? 7.307   28.122  92.743  1.00  28.16 ? 179 TYR D CE1 1 
ATOM   6251 C  CE2 . TYR D 1 180 ? 9.096   26.636  93.355  1.00  26.57 ? 179 TYR D CE2 1 
ATOM   6252 C  CZ  . TYR D 1 180 ? 8.579   27.610  92.522  1.00  26.39 ? 179 TYR D CZ  1 
ATOM   6253 O  OH  . TYR D 1 180 ? 9.316   28.087  91.465  1.00  27.10 ? 179 TYR D OH  1 
ATOM   6254 N  N   . TYR D 1 181 ? 3.906   24.903  93.478  1.00  26.03 ? 180 TYR D N   1 
ATOM   6255 C  CA  . TYR D 1 181 ? 3.004   25.497  92.495  1.00  25.93 ? 180 TYR D CA  1 
ATOM   6256 C  C   . TYR D 1 181 ? 1.522   25.519  92.905  1.00  26.32 ? 180 TYR D C   1 
ATOM   6257 O  O   . TYR D 1 181 ? 0.815   26.494  92.641  1.00  26.13 ? 180 TYR D O   1 
ATOM   6258 C  CB  . TYR D 1 181 ? 3.188   24.900  91.088  1.00  25.38 ? 180 TYR D CB  1 
ATOM   6259 C  CG  . TYR D 1 181 ? 3.016   25.971  90.053  1.00  25.94 ? 180 TYR D CG  1 
ATOM   6260 C  CD1 . TYR D 1 181 ? 4.067   26.850  89.749  1.00  24.73 ? 180 TYR D CD1 1 
ATOM   6261 C  CD2 . TYR D 1 181 ? 1.784   26.165  89.427  1.00  24.48 ? 180 TYR D CD2 1 
ATOM   6262 C  CE1 . TYR D 1 181 ? 3.890   27.879  88.827  1.00  25.27 ? 180 TYR D CE1 1 
ATOM   6263 C  CE2 . TYR D 1 181 ? 1.598   27.186  88.497  1.00  25.71 ? 180 TYR D CE2 1 
ATOM   6264 C  CZ  . TYR D 1 181 ? 2.659   28.040  88.203  1.00  24.69 ? 180 TYR D CZ  1 
ATOM   6265 O  OH  . TYR D 1 181 ? 2.473   29.041  87.290  1.00  25.59 ? 180 TYR D OH  1 
ATOM   6266 N  N   . LEU D 1 182 ? 1.042   24.450  93.530  1.00  26.83 ? 181 LEU D N   1 
ATOM   6267 C  CA  . LEU D 1 182 ? -0.379  24.426  93.909  1.00  27.34 ? 181 LEU D CA  1 
ATOM   6268 C  C   . LEU D 1 182 ? -0.757  25.541  94.899  1.00  27.39 ? 181 LEU D C   1 
ATOM   6269 O  O   . LEU D 1 182 ? -1.814  26.161  94.763  1.00  27.51 ? 181 LEU D O   1 
ATOM   6270 C  CB  . LEU D 1 182 ? -0.814  23.044  94.416  1.00  27.66 ? 181 LEU D CB  1 
ATOM   6271 C  CG  . LEU D 1 182 ? -0.638  21.875  93.436  1.00  27.96 ? 181 LEU D CG  1 
ATOM   6272 C  CD1 . LEU D 1 182 ? -1.006  20.551  94.112  1.00  27.97 ? 181 LEU D CD1 1 
ATOM   6273 C  CD2 . LEU D 1 182 ? -1.462  22.062  92.147  1.00  28.94 ? 181 LEU D CD2 1 
ATOM   6274 N  N   . ASN D 1 183 ? 0.127   25.809  95.856  1.00  27.38 ? 182 ASN D N   1 
ATOM   6275 C  CA  . ASN D 1 183 ? -0.098  26.803  96.912  1.00  27.86 ? 182 ASN D CA  1 
ATOM   6276 C  C   . ASN D 1 183 ? 0.347   28.217  96.502  1.00  27.70 ? 182 ASN D C   1 
ATOM   6277 O  O   . ASN D 1 183 ? -0.325  29.200  96.829  1.00  28.25 ? 182 ASN D O   1 
ATOM   6278 C  CB  . ASN D 1 183 ? 0.664   26.371  98.176  1.00  28.52 ? 182 ASN D CB  1 
ATOM   6279 C  CG  . ASN D 1 183 ? -0.005  26.821  99.468  1.00  31.03 ? 182 ASN D CG  1 
ATOM   6280 O  OD1 . ASN D 1 183 ? -1.172  27.223  99.484  1.00  34.26 ? 182 ASN D OD1 1 
ATOM   6281 N  ND2 . ASN D 1 183 ? 0.739   26.736  100.571 1.00  33.78 ? 182 ASN D ND2 1 
ATOM   6282 N  N   . TYR D 1 184 ? 1.468   28.313  95.777  1.00  26.71 ? 183 TYR D N   1 
ATOM   6283 C  CA  . TYR D 1 184 ? 2.116   29.609  95.500  1.00  26.44 ? 183 TYR D CA  1 
ATOM   6284 C  C   . TYR D 1 184 ? 2.190   30.017  94.033  1.00  26.15 ? 183 TYR D C   1 
ATOM   6285 O  O   . TYR D 1 184 ? 2.514   31.176  93.724  1.00  26.32 ? 183 TYR D O   1 
ATOM   6286 C  CB  . TYR D 1 184 ? 3.525   29.642  96.097  1.00  26.14 ? 183 TYR D CB  1 
ATOM   6287 C  CG  . TYR D 1 184 ? 3.518   29.436  97.591  1.00  26.44 ? 183 TYR D CG  1 
ATOM   6288 C  CD1 . TYR D 1 184 ? 3.798   28.182  98.146  1.00  26.12 ? 183 TYR D CD1 1 
ATOM   6289 C  CD2 . TYR D 1 184 ? 3.190   30.490  98.448  1.00  25.91 ? 183 TYR D CD2 1 
ATOM   6290 C  CE1 . TYR D 1 184 ? 3.765   27.994  99.543  1.00  26.73 ? 183 TYR D CE1 1 
ATOM   6291 C  CE2 . TYR D 1 184 ? 3.143   30.316  99.827  1.00  26.48 ? 183 TYR D CE2 1 
ATOM   6292 C  CZ  . TYR D 1 184 ? 3.440   29.071  100.365 1.00  26.65 ? 183 TYR D CZ  1 
ATOM   6293 O  OH  . TYR D 1 184 ? 3.399   28.925  101.729 1.00  25.86 ? 183 TYR D OH  1 
ATOM   6294 N  N   . GLN D 1 185 ? 1.889   29.078  93.139  1.00  25.96 ? 184 GLN D N   1 
ATOM   6295 C  CA  . GLN D 1 185 ? 2.036   29.298  91.689  1.00  25.73 ? 184 GLN D CA  1 
ATOM   6296 C  C   . GLN D 1 185 ? 3.420   29.898  91.370  1.00  25.33 ? 184 GLN D C   1 
ATOM   6297 O  O   . GLN D 1 185 ? 4.438   29.363  91.820  1.00  25.37 ? 184 GLN D O   1 
ATOM   6298 C  CB  . GLN D 1 185 ? 0.855   30.120  91.121  1.00  25.76 ? 184 GLN D CB  1 
ATOM   6299 C  CG  . GLN D 1 185 ? -0.529  29.442  91.326  1.00  25.68 ? 184 GLN D CG  1 
ATOM   6300 C  CD  . GLN D 1 185 ? -1.116  29.754  92.692  1.00  26.52 ? 184 GLN D CD  1 
ATOM   6301 O  OE1 . GLN D 1 185 ? -1.240  30.919  93.065  1.00  26.86 ? 184 GLN D OE1 1 
ATOM   6302 N  NE2 . GLN D 1 185 ? -1.455  28.715  93.451  1.00  27.16 ? 184 GLN D NE2 1 
ATOM   6303 N  N   . ASN D 1 186 ? 3.469   31.008  90.637  1.00  25.23 ? 185 ASN D N   1 
ATOM   6304 C  CA  . ASN D 1 186 ? 4.743   31.646  90.287  1.00  25.68 ? 185 ASN D CA  1 
ATOM   6305 C  C   . ASN D 1 186 ? 5.495   32.266  91.480  1.00  26.40 ? 185 ASN D C   1 
ATOM   6306 O  O   . ASN D 1 186 ? 6.651   32.661  91.330  1.00  26.78 ? 185 ASN D O   1 
ATOM   6307 C  CB  . ASN D 1 186 ? 4.503   32.754  89.261  1.00  25.76 ? 185 ASN D CB  1 
ATOM   6308 C  CG  . ASN D 1 186 ? 3.525   33.796  89.771  1.00  25.96 ? 185 ASN D CG  1 
ATOM   6309 O  OD1 . ASN D 1 186 ? 2.344   33.503  89.966  1.00  26.78 ? 185 ASN D OD1 1 
ATOM   6310 N  ND2 . ASN D 1 186 ? 4.017   35.006  90.023  1.00  28.45 ? 185 ASN D ND2 1 
ATOM   6311 N  N   . ARG D 1 187 ? 4.856   32.366  92.648  1.00  26.26 ? 186 ARG D N   1 
ATOM   6312 C  CA  . ARG D 1 187 ? 5.452   33.104  93.779  1.00  26.48 ? 186 ARG D CA  1 
ATOM   6313 C  C   . ARG D 1 187 ? 6.479   32.340  94.616  1.00  26.53 ? 186 ARG D C   1 
ATOM   6314 O  O   . ARG D 1 187 ? 6.281   32.117  95.817  1.00  26.65 ? 186 ARG D O   1 
ATOM   6315 C  CB  . ARG D 1 187 ? 4.361   33.729  94.657  1.00  26.54 ? 186 ARG D CB  1 
ATOM   6316 C  CG  . ARG D 1 187 ? 3.402   34.596  93.841  1.00  27.24 ? 186 ARG D CG  1 
ATOM   6317 C  CD  . ARG D 1 187 ? 2.291   35.208  94.680  1.00  28.52 ? 186 ARG D CD  1 
ATOM   6318 N  NE  . ARG D 1 187 ? 1.559   34.209  95.455  1.00  34.37 ? 186 ARG D NE  1 
ATOM   6319 C  CZ  . ARG D 1 187 ? 0.571   33.453  94.990  1.00  34.67 ? 186 ARG D CZ  1 
ATOM   6320 N  NH1 . ARG D 1 187 ? 0.165   33.562  93.732  1.00  38.47 ? 186 ARG D NH1 1 
ATOM   6321 N  NH2 . ARG D 1 187 ? -0.016  32.581  95.792  1.00  36.54 ? 186 ARG D NH2 1 
ATOM   6322 N  N   . ARG D 1 188 ? 7.588   31.945  93.984  1.00  26.39 ? 187 ARG D N   1 
ATOM   6323 C  CA  . ARG D 1 188 ? 8.662   31.254  94.707  1.00  26.74 ? 187 ARG D CA  1 
ATOM   6324 C  C   . ARG D 1 188 ? 9.134   32.011  95.973  1.00  25.83 ? 187 ARG D C   1 
ATOM   6325 O  O   . ARG D 1 188 ? 9.371   31.378  96.993  1.00  25.45 ? 187 ARG D O   1 
ATOM   6326 C  CB  . ARG D 1 188 ? 9.865   30.951  93.788  1.00  26.86 ? 187 ARG D CB  1 
ATOM   6327 C  CG  . ARG D 1 188 ? 10.826  29.912  94.384  1.00  27.94 ? 187 ARG D CG  1 
ATOM   6328 C  CD  . ARG D 1 188 ? 12.127  29.813  93.579  1.00  28.52 ? 187 ARG D CD  1 
ATOM   6329 N  NE  . ARG D 1 188 ? 11.942  29.060  92.331  1.00  30.21 ? 187 ARG D NE  1 
ATOM   6330 C  CZ  . ARG D 1 188 ? 12.936  28.696  91.525  1.00  31.31 ? 187 ARG D CZ  1 
ATOM   6331 N  NH1 . ARG D 1 188 ? 14.184  29.028  91.827  1.00  31.00 ? 187 ARG D NH1 1 
ATOM   6332 N  NH2 . ARG D 1 188 ? 12.676  28.002  90.414  1.00  31.67 ? 187 ARG D NH2 1 
ATOM   6333 N  N   . PRO D 1 189 ? 9.296   33.358  95.906  1.00  25.35 ? 188 PRO D N   1 
ATOM   6334 C  CA  . PRO D 1 189 ? 9.747   34.041  97.135  1.00  25.44 ? 188 PRO D CA  1 
ATOM   6335 C  C   . PRO D 1 189 ? 8.778   33.890  98.321  1.00  25.13 ? 188 PRO D C   1 
ATOM   6336 O  O   . PRO D 1 189 ? 9.224   33.854  99.473  1.00  23.94 ? 188 PRO D O   1 
ATOM   6337 C  CB  . PRO D 1 189 ? 9.864   35.507  96.706  1.00  25.02 ? 188 PRO D CB  1 
ATOM   6338 C  CG  . PRO D 1 189 ? 10.029  35.456  95.212  1.00  26.18 ? 188 PRO D CG  1 
ATOM   6339 C  CD  . PRO D 1 189 ? 9.158   34.306  94.782  1.00  25.64 ? 188 PRO D CD  1 
ATOM   6340 N  N   . ASP D 1 190 ? 7.476   33.786  98.045  1.00  25.07 ? 189 ASP D N   1 
ATOM   6341 C  CA  . ASP D 1 190 ? 6.467   33.567  99.105  1.00  25.51 ? 189 ASP D CA  1 
ATOM   6342 C  C   . ASP D 1 190 ? 6.630   32.165  99.718  1.00  25.86 ? 189 ASP D C   1 
ATOM   6343 O  O   . ASP D 1 190 ? 6.500   31.985  100.931 1.00  25.35 ? 189 ASP D O   1 
ATOM   6344 C  CB  . ASP D 1 190 ? 5.033   33.701  98.559  1.00  25.79 ? 189 ASP D CB  1 
ATOM   6345 C  CG  . ASP D 1 190 ? 4.661   35.125  98.119  1.00  27.10 ? 189 ASP D CG  1 
ATOM   6346 O  OD1 . ASP D 1 190 ? 5.541   36.007  97.928  1.00  27.21 ? 189 ASP D OD1 1 
ATOM   6347 O  OD2 . ASP D 1 190 ? 3.438   35.354  97.927  1.00  27.42 ? 189 ASP D OD2 1 
ATOM   6348 N  N   . TYR D 1 191 ? 6.898   31.176  98.867  1.00  26.20 ? 190 TYR D N   1 
ATOM   6349 C  CA  . TYR D 1 191 ? 7.157   29.810  99.314  1.00  26.55 ? 190 TYR D CA  1 
ATOM   6350 C  C   . TYR D 1 191 ? 8.384   29.794  100.212 1.00  26.79 ? 190 TYR D C   1 
ATOM   6351 O  O   . TYR D 1 191 ? 8.350   29.213  101.284 1.00  25.82 ? 190 TYR D O   1 
ATOM   6352 C  CB  . TYR D 1 191 ? 7.342   28.891  98.115  1.00  27.03 ? 190 TYR D CB  1 
ATOM   6353 C  CG  . TYR D 1 191 ? 8.003   27.547  98.378  1.00  27.12 ? 190 TYR D CG  1 
ATOM   6354 C  CD1 . TYR D 1 191 ? 7.415   26.594  99.224  1.00  27.85 ? 190 TYR D CD1 1 
ATOM   6355 C  CD2 . TYR D 1 191 ? 9.185   27.209  97.726  1.00  27.79 ? 190 TYR D CD2 1 
ATOM   6356 C  CE1 . TYR D 1 191 ? 8.020   25.340  99.429  1.00  27.71 ? 190 TYR D CE1 1 
ATOM   6357 C  CE2 . TYR D 1 191 ? 9.793   25.982  97.918  1.00  28.06 ? 190 TYR D CE2 1 
ATOM   6358 C  CZ  . TYR D 1 191 ? 9.223   25.054  98.777  1.00  28.15 ? 190 TYR D CZ  1 
ATOM   6359 O  OH  . TYR D 1 191 ? 9.833   23.832  98.936  1.00  29.22 ? 190 TYR D OH  1 
ATOM   6360 N  N   . LEU D 1 192 ? 9.447   30.475  99.786  1.00  26.74 ? 191 LEU D N   1 
ATOM   6361 C  CA  . LEU D 1 192 ? 10.695  30.507  100.565 1.00  27.21 ? 191 LEU D CA  1 
ATOM   6362 C  C   . LEU D 1 192 ? 10.557  31.228  101.913 1.00  26.92 ? 191 LEU D C   1 
ATOM   6363 O  O   . LEU D 1 192 ? 11.126  30.793  102.915 1.00  26.80 ? 191 LEU D O   1 
ATOM   6364 C  CB  . LEU D 1 192 ? 11.821  31.126  99.738  1.00  27.43 ? 191 LEU D CB  1 
ATOM   6365 C  CG  . LEU D 1 192 ? 12.183  30.347  98.465  1.00  28.41 ? 191 LEU D CG  1 
ATOM   6366 C  CD1 . LEU D 1 192 ? 13.081  31.204  97.585  1.00  30.92 ? 191 LEU D CD1 1 
ATOM   6367 C  CD2 . LEU D 1 192 ? 12.849  29.016  98.810  1.00  28.35 ? 191 LEU D CD2 1 
ATOM   6368 N  N   . ALA D 1 193 ? 9.790   32.320  101.943 1.00  26.68 ? 192 ALA D N   1 
ATOM   6369 C  CA  . ALA D 1 193 ? 9.488   32.994  103.205 1.00  26.37 ? 192 ALA D CA  1 
ATOM   6370 C  C   . ALA D 1 193 ? 8.748   32.038  104.159 1.00  26.38 ? 192 ALA D C   1 
ATOM   6371 O  O   . ALA D 1 193 ? 9.072   31.943  105.353 1.00  25.73 ? 192 ALA D O   1 
ATOM   6372 C  CB  . ALA D 1 193 ? 8.655   34.265  102.949 1.00  26.37 ? 192 ALA D CB  1 
ATOM   6373 N  N   . ALA D 1 194 ? 7.749   31.342  103.628 1.00  26.12 ? 193 ALA D N   1 
ATOM   6374 C  CA  . ALA D 1 194 ? 6.939   30.409  104.426 1.00  26.03 ? 193 ALA D CA  1 
ATOM   6375 C  C   . ALA D 1 194 ? 7.746   29.224  104.935 1.00  26.10 ? 193 ALA D C   1 
ATOM   6376 O  O   . ALA D 1 194 ? 7.490   28.723  106.026 1.00  25.71 ? 193 ALA D O   1 
ATOM   6377 C  CB  . ALA D 1 194 ? 5.739   29.921  103.621 1.00  26.00 ? 193 ALA D CB  1 
ATOM   6378 N  N   . PHE D 1 195 ? 8.715   28.780  104.131 1.00  26.91 ? 194 PHE D N   1 
ATOM   6379 C  CA  . PHE D 1 195 ? 9.565   27.635  104.476 1.00  27.22 ? 194 PHE D CA  1 
ATOM   6380 C  C   . PHE D 1 195 ? 10.208  27.751  105.865 1.00  27.43 ? 194 PHE D C   1 
ATOM   6381 O  O   . PHE D 1 195 ? 10.273  26.768  106.602 1.00  27.36 ? 194 PHE D O   1 
ATOM   6382 C  CB  . PHE D 1 195 ? 10.634  27.418  103.389 1.00  28.10 ? 194 PHE D CB  1 
ATOM   6383 C  CG  . PHE D 1 195 ? 11.567  26.262  103.663 1.00  29.39 ? 194 PHE D CG  1 
ATOM   6384 C  CD1 . PHE D 1 195 ? 11.102  24.958  103.640 1.00  30.33 ? 194 PHE D CD1 1 
ATOM   6385 C  CD2 . PHE D 1 195 ? 12.922  26.493  103.917 1.00  31.47 ? 194 PHE D CD2 1 
ATOM   6386 C  CE1 . PHE D 1 195 ? 11.967  23.893  103.888 1.00  31.89 ? 194 PHE D CE1 1 
ATOM   6387 C  CE2 . PHE D 1 195 ? 13.797  25.436  104.166 1.00  32.31 ? 194 PHE D CE2 1 
ATOM   6388 C  CZ  . PHE D 1 195 ? 13.321  24.139  104.146 1.00  31.04 ? 194 PHE D CZ  1 
ATOM   6389 N  N   . TRP D 1 196 ? 10.674  28.944  106.225 1.00  27.21 ? 195 TRP D N   1 
ATOM   6390 C  CA  . TRP D 1 196 ? 11.301  29.145  107.544 1.00  27.75 ? 195 TRP D CA  1 
ATOM   6391 C  C   . TRP D 1 196 ? 10.407  28.736  108.713 1.00  27.89 ? 195 TRP D C   1 
ATOM   6392 O  O   . TRP D 1 196 ? 10.904  28.325  109.771 1.00  28.35 ? 195 TRP D O   1 
ATOM   6393 C  CB  . TRP D 1 196 ? 11.770  30.590  107.706 1.00  28.20 ? 195 TRP D CB  1 
ATOM   6394 C  CG  . TRP D 1 196 ? 12.771  30.978  106.666 1.00  28.32 ? 195 TRP D CG  1 
ATOM   6395 C  CD1 . TRP D 1 196 ? 12.635  31.952  105.722 1.00  29.32 ? 195 TRP D CD1 1 
ATOM   6396 C  CD2 . TRP D 1 196 ? 14.051  30.363  106.433 1.00  29.51 ? 195 TRP D CD2 1 
ATOM   6397 N  NE1 . TRP D 1 196 ? 13.757  32.006  104.931 1.00  29.13 ? 195 TRP D NE1 1 
ATOM   6398 C  CE2 . TRP D 1 196 ? 14.638  31.032  105.337 1.00  29.76 ? 195 TRP D CE2 1 
ATOM   6399 C  CE3 . TRP D 1 196 ? 14.763  29.319  107.058 1.00  29.58 ? 195 TRP D CE3 1 
ATOM   6400 C  CZ2 . TRP D 1 196 ? 15.907  30.699  104.846 1.00  29.15 ? 195 TRP D CZ2 1 
ATOM   6401 C  CZ3 . TRP D 1 196 ? 16.020  28.975  106.566 1.00  29.40 ? 195 TRP D CZ3 1 
ATOM   6402 C  CH2 . TRP D 1 196 ? 16.580  29.667  105.463 1.00  29.59 ? 195 TRP D CH2 1 
ATOM   6403 N  N   . ASN D 1 197 ? 9.094   28.841  108.517 1.00  27.79 ? 196 ASN D N   1 
ATOM   6404 C  CA  . ASN D 1 197 ? 8.122   28.460  109.546 1.00  28.21 ? 196 ASN D CA  1 
ATOM   6405 C  C   . ASN D 1 197 ? 8.064   26.965  109.825 1.00  28.33 ? 196 ASN D C   1 
ATOM   6406 O  O   . ASN D 1 197 ? 7.584   26.550  110.881 1.00  27.92 ? 196 ASN D O   1 
ATOM   6407 C  CB  . ASN D 1 197 ? 6.738   28.974  109.187 1.00  28.37 ? 196 ASN D CB  1 
ATOM   6408 C  CG  . ASN D 1 197 ? 6.675   30.478  109.168 1.00  29.44 ? 196 ASN D CG  1 
ATOM   6409 O  OD1 . ASN D 1 197 ? 7.065   31.129  110.133 1.00  32.03 ? 196 ASN D OD1 1 
ATOM   6410 N  ND2 . ASN D 1 197 ? 6.195   31.039  108.071 1.00  29.97 ? 196 ASN D ND2 1 
ATOM   6411 N  N   . VAL D 1 198 ? 8.564   26.159  108.890 1.00  28.55 ? 197 VAL D N   1 
ATOM   6412 C  CA  . VAL D 1 198 ? 8.505   24.695  109.055 1.00  29.01 ? 197 VAL D CA  1 
ATOM   6413 C  C   . VAL D 1 198 ? 9.860   23.988  109.230 1.00  28.94 ? 197 VAL D C   1 
ATOM   6414 O  O   . VAL D 1 198 ? 9.899   22.766  109.373 1.00  29.07 ? 197 VAL D O   1 
ATOM   6415 C  CB  . VAL D 1 198 ? 7.678   24.008  107.923 1.00  28.93 ? 197 VAL D CB  1 
ATOM   6416 C  CG1 . VAL D 1 198 ? 6.230   24.474  107.956 1.00  29.05 ? 197 VAL D CG1 1 
ATOM   6417 C  CG2 . VAL D 1 198 ? 8.292   24.261  106.545 1.00  29.09 ? 197 VAL D CG2 1 
ATOM   6418 N  N   . VAL D 1 199 ? 10.964  24.736  109.241 1.00  28.98 ? 198 VAL D N   1 
ATOM   6419 C  CA  . VAL D 1 199 ? 12.290  24.106  109.440 1.00  29.00 ? 198 VAL D CA  1 
ATOM   6420 C  C   . VAL D 1 199 ? 12.398  23.526  110.852 1.00  28.93 ? 198 VAL D C   1 
ATOM   6421 O  O   . VAL D 1 199 ? 12.032  24.179  111.830 1.00  29.13 ? 198 VAL D O   1 
ATOM   6422 C  CB  . VAL D 1 199 ? 13.480  25.075  109.150 1.00  28.91 ? 198 VAL D CB  1 
ATOM   6423 C  CG1 . VAL D 1 199 ? 14.828  24.424  109.485 1.00  28.38 ? 198 VAL D CG1 1 
ATOM   6424 C  CG2 . VAL D 1 199 ? 13.468  25.510  107.710 1.00  28.57 ? 198 VAL D CG2 1 
ATOM   6425 N  N   . ASN D 1 200 ? 12.865  22.282  110.932 1.00  28.92 ? 199 ASN D N   1 
ATOM   6426 C  CA  . ASN D 1 200 ? 13.136  21.628  112.196 1.00  28.90 ? 199 ASN D CA  1 
ATOM   6427 C  C   . ASN D 1 200 ? 14.614  21.842  112.532 1.00  28.93 ? 199 ASN D C   1 
ATOM   6428 O  O   . ASN D 1 200 ? 15.479  21.085  112.090 1.00  28.81 ? 199 ASN D O   1 
ATOM   6429 C  CB  . ASN D 1 200 ? 12.785  20.131  112.132 1.00  29.44 ? 199 ASN D CB  1 
ATOM   6430 C  CG  . ASN D 1 200 ? 12.952  19.428  113.478 1.00  30.25 ? 199 ASN D CG  1 
ATOM   6431 O  OD1 . ASN D 1 200 ? 13.674  19.907  114.348 1.00  31.59 ? 199 ASN D OD1 1 
ATOM   6432 N  ND2 . ASN D 1 200 ? 12.284  18.292  113.649 1.00  31.80 ? 199 ASN D ND2 1 
ATOM   6433 N  N   . TRP D 1 201 ? 14.896  22.885  113.307 1.00  28.69 ? 200 TRP D N   1 
ATOM   6434 C  CA  . TRP D 1 201 ? 16.278  23.236  113.645 1.00  29.08 ? 200 TRP D CA  1 
ATOM   6435 C  C   . TRP D 1 201 ? 16.982  22.208  114.533 1.00  29.51 ? 200 TRP D C   1 
ATOM   6436 O  O   . TRP D 1 201 ? 18.216  22.124  114.523 1.00  29.94 ? 200 TRP D O   1 
ATOM   6437 C  CB  . TRP D 1 201 ? 16.355  24.654  114.232 1.00  28.74 ? 200 TRP D CB  1 
ATOM   6438 C  CG  . TRP D 1 201 ? 16.096  25.682  113.155 1.00  28.63 ? 200 TRP D CG  1 
ATOM   6439 C  CD1 . TRP D 1 201 ? 14.977  26.442  112.999 1.00  27.92 ? 200 TRP D CD1 1 
ATOM   6440 C  CD2 . TRP D 1 201 ? 16.952  25.998  112.052 1.00  27.39 ? 200 TRP D CD2 1 
ATOM   6441 N  NE1 . TRP D 1 201 ? 15.091  27.236  111.884 1.00  26.92 ? 200 TRP D NE1 1 
ATOM   6442 C  CE2 . TRP D 1 201 ? 16.293  26.982  111.281 1.00  27.81 ? 200 TRP D CE2 1 
ATOM   6443 C  CE3 . TRP D 1 201 ? 18.221  25.555  111.650 1.00  27.68 ? 200 TRP D CE3 1 
ATOM   6444 C  CZ2 . TRP D 1 201 ? 16.856  27.532  110.121 1.00  27.84 ? 200 TRP D CZ2 1 
ATOM   6445 C  CZ3 . TRP D 1 201 ? 18.784  26.101  110.495 1.00  28.79 ? 200 TRP D CZ3 1 
ATOM   6446 C  CH2 . TRP D 1 201 ? 18.102  27.086  109.749 1.00  28.66 ? 200 TRP D CH2 1 
ATOM   6447 N  N   . ASP D 1 202 ? 16.196  21.435  115.287 1.00  29.65 ? 201 ASP D N   1 
ATOM   6448 C  CA  . ASP D 1 202 ? 16.707  20.299  116.064 1.00  30.33 ? 201 ASP D CA  1 
ATOM   6449 C  C   . ASP D 1 202 ? 17.382  19.285  115.137 1.00  29.95 ? 201 ASP D C   1 
ATOM   6450 O  O   . ASP D 1 202 ? 18.488  18.811  115.415 1.00  29.94 ? 201 ASP D O   1 
ATOM   6451 C  CB  . ASP D 1 202 ? 15.570  19.606  116.822 1.00  30.49 ? 201 ASP D CB  1 
ATOM   6452 C  CG  . ASP D 1 202 ? 15.188  20.319  118.102 1.00  32.82 ? 201 ASP D CG  1 
ATOM   6453 O  OD1 . ASP D 1 202 ? 15.525  21.507  118.274 1.00  35.47 ? 201 ASP D OD1 1 
ATOM   6454 O  OD2 . ASP D 1 202 ? 14.559  19.676  118.966 1.00  36.34 ? 201 ASP D OD2 1 
ATOM   6455 N  N   . GLU D 1 203 ? 16.701  18.952  114.042 1.00  29.75 ? 202 GLU D N   1 
ATOM   6456 C  CA  . GLU D 1 203 ? 17.228  17.988  113.078 1.00  29.67 ? 202 GLU D CA  1 
ATOM   6457 C  C   . GLU D 1 203 ? 18.425  18.557  112.327 1.00  29.16 ? 202 GLU D C   1 
ATOM   6458 O  O   . GLU D 1 203 ? 19.420  17.862  112.115 1.00  28.92 ? 202 GLU D O   1 
ATOM   6459 C  CB  . GLU D 1 203 ? 16.140  17.526  112.100 1.00  30.40 ? 202 GLU D CB  1 
ATOM   6460 C  CG  . GLU D 1 203 ? 16.650  16.609  110.969 1.00  32.47 ? 202 GLU D CG  1 
ATOM   6461 C  CD  . GLU D 1 203 ? 17.042  15.198  111.415 1.00  36.43 ? 202 GLU D CD  1 
ATOM   6462 O  OE1 . GLU D 1 203 ? 16.890  14.834  112.611 1.00  37.36 ? 202 GLU D OE1 1 
ATOM   6463 O  OE2 . GLU D 1 203 ? 17.499  14.433  110.533 1.00  38.23 ? 202 GLU D OE2 1 
ATOM   6464 N  N   . VAL D 1 204 ? 18.331  19.825  111.934 1.00  28.38 ? 203 VAL D N   1 
ATOM   6465 C  CA  . VAL D 1 204 ? 19.461  20.496  111.292 1.00  28.21 ? 203 VAL D CA  1 
ATOM   6466 C  C   . VAL D 1 204 ? 20.699  20.503  112.219 1.00  28.07 ? 203 VAL D C   1 
ATOM   6467 O  O   . VAL D 1 204 ? 21.813  20.237  111.761 1.00  28.13 ? 203 VAL D O   1 
ATOM   6468 C  CB  . VAL D 1 204 ? 19.091  21.911  110.785 1.00  27.46 ? 203 VAL D CB  1 
ATOM   6469 C  CG1 . VAL D 1 204 ? 20.253  22.507  110.036 1.00  27.66 ? 203 VAL D CG1 1 
ATOM   6470 C  CG2 . VAL D 1 204 ? 17.863  21.836  109.840 1.00  27.65 ? 203 VAL D CG2 1 
ATOM   6471 N  N   . SER D 1 205 ? 20.494  20.755  113.512 1.00  28.54 ? 204 SER D N   1 
ATOM   6472 C  CA  . SER D 1 205 ? 21.595  20.739  114.497 1.00  28.94 ? 204 SER D CA  1 
ATOM   6473 C  C   . SER D 1 205 ? 22.229  19.349  114.656 1.00  29.36 ? 204 SER D C   1 
ATOM   6474 O  O   . SER D 1 205 ? 23.450  19.231  114.741 1.00  29.12 ? 204 SER D O   1 
ATOM   6475 C  CB  . SER D 1 205 ? 21.141  21.287  115.855 1.00  29.32 ? 204 SER D CB  1 
ATOM   6476 O  OG  . SER D 1 205 ? 20.988  22.705  115.802 1.00  30.71 ? 204 SER D OG  1 
ATOM   6477 N  N   . LYS D 1 206 ? 21.392  18.312  114.682 1.00  29.44 ? 205 LYS D N   1 
ATOM   6478 C  CA  . LYS D 1 206 ? 21.844  16.915  114.715 1.00  30.00 ? 205 LYS D CA  1 
ATOM   6479 C  C   . LYS D 1 206 ? 22.706  16.610  113.482 1.00  29.47 ? 205 LYS D C   1 
ATOM   6480 O  O   . LYS D 1 206 ? 23.781  16.015  113.586 1.00  28.45 ? 205 LYS D O   1 
ATOM   6481 C  CB  . LYS D 1 206 ? 20.621  15.991  114.763 1.00  30.57 ? 205 LYS D CB  1 
ATOM   6482 C  CG  . LYS D 1 206 ? 20.892  14.537  115.074 1.00  32.78 ? 205 LYS D CG  1 
ATOM   6483 C  CD  . LYS D 1 206 ? 19.589  13.764  115.114 1.00  35.95 ? 205 LYS D CD  1 
ATOM   6484 C  CE  . LYS D 1 206 ? 19.841  12.278  115.314 1.00  38.65 ? 205 LYS D CE  1 
ATOM   6485 N  NZ  . LYS D 1 206 ? 18.786  11.453  114.649 1.00  40.89 ? 205 LYS D NZ  1 
ATOM   6486 N  N   . ARG D 1 207 ? 22.228  17.034  112.315 1.00  29.04 ? 206 ARG D N   1 
ATOM   6487 C  CA  . ARG D 1 207 ? 22.971  16.870  111.071 1.00  29.40 ? 206 ARG D CA  1 
ATOM   6488 C  C   . ARG D 1 207 ? 24.310  17.626  111.044 1.00  29.04 ? 206 ARG D C   1 
ATOM   6489 O  O   . ARG D 1 207 ? 25.313  17.074  110.583 1.00  28.68 ? 206 ARG D O   1 
ATOM   6490 C  CB  . ARG D 1 207 ? 22.090  17.249  109.871 1.00  29.24 ? 206 ARG D CB  1 
ATOM   6491 C  CG  . ARG D 1 207 ? 21.002  16.212  109.622 1.00  29.99 ? 206 ARG D CG  1 
ATOM   6492 C  CD  . ARG D 1 207 ? 20.092  16.565  108.449 1.00  30.18 ? 206 ARG D CD  1 
ATOM   6493 N  NE  . ARG D 1 207 ? 19.124  15.491  108.242 1.00  32.52 ? 206 ARG D NE  1 
ATOM   6494 C  CZ  . ARG D 1 207 ? 19.262  14.507  107.357 1.00  34.31 ? 206 ARG D CZ  1 
ATOM   6495 N  NH1 . ARG D 1 207 ? 20.324  14.455  106.560 1.00  35.31 ? 206 ARG D NH1 1 
ATOM   6496 N  NH2 . ARG D 1 207 ? 18.322  13.580  107.259 1.00  34.73 ? 206 ARG D NH2 1 
ATOM   6497 N  N   . TYR D 1 208 ? 24.323  18.866  111.544 1.00  28.91 ? 207 TYR D N   1 
ATOM   6498 C  CA  . TYR D 1 208 ? 25.564  19.643  111.684 1.00  29.13 ? 207 TYR D CA  1 
ATOM   6499 C  C   . TYR D 1 208 ? 26.583  18.914  112.579 1.00  29.32 ? 207 TYR D C   1 
ATOM   6500 O  O   . TYR D 1 208 ? 27.749  18.750  112.209 1.00  29.04 ? 207 TYR D O   1 
ATOM   6501 C  CB  . TYR D 1 208 ? 25.275  21.063  112.216 1.00  29.72 ? 207 TYR D CB  1 
ATOM   6502 C  CG  . TYR D 1 208 ? 26.519  21.918  112.416 1.00  30.14 ? 207 TYR D CG  1 
ATOM   6503 C  CD1 . TYR D 1 208 ? 27.347  22.236  111.337 1.00  30.71 ? 207 TYR D CD1 1 
ATOM   6504 C  CD2 . TYR D 1 208 ? 26.873  22.399  113.681 1.00  31.50 ? 207 TYR D CD2 1 
ATOM   6505 C  CE1 . TYR D 1 208 ? 28.503  23.014  111.512 1.00  31.19 ? 207 TYR D CE1 1 
ATOM   6506 C  CE2 . TYR D 1 208 ? 28.030  23.179  113.867 1.00  32.00 ? 207 TYR D CE2 1 
ATOM   6507 C  CZ  . TYR D 1 208 ? 28.835  23.483  112.773 1.00  31.99 ? 207 TYR D CZ  1 
ATOM   6508 O  OH  . TYR D 1 208 ? 29.979  24.245  112.935 1.00  31.47 ? 207 TYR D OH  1 
ATOM   6509 N  N   . ALA D 1 209 ? 26.129  18.464  113.746 1.00  29.24 ? 208 ALA D N   1 
ATOM   6510 C  CA  . ALA D 1 209 ? 26.974  17.713  114.681 1.00  29.76 ? 208 ALA D CA  1 
ATOM   6511 C  C   . ALA D 1 209 ? 27.583  16.457  114.030 1.00  30.05 ? 208 ALA D C   1 
ATOM   6512 O  O   . ALA D 1 209 ? 28.771  16.170  114.202 1.00  29.96 ? 208 ALA D O   1 
ATOM   6513 C  CB  . ALA D 1 209 ? 26.179  17.349  115.933 1.00  29.76 ? 208 ALA D CB  1 
ATOM   6514 N  N   . ALA D 1 210 ? 26.769  15.732  113.269 1.00  30.43 ? 209 ALA D N   1 
ATOM   6515 C  CA  . ALA D 1 210 ? 27.231  14.547  112.552 1.00  31.00 ? 209 ALA D CA  1 
ATOM   6516 C  C   . ALA D 1 210 ? 28.230  14.911  111.452 1.00  31.51 ? 209 ALA D C   1 
ATOM   6517 O  O   . ALA D 1 210 ? 29.249  14.231  111.293 1.00  31.47 ? 209 ALA D O   1 
ATOM   6518 C  CB  . ALA D 1 210 ? 26.042  13.774  111.962 1.00  31.14 ? 209 ALA D CB  1 
ATOM   6519 N  N   . ALA D 1 211 ? 27.936  15.982  110.707 1.00  32.01 ? 210 ALA D N   1 
ATOM   6520 C  CA  . ALA D 1 211 ? 28.774  16.411  109.577 1.00  33.09 ? 210 ALA D CA  1 
ATOM   6521 C  C   . ALA D 1 211 ? 30.212  16.737  109.999 1.00  33.94 ? 210 ALA D C   1 
ATOM   6522 O  O   . ALA D 1 211 ? 31.164  16.413  109.284 1.00  34.27 ? 210 ALA D O   1 
ATOM   6523 C  CB  . ALA D 1 211 ? 28.146  17.599  108.854 1.00  33.01 ? 210 ALA D CB  1 
ATOM   6524 N  N   . LYS D 1 212 ? 30.362  17.353  111.166 1.00  34.72 ? 211 LYS D N   1 
ATOM   6525 C  CA  . LYS D 1 212 ? 31.681  17.719  111.683 1.00  36.12 ? 211 LYS D CA  1 
ATOM   6526 C  C   . LYS D 1 212 ? 32.539  16.504  112.054 1.00  37.03 ? 211 LYS D C   1 
ATOM   6527 O  O   . LYS D 1 212 ? 33.748  16.633  112.270 1.00  37.52 ? 211 LYS D O   1 
ATOM   6528 C  CB  . LYS D 1 212 ? 31.546  18.653  112.888 1.00  36.18 ? 211 LYS D CB  1 
ATOM   6529 C  CG  . LYS D 1 212 ? 30.847  19.975  112.584 1.00  35.76 ? 211 LYS D CG  1 
ATOM   6530 C  CD  . LYS D 1 212 ? 31.079  20.998  113.686 1.00  37.06 ? 211 LYS D CD  1 
ATOM   6531 C  CE  . LYS D 1 212 ? 30.317  20.666  114.965 1.00  36.81 ? 211 LYS D CE  1 
ATOM   6532 N  NZ  . LYS D 1 212 ? 30.507  21.727  116.005 1.00  36.74 ? 211 LYS D NZ  1 
ATOM   6533 N  N   . LEU D 1 213 ? 31.917  15.328  112.115 1.00  37.99 ? 212 LEU D N   1 
ATOM   6534 C  CA  . LEU D 1 213 ? 32.605  14.113  112.553 1.00  38.95 ? 212 LEU D CA  1 
ATOM   6535 C  C   . LEU D 1 213 ? 33.013  13.171  111.418 1.00  39.96 ? 212 LEU D C   1 
ATOM   6536 O  O   . LEU D 1 213 ? 33.649  12.143  111.659 1.00  40.17 ? 212 LEU D O   1 
ATOM   6537 C  CB  . LEU D 1 213 ? 31.757  13.371  113.595 1.00  38.80 ? 212 LEU D CB  1 
ATOM   6538 C  CG  . LEU D 1 213 ? 31.494  14.095  114.923 1.00  38.69 ? 212 LEU D CG  1 
ATOM   6539 C  CD1 . LEU D 1 213 ? 30.389  13.392  115.701 1.00  38.76 ? 212 LEU D CD1 1 
ATOM   6540 C  CD2 . LEU D 1 213 ? 32.766  14.208  115.773 1.00  39.89 ? 212 LEU D CD2 1 
ATOM   6541 N  N   . VAL D 1 214 ? 32.660  13.526  110.188 1.00  41.32 ? 213 VAL D N   1 
ATOM   6542 C  CA  . VAL D 1 214 ? 32.944  12.676  109.029 1.00  42.77 ? 213 VAL D CA  1 
ATOM   6543 C  C   . VAL D 1 214 ? 34.390  12.873  108.570 1.00  43.65 ? 213 VAL D C   1 
ATOM   6544 O  O   . VAL D 1 214 ? 34.798  14.003  108.291 1.00  43.83 ? 213 VAL D O   1 
ATOM   6545 C  CB  . VAL D 1 214 ? 31.971  12.955  107.861 1.00  42.76 ? 213 VAL D CB  1 
ATOM   6546 C  CG1 . VAL D 1 214 ? 32.177  11.949  106.727 1.00  43.37 ? 213 VAL D CG1 1 
ATOM   6547 C  CG2 . VAL D 1 214 ? 30.530  12.913  108.348 1.00  43.14 ? 213 VAL D CG2 1 
ATOM   6548 N  N   . PRO D 1 215 ? 35.167  11.773  108.489 1.00  44.72 ? 214 PRO D N   1 
ATOM   6549 C  CA  . PRO D 1 215 ? 36.579  11.862  108.107 1.00  45.35 ? 214 PRO D CA  1 
ATOM   6550 C  C   . PRO D 1 215 ? 36.771  12.243  106.635 1.00  46.00 ? 214 PRO D C   1 
ATOM   6551 O  O   . PRO D 1 215 ? 35.939  11.887  105.795 1.00  45.95 ? 214 PRO D O   1 
ATOM   6552 C  CB  . PRO D 1 215 ? 37.103  10.448  108.378 1.00  45.45 ? 214 PRO D CB  1 
ATOM   6553 C  CG  . PRO D 1 215 ? 35.899  9.563   108.235 1.00  45.17 ? 214 PRO D CG  1 
ATOM   6554 C  CD  . PRO D 1 215 ? 34.755  10.379  108.760 1.00  44.80 ? 214 PRO D CD  1 
ATOM   6555 N  N   . ARG D 1 216 ? 37.859  12.972  106.365 1.00  46.70 ? 215 ARG D N   1 
ATOM   6556 C  CA  . ARG D 1 216 ? 38.282  13.471  105.034 1.00  47.38 ? 215 ARG D CA  1 
ATOM   6557 C  C   . ARG D 1 216 ? 38.381  14.996  105.009 1.00  47.57 ? 215 ARG D C   1 
ATOM   6558 O  O   . ARG D 1 216 ? 38.699  15.594  103.976 1.00  47.88 ? 215 ARG D O   1 
ATOM   6559 C  CB  . ARG D 1 216 ? 37.406  12.970  103.875 1.00  47.60 ? 215 ARG D CB  1 
ATOM   6560 C  CG  . ARG D 1 216 ? 37.909  11.695  103.199 1.00  48.80 ? 215 ARG D CG  1 
ATOM   6561 C  CD  . ARG D 1 216 ? 37.347  11.583  101.788 1.00  50.77 ? 215 ARG D CD  1 
ATOM   6562 N  NE  . ARG D 1 216 ? 37.585  10.268  101.190 1.00  52.30 ? 215 ARG D NE  1 
ATOM   6563 C  CZ  . ARG D 1 216 ? 37.431  9.991   99.895  1.00  53.05 ? 215 ARG D CZ  1 
ATOM   6564 N  NH1 . ARG D 1 216 ? 37.052  10.938  99.045  1.00  53.15 ? 215 ARG D NH1 1 
ATOM   6565 N  NH2 . ARG D 1 216 ? 37.665  8.764   99.446  1.00  53.54 ? 215 ARG D NH2 1 
HETATM 6566 FE FE  . FE  E 2 .   ? -11.949 22.255  19.868  0.70  18.91 ? 229 FE  A FE  1 
HETATM 6567 FE FE  . FE  F 2 .   ? -5.462  22.937  37.075  0.70  20.09 ? 229 FE  B FE  1 
HETATM 6568 FE FE  . FE  G 2 .   ? 6.547   28.231  80.516  0.70  20.58 ? 229 FE  C FE  1 
HETATM 6569 FE FE  . FE  H 2 .   ? 10.646  17.565  94.866  0.70  23.43 ? 229 FE  D FE  1 
HETATM 6570 O  O   . HOH I 3 .   ? -13.831 -5.984  17.143  1.00  17.18 ? 230 HOH A O   1 
HETATM 6571 O  O   . HOH I 3 .   ? -0.402  18.877  24.601  1.00  16.02 ? 231 HOH A O   1 
HETATM 6572 O  O   . HOH I 3 .   ? -13.028 -6.158  13.822  1.00  15.31 ? 232 HOH A O   1 
HETATM 6573 O  O   . HOH I 3 .   ? -9.680  22.116  19.869  1.00  19.74 ? 233 HOH A O   1 
HETATM 6574 O  O   . HOH I 3 .   ? -0.720  10.317  22.813  1.00  21.10 ? 234 HOH A O   1 
HETATM 6575 O  O   . HOH I 3 .   ? 2.116   18.303  18.082  1.00  19.04 ? 235 HOH A O   1 
HETATM 6576 O  O   . HOH I 3 .   ? -17.633 21.321  26.938  1.00  20.73 ? 236 HOH A O   1 
HETATM 6577 O  O   . HOH I 3 .   ? -25.551 17.446  20.148  1.00  22.52 ? 237 HOH A O   1 
HETATM 6578 O  O   . HOH I 3 .   ? -24.096 25.251  11.525  1.00  27.81 ? 238 HOH A O   1 
HETATM 6579 O  O   . HOH I 3 .   ? -17.661 3.798   16.361  1.00  17.61 ? 239 HOH A O   1 
HETATM 6580 O  O   . HOH I 3 .   ? -1.050  24.425  17.479  1.00  20.27 ? 240 HOH A O   1 
HETATM 6581 O  O   . HOH I 3 .   ? -7.341  -10.318 13.659  1.00  17.77 ? 241 HOH A O   1 
HETATM 6582 O  O   . HOH I 3 .   ? -17.907 19.440  20.095  1.00  24.88 ? 242 HOH A O   1 
HETATM 6583 O  O   . HOH I 3 .   ? -10.578 29.518  19.980  1.00  26.18 ? 243 HOH A O   1 
HETATM 6584 O  O   . HOH I 3 .   ? -21.178 5.365   10.929  1.00  22.11 ? 244 HOH A O   1 
HETATM 6585 O  O   . HOH I 3 .   ? 1.606   10.114  18.835  1.00  19.28 ? 245 HOH A O   1 
HETATM 6586 O  O   . HOH I 3 .   ? 1.744   23.368  24.613  1.00  18.02 ? 246 HOH A O   1 
HETATM 6587 O  O   . HOH I 3 .   ? -19.468 7.301   28.099  1.00  24.36 ? 247 HOH A O   1 
HETATM 6588 O  O   . HOH I 3 .   ? -4.141  16.353  30.326  1.00  14.75 ? 248 HOH A O   1 
HETATM 6589 O  O   . HOH I 3 .   ? -9.759  16.925  31.712  1.00  19.68 ? 249 HOH A O   1 
HETATM 6590 O  O   . HOH I 3 .   ? -13.062 8.480   -1.557  1.00  21.70 ? 250 HOH A O   1 
HETATM 6591 O  O   . HOH I 3 .   ? -13.960 10.936  -2.484  1.00  23.91 ? 251 HOH A O   1 
HETATM 6592 O  O   . HOH I 3 .   ? -26.599 21.278  26.174  1.00  29.32 ? 252 HOH A O   1 
HETATM 6593 O  O   . HOH I 3 .   ? -4.331  0.293   4.966   1.00  31.98 ? 253 HOH A O   1 
HETATM 6594 O  O   . HOH I 3 .   ? -19.378 20.899  8.188   1.00  29.13 ? 254 HOH A O   1 
HETATM 6595 O  O   . HOH I 3 .   ? 2.872   14.649  18.285  1.00  25.48 ? 255 HOH A O   1 
HETATM 6596 O  O   . HOH I 3 .   ? -7.692  22.328  26.675  1.00  18.19 ? 256 HOH A O   1 
HETATM 6597 O  O   . HOH I 3 .   ? -16.706 21.398  8.625   1.00  18.07 ? 257 HOH A O   1 
HETATM 6598 O  O   . HOH I 3 .   ? -14.638 1.061   3.916   1.00  28.03 ? 258 HOH A O   1 
HETATM 6599 O  O   . HOH I 3 .   ? -7.974  11.455  2.479   1.00  31.42 ? 259 HOH A O   1 
HETATM 6600 O  O   . HOH I 3 .   ? 1.405   14.093  25.728  1.00  23.30 ? 260 HOH A O   1 
HETATM 6601 O  O   . HOH I 3 .   ? -17.426 -5.762  7.012   1.00  28.61 ? 261 HOH A O   1 
HETATM 6602 O  O   . HOH I 3 .   ? 2.226   16.888  26.299  1.00  30.12 ? 262 HOH A O   1 
HETATM 6603 O  O   . HOH I 3 .   ? -4.563  -6.303  18.773  1.00  22.46 ? 263 HOH A O   1 
HETATM 6604 O  O   . HOH I 3 .   ? -8.117  36.993  5.397   1.00  26.20 ? 264 HOH A O   1 
HETATM 6605 O  O   . HOH I 3 .   ? -19.227 29.537  5.480   1.00  28.27 ? 265 HOH A O   1 
HETATM 6606 O  O   . HOH I 3 .   ? -14.199 33.223  2.315   1.00  26.73 ? 266 HOH A O   1 
HETATM 6607 O  O   . HOH I 3 .   ? -18.690 16.591  24.946  1.00  26.10 ? 267 HOH A O   1 
HETATM 6608 O  O   . HOH I 3 .   ? -16.600 17.428  21.459  1.00  21.38 ? 268 HOH A O   1 
HETATM 6609 O  O   . HOH I 3 .   ? -19.168 18.854  27.069  1.00  26.93 ? 269 HOH A O   1 
HETATM 6610 O  O   . HOH I 3 .   ? -18.543 3.480   23.119  1.00  29.43 ? 270 HOH A O   1 
HETATM 6611 O  O   . HOH I 3 .   ? -19.697 19.671  5.789   1.00  24.97 ? 271 HOH A O   1 
HETATM 6612 O  O   . HOH I 3 .   ? -14.760 27.086  5.729   1.00  33.07 ? 272 HOH A O   1 
HETATM 6613 O  O   . HOH I 3 .   ? 1.778   23.092  19.515  1.00  26.83 ? 273 HOH A O   1 
HETATM 6614 O  O   . HOH I 3 .   ? 1.988   25.857  18.876  1.00  37.28 ? 274 HOH A O   1 
HETATM 6615 O  O   . HOH I 3 .   ? -7.778  30.705  20.316  1.00  26.35 ? 275 HOH A O   1 
HETATM 6616 O  O   . HOH I 3 .   ? -8.698  -2.947  3.117   1.00  30.44 ? 276 HOH A O   1 
HETATM 6617 O  O   . HOH I 3 .   ? -14.013 24.596  6.418   1.00  25.90 ? 277 HOH A O   1 
HETATM 6618 O  O   . HOH I 3 .   ? -20.425 14.683  7.407   1.00  30.36 ? 278 HOH A O   1 
HETATM 6619 O  O   . HOH I 3 .   ? -7.469  28.380  21.626  1.00  23.65 ? 279 HOH A O   1 
HETATM 6620 O  O   . HOH I 3 .   ? -23.970 21.379  28.573  1.00  28.92 ? 280 HOH A O   1 
HETATM 6621 O  O   . HOH I 3 .   ? -12.102 21.772  37.547  1.00  32.04 ? 281 HOH A O   1 
HETATM 6622 O  O   . HOH I 3 .   ? -3.256  -0.560  7.366   1.00  27.71 ? 282 HOH A O   1 
HETATM 6623 O  O   . HOH I 3 .   ? 2.959   34.257  14.526  1.00  36.07 ? 283 HOH A O   1 
HETATM 6624 O  O   . HOH I 3 .   ? 2.025   14.181  6.856   1.00  28.77 ? 284 HOH A O   1 
HETATM 6625 O  O   . HOH I 3 .   ? -23.051 8.162   25.545  1.00  28.75 ? 285 HOH A O   1 
HETATM 6626 O  O   . HOH I 3 .   ? -12.005 27.262  4.747   1.00  34.18 ? 286 HOH A O   1 
HETATM 6627 O  O   . HOH I 3 .   ? -26.106 13.512  11.108  1.00  32.27 ? 287 HOH A O   1 
HETATM 6628 O  O   . HOH I 3 .   ? -27.281 24.882  21.561  1.00  34.63 ? 288 HOH A O   1 
HETATM 6629 O  O   . HOH I 3 .   ? -7.126  18.947  27.463  1.00  25.80 ? 289 HOH A O   1 
HETATM 6630 O  O   . HOH I 3 .   ? -8.983  14.912  33.336  1.00  28.79 ? 290 HOH A O   1 
HETATM 6631 O  O   . HOH I 3 .   ? -12.632 -1.727  22.678  1.00  26.20 ? 291 HOH A O   1 
HETATM 6632 O  O   . HOH I 3 .   ? -18.351 1.229   18.567  1.00  29.99 ? 292 HOH A O   1 
HETATM 6633 O  O   . HOH I 3 .   ? -7.973  -7.834  7.183   1.00  32.22 ? 293 HOH A O   1 
HETATM 6634 O  O   . HOH I 3 .   ? 7.024   19.567  9.529   1.00  33.10 ? 294 HOH A O   1 
HETATM 6635 O  O   . HOH I 3 .   ? -30.688 10.429  11.978  1.00  75.14 ? 295 HOH A O   1 
HETATM 6636 O  O   . HOH I 3 .   ? -6.381  31.838  18.404  1.00  28.55 ? 296 HOH A O   1 
HETATM 6637 O  O   . HOH I 3 .   ? -22.076 13.634  9.159   1.00  32.14 ? 297 HOH A O   1 
HETATM 6638 O  O   . HOH I 3 .   ? -16.352 -4.603  16.973  1.00  32.20 ? 298 HOH A O   1 
HETATM 6639 O  O   . HOH I 3 .   ? -6.735  17.488  30.202  1.00  31.79 ? 299 HOH A O   1 
HETATM 6640 O  O   . HOH I 3 .   ? -17.382 2.052   6.800   1.00  26.73 ? 300 HOH A O   1 
HETATM 6641 O  O   . HOH I 3 .   ? -15.654 22.386  6.219   1.00  26.16 ? 301 HOH A O   1 
HETATM 6642 O  O   . HOH I 3 .   ? -4.948  29.618  2.990   1.00  38.78 ? 302 HOH A O   1 
HETATM 6643 O  O   . HOH I 3 .   ? -10.132 19.972  7.206   1.00  33.80 ? 303 HOH A O   1 
HETATM 6644 O  O   . HOH I 3 .   ? -23.834 23.261  30.474  1.00  30.02 ? 304 HOH A O   1 
HETATM 6645 O  O   . HOH I 3 .   ? -24.401 5.277   17.360  1.00  37.40 ? 305 HOH A O   1 
HETATM 6646 O  O   . HOH I 3 .   ? -17.187 -2.681  20.450  1.00  45.78 ? 306 HOH A O   1 
HETATM 6647 O  O   . HOH I 3 .   ? -14.332 -6.147  23.002  1.00  37.06 ? 307 HOH A O   1 
HETATM 6648 O  O   . HOH I 3 .   ? -12.904 5.272   27.639  1.00  35.12 ? 308 HOH A O   1 
HETATM 6649 O  O   . HOH I 3 .   ? -7.028  16.960  8.775   1.00  31.73 ? 309 HOH A O   1 
HETATM 6650 O  O   . HOH I 3 .   ? -4.750  -10.667 13.995  1.00  26.40 ? 310 HOH A O   1 
HETATM 6651 O  O   . HOH I 3 .   ? -20.213 23.979  5.470   1.00  30.77 ? 311 HOH A O   1 
HETATM 6652 O  O   . HOH I 3 .   ? -12.620 7.836   21.185  1.00  26.69 ? 312 HOH A O   1 
HETATM 6653 O  O   . HOH I 3 .   ? 3.941   9.589   12.418  1.00  30.90 ? 313 HOH A O   1 
HETATM 6654 O  O   . HOH I 3 .   ? -22.668 2.645   18.858  1.00  36.23 ? 314 HOH A O   1 
HETATM 6655 O  O   . HOH I 3 .   ? -7.200  -10.643 10.879  1.00  27.79 ? 315 HOH A O   1 
HETATM 6656 O  O   . HOH I 3 .   ? -3.606  36.262  13.914  1.00  33.12 ? 316 HOH A O   1 
HETATM 6657 O  O   . HOH I 3 .   ? -12.236 11.557  -4.676  1.00  31.43 ? 317 HOH A O   1 
HETATM 6658 O  O   . HOH I 3 .   ? -11.348 32.657  0.175   1.00  33.85 ? 318 HOH A O   1 
HETATM 6659 O  O   . HOH I 3 .   ? -20.293 16.988  5.832   1.00  31.62 ? 319 HOH A O   1 
HETATM 6660 O  O   . HOH I 3 .   ? -2.102  4.191   21.591  1.00  29.46 ? 320 HOH A O   1 
HETATM 6661 O  O   . HOH I 3 .   ? -17.683 23.051  4.508   1.00  29.69 ? 321 HOH A O   1 
HETATM 6662 O  O   . HOH I 3 .   ? -15.069 34.755  7.945   1.00  33.31 ? 322 HOH A O   1 
HETATM 6663 O  O   . HOH I 3 .   ? -19.000 -3.674  10.323  1.00  32.65 ? 323 HOH A O   1 
HETATM 6664 O  O   . HOH I 3 .   ? -3.893  13.639  30.129  1.00  32.99 ? 324 HOH A O   1 
HETATM 6665 O  O   . HOH I 3 .   ? -14.090 11.155  38.237  1.00  31.03 ? 325 HOH A O   1 
HETATM 6666 O  O   . HOH I 3 .   ? -21.140 6.262   26.398  1.00  34.07 ? 326 HOH A O   1 
HETATM 6667 O  O   . HOH I 3 .   ? -22.603 10.161  27.323  1.00  34.08 ? 327 HOH A O   1 
HETATM 6668 O  O   . HOH I 3 .   ? -28.651 23.038  25.575  1.00  36.64 ? 328 HOH A O   1 
HETATM 6669 O  O   . HOH I 3 .   ? -8.038  2.296   26.124  1.00  36.75 ? 329 HOH A O   1 
HETATM 6670 O  O   . HOH I 3 .   ? 3.585   22.430  7.317   1.00  39.66 ? 330 HOH A O   1 
HETATM 6671 O  O   . HOH I 3 .   ? -10.473 38.423  11.244  1.00  37.16 ? 331 HOH A O   1 
HETATM 6672 O  O   . HOH I 3 .   ? 5.639   33.014  14.257  1.00  38.54 ? 332 HOH A O   1 
HETATM 6673 O  O   . HOH I 3 .   ? 3.314   8.366   17.703  1.00  32.11 ? 333 HOH A O   1 
HETATM 6674 O  O   . HOH I 3 .   ? -8.970  12.988  5.225   1.00  35.29 ? 334 HOH A O   1 
HETATM 6675 O  O   . HOH I 3 .   ? -4.666  -2.480  20.742  1.00  31.48 ? 335 HOH A O   1 
HETATM 6676 O  O   . HOH I 3 .   ? -4.004  -8.267  12.301  1.00  36.68 ? 336 HOH A O   1 
HETATM 6677 O  O   . HOH I 3 .   ? -16.382 10.273  -3.259  1.00  32.46 ? 337 HOH A O   1 
HETATM 6678 O  O   . HOH I 3 .   ? -19.720 32.461  15.061  1.00  32.31 ? 338 HOH A O   1 
HETATM 6679 O  O   . HOH I 3 .   ? -17.808 -2.265  17.982  1.00  44.45 ? 339 HOH A O   1 
HETATM 6680 O  O   . HOH I 3 .   ? -18.386 12.025  -2.570  1.00  33.66 ? 340 HOH A O   1 
HETATM 6681 O  O   . HOH I 3 .   ? -7.269  -1.313  1.877   1.00  38.52 ? 341 HOH A O   1 
HETATM 6682 O  O   . HOH I 3 .   ? -11.871 30.777  21.976  1.00  35.83 ? 342 HOH A O   1 
HETATM 6683 O  O   . HOH I 3 .   ? -9.826  12.436  36.608  1.00  32.31 ? 343 HOH A O   1 
HETATM 6684 O  O   . HOH I 3 .   ? -16.138 13.847  37.831  1.00  36.42 ? 344 HOH A O   1 
HETATM 6685 O  O   . HOH I 3 .   ? -13.492 20.610  5.153   1.00  37.80 ? 345 HOH A O   1 
HETATM 6686 O  O   . HOH J 3 .   ? -3.815  22.927  35.631  1.00  20.33 ? 230 HOH B O   1 
HETATM 6687 O  O   . HOH J 3 .   ? 4.027   19.601  31.919  1.00  18.96 ? 231 HOH B O   1 
HETATM 6688 O  O   . HOH J 3 .   ? 0.416   25.514  26.045  1.00  17.64 ? 232 HOH B O   1 
HETATM 6689 O  O   . HOH J 3 .   ? -6.786  22.859  29.188  1.00  18.15 ? 233 HOH B O   1 
HETATM 6690 O  O   . HOH J 3 .   ? -14.307 24.815  35.427  1.00  20.55 ? 234 HOH B O   1 
HETATM 6691 O  O   . HOH J 3 .   ? -5.848  28.409  23.955  1.00  16.48 ? 235 HOH B O   1 
HETATM 6692 O  O   . HOH J 3 .   ? -15.422 29.191  45.468  1.00  24.86 ? 236 HOH B O   1 
HETATM 6693 O  O   . HOH J 3 .   ? -6.462  26.153  28.117  1.00  23.35 ? 237 HOH B O   1 
HETATM 6694 O  O   . HOH J 3 .   ? 4.962   20.794  28.645  1.00  23.08 ? 238 HOH B O   1 
HETATM 6695 O  O   . HOH J 3 .   ? -11.027 28.472  26.523  1.00  23.05 ? 239 HOH B O   1 
HETATM 6696 O  O   . HOH J 3 .   ? 1.559   20.699  24.585  1.00  21.05 ? 240 HOH B O   1 
HETATM 6697 O  O   . HOH J 3 .   ? -11.106 30.466  24.711  1.00  27.94 ? 241 HOH B O   1 
HETATM 6698 O  O   . HOH J 3 .   ? -3.783  16.559  33.160  1.00  26.42 ? 242 HOH B O   1 
HETATM 6699 O  O   . HOH J 3 .   ? -1.622  22.252  25.875  1.00  17.84 ? 243 HOH B O   1 
HETATM 6700 O  O   . HOH J 3 .   ? 3.329   8.074   36.651  1.00  28.13 ? 244 HOH B O   1 
HETATM 6701 O  O   . HOH J 3 .   ? -15.391 27.519  36.155  1.00  27.36 ? 245 HOH B O   1 
HETATM 6702 O  O   . HOH J 3 .   ? -9.938  20.930  51.350  1.00  32.60 ? 246 HOH B O   1 
HETATM 6703 O  O   . HOH J 3 .   ? -5.534  41.686  42.976  1.00  31.90 ? 247 HOH B O   1 
HETATM 6704 O  O   . HOH J 3 .   ? 6.384   18.562  49.061  1.00  29.54 ? 248 HOH B O   1 
HETATM 6705 O  O   . HOH J 3 .   ? 1.580   29.862  23.771  1.00  21.93 ? 249 HOH B O   1 
HETATM 6706 O  O   . HOH J 3 .   ? 10.681  10.376  30.459  1.00  33.96 ? 250 HOH B O   1 
HETATM 6707 O  O   . HOH J 3 .   ? 7.286   31.022  45.894  1.00  28.05 ? 251 HOH B O   1 
HETATM 6708 O  O   . HOH J 3 .   ? 2.111   33.703  27.229  1.00  27.67 ? 252 HOH B O   1 
HETATM 6709 O  O   . HOH J 3 .   ? 6.600   33.681  28.824  1.00  26.53 ? 253 HOH B O   1 
HETATM 6710 O  O   . HOH J 3 .   ? -1.668  23.828  48.874  1.00  22.07 ? 254 HOH B O   1 
HETATM 6711 O  O   . HOH J 3 .   ? 6.698   25.378  29.158  1.00  20.43 ? 255 HOH B O   1 
HETATM 6712 O  O   . HOH J 3 .   ? -20.305 25.328  38.219  1.00  32.54 ? 256 HOH B O   1 
HETATM 6713 O  O   . HOH J 3 .   ? -9.971  26.428  40.634  1.00  31.22 ? 257 HOH B O   1 
HETATM 6714 O  O   . HOH J 3 .   ? -2.495  15.972  52.976  1.00  27.40 ? 258 HOH B O   1 
HETATM 6715 O  O   . HOH J 3 .   ? 14.300  28.656  37.754  1.00  31.81 ? 259 HOH B O   1 
HETATM 6716 O  O   . HOH J 3 .   ? -3.437  24.524  50.603  1.00  25.51 ? 260 HOH B O   1 
HETATM 6717 O  O   . HOH J 3 .   ? 14.467  39.265  35.637  1.00  40.85 ? 261 HOH B O   1 
HETATM 6718 O  O   . HOH J 3 .   ? 11.484  44.034  40.561  1.00  32.86 ? 262 HOH B O   1 
HETATM 6719 O  O   . HOH J 3 .   ? -3.725  14.146  34.533  1.00  24.87 ? 263 HOH B O   1 
HETATM 6720 O  O   . HOH J 3 .   ? -5.208  15.576  36.442  1.00  27.15 ? 264 HOH B O   1 
HETATM 6721 O  O   . HOH J 3 .   ? 18.434  9.176   38.895  1.00  37.31 ? 265 HOH B O   1 
HETATM 6722 O  O   . HOH J 3 .   ? 6.294   11.548  52.186  1.00  35.61 ? 266 HOH B O   1 
HETATM 6723 O  O   . HOH J 3 .   ? 16.620  7.430   41.565  1.00  38.69 ? 267 HOH B O   1 
HETATM 6724 O  O   . HOH J 3 .   ? 5.730   7.248   45.971  1.00  30.41 ? 268 HOH B O   1 
HETATM 6725 O  O   . HOH J 3 .   ? -17.136 24.105  23.683  1.00  24.84 ? 269 HOH B O   1 
HETATM 6726 O  O   . HOH J 3 .   ? 5.010   17.775  28.865  1.00  42.24 ? 270 HOH B O   1 
HETATM 6727 O  O   . HOH J 3 .   ? -14.803 39.011  35.048  1.00  30.57 ? 271 HOH B O   1 
HETATM 6728 O  O   . HOH J 3 .   ? -9.207  13.231  46.118  1.00  30.71 ? 272 HOH B O   1 
HETATM 6729 O  O   . HOH J 3 .   ? 9.614   32.127  47.422  1.00  39.35 ? 273 HOH B O   1 
HETATM 6730 O  O   . HOH J 3 .   ? -4.660  40.319  49.291  1.00  30.73 ? 274 HOH B O   1 
HETATM 6731 O  O   . HOH J 3 .   ? -9.656  28.258  38.774  1.00  26.70 ? 275 HOH B O   1 
HETATM 6732 O  O   . HOH J 3 .   ? 1.451   20.424  48.862  1.00  30.41 ? 276 HOH B O   1 
HETATM 6733 O  O   . HOH J 3 .   ? 17.357  27.878  33.663  1.00  45.09 ? 277 HOH B O   1 
HETATM 6734 O  O   . HOH J 3 .   ? -1.294  12.892  34.946  1.00  28.24 ? 278 HOH B O   1 
HETATM 6735 O  O   . HOH J 3 .   ? -7.571  14.328  35.929  1.00  37.14 ? 279 HOH B O   1 
HETATM 6736 O  O   . HOH J 3 .   ? 10.652  21.271  26.690  1.00  39.25 ? 280 HOH B O   1 
HETATM 6737 O  O   . HOH J 3 .   ? 3.336   11.491  52.265  1.00  52.30 ? 281 HOH B O   1 
HETATM 6738 O  O   . HOH J 3 .   ? 14.479  20.657  36.514  1.00  28.58 ? 282 HOH B O   1 
HETATM 6739 O  O   . HOH J 3 .   ? -13.440 29.673  37.324  1.00  34.44 ? 283 HOH B O   1 
HETATM 6740 O  O   . HOH J 3 .   ? 0.818   11.204  33.391  1.00  31.75 ? 284 HOH B O   1 
HETATM 6741 O  O   . HOH J 3 .   ? 0.625   22.750  49.933  1.00  30.69 ? 285 HOH B O   1 
HETATM 6742 O  O   . HOH J 3 .   ? 8.087   9.407   31.910  1.00  30.80 ? 286 HOH B O   1 
HETATM 6743 O  O   . HOH J 3 .   ? 7.403   28.960  28.545  1.00  31.82 ? 287 HOH B O   1 
HETATM 6744 O  O   . HOH J 3 .   ? 9.234   35.339  53.583  1.00  33.39 ? 288 HOH B O   1 
HETATM 6745 O  O   . HOH J 3 .   ? 5.991   27.175  42.356  1.00  33.48 ? 289 HOH B O   1 
HETATM 6746 O  O   . HOH J 3 .   ? 3.885   17.705  48.805  1.00  33.06 ? 290 HOH B O   1 
HETATM 6747 O  O   . HOH J 3 .   ? 3.125   38.939  54.019  1.00  39.30 ? 291 HOH B O   1 
HETATM 6748 O  O   . HOH J 3 .   ? -5.449  37.497  36.077  1.00  37.17 ? 292 HOH B O   1 
HETATM 6749 O  O   . HOH J 3 .   ? 16.244  13.081  33.831  1.00  37.56 ? 293 HOH B O   1 
HETATM 6750 O  O   . HOH J 3 .   ? 16.887  19.840  35.798  1.00  36.11 ? 294 HOH B O   1 
HETATM 6751 O  O   . HOH J 3 .   ? 2.264   12.393  31.582  1.00  34.25 ? 295 HOH B O   1 
HETATM 6752 O  O   . HOH J 3 .   ? -3.139  30.863  51.767  1.00  33.65 ? 296 HOH B O   1 
HETATM 6753 O  O   . HOH J 3 .   ? -7.027  43.980  42.392  1.00  43.90 ? 297 HOH B O   1 
HETATM 6754 O  O   . HOH J 3 .   ? -5.432  32.042  51.529  1.00  41.98 ? 298 HOH B O   1 
HETATM 6755 O  O   . HOH J 3 .   ? -5.107  31.360  23.889  1.00  34.75 ? 299 HOH B O   1 
HETATM 6756 O  O   . HOH J 3 .   ? -24.356 19.595  38.619  1.00  44.33 ? 300 HOH B O   1 
HETATM 6757 O  O   . HOH J 3 .   ? 10.089  14.383  45.788  1.00  34.80 ? 301 HOH B O   1 
HETATM 6758 O  O   . HOH J 3 .   ? 14.080  11.468  29.298  1.00  38.18 ? 302 HOH B O   1 
HETATM 6759 O  O   . HOH J 3 .   ? 1.221   17.807  49.771  1.00  40.85 ? 303 HOH B O   1 
HETATM 6760 O  O   . HOH J 3 .   ? 15.672  23.041  32.548  1.00  39.04 ? 304 HOH B O   1 
HETATM 6761 O  O   . HOH J 3 .   ? -15.982 38.456  39.461  1.00  41.94 ? 305 HOH B O   1 
HETATM 6762 O  O   . HOH J 3 .   ? -20.643 25.538  41.574  1.00  40.85 ? 306 HOH B O   1 
HETATM 6763 O  O   . HOH J 3 .   ? 14.940  0.990   43.418  1.00  43.84 ? 307 HOH B O   1 
HETATM 6764 O  O   . HOH J 3 .   ? -1.181  10.239  48.319  1.00  33.71 ? 308 HOH B O   1 
HETATM 6765 O  O   . HOH J 3 .   ? -19.785 33.959  34.586  1.00  39.65 ? 309 HOH B O   1 
HETATM 6766 O  O   . HOH J 3 .   ? -7.692  27.462  25.903  1.00  30.91 ? 310 HOH B O   1 
HETATM 6767 O  O   . HOH J 3 .   ? -6.456  12.593  49.237  1.00  40.31 ? 311 HOH B O   1 
HETATM 6768 O  O   . HOH J 3 .   ? 5.379   6.530   35.795  1.00  44.52 ? 312 HOH B O   1 
HETATM 6769 O  O   . HOH J 3 .   ? -1.425  8.968   45.760  1.00  39.65 ? 313 HOH B O   1 
HETATM 6770 O  O   . HOH J 3 .   ? 5.563   43.100  50.457  1.00  34.14 ? 314 HOH B O   1 
HETATM 6771 O  O   . HOH J 3 .   ? 7.187   7.022   33.619  -3.97 2.00  ? 315 HOH B O   1 
HETATM 6772 O  O   . HOH J 3 .   ? 17.114  33.967  39.966  1.00  41.78 ? 316 HOH B O   1 
HETATM 6773 O  O   . HOH J 3 .   ? 3.635   5.163   46.135  1.00  45.42 ? 317 HOH B O   1 
HETATM 6774 O  O   . HOH J 3 .   ? 1.598   27.094  22.768  1.00  37.30 ? 318 HOH B O   1 
HETATM 6775 O  O   . HOH K 3 .   ? 8.588   27.560  80.441  1.00  18.29 ? 230 HOH C O   1 
HETATM 6776 O  O   . HOH K 3 .   ? -0.191  24.944  85.656  1.00  20.25 ? 231 HOH C O   1 
HETATM 6777 O  O   . HOH K 3 .   ? 0.155   27.346  79.161  1.00  26.06 ? 232 HOH C O   1 
HETATM 6778 O  O   . HOH K 3 .   ? 17.796  28.577  79.775  1.00  20.42 ? 233 HOH C O   1 
HETATM 6779 O  O   . HOH K 3 .   ? -7.686  27.636  77.926  1.00  25.40 ? 234 HOH C O   1 
HETATM 6780 O  O   . HOH K 3 .   ? 16.341  20.056  82.244  1.00  20.57 ? 235 HOH C O   1 
HETATM 6781 O  O   . HOH K 3 .   ? 0.733   24.776  79.137  1.00  20.28 ? 236 HOH C O   1 
HETATM 6782 O  O   . HOH K 3 .   ? 9.800   23.355  86.040  1.00  18.25 ? 237 HOH C O   1 
HETATM 6783 O  O   . HOH K 3 .   ? 3.203   35.057  70.710  1.00  22.77 ? 238 HOH C O   1 
HETATM 6784 O  O   . HOH K 3 .   ? 19.463  23.150  84.881  1.00  20.36 ? 239 HOH C O   1 
HETATM 6785 O  O   . HOH K 3 .   ? 3.776   18.136  94.670  1.00  27.12 ? 240 HOH C O   1 
HETATM 6786 O  O   . HOH K 3 .   ? 17.399  15.981  72.358  1.00  25.32 ? 241 HOH C O   1 
HETATM 6787 O  O   . HOH K 3 .   ? -8.978  36.194  78.008  1.00  29.13 ? 242 HOH C O   1 
HETATM 6788 O  O   . HOH K 3 .   ? -2.209  23.348  84.408  1.00  27.64 ? 243 HOH C O   1 
HETATM 6789 O  O   . HOH K 3 .   ? 9.311   33.535  84.643  1.00  23.29 ? 244 HOH C O   1 
HETATM 6790 O  O   . HOH K 3 .   ? 0.543   35.283  70.337  1.00  25.62 ? 245 HOH C O   1 
HETATM 6791 O  O   . HOH K 3 .   ? 11.573  29.527  68.603  1.00  32.95 ? 246 HOH C O   1 
HETATM 6792 O  O   . HOH K 3 .   ? 5.972   16.855  87.010  1.00  25.84 ? 247 HOH C O   1 
HETATM 6793 O  O   . HOH K 3 .   ? 1.315   28.603  84.795  1.00  28.41 ? 248 HOH C O   1 
HETATM 6794 O  O   . HOH K 3 .   ? -6.452  26.022  89.707  1.00  29.35 ? 249 HOH C O   1 
HETATM 6795 O  O   . HOH K 3 .   ? 19.990  25.874  80.631  1.00  29.97 ? 250 HOH C O   1 
HETATM 6796 O  O   . HOH K 3 .   ? 1.035   9.758   58.607  1.00  25.05 ? 251 HOH C O   1 
HETATM 6797 O  O   . HOH K 3 .   ? 11.441  15.812  85.565  1.00  18.03 ? 252 HOH C O   1 
HETATM 6798 O  O   . HOH K 3 .   ? -4.696  22.177  63.451  1.00  25.31 ? 253 HOH C O   1 
HETATM 6799 O  O   . HOH K 3 .   ? 9.032   41.568  71.643  1.00  28.40 ? 254 HOH C O   1 
HETATM 6800 O  O   . HOH K 3 .   ? 14.034  35.136  84.952  1.00  31.52 ? 255 HOH C O   1 
HETATM 6801 O  O   . HOH K 3 .   ? -0.231  7.855   61.525  1.00  30.62 ? 256 HOH C O   1 
HETATM 6802 O  O   . HOH K 3 .   ? 11.841  30.905  85.303  1.00  22.83 ? 257 HOH C O   1 
HETATM 6803 O  O   . HOH K 3 .   ? 14.392  14.500  75.895  1.00  26.64 ? 258 HOH C O   1 
HETATM 6804 O  O   . HOH K 3 .   ? -2.604  21.544  53.450  1.00  32.69 ? 259 HOH C O   1 
HETATM 6805 O  O   . HOH K 3 .   ? -3.632  29.988  67.138  1.00  32.85 ? 260 HOH C O   1 
HETATM 6806 O  O   . HOH K 3 .   ? -8.976  27.626  85.133  1.00  29.66 ? 261 HOH C O   1 
HETATM 6807 O  O   . HOH K 3 .   ? 9.943   29.141  60.931  1.00  27.21 ? 262 HOH C O   1 
HETATM 6808 O  O   . HOH K 3 .   ? 17.229  13.994  68.206  1.00  55.95 ? 263 HOH C O   1 
HETATM 6809 O  O   . HOH K 3 .   ? -2.228  17.203  66.711  1.00  28.36 ? 264 HOH C O   1 
HETATM 6810 O  O   . HOH K 3 .   ? 2.801   16.124  73.295  1.00  31.52 ? 265 HOH C O   1 
HETATM 6811 O  O   . HOH K 3 .   ? 1.716   40.981  82.625  1.00  30.75 ? 266 HOH C O   1 
HETATM 6812 O  O   . HOH K 3 .   ? 4.625   36.990  69.286  1.00  24.37 ? 267 HOH C O   1 
HETATM 6813 O  O   . HOH K 3 .   ? 6.963   17.920  51.777  1.00  33.95 ? 268 HOH C O   1 
HETATM 6814 O  O   . HOH K 3 .   ? 1.742   21.631  55.206  1.00  30.57 ? 269 HOH C O   1 
HETATM 6815 O  O   . HOH K 3 .   ? 23.225  31.944  70.169  1.00  33.12 ? 270 HOH C O   1 
HETATM 6816 O  O   . HOH K 3 .   ? 6.618   38.049  70.835  1.00  29.27 ? 271 HOH C O   1 
HETATM 6817 O  O   . HOH K 3 .   ? 28.306  36.600  74.931  1.00  32.55 ? 272 HOH C O   1 
HETATM 6818 O  O   . HOH K 3 .   ? 23.872  37.591  82.694  1.00  28.33 ? 273 HOH C O   1 
HETATM 6819 O  O   . HOH K 3 .   ? 9.322   20.081  84.575  1.00  28.95 ? 274 HOH C O   1 
HETATM 6820 O  O   . HOH K 3 .   ? -2.129  22.397  81.494  1.00  32.63 ? 275 HOH C O   1 
HETATM 6821 O  O   . HOH K 3 .   ? 19.634  19.530  74.834  1.00  29.58 ? 276 HOH C O   1 
HETATM 6822 O  O   . HOH K 3 .   ? 6.029   40.767  71.378  1.00  29.18 ? 277 HOH C O   1 
HETATM 6823 O  O   . HOH K 3 .   ? 18.213  16.764  82.432  1.00  40.67 ? 278 HOH C O   1 
HETATM 6824 O  O   . HOH K 3 .   ? 18.573  33.980  84.983  1.00  32.06 ? 279 HOH C O   1 
HETATM 6825 O  O   . HOH K 3 .   ? 7.327   33.547  67.309  1.00  36.44 ? 280 HOH C O   1 
HETATM 6826 O  O   . HOH K 3 .   ? 28.461  43.119  72.144  1.00  40.91 ? 281 HOH C O   1 
HETATM 6827 O  O   . HOH K 3 .   ? 9.702   28.723  63.439  1.00  33.55 ? 282 HOH C O   1 
HETATM 6828 O  O   . HOH K 3 .   ? 9.633   33.002  68.987  1.00  29.30 ? 283 HOH C O   1 
HETATM 6829 O  O   . HOH K 3 .   ? 11.129  40.002  68.905  1.00  32.73 ? 284 HOH C O   1 
HETATM 6830 O  O   . HOH K 3 .   ? -4.850  13.736  78.497  1.00  29.87 ? 285 HOH C O   1 
HETATM 6831 O  O   . HOH K 3 .   ? 3.028   38.885  68.239  1.00  32.78 ? 286 HOH C O   1 
HETATM 6832 O  O   . HOH K 3 .   ? 12.744  45.657  82.331  1.00  35.16 ? 287 HOH C O   1 
HETATM 6833 O  O   . HOH K 3 .   ? 16.982  15.236  80.540  1.00  28.83 ? 288 HOH C O   1 
HETATM 6834 O  O   . HOH K 3 .   ? -10.855 33.148  72.105  1.00  34.09 ? 289 HOH C O   1 
HETATM 6835 O  O   . HOH K 3 .   ? 7.659   45.673  77.866  1.00  34.47 ? 290 HOH C O   1 
HETATM 6836 O  O   . HOH K 3 .   ? 18.103  40.779  83.610  1.00  29.78 ? 291 HOH C O   1 
HETATM 6837 O  O   . HOH K 3 .   ? 19.561  22.584  76.717  1.00  23.33 ? 292 HOH C O   1 
HETATM 6838 O  O   . HOH K 3 .   ? -3.962  38.083  75.551  1.00  35.86 ? 293 HOH C O   1 
HETATM 6839 O  O   . HOH K 3 .   ? -6.689  25.566  87.101  1.00  35.29 ? 294 HOH C O   1 
HETATM 6840 O  O   . HOH K 3 .   ? -0.936  21.238  58.179  1.00  39.11 ? 295 HOH C O   1 
HETATM 6841 O  O   . HOH K 3 .   ? 1.241   8.135   68.720  1.00  33.79 ? 296 HOH C O   1 
HETATM 6842 O  O   . HOH K 3 .   ? 21.443  21.125  78.146  1.00  34.83 ? 297 HOH C O   1 
HETATM 6843 O  O   . HOH K 3 .   ? 20.296  26.140  65.356  1.00  35.84 ? 298 HOH C O   1 
HETATM 6844 O  O   . HOH K 3 .   ? -3.466  14.362  67.052  1.00  32.94 ? 299 HOH C O   1 
HETATM 6845 O  O   . HOH K 3 .   ? 12.008  33.594  85.761  1.00  29.91 ? 300 HOH C O   1 
HETATM 6846 O  O   . HOH K 3 .   ? 5.770   30.915  56.015  1.00  34.94 ? 301 HOH C O   1 
HETATM 6847 O  O   . HOH K 3 .   ? 8.849   31.569  61.045  1.00  38.53 ? 302 HOH C O   1 
HETATM 6848 O  O   . HOH K 3 .   ? 25.748  27.511  70.377  1.00  34.02 ? 303 HOH C O   1 
HETATM 6849 O  O   . HOH K 3 .   ? 5.363   43.897  77.998  1.00  37.82 ? 304 HOH C O   1 
HETATM 6850 O  O   . HOH K 3 .   ? 8.771   19.596  52.368  1.00  43.08 ? 305 HOH C O   1 
HETATM 6851 O  O   . HOH K 3 .   ? -9.180  13.763  64.320  1.00  41.41 ? 306 HOH C O   1 
HETATM 6852 O  O   . HOH K 3 .   ? 1.303   11.110  76.737  1.00  36.38 ? 307 HOH C O   1 
HETATM 6853 O  O   . HOH K 3 .   ? -0.110  35.772  67.758  1.00  40.48 ? 308 HOH C O   1 
HETATM 6854 O  O   . HOH K 3 .   ? 12.482  10.921  71.060  1.00  34.02 ? 309 HOH C O   1 
HETATM 6855 O  O   . HOH K 3 .   ? 17.105  41.625  70.849  1.00  42.39 ? 310 HOH C O   1 
HETATM 6856 O  O   . HOH K 3 .   ? 11.118  13.780  83.676  1.00  39.53 ? 311 HOH C O   1 
HETATM 6857 O  O   . HOH K 3 .   ? -6.648  16.452  84.386  1.00  42.57 ? 312 HOH C O   1 
HETATM 6858 O  O   . HOH K 3 .   ? -6.837  14.659  76.474  1.00  43.50 ? 313 HOH C O   1 
HETATM 6859 O  O   . HOH K 3 .   ? -8.026  16.913  77.021  1.00  32.66 ? 314 HOH C O   1 
HETATM 6860 O  O   . HOH K 3 .   ? -7.453  23.132  86.891  1.00  45.60 ? 315 HOH C O   1 
HETATM 6861 O  O   . HOH K 3 .   ? 15.520  14.049  73.256  1.00  40.35 ? 316 HOH C O   1 
HETATM 6862 O  O   . HOH K 3 .   ? 13.453  38.107  88.349  1.00  39.08 ? 317 HOH C O   1 
HETATM 6863 O  O   . HOH K 3 .   ? 11.984  30.307  60.077  1.00  43.69 ? 318 HOH C O   1 
HETATM 6864 O  O   . HOH K 3 .   ? 22.001  23.393  84.535  1.00  34.75 ? 319 HOH C O   1 
HETATM 6865 O  O   . HOH K 3 .   ? -1.534  31.267  65.925  1.00  32.29 ? 320 HOH C O   1 
HETATM 6866 O  O   . HOH K 3 .   ? 5.703   39.414  85.952  1.00  37.34 ? 321 HOH C O   1 
HETATM 6867 O  O   . HOH K 3 .   ? -10.759 33.750  79.031  1.00  36.02 ? 322 HOH C O   1 
HETATM 6868 O  O   . HOH K 3 .   ? 16.728  35.802  85.482  1.00  33.81 ? 323 HOH C O   1 
HETATM 6869 O  O   . HOH L 3 .   ? 13.486  29.099  110.513 1.00  20.85 ? 230 HOH D O   1 
HETATM 6870 O  O   . HOH L 3 .   ? 15.716  22.263  85.288  1.00  12.46 ? 231 HOH D O   1 
HETATM 6871 O  O   . HOH L 3 .   ? 13.253  29.457  87.280  1.00  15.93 ? 232 HOH D O   1 
HETATM 6872 O  O   . HOH L 3 .   ? 18.422  24.280  87.247  1.00  18.62 ? 233 HOH D O   1 
HETATM 6873 O  O   . HOH L 3 .   ? 12.265  17.941  93.809  1.00  23.84 ? 234 HOH D O   1 
HETATM 6874 O  O   . HOH L 3 .   ? 18.697  21.026  83.409  1.00  20.19 ? 235 HOH D O   1 
HETATM 6875 O  O   . HOH L 3 .   ? 20.695  28.794  87.994  1.00  23.39 ? 236 HOH D O   1 
HETATM 6876 O  O   . HOH L 3 .   ? 2.549   22.142  94.612  1.00  22.90 ? 237 HOH D O   1 
HETATM 6877 O  O   . HOH L 3 .   ? 11.027  35.604  100.442 1.00  19.77 ? 238 HOH D O   1 
HETATM 6878 O  O   . HOH L 3 .   ? 9.840   33.576  107.339 1.00  23.95 ? 239 HOH D O   1 
HETATM 6879 O  O   . HOH L 3 .   ? 25.893  27.597  94.215  1.00  23.53 ? 240 HOH D O   1 
HETATM 6880 O  O   . HOH L 3 .   ? 24.858  15.152  108.616 1.00  23.07 ? 241 HOH D O   1 
HETATM 6881 O  O   . HOH L 3 .   ? 10.422  22.206  88.362  1.00  20.72 ? 242 HOH D O   1 
HETATM 6882 O  O   . HOH L 3 .   ? 21.977  35.517  114.701 1.00  24.33 ? 243 HOH D O   1 
HETATM 6883 O  O   . HOH L 3 .   ? 7.839   29.152  89.442  1.00  20.50 ? 244 HOH D O   1 
HETATM 6884 O  O   . HOH L 3 .   ? 1.649   30.759  103.182 1.00  27.49 ? 245 HOH D O   1 
HETATM 6885 O  O   . HOH L 3 .   ? 11.030  10.792  106.791 1.00  33.04 ? 246 HOH D O   1 
HETATM 6886 O  O   . HOH L 3 .   ? 25.653  23.855  91.272  1.00  29.74 ? 247 HOH D O   1 
HETATM 6887 O  O   . HOH L 3 .   ? 23.000  23.460  117.495 1.00  25.13 ? 248 HOH D O   1 
HETATM 6888 O  O   . HOH L 3 .   ? 17.417  36.929  99.585  1.00  29.02 ? 249 HOH D O   1 
HETATM 6889 O  O   . HOH L 3 .   ? 11.507  14.434  87.858  1.00  24.10 ? 250 HOH D O   1 
HETATM 6890 O  O   . HOH L 3 .   ? 21.680  29.656  93.047  1.00  27.76 ? 251 HOH D O   1 
HETATM 6891 O  O   . HOH L 3 .   ? 7.391   21.884  99.394  1.00  26.83 ? 252 HOH D O   1 
HETATM 6892 O  O   . HOH L 3 .   ? 6.394   36.511  95.129  1.00  34.41 ? 253 HOH D O   1 
HETATM 6893 O  O   . HOH L 3 .   ? 2.167   23.918  96.723  1.00  26.90 ? 254 HOH D O   1 
HETATM 6894 O  O   . HOH L 3 .   ? 29.808  26.243  116.618 1.00  31.53 ? 255 HOH D O   1 
HETATM 6895 O  O   . HOH L 3 .   ? 3.923   24.637  98.898  1.00  31.71 ? 256 HOH D O   1 
HETATM 6896 O  O   . HOH L 3 .   ? 19.587  37.396  113.079 1.00  28.77 ? 257 HOH D O   1 
HETATM 6897 O  O   . HOH L 3 .   ? 23.913  20.886  89.703  1.00  24.45 ? 258 HOH D O   1 
HETATM 6898 O  O   . HOH L 3 .   ? 19.750  15.463  88.790  1.00  25.80 ? 259 HOH D O   1 
HETATM 6899 O  O   . HOH L 3 .   ? 0.689   34.856  91.151  1.00  35.80 ? 260 HOH D O   1 
HETATM 6900 O  O   . HOH L 3 .   ? 12.729  10.774  104.939 1.00  28.21 ? 261 HOH D O   1 
HETATM 6901 O  O   . HOH L 3 .   ? 2.818   37.369  91.334  1.00  26.33 ? 262 HOH D O   1 
HETATM 6902 O  O   . HOH L 3 .   ? 20.065  26.773  85.929  1.00  31.98 ? 263 HOH D O   1 
HETATM 6903 O  O   . HOH L 3 .   ? 12.449  9.807   87.410  1.00  34.04 ? 264 HOH D O   1 
HETATM 6904 O  O   . HOH L 3 .   ? 9.109   1.985   97.722  1.00  43.93 ? 265 HOH D O   1 
HETATM 6905 O  O   . HOH L 3 .   ? 12.810  24.290  114.894 1.00  24.91 ? 266 HOH D O   1 
HETATM 6906 O  O   . HOH L 3 .   ? 16.411  37.643  106.779 1.00  23.52 ? 267 HOH D O   1 
HETATM 6907 O  O   . HOH L 3 .   ? 19.365  24.474  116.921 1.00  24.68 ? 268 HOH D O   1 
HETATM 6908 O  O   . HOH L 3 .   ? 22.902  15.831  106.926 1.00  30.05 ? 269 HOH D O   1 
HETATM 6909 O  O   . HOH L 3 .   ? 31.454  28.348  109.590 1.00  40.50 ? 270 HOH D O   1 
HETATM 6910 O  O   . HOH L 3 .   ? 6.371   19.398  99.814  1.00  27.35 ? 271 HOH D O   1 
HETATM 6911 O  O   . HOH L 3 .   ? 13.770  29.609  102.341 1.00  24.40 ? 272 HOH D O   1 
HETATM 6912 O  O   . HOH L 3 .   ? 0.697   20.365  105.254 1.00  28.84 ? 273 HOH D O   1 
HETATM 6913 O  O   . HOH L 3 .   ? 3.123   30.989  105.556 1.00  27.67 ? 274 HOH D O   1 
HETATM 6914 O  O   . HOH L 3 .   ? 11.614  25.423  89.380  1.00  27.14 ? 275 HOH D O   1 
HETATM 6915 O  O   . HOH L 3 .   ? 1.455   33.990  99.306  1.00  35.29 ? 276 HOH D O   1 
HETATM 6916 O  O   . HOH L 3 .   ? 4.295   38.067  93.503  1.00  25.81 ? 277 HOH D O   1 
HETATM 6917 O  O   . HOH L 3 .   ? 2.244   38.774  94.949  1.00  26.75 ? 278 HOH D O   1 
HETATM 6918 O  O   . HOH L 3 .   ? 23.499  33.327  98.031  1.00  29.44 ? 279 HOH D O   1 
HETATM 6919 O  O   . HOH L 3 .   ? -4.352  20.907  100.007 1.00  32.13 ? 280 HOH D O   1 
HETATM 6920 O  O   . HOH L 3 .   ? 24.355  7.747   81.913  1.00  36.55 ? 281 HOH D O   1 
HETATM 6921 O  O   . HOH L 3 .   ? 10.526  11.552  87.728  1.00  32.73 ? 282 HOH D O   1 
HETATM 6922 O  O   . HOH L 3 .   ? 10.891  27.807  88.279  1.00  30.95 ? 283 HOH D O   1 
HETATM 6923 O  O   . HOH L 3 .   ? -3.424  22.525  97.252  1.00  31.60 ? 284 HOH D O   1 
HETATM 6924 O  O   . HOH L 3 .   ? 9.496   12.045  90.100  1.00  30.18 ? 285 HOH D O   1 
HETATM 6925 O  O   . HOH L 3 .   ? 22.488  29.223  90.229  1.00  37.48 ? 286 HOH D O   1 
HETATM 6926 O  O   . HOH L 3 .   ? 27.414  13.728  107.877 1.00  27.85 ? 287 HOH D O   1 
HETATM 6927 O  O   . HOH L 3 .   ? 27.309  11.320  109.310 1.00  26.38 ? 288 HOH D O   1 
HETATM 6928 O  O   . HOH L 3 .   ? 32.930  12.696  90.203  1.00  28.83 ? 289 HOH D O   1 
HETATM 6929 O  O   . HOH L 3 .   ? 23.468  12.789  109.300 1.00  30.46 ? 290 HOH D O   1 
HETATM 6930 O  O   . HOH L 3 .   ? 15.808  3.945   85.949  1.00  28.44 ? 291 HOH D O   1 
HETATM 6931 O  O   . HOH L 3 .   ? 34.280  18.038  95.125  1.00  36.85 ? 292 HOH D O   1 
HETATM 6932 O  O   . HOH L 3 .   ? 31.876  14.906  91.424  1.00  31.18 ? 293 HOH D O   1 
HETATM 6933 O  O   . HOH L 3 .   ? 15.165  7.319   102.957 1.00  30.17 ? 294 HOH D O   1 
HETATM 6934 O  O   . HOH L 3 .   ? 14.665  8.517   105.371 1.00  29.27 ? 295 HOH D O   1 
HETATM 6935 O  O   . HOH L 3 .   ? 19.034  33.036  87.982  1.00  38.71 ? 296 HOH D O   1 
HETATM 6936 O  O   . HOH L 3 .   ? 22.823  37.915  103.618 1.00  33.57 ? 297 HOH D O   1 
HETATM 6937 O  O   . HOH L 3 .   ? 30.115  17.119  116.187 1.00  32.71 ? 298 HOH D O   1 
HETATM 6938 O  O   . HOH L 3 .   ? 24.703  22.271  87.516  1.00  34.35 ? 299 HOH D O   1 
HETATM 6939 O  O   . HOH L 3 .   ? -4.712  26.129  105.311 1.00  39.44 ? 300 HOH D O   1 
HETATM 6940 O  O   . HOH L 3 .   ? 12.888  31.966  111.021 1.00  31.92 ? 301 HOH D O   1 
HETATM 6941 O  O   . HOH L 3 .   ? 21.685  6.510   82.821  1.00  33.43 ? 302 HOH D O   1 
HETATM 6942 O  O   . HOH L 3 .   ? 21.364  17.769  86.701  1.00  34.97 ? 303 HOH D O   1 
HETATM 6943 O  O   . HOH L 3 .   ? -6.977  19.511  89.937  1.00  39.46 ? 304 HOH D O   1 
HETATM 6944 O  O   . HOH L 3 .   ? 31.437  16.718  106.302 1.00  38.65 ? 305 HOH D O   1 
HETATM 6945 O  O   . HOH L 3 .   ? 3.605   5.937   96.740  1.00  34.33 ? 306 HOH D O   1 
HETATM 6946 O  O   . HOH L 3 .   ? 16.455  10.282  84.340  1.00  40.61 ? 307 HOH D O   1 
HETATM 6947 O  O   . HOH L 3 .   ? 22.609  19.322  84.742  -4.50 2.00  ? 308 HOH D O   1 
HETATM 6948 O  O   . HOH L 3 .   ? 19.215  11.711  102.526 1.00  38.08 ? 309 HOH D O   1 
HETATM 6949 O  O   . HOH L 3 .   ? 25.071  10.628  110.113 1.00  26.95 ? 310 HOH D O   1 
HETATM 6950 O  O   . HOH L 3 .   ? 34.271  16.196  92.144  1.00  35.07 ? 311 HOH D O   1 
HETATM 6951 O  O   . HOH L 3 .   ? -4.945  22.086  94.895  1.00  35.38 ? 312 HOH D O   1 
HETATM 6952 O  O   . HOH L 3 .   ? 10.120  16.690  112.007 1.00  32.48 ? 313 HOH D O   1 
HETATM 6953 O  O   . HOH L 3 .   ? 23.049  34.971  118.226 1.00  35.68 ? 314 HOH D O   1 
HETATM 6954 O  O   . HOH L 3 .   ? 24.062  29.466  94.994  1.00  33.18 ? 315 HOH D O   1 
HETATM 6955 O  O   . HOH L 3 .   ? 6.461   27.655  113.229 1.00  37.80 ? 316 HOH D O   1 
HETATM 6956 O  O   . HOH L 3 .   ? 9.350   29.928  86.134  1.00  39.07 ? 317 HOH D O   1 
HETATM 6957 O  O   . HOH L 3 .   ? 12.264  15.109  111.524 1.00  36.68 ? 318 HOH D O   1 
HETATM 6958 O  O   . HOH L 3 .   ? 30.837  24.171  115.290 1.00  37.17 ? 319 HOH D O   1 
HETATM 6959 O  O   . HOH L 3 .   ? 25.914  12.256  84.612  1.00  43.37 ? 320 HOH D O   1 
HETATM 6960 O  O   . HOH L 3 .   ? 16.253  32.629  88.581  1.00  40.75 ? 321 HOH D O   1 
HETATM 6961 O  O   . HOH L 3 .   ? 8.511   31.707  89.087  1.00  34.48 ? 322 HOH D O   1 
HETATM 6962 O  O   . HOH L 3 .   ? 10.354  23.752  117.789 1.00  38.92 ? 323 HOH D O   1 
HETATM 6963 O  O   . HOH L 3 .   ? 30.980  16.785  98.738  1.00  40.41 ? 324 HOH D O   1 
HETATM 6964 O  O   . HOH L 3 .   ? 19.126  18.633  117.957 1.00  35.75 ? 325 HOH D O   1 
HETATM 6965 O  O   . HOH L 3 .   ? 14.136  31.300  88.911  1.00  35.10 ? 326 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   0   ?   ?   ?   A . n 
A 1 2   ALA 2   1   1   ALA ALA A . n 
A 1 3   ALA 3   2   2   ALA ALA A . n 
A 1 4   TYR 4   3   3   TYR TYR A . n 
A 1 5   THR 5   4   4   THR THR A . n 
A 1 6   LEU 6   5   5   LEU LEU A . n 
A 1 7   PRO 7   6   6   PRO PRO A . n 
A 1 8   GLN 8   7   7   GLN GLN A . n 
A 1 9   LEU 9   8   8   LEU LEU A . n 
A 1 10  PRO 10  9   9   PRO PRO A . n 
A 1 11  TYR 11  10  10  TYR TYR A . n 
A 1 12  ALA 12  11  11  ALA ALA A . n 
A 1 13  TYR 13  12  12  TYR TYR A . n 
A 1 14  ASP 14  13  13  ASP ASP A . n 
A 1 15  ALA 15  14  14  ALA ALA A . n 
A 1 16  LEU 16  15  15  LEU LEU A . n 
A 1 17  GLU 17  16  16  GLU GLU A . n 
A 1 18  PRO 18  17  17  PRO PRO A . n 
A 1 19  HIS 19  18  18  HIS HIS A . n 
A 1 20  ILE 20  19  19  ILE ILE A . n 
A 1 21  ASP 21  20  20  ASP ASP A . n 
A 1 22  ALA 22  21  21  ALA ALA A . n 
A 1 23  ARG 23  22  22  ARG ARG A . n 
A 1 24  THR 24  23  23  THR THR A . n 
A 1 25  MET 25  24  24  MET MET A . n 
A 1 26  GLU 26  25  25  GLU GLU A . n 
A 1 27  ILE 27  26  26  ILE ILE A . n 
A 1 28  HIS 28  27  27  HIS HIS A . n 
A 1 29  HIS 29  28  28  HIS HIS A . n 
A 1 30  THR 30  29  29  THR THR A . n 
A 1 31  LYS 31  30  30  LYS LYS A . n 
A 1 32  HIS 32  31  31  HIS HIS A . n 
A 1 33  HIS 33  32  32  HIS HIS A . n 
A 1 34  GLN 34  33  33  GLN GLN A . n 
A 1 35  THR 35  34  34  THR THR A . n 
A 1 36  TYR 36  35  35  TYR TYR A . n 
A 1 37  VAL 37  36  36  VAL VAL A . n 
A 1 38  ASP 38  37  37  ASP ASP A . n 
A 1 39  ASN 39  38  38  ASN ASN A . n 
A 1 40  ALA 40  39  39  ALA ALA A . n 
A 1 41  ASN 41  40  40  ASN ASN A . n 
A 1 42  LYS 42  41  41  LYS LYS A . n 
A 1 43  ALA 43  42  42  ALA ALA A . n 
A 1 44  LEU 44  43  43  LEU LEU A . n 
A 1 45  GLU 45  44  44  GLU GLU A . n 
A 1 46  GLY 46  45  45  GLY GLY A . n 
A 1 47  THR 47  46  46  THR THR A . n 
A 1 48  GLU 48  47  47  GLU GLU A . n 
A 1 49  PHE 49  48  48  PHE PHE A . n 
A 1 50  ALA 50  49  49  ALA ALA A . n 
A 1 51  ASP 51  50  50  ASP ASP A . n 
A 1 52  LEU 52  51  51  LEU LEU A . n 
A 1 53  PRO 53  52  52  PRO PRO A . n 
A 1 54  VAL 54  53  53  VAL VAL A . n 
A 1 55  GLU 55  54  54  GLU GLU A . n 
A 1 56  GLN 56  55  55  GLN GLN A . n 
A 1 57  LEU 57  56  56  LEU LEU A . n 
A 1 58  ILE 58  57  57  ILE ILE A . n 
A 1 59  GLN 59  58  58  GLN GLN A . n 
A 1 60  GLN 60  59  59  GLN GLN A . n 
A 1 61  LEU 61  60  60  LEU LEU A . n 
A 1 62  ASP 62  61  61  ASP ASP A . n 
A 1 63  ARG 63  62  62  ARG ARG A . n 
A 1 64  VAL 64  63  63  VAL VAL A . n 
A 1 65  PRO 65  64  64  PRO PRO A . n 
A 1 66  ALA 66  65  65  ALA ALA A . n 
A 1 67  ASP 67  66  66  ASP ASP A . n 
A 1 68  LYS 68  67  67  LYS LYS A . n 
A 1 69  LYS 69  68  68  LYS LYS A . n 
A 1 70  GLY 70  69  69  GLY GLY A . n 
A 1 71  ALA 71  70  70  ALA ALA A . n 
A 1 72  LEU 72  71  71  LEU LEU A . n 
A 1 73  ARG 73  72  72  ARG ARG A . n 
A 1 74  ASN 74  73  73  ASN ASN A . n 
A 1 75  ASN 75  74  74  ASN ASN A . n 
A 1 76  ALA 76  75  75  ALA ALA A . n 
A 1 77  GLY 77  76  76  GLY GLY A . n 
A 1 78  GLY 78  77  77  GLY GLY A . n 
A 1 79  HIS 79  78  78  HIS HIS A . n 
A 1 80  ALA 80  79  79  ALA ALA A . n 
A 1 81  ASN 81  80  80  ASN ASN A . n 
A 1 82  HIS 82  81  81  HIS HIS A . n 
A 1 83  SER 83  82  82  SER SER A . n 
A 1 84  MET 84  83  83  MET MET A . n 
A 1 85  PHE 85  84  84  PHE PHE A . n 
A 1 86  TRP 86  85  85  TRP TRP A . n 
A 1 87  GLN 87  86  86  GLN GLN A . n 
A 1 88  ILE 88  87  87  ILE ILE A . n 
A 1 89  MET 89  88  88  MET MET A . n 
A 1 90  GLY 90  89  89  GLY GLY A . n 
A 1 91  GLN 91  90  90  GLN GLN A . n 
A 1 92  GLY 92  91  91  GLY GLY A . n 
A 1 93  GLN 93  92  92  GLN GLN A . n 
A 1 94  GLY 94  93  93  GLY GLY A . n 
A 1 95  GLN 95  94  ?   ?   ?   A . n 
A 1 96  ASN 96  95  ?   ?   ?   A . n 
A 1 97  GLY 97  96  ?   ?   ?   A . n 
A 1 98  ALA 98  97  97  ALA ALA A . n 
A 1 99  ASN 99  98  98  ASN ASN A . n 
A 1 100 GLN 100 99  99  GLN GLN A . n 
A 1 101 PRO 101 100 100 PRO PRO A . n 
A 1 102 SER 102 101 101 SER SER A . n 
A 1 103 GLY 103 102 102 GLY GLY A . n 
A 1 104 GLU 104 103 103 GLU GLU A . n 
A 1 105 LEU 105 104 104 LEU LEU A . n 
A 1 106 LEU 106 105 105 LEU LEU A . n 
A 1 107 ASP 107 106 106 ASP ASP A . n 
A 1 108 ALA 108 107 107 ALA ALA A . n 
A 1 109 ILE 109 108 108 ILE ILE A . n 
A 1 110 ASN 110 109 109 ASN ASN A . n 
A 1 111 SER 111 110 110 SER SER A . n 
A 1 112 ALA 112 111 111 ALA ALA A . n 
A 1 113 PHE 113 112 112 PHE PHE A . n 
A 1 114 GLY 114 113 113 GLY GLY A . n 
A 1 115 SER 115 114 114 SER SER A . n 
A 1 116 PHE 116 115 115 PHE PHE A . n 
A 1 117 ASP 117 116 116 ASP ASP A . n 
A 1 118 ALA 118 117 117 ALA ALA A . n 
A 1 119 PHE 119 118 118 PHE PHE A . n 
A 1 120 LYS 120 119 119 LYS LYS A . n 
A 1 121 GLN 121 120 120 GLN GLN A . n 
A 1 122 LYS 122 121 121 LYS LYS A . n 
A 1 123 PHE 123 122 122 PHE PHE A . n 
A 1 124 GLU 124 123 123 GLU GLU A . n 
A 1 125 ASP 125 124 124 ASP ASP A . n 
A 1 126 ALA 126 125 125 ALA ALA A . n 
A 1 127 ALA 127 126 126 ALA ALA A . n 
A 1 128 LYS 128 127 127 LYS LYS A . n 
A 1 129 THR 129 128 128 THR THR A . n 
A 1 130 ARG 130 129 129 ARG ARG A . n 
A 1 131 PHE 131 130 130 PHE PHE A . n 
A 1 132 GLY 132 131 131 GLY GLY A . n 
A 1 133 SER 133 132 132 SER SER A . n 
A 1 134 GLY 134 133 133 GLY GLY A . n 
A 1 135 TRP 135 134 134 TRP TRP A . n 
A 1 136 ALA 136 135 135 ALA ALA A . n 
A 1 137 TRP 137 136 136 TRP TRP A . n 
A 1 138 LEU 138 137 137 LEU LEU A . n 
A 1 139 VAL 139 138 138 VAL VAL A . n 
A 1 140 VAL 140 139 139 VAL VAL A . n 
A 1 141 LYS 141 140 140 LYS LYS A . n 
A 1 142 ASP 142 141 141 ASP ASP A . n 
A 1 143 GLY 143 142 142 GLY GLY A . n 
A 1 144 LYS 144 143 143 LYS LYS A . n 
A 1 145 LEU 145 144 144 LEU LEU A . n 
A 1 146 ASP 146 145 145 ASP ASP A . n 
A 1 147 VAL 147 146 146 VAL VAL A . n 
A 1 148 VAL 148 147 147 VAL VAL A . n 
A 1 149 SER 149 148 148 SER SER A . n 
A 1 150 THR 150 149 149 THR THR A . n 
A 1 151 ALA 151 150 150 ALA ALA A . n 
A 1 152 ASN 152 151 151 ASN ASN A . n 
A 1 153 GLN 153 152 152 GLN GLN A . n 
A 1 154 ASP 154 153 153 ASP ASP A . n 
A 1 155 ASN 155 154 154 ASN ASN A . n 
A 1 156 PRO 156 155 155 PRO PRO A . n 
A 1 157 LEU 157 156 156 LEU LEU A . n 
A 1 158 MET 158 157 157 MET MET A . n 
A 1 159 GLY 159 158 158 GLY GLY A . n 
A 1 160 GLU 160 159 159 GLU GLU A . n 
A 1 161 ALA 161 160 160 ALA ALA A . n 
A 1 162 ILE 162 161 161 ILE ILE A . n 
A 1 163 ALA 163 162 162 ALA ALA A . n 
A 1 164 GLY 164 163 163 GLY GLY A . n 
A 1 165 VAL 165 164 164 VAL VAL A . n 
A 1 166 SER 166 165 165 SER SER A . n 
A 1 167 GLY 167 166 166 GLY GLY A . n 
A 1 168 THR 168 167 167 THR THR A . n 
A 1 169 PRO 169 168 168 PRO PRO A . n 
A 1 170 ILE 170 169 169 ILE ILE A . n 
A 1 171 LEU 171 170 170 LEU LEU A . n 
A 1 172 GLY 172 171 171 GLY GLY A . n 
A 1 173 VAL 173 172 172 VAL VAL A . n 
A 1 174 ASP 174 173 173 ASP ASP A . n 
A 1 175 VAL 175 174 174 VAL VAL A . n 
A 1 176 TRP 176 175 175 TRP TRP A . n 
A 1 177 GLU 177 176 176 GLU GLU A . n 
A 1 178 HIS 178 177 177 HIS HIS A . n 
A 1 179 ALA 179 178 178 ALA ALA A . n 
A 1 180 TYR 180 179 179 TYR TYR A . n 
A 1 181 TYR 181 180 180 TYR TYR A . n 
A 1 182 LEU 182 181 181 LEU LEU A . n 
A 1 183 ASN 183 182 182 ASN ASN A . n 
A 1 184 TYR 184 183 183 TYR TYR A . n 
A 1 185 GLN 185 184 184 GLN GLN A . n 
A 1 186 ASN 186 185 185 ASN ASN A . n 
A 1 187 ARG 187 186 186 ARG ARG A . n 
A 1 188 ARG 188 187 187 ARG ARG A . n 
A 1 189 PRO 189 188 188 PRO PRO A . n 
A 1 190 ASP 190 189 189 ASP ASP A . n 
A 1 191 TYR 191 190 190 TYR TYR A . n 
A 1 192 LEU 192 191 191 LEU LEU A . n 
A 1 193 ALA 193 192 192 ALA ALA A . n 
A 1 194 ALA 194 193 193 ALA ALA A . n 
A 1 195 PHE 195 194 194 PHE PHE A . n 
A 1 196 TRP 196 195 195 TRP TRP A . n 
A 1 197 ASN 197 196 196 ASN ASN A . n 
A 1 198 VAL 198 197 197 VAL VAL A . n 
A 1 199 VAL 199 198 198 VAL VAL A . n 
A 1 200 ASN 200 199 199 ASN ASN A . n 
A 1 201 TRP 201 200 200 TRP TRP A . n 
A 1 202 ASP 202 201 201 ASP ASP A . n 
A 1 203 GLU 203 202 202 GLU GLU A . n 
A 1 204 VAL 204 203 203 VAL VAL A . n 
A 1 205 SER 205 204 204 SER SER A . n 
A 1 206 LYS 206 205 205 LYS LYS A . n 
A 1 207 ARG 207 206 206 ARG ARG A . n 
A 1 208 TYR 208 207 207 TYR TYR A . n 
A 1 209 ALA 209 208 208 ALA ALA A . n 
A 1 210 ALA 210 209 209 ALA ALA A . n 
A 1 211 ALA 211 210 210 ALA ALA A . n 
A 1 212 LYS 212 211 211 LYS LYS A . n 
A 1 213 LEU 213 212 212 LEU LEU A . n 
A 1 214 VAL 214 213 213 VAL VAL A . n 
A 1 215 PRO 215 214 ?   ?   ?   A . n 
A 1 216 ARG 216 215 ?   ?   ?   A . n 
A 1 217 GLY 217 216 ?   ?   ?   A . n 
A 1 218 SER 218 217 ?   ?   ?   A . n 
A 1 219 ALA 219 218 ?   ?   ?   A . n 
A 1 220 ALA 220 219 ?   ?   ?   A . n 
A 1 221 ALA 221 220 ?   ?   ?   A . n 
A 1 222 LEU 222 221 ?   ?   ?   A . n 
A 1 223 GLU 223 222 ?   ?   ?   A . n 
A 1 224 HIS 224 223 ?   ?   ?   A . n 
A 1 225 HIS 225 224 ?   ?   ?   A . n 
A 1 226 HIS 226 225 ?   ?   ?   A . n 
A 1 227 HIS 227 226 ?   ?   ?   A . n 
A 1 228 HIS 228 227 ?   ?   ?   A . n 
A 1 229 HIS 229 228 ?   ?   ?   A . n 
B 1 1   MET 1   0   ?   ?   ?   B . n 
B 1 2   ALA 2   1   1   ALA ALA B . n 
B 1 3   ALA 3   2   2   ALA ALA B . n 
B 1 4   TYR 4   3   3   TYR TYR B . n 
B 1 5   THR 5   4   4   THR THR B . n 
B 1 6   LEU 6   5   5   LEU LEU B . n 
B 1 7   PRO 7   6   6   PRO PRO B . n 
B 1 8   GLN 8   7   7   GLN GLN B . n 
B 1 9   LEU 9   8   8   LEU LEU B . n 
B 1 10  PRO 10  9   9   PRO PRO B . n 
B 1 11  TYR 11  10  10  TYR TYR B . n 
B 1 12  ALA 12  11  11  ALA ALA B . n 
B 1 13  TYR 13  12  12  TYR TYR B . n 
B 1 14  ASP 14  13  13  ASP ASP B . n 
B 1 15  ALA 15  14  14  ALA ALA B . n 
B 1 16  LEU 16  15  15  LEU LEU B . n 
B 1 17  GLU 17  16  16  GLU GLU B . n 
B 1 18  PRO 18  17  17  PRO PRO B . n 
B 1 19  HIS 19  18  18  HIS HIS B . n 
B 1 20  ILE 20  19  19  ILE ILE B . n 
B 1 21  ASP 21  20  20  ASP ASP B . n 
B 1 22  ALA 22  21  21  ALA ALA B . n 
B 1 23  ARG 23  22  22  ARG ARG B . n 
B 1 24  THR 24  23  23  THR THR B . n 
B 1 25  MET 25  24  24  MET MET B . n 
B 1 26  GLU 26  25  25  GLU GLU B . n 
B 1 27  ILE 27  26  26  ILE ILE B . n 
B 1 28  HIS 28  27  27  HIS HIS B . n 
B 1 29  HIS 29  28  28  HIS HIS B . n 
B 1 30  THR 30  29  29  THR THR B . n 
B 1 31  LYS 31  30  30  LYS LYS B . n 
B 1 32  HIS 32  31  31  HIS HIS B . n 
B 1 33  HIS 33  32  32  HIS HIS B . n 
B 1 34  GLN 34  33  33  GLN GLN B . n 
B 1 35  THR 35  34  34  THR THR B . n 
B 1 36  TYR 36  35  35  TYR TYR B . n 
B 1 37  VAL 37  36  36  VAL VAL B . n 
B 1 38  ASP 38  37  37  ASP ASP B . n 
B 1 39  ASN 39  38  38  ASN ASN B . n 
B 1 40  ALA 40  39  39  ALA ALA B . n 
B 1 41  ASN 41  40  40  ASN ASN B . n 
B 1 42  LYS 42  41  41  LYS LYS B . n 
B 1 43  ALA 43  42  42  ALA ALA B . n 
B 1 44  LEU 44  43  43  LEU LEU B . n 
B 1 45  GLU 45  44  44  GLU GLU B . n 
B 1 46  GLY 46  45  45  GLY GLY B . n 
B 1 47  THR 47  46  46  THR THR B . n 
B 1 48  GLU 48  47  47  GLU GLU B . n 
B 1 49  PHE 49  48  48  PHE PHE B . n 
B 1 50  ALA 50  49  49  ALA ALA B . n 
B 1 51  ASP 51  50  50  ASP ASP B . n 
B 1 52  LEU 52  51  51  LEU LEU B . n 
B 1 53  PRO 53  52  52  PRO PRO B . n 
B 1 54  VAL 54  53  53  VAL VAL B . n 
B 1 55  GLU 55  54  54  GLU GLU B . n 
B 1 56  GLN 56  55  55  GLN GLN B . n 
B 1 57  LEU 57  56  56  LEU LEU B . n 
B 1 58  ILE 58  57  57  ILE ILE B . n 
B 1 59  GLN 59  58  58  GLN GLN B . n 
B 1 60  GLN 60  59  59  GLN GLN B . n 
B 1 61  LEU 61  60  60  LEU LEU B . n 
B 1 62  ASP 62  61  61  ASP ASP B . n 
B 1 63  ARG 63  62  62  ARG ARG B . n 
B 1 64  VAL 64  63  63  VAL VAL B . n 
B 1 65  PRO 65  64  64  PRO PRO B . n 
B 1 66  ALA 66  65  65  ALA ALA B . n 
B 1 67  ASP 67  66  66  ASP ASP B . n 
B 1 68  LYS 68  67  67  LYS LYS B . n 
B 1 69  LYS 69  68  68  LYS LYS B . n 
B 1 70  GLY 70  69  69  GLY GLY B . n 
B 1 71  ALA 71  70  70  ALA ALA B . n 
B 1 72  LEU 72  71  71  LEU LEU B . n 
B 1 73  ARG 73  72  72  ARG ARG B . n 
B 1 74  ASN 74  73  73  ASN ASN B . n 
B 1 75  ASN 75  74  74  ASN ASN B . n 
B 1 76  ALA 76  75  75  ALA ALA B . n 
B 1 77  GLY 77  76  76  GLY GLY B . n 
B 1 78  GLY 78  77  77  GLY GLY B . n 
B 1 79  HIS 79  78  78  HIS HIS B . n 
B 1 80  ALA 80  79  79  ALA ALA B . n 
B 1 81  ASN 81  80  80  ASN ASN B . n 
B 1 82  HIS 82  81  81  HIS HIS B . n 
B 1 83  SER 83  82  82  SER SER B . n 
B 1 84  MET 84  83  83  MET MET B . n 
B 1 85  PHE 85  84  84  PHE PHE B . n 
B 1 86  TRP 86  85  85  TRP TRP B . n 
B 1 87  GLN 87  86  86  GLN GLN B . n 
B 1 88  ILE 88  87  87  ILE ILE B . n 
B 1 89  MET 89  88  88  MET MET B . n 
B 1 90  GLY 90  89  89  GLY GLY B . n 
B 1 91  GLN 91  90  90  GLN GLN B . n 
B 1 92  GLY 92  91  ?   ?   ?   B . n 
B 1 93  GLN 93  92  ?   ?   ?   B . n 
B 1 94  GLY 94  93  ?   ?   ?   B . n 
B 1 95  GLN 95  94  ?   ?   ?   B . n 
B 1 96  ASN 96  95  ?   ?   ?   B . n 
B 1 97  GLY 97  96  ?   ?   ?   B . n 
B 1 98  ALA 98  97  ?   ?   ?   B . n 
B 1 99  ASN 99  98  98  ASN ASN B . n 
B 1 100 GLN 100 99  99  GLN GLN B . n 
B 1 101 PRO 101 100 100 PRO PRO B . n 
B 1 102 SER 102 101 101 SER SER B . n 
B 1 103 GLY 103 102 102 GLY GLY B . n 
B 1 104 GLU 104 103 103 GLU GLU B . n 
B 1 105 LEU 105 104 104 LEU LEU B . n 
B 1 106 LEU 106 105 105 LEU LEU B . n 
B 1 107 ASP 107 106 106 ASP ASP B . n 
B 1 108 ALA 108 107 107 ALA ALA B . n 
B 1 109 ILE 109 108 108 ILE ILE B . n 
B 1 110 ASN 110 109 109 ASN ASN B . n 
B 1 111 SER 111 110 110 SER SER B . n 
B 1 112 ALA 112 111 111 ALA ALA B . n 
B 1 113 PHE 113 112 112 PHE PHE B . n 
B 1 114 GLY 114 113 113 GLY GLY B . n 
B 1 115 SER 115 114 114 SER SER B . n 
B 1 116 PHE 116 115 115 PHE PHE B . n 
B 1 117 ASP 117 116 116 ASP ASP B . n 
B 1 118 ALA 118 117 117 ALA ALA B . n 
B 1 119 PHE 119 118 118 PHE PHE B . n 
B 1 120 LYS 120 119 119 LYS LYS B . n 
B 1 121 GLN 121 120 120 GLN GLN B . n 
B 1 122 LYS 122 121 121 LYS LYS B . n 
B 1 123 PHE 123 122 122 PHE PHE B . n 
B 1 124 GLU 124 123 123 GLU GLU B . n 
B 1 125 ASP 125 124 124 ASP ASP B . n 
B 1 126 ALA 126 125 125 ALA ALA B . n 
B 1 127 ALA 127 126 126 ALA ALA B . n 
B 1 128 LYS 128 127 127 LYS LYS B . n 
B 1 129 THR 129 128 128 THR THR B . n 
B 1 130 ARG 130 129 129 ARG ARG B . n 
B 1 131 PHE 131 130 130 PHE PHE B . n 
B 1 132 GLY 132 131 131 GLY GLY B . n 
B 1 133 SER 133 132 132 SER SER B . n 
B 1 134 GLY 134 133 133 GLY GLY B . n 
B 1 135 TRP 135 134 134 TRP TRP B . n 
B 1 136 ALA 136 135 135 ALA ALA B . n 
B 1 137 TRP 137 136 136 TRP TRP B . n 
B 1 138 LEU 138 137 137 LEU LEU B . n 
B 1 139 VAL 139 138 138 VAL VAL B . n 
B 1 140 VAL 140 139 139 VAL VAL B . n 
B 1 141 LYS 141 140 140 LYS LYS B . n 
B 1 142 ASP 142 141 141 ASP ASP B . n 
B 1 143 GLY 143 142 142 GLY GLY B . n 
B 1 144 LYS 144 143 143 LYS LYS B . n 
B 1 145 LEU 145 144 144 LEU LEU B . n 
B 1 146 ASP 146 145 145 ASP ASP B . n 
B 1 147 VAL 147 146 146 VAL VAL B . n 
B 1 148 VAL 148 147 147 VAL VAL B . n 
B 1 149 SER 149 148 148 SER SER B . n 
B 1 150 THR 150 149 149 THR THR B . n 
B 1 151 ALA 151 150 150 ALA ALA B . n 
B 1 152 ASN 152 151 151 ASN ASN B . n 
B 1 153 GLN 153 152 152 GLN GLN B . n 
B 1 154 ASP 154 153 153 ASP ASP B . n 
B 1 155 ASN 155 154 154 ASN ASN B . n 
B 1 156 PRO 156 155 155 PRO PRO B . n 
B 1 157 LEU 157 156 156 LEU LEU B . n 
B 1 158 MET 158 157 157 MET MET B . n 
B 1 159 GLY 159 158 158 GLY GLY B . n 
B 1 160 GLU 160 159 159 GLU GLU B . n 
B 1 161 ALA 161 160 160 ALA ALA B . n 
B 1 162 ILE 162 161 161 ILE ILE B . n 
B 1 163 ALA 163 162 162 ALA ALA B . n 
B 1 164 GLY 164 163 163 GLY GLY B . n 
B 1 165 VAL 165 164 164 VAL VAL B . n 
B 1 166 SER 166 165 165 SER SER B . n 
B 1 167 GLY 167 166 166 GLY GLY B . n 
B 1 168 THR 168 167 167 THR THR B . n 
B 1 169 PRO 169 168 168 PRO PRO B . n 
B 1 170 ILE 170 169 169 ILE ILE B . n 
B 1 171 LEU 171 170 170 LEU LEU B . n 
B 1 172 GLY 172 171 171 GLY GLY B . n 
B 1 173 VAL 173 172 172 VAL VAL B . n 
B 1 174 ASP 174 173 173 ASP ASP B . n 
B 1 175 VAL 175 174 174 VAL VAL B . n 
B 1 176 TRP 176 175 175 TRP TRP B . n 
B 1 177 GLU 177 176 176 GLU GLU B . n 
B 1 178 HIS 178 177 177 HIS HIS B . n 
B 1 179 ALA 179 178 178 ALA ALA B . n 
B 1 180 TYR 180 179 179 TYR TYR B . n 
B 1 181 TYR 181 180 180 TYR TYR B . n 
B 1 182 LEU 182 181 181 LEU LEU B . n 
B 1 183 ASN 183 182 182 ASN ASN B . n 
B 1 184 TYR 184 183 183 TYR TYR B . n 
B 1 185 GLN 185 184 184 GLN GLN B . n 
B 1 186 ASN 186 185 185 ASN ASN B . n 
B 1 187 ARG 187 186 186 ARG ARG B . n 
B 1 188 ARG 188 187 187 ARG ARG B . n 
B 1 189 PRO 189 188 188 PRO PRO B . n 
B 1 190 ASP 190 189 189 ASP ASP B . n 
B 1 191 TYR 191 190 190 TYR TYR B . n 
B 1 192 LEU 192 191 191 LEU LEU B . n 
B 1 193 ALA 193 192 192 ALA ALA B . n 
B 1 194 ALA 194 193 193 ALA ALA B . n 
B 1 195 PHE 195 194 194 PHE PHE B . n 
B 1 196 TRP 196 195 195 TRP TRP B . n 
B 1 197 ASN 197 196 196 ASN ASN B . n 
B 1 198 VAL 198 197 197 VAL VAL B . n 
B 1 199 VAL 199 198 198 VAL VAL B . n 
B 1 200 ASN 200 199 199 ASN ASN B . n 
B 1 201 TRP 201 200 200 TRP TRP B . n 
B 1 202 ASP 202 201 201 ASP ASP B . n 
B 1 203 GLU 203 202 202 GLU GLU B . n 
B 1 204 VAL 204 203 203 VAL VAL B . n 
B 1 205 SER 205 204 204 SER SER B . n 
B 1 206 LYS 206 205 205 LYS LYS B . n 
B 1 207 ARG 207 206 206 ARG ARG B . n 
B 1 208 TYR 208 207 207 TYR TYR B . n 
B 1 209 ALA 209 208 208 ALA ALA B . n 
B 1 210 ALA 210 209 209 ALA ALA B . n 
B 1 211 ALA 211 210 210 ALA ALA B . n 
B 1 212 LYS 212 211 211 LYS LYS B . n 
B 1 213 LEU 213 212 ?   ?   ?   B . n 
B 1 214 VAL 214 213 ?   ?   ?   B . n 
B 1 215 PRO 215 214 ?   ?   ?   B . n 
B 1 216 ARG 216 215 ?   ?   ?   B . n 
B 1 217 GLY 217 216 ?   ?   ?   B . n 
B 1 218 SER 218 217 ?   ?   ?   B . n 
B 1 219 ALA 219 218 ?   ?   ?   B . n 
B 1 220 ALA 220 219 ?   ?   ?   B . n 
B 1 221 ALA 221 220 ?   ?   ?   B . n 
B 1 222 LEU 222 221 ?   ?   ?   B . n 
B 1 223 GLU 223 222 ?   ?   ?   B . n 
B 1 224 HIS 224 223 ?   ?   ?   B . n 
B 1 225 HIS 225 224 ?   ?   ?   B . n 
B 1 226 HIS 226 225 ?   ?   ?   B . n 
B 1 227 HIS 227 226 ?   ?   ?   B . n 
B 1 228 HIS 228 227 ?   ?   ?   B . n 
B 1 229 HIS 229 228 ?   ?   ?   B . n 
C 1 1   MET 1   0   ?   ?   ?   C . n 
C 1 2   ALA 2   1   ?   ?   ?   C . n 
C 1 3   ALA 3   2   2   ALA ALA C . n 
C 1 4   TYR 4   3   3   TYR TYR C . n 
C 1 5   THR 5   4   4   THR THR C . n 
C 1 6   LEU 6   5   5   LEU LEU C . n 
C 1 7   PRO 7   6   6   PRO PRO C . n 
C 1 8   GLN 8   7   7   GLN GLN C . n 
C 1 9   LEU 9   8   8   LEU LEU C . n 
C 1 10  PRO 10  9   9   PRO PRO C . n 
C 1 11  TYR 11  10  10  TYR TYR C . n 
C 1 12  ALA 12  11  11  ALA ALA C . n 
C 1 13  TYR 13  12  12  TYR TYR C . n 
C 1 14  ASP 14  13  13  ASP ASP C . n 
C 1 15  ALA 15  14  14  ALA ALA C . n 
C 1 16  LEU 16  15  15  LEU LEU C . n 
C 1 17  GLU 17  16  16  GLU GLU C . n 
C 1 18  PRO 18  17  17  PRO PRO C . n 
C 1 19  HIS 19  18  18  HIS HIS C . n 
C 1 20  ILE 20  19  19  ILE ILE C . n 
C 1 21  ASP 21  20  20  ASP ASP C . n 
C 1 22  ALA 22  21  21  ALA ALA C . n 
C 1 23  ARG 23  22  22  ARG ARG C . n 
C 1 24  THR 24  23  23  THR THR C . n 
C 1 25  MET 25  24  24  MET MET C . n 
C 1 26  GLU 26  25  25  GLU GLU C . n 
C 1 27  ILE 27  26  26  ILE ILE C . n 
C 1 28  HIS 28  27  27  HIS HIS C . n 
C 1 29  HIS 29  28  28  HIS HIS C . n 
C 1 30  THR 30  29  29  THR THR C . n 
C 1 31  LYS 31  30  30  LYS LYS C . n 
C 1 32  HIS 32  31  31  HIS HIS C . n 
C 1 33  HIS 33  32  32  HIS HIS C . n 
C 1 34  GLN 34  33  33  GLN GLN C . n 
C 1 35  THR 35  34  34  THR THR C . n 
C 1 36  TYR 36  35  35  TYR TYR C . n 
C 1 37  VAL 37  36  36  VAL VAL C . n 
C 1 38  ASP 38  37  37  ASP ASP C . n 
C 1 39  ASN 39  38  38  ASN ASN C . n 
C 1 40  ALA 40  39  39  ALA ALA C . n 
C 1 41  ASN 41  40  40  ASN ASN C . n 
C 1 42  LYS 42  41  41  LYS LYS C . n 
C 1 43  ALA 43  42  42  ALA ALA C . n 
C 1 44  LEU 44  43  43  LEU LEU C . n 
C 1 45  GLU 45  44  44  GLU GLU C . n 
C 1 46  GLY 46  45  45  GLY GLY C . n 
C 1 47  THR 47  46  46  THR THR C . n 
C 1 48  GLU 48  47  47  GLU GLU C . n 
C 1 49  PHE 49  48  48  PHE PHE C . n 
C 1 50  ALA 50  49  49  ALA ALA C . n 
C 1 51  ASP 51  50  50  ASP ASP C . n 
C 1 52  LEU 52  51  51  LEU LEU C . n 
C 1 53  PRO 53  52  52  PRO PRO C . n 
C 1 54  VAL 54  53  53  VAL VAL C . n 
C 1 55  GLU 55  54  54  GLU GLU C . n 
C 1 56  GLN 56  55  55  GLN GLN C . n 
C 1 57  LEU 57  56  56  LEU LEU C . n 
C 1 58  ILE 58  57  57  ILE ILE C . n 
C 1 59  GLN 59  58  58  GLN GLN C . n 
C 1 60  GLN 60  59  59  GLN GLN C . n 
C 1 61  LEU 61  60  60  LEU LEU C . n 
C 1 62  ASP 62  61  61  ASP ASP C . n 
C 1 63  ARG 63  62  62  ARG ARG C . n 
C 1 64  VAL 64  63  63  VAL VAL C . n 
C 1 65  PRO 65  64  64  PRO PRO C . n 
C 1 66  ALA 66  65  65  ALA ALA C . n 
C 1 67  ASP 67  66  66  ASP ASP C . n 
C 1 68  LYS 68  67  67  LYS LYS C . n 
C 1 69  LYS 69  68  68  LYS LYS C . n 
C 1 70  GLY 70  69  69  GLY GLY C . n 
C 1 71  ALA 71  70  70  ALA ALA C . n 
C 1 72  LEU 72  71  71  LEU LEU C . n 
C 1 73  ARG 73  72  72  ARG ARG C . n 
C 1 74  ASN 74  73  73  ASN ASN C . n 
C 1 75  ASN 75  74  74  ASN ASN C . n 
C 1 76  ALA 76  75  75  ALA ALA C . n 
C 1 77  GLY 77  76  76  GLY GLY C . n 
C 1 78  GLY 78  77  77  GLY GLY C . n 
C 1 79  HIS 79  78  78  HIS HIS C . n 
C 1 80  ALA 80  79  79  ALA ALA C . n 
C 1 81  ASN 81  80  80  ASN ASN C . n 
C 1 82  HIS 82  81  81  HIS HIS C . n 
C 1 83  SER 83  82  82  SER SER C . n 
C 1 84  MET 84  83  83  MET MET C . n 
C 1 85  PHE 85  84  84  PHE PHE C . n 
C 1 86  TRP 86  85  85  TRP TRP C . n 
C 1 87  GLN 87  86  86  GLN GLN C . n 
C 1 88  ILE 88  87  87  ILE ILE C . n 
C 1 89  MET 89  88  88  MET MET C . n 
C 1 90  GLY 90  89  89  GLY GLY C . n 
C 1 91  GLN 91  90  ?   ?   ?   C . n 
C 1 92  GLY 92  91  ?   ?   ?   C . n 
C 1 93  GLN 93  92  ?   ?   ?   C . n 
C 1 94  GLY 94  93  ?   ?   ?   C . n 
C 1 95  GLN 95  94  ?   ?   ?   C . n 
C 1 96  ASN 96  95  ?   ?   ?   C . n 
C 1 97  GLY 97  96  ?   ?   ?   C . n 
C 1 98  ALA 98  97  ?   ?   ?   C . n 
C 1 99  ASN 99  98  98  ASN ASN C . n 
C 1 100 GLN 100 99  99  GLN GLN C . n 
C 1 101 PRO 101 100 100 PRO PRO C . n 
C 1 102 SER 102 101 101 SER SER C . n 
C 1 103 GLY 103 102 102 GLY GLY C . n 
C 1 104 GLU 104 103 103 GLU GLU C . n 
C 1 105 LEU 105 104 104 LEU LEU C . n 
C 1 106 LEU 106 105 105 LEU LEU C . n 
C 1 107 ASP 107 106 106 ASP ASP C . n 
C 1 108 ALA 108 107 107 ALA ALA C . n 
C 1 109 ILE 109 108 108 ILE ILE C . n 
C 1 110 ASN 110 109 109 ASN ASN C . n 
C 1 111 SER 111 110 110 SER SER C . n 
C 1 112 ALA 112 111 111 ALA ALA C . n 
C 1 113 PHE 113 112 112 PHE PHE C . n 
C 1 114 GLY 114 113 113 GLY GLY C . n 
C 1 115 SER 115 114 114 SER SER C . n 
C 1 116 PHE 116 115 115 PHE PHE C . n 
C 1 117 ASP 117 116 116 ASP ASP C . n 
C 1 118 ALA 118 117 117 ALA ALA C . n 
C 1 119 PHE 119 118 118 PHE PHE C . n 
C 1 120 LYS 120 119 119 LYS LYS C . n 
C 1 121 GLN 121 120 120 GLN GLN C . n 
C 1 122 LYS 122 121 121 LYS LYS C . n 
C 1 123 PHE 123 122 122 PHE PHE C . n 
C 1 124 GLU 124 123 123 GLU GLU C . n 
C 1 125 ASP 125 124 124 ASP ASP C . n 
C 1 126 ALA 126 125 125 ALA ALA C . n 
C 1 127 ALA 127 126 126 ALA ALA C . n 
C 1 128 LYS 128 127 127 LYS LYS C . n 
C 1 129 THR 129 128 128 THR THR C . n 
C 1 130 ARG 130 129 129 ARG ARG C . n 
C 1 131 PHE 131 130 130 PHE PHE C . n 
C 1 132 GLY 132 131 131 GLY GLY C . n 
C 1 133 SER 133 132 132 SER SER C . n 
C 1 134 GLY 134 133 133 GLY GLY C . n 
C 1 135 TRP 135 134 134 TRP TRP C . n 
C 1 136 ALA 136 135 135 ALA ALA C . n 
C 1 137 TRP 137 136 136 TRP TRP C . n 
C 1 138 LEU 138 137 137 LEU LEU C . n 
C 1 139 VAL 139 138 138 VAL VAL C . n 
C 1 140 VAL 140 139 139 VAL VAL C . n 
C 1 141 LYS 141 140 140 LYS LYS C . n 
C 1 142 ASP 142 141 141 ASP ASP C . n 
C 1 143 GLY 143 142 142 GLY GLY C . n 
C 1 144 LYS 144 143 143 LYS LYS C . n 
C 1 145 LEU 145 144 144 LEU LEU C . n 
C 1 146 ASP 146 145 145 ASP ASP C . n 
C 1 147 VAL 147 146 146 VAL VAL C . n 
C 1 148 VAL 148 147 147 VAL VAL C . n 
C 1 149 SER 149 148 148 SER SER C . n 
C 1 150 THR 150 149 149 THR THR C . n 
C 1 151 ALA 151 150 150 ALA ALA C . n 
C 1 152 ASN 152 151 151 ASN ASN C . n 
C 1 153 GLN 153 152 152 GLN GLN C . n 
C 1 154 ASP 154 153 153 ASP ASP C . n 
C 1 155 ASN 155 154 154 ASN ASN C . n 
C 1 156 PRO 156 155 155 PRO PRO C . n 
C 1 157 LEU 157 156 156 LEU LEU C . n 
C 1 158 MET 158 157 157 MET MET C . n 
C 1 159 GLY 159 158 158 GLY GLY C . n 
C 1 160 GLU 160 159 159 GLU GLU C . n 
C 1 161 ALA 161 160 160 ALA ALA C . n 
C 1 162 ILE 162 161 161 ILE ILE C . n 
C 1 163 ALA 163 162 162 ALA ALA C . n 
C 1 164 GLY 164 163 163 GLY GLY C . n 
C 1 165 VAL 165 164 164 VAL VAL C . n 
C 1 166 SER 166 165 165 SER SER C . n 
C 1 167 GLY 167 166 166 GLY GLY C . n 
C 1 168 THR 168 167 167 THR THR C . n 
C 1 169 PRO 169 168 168 PRO PRO C . n 
C 1 170 ILE 170 169 169 ILE ILE C . n 
C 1 171 LEU 171 170 170 LEU LEU C . n 
C 1 172 GLY 172 171 171 GLY GLY C . n 
C 1 173 VAL 173 172 172 VAL VAL C . n 
C 1 174 ASP 174 173 173 ASP ASP C . n 
C 1 175 VAL 175 174 174 VAL VAL C . n 
C 1 176 TRP 176 175 175 TRP TRP C . n 
C 1 177 GLU 177 176 176 GLU GLU C . n 
C 1 178 HIS 178 177 177 HIS HIS C . n 
C 1 179 ALA 179 178 178 ALA ALA C . n 
C 1 180 TYR 180 179 179 TYR TYR C . n 
C 1 181 TYR 181 180 180 TYR TYR C . n 
C 1 182 LEU 182 181 181 LEU LEU C . n 
C 1 183 ASN 183 182 182 ASN ASN C . n 
C 1 184 TYR 184 183 183 TYR TYR C . n 
C 1 185 GLN 185 184 184 GLN GLN C . n 
C 1 186 ASN 186 185 185 ASN ASN C . n 
C 1 187 ARG 187 186 186 ARG ARG C . n 
C 1 188 ARG 188 187 187 ARG ARG C . n 
C 1 189 PRO 189 188 188 PRO PRO C . n 
C 1 190 ASP 190 189 189 ASP ASP C . n 
C 1 191 TYR 191 190 190 TYR TYR C . n 
C 1 192 LEU 192 191 191 LEU LEU C . n 
C 1 193 ALA 193 192 192 ALA ALA C . n 
C 1 194 ALA 194 193 193 ALA ALA C . n 
C 1 195 PHE 195 194 194 PHE PHE C . n 
C 1 196 TRP 196 195 195 TRP TRP C . n 
C 1 197 ASN 197 196 196 ASN ASN C . n 
C 1 198 VAL 198 197 197 VAL VAL C . n 
C 1 199 VAL 199 198 198 VAL VAL C . n 
C 1 200 ASN 200 199 199 ASN ASN C . n 
C 1 201 TRP 201 200 200 TRP TRP C . n 
C 1 202 ASP 202 201 201 ASP ASP C . n 
C 1 203 GLU 203 202 202 GLU GLU C . n 
C 1 204 VAL 204 203 203 VAL VAL C . n 
C 1 205 SER 205 204 204 SER SER C . n 
C 1 206 LYS 206 205 205 LYS LYS C . n 
C 1 207 ARG 207 206 206 ARG ARG C . n 
C 1 208 TYR 208 207 207 TYR TYR C . n 
C 1 209 ALA 209 208 208 ALA ALA C . n 
C 1 210 ALA 210 209 209 ALA ALA C . n 
C 1 211 ALA 211 210 210 ALA ALA C . n 
C 1 212 LYS 212 211 211 LYS LYS C . n 
C 1 213 LEU 213 212 212 LEU LEU C . n 
C 1 214 VAL 214 213 213 VAL VAL C . n 
C 1 215 PRO 215 214 ?   ?   ?   C . n 
C 1 216 ARG 216 215 ?   ?   ?   C . n 
C 1 217 GLY 217 216 ?   ?   ?   C . n 
C 1 218 SER 218 217 ?   ?   ?   C . n 
C 1 219 ALA 219 218 ?   ?   ?   C . n 
C 1 220 ALA 220 219 ?   ?   ?   C . n 
C 1 221 ALA 221 220 ?   ?   ?   C . n 
C 1 222 LEU 222 221 ?   ?   ?   C . n 
C 1 223 GLU 223 222 ?   ?   ?   C . n 
C 1 224 HIS 224 223 ?   ?   ?   C . n 
C 1 225 HIS 225 224 ?   ?   ?   C . n 
C 1 226 HIS 226 225 ?   ?   ?   C . n 
C 1 227 HIS 227 226 ?   ?   ?   C . n 
C 1 228 HIS 228 227 ?   ?   ?   C . n 
C 1 229 HIS 229 228 ?   ?   ?   C . n 
D 1 1   MET 1   0   ?   ?   ?   D . n 
D 1 2   ALA 2   1   ?   ?   ?   D . n 
D 1 3   ALA 3   2   2   ALA ALA D . n 
D 1 4   TYR 4   3   3   TYR TYR D . n 
D 1 5   THR 5   4   4   THR THR D . n 
D 1 6   LEU 6   5   5   LEU LEU D . n 
D 1 7   PRO 7   6   6   PRO PRO D . n 
D 1 8   GLN 8   7   7   GLN GLN D . n 
D 1 9   LEU 9   8   8   LEU LEU D . n 
D 1 10  PRO 10  9   9   PRO PRO D . n 
D 1 11  TYR 11  10  10  TYR TYR D . n 
D 1 12  ALA 12  11  11  ALA ALA D . n 
D 1 13  TYR 13  12  12  TYR TYR D . n 
D 1 14  ASP 14  13  13  ASP ASP D . n 
D 1 15  ALA 15  14  14  ALA ALA D . n 
D 1 16  LEU 16  15  15  LEU LEU D . n 
D 1 17  GLU 17  16  16  GLU GLU D . n 
D 1 18  PRO 18  17  17  PRO PRO D . n 
D 1 19  HIS 19  18  18  HIS HIS D . n 
D 1 20  ILE 20  19  19  ILE ILE D . n 
D 1 21  ASP 21  20  20  ASP ASP D . n 
D 1 22  ALA 22  21  21  ALA ALA D . n 
D 1 23  ARG 23  22  22  ARG ARG D . n 
D 1 24  THR 24  23  23  THR THR D . n 
D 1 25  MET 25  24  24  MET MET D . n 
D 1 26  GLU 26  25  25  GLU GLU D . n 
D 1 27  ILE 27  26  26  ILE ILE D . n 
D 1 28  HIS 28  27  27  HIS HIS D . n 
D 1 29  HIS 29  28  28  HIS HIS D . n 
D 1 30  THR 30  29  29  THR THR D . n 
D 1 31  LYS 31  30  30  LYS LYS D . n 
D 1 32  HIS 32  31  31  HIS HIS D . n 
D 1 33  HIS 33  32  32  HIS HIS D . n 
D 1 34  GLN 34  33  33  GLN GLN D . n 
D 1 35  THR 35  34  34  THR THR D . n 
D 1 36  TYR 36  35  35  TYR TYR D . n 
D 1 37  VAL 37  36  36  VAL VAL D . n 
D 1 38  ASP 38  37  37  ASP ASP D . n 
D 1 39  ASN 39  38  38  ASN ASN D . n 
D 1 40  ALA 40  39  39  ALA ALA D . n 
D 1 41  ASN 41  40  40  ASN ASN D . n 
D 1 42  LYS 42  41  41  LYS LYS D . n 
D 1 43  ALA 43  42  42  ALA ALA D . n 
D 1 44  LEU 44  43  43  LEU LEU D . n 
D 1 45  GLU 45  44  44  GLU GLU D . n 
D 1 46  GLY 46  45  45  GLY GLY D . n 
D 1 47  THR 47  46  46  THR THR D . n 
D 1 48  GLU 48  47  47  GLU GLU D . n 
D 1 49  PHE 49  48  48  PHE PHE D . n 
D 1 50  ALA 50  49  49  ALA ALA D . n 
D 1 51  ASP 51  50  50  ASP ASP D . n 
D 1 52  LEU 52  51  51  LEU LEU D . n 
D 1 53  PRO 53  52  52  PRO PRO D . n 
D 1 54  VAL 54  53  53  VAL VAL D . n 
D 1 55  GLU 55  54  54  GLU GLU D . n 
D 1 56  GLN 56  55  55  GLN GLN D . n 
D 1 57  LEU 57  56  56  LEU LEU D . n 
D 1 58  ILE 58  57  57  ILE ILE D . n 
D 1 59  GLN 59  58  58  GLN GLN D . n 
D 1 60  GLN 60  59  59  GLN GLN D . n 
D 1 61  LEU 61  60  60  LEU LEU D . n 
D 1 62  ASP 62  61  61  ASP ASP D . n 
D 1 63  ARG 63  62  62  ARG ARG D . n 
D 1 64  VAL 64  63  63  VAL VAL D . n 
D 1 65  PRO 65  64  64  PRO PRO D . n 
D 1 66  ALA 66  65  65  ALA ALA D . n 
D 1 67  ASP 67  66  66  ASP ASP D . n 
D 1 68  LYS 68  67  67  LYS LYS D . n 
D 1 69  LYS 69  68  68  LYS LYS D . n 
D 1 70  GLY 70  69  69  GLY GLY D . n 
D 1 71  ALA 71  70  70  ALA ALA D . n 
D 1 72  LEU 72  71  71  LEU LEU D . n 
D 1 73  ARG 73  72  72  ARG ARG D . n 
D 1 74  ASN 74  73  73  ASN ASN D . n 
D 1 75  ASN 75  74  74  ASN ASN D . n 
D 1 76  ALA 76  75  75  ALA ALA D . n 
D 1 77  GLY 77  76  76  GLY GLY D . n 
D 1 78  GLY 78  77  77  GLY GLY D . n 
D 1 79  HIS 79  78  78  HIS HIS D . n 
D 1 80  ALA 80  79  79  ALA ALA D . n 
D 1 81  ASN 81  80  80  ASN ASN D . n 
D 1 82  HIS 82  81  81  HIS HIS D . n 
D 1 83  SER 83  82  82  SER SER D . n 
D 1 84  MET 84  83  83  MET MET D . n 
D 1 85  PHE 85  84  84  PHE PHE D . n 
D 1 86  TRP 86  85  85  TRP TRP D . n 
D 1 87  GLN 87  86  86  GLN GLN D . n 
D 1 88  ILE 88  87  87  ILE ILE D . n 
D 1 89  MET 89  88  88  MET MET D . n 
D 1 90  GLY 90  89  89  GLY GLY D . n 
D 1 91  GLN 91  90  90  GLN GLN D . n 
D 1 92  GLY 92  91  91  GLY GLY D . n 
D 1 93  GLN 93  92  92  GLN GLN D . n 
D 1 94  GLY 94  93  93  GLY GLY D . n 
D 1 95  GLN 95  94  94  GLN GLN D . n 
D 1 96  ASN 96  95  95  ASN ASN D . n 
D 1 97  GLY 97  96  96  GLY GLY D . n 
D 1 98  ALA 98  97  97  ALA ALA D . n 
D 1 99  ASN 99  98  98  ASN ASN D . n 
D 1 100 GLN 100 99  99  GLN GLN D . n 
D 1 101 PRO 101 100 100 PRO PRO D . n 
D 1 102 SER 102 101 101 SER SER D . n 
D 1 103 GLY 103 102 102 GLY GLY D . n 
D 1 104 GLU 104 103 103 GLU GLU D . n 
D 1 105 LEU 105 104 104 LEU LEU D . n 
D 1 106 LEU 106 105 105 LEU LEU D . n 
D 1 107 ASP 107 106 106 ASP ASP D . n 
D 1 108 ALA 108 107 107 ALA ALA D . n 
D 1 109 ILE 109 108 108 ILE ILE D . n 
D 1 110 ASN 110 109 109 ASN ASN D . n 
D 1 111 SER 111 110 110 SER SER D . n 
D 1 112 ALA 112 111 111 ALA ALA D . n 
D 1 113 PHE 113 112 112 PHE PHE D . n 
D 1 114 GLY 114 113 113 GLY GLY D . n 
D 1 115 SER 115 114 114 SER SER D . n 
D 1 116 PHE 116 115 115 PHE PHE D . n 
D 1 117 ASP 117 116 116 ASP ASP D . n 
D 1 118 ALA 118 117 117 ALA ALA D . n 
D 1 119 PHE 119 118 118 PHE PHE D . n 
D 1 120 LYS 120 119 119 LYS LYS D . n 
D 1 121 GLN 121 120 120 GLN GLN D . n 
D 1 122 LYS 122 121 121 LYS LYS D . n 
D 1 123 PHE 123 122 122 PHE PHE D . n 
D 1 124 GLU 124 123 123 GLU GLU D . n 
D 1 125 ASP 125 124 124 ASP ASP D . n 
D 1 126 ALA 126 125 125 ALA ALA D . n 
D 1 127 ALA 127 126 126 ALA ALA D . n 
D 1 128 LYS 128 127 127 LYS LYS D . n 
D 1 129 THR 129 128 128 THR THR D . n 
D 1 130 ARG 130 129 129 ARG ARG D . n 
D 1 131 PHE 131 130 130 PHE PHE D . n 
D 1 132 GLY 132 131 131 GLY GLY D . n 
D 1 133 SER 133 132 132 SER SER D . n 
D 1 134 GLY 134 133 133 GLY GLY D . n 
D 1 135 TRP 135 134 134 TRP TRP D . n 
D 1 136 ALA 136 135 135 ALA ALA D . n 
D 1 137 TRP 137 136 136 TRP TRP D . n 
D 1 138 LEU 138 137 137 LEU LEU D . n 
D 1 139 VAL 139 138 138 VAL VAL D . n 
D 1 140 VAL 140 139 139 VAL VAL D . n 
D 1 141 LYS 141 140 140 LYS LYS D . n 
D 1 142 ASP 142 141 141 ASP ASP D . n 
D 1 143 GLY 143 142 142 GLY GLY D . n 
D 1 144 LYS 144 143 143 LYS LYS D . n 
D 1 145 LEU 145 144 144 LEU LEU D . n 
D 1 146 ASP 146 145 145 ASP ASP D . n 
D 1 147 VAL 147 146 146 VAL VAL D . n 
D 1 148 VAL 148 147 147 VAL VAL D . n 
D 1 149 SER 149 148 148 SER SER D . n 
D 1 150 THR 150 149 149 THR THR D . n 
D 1 151 ALA 151 150 150 ALA ALA D . n 
D 1 152 ASN 152 151 151 ASN ASN D . n 
D 1 153 GLN 153 152 152 GLN GLN D . n 
D 1 154 ASP 154 153 153 ASP ASP D . n 
D 1 155 ASN 155 154 154 ASN ASN D . n 
D 1 156 PRO 156 155 155 PRO PRO D . n 
D 1 157 LEU 157 156 156 LEU LEU D . n 
D 1 158 MET 158 157 157 MET MET D . n 
D 1 159 GLY 159 158 158 GLY GLY D . n 
D 1 160 GLU 160 159 159 GLU GLU D . n 
D 1 161 ALA 161 160 160 ALA ALA D . n 
D 1 162 ILE 162 161 161 ILE ILE D . n 
D 1 163 ALA 163 162 162 ALA ALA D . n 
D 1 164 GLY 164 163 163 GLY GLY D . n 
D 1 165 VAL 165 164 164 VAL VAL D . n 
D 1 166 SER 166 165 165 SER SER D . n 
D 1 167 GLY 167 166 166 GLY GLY D . n 
D 1 168 THR 168 167 167 THR THR D . n 
D 1 169 PRO 169 168 168 PRO PRO D . n 
D 1 170 ILE 170 169 169 ILE ILE D . n 
D 1 171 LEU 171 170 170 LEU LEU D . n 
D 1 172 GLY 172 171 171 GLY GLY D . n 
D 1 173 VAL 173 172 172 VAL VAL D . n 
D 1 174 ASP 174 173 173 ASP ASP D . n 
D 1 175 VAL 175 174 174 VAL VAL D . n 
D 1 176 TRP 176 175 175 TRP TRP D . n 
D 1 177 GLU 177 176 176 GLU GLU D . n 
D 1 178 HIS 178 177 177 HIS HIS D . n 
D 1 179 ALA 179 178 178 ALA ALA D . n 
D 1 180 TYR 180 179 179 TYR TYR D . n 
D 1 181 TYR 181 180 180 TYR TYR D . n 
D 1 182 LEU 182 181 181 LEU LEU D . n 
D 1 183 ASN 183 182 182 ASN ASN D . n 
D 1 184 TYR 184 183 183 TYR TYR D . n 
D 1 185 GLN 185 184 184 GLN GLN D . n 
D 1 186 ASN 186 185 185 ASN ASN D . n 
D 1 187 ARG 187 186 186 ARG ARG D . n 
D 1 188 ARG 188 187 187 ARG ARG D . n 
D 1 189 PRO 189 188 188 PRO PRO D . n 
D 1 190 ASP 190 189 189 ASP ASP D . n 
D 1 191 TYR 191 190 190 TYR TYR D . n 
D 1 192 LEU 192 191 191 LEU LEU D . n 
D 1 193 ALA 193 192 192 ALA ALA D . n 
D 1 194 ALA 194 193 193 ALA ALA D . n 
D 1 195 PHE 195 194 194 PHE PHE D . n 
D 1 196 TRP 196 195 195 TRP TRP D . n 
D 1 197 ASN 197 196 196 ASN ASN D . n 
D 1 198 VAL 198 197 197 VAL VAL D . n 
D 1 199 VAL 199 198 198 VAL VAL D . n 
D 1 200 ASN 200 199 199 ASN ASN D . n 
D 1 201 TRP 201 200 200 TRP TRP D . n 
D 1 202 ASP 202 201 201 ASP ASP D . n 
D 1 203 GLU 203 202 202 GLU GLU D . n 
D 1 204 VAL 204 203 203 VAL VAL D . n 
D 1 205 SER 205 204 204 SER SER D . n 
D 1 206 LYS 206 205 205 LYS LYS D . n 
D 1 207 ARG 207 206 206 ARG ARG D . n 
D 1 208 TYR 208 207 207 TYR TYR D . n 
D 1 209 ALA 209 208 208 ALA ALA D . n 
D 1 210 ALA 210 209 209 ALA ALA D . n 
D 1 211 ALA 211 210 210 ALA ALA D . n 
D 1 212 LYS 212 211 211 LYS LYS D . n 
D 1 213 LEU 213 212 212 LEU LEU D . n 
D 1 214 VAL 214 213 213 VAL VAL D . n 
D 1 215 PRO 215 214 214 PRO PRO D . n 
D 1 216 ARG 216 215 215 ARG ARG D . n 
D 1 217 GLY 217 216 ?   ?   ?   D . n 
D 1 218 SER 218 217 ?   ?   ?   D . n 
D 1 219 ALA 219 218 ?   ?   ?   D . n 
D 1 220 ALA 220 219 ?   ?   ?   D . n 
D 1 221 ALA 221 220 ?   ?   ?   D . n 
D 1 222 LEU 222 221 ?   ?   ?   D . n 
D 1 223 GLU 223 222 ?   ?   ?   D . n 
D 1 224 HIS 224 223 ?   ?   ?   D . n 
D 1 225 HIS 225 224 ?   ?   ?   D . n 
D 1 226 HIS 226 225 ?   ?   ?   D . n 
D 1 227 HIS 227 226 ?   ?   ?   D . n 
D 1 228 HIS 228 227 ?   ?   ?   D . n 
D 1 229 HIS 229 228 ?   ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 FE  1   229 220 FE  FE  A . 
F 2 FE  1   229 220 FE  FE  B . 
G 2 FE  1   229 220 FE  FE  C . 
H 2 FE  1   229 220 FE  FE  D . 
I 3 HOH 1   230 1   HOH HOH A . 
I 3 HOH 2   231 3   HOH HOH A . 
I 3 HOH 3   232 4   HOH HOH A . 
I 3 HOH 4   233 8   HOH HOH A . 
I 3 HOH 5   234 9   HOH HOH A . 
I 3 HOH 6   235 10  HOH HOH A . 
I 3 HOH 7   236 11  HOH HOH A . 
I 3 HOH 8   237 13  HOH HOH A . 
I 3 HOH 9   238 16  HOH HOH A . 
I 3 HOH 10  239 18  HOH HOH A . 
I 3 HOH 11  240 19  HOH HOH A . 
I 3 HOH 12  241 22  HOH HOH A . 
I 3 HOH 13  242 24  HOH HOH A . 
I 3 HOH 14  243 28  HOH HOH A . 
I 3 HOH 15  244 30  HOH HOH A . 
I 3 HOH 16  245 31  HOH HOH A . 
I 3 HOH 17  246 33  HOH HOH A . 
I 3 HOH 18  247 46  HOH HOH A . 
I 3 HOH 19  248 48  HOH HOH A . 
I 3 HOH 20  249 49  HOH HOH A . 
I 3 HOH 21  250 59  HOH HOH A . 
I 3 HOH 22  251 62  HOH HOH A . 
I 3 HOH 23  252 64  HOH HOH A . 
I 3 HOH 24  253 68  HOH HOH A . 
I 3 HOH 25  254 69  HOH HOH A . 
I 3 HOH 26  255 70  HOH HOH A . 
I 3 HOH 27  256 72  HOH HOH A . 
I 3 HOH 28  257 75  HOH HOH A . 
I 3 HOH 29  258 81  HOH HOH A . 
I 3 HOH 30  259 84  HOH HOH A . 
I 3 HOH 31  260 85  HOH HOH A . 
I 3 HOH 32  261 87  HOH HOH A . 
I 3 HOH 33  262 88  HOH HOH A . 
I 3 HOH 34  263 91  HOH HOH A . 
I 3 HOH 35  264 97  HOH HOH A . 
I 3 HOH 36  265 98  HOH HOH A . 
I 3 HOH 37  266 102 HOH HOH A . 
I 3 HOH 38  267 103 HOH HOH A . 
I 3 HOH 39  268 107 HOH HOH A . 
I 3 HOH 40  269 110 HOH HOH A . 
I 3 HOH 41  270 114 HOH HOH A . 
I 3 HOH 42  271 122 HOH HOH A . 
I 3 HOH 43  272 127 HOH HOH A . 
I 3 HOH 44  273 128 HOH HOH A . 
I 3 HOH 45  274 129 HOH HOH A . 
I 3 HOH 46  275 130 HOH HOH A . 
I 3 HOH 47  276 133 HOH HOH A . 
I 3 HOH 48  277 134 HOH HOH A . 
I 3 HOH 49  278 135 HOH HOH A . 
I 3 HOH 50  279 136 HOH HOH A . 
I 3 HOH 51  280 137 HOH HOH A . 
I 3 HOH 52  281 138 HOH HOH A . 
I 3 HOH 53  282 143 HOH HOH A . 
I 3 HOH 54  283 144 HOH HOH A . 
I 3 HOH 55  284 150 HOH HOH A . 
I 3 HOH 56  285 151 HOH HOH A . 
I 3 HOH 57  286 158 HOH HOH A . 
I 3 HOH 58  287 159 HOH HOH A . 
I 3 HOH 59  288 160 HOH HOH A . 
I 3 HOH 60  289 161 HOH HOH A . 
I 3 HOH 61  290 162 HOH HOH A . 
I 3 HOH 62  291 169 HOH HOH A . 
I 3 HOH 63  292 176 HOH HOH A . 
I 3 HOH 64  293 180 HOH HOH A . 
I 3 HOH 65  294 181 HOH HOH A . 
I 3 HOH 66  295 182 HOH HOH A . 
I 3 HOH 67  296 183 HOH HOH A . 
I 3 HOH 68  297 195 HOH HOH A . 
I 3 HOH 69  298 196 HOH HOH A . 
I 3 HOH 70  299 206 HOH HOH A . 
I 3 HOH 71  300 209 HOH HOH A . 
I 3 HOH 72  301 210 HOH HOH A . 
I 3 HOH 73  302 214 HOH HOH A . 
I 3 HOH 74  303 228 HOH HOH A . 
I 3 HOH 75  304 229 HOH HOH A . 
I 3 HOH 76  305 235 HOH HOH A . 
I 3 HOH 77  306 236 HOH HOH A . 
I 3 HOH 78  307 237 HOH HOH A . 
I 3 HOH 79  308 238 HOH HOH A . 
I 3 HOH 80  309 239 HOH HOH A . 
I 3 HOH 81  310 247 HOH HOH A . 
I 3 HOH 82  311 249 HOH HOH A . 
I 3 HOH 83  312 253 HOH HOH A . 
I 3 HOH 84  313 256 HOH HOH A . 
I 3 HOH 85  314 262 HOH HOH A . 
I 3 HOH 86  315 264 HOH HOH A . 
I 3 HOH 87  316 265 HOH HOH A . 
I 3 HOH 88  317 267 HOH HOH A . 
I 3 HOH 89  318 268 HOH HOH A . 
I 3 HOH 90  319 269 HOH HOH A . 
I 3 HOH 91  320 270 HOH HOH A . 
I 3 HOH 92  321 279 HOH HOH A . 
I 3 HOH 93  322 280 HOH HOH A . 
I 3 HOH 94  323 282 HOH HOH A . 
I 3 HOH 95  324 286 HOH HOH A . 
I 3 HOH 96  325 287 HOH HOH A . 
I 3 HOH 97  326 293 HOH HOH A . 
I 3 HOH 98  327 300 HOH HOH A . 
I 3 HOH 99  328 305 HOH HOH A . 
I 3 HOH 100 329 312 HOH HOH A . 
I 3 HOH 101 330 318 HOH HOH A . 
I 3 HOH 102 331 328 HOH HOH A . 
I 3 HOH 103 332 329 HOH HOH A . 
I 3 HOH 104 333 330 HOH HOH A . 
I 3 HOH 105 334 331 HOH HOH A . 
I 3 HOH 106 335 343 HOH HOH A . 
I 3 HOH 107 336 355 HOH HOH A . 
I 3 HOH 108 337 356 HOH HOH A . 
I 3 HOH 109 338 357 HOH HOH A . 
I 3 HOH 110 339 364 HOH HOH A . 
I 3 HOH 111 340 371 HOH HOH A . 
I 3 HOH 112 341 376 HOH HOH A . 
I 3 HOH 113 342 377 HOH HOH A . 
I 3 HOH 114 343 384 HOH HOH A . 
I 3 HOH 115 344 385 HOH HOH A . 
I 3 HOH 116 345 388 HOH HOH A . 
J 3 HOH 1   230 6   HOH HOH B . 
J 3 HOH 2   231 7   HOH HOH B . 
J 3 HOH 3   232 20  HOH HOH B . 
J 3 HOH 4   233 26  HOH HOH B . 
J 3 HOH 5   234 27  HOH HOH B . 
J 3 HOH 6   235 32  HOH HOH B . 
J 3 HOH 7   236 39  HOH HOH B . 
J 3 HOH 8   237 42  HOH HOH B . 
J 3 HOH 9   238 43  HOH HOH B . 
J 3 HOH 10  239 45  HOH HOH B . 
J 3 HOH 11  240 47  HOH HOH B . 
J 3 HOH 12  241 53  HOH HOH B . 
J 3 HOH 13  242 57  HOH HOH B . 
J 3 HOH 14  243 71  HOH HOH B . 
J 3 HOH 15  244 73  HOH HOH B . 
J 3 HOH 16  245 76  HOH HOH B . 
J 3 HOH 17  246 86  HOH HOH B . 
J 3 HOH 18  247 92  HOH HOH B . 
J 3 HOH 19  248 104 HOH HOH B . 
J 3 HOH 20  249 109 HOH HOH B . 
J 3 HOH 21  250 111 HOH HOH B . 
J 3 HOH 22  251 112 HOH HOH B . 
J 3 HOH 23  252 116 HOH HOH B . 
J 3 HOH 24  253 117 HOH HOH B . 
J 3 HOH 25  254 118 HOH HOH B . 
J 3 HOH 26  255 123 HOH HOH B . 
J 3 HOH 27  256 124 HOH HOH B . 
J 3 HOH 28  257 139 HOH HOH B . 
J 3 HOH 29  258 140 HOH HOH B . 
J 3 HOH 30  259 145 HOH HOH B . 
J 3 HOH 31  260 146 HOH HOH B . 
J 3 HOH 32  261 152 HOH HOH B . 
J 3 HOH 33  262 153 HOH HOH B . 
J 3 HOH 34  263 163 HOH HOH B . 
J 3 HOH 35  264 171 HOH HOH B . 
J 3 HOH 36  265 172 HOH HOH B . 
J 3 HOH 37  266 173 HOH HOH B . 
J 3 HOH 38  267 184 HOH HOH B . 
J 3 HOH 39  268 185 HOH HOH B . 
J 3 HOH 40  269 197 HOH HOH B . 
J 3 HOH 41  270 198 HOH HOH B . 
J 3 HOH 42  271 199 HOH HOH B . 
J 3 HOH 43  272 200 HOH HOH B . 
J 3 HOH 44  273 201 HOH HOH B . 
J 3 HOH 45  274 202 HOH HOH B . 
J 3 HOH 46  275 215 HOH HOH B . 
J 3 HOH 47  276 216 HOH HOH B . 
J 3 HOH 48  277 219 HOH HOH B . 
J 3 HOH 49  278 220 HOH HOH B . 
J 3 HOH 50  279 221 HOH HOH B . 
J 3 HOH 51  280 227 HOH HOH B . 
J 3 HOH 52  281 230 HOH HOH B . 
J 3 HOH 53  282 242 HOH HOH B . 
J 3 HOH 54  283 243 HOH HOH B . 
J 3 HOH 55  284 255 HOH HOH B . 
J 3 HOH 56  285 257 HOH HOH B . 
J 3 HOH 57  286 258 HOH HOH B . 
J 3 HOH 58  287 285 HOH HOH B . 
J 3 HOH 59  288 288 HOH HOH B . 
J 3 HOH 60  289 292 HOH HOH B . 
J 3 HOH 61  290 294 HOH HOH B . 
J 3 HOH 62  291 295 HOH HOH B . 
J 3 HOH 63  292 297 HOH HOH B . 
J 3 HOH 64  293 301 HOH HOH B . 
J 3 HOH 65  294 302 HOH HOH B . 
J 3 HOH 66  295 306 HOH HOH B . 
J 3 HOH 67  296 307 HOH HOH B . 
J 3 HOH 68  297 313 HOH HOH B . 
J 3 HOH 69  298 314 HOH HOH B . 
J 3 HOH 70  299 319 HOH HOH B . 
J 3 HOH 71  300 332 HOH HOH B . 
J 3 HOH 72  301 333 HOH HOH B . 
J 3 HOH 73  302 337 HOH HOH B . 
J 3 HOH 74  303 338 HOH HOH B . 
J 3 HOH 75  304 344 HOH HOH B . 
J 3 HOH 76  305 345 HOH HOH B . 
J 3 HOH 77  306 346 HOH HOH B . 
J 3 HOH 78  307 347 HOH HOH B . 
J 3 HOH 79  308 348 HOH HOH B . 
J 3 HOH 80  309 358 HOH HOH B . 
J 3 HOH 81  310 365 HOH HOH B . 
J 3 HOH 82  311 366 HOH HOH B . 
J 3 HOH 83  312 372 HOH HOH B . 
J 3 HOH 84  313 373 HOH HOH B . 
J 3 HOH 85  314 378 HOH HOH B . 
J 3 HOH 86  315 389 HOH HOH B . 
J 3 HOH 87  316 390 HOH HOH B . 
J 3 HOH 88  317 392 HOH HOH B . 
J 3 HOH 89  318 396 HOH HOH B . 
K 3 HOH 1   230 15  HOH HOH C . 
K 3 HOH 2   231 17  HOH HOH C . 
K 3 HOH 3   232 21  HOH HOH C . 
K 3 HOH 4   233 25  HOH HOH C . 
K 3 HOH 5   234 29  HOH HOH C . 
K 3 HOH 6   235 34  HOH HOH C . 
K 3 HOH 7   236 35  HOH HOH C . 
K 3 HOH 8   237 36  HOH HOH C . 
K 3 HOH 9   238 50  HOH HOH C . 
K 3 HOH 10  239 51  HOH HOH C . 
K 3 HOH 11  240 52  HOH HOH C . 
K 3 HOH 12  241 54  HOH HOH C . 
K 3 HOH 13  242 58  HOH HOH C . 
K 3 HOH 14  243 60  HOH HOH C . 
K 3 HOH 15  244 61  HOH HOH C . 
K 3 HOH 16  245 66  HOH HOH C . 
K 3 HOH 17  246 77  HOH HOH C . 
K 3 HOH 18  247 78  HOH HOH C . 
K 3 HOH 19  248 80  HOH HOH C . 
K 3 HOH 20  249 89  HOH HOH C . 
K 3 HOH 21  250 93  HOH HOH C . 
K 3 HOH 22  251 105 HOH HOH C . 
K 3 HOH 23  252 113 HOH HOH C . 
K 3 HOH 24  253 115 HOH HOH C . 
K 3 HOH 25  254 119 HOH HOH C . 
K 3 HOH 26  255 120 HOH HOH C . 
K 3 HOH 27  256 125 HOH HOH C . 
K 3 HOH 28  257 126 HOH HOH C . 
K 3 HOH 29  258 131 HOH HOH C . 
K 3 HOH 30  259 141 HOH HOH C . 
K 3 HOH 31  260 147 HOH HOH C . 
K 3 HOH 32  261 148 HOH HOH C . 
K 3 HOH 33  262 154 HOH HOH C . 
K 3 HOH 34  263 155 HOH HOH C . 
K 3 HOH 35  264 156 HOH HOH C . 
K 3 HOH 36  265 164 HOH HOH C . 
K 3 HOH 37  266 165 HOH HOH C . 
K 3 HOH 38  267 174 HOH HOH C . 
K 3 HOH 39  268 186 HOH HOH C . 
K 3 HOH 40  269 187 HOH HOH C . 
K 3 HOH 41  270 188 HOH HOH C . 
K 3 HOH 42  271 189 HOH HOH C . 
K 3 HOH 43  272 190 HOH HOH C . 
K 3 HOH 44  273 191 HOH HOH C . 
K 3 HOH 45  274 192 HOH HOH C . 
K 3 HOH 46  275 203 HOH HOH C . 
K 3 HOH 47  276 207 HOH HOH C . 
K 3 HOH 48  277 211 HOH HOH C . 
K 3 HOH 49  278 212 HOH HOH C . 
K 3 HOH 50  279 217 HOH HOH C . 
K 3 HOH 51  280 222 HOH HOH C . 
K 3 HOH 52  281 223 HOH HOH C . 
K 3 HOH 53  282 231 HOH HOH C . 
K 3 HOH 54  283 240 HOH HOH C . 
K 3 HOH 55  284 241 HOH HOH C . 
K 3 HOH 56  285 245 HOH HOH C . 
K 3 HOH 57  286 251 HOH HOH C . 
K 3 HOH 58  287 254 HOH HOH C . 
K 3 HOH 59  288 260 HOH HOH C . 
K 3 HOH 60  289 261 HOH HOH C . 
K 3 HOH 61  290 266 HOH HOH C . 
K 3 HOH 62  291 271 HOH HOH C . 
K 3 HOH 63  292 273 HOH HOH C . 
K 3 HOH 64  293 276 HOH HOH C . 
K 3 HOH 65  294 289 HOH HOH C . 
K 3 HOH 66  295 290 HOH HOH C . 
K 3 HOH 67  296 296 HOH HOH C . 
K 3 HOH 68  297 298 HOH HOH C . 
K 3 HOH 69  298 303 HOH HOH C . 
K 3 HOH 70  299 315 HOH HOH C . 
K 3 HOH 71  300 316 HOH HOH C . 
K 3 HOH 72  301 320 HOH HOH C . 
K 3 HOH 73  302 321 HOH HOH C . 
K 3 HOH 74  303 322 HOH HOH C . 
K 3 HOH 75  304 323 HOH HOH C . 
K 3 HOH 76  305 339 HOH HOH C . 
K 3 HOH 77  306 340 HOH HOH C . 
K 3 HOH 78  307 341 HOH HOH C . 
K 3 HOH 79  308 349 HOH HOH C . 
K 3 HOH 80  309 350 HOH HOH C . 
K 3 HOH 81  310 351 HOH HOH C . 
K 3 HOH 82  311 352 HOH HOH C . 
K 3 HOH 83  312 353 HOH HOH C . 
K 3 HOH 84  313 359 HOH HOH C . 
K 3 HOH 85  314 360 HOH HOH C . 
K 3 HOH 86  315 363 HOH HOH C . 
K 3 HOH 87  316 367 HOH HOH C . 
K 3 HOH 88  317 369 HOH HOH C . 
K 3 HOH 89  318 374 HOH HOH C . 
K 3 HOH 90  319 375 HOH HOH C . 
K 3 HOH 91  320 379 HOH HOH C . 
K 3 HOH 92  321 381 HOH HOH C . 
K 3 HOH 93  322 387 HOH HOH C . 
K 3 HOH 94  323 394 HOH HOH C . 
L 3 HOH 1   230 2   HOH HOH D . 
L 3 HOH 2   231 5   HOH HOH D . 
L 3 HOH 3   232 12  HOH HOH D . 
L 3 HOH 4   233 14  HOH HOH D . 
L 3 HOH 5   234 23  HOH HOH D . 
L 3 HOH 6   235 37  HOH HOH D . 
L 3 HOH 7   236 38  HOH HOH D . 
L 3 HOH 8   237 40  HOH HOH D . 
L 3 HOH 9   238 41  HOH HOH D . 
L 3 HOH 10  239 44  HOH HOH D . 
L 3 HOH 11  240 55  HOH HOH D . 
L 3 HOH 12  241 56  HOH HOH D . 
L 3 HOH 13  242 63  HOH HOH D . 
L 3 HOH 14  243 65  HOH HOH D . 
L 3 HOH 15  244 67  HOH HOH D . 
L 3 HOH 16  245 74  HOH HOH D . 
L 3 HOH 17  246 79  HOH HOH D . 
L 3 HOH 18  247 82  HOH HOH D . 
L 3 HOH 19  248 83  HOH HOH D . 
L 3 HOH 20  249 90  HOH HOH D . 
L 3 HOH 21  250 94  HOH HOH D . 
L 3 HOH 22  251 95  HOH HOH D . 
L 3 HOH 23  252 96  HOH HOH D . 
L 3 HOH 24  253 99  HOH HOH D . 
L 3 HOH 25  254 100 HOH HOH D . 
L 3 HOH 26  255 101 HOH HOH D . 
L 3 HOH 27  256 106 HOH HOH D . 
L 3 HOH 28  257 108 HOH HOH D . 
L 3 HOH 29  258 121 HOH HOH D . 
L 3 HOH 30  259 132 HOH HOH D . 
L 3 HOH 31  260 142 HOH HOH D . 
L 3 HOH 32  261 149 HOH HOH D . 
L 3 HOH 33  262 157 HOH HOH D . 
L 3 HOH 34  263 166 HOH HOH D . 
L 3 HOH 35  264 167 HOH HOH D . 
L 3 HOH 36  265 168 HOH HOH D . 
L 3 HOH 37  266 170 HOH HOH D . 
L 3 HOH 38  267 175 HOH HOH D . 
L 3 HOH 39  268 177 HOH HOH D . 
L 3 HOH 40  269 178 HOH HOH D . 
L 3 HOH 41  270 179 HOH HOH D . 
L 3 HOH 42  271 193 HOH HOH D . 
L 3 HOH 43  272 194 HOH HOH D . 
L 3 HOH 44  273 204 HOH HOH D . 
L 3 HOH 45  274 205 HOH HOH D . 
L 3 HOH 46  275 208 HOH HOH D . 
L 3 HOH 47  276 213 HOH HOH D . 
L 3 HOH 48  277 218 HOH HOH D . 
L 3 HOH 49  278 224 HOH HOH D . 
L 3 HOH 50  279 225 HOH HOH D . 
L 3 HOH 51  280 226 HOH HOH D . 
L 3 HOH 52  281 232 HOH HOH D . 
L 3 HOH 53  282 233 HOH HOH D . 
L 3 HOH 54  283 234 HOH HOH D . 
L 3 HOH 55  284 244 HOH HOH D . 
L 3 HOH 56  285 246 HOH HOH D . 
L 3 HOH 57  286 248 HOH HOH D . 
L 3 HOH 58  287 250 HOH HOH D . 
L 3 HOH 59  288 252 HOH HOH D . 
L 3 HOH 60  289 259 HOH HOH D . 
L 3 HOH 61  290 263 HOH HOH D . 
L 3 HOH 62  291 272 HOH HOH D . 
L 3 HOH 63  292 274 HOH HOH D . 
L 3 HOH 64  293 275 HOH HOH D . 
L 3 HOH 65  294 277 HOH HOH D . 
L 3 HOH 66  295 278 HOH HOH D . 
L 3 HOH 67  296 281 HOH HOH D . 
L 3 HOH 68  297 283 HOH HOH D . 
L 3 HOH 69  298 284 HOH HOH D . 
L 3 HOH 70  299 291 HOH HOH D . 
L 3 HOH 71  300 299 HOH HOH D . 
L 3 HOH 72  301 304 HOH HOH D . 
L 3 HOH 73  302 308 HOH HOH D . 
L 3 HOH 74  303 309 HOH HOH D . 
L 3 HOH 75  304 310 HOH HOH D . 
L 3 HOH 76  305 311 HOH HOH D . 
L 3 HOH 77  306 317 HOH HOH D . 
L 3 HOH 78  307 324 HOH HOH D . 
L 3 HOH 79  308 325 HOH HOH D . 
L 3 HOH 80  309 326 HOH HOH D . 
L 3 HOH 81  310 327 HOH HOH D . 
L 3 HOH 82  311 334 HOH HOH D . 
L 3 HOH 83  312 335 HOH HOH D . 
L 3 HOH 84  313 336 HOH HOH D . 
L 3 HOH 85  314 342 HOH HOH D . 
L 3 HOH 86  315 354 HOH HOH D . 
L 3 HOH 87  316 361 HOH HOH D . 
L 3 HOH 88  317 362 HOH HOH D . 
L 3 HOH 89  318 368 HOH HOH D . 
L 3 HOH 90  319 370 HOH HOH D . 
L 3 HOH 91  320 380 HOH HOH D . 
L 3 HOH 92  321 382 HOH HOH D . 
L 3 HOH 93  322 383 HOH HOH D . 
L 3 HOH 94  323 386 HOH HOH D . 
L 3 HOH 95  324 391 HOH HOH D . 
L 3 HOH 96  325 393 HOH HOH D . 
L 3 HOH 97  326 395 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? dimeric 2 
2 author_defined_assembly ? dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F,I,J 
2 1 C,D,G,H,K,L 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 28  ? A HIS 27  ? 1_555 FE ? E FE . ? A FE 229 ? 1_555 NE2 ? A HIS 82  ? A HIS 81  ? 1_555 88.3  ? 
2  NE2 ? A HIS 28  ? A HIS 27  ? 1_555 FE ? E FE . ? A FE 229 ? 1_555 OD2 ? A ASP 174 ? A ASP 173 ? 1_555 88.0  ? 
3  NE2 ? A HIS 82  ? A HIS 81  ? 1_555 FE ? E FE . ? A FE 229 ? 1_555 OD2 ? A ASP 174 ? A ASP 173 ? 1_555 108.7 ? 
4  NE2 ? A HIS 28  ? A HIS 27  ? 1_555 FE ? E FE . ? A FE 229 ? 1_555 NE2 ? A HIS 178 ? A HIS 177 ? 1_555 97.8  ? 
5  NE2 ? A HIS 82  ? A HIS 81  ? 1_555 FE ? E FE . ? A FE 229 ? 1_555 NE2 ? A HIS 178 ? A HIS 177 ? 1_555 134.8 ? 
6  OD2 ? A ASP 174 ? A ASP 173 ? 1_555 FE ? E FE . ? A FE 229 ? 1_555 NE2 ? A HIS 178 ? A HIS 177 ? 1_555 116.2 ? 
7  NE2 ? A HIS 28  ? A HIS 27  ? 1_555 FE ? E FE . ? A FE 229 ? 1_555 O   ? I HOH .   ? A HOH 233 ? 1_555 170.8 ? 
8  NE2 ? A HIS 82  ? A HIS 81  ? 1_555 FE ? E FE . ? A FE 229 ? 1_555 O   ? I HOH .   ? A HOH 233 ? 1_555 89.4  ? 
9  OD2 ? A ASP 174 ? A ASP 173 ? 1_555 FE ? E FE . ? A FE 229 ? 1_555 O   ? I HOH .   ? A HOH 233 ? 1_555 84.2  ? 
10 NE2 ? A HIS 178 ? A HIS 177 ? 1_555 FE ? E FE . ? A FE 229 ? 1_555 O   ? I HOH .   ? A HOH 233 ? 1_555 90.2  ? 
11 NE2 ? B HIS 28  ? B HIS 27  ? 1_555 FE ? F FE . ? B FE 229 ? 1_555 NE2 ? B HIS 82  ? B HIS 81  ? 1_555 85.0  ? 
12 NE2 ? B HIS 28  ? B HIS 27  ? 1_555 FE ? F FE . ? B FE 229 ? 1_555 OD2 ? B ASP 174 ? B ASP 173 ? 1_555 84.4  ? 
13 NE2 ? B HIS 82  ? B HIS 81  ? 1_555 FE ? F FE . ? B FE 229 ? 1_555 OD2 ? B ASP 174 ? B ASP 173 ? 1_555 109.1 ? 
14 NE2 ? B HIS 28  ? B HIS 27  ? 1_555 FE ? F FE . ? B FE 229 ? 1_555 NE2 ? B HIS 178 ? B HIS 177 ? 1_555 99.0  ? 
15 NE2 ? B HIS 82  ? B HIS 81  ? 1_555 FE ? F FE . ? B FE 229 ? 1_555 NE2 ? B HIS 178 ? B HIS 177 ? 1_555 136.3 ? 
16 OD2 ? B ASP 174 ? B ASP 173 ? 1_555 FE ? F FE . ? B FE 229 ? 1_555 NE2 ? B HIS 178 ? B HIS 177 ? 1_555 114.6 ? 
17 NE2 ? B HIS 28  ? B HIS 27  ? 1_555 FE ? F FE . ? B FE 229 ? 1_555 O   ? J HOH .   ? B HOH 230 ? 1_555 168.2 ? 
18 NE2 ? B HIS 82  ? B HIS 81  ? 1_555 FE ? F FE . ? B FE 229 ? 1_555 O   ? J HOH .   ? B HOH 230 ? 1_555 93.8  ? 
19 OD2 ? B ASP 174 ? B ASP 173 ? 1_555 FE ? F FE . ? B FE 229 ? 1_555 O   ? J HOH .   ? B HOH 230 ? 1_555 85.0  ? 
20 NE2 ? B HIS 178 ? B HIS 177 ? 1_555 FE ? F FE . ? B FE 229 ? 1_555 O   ? J HOH .   ? B HOH 230 ? 1_555 90.0  ? 
21 NE2 ? C HIS 28  ? C HIS 27  ? 1_555 FE ? G FE . ? C FE 229 ? 1_555 NE2 ? C HIS 82  ? C HIS 81  ? 1_555 86.5  ? 
22 NE2 ? C HIS 28  ? C HIS 27  ? 1_555 FE ? G FE . ? C FE 229 ? 1_555 OD2 ? C ASP 174 ? C ASP 173 ? 1_555 89.9  ? 
23 NE2 ? C HIS 82  ? C HIS 81  ? 1_555 FE ? G FE . ? C FE 229 ? 1_555 OD2 ? C ASP 174 ? C ASP 173 ? 1_555 106.6 ? 
24 NE2 ? C HIS 28  ? C HIS 27  ? 1_555 FE ? G FE . ? C FE 229 ? 1_555 NE2 ? C HIS 178 ? C HIS 177 ? 1_555 95.5  ? 
25 NE2 ? C HIS 82  ? C HIS 81  ? 1_555 FE ? G FE . ? C FE 229 ? 1_555 NE2 ? C HIS 178 ? C HIS 177 ? 1_555 134.4 ? 
26 OD2 ? C ASP 174 ? C ASP 173 ? 1_555 FE ? G FE . ? C FE 229 ? 1_555 NE2 ? C HIS 178 ? C HIS 177 ? 1_555 118.9 ? 
27 NE2 ? C HIS 28  ? C HIS 27  ? 1_555 FE ? G FE . ? C FE 229 ? 1_555 O   ? K HOH .   ? C HOH 230 ? 1_555 171.9 ? 
28 NE2 ? C HIS 82  ? C HIS 81  ? 1_555 FE ? G FE . ? C FE 229 ? 1_555 O   ? K HOH .   ? C HOH 230 ? 1_555 91.7  ? 
29 OD2 ? C ASP 174 ? C ASP 173 ? 1_555 FE ? G FE . ? C FE 229 ? 1_555 O   ? K HOH .   ? C HOH 230 ? 1_555 83.1  ? 
30 NE2 ? C HIS 178 ? C HIS 177 ? 1_555 FE ? G FE . ? C FE 229 ? 1_555 O   ? K HOH .   ? C HOH 230 ? 1_555 91.4  ? 
31 NE2 ? D HIS 28  ? D HIS 27  ? 1_555 FE ? H FE . ? D FE 229 ? 1_555 NE2 ? D HIS 82  ? D HIS 81  ? 1_555 84.8  ? 
32 NE2 ? D HIS 28  ? D HIS 27  ? 1_555 FE ? H FE . ? D FE 229 ? 1_555 OD2 ? D ASP 174 ? D ASP 173 ? 1_555 85.7  ? 
33 NE2 ? D HIS 82  ? D HIS 81  ? 1_555 FE ? H FE . ? D FE 229 ? 1_555 OD2 ? D ASP 174 ? D ASP 173 ? 1_555 109.0 ? 
34 NE2 ? D HIS 28  ? D HIS 27  ? 1_555 FE ? H FE . ? D FE 229 ? 1_555 NE2 ? D HIS 178 ? D HIS 177 ? 1_555 94.1  ? 
35 NE2 ? D HIS 82  ? D HIS 81  ? 1_555 FE ? H FE . ? D FE 229 ? 1_555 NE2 ? D HIS 178 ? D HIS 177 ? 1_555 135.8 ? 
36 OD2 ? D ASP 174 ? D ASP 173 ? 1_555 FE ? H FE . ? D FE 229 ? 1_555 NE2 ? D HIS 178 ? D HIS 177 ? 1_555 115.0 ? 
37 NE2 ? D HIS 28  ? D HIS 27  ? 1_555 FE ? H FE . ? D FE 229 ? 1_555 O   ? L HOH .   ? D HOH 234 ? 1_555 169.9 ? 
38 NE2 ? D HIS 82  ? D HIS 81  ? 1_555 FE ? H FE . ? D FE 229 ? 1_555 O   ? L HOH .   ? D HOH 234 ? 1_555 94.6  ? 
39 OD2 ? D ASP 174 ? D ASP 173 ? 1_555 FE ? H FE . ? D FE 229 ? 1_555 O   ? L HOH .   ? D HOH 234 ? 1_555 84.9  ? 
40 NE2 ? D HIS 178 ? D HIS 177 ? 1_555 FE ? H FE . ? D FE 229 ? 1_555 O   ? L HOH .   ? D HOH 234 ? 1_555 93.3  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-12-21 
2 'Structure model' 1 1 2007-10-16 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1 . refined -9.9494 16.4962 14.2350  -0.1359 -0.1242 -0.1349 -0.0249 0.0135  -0.0019 0.6603 2.4764 1.5235 0.3411 0.5030 0.3781 
-0.0502 0.0077  0.0424  -0.0190 0.0351  0.0475  -0.3158 -0.0491 0.0661  'X-RAY DIFFRACTION' 
2 . refined 0.3050  27.9594 39.7315  -0.1419 -0.1051 -0.1491 -0.0441 -0.0023 -0.0310 1.4630 1.9144 2.5240 0.2652 1.1158 0.1777 
-0.1047 -0.0810 0.1857  -0.0825 0.1760  -0.0461 0.1919  -0.2949 0.0107  'X-RAY DIFFRACTION' 
3 . refined 8.3888  26.4932 72.5899  -0.1447 -0.0939 -0.1608 -0.0044 -0.0157 -0.0078 1.2965 2.0345 2.3783 0.3248 0.4772 1.1512 
0.0355  0.1460  -0.1815 0.2108  -0.0167 -0.0671 -0.1621 0.0003  0.0197  'X-RAY DIFFRACTION' 
4 . refined 16.9661 18.7900 100.5325 0.0373  -0.2063 -0.1173 -0.0063 -0.1017 0.0129  1.2085 1.3554 1.7743 0.1924 0.5607 0.3588 
0.1723  0.0118  -0.1841 0.0062  -0.1939 -0.1297 0.3459  0.3405  -0.0201 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 2  A 94  ALL A 1  A 93  'X-RAY DIFFRACTION' ? 
2 1 A 98 A 214 ALL A 97 A 213 'X-RAY DIFFRACTION' ? 
3 2 B 2  B 91  ALL B 1  B 90  'X-RAY DIFFRACTION' ? 
4 2 B 99 B 212 ALL B 98 B 211 'X-RAY DIFFRACTION' ? 
5 3 C 3  C 90  ALL C 2  C 89  'X-RAY DIFFRACTION' ? 
6 3 C 99 C 214 ALL C 98 C 213 'X-RAY DIFFRACTION' ? 
7 4 D 3  D 216 ALL D 2  D 215 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refmac_5.2.0005 24/04/2001 program 'Murshudov, G.N.' ccp4@dl.ac.uk refinement       http://www.ccp4.ac.uk/main.html 
Fortran ? 1 
DENZO     .               ?          ?       ?                 ?             'data reduction' ?                               ? ? 
2 
SCALEPACK .               ?          ?       ?                 ?             'data scaling'   ?                               ? ? 
3 
EPMR      .               ?          ?       ?                 ?             phasing          ?                               ? ? 
4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 151 ? ? 54.84   -119.84 
2  1 TYR A 179 ? ? -141.12 -10.57  
3  1 GLN A 184 ? ? 48.94   -126.64 
4  1 ASN B 151 ? ? 50.86   -120.87 
5  1 TYR B 179 ? ? -142.01 -8.17   
6  1 GLN B 184 ? ? 48.36   -127.30 
7  1 LYS C 30  ? ? -109.56 -60.36  
8  1 ASN C 151 ? ? 53.93   -120.94 
9  1 TYR C 179 ? ? -140.51 -8.92   
10 1 GLN C 184 ? ? 50.96   -129.18 
11 1 PRO D 9   ? ? -69.78  1.74    
12 1 LYS D 30  ? ? -104.87 -65.23  
13 1 ASN D 95  ? ? 20.71   69.27   
14 1 ASN D 151 ? ? 54.00   -119.02 
15 1 TYR D 179 ? ? -141.54 -6.98   
16 1 GLN D 184 ? ? 48.43   -127.64 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 0   ? A MET 1   
2  1 Y 1 A GLN 94  ? A GLN 95  
3  1 Y 1 A ASN 95  ? A ASN 96  
4  1 Y 1 A GLY 96  ? A GLY 97  
5  1 Y 1 A PRO 214 ? A PRO 215 
6  1 Y 1 A ARG 215 ? A ARG 216 
7  1 Y 1 A GLY 216 ? A GLY 217 
8  1 Y 1 A SER 217 ? A SER 218 
9  1 Y 1 A ALA 218 ? A ALA 219 
10 1 Y 1 A ALA 219 ? A ALA 220 
11 1 Y 1 A ALA 220 ? A ALA 221 
12 1 Y 1 A LEU 221 ? A LEU 222 
13 1 Y 1 A GLU 222 ? A GLU 223 
14 1 Y 1 A HIS 223 ? A HIS 224 
15 1 Y 1 A HIS 224 ? A HIS 225 
16 1 Y 1 A HIS 225 ? A HIS 226 
17 1 Y 1 A HIS 226 ? A HIS 227 
18 1 Y 1 A HIS 227 ? A HIS 228 
19 1 Y 1 A HIS 228 ? A HIS 229 
20 1 Y 1 B MET 0   ? B MET 1   
21 1 Y 1 B GLY 91  ? B GLY 92  
22 1 Y 1 B GLN 92  ? B GLN 93  
23 1 Y 1 B GLY 93  ? B GLY 94  
24 1 Y 1 B GLN 94  ? B GLN 95  
25 1 Y 1 B ASN 95  ? B ASN 96  
26 1 Y 1 B GLY 96  ? B GLY 97  
27 1 Y 1 B ALA 97  ? B ALA 98  
28 1 Y 1 B LEU 212 ? B LEU 213 
29 1 Y 1 B VAL 213 ? B VAL 214 
30 1 Y 1 B PRO 214 ? B PRO 215 
31 1 Y 1 B ARG 215 ? B ARG 216 
32 1 Y 1 B GLY 216 ? B GLY 217 
33 1 Y 1 B SER 217 ? B SER 218 
34 1 Y 1 B ALA 218 ? B ALA 219 
35 1 Y 1 B ALA 219 ? B ALA 220 
36 1 Y 1 B ALA 220 ? B ALA 221 
37 1 Y 1 B LEU 221 ? B LEU 222 
38 1 Y 1 B GLU 222 ? B GLU 223 
39 1 Y 1 B HIS 223 ? B HIS 224 
40 1 Y 1 B HIS 224 ? B HIS 225 
41 1 Y 1 B HIS 225 ? B HIS 226 
42 1 Y 1 B HIS 226 ? B HIS 227 
43 1 Y 1 B HIS 227 ? B HIS 228 
44 1 Y 1 B HIS 228 ? B HIS 229 
45 1 Y 1 C MET 0   ? C MET 1   
46 1 Y 1 C ALA 1   ? C ALA 2   
47 1 Y 1 C GLN 90  ? C GLN 91  
48 1 Y 1 C GLY 91  ? C GLY 92  
49 1 Y 1 C GLN 92  ? C GLN 93  
50 1 Y 1 C GLY 93  ? C GLY 94  
51 1 Y 1 C GLN 94  ? C GLN 95  
52 1 Y 1 C ASN 95  ? C ASN 96  
53 1 Y 1 C GLY 96  ? C GLY 97  
54 1 Y 1 C ALA 97  ? C ALA 98  
55 1 Y 1 C PRO 214 ? C PRO 215 
56 1 Y 1 C ARG 215 ? C ARG 216 
57 1 Y 1 C GLY 216 ? C GLY 217 
58 1 Y 1 C SER 217 ? C SER 218 
59 1 Y 1 C ALA 218 ? C ALA 219 
60 1 Y 1 C ALA 219 ? C ALA 220 
61 1 Y 1 C ALA 220 ? C ALA 221 
62 1 Y 1 C LEU 221 ? C LEU 222 
63 1 Y 1 C GLU 222 ? C GLU 223 
64 1 Y 1 C HIS 223 ? C HIS 224 
65 1 Y 1 C HIS 224 ? C HIS 225 
66 1 Y 1 C HIS 225 ? C HIS 226 
67 1 Y 1 C HIS 226 ? C HIS 227 
68 1 Y 1 C HIS 227 ? C HIS 228 
69 1 Y 1 C HIS 228 ? C HIS 229 
70 1 Y 1 D MET 0   ? D MET 1   
71 1 Y 1 D ALA 1   ? D ALA 2   
72 1 Y 1 D GLY 216 ? D GLY 217 
73 1 Y 1 D SER 217 ? D SER 218 
74 1 Y 1 D ALA 218 ? D ALA 219 
75 1 Y 1 D ALA 219 ? D ALA 220 
76 1 Y 1 D ALA 220 ? D ALA 221 
77 1 Y 1 D LEU 221 ? D LEU 222 
78 1 Y 1 D GLU 222 ? D GLU 223 
79 1 Y 1 D HIS 223 ? D HIS 224 
80 1 Y 1 D HIS 224 ? D HIS 225 
81 1 Y 1 D HIS 225 ? D HIS 226 
82 1 Y 1 D HIS 226 ? D HIS 227 
83 1 Y 1 D HIS 227 ? D HIS 228 
84 1 Y 1 D HIS 228 ? D HIS 229 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'FE (III) ION' FE  
3 water          HOH 
#