data_1YA8
# 
_entry.id   1YA8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1YA8         
RCSB  RCSB031311   
WWPDB D_1000031311 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1MX1 'Crystal Structure Of Human Liver Carboxylesterase In Complex With Tacrine'                                      
unspecified 
PDB 1MX5 'Crystal Structure Of Human Liver Carboxylesterase In Complexed With Homatropine, A Cocaine Analogue'            
unspecified 
PDB 1MX9 'Crystal Structure Of Human Liver Carboxylesterase In Complexed With Naloxone Methiodide, A Heroin Analogue'     
unspecified 
PDB 1ya4 'Crystal Structure of Human Liver Carboxylesterase 1 in complex with tamoxifen'                                  
unspecified 
PDB 1yah 'Crystal Structure of Human Liver Carboxylesterase complexed to Etyl Acetate; A Fatty Acid Ethyl Ester Analogue' 
unspecified 
PDB 1yaj 'Crystal Structure of Human Liver Carboxylesterase in complex with benzil'                                       
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1YA8 
_pdbx_database_status.recvd_initial_deposition_date   2004-12-17 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fleming, C.D.'         1 
'Bencharit, S.'         2 
'Edwards, C.C.'         3 
'Hyatt, J.L.'           4 
'Morton, C.L.'          5 
'Howard-Williams, E.L.' 6 
'Potter, P.M.'          7 
'Redinbo, M.R.'         8 
# 
_citation.id                        primary 
_citation.title                     
'Structural insights into drug processing by human carboxylesterase 1: tamoxifen, mevastatin, and inhibition by benzil.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            352 
_citation.page_first                165 
_citation.page_last                 177 
_citation.year                      2005 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16081098 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2005.07.016 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Fleming, C.D.'         1  ? 
primary 'Bencharit, S.'         2  ? 
primary 'Edwards, C.C.'         3  ? 
primary 'Hyatt, J.L.'           4  ? 
primary 'Tsurkan, L.'           5  ? 
primary 'Bai, F.'               6  ? 
primary 'Fraga, C.'             7  ? 
primary 'Morton, C.L.'          8  ? 
primary 'Howard-Williams, E.L.' 9  ? 
primary 'Potter, P.M.'          10 ? 
primary 'Redinbo, M.R.'         11 ? 
# 
_cell.entry_id           1YA8 
_cell.length_a           55.777 
_cell.length_b           181.589 
_cell.length_c           202.874 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1YA8 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'CES1 protein' 58672.227 3   3.1.1.1 ? ? ? 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   3   ?       ? ? ? 
3 non-polymer man 'N-acetyl-alpha-neuraminic acid' 309.270   3   ?       ? ? ? 
4 non-polymer syn 'SULFATE ION' 96.063    6   ?       ? ? ? 
5 non-polymer syn 
'(1S,7S,8S,8AR)-1,2,3,7,8,8A-HEXAHYDRO-7-METHYL-8-[2-[(2R,4R)-TETRAHYDRO-4-HY DROXY-6-OXO-2H-PYRAN-2-YL]ETHYL]-1-NAPHTHALENOL' 
306.397   2   ?       ? ? ? 
6 non-polymer syn '2-METHYLBUTANOIC ACID' 102.132   4   ?       ? ? ? 
7 water       nat water 18.015    347 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLSEL
FTNRKENIPLKLSEDCLYLNIYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFST
GDEHSRGNWGHLDQVAALRWVQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKKGD
VKPLAEQIAITAGCKTTTSAVMVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERN
FHTVPYMVGINKQEFGWLIPMLMSYPLSEGQLDQKTAMSLLWKSYPLVCIAKELIPEATEKYLGGTDDTVKKKDLFLDLI
ADVMFGVPSVIVARNHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPFLKEGASEEEIRLSKMVMKFWA
NFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLSEL
FTNRKENIPLKLSEDCLYLNIYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFST
GDEHSRGNWGHLDQVAALRWVQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKKGD
VKPLAEQIAITAGCKTTTSAVMVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERN
FHTVPYMVGINKQEFGWLIPMLMSYPLSEGQLDQKTAMSLLWKSYPLVCIAKELIPEATEKYLGGTDDTVKKKDLFLDLI
ADVMFGVPSVIVARNHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPFLKEGASEEEIRLSKMVMKFWA
NFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAK
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   SER n 
1 3   PRO n 
1 4   PRO n 
1 5   VAL n 
1 6   VAL n 
1 7   ASP n 
1 8   THR n 
1 9   VAL n 
1 10  HIS n 
1 11  GLY n 
1 12  LYS n 
1 13  VAL n 
1 14  LEU n 
1 15  GLY n 
1 16  LYS n 
1 17  PHE n 
1 18  VAL n 
1 19  SER n 
1 20  LEU n 
1 21  GLU n 
1 22  GLY n 
1 23  PHE n 
1 24  ALA n 
1 25  GLN n 
1 26  PRO n 
1 27  VAL n 
1 28  ALA n 
1 29  ILE n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  LYS n 
1 38  PRO n 
1 39  PRO n 
1 40  LEU n 
1 41  GLY n 
1 42  PRO n 
1 43  LEU n 
1 44  ARG n 
1 45  PHE n 
1 46  THR n 
1 47  PRO n 
1 48  PRO n 
1 49  GLN n 
1 50  PRO n 
1 51  ALA n 
1 52  GLU n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  PHE n 
1 57  VAL n 
1 58  LYS n 
1 59  ASN n 
1 60  ALA n 
1 61  THR n 
1 62  SER n 
1 63  TYR n 
1 64  PRO n 
1 65  PRO n 
1 66  MET n 
1 67  CYS n 
1 68  THR n 
1 69  GLN n 
1 70  ASP n 
1 71  PRO n 
1 72  LYS n 
1 73  ALA n 
1 74  GLY n 
1 75  GLN n 
1 76  LEU n 
1 77  LEU n 
1 78  SER n 
1 79  GLU n 
1 80  LEU n 
1 81  PHE n 
1 82  THR n 
1 83  ASN n 
1 84  ARG n 
1 85  LYS n 
1 86  GLU n 
1 87  ASN n 
1 88  ILE n 
1 89  PRO n 
1 90  LEU n 
1 91  LYS n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 ILE n 
1 102 TYR n 
1 103 THR n 
1 104 PRO n 
1 105 ALA n 
1 106 ASP n 
1 107 LEU n 
1 108 THR n 
1 109 LYS n 
1 110 LYS n 
1 111 ASN n 
1 112 ARG n 
1 113 LEU n 
1 114 PRO n 
1 115 VAL n 
1 116 MET n 
1 117 VAL n 
1 118 TRP n 
1 119 ILE n 
1 120 HIS n 
1 121 GLY n 
1 122 GLY n 
1 123 GLY n 
1 124 LEU n 
1 125 MET n 
1 126 VAL n 
1 127 GLY n 
1 128 ALA n 
1 129 ALA n 
1 130 SER n 
1 131 THR n 
1 132 TYR n 
1 133 ASP n 
1 134 GLY n 
1 135 LEU n 
1 136 ALA n 
1 137 LEU n 
1 138 ALA n 
1 139 ALA n 
1 140 HIS n 
1 141 GLU n 
1 142 ASN n 
1 143 VAL n 
1 144 VAL n 
1 145 VAL n 
1 146 VAL n 
1 147 THR n 
1 148 ILE n 
1 149 GLN n 
1 150 TYR n 
1 151 ARG n 
1 152 LEU n 
1 153 GLY n 
1 154 ILE n 
1 155 TRP n 
1 156 GLY n 
1 157 PHE n 
1 158 PHE n 
1 159 SER n 
1 160 THR n 
1 161 GLY n 
1 162 ASP n 
1 163 GLU n 
1 164 HIS n 
1 165 SER n 
1 166 ARG n 
1 167 GLY n 
1 168 ASN n 
1 169 TRP n 
1 170 GLY n 
1 171 HIS n 
1 172 LEU n 
1 173 ASP n 
1 174 GLN n 
1 175 VAL n 
1 176 ALA n 
1 177 ALA n 
1 178 LEU n 
1 179 ARG n 
1 180 TRP n 
1 181 VAL n 
1 182 GLN n 
1 183 ASP n 
1 184 ASN n 
1 185 ILE n 
1 186 ALA n 
1 187 SER n 
1 188 PHE n 
1 189 GLY n 
1 190 GLY n 
1 191 ASN n 
1 192 PRO n 
1 193 GLY n 
1 194 SER n 
1 195 VAL n 
1 196 THR n 
1 197 ILE n 
1 198 PHE n 
1 199 GLY n 
1 200 GLU n 
1 201 SER n 
1 202 ALA n 
1 203 GLY n 
1 204 GLY n 
1 205 GLU n 
1 206 SER n 
1 207 VAL n 
1 208 SER n 
1 209 VAL n 
1 210 LEU n 
1 211 VAL n 
1 212 LEU n 
1 213 SER n 
1 214 PRO n 
1 215 LEU n 
1 216 ALA n 
1 217 LYS n 
1 218 ASN n 
1 219 LEU n 
1 220 PHE n 
1 221 HIS n 
1 222 ARG n 
1 223 ALA n 
1 224 ILE n 
1 225 SER n 
1 226 GLU n 
1 227 SER n 
1 228 GLY n 
1 229 VAL n 
1 230 ALA n 
1 231 LEU n 
1 232 THR n 
1 233 SER n 
1 234 VAL n 
1 235 LEU n 
1 236 VAL n 
1 237 LYS n 
1 238 LYS n 
1 239 GLY n 
1 240 ASP n 
1 241 VAL n 
1 242 LYS n 
1 243 PRO n 
1 244 LEU n 
1 245 ALA n 
1 246 GLU n 
1 247 GLN n 
1 248 ILE n 
1 249 ALA n 
1 250 ILE n 
1 251 THR n 
1 252 ALA n 
1 253 GLY n 
1 254 CYS n 
1 255 LYS n 
1 256 THR n 
1 257 THR n 
1 258 THR n 
1 259 SER n 
1 260 ALA n 
1 261 VAL n 
1 262 MET n 
1 263 VAL n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLN n 
1 269 LYS n 
1 270 THR n 
1 271 GLU n 
1 272 GLU n 
1 273 GLU n 
1 274 LEU n 
1 275 LEU n 
1 276 GLU n 
1 277 THR n 
1 278 THR n 
1 279 LEU n 
1 280 LYS n 
1 281 MET n 
1 282 LYS n 
1 283 PHE n 
1 284 LEU n 
1 285 SER n 
1 286 LEU n 
1 287 ASP n 
1 288 LEU n 
1 289 GLN n 
1 290 GLY n 
1 291 ASP n 
1 292 PRO n 
1 293 ARG n 
1 294 GLU n 
1 295 SER n 
1 296 GLN n 
1 297 PRO n 
1 298 LEU n 
1 299 LEU n 
1 300 GLY n 
1 301 THR n 
1 302 VAL n 
1 303 ILE n 
1 304 ASP n 
1 305 GLY n 
1 306 MET n 
1 307 LEU n 
1 308 LEU n 
1 309 LEU n 
1 310 LYS n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 GLU n 
1 315 LEU n 
1 316 GLN n 
1 317 ALA n 
1 318 GLU n 
1 319 ARG n 
1 320 ASN n 
1 321 PHE n 
1 322 HIS n 
1 323 THR n 
1 324 VAL n 
1 325 PRO n 
1 326 TYR n 
1 327 MET n 
1 328 VAL n 
1 329 GLY n 
1 330 ILE n 
1 331 ASN n 
1 332 LYS n 
1 333 GLN n 
1 334 GLU n 
1 335 PHE n 
1 336 GLY n 
1 337 TRP n 
1 338 LEU n 
1 339 ILE n 
1 340 PRO n 
1 341 MET n 
1 342 LEU n 
1 343 MET n 
1 344 SER n 
1 345 TYR n 
1 346 PRO n 
1 347 LEU n 
1 348 SER n 
1 349 GLU n 
1 350 GLY n 
1 351 GLN n 
1 352 LEU n 
1 353 ASP n 
1 354 GLN n 
1 355 LYS n 
1 356 THR n 
1 357 ALA n 
1 358 MET n 
1 359 SER n 
1 360 LEU n 
1 361 LEU n 
1 362 TRP n 
1 363 LYS n 
1 364 SER n 
1 365 TYR n 
1 366 PRO n 
1 367 LEU n 
1 368 VAL n 
1 369 CYS n 
1 370 ILE n 
1 371 ALA n 
1 372 LYS n 
1 373 GLU n 
1 374 LEU n 
1 375 ILE n 
1 376 PRO n 
1 377 GLU n 
1 378 ALA n 
1 379 THR n 
1 380 GLU n 
1 381 LYS n 
1 382 TYR n 
1 383 LEU n 
1 384 GLY n 
1 385 GLY n 
1 386 THR n 
1 387 ASP n 
1 388 ASP n 
1 389 THR n 
1 390 VAL n 
1 391 LYS n 
1 392 LYS n 
1 393 LYS n 
1 394 ASP n 
1 395 LEU n 
1 396 PHE n 
1 397 LEU n 
1 398 ASP n 
1 399 LEU n 
1 400 ILE n 
1 401 ALA n 
1 402 ASP n 
1 403 VAL n 
1 404 MET n 
1 405 PHE n 
1 406 GLY n 
1 407 VAL n 
1 408 PRO n 
1 409 SER n 
1 410 VAL n 
1 411 ILE n 
1 412 VAL n 
1 413 ALA n 
1 414 ARG n 
1 415 ASN n 
1 416 HIS n 
1 417 ARG n 
1 418 ASP n 
1 419 ALA n 
1 420 GLY n 
1 421 ALA n 
1 422 PRO n 
1 423 THR n 
1 424 TYR n 
1 425 MET n 
1 426 TYR n 
1 427 GLU n 
1 428 PHE n 
1 429 GLN n 
1 430 TYR n 
1 431 ARG n 
1 432 PRO n 
1 433 SER n 
1 434 PHE n 
1 435 SER n 
1 436 SER n 
1 437 ASP n 
1 438 MET n 
1 439 LYS n 
1 440 PRO n 
1 441 LYS n 
1 442 THR n 
1 443 VAL n 
1 444 ILE n 
1 445 GLY n 
1 446 ASP n 
1 447 HIS n 
1 448 GLY n 
1 449 ASP n 
1 450 GLU n 
1 451 LEU n 
1 452 PHE n 
1 453 SER n 
1 454 VAL n 
1 455 PHE n 
1 456 GLY n 
1 457 ALA n 
1 458 PRO n 
1 459 PHE n 
1 460 LEU n 
1 461 LYS n 
1 462 GLU n 
1 463 GLY n 
1 464 ALA n 
1 465 SER n 
1 466 GLU n 
1 467 GLU n 
1 468 GLU n 
1 469 ILE n 
1 470 ARG n 
1 471 LEU n 
1 472 SER n 
1 473 LYS n 
1 474 MET n 
1 475 VAL n 
1 476 MET n 
1 477 LYS n 
1 478 PHE n 
1 479 TRP n 
1 480 ALA n 
1 481 ASN n 
1 482 PHE n 
1 483 ALA n 
1 484 ARG n 
1 485 ASN n 
1 486 GLY n 
1 487 ASN n 
1 488 PRO n 
1 489 ASN n 
1 490 GLY n 
1 491 GLU n 
1 492 GLY n 
1 493 LEU n 
1 494 PRO n 
1 495 HIS n 
1 496 TRP n 
1 497 PRO n 
1 498 GLU n 
1 499 TYR n 
1 500 ASN n 
1 501 GLN n 
1 502 LYS n 
1 503 GLU n 
1 504 GLY n 
1 505 TYR n 
1 506 LEU n 
1 507 GLN n 
1 508 ILE n 
1 509 GLY n 
1 510 ALA n 
1 511 ASN n 
1 512 THR n 
1 513 GLN n 
1 514 ALA n 
1 515 ALA n 
1 516 GLN n 
1 517 LYS n 
1 518 LEU n 
1 519 LYS n 
1 520 ASP n 
1 521 LYS n 
1 522 GLU n 
1 523 VAL n 
1 524 ALA n 
1 525 PHE n 
1 526 TRP n 
1 527 THR n 
1 528 ASN n 
1 529 LEU n 
1 530 PHE n 
1 531 ALA n 
1 532 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     Spodoptera 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               Sf9 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    EST1_HUMAN 
_struct_ref.pdbx_db_accession          P23141 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLSEL
FTNRKENIPLKLSEDCLYLNIYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFST
GDEHSRGNWGHLDQVAALRWVQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKKGD
VKPLAEQIAITAGCKTTTSAVMVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERN
FHTVPYMVGINKQEFGWLIPMLMSYPLSEGQLDQKTAMSLLWKSYPLVCIAKELIPEATEKYLGGTDDTVKKKDLFLDLI
ADVMFGVPSVIVARNHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPFLKEGASEEEIRLSKMVMKFWA
NFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAK
;
_struct_ref.pdbx_align_begin           21 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1YA8 A 1 ? 531 ? P23141 21 ? 552 ? 21 552 
2 1 1YA8 B 1 ? 531 ? P23141 21 ? 552 ? 21 552 
3 1 1YA8 C 1 ? 531 ? P23141 21 ? 552 ? 21 552 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'           y CYSTEINE ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'           y GLUTAMINE ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE ? 'C5 H11 N O2 S'  149.211 
MVB non-polymer                   . 
'(1S,7S,8S,8AR)-1,2,3,7,8,8A-HEXAHYDRO-7-METHYL-8-[2-[(2R,4R)-TETRAHYDRO-4-HY DROXY-6-OXO-2H-PYRAN-2-YL]ETHYL]-1-NAPHTHALENOL' ? 
'C18 H26 O4'     306.397 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE ? 'C3 H7 N O3'     105.093 
SIA 'D-saccharide, alpha linking' . 'N-acetyl-alpha-neuraminic acid' ? 'C11 H19 N O9'   309.270 
SMB non-polymer                   . '2-METHYLBUTANOIC ACID' ? 'C5 H10 O2'      102.132 
SO4 non-polymer                   . 'SULFATE ION' ? 'O4 S -2'        96.063  
THR 'L-peptide linking'           y THREONINE ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1YA8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.85 
_exptl_crystal.density_percent_sol   56.79 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    
;PEG 3350, Sodium Chloride, Lithium Chloride, Lithium Sulfate, Citrate, Glycerol, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 295K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2002-11-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL9-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL9-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.1 
# 
_reflns.entry_id                     1YA8 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            3.0 
_reflns.number_obs                   41408 
_reflns.number_all                   42843 
_reflns.percent_possible_obs         98.1 
_reflns.pdbx_Rmerge_I_obs            0.128 
_reflns.pdbx_Rsym_value              0.128 
_reflns.pdbx_netI_over_sigmaI        11.3 
_reflns.B_iso_Wilson_estimate        29.7 
_reflns.pdbx_redundancy              10.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.0 
_reflns_shell.d_res_low              3.11 
_reflns_shell.percent_possible_all   97.5 
_reflns_shell.Rmerge_I_obs           0.415 
_reflns_shell.pdbx_Rsym_value        0.415 
_reflns_shell.meanI_over_sigI_obs    3.7 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      4185 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1YA8 
_refine.ls_number_reflns_obs                     41408 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               2421972.33 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           2421972.33 
_refine.ls_d_res_low                             22.70 
_refine.ls_d_res_high                            3.00 
_refine.ls_percent_reflns_obs                    98.1 
_refine.ls_R_factor_obs                          0.187 
_refine.ls_R_factor_all                          0.187 
_refine.ls_R_factor_R_work                       0.187 
_refine.ls_R_factor_R_free                       0.247 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 7.1 
_refine.ls_number_reflns_R_free                  2931 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               29.7 
_refine.aniso_B[1][1]                            -2.46 
_refine.aniso_B[2][2]                            6.85 
_refine.aniso_B[3][3]                            -4.38 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.363964 
_refine.solvent_model_param_bsol                 34.3224 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB CODE 1MX1' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1YA8 
_refine_analyze.Luzzati_coordinate_error_obs    0.29 
_refine_analyze.Luzzati_sigma_a_obs             0.35 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.41 
_refine_analyze.Luzzati_sigma_a_free            0.52 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        12391 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         207 
_refine_hist.number_atoms_solvent             347 
_refine_hist.number_atoms_total               12945 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        22.70 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 22.6  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.88  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.37  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.44  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        1.78  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.88  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       3.00 
_refine_ls_shell.d_res_low                        3.19 
_refine_ls_shell.number_reflns_R_work             6311 
_refine_ls_shell.R_factor_R_work                  0.273 
_refine_ls_shell.percent_reflns_obs               97.5 
_refine_ls_shell.R_factor_R_free                  0.364 
_refine_ls_shell.R_factor_R_free_error            0.017 
_refine_ls_shell.percent_reflns_R_free            6.5 
_refine_ls_shell.number_reflns_R_free             442 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM  PROTEIN.TOP      'X-RAY DIFFRACTION' 
2 CARBOHYDRATE.PARAM CARBOHYDRATE.TOP 'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM    WATER.TOP        'X-RAY DIFFRACTION' 
4 ION.PARAM          ION.TOP          'X-RAY DIFFRACTION' 
5 MVP.PAR            MVP.TOP          'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1YA8 
_struct.title                     
'Crystal Structure of Human Liver Carboxylesterase in complex with cleavage products of Mevastatin' 
_struct.pdbx_descriptor           'CES1 protein (E.C.3.1.1.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1YA8 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'Hydrolase, Carboxylesterase, Mevastatin' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 5 ? 
I N N 6 ? 
J N N 2 ? 
K N N 3 ? 
L N N 4 ? 
M N N 4 ? 
N N N 6 ? 
O N N 6 ? 
P N N 2 ? 
Q N N 3 ? 
R N N 4 ? 
S N N 4 ? 
T N N 5 ? 
U N N 6 ? 
V N N 7 ? 
W N N 7 ? 
X N N 7 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 40  ? ARG A 44  ? LEU A 60  ARG A 64  5 ? 5  
HELX_P HELX_P2  2  ASP A 70  ? THR A 82  ? ASP A 90  THR A 102 1 ? 13 
HELX_P HELX_P3  3  GLY A 134 ? ASN A 142 ? GLY A 154 ASN A 162 1 ? 9  
HELX_P HELX_P4  4  LEU A 152 ? PHE A 158 ? LEU A 172 PHE A 178 1 ? 7  
HELX_P HELX_P5  5  ASN A 168 ? ILE A 185 ? ASN A 188 ILE A 205 1 ? 18 
HELX_P HELX_P6  6  ALA A 186 ? PHE A 188 ? ALA A 206 PHE A 208 5 ? 3  
HELX_P HELX_P7  7  SER A 201 ? SER A 213 ? SER A 221 SER A 233 1 ? 13 
HELX_P HELX_P8  8  THR A 232 ? VAL A 236 ? THR A 252 VAL A 256 5 ? 5  
HELX_P HELX_P9  9  VAL A 241 ? ALA A 252 ? VAL A 261 ALA A 272 1 ? 12 
HELX_P HELX_P10 10 THR A 258 ? ARG A 267 ? THR A 278 ARG A 287 1 ? 10 
HELX_P HELX_P11 11 THR A 270 ? LYS A 282 ? THR A 290 LYS A 302 1 ? 13 
HELX_P HELX_P12 12 ASP A 291 ? SER A 295 ? ASP A 311 SER A 315 5 ? 5  
HELX_P HELX_P13 13 THR A 311 ? ALA A 317 ? THR A 331 ALA A 337 1 ? 7  
HELX_P HELX_P14 14 TRP A 337 ? SER A 344 ? TRP A 357 SER A 365 1 ? 8  
HELX_P HELX_P15 15 ASP A 353 ? SER A 364 ? ASP A 374 SER A 385 1 ? 12 
HELX_P HELX_P16 16 SER A 364 ? CYS A 369 ? SER A 385 CYS A 390 1 ? 6  
HELX_P HELX_P17 17 LEU A 374 ? GLY A 384 ? LEU A 395 GLY A 405 1 ? 11 
HELX_P HELX_P18 18 ASP A 388 ? PHE A 405 ? ASP A 409 PHE A 426 1 ? 18 
HELX_P HELX_P19 19 PHE A 405 ? GLY A 420 ? PHE A 426 GLY A 441 1 ? 16 
HELX_P HELX_P20 20 ASP A 449 ? PHE A 455 ? ASP A 470 PHE A 476 1 ? 7  
HELX_P HELX_P21 21 GLY A 456 ? LEU A 460 ? GLY A 477 LEU A 481 5 ? 5  
HELX_P HELX_P22 22 SER A 465 ? GLY A 486 ? SER A 486 GLY A 507 1 ? 22 
HELX_P HELX_P23 23 LYS A 519 ? PHE A 530 ? LYS A 540 PHE A 551 1 ? 12 
HELX_P HELX_P24 24 LEU B 40  ? ARG B 44  ? LEU B 60  ARG B 64  5 ? 5  
HELX_P HELX_P25 25 ASP B 70  ? THR B 82  ? ASP B 90  THR B 102 1 ? 13 
HELX_P HELX_P26 26 GLY B 134 ? ASN B 142 ? GLY B 154 ASN B 162 1 ? 9  
HELX_P HELX_P27 27 LEU B 152 ? PHE B 158 ? LEU B 172 PHE B 178 1 ? 7  
HELX_P HELX_P28 28 ASN B 168 ? ILE B 185 ? ASN B 188 ILE B 205 1 ? 18 
HELX_P HELX_P29 29 ALA B 186 ? PHE B 188 ? ALA B 206 PHE B 208 5 ? 3  
HELX_P HELX_P30 30 SER B 201 ? SER B 213 ? SER B 221 SER B 233 1 ? 13 
HELX_P HELX_P31 31 THR B 232 ? VAL B 236 ? THR B 252 VAL B 256 5 ? 5  
HELX_P HELX_P32 32 VAL B 241 ? GLY B 253 ? VAL B 261 GLY B 273 1 ? 13 
HELX_P HELX_P33 33 THR B 258 ? LYS B 269 ? THR B 278 LYS B 289 1 ? 12 
HELX_P HELX_P34 34 THR B 270 ? MET B 281 ? THR B 290 MET B 301 1 ? 12 
HELX_P HELX_P35 35 THR B 311 ? GLN B 316 ? THR B 331 GLN B 336 1 ? 6  
HELX_P HELX_P36 36 TRP B 337 ? SER B 344 ? TRP B 357 SER B 365 1 ? 8  
HELX_P HELX_P37 37 ASP B 353 ? SER B 364 ? ASP B 374 SER B 385 1 ? 12 
HELX_P HELX_P38 38 SER B 364 ? CYS B 369 ? SER B 385 CYS B 390 1 ? 6  
HELX_P HELX_P39 39 LEU B 374 ? GLY B 384 ? LEU B 395 GLY B 405 1 ? 11 
HELX_P HELX_P40 40 ASP B 388 ? PHE B 405 ? ASP B 409 PHE B 426 1 ? 18 
HELX_P HELX_P41 41 PHE B 405 ? ALA B 419 ? PHE B 426 ALA B 440 1 ? 15 
HELX_P HELX_P42 42 GLU B 450 ? PHE B 455 ? GLU B 471 PHE B 476 1 ? 6  
HELX_P HELX_P43 43 GLY B 456 ? LEU B 460 ? GLY B 477 LEU B 481 5 ? 5  
HELX_P HELX_P44 44 SER B 465 ? GLY B 486 ? SER B 486 GLY B 507 1 ? 22 
HELX_P HELX_P45 45 LYS B 519 ? ALA B 531 ? LYS B 540 ALA B 552 1 ? 13 
HELX_P HELX_P46 46 LEU C 40  ? ARG C 44  ? LEU C 60  ARG C 64  5 ? 5  
HELX_P HELX_P47 47 ASP C 70  ? THR C 82  ? ASP C 90  THR C 102 1 ? 13 
HELX_P HELX_P48 48 ALA C 128 ? TYR C 132 ? ALA C 148 TYR C 152 5 ? 5  
HELX_P HELX_P49 49 GLY C 134 ? ASN C 142 ? GLY C 154 ASN C 162 1 ? 9  
HELX_P HELX_P50 50 LEU C 152 ? PHE C 158 ? LEU C 172 PHE C 178 1 ? 7  
HELX_P HELX_P51 51 ASN C 168 ? ILE C 185 ? ASN C 188 ILE C 205 1 ? 18 
HELX_P HELX_P52 52 ALA C 186 ? PHE C 188 ? ALA C 206 PHE C 208 5 ? 3  
HELX_P HELX_P53 53 SER C 201 ? VAL C 211 ? SER C 221 VAL C 231 1 ? 11 
HELX_P HELX_P54 54 THR C 232 ? VAL C 236 ? THR C 252 VAL C 256 5 ? 5  
HELX_P HELX_P55 55 VAL C 241 ? ALA C 252 ? VAL C 261 ALA C 272 1 ? 12 
HELX_P HELX_P56 56 THR C 258 ? LYS C 269 ? THR C 278 LYS C 289 1 ? 12 
HELX_P HELX_P57 57 THR C 270 ? LYS C 282 ? THR C 290 LYS C 302 1 ? 13 
HELX_P HELX_P58 58 THR C 311 ? ALA C 317 ? THR C 331 ALA C 337 1 ? 7  
HELX_P HELX_P59 59 TRP C 337 ? MET C 343 ? TRP C 357 MET C 364 1 ? 7  
HELX_P HELX_P60 60 ASP C 353 ? SER C 364 ? ASP C 374 SER C 385 1 ? 12 
HELX_P HELX_P61 61 SER C 364 ? CYS C 369 ? SER C 385 CYS C 390 1 ? 6  
HELX_P HELX_P62 62 LEU C 374 ? LEU C 383 ? LEU C 395 LEU C 404 1 ? 10 
HELX_P HELX_P63 63 ASP C 388 ? PHE C 405 ? ASP C 409 PHE C 426 1 ? 18 
HELX_P HELX_P64 64 PHE C 405 ? ALA C 419 ? PHE C 426 ALA C 440 1 ? 15 
HELX_P HELX_P65 65 GLU C 450 ? PHE C 455 ? GLU C 471 PHE C 476 1 ? 6  
HELX_P HELX_P66 66 GLY C 456 ? LEU C 460 ? GLY C 477 LEU C 481 5 ? 5  
HELX_P HELX_P67 67 SER C 465 ? GLY C 486 ? SER C 486 GLY C 507 1 ? 22 
HELX_P HELX_P68 68 LYS C 519 ? ALA C 531 ? LYS C 540 ALA C 552 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 67  SG  ? ? ? 1_555 A CYS 96  SG ? ? A CYS 87  A CYS 116  1_555 ? ? ? ? ? ? ? 2.024 ? ?               
disulf2 disulf ?   ? A CYS 254 SG  ? ? ? 1_555 A CYS 265 SG ? ? A CYS 274 A CYS 285  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf3 disulf ?   ? B CYS 67  SG  ? ? ? 1_555 B CYS 96  SG ? ? B CYS 87  B CYS 116  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf4 disulf ?   ? B CYS 254 SG  ? ? ? 1_555 B CYS 265 SG ? ? B CYS 274 B CYS 285  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf5 disulf ?   ? C CYS 67  SG  ? ? ? 1_555 C CYS 96  SG ? ? C CYS 87  C CYS 116  1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf6 disulf ?   ? C CYS 254 SG  ? ? ? 1_555 C CYS 265 SG ? ? C CYS 274 C CYS 285  1_555 ? ? ? ? ? ? ? 2.041 ? ?               
covale1 covale one ? A ASN 59  ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 79  A NAG 1179 1_555 ? ? ? ? ? ? ? 1.448 ? N-Glycosylation 
covale2 covale one ? B ASN 59  ND2 ? ? ? 1_555 J NAG .   C1 ? ? B ASN 79  B NAG 1279 1_555 ? ? ? ? ? ? ? 1.454 ? N-Glycosylation 
covale3 covale one ? C ASN 59  ND2 ? ? ? 1_555 P NAG .   C1 ? ? C ASN 79  C NAG 1379 1_555 ? ? ? ? ? ? ? 1.447 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
C ? 2  ? 
D ? 3  ? 
E ? 11 ? 
F ? 2  ? 
G ? 3  ? 
H ? 11 ? 
I ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
C 1  2  ? parallel      
D 1  2  ? anti-parallel 
D 2  3  ? parallel      
E 1  2  ? anti-parallel 
E 2  3  ? anti-parallel 
E 3  4  ? anti-parallel 
E 4  5  ? parallel      
E 5  6  ? parallel      
E 6  7  ? parallel      
E 7  8  ? parallel      
E 8  9  ? parallel      
E 9  10 ? parallel      
E 10 11 ? anti-parallel 
F 1  2  ? parallel      
G 1  2  ? anti-parallel 
G 2  3  ? parallel      
H 1  2  ? anti-parallel 
H 2  3  ? anti-parallel 
H 3  4  ? anti-parallel 
H 4  5  ? parallel      
H 5  6  ? parallel      
H 6  7  ? parallel      
H 7  8  ? parallel      
H 8  9  ? parallel      
H 9  10 ? parallel      
H 10 11 ? anti-parallel 
I 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  VAL A 5   ? ASP A 7   ? VAL A 25  ASP A 27  
A 2  LYS A 12  ? LEU A 14  ? LYS A 32  LEU A 34  
A 3  VAL A 57  ? ASN A 59  ? VAL A 77  ASN A 79  
B 1  LYS A 16  ? LEU A 20  ? LYS A 36  LEU A 40  
B 2  PHE A 23  ? PRO A 34  ? PHE A 43  PRO A 54  
B 3  TYR A 98  ? THR A 103 ? TYR A 118 THR A 123 
B 4  VAL A 144 ? ILE A 148 ? VAL A 164 ILE A 168 
B 5  LEU A 113 ? ILE A 119 ? LEU A 133 ILE A 139 
B 6  GLY A 190 ? GLU A 200 ? GLY A 210 GLU A 220 
B 7  ARG A 222 ? GLU A 226 ? ARG A 242 GLU A 246 
B 8  TYR A 326 ? ASN A 331 ? TYR A 346 ASN A 351 
B 9  THR A 423 ? PHE A 428 ? THR A 444 PHE A 449 
B 10 GLY A 504 ? ILE A 508 ? GLY A 525 ILE A 529 
B 11 GLN A 513 ? GLN A 516 ? GLN A 534 GLN A 537 
C 1  MET A 66  ? CYS A 67  ? MET A 86  CYS A 87  
C 2  LEU A 92  ? SER A 93  ? LEU A 112 SER A 113 
D 1  VAL B 5   ? THR B 8   ? VAL B 25  THR B 28  
D 2  GLY B 11  ? LEU B 14  ? GLY B 31  LEU B 34  
D 3  VAL B 57  ? ASN B 59  ? VAL B 77  ASN B 79  
E 1  LYS B 16  ? VAL B 18  ? LYS B 36  VAL B 38  
E 2  VAL B 27  ? PRO B 34  ? VAL B 47  PRO B 54  
E 3  TYR B 98  ? THR B 103 ? TYR B 118 THR B 123 
E 4  VAL B 144 ? ILE B 148 ? VAL B 164 ILE B 168 
E 5  LEU B 113 ? ILE B 119 ? LEU B 133 ILE B 139 
E 6  GLY B 190 ? GLU B 200 ? GLY B 210 GLU B 220 
E 7  ARG B 222 ? GLU B 226 ? ARG B 242 GLU B 246 
E 8  TYR B 326 ? ASN B 331 ? TYR B 346 ASN B 351 
E 9  THR B 423 ? PHE B 428 ? THR B 444 PHE B 449 
E 10 GLY B 504 ? ILE B 508 ? GLY B 525 ILE B 529 
E 11 GLN B 513 ? GLN B 516 ? GLN B 534 GLN B 537 
F 1  MET B 66  ? CYS B 67  ? MET B 86  CYS B 87  
F 2  LEU B 92  ? SER B 93  ? LEU B 112 SER B 113 
G 1  VAL C 5   ? THR C 8   ? VAL C 25  THR C 28  
G 2  GLY C 11  ? LEU C 14  ? GLY C 31  LEU C 34  
G 3  VAL C 57  ? ASN C 59  ? VAL C 77  ASN C 79  
H 1  LYS C 16  ? VAL C 18  ? LYS C 36  VAL C 38  
H 2  VAL C 27  ? PRO C 34  ? VAL C 47  PRO C 54  
H 3  TYR C 98  ? THR C 103 ? TYR C 118 THR C 123 
H 4  VAL C 144 ? ILE C 148 ? VAL C 164 ILE C 168 
H 5  LEU C 113 ? ILE C 119 ? LEU C 133 ILE C 139 
H 6  GLY C 190 ? GLU C 200 ? GLY C 210 GLU C 220 
H 7  ARG C 222 ? GLU C 226 ? ARG C 242 GLU C 246 
H 8  TYR C 326 ? ASN C 331 ? TYR C 346 ASN C 351 
H 9  THR C 423 ? GLN C 429 ? THR C 444 GLN C 450 
H 10 GLY C 504 ? GLY C 509 ? GLY C 525 GLY C 530 
H 11 GLN C 513 ? GLN C 516 ? GLN C 534 GLN C 537 
I 1  MET C 66  ? CYS C 67  ? MET C 86  CYS C 87  
I 2  LEU C 92  ? SER C 93  ? LEU C 112 SER C 113 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N VAL A 6   ? N VAL A 26  O VAL A 13  ? O VAL A 33  
A 2  3  N LYS A 12  ? N LYS A 32  O LYS A 58  ? O LYS A 78  
B 1  2  N LYS A 16  ? N LYS A 36  O ILE A 29  ? O ILE A 49  
B 2  3  N PHE A 30  ? N PHE A 50  O ILE A 101 ? O ILE A 121 
B 3  4  N TYR A 102 ? N TYR A 122 O VAL A 145 ? O VAL A 165 
B 4  5  O VAL A 146 ? O VAL A 166 N TRP A 118 ? N TRP A 138 
B 5  6  N VAL A 115 ? N VAL A 135 O THR A 196 ? O THR A 216 
B 6  7  N GLY A 199 ? N GLY A 219 O GLU A 226 ? O GLU A 246 
B 7  8  N SER A 225 ? N SER A 245 O MET A 327 ? O MET A 347 
B 8  9  N VAL A 328 ? N VAL A 348 O TYR A 424 ? O TYR A 445 
B 9  10 N GLU A 427 ? N GLU A 448 O ILE A 508 ? O ILE A 529 
B 10 11 N GLN A 507 ? N GLN A 528 O GLN A 513 ? O GLN A 534 
C 1  2  N MET A 66  ? N MET A 86  O SER A 93  ? O SER A 113 
D 1  2  N VAL B 6   ? N VAL B 26  O VAL B 13  ? O VAL B 33  
D 2  3  N LEU B 14  ? N LEU B 34  O LYS B 58  ? O LYS B 78  
E 1  2  N VAL B 18  ? N VAL B 38  O VAL B 27  ? O VAL B 47  
E 2  3  N ALA B 28  ? N ALA B 48  O THR B 103 ? O THR B 123 
E 3  4  N ASN B 100 ? N ASN B 120 O THR B 147 ? O THR B 167 
E 4  5  O VAL B 146 ? O VAL B 166 N TRP B 118 ? N TRP B 138 
E 5  6  N VAL B 115 ? N VAL B 135 O THR B 196 ? O THR B 216 
E 6  7  N ILE B 197 ? N ILE B 217 O ILE B 224 ? O ILE B 244 
E 7  8  N ALA B 223 ? N ALA B 243 O MET B 327 ? O MET B 347 
E 8  9  N VAL B 328 ? N VAL B 348 O TYR B 424 ? O TYR B 445 
E 9  10 N GLU B 427 ? N GLU B 448 O LEU B 506 ? O LEU B 527 
E 10 11 N TYR B 505 ? N TYR B 526 O ALA B 515 ? O ALA B 536 
F 1  2  N MET B 66  ? N MET B 86  O SER B 93  ? O SER B 113 
G 1  2  N THR C 8   ? N THR C 28  O GLY C 11  ? O GLY C 31  
G 2  3  N LYS C 12  ? N LYS C 32  O LYS C 58  ? O LYS C 78  
H 1  2  N LYS C 16  ? N LYS C 36  O ILE C 29  ? O ILE C 49  
H 2  3  N PHE C 30  ? N PHE C 50  O ILE C 101 ? O ILE C 121 
H 3  4  N ASN C 100 ? N ASN C 120 O THR C 147 ? O THR C 167 
H 4  5  O VAL C 146 ? O VAL C 166 N TRP C 118 ? N TRP C 138 
H 5  6  N VAL C 115 ? N VAL C 135 O THR C 196 ? O THR C 216 
H 6  7  N ILE C 197 ? N ILE C 217 O ILE C 224 ? O ILE C 244 
H 7  8  N ALA C 223 ? N ALA C 243 O MET C 327 ? O MET C 347 
H 8  9  N VAL C 328 ? N VAL C 348 O TYR C 424 ? O TYR C 445 
H 9  10 N GLN C 429 ? N GLN C 450 O ILE C 508 ? O ILE C 529 
H 10 11 N GLN C 507 ? N GLN C 528 O GLN C 513 ? O GLN C 534 
I 1  2  N MET C 66  ? N MET C 86  O SER C 93  ? O SER C 113 
# 
_database_PDB_matrix.entry_id          1YA8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1YA8 
_atom_sites.fract_transf_matrix[1][1]   0.017929 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005507 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004929 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . SER A 1 1   ? -29.230 42.206  72.186  1.00 53.18  ? 21   SER A N   1 
ATOM   2     C CA  . SER A 1 1   ? -29.491 40.870  72.799  1.00 53.14  ? 21   SER A CA  1 
ATOM   3     C C   . SER A 1 1   ? -28.199 40.182  73.265  1.00 52.31  ? 21   SER A C   1 
ATOM   4     O O   . SER A 1 1   ? -27.565 40.623  74.231  1.00 53.63  ? 21   SER A O   1 
ATOM   5     C CB  . SER A 1 1   ? -30.238 39.974  71.802  1.00 53.86  ? 21   SER A CB  1 
ATOM   6     O OG  . SER A 1 1   ? -29.555 39.893  70.562  1.00 54.02  ? 21   SER A OG  1 
ATOM   7     N N   . SER A 1 2   ? -27.809 39.105  72.585  1.00 49.20  ? 22   SER A N   1 
ATOM   8     C CA  . SER A 1 2   ? -26.596 38.381  72.954  1.00 44.95  ? 22   SER A CA  1 
ATOM   9     C C   . SER A 1 2   ? -25.757 38.016  71.735  1.00 41.63  ? 22   SER A C   1 
ATOM   10    O O   . SER A 1 2   ? -26.296 37.684  70.679  1.00 41.72  ? 22   SER A O   1 
ATOM   11    C CB  . SER A 1 2   ? -26.952 37.110  73.724  1.00 45.36  ? 22   SER A CB  1 
ATOM   12    O OG  . SER A 1 2   ? -25.778 36.432  74.139  1.00 45.75  ? 22   SER A OG  1 
ATOM   13    N N   . PRO A 1 3   ? -24.419 38.059  71.874  1.00 37.64  ? 23   PRO A N   1 
ATOM   14    C CA  . PRO A 1 3   ? -23.528 37.728  70.761  1.00 33.97  ? 23   PRO A CA  1 
ATOM   15    C C   . PRO A 1 3   ? -23.886 36.370  70.161  1.00 30.23  ? 23   PRO A C   1 
ATOM   16    O O   . PRO A 1 3   ? -24.251 35.439  70.876  1.00 27.97  ? 23   PRO A O   1 
ATOM   17    C CB  . PRO A 1 3   ? -22.146 37.723  71.413  1.00 34.32  ? 23   PRO A CB  1 
ATOM   18    C CG  . PRO A 1 3   ? -22.297 38.672  72.546  1.00 34.86  ? 23   PRO A CG  1 
ATOM   19    C CD  . PRO A 1 3   ? -23.643 38.306  73.100  1.00 36.30  ? 23   PRO A CD  1 
ATOM   20    N N   . PRO A 1 4   ? -23.788 36.247  68.834  1.00 27.41  ? 24   PRO A N   1 
ATOM   21    C CA  . PRO A 1 4   ? -24.104 34.996  68.145  1.00 25.70  ? 24   PRO A CA  1 
ATOM   22    C C   . PRO A 1 4   ? -23.108 33.879  68.478  1.00 23.17  ? 24   PRO A C   1 
ATOM   23    O O   . PRO A 1 4   ? -21.897 34.115  68.497  1.00 24.56  ? 24   PRO A O   1 
ATOM   24    C CB  . PRO A 1 4   ? -24.023 35.385  66.665  1.00 25.85  ? 24   PRO A CB  1 
ATOM   25    C CG  . PRO A 1 4   ? -24.251 36.855  66.666  1.00 26.61  ? 24   PRO A CG  1 
ATOM   26    C CD  . PRO A 1 4   ? -23.483 37.312  67.867  1.00 26.79  ? 24   PRO A CD  1 
ATOM   27    N N   . VAL A 1 5   ? -23.616 32.677  68.754  1.00 18.30  ? 25   VAL A N   1 
ATOM   28    C CA  . VAL A 1 5   ? -22.752 31.535  69.028  1.00 13.99  ? 25   VAL A CA  1 
ATOM   29    C C   . VAL A 1 5   ? -23.206 30.381  68.156  1.00 14.38  ? 25   VAL A C   1 
ATOM   30    O O   . VAL A 1 5   ? -24.308 29.863  68.294  1.00 14.25  ? 25   VAL A O   1 
ATOM   31    C CB  . VAL A 1 5   ? -22.787 31.084  70.496  1.00 11.04  ? 25   VAL A CB  1 
ATOM   32    C CG1 . VAL A 1 5   ? -21.929 29.844  70.674  1.00 8.33   ? 25   VAL A CG1 1 
ATOM   33    C CG2 . VAL A 1 5   ? -22.268 32.170  71.380  1.00 9.04   ? 25   VAL A CG2 1 
ATOM   34    N N   . VAL A 1 6   ? -22.338 29.987  67.244  1.00 14.90  ? 26   VAL A N   1 
ATOM   35    C CA  . VAL A 1 6   ? -22.631 28.909  66.332  1.00 14.14  ? 26   VAL A CA  1 
ATOM   36    C C   . VAL A 1 6   ? -21.825 27.681  66.681  1.00 14.48  ? 26   VAL A C   1 
ATOM   37    O O   . VAL A 1 6   ? -20.657 27.772  67.068  1.00 13.95  ? 26   VAL A O   1 
ATOM   38    C CB  . VAL A 1 6   ? -22.262 29.316  64.914  1.00 15.19  ? 26   VAL A CB  1 
ATOM   39    C CG1 . VAL A 1 6   ? -22.318 28.117  63.981  1.00 14.74  ? 26   VAL A CG1 1 
ATOM   40    C CG2 . VAL A 1 6   ? -23.187 30.413  64.457  1.00 18.01  ? 26   VAL A CG2 1 
ATOM   41    N N   . ASP A 1 7   ? -22.446 26.523  66.551  1.00 14.96  ? 27   ASP A N   1 
ATOM   42    C CA  . ASP A 1 7   ? -21.718 25.302  66.808  1.00 15.69  ? 27   ASP A CA  1 
ATOM   43    C C   . ASP A 1 7   ? -21.282 24.723  65.459  1.00 14.64  ? 27   ASP A C   1 
ATOM   44    O O   . ASP A 1 7   ? -22.120 24.390  64.611  1.00 15.10  ? 27   ASP A O   1 
ATOM   45    C CB  . ASP A 1 7   ? -22.582 24.298  67.563  1.00 19.07  ? 27   ASP A CB  1 
ATOM   46    C CG  . ASP A 1 7   ? -21.863 22.986  67.796  1.00 23.29  ? 27   ASP A CG  1 
ATOM   47    O OD1 . ASP A 1 7   ? -21.894 22.126  66.891  1.00 26.14  ? 27   ASP A OD1 1 
ATOM   48    O OD2 . ASP A 1 7   ? -21.244 22.819  68.872  1.00 26.38  ? 27   ASP A OD2 1 
ATOM   49    N N   . THR A 1 8   ? -19.969 24.645  65.250  1.00 10.80  ? 28   THR A N   1 
ATOM   50    C CA  . THR A 1 8   ? -19.431 24.091  64.020  1.00 7.17   ? 28   THR A CA  1 
ATOM   51    C C   . THR A 1 8   ? -19.000 22.677  64.365  1.00 5.24   ? 28   THR A C   1 
ATOM   52    O O   . THR A 1 8   ? -19.261 22.193  65.452  1.00 6.29   ? 28   THR A O   1 
ATOM   53    C CB  . THR A 1 8   ? -18.208 24.894  63.498  1.00 7.25   ? 28   THR A CB  1 
ATOM   54    O OG1 . THR A 1 8   ? -17.022 24.472  64.177  1.00 9.53   ? 28   THR A OG1 1 
ATOM   55    C CG2 . THR A 1 8   ? -18.405 26.388  63.728  1.00 4.75   ? 28   THR A CG2 1 
ATOM   56    N N   . VAL A 1 9   ? -18.344 22.000  63.448  1.00 4.35   ? 29   VAL A N   1 
ATOM   57    C CA  . VAL A 1 9   ? -17.924 20.646  63.734  1.00 4.05   ? 29   VAL A CA  1 
ATOM   58    C C   . VAL A 1 9   ? -16.805 20.606  64.754  1.00 3.59   ? 29   VAL A C   1 
ATOM   59    O O   . VAL A 1 9   ? -16.801 19.749  65.632  1.00 4.33   ? 29   VAL A O   1 
ATOM   60    C CB  . VAL A 1 9   ? -17.434 19.935  62.462  1.00 4.29   ? 29   VAL A CB  1 
ATOM   61    C CG1 . VAL A 1 9   ? -17.016 18.504  62.795  1.00 2.64   ? 29   VAL A CG1 1 
ATOM   62    C CG2 . VAL A 1 9   ? -18.527 19.957  61.401  1.00 1.76   ? 29   VAL A CG2 1 
ATOM   63    N N   . HIS A 1 10  ? -15.862 21.535  64.636  1.00 4.61   ? 30   HIS A N   1 
ATOM   64    C CA  . HIS A 1 10  ? -14.706 21.587  65.529  1.00 6.73   ? 30   HIS A CA  1 
ATOM   65    C C   . HIS A 1 10  ? -14.926 22.282  66.869  1.00 7.45   ? 30   HIS A C   1 
ATOM   66    O O   . HIS A 1 10  ? -14.007 22.348  67.696  1.00 6.00   ? 30   HIS A O   1 
ATOM   67    C CB  . HIS A 1 10  ? -13.521 22.257  64.832  1.00 8.46   ? 30   HIS A CB  1 
ATOM   68    C CG  . HIS A 1 10  ? -12.999 21.502  63.650  1.00 9.98   ? 30   HIS A CG  1 
ATOM   69    N ND1 . HIS A 1 10  ? -13.120 20.134  63.528  1.00 11.43  ? 30   HIS A ND1 1 
ATOM   70    C CD2 . HIS A 1 10  ? -12.301 21.915  62.567  1.00 10.23  ? 30   HIS A CD2 1 
ATOM   71    C CE1 . HIS A 1 10  ? -12.519 19.739  62.420  1.00 11.54  ? 30   HIS A CE1 1 
ATOM   72    N NE2 . HIS A 1 10  ? -12.013 20.800  61.819  1.00 12.00  ? 30   HIS A NE2 1 
ATOM   73    N N   . GLY A 1 11  ? -16.130 22.801  67.086  1.00 7.82   ? 31   GLY A N   1 
ATOM   74    C CA  . GLY A 1 11  ? -16.409 23.481  68.335  1.00 9.79   ? 31   GLY A CA  1 
ATOM   75    C C   . GLY A 1 11  ? -17.217 24.737  68.110  1.00 12.15  ? 31   GLY A C   1 
ATOM   76    O O   . GLY A 1 11  ? -17.398 25.160  66.973  1.00 14.61  ? 31   GLY A O   1 
ATOM   77    N N   . LYS A 1 12  ? -17.685 25.347  69.195  1.00 13.98  ? 32   LYS A N   1 
ATOM   78    C CA  . LYS A 1 12  ? -18.510 26.552  69.126  1.00 13.34  ? 32   LYS A CA  1 
ATOM   79    C C   . LYS A 1 12  ? -17.723 27.831  68.872  1.00 12.64  ? 32   LYS A C   1 
ATOM   80    O O   . LYS A 1 12  ? -16.625 27.991  69.401  1.00 13.08  ? 32   LYS A O   1 
ATOM   81    C CB  . LYS A 1 12  ? -19.298 26.696  70.430  1.00 13.10  ? 32   LYS A CB  1 
ATOM   82    C CG  . LYS A 1 12  ? -20.207 25.518  70.742  1.00 15.01  ? 32   LYS A CG  1 
ATOM   83    C CD  . LYS A 1 12  ? -21.041 25.776  71.999  1.00 19.63  ? 32   LYS A CD  1 
ATOM   84    C CE  . LYS A 1 12  ? -22.110 24.700  72.221  1.00 20.07  ? 32   LYS A CE  1 
ATOM   85    N NZ  . LYS A 1 12  ? -23.090 24.591  71.092  1.00 20.02  ? 32   LYS A NZ  1 
ATOM   86    N N   . VAL A 1 13  ? -18.277 28.729  68.051  1.00 12.54  ? 33   VAL A N   1 
ATOM   87    C CA  . VAL A 1 13  ? -17.635 30.022  67.771  1.00 11.16  ? 33   VAL A CA  1 
ATOM   88    C C   . VAL A 1 13  ? -18.566 31.157  68.170  1.00 10.33  ? 33   VAL A C   1 
ATOM   89    O O   . VAL A 1 13  ? -19.784 31.061  68.029  1.00 7.93   ? 33   VAL A O   1 
ATOM   90    C CB  . VAL A 1 13  ? -17.234 30.195  66.287  1.00 8.56   ? 33   VAL A CB  1 
ATOM   91    C CG1 . VAL A 1 13  ? -16.055 29.313  65.973  1.00 9.07   ? 33   VAL A CG1 1 
ATOM   92    C CG2 . VAL A 1 13  ? -18.380 29.846  65.393  1.00 9.94   ? 33   VAL A CG2 1 
ATOM   93    N N   . LEU A 1 14  ? -17.967 32.225  68.682  1.00 11.32  ? 34   LEU A N   1 
ATOM   94    C CA  . LEU A 1 14  ? -18.687 33.397  69.160  1.00 11.50  ? 34   LEU A CA  1 
ATOM   95    C C   . LEU A 1 14  ? -18.438 34.568  68.227  1.00 11.40  ? 34   LEU A C   1 
ATOM   96    O O   . LEU A 1 14  ? -17.295 34.935  67.986  1.00 12.44  ? 34   LEU A O   1 
ATOM   97    C CB  . LEU A 1 14  ? -18.194 33.723  70.574  1.00 12.79  ? 34   LEU A CB  1 
ATOM   98    C CG  . LEU A 1 14  ? -18.697 34.903  71.409  1.00 13.56  ? 34   LEU A CG  1 
ATOM   99    C CD1 . LEU A 1 14  ? -18.179 36.206  70.845  1.00 15.46  ? 34   LEU A CD1 1 
ATOM   100   C CD2 . LEU A 1 14  ? -20.208 34.885  71.447  1.00 13.89  ? 34   LEU A CD2 1 
ATOM   101   N N   . GLY A 1 15  ? -19.506 35.153  67.702  1.00 11.92  ? 35   GLY A N   1 
ATOM   102   C CA  . GLY A 1 15  ? -19.349 36.275  66.796  1.00 14.57  ? 35   GLY A CA  1 
ATOM   103   C C   . GLY A 1 15  ? -19.856 37.584  67.373  1.00 16.22  ? 35   GLY A C   1 
ATOM   104   O O   . GLY A 1 15  ? -19.926 37.753  68.595  1.00 16.16  ? 35   GLY A O   1 
ATOM   105   N N   . LYS A 1 16  ? -20.193 38.521  66.488  1.00 17.56  ? 36   LYS A N   1 
ATOM   106   C CA  . LYS A 1 16  ? -20.717 39.820  66.901  1.00 17.62  ? 36   LYS A CA  1 
ATOM   107   C C   . LYS A 1 16  ? -21.752 40.324  65.905  1.00 16.01  ? 36   LYS A C   1 
ATOM   108   O O   . LYS A 1 16  ? -21.654 40.069  64.707  1.00 17.25  ? 36   LYS A O   1 
ATOM   109   C CB  . LYS A 1 16  ? -19.597 40.853  67.029  1.00 19.18  ? 36   LYS A CB  1 
ATOM   110   C CG  . LYS A 1 16  ? -19.098 41.439  65.720  1.00 25.01  ? 36   LYS A CG  1 
ATOM   111   C CD  . LYS A 1 16  ? -18.128 42.600  65.989  1.00 30.10  ? 36   LYS A CD  1 
ATOM   112   C CE  . LYS A 1 16  ? -17.652 43.286  64.699  1.00 32.41  ? 36   LYS A CE  1 
ATOM   113   N NZ  . LYS A 1 16  ? -16.753 44.463  64.969  1.00 32.63  ? 36   LYS A NZ  1 
ATOM   114   N N   . PHE A 1 17  ? -22.746 41.039  66.418  1.00 14.25  ? 37   PHE A N   1 
ATOM   115   C CA  . PHE A 1 17  ? -23.809 41.600  65.601  1.00 11.77  ? 37   PHE A CA  1 
ATOM   116   C C   . PHE A 1 17  ? -23.478 42.989  65.073  1.00 10.75  ? 37   PHE A C   1 
ATOM   117   O O   . PHE A 1 17  ? -22.868 43.798  65.763  1.00 11.20  ? 37   PHE A O   1 
ATOM   118   C CB  . PHE A 1 17  ? -25.093 41.700  66.414  1.00 12.30  ? 37   PHE A CB  1 
ATOM   119   C CG  . PHE A 1 17  ? -25.807 40.401  66.585  1.00 12.80  ? 37   PHE A CG  1 
ATOM   120   C CD1 . PHE A 1 17  ? -25.974 39.850  67.847  1.00 11.34  ? 37   PHE A CD1 1 
ATOM   121   C CD2 . PHE A 1 17  ? -26.345 39.743  65.480  1.00 13.97  ? 37   PHE A CD2 1 
ATOM   122   C CE1 . PHE A 1 17  ? -26.669 38.666  68.011  1.00 12.29  ? 37   PHE A CE1 1 
ATOM   123   C CE2 . PHE A 1 17  ? -27.037 38.564  65.633  1.00 13.98  ? 37   PHE A CE2 1 
ATOM   124   C CZ  . PHE A 1 17  ? -27.203 38.021  66.906  1.00 14.42  ? 37   PHE A CZ  1 
ATOM   125   N N   . VAL A 1 18  ? -23.900 43.270  63.850  1.00 11.07  ? 38   VAL A N   1 
ATOM   126   C CA  . VAL A 1 18  ? -23.673 44.579  63.250  1.00 10.97  ? 38   VAL A CA  1 
ATOM   127   C C   . VAL A 1 18  ? -24.883 44.961  62.397  1.00 12.03  ? 38   VAL A C   1 
ATOM   128   O O   . VAL A 1 18  ? -25.251 44.244  61.465  1.00 11.32  ? 38   VAL A O   1 
ATOM   129   C CB  . VAL A 1 18  ? -22.404 44.581  62.373  1.00 9.43   ? 38   VAL A CB  1 
ATOM   130   C CG1 . VAL A 1 18  ? -22.208 45.943  61.737  1.00 5.67   ? 38   VAL A CG1 1 
ATOM   131   C CG2 . VAL A 1 18  ? -21.196 44.206  63.219  1.00 8.97   ? 38   VAL A CG2 1 
ATOM   132   N N   . SER A 1 19  ? -25.513 46.083  62.725  1.00 13.34  ? 39   SER A N   1 
ATOM   133   C CA  . SER A 1 19  ? -26.669 46.527  61.965  1.00 15.42  ? 39   SER A CA  1 
ATOM   134   C C   . SER A 1 19  ? -26.264 47.404  60.800  1.00 16.41  ? 39   SER A C   1 
ATOM   135   O O   . SER A 1 19  ? -25.266 48.116  60.869  1.00 16.64  ? 39   SER A O   1 
ATOM   136   C CB  . SER A 1 19  ? -27.639 47.290  62.860  1.00 14.87  ? 39   SER A CB  1 
ATOM   137   O OG  . SER A 1 19  ? -28.435 46.393  63.616  1.00 18.34  ? 39   SER A OG  1 
ATOM   138   N N   . LEU A 1 20  ? -27.033 47.333  59.719  1.00 18.94  ? 40   LEU A N   1 
ATOM   139   C CA  . LEU A 1 20  ? -26.755 48.148  58.549  1.00 21.14  ? 40   LEU A CA  1 
ATOM   140   C C   . LEU A 1 20  ? -27.979 48.906  58.072  1.00 24.29  ? 40   LEU A C   1 
ATOM   141   O O   . LEU A 1 20  ? -29.064 48.336  57.909  1.00 23.50  ? 40   LEU A O   1 
ATOM   142   C CB  . LEU A 1 20  ? -26.227 47.311  57.392  1.00 19.71  ? 40   LEU A CB  1 
ATOM   143   C CG  . LEU A 1 20  ? -25.871 48.215  56.208  1.00 20.15  ? 40   LEU A CG  1 
ATOM   144   C CD1 . LEU A 1 20  ? -24.807 49.212  56.649  1.00 19.81  ? 40   LEU A CD1 1 
ATOM   145   C CD2 . LEU A 1 20  ? -25.380 47.391  55.031  1.00 21.34  ? 40   LEU A CD2 1 
ATOM   146   N N   . GLU A 1 21  ? -27.769 50.202  57.853  1.00 27.71  ? 41   GLU A N   1 
ATOM   147   C CA  . GLU A 1 21  ? -28.778 51.139  57.371  1.00 30.38  ? 41   GLU A CA  1 
ATOM   148   C C   . GLU A 1 21  ? -29.860 50.500  56.507  1.00 29.69  ? 41   GLU A C   1 
ATOM   149   O O   . GLU A 1 21  ? -29.569 49.985  55.429  1.00 29.95  ? 41   GLU A O   1 
ATOM   150   C CB  . GLU A 1 21  ? -28.088 52.231  56.555  1.00 35.13  ? 41   GLU A CB  1 
ATOM   151   C CG  . GLU A 1 21  ? -29.029 53.275  56.014  1.00 42.69  ? 41   GLU A CG  1 
ATOM   152   C CD  . GLU A 1 21  ? -29.589 54.146  57.115  1.00 47.78  ? 41   GLU A CD  1 
ATOM   153   O OE1 . GLU A 1 21  ? -29.098 55.292  57.267  1.00 49.62  ? 41   GLU A OE1 1 
ATOM   154   O OE2 . GLU A 1 21  ? -30.505 53.673  57.836  1.00 49.58  ? 41   GLU A OE2 1 
ATOM   155   N N   . GLY A 1 22  ? -31.104 50.540  56.975  1.00 28.46  ? 42   GLY A N   1 
ATOM   156   C CA  . GLY A 1 22  ? -32.198 49.977  56.200  1.00 27.56  ? 42   GLY A CA  1 
ATOM   157   C C   . GLY A 1 22  ? -32.465 48.488  56.355  1.00 27.50  ? 42   GLY A C   1 
ATOM   158   O O   . GLY A 1 22  ? -33.221 47.896  55.570  1.00 26.78  ? 42   GLY A O   1 
ATOM   159   N N   . PHE A 1 23  ? -31.853 47.864  57.357  1.00 26.42  ? 43   PHE A N   1 
ATOM   160   C CA  . PHE A 1 23  ? -32.064 46.441  57.568  1.00 23.81  ? 43   PHE A CA  1 
ATOM   161   C C   . PHE A 1 23  ? -32.319 46.106  59.022  1.00 24.42  ? 43   PHE A C   1 
ATOM   162   O O   . PHE A 1 23  ? -31.446 46.259  59.877  1.00 25.64  ? 43   PHE A O   1 
ATOM   163   C CB  . PHE A 1 23  ? -30.878 45.648  57.032  1.00 20.60  ? 43   PHE A CB  1 
ATOM   164   C CG  . PHE A 1 23  ? -30.680 45.809  55.563  1.00 16.73  ? 43   PHE A CG  1 
ATOM   165   C CD1 . PHE A 1 23  ? -29.876 46.824  55.065  1.00 16.97  ? 43   PHE A CD1 1 
ATOM   166   C CD2 . PHE A 1 23  ? -31.345 44.988  54.672  1.00 14.63  ? 43   PHE A CD2 1 
ATOM   167   C CE1 . PHE A 1 23  ? -29.741 47.017  53.694  1.00 15.98  ? 43   PHE A CE1 1 
ATOM   168   C CE2 . PHE A 1 23  ? -31.217 45.172  53.305  1.00 14.20  ? 43   PHE A CE2 1 
ATOM   169   C CZ  . PHE A 1 23  ? -30.415 46.187  52.815  1.00 13.88  ? 43   PHE A CZ  1 
ATOM   170   N N   . ALA A 1 24  ? -33.540 45.654  59.285  1.00 24.56  ? 44   ALA A N   1 
ATOM   171   C CA  . ALA A 1 24  ? -33.971 45.299  60.624  1.00 23.88  ? 44   ALA A CA  1 
ATOM   172   C C   . ALA A 1 24  ? -33.015 44.323  61.283  1.00 23.22  ? 44   ALA A C   1 
ATOM   173   O O   . ALA A 1 24  ? -32.338 44.665  62.251  1.00 23.33  ? 44   ALA A O   1 
ATOM   174   C CB  . ALA A 1 24  ? -35.362 44.702  60.566  1.00 24.13  ? 44   ALA A CB  1 
ATOM   175   N N   . GLN A 1 25  ? -32.972 43.107  60.747  1.00 22.94  ? 45   GLN A N   1 
ATOM   176   C CA  . GLN A 1 25  ? -32.119 42.042  61.263  1.00 22.99  ? 45   GLN A CA  1 
ATOM   177   C C   . GLN A 1 25  ? -30.630 42.340  61.158  1.00 21.66  ? 45   GLN A C   1 
ATOM   178   O O   . GLN A 1 25  ? -30.103 42.576  60.071  1.00 20.76  ? 45   GLN A O   1 
ATOM   179   C CB  . GLN A 1 25  ? -32.409 40.733  60.521  1.00 26.42  ? 45   GLN A CB  1 
ATOM   180   C CG  . GLN A 1 25  ? -31.396 39.614  60.771  1.00 28.40  ? 45   GLN A CG  1 
ATOM   181   C CD  . GLN A 1 25  ? -31.588 38.944  62.112  1.00 29.56  ? 45   GLN A CD  1 
ATOM   182   O OE1 . GLN A 1 25  ? -32.598 38.286  62.345  1.00 30.20  ? 45   GLN A OE1 1 
ATOM   183   N NE2 . GLN A 1 25  ? -30.619 39.109  63.003  1.00 31.12  ? 45   GLN A NE2 1 
ATOM   184   N N   . PRO A 1 26  ? -29.930 42.328  62.295  1.00 20.37  ? 46   PRO A N   1 
ATOM   185   C CA  . PRO A 1 26  ? -28.496 42.593  62.299  1.00 20.91  ? 46   PRO A CA  1 
ATOM   186   C C   . PRO A 1 26  ? -27.712 41.410  61.719  1.00 20.08  ? 46   PRO A C   1 
ATOM   187   O O   . PRO A 1 26  ? -28.126 40.254  61.838  1.00 19.84  ? 46   PRO A O   1 
ATOM   188   C CB  . PRO A 1 26  ? -28.203 42.820  63.778  1.00 21.69  ? 46   PRO A CB  1 
ATOM   189   C CG  . PRO A 1 26  ? -29.176 41.902  64.446  1.00 20.72  ? 46   PRO A CG  1 
ATOM   190   C CD  . PRO A 1 26  ? -30.435 42.180  63.669  1.00 20.58  ? 46   PRO A CD  1 
ATOM   191   N N   . VAL A 1 27  ? -26.582 41.713  61.089  1.00 18.50  ? 47   VAL A N   1 
ATOM   192   C CA  . VAL A 1 27  ? -25.729 40.698  60.493  1.00 15.03  ? 47   VAL A CA  1 
ATOM   193   C C   . VAL A 1 27  ? -24.768 40.154  61.544  1.00 13.61  ? 47   VAL A C   1 
ATOM   194   O O   . VAL A 1 27  ? -24.165 40.912  62.301  1.00 10.88  ? 47   VAL A O   1 
ATOM   195   C CB  . VAL A 1 27  ? -24.910 41.286  59.328  1.00 15.02  ? 47   VAL A CB  1 
ATOM   196   C CG1 . VAL A 1 27  ? -24.083 40.199  58.661  1.00 14.27  ? 47   VAL A CG1 1 
ATOM   197   C CG2 . VAL A 1 27  ? -25.836 41.942  58.334  1.00 14.04  ? 47   VAL A CG2 1 
ATOM   198   N N   . ALA A 1 28  ? -24.641 38.833  61.584  1.00 14.07  ? 48   ALA A N   1 
ATOM   199   C CA  . ALA A 1 28  ? -23.749 38.167  62.521  1.00 12.91  ? 48   ALA A CA  1 
ATOM   200   C C   . ALA A 1 28  ? -22.410 37.985  61.815  1.00 13.05  ? 48   ALA A C   1 
ATOM   201   O O   . ALA A 1 28  ? -22.328 37.268  60.816  1.00 13.49  ? 48   ALA A O   1 
ATOM   202   C CB  . ALA A 1 28  ? -24.324 36.817  62.914  1.00 12.94  ? 48   ALA A CB  1 
ATOM   203   N N   . ILE A 1 29  ? -21.372 38.649  62.325  1.00 12.51  ? 49   ILE A N   1 
ATOM   204   C CA  . ILE A 1 29  ? -20.038 38.566  61.737  1.00 11.11  ? 49   ILE A CA  1 
ATOM   205   C C   . ILE A 1 29  ? -19.086 37.723  62.583  1.00 9.48   ? 49   ILE A C   1 
ATOM   206   O O   . ILE A 1 29  ? -19.072 37.827  63.811  1.00 8.94   ? 49   ILE A O   1 
ATOM   207   C CB  . ILE A 1 29  ? -19.410 39.973  61.560  1.00 11.66  ? 49   ILE A CB  1 
ATOM   208   C CG1 . ILE A 1 29  ? -20.240 40.800  60.584  1.00 8.91   ? 49   ILE A CG1 1 
ATOM   209   C CG2 . ILE A 1 29  ? -17.978 39.850  61.037  1.00 10.85  ? 49   ILE A CG2 1 
ATOM   210   C CD1 . ILE A 1 29  ? -19.626 42.148  60.284  1.00 9.42   ? 49   ILE A CD1 1 
ATOM   211   N N   . PHE A 1 30  ? -18.296 36.890  61.914  1.00 7.95   ? 50   PHE A N   1 
ATOM   212   C CA  . PHE A 1 30  ? -17.327 36.032  62.588  1.00 7.63   ? 50   PHE A CA  1 
ATOM   213   C C   . PHE A 1 30  ? -15.962 36.224  61.961  1.00 7.17   ? 50   PHE A C   1 
ATOM   214   O O   . PHE A 1 30  ? -15.790 36.002  60.760  1.00 7.62   ? 50   PHE A O   1 
ATOM   215   C CB  . PHE A 1 30  ? -17.732 34.573  62.470  1.00 5.68   ? 50   PHE A CB  1 
ATOM   216   C CG  . PHE A 1 30  ? -19.110 34.299  62.956  1.00 6.59   ? 50   PHE A CG  1 
ATOM   217   C CD1 . PHE A 1 30  ? -20.198 34.445  62.106  1.00 5.46   ? 50   PHE A CD1 1 
ATOM   218   C CD2 . PHE A 1 30  ? -19.326 33.896  64.272  1.00 7.89   ? 50   PHE A CD2 1 
ATOM   219   C CE1 . PHE A 1 30  ? -21.488 34.190  62.554  1.00 7.26   ? 50   PHE A CE1 1 
ATOM   220   C CE2 . PHE A 1 30  ? -20.614 33.638  64.734  1.00 8.84   ? 50   PHE A CE2 1 
ATOM   221   C CZ  . PHE A 1 30  ? -21.698 33.785  63.871  1.00 8.89   ? 50   PHE A CZ  1 
ATOM   222   N N   . LEU A 1 31  ? -14.994 36.627  62.782  1.00 6.68   ? 51   LEU A N   1 
ATOM   223   C CA  . LEU A 1 31  ? -13.639 36.886  62.312  1.00 5.37   ? 51   LEU A CA  1 
ATOM   224   C C   . LEU A 1 31  ? -12.598 35.905  62.822  1.00 4.57   ? 51   LEU A C   1 
ATOM   225   O O   . LEU A 1 31  ? -12.506 35.654  64.021  1.00 4.58   ? 51   LEU A O   1 
ATOM   226   C CB  . LEU A 1 31  ? -13.217 38.293  62.722  1.00 4.50   ? 51   LEU A CB  1 
ATOM   227   C CG  . LEU A 1 31  ? -14.146 39.422  62.289  1.00 3.52   ? 51   LEU A CG  1 
ATOM   228   C CD1 . LEU A 1 31  ? -13.677 40.748  62.882  1.00 1.52   ? 51   LEU A CD1 1 
ATOM   229   C CD2 . LEU A 1 31  ? -14.180 39.481  60.771  1.00 3.84   ? 51   LEU A CD2 1 
ATOM   230   N N   . GLY A 1 32  ? -11.808 35.359  61.904  1.00 4.38   ? 52   GLY A N   1 
ATOM   231   C CA  . GLY A 1 32  ? -10.755 34.440  62.295  1.00 4.37   ? 52   GLY A CA  1 
ATOM   232   C C   . GLY A 1 32  ? -11.120 33.002  62.597  1.00 3.76   ? 52   GLY A C   1 
ATOM   233   O O   . GLY A 1 32  ? -10.593 32.407  63.533  1.00 1.44   ? 52   GLY A O   1 
ATOM   234   N N   . ILE A 1 33  ? -12.031 32.433  61.825  1.00 5.26   ? 53   ILE A N   1 
ATOM   235   C CA  . ILE A 1 33  ? -12.372 31.040  62.045  1.00 7.24   ? 53   ILE A CA  1 
ATOM   236   C C   . ILE A 1 33  ? -11.270 30.266  61.342  1.00 7.40   ? 53   ILE A C   1 
ATOM   237   O O   . ILE A 1 33  ? -10.998 30.508  60.159  1.00 9.07   ? 53   ILE A O   1 
ATOM   238   C CB  . ILE A 1 33  ? -13.736 30.672  61.418  1.00 9.42   ? 53   ILE A CB  1 
ATOM   239   C CG1 . ILE A 1 33  ? -14.860 31.406  62.158  1.00 8.04   ? 53   ILE A CG1 1 
ATOM   240   C CG2 . ILE A 1 33  ? -13.951 29.155  61.473  1.00 7.81   ? 53   ILE A CG2 1 
ATOM   241   C CD1 . ILE A 1 33  ? -16.249 31.002  61.706  1.00 9.27   ? 53   ILE A CD1 1 
ATOM   242   N N   . PRO A 1 34  ? -10.598 29.349  62.063  1.00 6.57   ? 54   PRO A N   1 
ATOM   243   C CA  . PRO A 1 34  ? -9.515  28.550  61.479  1.00 5.40   ? 54   PRO A CA  1 
ATOM   244   C C   . PRO A 1 34  ? -10.089 27.389  60.661  1.00 4.46   ? 54   PRO A C   1 
ATOM   245   O O   . PRO A 1 34  ? -10.929 26.642  61.153  1.00 3.81   ? 54   PRO A O   1 
ATOM   246   C CB  . PRO A 1 34  ? -8.757  28.070  62.710  1.00 4.51   ? 54   PRO A CB  1 
ATOM   247   C CG  . PRO A 1 34  ? -9.875  27.785  63.666  1.00 4.69   ? 54   PRO A CG  1 
ATOM   248   C CD  . PRO A 1 34  ? -10.795 28.999  63.483  1.00 6.30   ? 54   PRO A CD  1 
ATOM   249   N N   . PHE A 1 35  ? -9.657  27.244  59.414  1.00 2.92   ? 55   PHE A N   1 
ATOM   250   C CA  . PHE A 1 35  ? -10.157 26.158  58.584  1.00 3.42   ? 55   PHE A CA  1 
ATOM   251   C C   . PHE A 1 35  ? -9.046  25.169  58.277  1.00 3.21   ? 55   PHE A C   1 
ATOM   252   O O   . PHE A 1 35  ? -9.212  24.269  57.460  1.00 2.50   ? 55   PHE A O   1 
ATOM   253   C CB  . PHE A 1 35  ? -10.752 26.703  57.283  1.00 4.45   ? 55   PHE A CB  1 
ATOM   254   C CG  . PHE A 1 35  ? -9.745  27.317  56.369  1.00 5.01   ? 55   PHE A CG  1 
ATOM   255   C CD1 . PHE A 1 35  ? -8.962  26.517  55.539  1.00 4.51   ? 55   PHE A CD1 1 
ATOM   256   C CD2 . PHE A 1 35  ? -9.544  28.694  56.369  1.00 4.92   ? 55   PHE A CD2 1 
ATOM   257   C CE1 . PHE A 1 35  ? -7.992  27.077  54.720  1.00 6.35   ? 55   PHE A CE1 1 
ATOM   258   C CE2 . PHE A 1 35  ? -8.576  29.273  55.556  1.00 5.43   ? 55   PHE A CE2 1 
ATOM   259   C CZ  . PHE A 1 35  ? -7.795  28.464  54.728  1.00 7.24   ? 55   PHE A CZ  1 
ATOM   260   N N   . ALA A 1 36  ? -7.913  25.341  58.946  1.00 4.33   ? 56   ALA A N   1 
ATOM   261   C CA  . ALA A 1 36  ? -6.766  24.463  58.750  1.00 7.04   ? 56   ALA A CA  1 
ATOM   262   C C   . ALA A 1 36  ? -5.822  24.531  59.938  1.00 8.19   ? 56   ALA A C   1 
ATOM   263   O O   . ALA A 1 36  ? -5.894  25.453  60.746  1.00 10.09  ? 56   ALA A O   1 
ATOM   264   C CB  . ALA A 1 36  ? -6.019  24.854  57.492  1.00 4.64   ? 56   ALA A CB  1 
ATOM   265   N N   . LYS A 1 37  ? -4.949  23.537  60.044  1.00 8.55   ? 57   LYS A N   1 
ATOM   266   C CA  . LYS A 1 37  ? -3.953  23.492  61.105  1.00 9.70   ? 57   LYS A CA  1 
ATOM   267   C C   . LYS A 1 37  ? -2.890  24.510  60.683  1.00 9.70   ? 57   LYS A C   1 
ATOM   268   O O   . LYS A 1 37  ? -2.526  24.564  59.507  1.00 10.69  ? 57   LYS A O   1 
ATOM   269   C CB  . LYS A 1 37  ? -3.355  22.088  61.175  1.00 10.29  ? 57   LYS A CB  1 
ATOM   270   C CG  . LYS A 1 37  ? -2.314  21.895  62.249  1.00 11.99  ? 57   LYS A CG  1 
ATOM   271   C CD  . LYS A 1 37  ? -1.914  20.432  62.327  1.00 15.43  ? 57   LYS A CD  1 
ATOM   272   C CE  . LYS A 1 37  ? -0.914  20.188  63.447  1.00 18.16  ? 57   LYS A CE  1 
ATOM   273   N NZ  . LYS A 1 37  ? -1.455  20.554  64.791  1.00 18.31  ? 57   LYS A NZ  1 
ATOM   274   N N   . PRO A 1 38  ? -2.386  25.335  61.619  1.00 9.41   ? 58   PRO A N   1 
ATOM   275   C CA  . PRO A 1 38  ? -1.370  26.315  61.206  1.00 11.69  ? 58   PRO A CA  1 
ATOM   276   C C   . PRO A 1 38  ? -0.194  25.637  60.501  1.00 13.39  ? 58   PRO A C   1 
ATOM   277   O O   . PRO A 1 38  ? 0.491   24.800  61.094  1.00 14.52  ? 58   PRO A O   1 
ATOM   278   C CB  . PRO A 1 38  ? -0.972  26.978  62.525  1.00 10.56  ? 58   PRO A CB  1 
ATOM   279   C CG  . PRO A 1 38  ? -2.225  26.881  63.340  1.00 7.81   ? 58   PRO A CG  1 
ATOM   280   C CD  . PRO A 1 38  ? -2.688  25.471  63.053  1.00 8.20   ? 58   PRO A CD  1 
ATOM   281   N N   . PRO A 1 39  ? 0.048   25.987  59.221  1.00 15.02  ? 59   PRO A N   1 
ATOM   282   C CA  . PRO A 1 39  ? 1.144   25.394  58.447  1.00 15.94  ? 59   PRO A CA  1 
ATOM   283   C C   . PRO A 1 39  ? 2.538   25.843  58.907  1.00 17.25  ? 59   PRO A C   1 
ATOM   284   O O   . PRO A 1 39  ? 3.282   26.477  58.148  1.00 19.25  ? 59   PRO A O   1 
ATOM   285   C CB  . PRO A 1 39  ? 0.813   25.825  57.017  1.00 14.15  ? 59   PRO A CB  1 
ATOM   286   C CG  . PRO A 1 39  ? 0.211   27.168  57.211  1.00 11.60  ? 59   PRO A CG  1 
ATOM   287   C CD  . PRO A 1 39  ? -0.687  26.980  58.411  1.00 14.22  ? 59   PRO A CD  1 
ATOM   288   N N   . LEU A 1 40  ? 2.878   25.500  60.150  1.00 16.86  ? 60   LEU A N   1 
ATOM   289   C CA  . LEU A 1 40  ? 4.165   25.856  60.747  1.00 15.49  ? 60   LEU A CA  1 
ATOM   290   C C   . LEU A 1 40  ? 5.108   24.660  60.849  1.00 15.93  ? 60   LEU A C   1 
ATOM   291   O O   . LEU A 1 40  ? 4.718   23.499  60.627  1.00 14.68  ? 60   LEU A O   1 
ATOM   292   C CB  . LEU A 1 40  ? 3.963   26.428  62.150  1.00 13.32  ? 60   LEU A CB  1 
ATOM   293   C CG  . LEU A 1 40  ? 2.887   27.497  62.269  1.00 12.91  ? 60   LEU A CG  1 
ATOM   294   C CD1 . LEU A 1 40  ? 2.743   27.939  63.709  1.00 13.76  ? 60   LEU A CD1 1 
ATOM   295   C CD2 . LEU A 1 40  ? 3.251   28.659  61.387  1.00 12.87  ? 60   LEU A CD2 1 
ATOM   296   N N   . GLY A 1 41  ? 6.353   24.958  61.203  1.00 14.45  ? 61   GLY A N   1 
ATOM   297   C CA  . GLY A 1 41  ? 7.344   23.912  61.334  1.00 14.35  ? 61   GLY A CA  1 
ATOM   298   C C   . GLY A 1 41  ? 7.400   22.979  60.140  1.00 13.81  ? 61   GLY A C   1 
ATOM   299   O O   . GLY A 1 41  ? 7.447   23.421  58.991  1.00 13.88  ? 61   GLY A O   1 
ATOM   300   N N   . PRO A 1 42  ? 7.370   21.666  60.384  1.00 13.62  ? 62   PRO A N   1 
ATOM   301   C CA  . PRO A 1 42  ? 7.426   20.686  59.301  1.00 13.36  ? 62   PRO A CA  1 
ATOM   302   C C   . PRO A 1 42  ? 6.283   20.807  58.307  1.00 12.82  ? 62   PRO A C   1 
ATOM   303   O O   . PRO A 1 42  ? 6.391   20.326  57.187  1.00 13.08  ? 62   PRO A O   1 
ATOM   304   C CB  . PRO A 1 42  ? 7.399   19.357  60.049  1.00 10.74  ? 62   PRO A CB  1 
ATOM   305   C CG  . PRO A 1 42  ? 6.501   19.655  61.182  1.00 12.21  ? 62   PRO A CG  1 
ATOM   306   C CD  . PRO A 1 42  ? 7.018   21.007  61.654  1.00 13.58  ? 62   PRO A CD  1 
ATOM   307   N N   . LEU A 1 43  ? 5.191   21.447  58.712  1.00 13.41  ? 63   LEU A N   1 
ATOM   308   C CA  . LEU A 1 43  ? 4.037   21.586  57.832  1.00 14.02  ? 63   LEU A CA  1 
ATOM   309   C C   . LEU A 1 43  ? 4.232   22.562  56.682  1.00 14.62  ? 63   LEU A C   1 
ATOM   310   O O   . LEU A 1 43  ? 3.418   22.618  55.751  1.00 13.13  ? 63   LEU A O   1 
ATOM   311   C CB  . LEU A 1 43  ? 2.805   21.975  58.645  1.00 13.41  ? 63   LEU A CB  1 
ATOM   312   C CG  . LEU A 1 43  ? 2.316   20.805  59.487  1.00 11.57  ? 63   LEU A CG  1 
ATOM   313   C CD1 . LEU A 1 43  ? 0.990   21.143  60.129  1.00 11.09  ? 63   LEU A CD1 1 
ATOM   314   C CD2 . LEU A 1 43  ? 2.175   19.586  58.594  1.00 10.54  ? 63   LEU A CD2 1 
ATOM   315   N N   . ARG A 1 44  ? 5.317   23.326  56.752  1.00 14.15  ? 64   ARG A N   1 
ATOM   316   C CA  . ARG A 1 44  ? 5.630   24.291  55.715  1.00 13.50  ? 64   ARG A CA  1 
ATOM   317   C C   . ARG A 1 44  ? 5.839   23.572  54.372  1.00 11.39  ? 64   ARG A C   1 
ATOM   318   O O   . ARG A 1 44  ? 6.366   22.468  54.335  1.00 10.68  ? 64   ARG A O   1 
ATOM   319   C CB  . ARG A 1 44  ? 6.877   25.078  56.124  1.00 14.03  ? 64   ARG A CB  1 
ATOM   320   C CG  . ARG A 1 44  ? 7.152   26.293  55.259  1.00 16.31  ? 64   ARG A CG  1 
ATOM   321   C CD  . ARG A 1 44  ? 8.384   27.026  55.729  1.00 17.75  ? 64   ARG A CD  1 
ATOM   322   N NE  . ARG A 1 44  ? 8.134   27.912  56.863  1.00 18.41  ? 64   ARG A NE  1 
ATOM   323   C CZ  . ARG A 1 44  ? 9.094   28.396  57.650  1.00 19.11  ? 64   ARG A CZ  1 
ATOM   324   N NH1 . ARG A 1 44  ? 10.368  28.073  57.439  1.00 15.50  ? 64   ARG A NH1 1 
ATOM   325   N NH2 . ARG A 1 44  ? 8.784   29.227  58.633  1.00 19.67  ? 64   ARG A NH2 1 
ATOM   326   N N   . PHE A 1 45  ? 5.409   24.194  53.276  1.00 10.82  ? 65   PHE A N   1 
ATOM   327   C CA  . PHE A 1 45  ? 5.541   23.605  51.937  1.00 10.86  ? 65   PHE A CA  1 
ATOM   328   C C   . PHE A 1 45  ? 4.870   22.236  51.843  1.00 10.10  ? 65   PHE A C   1 
ATOM   329   O O   . PHE A 1 45  ? 5.414   21.314  51.245  1.00 10.44  ? 65   PHE A O   1 
ATOM   330   C CB  . PHE A 1 45  ? 7.014   23.433  51.541  1.00 10.45  ? 65   PHE A CB  1 
ATOM   331   C CG  . PHE A 1 45  ? 7.847   24.659  51.730  1.00 10.01  ? 65   PHE A CG  1 
ATOM   332   C CD1 . PHE A 1 45  ? 7.520   25.847  51.088  1.00 11.01  ? 65   PHE A CD1 1 
ATOM   333   C CD2 . PHE A 1 45  ? 8.958   24.629  52.558  1.00 9.08   ? 65   PHE A CD2 1 
ATOM   334   C CE1 . PHE A 1 45  ? 8.288   26.993  51.270  1.00 10.95  ? 65   PHE A CE1 1 
ATOM   335   C CE2 . PHE A 1 45  ? 9.733   25.765  52.748  1.00 10.87  ? 65   PHE A CE2 1 
ATOM   336   C CZ  . PHE A 1 45  ? 9.398   26.953  52.105  1.00 10.74  ? 65   PHE A CZ  1 
ATOM   337   N N   . THR A 1 46  ? 3.699   22.094  52.447  1.00 10.39  ? 66   THR A N   1 
ATOM   338   C CA  . THR A 1 46  ? 2.982   20.823  52.399  1.00 9.63   ? 66   THR A CA  1 
ATOM   339   C C   . THR A 1 46  ? 1.481   21.091  52.410  1.00 9.42   ? 66   THR A C   1 
ATOM   340   O O   . THR A 1 46  ? 1.034   22.161  52.839  1.00 11.28  ? 66   THR A O   1 
ATOM   341   C CB  . THR A 1 46  ? 3.324   19.927  53.608  1.00 8.86   ? 66   THR A CB  1 
ATOM   342   O OG1 . THR A 1 46  ? 2.537   20.324  54.737  1.00 8.31   ? 66   THR A OG1 1 
ATOM   343   C CG2 . THR A 1 46  ? 4.800   20.047  53.961  1.00 7.34   ? 66   THR A CG2 1 
ATOM   344   N N   . PRO A 1 47  ? 0.683   20.124  51.942  1.00 7.65   ? 67   PRO A N   1 
ATOM   345   C CA  . PRO A 1 47  ? -0.778  20.240  51.890  1.00 7.76   ? 67   PRO A CA  1 
ATOM   346   C C   . PRO A 1 47  ? -1.371  20.680  53.222  1.00 8.57   ? 67   PRO A C   1 
ATOM   347   O O   . PRO A 1 47  ? -0.882  20.294  54.274  1.00 10.27  ? 67   PRO A O   1 
ATOM   348   C CB  . PRO A 1 47  ? -1.208  18.835  51.507  1.00 6.41   ? 67   PRO A CB  1 
ATOM   349   C CG  . PRO A 1 47  ? -0.094  18.398  50.628  1.00 5.20   ? 67   PRO A CG  1 
ATOM   350   C CD  . PRO A 1 47  ? 1.120   18.836  51.388  1.00 5.35   ? 67   PRO A CD  1 
ATOM   351   N N   . PRO A 1 48  ? -2.441  21.490  53.192  1.00 9.35   ? 68   PRO A N   1 
ATOM   352   C CA  . PRO A 1 48  ? -3.059  21.950  54.441  1.00 8.78   ? 68   PRO A CA  1 
ATOM   353   C C   . PRO A 1 48  ? -3.785  20.823  55.187  1.00 9.99   ? 68   PRO A C   1 
ATOM   354   O O   . PRO A 1 48  ? -4.477  20.001  54.578  1.00 8.70   ? 68   PRO A O   1 
ATOM   355   C CB  . PRO A 1 48  ? -4.016  23.041  53.965  1.00 7.11   ? 68   PRO A CB  1 
ATOM   356   C CG  . PRO A 1 48  ? -4.495  22.503  52.658  1.00 7.17   ? 68   PRO A CG  1 
ATOM   357   C CD  . PRO A 1 48  ? -3.213  21.951  52.019  1.00 8.75   ? 68   PRO A CD  1 
ATOM   358   N N   . GLN A 1 49  ? -3.624  20.792  56.506  1.00 12.40  ? 69   GLN A N   1 
ATOM   359   C CA  . GLN A 1 49  ? -4.267  19.780  57.336  1.00 14.33  ? 69   GLN A CA  1 
ATOM   360   C C   . GLN A 1 49  ? -5.414  20.333  58.169  1.00 15.50  ? 69   GLN A C   1 
ATOM   361   O O   . GLN A 1 49  ? -5.419  21.503  58.552  1.00 17.49  ? 69   GLN A O   1 
ATOM   362   C CB  . GLN A 1 49  ? -3.239  19.135  58.243  1.00 16.06  ? 69   GLN A CB  1 
ATOM   363   C CG  . GLN A 1 49  ? -2.339  18.178  57.509  1.00 21.29  ? 69   GLN A CG  1 
ATOM   364   C CD  . GLN A 1 49  ? -1.226  17.661  58.380  1.00 25.76  ? 69   GLN A CD  1 
ATOM   365   O OE1 . GLN A 1 49  ? -1.463  17.138  59.474  1.00 28.93  ? 69   GLN A OE1 1 
ATOM   366   N NE2 . GLN A 1 49  ? 0.003   17.803  57.904  1.00 28.65  ? 69   GLN A NE2 1 
ATOM   367   N N   . PRO A 1 50  ? -6.408  19.489  58.467  1.00 15.83  ? 70   PRO A N   1 
ATOM   368   C CA  . PRO A 1 50  ? -7.588  19.865  59.255  1.00 16.49  ? 70   PRO A CA  1 
ATOM   369   C C   . PRO A 1 50  ? -7.247  20.532  60.584  1.00 18.02  ? 70   PRO A C   1 
ATOM   370   O O   . PRO A 1 50  ? -6.284  20.148  61.250  1.00 19.26  ? 70   PRO A O   1 
ATOM   371   C CB  . PRO A 1 50  ? -8.301  18.537  59.452  1.00 14.85  ? 70   PRO A CB  1 
ATOM   372   C CG  . PRO A 1 50  ? -7.922  17.771  58.223  1.00 13.91  ? 70   PRO A CG  1 
ATOM   373   C CD  . PRO A 1 50  ? -6.455  18.063  58.110  1.00 14.61  ? 70   PRO A CD  1 
ATOM   374   N N   . ALA A 1 51  ? -8.039  21.530  60.965  1.00 18.63  ? 71   ALA A N   1 
ATOM   375   C CA  . ALA A 1 51  ? -7.821  22.247  62.218  1.00 18.59  ? 71   ALA A CA  1 
ATOM   376   C C   . ALA A 1 51  ? -8.167  21.363  63.415  1.00 17.98  ? 71   ALA A C   1 
ATOM   377   O O   . ALA A 1 51  ? -9.039  20.501  63.324  1.00 17.79  ? 71   ALA A O   1 
ATOM   378   C CB  . ALA A 1 51  ? -8.665  23.516  62.240  1.00 18.74  ? 71   ALA A CB  1 
ATOM   379   N N   . GLU A 1 52  ? -7.482  21.568  64.534  1.00 18.26  ? 72   GLU A N   1 
ATOM   380   C CA  . GLU A 1 52  ? -7.750  20.763  65.720  1.00 20.15  ? 72   GLU A CA  1 
ATOM   381   C C   . GLU A 1 52  ? -8.966  21.348  66.422  1.00 17.70  ? 72   GLU A C   1 
ATOM   382   O O   . GLU A 1 52  ? -9.066  22.560  66.579  1.00 20.04  ? 72   GLU A O   1 
ATOM   383   C CB  . GLU A 1 52  ? -6.536  20.772  66.665  1.00 25.19  ? 72   GLU A CB  1 
ATOM   384   C CG  . GLU A 1 52  ? -6.337  19.473  67.495  1.00 34.67  ? 72   GLU A CG  1 
ATOM   385   C CD  . GLU A 1 52  ? -7.062  19.456  68.864  1.00 38.61  ? 72   GLU A CD  1 
ATOM   386   O OE1 . GLU A 1 52  ? -8.268  19.782  68.927  1.00 41.87  ? 72   GLU A OE1 1 
ATOM   387   O OE2 . GLU A 1 52  ? -6.422  19.096  69.881  1.00 38.12  ? 72   GLU A OE2 1 
ATOM   388   N N   . PRO A 1 53  ? -9.918  20.492  66.830  1.00 14.46  ? 73   PRO A N   1 
ATOM   389   C CA  . PRO A 1 53  ? -11.148 20.899  67.524  1.00 12.67  ? 73   PRO A CA  1 
ATOM   390   C C   . PRO A 1 53  ? -10.909 21.499  68.915  1.00 12.16  ? 73   PRO A C   1 
ATOM   391   O O   . PRO A 1 53  ? -10.005 21.087  69.629  1.00 11.28  ? 73   PRO A O   1 
ATOM   392   C CB  . PRO A 1 53  ? -11.951 19.606  67.566  1.00 11.33  ? 73   PRO A CB  1 
ATOM   393   C CG  . PRO A 1 53  ? -10.894 18.552  67.560  1.00 10.20  ? 73   PRO A CG  1 
ATOM   394   C CD  . PRO A 1 53  ? -9.943  19.050  66.535  1.00 10.96  ? 73   PRO A CD  1 
ATOM   395   N N   . TRP A 1 54  ? -11.732 22.469  69.300  1.00 13.32  ? 74   TRP A N   1 
ATOM   396   C CA  . TRP A 1 54  ? -11.577 23.137  70.593  1.00 13.74  ? 74   TRP A CA  1 
ATOM   397   C C   . TRP A 1 54  ? -12.638 22.788  71.628  1.00 14.20  ? 74   TRP A C   1 
ATOM   398   O O   . TRP A 1 54  ? -13.799 22.591  71.295  1.00 14.01  ? 74   TRP A O   1 
ATOM   399   C CB  . TRP A 1 54  ? -11.526 24.648  70.377  1.00 12.87  ? 74   TRP A CB  1 
ATOM   400   C CG  . TRP A 1 54  ? -12.584 25.171  69.445  1.00 11.08  ? 74   TRP A CG  1 
ATOM   401   C CD1 . TRP A 1 54  ? -13.801 25.695  69.788  1.00 9.04   ? 74   TRP A CD1 1 
ATOM   402   C CD2 . TRP A 1 54  ? -12.492 25.268  68.021  1.00 9.35   ? 74   TRP A CD2 1 
ATOM   403   N NE1 . TRP A 1 54  ? -14.465 26.122  68.665  1.00 8.22   ? 74   TRP A NE1 1 
ATOM   404   C CE2 . TRP A 1 54  ? -13.686 25.871  67.566  1.00 8.78   ? 74   TRP A CE2 1 
ATOM   405   C CE3 . TRP A 1 54  ? -11.516 24.907  67.084  1.00 8.63   ? 74   TRP A CE3 1 
ATOM   406   C CZ2 . TRP A 1 54  ? -13.928 26.123  66.211  1.00 7.70   ? 74   TRP A CZ2 1 
ATOM   407   C CZ3 . TRP A 1 54  ? -11.758 25.158  65.735  1.00 8.64   ? 74   TRP A CZ3 1 
ATOM   408   C CH2 . TRP A 1 54  ? -12.955 25.760  65.314  1.00 7.08   ? 74   TRP A CH2 1 
ATOM   409   N N   . SER A 1 55  ? -12.223 22.752  72.891  1.00 16.95  ? 75   SER A N   1 
ATOM   410   C CA  . SER A 1 55  ? -13.091 22.371  74.002  1.00 19.54  ? 75   SER A CA  1 
ATOM   411   C C   . SER A 1 55  ? -14.191 23.301  74.477  1.00 20.11  ? 75   SER A C   1 
ATOM   412   O O   . SER A 1 55  ? -15.162 22.837  75.096  1.00 21.67  ? 75   SER A O   1 
ATOM   413   C CB  . SER A 1 55  ? -12.243 21.961  75.201  1.00 20.78  ? 75   SER A CB  1 
ATOM   414   O OG  . SER A 1 55  ? -11.554 20.751  74.920  1.00 25.15  ? 75   SER A OG  1 
ATOM   415   N N   . PHE A 1 56  ? -14.084 24.598  74.219  1.00 19.09  ? 76   PHE A N   1 
ATOM   416   C CA  . PHE A 1 56  ? -15.169 25.483  74.667  1.00 17.49  ? 76   PHE A CA  1 
ATOM   417   C C   . PHE A 1 56  ? -15.725 26.359  73.552  1.00 15.13  ? 76   PHE A C   1 
ATOM   418   O O   . PHE A 1 56  ? -15.900 25.915  72.424  1.00 16.28  ? 76   PHE A O   1 
ATOM   419   C CB  . PHE A 1 56  ? -14.682 26.360  75.826  1.00 17.69  ? 76   PHE A CB  1 
ATOM   420   C CG  . PHE A 1 56  ? -14.236 25.581  77.014  1.00 21.29  ? 76   PHE A CG  1 
ATOM   421   C CD1 . PHE A 1 56  ? -12.897 25.233  77.167  1.00 22.95  ? 76   PHE A CD1 1 
ATOM   422   C CD2 . PHE A 1 56  ? -15.158 25.167  77.980  1.00 22.41  ? 76   PHE A CD2 1 
ATOM   423   C CE1 . PHE A 1 56  ? -12.473 24.482  78.271  1.00 23.56  ? 76   PHE A CE1 1 
ATOM   424   C CE2 . PHE A 1 56  ? -14.747 24.414  79.089  1.00 22.73  ? 76   PHE A CE2 1 
ATOM   425   C CZ  . PHE A 1 56  ? -13.400 24.072  79.233  1.00 23.47  ? 76   PHE A CZ  1 
ATOM   426   N N   . VAL A 1 57  ? -16.033 27.601  73.896  1.00 12.47  ? 77   VAL A N   1 
ATOM   427   C CA  . VAL A 1 57  ? -16.496 28.567  72.930  1.00 11.62  ? 77   VAL A CA  1 
ATOM   428   C C   . VAL A 1 57  ? -15.328 29.433  72.464  1.00 11.50  ? 77   VAL A C   1 
ATOM   429   O O   . VAL A 1 57  ? -14.702 30.106  73.260  1.00 11.36  ? 77   VAL A O   1 
ATOM   430   C CB  . VAL A 1 57  ? -17.591 29.447  73.520  1.00 10.42  ? 77   VAL A CB  1 
ATOM   431   C CG1 . VAL A 1 57  ? -17.885 30.624  72.587  1.00 7.67   ? 77   VAL A CG1 1 
ATOM   432   C CG2 . VAL A 1 57  ? -18.827 28.604  73.730  1.00 8.65   ? 77   VAL A CG2 1 
ATOM   433   N N   . LYS A 1 58  ? -15.033 29.382  71.168  1.00 13.82  ? 78   LYS A N   1 
ATOM   434   C CA  . LYS A 1 58  ? -13.950 30.159  70.574  1.00 16.23  ? 78   LYS A CA  1 
ATOM   435   C C   . LYS A 1 58  ? -14.450 31.519  70.104  1.00 18.67  ? 78   LYS A C   1 
ATOM   436   O O   . LYS A 1 58  ? -15.511 31.618  69.484  1.00 18.37  ? 78   LYS A O   1 
ATOM   437   C CB  . LYS A 1 58  ? -13.338 29.394  69.390  1.00 14.96  ? 78   LYS A CB  1 
ATOM   438   C CG  . LYS A 1 58  ? -12.364 30.203  68.553  1.00 13.38  ? 78   LYS A CG  1 
ATOM   439   C CD  . LYS A 1 58  ? -11.810 29.376  67.411  1.00 14.59  ? 78   LYS A CD  1 
ATOM   440   C CE  . LYS A 1 58  ? -10.823 28.303  67.877  1.00 14.74  ? 78   LYS A CE  1 
ATOM   441   N NZ  . LYS A 1 58  ? -9.516  28.866  68.321  1.00 15.68  ? 78   LYS A NZ  1 
ATOM   442   N N   . ASN A 1 59  ? -13.679 32.563  70.396  1.00 21.24  ? 79   ASN A N   1 
ATOM   443   C CA  . ASN A 1 59  ? -14.049 33.910  69.989  1.00 23.71  ? 79   ASN A CA  1 
ATOM   444   C C   . ASN A 1 59  ? -13.551 34.222  68.603  1.00 21.31  ? 79   ASN A C   1 
ATOM   445   O O   . ASN A 1 59  ? -12.354 34.362  68.395  1.00 21.01  ? 79   ASN A O   1 
ATOM   446   C CB  . ASN A 1 59  ? -13.463 34.940  70.944  1.00 31.38  ? 79   ASN A CB  1 
ATOM   447   C CG  . ASN A 1 59  ? -14.202 34.999  72.246  1.00 39.20  ? 79   ASN A CG  1 
ATOM   448   O OD1 . ASN A 1 59  ? -14.737 33.987  72.705  1.00 39.74  ? 79   ASN A OD1 1 
ATOM   449   N ND2 . ASN A 1 59  ? -14.227 36.174  72.864  1.00 46.67  ? 79   ASN A ND2 1 
ATOM   450   N N   . ALA A 1 60  ? -14.470 34.327  67.655  1.00 19.12  ? 80   ALA A N   1 
ATOM   451   C CA  . ALA A 1 60  ? -14.102 34.667  66.294  1.00 18.64  ? 80   ALA A CA  1 
ATOM   452   C C   . ALA A 1 60  ? -14.418 36.153  66.164  1.00 19.05  ? 80   ALA A C   1 
ATOM   453   O O   . ALA A 1 60  ? -15.244 36.555  65.346  1.00 19.44  ? 80   ALA A O   1 
ATOM   454   C CB  . ALA A 1 60  ? -14.921 33.861  65.318  1.00 18.67  ? 80   ALA A CB  1 
ATOM   455   N N   . THR A 1 61  ? -13.738 36.966  66.969  1.00 18.75  ? 81   THR A N   1 
ATOM   456   C CA  . THR A 1 61  ? -13.991 38.398  66.996  1.00 17.99  ? 81   THR A CA  1 
ATOM   457   C C   . THR A 1 61  ? -12.863 39.358  66.635  1.00 16.43  ? 81   THR A C   1 
ATOM   458   O O   . THR A 1 61  ? -13.071 40.568  66.651  1.00 15.99  ? 81   THR A O   1 
ATOM   459   C CB  . THR A 1 61  ? -14.532 38.802  68.381  1.00 19.82  ? 81   THR A CB  1 
ATOM   460   O OG1 . THR A 1 61  ? -13.646 38.322  69.405  1.00 20.86  ? 81   THR A OG1 1 
ATOM   461   C CG2 . THR A 1 61  ? -15.910 38.204  68.598  1.00 20.95  ? 81   THR A CG2 1 
ATOM   462   N N   . SER A 1 62  ? -11.678 38.840  66.329  1.00 15.76  ? 82   SER A N   1 
ATOM   463   C CA  . SER A 1 62  ? -10.553 39.695  65.958  1.00 13.88  ? 82   SER A CA  1 
ATOM   464   C C   . SER A 1 62  ? -10.233 39.425  64.511  1.00 14.01  ? 82   SER A C   1 
ATOM   465   O O   . SER A 1 62  ? -10.517 38.346  64.008  1.00 16.06  ? 82   SER A O   1 
ATOM   466   C CB  . SER A 1 62  ? -9.316  39.355  66.779  1.00 13.82  ? 82   SER A CB  1 
ATOM   467   O OG  . SER A 1 62  ? -9.593  39.364  68.162  1.00 18.89  ? 82   SER A OG  1 
ATOM   468   N N   . TYR A 1 63  ? -9.652  40.399  63.825  1.00 14.35  ? 83   TYR A N   1 
ATOM   469   C CA  . TYR A 1 63  ? -9.269  40.173  62.441  1.00 14.19  ? 83   TYR A CA  1 
ATOM   470   C C   . TYR A 1 63  ? -8.030  39.284  62.501  1.00 13.29  ? 83   TYR A C   1 
ATOM   471   O O   . TYR A 1 63  ? -7.132  39.520  63.294  1.00 13.36  ? 83   TYR A O   1 
ATOM   472   C CB  . TYR A 1 63  ? -8.956  41.499  61.752  1.00 14.61  ? 83   TYR A CB  1 
ATOM   473   C CG  . TYR A 1 63  ? -10.199 42.272  61.402  1.00 16.25  ? 83   TYR A CG  1 
ATOM   474   C CD1 . TYR A 1 63  ? -11.039 41.841  60.373  1.00 17.80  ? 83   TYR A CD1 1 
ATOM   475   C CD2 . TYR A 1 63  ? -10.568 43.402  62.123  1.00 15.68  ? 83   TYR A CD2 1 
ATOM   476   C CE1 . TYR A 1 63  ? -12.222 42.516  60.073  1.00 18.44  ? 83   TYR A CE1 1 
ATOM   477   C CE2 . TYR A 1 63  ? -11.745 44.084  61.835  1.00 17.72  ? 83   TYR A CE2 1 
ATOM   478   C CZ  . TYR A 1 63  ? -12.569 43.635  60.810  1.00 19.06  ? 83   TYR A CZ  1 
ATOM   479   O OH  . TYR A 1 63  ? -13.751 44.288  60.540  1.00 20.25  ? 83   TYR A OH  1 
ATOM   480   N N   . PRO A 1 64  ? -7.988  38.219  61.696  1.00 12.82  ? 84   PRO A N   1 
ATOM   481   C CA  . PRO A 1 64  ? -6.810  37.350  61.736  1.00 12.76  ? 84   PRO A CA  1 
ATOM   482   C C   . PRO A 1 64  ? -5.597  37.973  61.039  1.00 12.90  ? 84   PRO A C   1 
ATOM   483   O O   . PRO A 1 64  ? -5.730  38.942  60.296  1.00 15.36  ? 84   PRO A O   1 
ATOM   484   C CB  . PRO A 1 64  ? -7.300  36.098  61.025  1.00 12.94  ? 84   PRO A CB  1 
ATOM   485   C CG  . PRO A 1 64  ? -8.262  36.660  60.007  1.00 11.80  ? 84   PRO A CG  1 
ATOM   486   C CD  . PRO A 1 64  ? -9.036  37.657  60.825  1.00 11.65  ? 84   PRO A CD  1 
ATOM   487   N N   . PRO A 1 65  ? -4.394  37.435  61.284  1.00 11.48  ? 85   PRO A N   1 
ATOM   488   C CA  . PRO A 1 65  ? -3.190  37.974  60.645  1.00 10.53  ? 85   PRO A CA  1 
ATOM   489   C C   . PRO A 1 65  ? -3.295  37.664  59.170  1.00 12.06  ? 85   PRO A C   1 
ATOM   490   O O   . PRO A 1 65  ? -4.102  36.828  58.776  1.00 12.65  ? 85   PRO A O   1 
ATOM   491   C CB  . PRO A 1 65  ? -2.064  37.159  61.268  1.00 8.93   ? 85   PRO A CB  1 
ATOM   492   C CG  . PRO A 1 65  ? -2.623  36.705  62.563  1.00 9.74   ? 85   PRO A CG  1 
ATOM   493   C CD  . PRO A 1 65  ? -4.046  36.368  62.233  1.00 10.65  ? 85   PRO A CD  1 
ATOM   494   N N   . MET A 1 66  ? -2.493  38.327  58.347  1.00 14.18  ? 86   MET A N   1 
ATOM   495   C CA  . MET A 1 66  ? -2.505  38.028  56.915  1.00 14.69  ? 86   MET A CA  1 
ATOM   496   C C   . MET A 1 66  ? -1.237  37.208  56.692  1.00 13.78  ? 86   MET A C   1 
ATOM   497   O O   . MET A 1 66  ? -0.267  37.372  57.439  1.00 14.00  ? 86   MET A O   1 
ATOM   498   C CB  . MET A 1 66  ? -2.503  39.320  56.082  1.00 15.04  ? 86   MET A CB  1 
ATOM   499   C CG  . MET A 1 66  ? -1.258  40.178  56.176  1.00 16.25  ? 86   MET A CG  1 
ATOM   500   S SD  . MET A 1 66  ? -1.474  41.715  55.240  1.00 19.15  ? 86   MET A SD  1 
ATOM   501   C CE  . MET A 1 66  ? -0.481  42.836  56.189  1.00 18.74  ? 86   MET A CE  1 
ATOM   502   N N   . CYS A 1 67  ? -1.238  36.310  55.709  1.00 12.65  ? 87   CYS A N   1 
ATOM   503   C CA  . CYS A 1 67  ? -0.048  35.489  55.474  1.00 12.95  ? 87   CYS A CA  1 
ATOM   504   C C   . CYS A 1 67  ? 1.160   36.349  55.120  1.00 13.15  ? 87   CYS A C   1 
ATOM   505   O O   . CYS A 1 67  ? 1.038   37.365  54.427  1.00 12.82  ? 87   CYS A O   1 
ATOM   506   C CB  . CYS A 1 67  ? -0.286  34.468  54.366  1.00 12.74  ? 87   CYS A CB  1 
ATOM   507   S SG  . CYS A 1 67  ? -1.740  33.397  54.609  1.00 15.23  ? 87   CYS A SG  1 
ATOM   508   N N   . THR A 1 68  ? 2.322   35.927  55.605  1.00 13.32  ? 88   THR A N   1 
ATOM   509   C CA  . THR A 1 68  ? 3.572   36.633  55.389  1.00 12.91  ? 88   THR A CA  1 
ATOM   510   C C   . THR A 1 68  ? 3.718   37.173  53.977  1.00 13.63  ? 88   THR A C   1 
ATOM   511   O O   . THR A 1 68  ? 3.570   36.444  52.995  1.00 13.08  ? 88   THR A O   1 
ATOM   512   C CB  . THR A 1 68  ? 4.746   35.728  55.693  1.00 13.73  ? 88   THR A CB  1 
ATOM   513   O OG1 . THR A 1 68  ? 4.494   35.030  56.918  1.00 14.44  ? 88   THR A OG1 1 
ATOM   514   C CG2 . THR A 1 68  ? 6.001   36.550  55.854  1.00 14.86  ? 88   THR A CG2 1 
ATOM   515   N N   . GLN A 1 69  ? 4.018   38.465  53.891  1.00 14.25  ? 89   GLN A N   1 
ATOM   516   C CA  . GLN A 1 69  ? 4.163   39.152  52.614  1.00 13.34  ? 89   GLN A CA  1 
ATOM   517   C C   . GLN A 1 69  ? 4.860   40.462  52.878  1.00 12.98  ? 89   GLN A C   1 
ATOM   518   O O   . GLN A 1 69  ? 5.134   40.800  54.028  1.00 11.23  ? 89   GLN A O   1 
ATOM   519   C CB  . GLN A 1 69  ? 2.784   39.446  52.017  1.00 14.69  ? 89   GLN A CB  1 
ATOM   520   C CG  . GLN A 1 69  ? 1.858   40.215  52.973  1.00 15.15  ? 89   GLN A CG  1 
ATOM   521   C CD  . GLN A 1 69  ? 0.426   40.349  52.462  1.00 15.91  ? 89   GLN A CD  1 
ATOM   522   O OE1 . GLN A 1 69  ? 0.101   41.250  51.683  1.00 12.26  ? 89   GLN A OE1 1 
ATOM   523   N NE2 . GLN A 1 69  ? -0.436  39.439  52.900  1.00 17.50  ? 89   GLN A NE2 1 
ATOM   524   N N   . ASP A 1 70  ? 5.148   41.196  51.808  1.00 14.07  ? 90   ASP A N   1 
ATOM   525   C CA  . ASP A 1 70  ? 5.787   42.497  51.944  1.00 14.67  ? 90   ASP A CA  1 
ATOM   526   C C   . ASP A 1 70  ? 4.801   43.334  52.742  1.00 13.58  ? 90   ASP A C   1 
ATOM   527   O O   . ASP A 1 70  ? 3.761   43.741  52.234  1.00 12.96  ? 90   ASP A O   1 
ATOM   528   C CB  . ASP A 1 70  ? 6.013   43.129  50.573  1.00 16.59  ? 90   ASP A CB  1 
ATOM   529   C CG  . ASP A 1 70  ? 6.646   44.507  50.658  1.00 19.29  ? 90   ASP A CG  1 
ATOM   530   O OD1 . ASP A 1 70  ? 6.570   45.159  51.727  1.00 19.08  ? 90   ASP A OD1 1 
ATOM   531   O OD2 . ASP A 1 70  ? 7.210   44.947  49.636  1.00 22.13  ? 90   ASP A OD2 1 
ATOM   532   N N   . PRO A 1 71  ? 5.121   43.610  54.006  1.00 13.78  ? 91   PRO A N   1 
ATOM   533   C CA  . PRO A 1 71  ? 4.229   44.403  54.855  1.00 14.90  ? 91   PRO A CA  1 
ATOM   534   C C   . PRO A 1 71  ? 3.883   45.739  54.213  1.00 16.06  ? 91   PRO A C   1 
ATOM   535   O O   . PRO A 1 71  ? 2.760   46.224  54.312  1.00 15.63  ? 91   PRO A O   1 
ATOM   536   C CB  . PRO A 1 71  ? 5.042   44.571  56.130  1.00 12.77  ? 91   PRO A CB  1 
ATOM   537   C CG  . PRO A 1 71  ? 6.429   44.678  55.591  1.00 12.99  ? 91   PRO A CG  1 
ATOM   538   C CD  . PRO A 1 71  ? 6.474   43.560  54.580  1.00 12.32  ? 91   PRO A CD  1 
ATOM   539   N N   . LYS A 1 72  ? 4.864   46.324  53.546  1.00 18.87  ? 92   LYS A N   1 
ATOM   540   C CA  . LYS A 1 72  ? 4.678   47.601  52.898  1.00 21.33  ? 92   LYS A CA  1 
ATOM   541   C C   . LYS A 1 72  ? 3.647   47.480  51.774  1.00 21.70  ? 92   LYS A C   1 
ATOM   542   O O   . LYS A 1 72  ? 2.585   48.102  51.829  1.00 22.26  ? 92   LYS A O   1 
ATOM   543   C CB  . LYS A 1 72  ? 6.025   48.084  52.368  1.00 24.21  ? 92   LYS A CB  1 
ATOM   544   C CG  . LYS A 1 72  ? 6.156   49.592  52.287  1.00 30.26  ? 92   LYS A CG  1 
ATOM   545   C CD  . LYS A 1 72  ? 7.610   50.039  52.486  1.00 33.96  ? 92   LYS A CD  1 
ATOM   546   C CE  . LYS A 1 72  ? 8.101   49.750  53.915  1.00 35.17  ? 92   LYS A CE  1 
ATOM   547   N NZ  . LYS A 1 72  ? 9.514   50.187  54.152  1.00 34.26  ? 92   LYS A NZ  1 
ATOM   548   N N   . ALA A 1 73  ? 3.954   46.666  50.768  1.00 21.72  ? 93   ALA A N   1 
ATOM   549   C CA  . ALA A 1 73  ? 3.059   46.459  49.625  1.00 21.87  ? 93   ALA A CA  1 
ATOM   550   C C   . ALA A 1 73  ? 1.670   45.961  50.030  1.00 21.90  ? 93   ALA A C   1 
ATOM   551   O O   . ALA A 1 73  ? 0.660   46.317  49.412  1.00 21.75  ? 93   ALA A O   1 
ATOM   552   C CB  . ALA A 1 73  ? 3.690   45.470  48.641  1.00 20.63  ? 93   ALA A CB  1 
ATOM   553   N N   . GLY A 1 74  ? 1.627   45.128  51.063  1.00 21.61  ? 94   GLY A N   1 
ATOM   554   C CA  . GLY A 1 74  ? 0.361   44.590  51.518  1.00 21.50  ? 94   GLY A CA  1 
ATOM   555   C C   . GLY A 1 74  ? -0.588  45.666  51.998  1.00 21.33  ? 94   GLY A C   1 
ATOM   556   O O   . GLY A 1 74  ? -1.751  45.721  51.591  1.00 21.70  ? 94   GLY A O   1 
ATOM   557   N N   . GLN A 1 75  ? -0.101  46.533  52.873  1.00 21.15  ? 95   GLN A N   1 
ATOM   558   C CA  . GLN A 1 75  ? -0.947  47.587  53.384  1.00 20.93  ? 95   GLN A CA  1 
ATOM   559   C C   . GLN A 1 75  ? -1.421  48.477  52.257  1.00 18.34  ? 95   GLN A C   1 
ATOM   560   O O   . GLN A 1 75  ? -2.560  48.924  52.256  1.00 17.42  ? 95   GLN A O   1 
ATOM   561   C CB  . GLN A 1 75  ? -0.201  48.420  54.418  1.00 24.39  ? 95   GLN A CB  1 
ATOM   562   C CG  . GLN A 1 75  ? -1.019  49.587  54.931  1.00 31.33  ? 95   GLN A CG  1 
ATOM   563   C CD  . GLN A 1 75  ? -0.427  50.209  56.179  1.00 35.69  ? 95   GLN A CD  1 
ATOM   564   O OE1 . GLN A 1 75  ? -0.425  49.595  57.253  1.00 37.98  ? 95   GLN A OE1 1 
ATOM   565   N NE2 . GLN A 1 75  ? 0.085   51.433  56.047  1.00 36.93  ? 95   GLN A NE2 1 
ATOM   566   N N   . LEU A 1 76  ? -0.553  48.714  51.283  1.00 16.84  ? 96   LEU A N   1 
ATOM   567   C CA  . LEU A 1 76  ? -0.914  49.583  50.180  1.00 16.26  ? 96   LEU A CA  1 
ATOM   568   C C   . LEU A 1 76  ? -2.027  49.035  49.320  1.00 15.64  ? 96   LEU A C   1 
ATOM   569   O O   . LEU A 1 76  ? -2.941  49.769  48.956  1.00 15.95  ? 96   LEU A O   1 
ATOM   570   C CB  . LEU A 1 76  ? 0.302   49.902  49.305  1.00 16.42  ? 96   LEU A CB  1 
ATOM   571   C CG  . LEU A 1 76  ? 0.001   50.880  48.155  1.00 16.75  ? 96   LEU A CG  1 
ATOM   572   C CD1 . LEU A 1 76  ? -0.800  52.055  48.676  1.00 16.35  ? 96   LEU A CD1 1 
ATOM   573   C CD2 . LEU A 1 76  ? 1.292   51.358  47.514  1.00 16.08  ? 96   LEU A CD2 1 
ATOM   574   N N   . LEU A 1 77  ? -1.962  47.752  48.988  1.00 16.57  ? 97   LEU A N   1 
ATOM   575   C CA  . LEU A 1 77  ? -3.006  47.160  48.159  1.00 16.14  ? 97   LEU A CA  1 
ATOM   576   C C   . LEU A 1 77  ? -4.317  47.088  48.926  1.00 17.13  ? 97   LEU A C   1 
ATOM   577   O O   . LEU A 1 77  ? -5.390  47.198  48.339  1.00 18.39  ? 97   LEU A O   1 
ATOM   578   C CB  . LEU A 1 77  ? -2.616  45.759  47.699  1.00 13.50  ? 97   LEU A CB  1 
ATOM   579   C CG  . LEU A 1 77  ? -3.611  45.144  46.713  1.00 13.33  ? 97   LEU A CG  1 
ATOM   580   C CD1 . LEU A 1 77  ? -3.659  46.003  45.455  1.00 12.06  ? 97   LEU A CD1 1 
ATOM   581   C CD2 . LEU A 1 77  ? -3.213  43.709  46.374  1.00 11.35  ? 97   LEU A CD2 1 
ATOM   582   N N   . SER A 1 78  ? -4.233  46.911  50.240  1.00 18.13  ? 98   SER A N   1 
ATOM   583   C CA  . SER A 1 78  ? -5.436  46.826  51.053  1.00 18.94  ? 98   SER A CA  1 
ATOM   584   C C   . SER A 1 78  ? -6.180  48.147  51.037  1.00 19.73  ? 98   SER A C   1 
ATOM   585   O O   . SER A 1 78  ? -7.398  48.180  50.867  1.00 20.92  ? 98   SER A O   1 
ATOM   586   C CB  . SER A 1 78  ? -5.093  46.456  52.496  1.00 19.26  ? 98   SER A CB  1 
ATOM   587   O OG  . SER A 1 78  ? -6.267  46.404  53.295  1.00 18.95  ? 98   SER A OG  1 
ATOM   588   N N   . GLU A 1 79  ? -5.443  49.238  51.208  1.00 20.31  ? 99   GLU A N   1 
ATOM   589   C CA  . GLU A 1 79  ? -6.042  50.566  51.225  1.00 20.34  ? 99   GLU A CA  1 
ATOM   590   C C   . GLU A 1 79  ? -6.693  50.903  49.887  1.00 19.85  ? 99   GLU A C   1 
ATOM   591   O O   . GLU A 1 79  ? -7.752  51.533  49.848  1.00 21.69  ? 99   GLU A O   1 
ATOM   592   C CB  . GLU A 1 79  ? -4.983  51.613  51.558  1.00 20.05  ? 99   GLU A CB  1 
ATOM   593   C CG  . GLU A 1 79  ? -4.162  51.273  52.781  1.00 21.89  ? 99   GLU A CG  1 
ATOM   594   C CD  . GLU A 1 79  ? -3.131  52.331  53.109  1.00 21.96  ? 99   GLU A CD  1 
ATOM   595   O OE1 . GLU A 1 79  ? -2.338  52.691  52.207  1.00 22.47  ? 99   GLU A OE1 1 
ATOM   596   O OE2 . GLU A 1 79  ? -3.114  52.794  54.271  1.00 21.02  ? 99   GLU A OE2 1 
ATOM   597   N N   . LEU A 1 80  ? -6.067  50.472  48.798  1.00 17.26  ? 100  LEU A N   1 
ATOM   598   C CA  . LEU A 1 80  ? -6.583  50.741  47.464  1.00 16.29  ? 100  LEU A CA  1 
ATOM   599   C C   . LEU A 1 80  ? -7.801  49.895  47.097  1.00 16.15  ? 100  LEU A C   1 
ATOM   600   O O   . LEU A 1 80  ? -8.637  50.320  46.302  1.00 16.74  ? 100  LEU A O   1 
ATOM   601   C CB  . LEU A 1 80  ? -5.484  50.505  46.431  1.00 16.57  ? 100  LEU A CB  1 
ATOM   602   C CG  . LEU A 1 80  ? -4.262  51.416  46.490  1.00 16.40  ? 100  LEU A CG  1 
ATOM   603   C CD1 . LEU A 1 80  ? -3.091  50.771  45.759  1.00 17.01  ? 100  LEU A CD1 1 
ATOM   604   C CD2 . LEU A 1 80  ? -4.614  52.753  45.888  1.00 15.25  ? 100  LEU A CD2 1 
ATOM   605   N N   . PHE A 1 81  ? -7.906  48.704  47.674  1.00 15.15  ? 101  PHE A N   1 
ATOM   606   C CA  . PHE A 1 81  ? -9.012  47.806  47.364  1.00 14.66  ? 101  PHE A CA  1 
ATOM   607   C C   . PHE A 1 81  ? -10.154 47.741  48.373  1.00 14.27  ? 101  PHE A C   1 
ATOM   608   O O   . PHE A 1 81  ? -11.287 47.415  48.003  1.00 12.56  ? 101  PHE A O   1 
ATOM   609   C CB  . PHE A 1 81  ? -8.477  46.392  47.150  1.00 14.89  ? 101  PHE A CB  1 
ATOM   610   C CG  . PHE A 1 81  ? -7.873  46.165  45.803  1.00 15.07  ? 101  PHE A CG  1 
ATOM   611   C CD1 . PHE A 1 81  ? -7.823  47.189  44.863  1.00 16.48  ? 101  PHE A CD1 1 
ATOM   612   C CD2 . PHE A 1 81  ? -7.380  44.909  45.460  1.00 15.73  ? 101  PHE A CD2 1 
ATOM   613   C CE1 . PHE A 1 81  ? -7.295  46.968  43.594  1.00 16.83  ? 101  PHE A CE1 1 
ATOM   614   C CE2 . PHE A 1 81  ? -6.851  44.673  44.205  1.00 17.59  ? 101  PHE A CE2 1 
ATOM   615   C CZ  . PHE A 1 81  ? -6.809  45.708  43.263  1.00 19.09  ? 101  PHE A CZ  1 
ATOM   616   N N   . THR A 1 82  ? -9.857  48.034  49.637  1.00 14.07  ? 102  THR A N   1 
ATOM   617   C CA  . THR A 1 82  ? -10.862 47.981  50.696  1.00 15.20  ? 102  THR A CA  1 
ATOM   618   C C   . THR A 1 82  ? -12.141 48.757  50.375  1.00 15.96  ? 102  THR A C   1 
ATOM   619   O O   . THR A 1 82  ? -12.100 49.879  49.875  1.00 17.39  ? 102  THR A O   1 
ATOM   620   C CB  . THR A 1 82  ? -10.292 48.490  52.034  1.00 13.79  ? 102  THR A CB  1 
ATOM   621   O OG1 . THR A 1 82  ? -11.309 48.432  53.038  1.00 13.55  ? 102  THR A OG1 1 
ATOM   622   C CG2 . THR A 1 82  ? -9.812  49.913  51.900  1.00 15.41  ? 102  THR A CG2 1 
ATOM   623   N N   . ASN A 1 83  ? -13.279 48.143  50.669  1.00 15.99  ? 103  ASN A N   1 
ATOM   624   C CA  . ASN A 1 83  ? -14.564 48.760  50.409  1.00 16.29  ? 103  ASN A CA  1 
ATOM   625   C C   . ASN A 1 83  ? -15.103 49.408  51.667  1.00 18.94  ? 103  ASN A C   1 
ATOM   626   O O   . ASN A 1 83  ? -16.275 49.780  51.716  1.00 19.26  ? 103  ASN A O   1 
ATOM   627   C CB  . ASN A 1 83  ? -15.562 47.714  49.923  1.00 15.25  ? 103  ASN A CB  1 
ATOM   628   C CG  . ASN A 1 83  ? -15.980 46.742  51.024  1.00 14.53  ? 103  ASN A CG  1 
ATOM   629   O OD1 . ASN A 1 83  ? -15.144 46.170  51.717  1.00 12.40  ? 103  ASN A OD1 1 
ATOM   630   N ND2 . ASN A 1 83  ? -17.281 46.550  51.178  1.00 15.20  ? 103  ASN A ND2 1 
ATOM   631   N N   . ARG A 1 84  ? -14.268 49.545  52.693  1.00 22.08  ? 104  ARG A N   1 
ATOM   632   C CA  . ARG A 1 84  ? -14.753 50.162  53.920  1.00 26.28  ? 104  ARG A CA  1 
ATOM   633   C C   . ARG A 1 84  ? -14.177 51.542  54.182  1.00 28.72  ? 104  ARG A C   1 
ATOM   634   O O   . ARG A 1 84  ? -13.163 51.926  53.607  1.00 29.82  ? 104  ARG A O   1 
ATOM   635   C CB  . ARG A 1 84  ? -14.530 49.244  55.130  1.00 25.75  ? 104  ARG A CB  1 
ATOM   636   C CG  . ARG A 1 84  ? -13.104 48.983  55.520  1.00 26.84  ? 104  ARG A CG  1 
ATOM   637   C CD  . ARG A 1 84  ? -13.066 48.136  56.789  1.00 27.44  ? 104  ARG A CD  1 
ATOM   638   N NE  . ARG A 1 84  ? -12.667 46.749  56.547  1.00 27.76  ? 104  ARG A NE  1 
ATOM   639   C CZ  . ARG A 1 84  ? -13.386 45.691  56.909  1.00 27.50  ? 104  ARG A CZ  1 
ATOM   640   N NH1 . ARG A 1 84  ? -14.549 45.859  57.518  1.00 27.88  ? 104  ARG A NH1 1 
ATOM   641   N NH2 . ARG A 1 84  ? -12.932 44.464  56.696  1.00 26.67  ? 104  ARG A NH2 1 
ATOM   642   N N   . LYS A 1 85  ? -14.858 52.281  55.049  1.00 32.13  ? 105  LYS A N   1 
ATOM   643   C CA  . LYS A 1 85  ? -14.494 53.645  55.410  1.00 35.71  ? 105  LYS A CA  1 
ATOM   644   C C   . LYS A 1 85  ? -13.046 53.838  55.829  1.00 36.94  ? 105  LYS A C   1 
ATOM   645   O O   . LYS A 1 85  ? -12.368 54.745  55.350  1.00 36.91  ? 105  LYS A O   1 
ATOM   646   C CB  . LYS A 1 85  ? -15.398 54.132  56.547  1.00 38.16  ? 105  LYS A CB  1 
ATOM   647   C CG  . LYS A 1 85  ? -15.017 53.594  57.940  1.00 42.27  ? 105  LYS A CG  1 
ATOM   648   C CD  . LYS A 1 85  ? -14.906 52.061  57.998  1.00 43.57  ? 105  LYS A CD  1 
ATOM   649   C CE  . LYS A 1 85  ? -14.173 51.611  59.269  1.00 44.02  ? 105  LYS A CE  1 
ATOM   650   N NZ  . LYS A 1 85  ? -13.929 50.132  59.329  1.00 44.82  ? 105  LYS A NZ  1 
ATOM   651   N N   . GLU A 1 86  ? -12.583 52.979  56.728  1.00 38.99  ? 106  GLU A N   1 
ATOM   652   C CA  . GLU A 1 86  ? -11.235 53.072  57.265  1.00 40.69  ? 106  GLU A CA  1 
ATOM   653   C C   . GLU A 1 86  ? -10.499 51.749  57.100  1.00 39.24  ? 106  GLU A C   1 
ATOM   654   O O   . GLU A 1 86  ? -10.954 50.718  57.597  1.00 39.74  ? 106  GLU A O   1 
ATOM   655   C CB  . GLU A 1 86  ? -11.331 53.437  58.748  1.00 44.68  ? 106  GLU A CB  1 
ATOM   656   C CG  . GLU A 1 86  ? -10.045 53.911  59.373  1.00 51.20  ? 106  GLU A CG  1 
ATOM   657   C CD  . GLU A 1 86  ? -9.520  55.165  58.712  1.00 55.00  ? 106  GLU A CD  1 
ATOM   658   O OE1 . GLU A 1 86  ? -9.025  55.068  57.565  1.00 56.92  ? 106  GLU A OE1 1 
ATOM   659   O OE2 . GLU A 1 86  ? -9.615  56.247  59.339  1.00 57.94  ? 106  GLU A OE2 1 
ATOM   660   N N   . ASN A 1 87  ? -9.363  51.774  56.408  1.00 36.47  ? 107  ASN A N   1 
ATOM   661   C CA  . ASN A 1 87  ? -8.603  50.552  56.202  1.00 34.49  ? 107  ASN A CA  1 
ATOM   662   C C   . ASN A 1 87  ? -8.157  49.982  57.541  1.00 32.27  ? 107  ASN A C   1 
ATOM   663   O O   . ASN A 1 87  ? -7.733  50.710  58.433  1.00 31.27  ? 107  ASN A O   1 
ATOM   664   C CB  . ASN A 1 87  ? -7.391  50.814  55.295  1.00 35.27  ? 107  ASN A CB  1 
ATOM   665   C CG  . ASN A 1 87  ? -6.644  49.531  54.913  1.00 35.86  ? 107  ASN A CG  1 
ATOM   666   O OD1 . ASN A 1 87  ? -5.630  49.180  55.525  1.00 36.41  ? 107  ASN A OD1 1 
ATOM   667   N ND2 . ASN A 1 87  ? -7.149  48.826  53.903  1.00 33.65  ? 107  ASN A ND2 1 
ATOM   668   N N   . ILE A 1 88  ? -8.291  48.669  57.674  1.00 30.69  ? 108  ILE A N   1 
ATOM   669   C CA  . ILE A 1 88  ? -7.909  47.958  58.883  1.00 29.09  ? 108  ILE A CA  1 
ATOM   670   C C   . ILE A 1 88  ? -6.482  47.449  58.700  1.00 29.44  ? 108  ILE A C   1 
ATOM   671   O O   . ILE A 1 88  ? -6.210  46.666  57.787  1.00 29.70  ? 108  ILE A O   1 
ATOM   672   C CB  . ILE A 1 88  ? -8.827  46.727  59.122  1.00 28.11  ? 108  ILE A CB  1 
ATOM   673   C CG1 . ILE A 1 88  ? -10.297 47.155  59.205  1.00 26.93  ? 108  ILE A CG1 1 
ATOM   674   C CG2 . ILE A 1 88  ? -8.389  45.983  60.368  1.00 25.79  ? 108  ILE A CG2 1 
ATOM   675   C CD1 . ILE A 1 88  ? -10.640 48.017  60.390  1.00 27.78  ? 108  ILE A CD1 1 
ATOM   676   N N   . PRO A 1 89  ? -5.547  47.900  59.550  1.00 29.43  ? 109  PRO A N   1 
ATOM   677   C CA  . PRO A 1 89  ? -4.155  47.451  59.447  1.00 28.95  ? 109  PRO A CA  1 
ATOM   678   C C   . PRO A 1 89  ? -4.080  46.015  59.972  1.00 27.67  ? 109  PRO A C   1 
ATOM   679   O O   . PRO A 1 89  ? -4.871  45.627  60.835  1.00 26.13  ? 109  PRO A O   1 
ATOM   680   C CB  . PRO A 1 89  ? -3.416  48.442  60.332  1.00 28.78  ? 109  PRO A CB  1 
ATOM   681   C CG  . PRO A 1 89  ? -4.403  48.658  61.427  1.00 30.10  ? 109  PRO A CG  1 
ATOM   682   C CD  . PRO A 1 89  ? -5.705  48.845  60.667  1.00 29.70  ? 109  PRO A CD  1 
ATOM   683   N N   . LEU A 1 90  ? -3.136  45.234  59.457  1.00 26.76  ? 110  LEU A N   1 
ATOM   684   C CA  . LEU A 1 90  ? -3.013  43.838  59.862  1.00 25.54  ? 110  LEU A CA  1 
ATOM   685   C C   . LEU A 1 90  ? -1.628  43.440  60.349  1.00 24.45  ? 110  LEU A C   1 
ATOM   686   O O   . LEU A 1 90  ? -0.668  44.200  60.250  1.00 26.72  ? 110  LEU A O   1 
ATOM   687   C CB  . LEU A 1 90  ? -3.400  42.934  58.693  1.00 25.54  ? 110  LEU A CB  1 
ATOM   688   C CG  . LEU A 1 90  ? -4.784  43.162  58.088  1.00 26.14  ? 110  LEU A CG  1 
ATOM   689   C CD1 . LEU A 1 90  ? -4.848  42.480  56.741  1.00 28.52  ? 110  LEU A CD1 1 
ATOM   690   C CD2 . LEU A 1 90  ? -5.864  42.637  59.016  1.00 25.05  ? 110  LEU A CD2 1 
ATOM   691   N N   . LYS A 1 91  ? -1.542  42.227  60.874  1.00 22.18  ? 111  LYS A N   1 
ATOM   692   C CA  . LYS A 1 91  ? -0.296  41.674  61.372  1.00 19.80  ? 111  LYS A CA  1 
ATOM   693   C C   . LYS A 1 91  ? 0.119   40.581  60.397  1.00 17.50  ? 111  LYS A C   1 
ATOM   694   O O   . LYS A 1 91  ? -0.725  39.991  59.728  1.00 17.89  ? 111  LYS A O   1 
ATOM   695   C CB  . LYS A 1 91  ? -0.513  41.086  62.769  1.00 21.04  ? 111  LYS A CB  1 
ATOM   696   C CG  . LYS A 1 91  ? -0.001  41.949  63.907  1.00 24.81  ? 111  LYS A CG  1 
ATOM   697   C CD  . LYS A 1 91  ? -0.493  43.382  63.805  1.00 29.74  ? 111  LYS A CD  1 
ATOM   698   C CE  . LYS A 1 91  ? 0.353   44.318  64.681  1.00 32.47  ? 111  LYS A CE  1 
ATOM   699   N NZ  . LYS A 1 91  ? 0.046   45.766  64.438  1.00 32.50  ? 111  LYS A NZ  1 
ATOM   700   N N   . LEU A 1 92  ? 1.414   40.327  60.290  1.00 14.90  ? 112  LEU A N   1 
ATOM   701   C CA  . LEU A 1 92  ? 1.880   39.281  59.398  1.00 13.28  ? 112  LEU A CA  1 
ATOM   702   C C   . LEU A 1 92  ? 2.058   38.021  60.228  1.00 13.19  ? 112  LEU A C   1 
ATOM   703   O O   . LEU A 1 92  ? 2.333   38.098  61.426  1.00 13.34  ? 112  LEU A O   1 
ATOM   704   C CB  . LEU A 1 92  ? 3.223   39.646  58.770  1.00 12.26  ? 112  LEU A CB  1 
ATOM   705   C CG  . LEU A 1 92  ? 3.293   40.778  57.758  1.00 13.44  ? 112  LEU A CG  1 
ATOM   706   C CD1 . LEU A 1 92  ? 4.705   40.838  57.210  1.00 14.34  ? 112  LEU A CD1 1 
ATOM   707   C CD2 . LEU A 1 92  ? 2.303   40.547  56.632  1.00 16.62  ? 112  LEU A CD2 1 
ATOM   708   N N   . SER A 1 93  ? 1.898   36.862  59.597  1.00 10.95  ? 113  SER A N   1 
ATOM   709   C CA  . SER A 1 93  ? 2.078   35.604  60.295  1.00 8.11   ? 113  SER A CA  1 
ATOM   710   C C   . SER A 1 93  ? 1.975   34.408  59.374  1.00 7.56   ? 113  SER A C   1 
ATOM   711   O O   . SER A 1 93  ? 1.333   34.467  58.332  1.00 7.79   ? 113  SER A O   1 
ATOM   712   C CB  . SER A 1 93  ? 1.047   35.460  61.402  1.00 6.55   ? 113  SER A CB  1 
ATOM   713   O OG  . SER A 1 93  ? 1.298   34.284  62.147  1.00 6.65   ? 113  SER A OG  1 
ATOM   714   N N   . GLU A 1 94  ? 2.628   33.320  59.758  1.00 7.27   ? 114  GLU A N   1 
ATOM   715   C CA  . GLU A 1 94  ? 2.566   32.097  58.979  1.00 6.05   ? 114  GLU A CA  1 
ATOM   716   C C   . GLU A 1 94  ? 1.276   31.397  59.373  1.00 5.72   ? 114  GLU A C   1 
ATOM   717   O O   . GLU A 1 94  ? 0.743   30.578  58.629  1.00 6.42   ? 114  GLU A O   1 
ATOM   718   C CB  . GLU A 1 94  ? 3.787   31.232  59.263  1.00 4.19   ? 114  GLU A CB  1 
ATOM   719   C CG  . GLU A 1 94  ? 4.878   31.456  58.245  1.00 7.56   ? 114  GLU A CG  1 
ATOM   720   C CD  . GLU A 1 94  ? 6.263   31.176  58.762  1.00 8.01   ? 114  GLU A CD  1 
ATOM   721   O OE1 . GLU A 1 94  ? 6.461   30.145  59.428  1.00 11.94  ? 114  GLU A OE1 1 
ATOM   722   O OE2 . GLU A 1 94  ? 7.166   31.984  58.483  1.00 11.37  ? 114  GLU A OE2 1 
ATOM   723   N N   . ASP A 1 95  ? 0.780   31.751  60.554  1.00 6.40   ? 115  ASP A N   1 
ATOM   724   C CA  . ASP A 1 95  ? -0.474  31.227  61.080  1.00 7.20   ? 115  ASP A CA  1 
ATOM   725   C C   . ASP A 1 95  ? -1.521  32.158  60.495  1.00 8.39   ? 115  ASP A C   1 
ATOM   726   O O   . ASP A 1 95  ? -1.890  33.156  61.120  1.00 8.82   ? 115  ASP A O   1 
ATOM   727   C CB  . ASP A 1 95  ? -0.482  31.318  62.607  1.00 6.85   ? 115  ASP A CB  1 
ATOM   728   C CG  . ASP A 1 95  ? -1.792  30.853  63.211  1.00 6.44   ? 115  ASP A CG  1 
ATOM   729   O OD1 . ASP A 1 95  ? -2.556  30.163  62.510  1.00 7.27   ? 115  ASP A OD1 1 
ATOM   730   O OD2 . ASP A 1 95  ? -2.050  31.165  64.390  1.00 4.74   ? 115  ASP A OD2 1 
ATOM   731   N N   . CYS A 1 96  ? -1.997  31.828  59.295  1.00 9.39   ? 116  CYS A N   1 
ATOM   732   C CA  . CYS A 1 96  ? -2.954  32.675  58.588  1.00 9.17   ? 116  CYS A CA  1 
ATOM   733   C C   . CYS A 1 96  ? -4.068  31.963  57.828  1.00 8.83   ? 116  CYS A C   1 
ATOM   734   O O   . CYS A 1 96  ? -4.772  32.591  57.039  1.00 9.80   ? 116  CYS A O   1 
ATOM   735   C CB  . CYS A 1 96  ? -2.189  33.527  57.601  1.00 9.75   ? 116  CYS A CB  1 
ATOM   736   S SG  . CYS A 1 96  ? -1.385  32.466  56.371  1.00 10.16  ? 116  CYS A SG  1 
ATOM   737   N N   . LEU A 1 97  ? -4.228  30.665  58.033  1.00 8.35   ? 117  LEU A N   1 
ATOM   738   C CA  . LEU A 1 97  ? -5.284  29.953  57.333  1.00 7.68   ? 117  LEU A CA  1 
ATOM   739   C C   . LEU A 1 97  ? -6.621  30.135  58.048  1.00 8.73   ? 117  LEU A C   1 
ATOM   740   O O   . LEU A 1 97  ? -7.138  29.220  58.691  1.00 8.30   ? 117  LEU A O   1 
ATOM   741   C CB  . LEU A 1 97  ? -4.927  28.473  57.199  1.00 5.34   ? 117  LEU A CB  1 
ATOM   742   C CG  . LEU A 1 97  ? -3.711  28.262  56.297  1.00 2.51   ? 117  LEU A CG  1 
ATOM   743   C CD1 . LEU A 1 97  ? -3.408  26.784  56.136  1.00 2.64   ? 117  LEU A CD1 1 
ATOM   744   C CD2 . LEU A 1 97  ? -3.993  28.888  54.948  1.00 3.60   ? 117  LEU A CD2 1 
ATOM   745   N N   . TYR A 1 98  ? -7.164  31.345  57.924  1.00 9.89   ? 118  TYR A N   1 
ATOM   746   C CA  . TYR A 1 98  ? -8.439  31.710  58.531  1.00 9.63   ? 118  TYR A CA  1 
ATOM   747   C C   . TYR A 1 98  ? -9.401  32.225  57.484  1.00 9.88   ? 118  TYR A C   1 
ATOM   748   O O   . TYR A 1 98  ? -9.031  32.430  56.325  1.00 9.71   ? 118  TYR A O   1 
ATOM   749   C CB  . TYR A 1 98  ? -8.243  32.801  59.577  1.00 8.27   ? 118  TYR A CB  1 
ATOM   750   C CG  . TYR A 1 98  ? -7.389  32.362  60.731  1.00 9.69   ? 118  TYR A CG  1 
ATOM   751   C CD1 . TYR A 1 98  ? -5.998  32.281  60.610  1.00 8.03   ? 118  TYR A CD1 1 
ATOM   752   C CD2 . TYR A 1 98  ? -7.977  31.957  61.926  1.00 8.44   ? 118  TYR A CD2 1 
ATOM   753   C CE1 . TYR A 1 98  ? -5.218  31.800  61.656  1.00 9.77   ? 118  TYR A CE1 1 
ATOM   754   C CE2 . TYR A 1 98  ? -7.216  31.474  62.971  1.00 9.15   ? 118  TYR A CE2 1 
ATOM   755   C CZ  . TYR A 1 98  ? -5.839  31.392  62.839  1.00 10.93  ? 118  TYR A CZ  1 
ATOM   756   O OH  . TYR A 1 98  ? -5.102  30.873  63.884  1.00 10.17  ? 118  TYR A OH  1 
ATOM   757   N N   . LEU A 1 99  ? -10.643 32.426  57.905  1.00 9.73   ? 119  LEU A N   1 
ATOM   758   C CA  . LEU A 1 99  ? -11.674 32.950  57.026  1.00 8.31   ? 119  LEU A CA  1 
ATOM   759   C C   . LEU A 1 99  ? -12.658 33.741  57.881  1.00 8.78   ? 119  LEU A C   1 
ATOM   760   O O   . LEU A 1 99  ? -12.771 33.504  59.091  1.00 8.55   ? 119  LEU A O   1 
ATOM   761   C CB  . LEU A 1 99  ? -12.377 31.807  56.277  1.00 5.51   ? 119  LEU A CB  1 
ATOM   762   C CG  . LEU A 1 99  ? -13.051 30.621  56.981  1.00 5.12   ? 119  LEU A CG  1 
ATOM   763   C CD1 . LEU A 1 99  ? -14.345 31.041  57.674  1.00 4.74   ? 119  LEU A CD1 1 
ATOM   764   C CD2 . LEU A 1 99  ? -13.375 29.565  55.931  1.00 5.08   ? 119  LEU A CD2 1 
ATOM   765   N N   . ASN A 1 100 ? -13.336 34.702  57.264  1.00 8.13   ? 120  ASN A N   1 
ATOM   766   C CA  . ASN A 1 100 ? -14.318 35.507  57.973  1.00 8.07   ? 120  ASN A CA  1 
ATOM   767   C C   . ASN A 1 100 ? -15.688 35.213  57.387  1.00 9.88   ? 120  ASN A C   1 
ATOM   768   O O   . ASN A 1 100 ? -15.809 34.976  56.184  1.00 11.65  ? 120  ASN A O   1 
ATOM   769   C CB  . ASN A 1 100 ? -13.985 36.985  57.830  1.00 5.60   ? 120  ASN A CB  1 
ATOM   770   C CG  . ASN A 1 100 ? -12.589 37.295  58.292  1.00 4.61   ? 120  ASN A CG  1 
ATOM   771   O OD1 . ASN A 1 100 ? -12.100 36.680  59.243  1.00 4.21   ? 120  ASN A OD1 1 
ATOM   772   N ND2 . ASN A 1 100 ? -11.935 38.253  57.635  1.00 1.99   ? 120  ASN A ND2 1 
ATOM   773   N N   . ILE A 1 101 ? -16.719 35.223  58.229  1.00 10.63  ? 121  ILE A N   1 
ATOM   774   C CA  . ILE A 1 101 ? -18.075 34.938  57.768  1.00 10.62  ? 121  ILE A CA  1 
ATOM   775   C C   . ILE A 1 101 ? -19.091 36.046  58.061  1.00 10.74  ? 121  ILE A C   1 
ATOM   776   O O   . ILE A 1 101 ? -19.198 36.529  59.187  1.00 9.98   ? 121  ILE A O   1 
ATOM   777   C CB  . ILE A 1 101 ? -18.592 33.632  58.398  1.00 11.64  ? 121  ILE A CB  1 
ATOM   778   C CG1 . ILE A 1 101 ? -17.754 32.447  57.908  1.00 13.74  ? 121  ILE A CG1 1 
ATOM   779   C CG2 . ILE A 1 101 ? -20.048 33.443  58.065  1.00 11.35  ? 121  ILE A CG2 1 
ATOM   780   C CD1 . ILE A 1 101 ? -18.134 31.118  58.526  1.00 12.41  ? 121  ILE A CD1 1 
ATOM   781   N N   . TYR A 1 102 ? -19.838 36.440  57.034  1.00 13.02  ? 122  TYR A N   1 
ATOM   782   C CA  . TYR A 1 102 ? -20.871 37.471  57.168  1.00 12.35  ? 122  TYR A CA  1 
ATOM   783   C C   . TYR A 1 102 ? -22.229 36.900  56.795  1.00 11.02  ? 122  TYR A C   1 
ATOM   784   O O   . TYR A 1 102 ? -22.554 36.821  55.616  1.00 12.95  ? 122  TYR A O   1 
ATOM   785   C CB  . TYR A 1 102 ? -20.588 38.661  56.248  1.00 10.71  ? 122  TYR A CB  1 
ATOM   786   C CG  . TYR A 1 102 ? -19.256 39.310  56.489  1.00 12.10  ? 122  TYR A CG  1 
ATOM   787   C CD1 . TYR A 1 102 ? -18.094 38.781  55.932  1.00 11.95  ? 122  TYR A CD1 1 
ATOM   788   C CD2 . TYR A 1 102 ? -19.147 40.436  57.300  1.00 12.38  ? 122  TYR A CD2 1 
ATOM   789   C CE1 . TYR A 1 102 ? -16.852 39.356  56.176  1.00 11.53  ? 122  TYR A CE1 1 
ATOM   790   C CE2 . TYR A 1 102 ? -17.905 41.021  57.552  1.00 13.62  ? 122  TYR A CE2 1 
ATOM   791   C CZ  . TYR A 1 102 ? -16.762 40.473  56.985  1.00 12.23  ? 122  TYR A CZ  1 
ATOM   792   O OH  . TYR A 1 102 ? -15.531 41.040  57.230  1.00 11.84  ? 122  TYR A OH  1 
ATOM   793   N N   . THR A 1 103 ? -23.021 36.489  57.779  1.00 9.48   ? 123  THR A N   1 
ATOM   794   C CA  . THR A 1 103 ? -24.343 35.948  57.469  1.00 7.83   ? 123  THR A CA  1 
ATOM   795   C C   . THR A 1 103 ? -25.459 36.923  57.829  1.00 7.08   ? 123  THR A C   1 
ATOM   796   O O   . THR A 1 103 ? -25.471 37.506  58.914  1.00 6.51   ? 123  THR A O   1 
ATOM   797   C CB  . THR A 1 103 ? -24.611 34.618  58.186  1.00 6.91   ? 123  THR A CB  1 
ATOM   798   O OG1 . THR A 1 103 ? -25.917 34.160  57.832  1.00 5.99   ? 123  THR A OG1 1 
ATOM   799   C CG2 . THR A 1 103 ? -24.534 34.786  59.696  1.00 7.13   ? 123  THR A CG2 1 
ATOM   800   N N   . PRO A 1 104 ? -26.406 37.126  56.909  1.00 5.68   ? 124  PRO A N   1 
ATOM   801   C CA  . PRO A 1 104 ? -27.510 38.043  57.170  1.00 6.79   ? 124  PRO A CA  1 
ATOM   802   C C   . PRO A 1 104 ? -28.705 37.313  57.767  1.00 7.24   ? 124  PRO A C   1 
ATOM   803   O O   . PRO A 1 104 ? -29.694 37.935  58.144  1.00 6.95   ? 124  PRO A O   1 
ATOM   804   C CB  . PRO A 1 104 ? -27.807 38.607  55.786  1.00 5.93   ? 124  PRO A CB  1 
ATOM   805   C CG  . PRO A 1 104 ? -27.636 37.405  54.929  1.00 6.19   ? 124  PRO A CG  1 
ATOM   806   C CD  . PRO A 1 104 ? -26.375 36.744  55.486  1.00 6.55   ? 124  PRO A CD  1 
ATOM   807   N N   . ALA A 1 105 ? -28.596 35.994  57.869  1.00 9.32   ? 125  ALA A N   1 
ATOM   808   C CA  . ALA A 1 105 ? -29.683 35.164  58.389  1.00 12.14  ? 125  ALA A CA  1 
ATOM   809   C C   . ALA A 1 105 ? -29.950 35.291  59.884  1.00 12.38  ? 125  ALA A C   1 
ATOM   810   O O   . ALA A 1 105 ? -29.079 35.689  60.647  1.00 14.61  ? 125  ALA A O   1 
ATOM   811   C CB  . ALA A 1 105 ? -29.424 33.699  58.035  1.00 12.41  ? 125  ALA A CB  1 
ATOM   812   N N   . ASP A 1 106 ? -31.170 34.965  60.294  1.00 12.10  ? 126  ASP A N   1 
ATOM   813   C CA  . ASP A 1 106 ? -31.521 35.007  61.702  1.00 13.61  ? 126  ASP A CA  1 
ATOM   814   C C   . ASP A 1 106 ? -31.126 33.642  62.243  1.00 14.64  ? 126  ASP A C   1 
ATOM   815   O O   . ASP A 1 106 ? -31.868 32.669  62.120  1.00 14.66  ? 126  ASP A O   1 
ATOM   816   C CB  . ASP A 1 106 ? -33.020 35.245  61.866  1.00 14.70  ? 126  ASP A CB  1 
ATOM   817   C CG  . ASP A 1 106 ? -33.473 35.179  63.313  1.00 17.74  ? 126  ASP A CG  1 
ATOM   818   O OD1 . ASP A 1 106 ? -32.632 35.394  64.221  1.00 19.95  ? 126  ASP A OD1 1 
ATOM   819   O OD2 . ASP A 1 106 ? -34.680 34.929  63.539  1.00 18.07  ? 126  ASP A OD2 1 
ATOM   820   N N   . LEU A 1 107 ? -29.939 33.575  62.835  1.00 16.22  ? 127  LEU A N   1 
ATOM   821   C CA  . LEU A 1 107 ? -29.410 32.323  63.369  1.00 17.69  ? 127  LEU A CA  1 
ATOM   822   C C   . LEU A 1 107 ? -30.282 31.598  64.402  1.00 19.61  ? 127  LEU A C   1 
ATOM   823   O O   . LEU A 1 107 ? -29.987 30.459  64.793  1.00 18.31  ? 127  LEU A O   1 
ATOM   824   C CB  . LEU A 1 107 ? -28.008 32.569  63.932  1.00 14.91  ? 127  LEU A CB  1 
ATOM   825   C CG  . LEU A 1 107 ? -26.984 32.947  62.859  1.00 12.19  ? 127  LEU A CG  1 
ATOM   826   C CD1 . LEU A 1 107 ? -25.654 33.283  63.498  1.00 11.59  ? 127  LEU A CD1 1 
ATOM   827   C CD2 . LEU A 1 107 ? -26.834 31.796  61.880  1.00 11.88  ? 127  LEU A CD2 1 
ATOM   828   N N   . THR A 1 108 ? -31.364 32.250  64.823  1.00 22.77  ? 128  THR A N   1 
ATOM   829   C CA  . THR A 1 108 ? -32.285 31.674  65.798  1.00 23.57  ? 128  THR A CA  1 
ATOM   830   C C   . THR A 1 108 ? -33.282 30.731  65.125  1.00 24.24  ? 128  THR A C   1 
ATOM   831   O O   . THR A 1 108 ? -34.201 30.223  65.764  1.00 23.22  ? 128  THR A O   1 
ATOM   832   C CB  . THR A 1 108 ? -33.055 32.769  66.527  1.00 23.56  ? 128  THR A CB  1 
ATOM   833   O OG1 . THR A 1 108 ? -33.823 33.519  65.579  1.00 24.53  ? 128  THR A OG1 1 
ATOM   834   C CG2 . THR A 1 108 ? -32.092 33.694  67.240  1.00 24.52  ? 128  THR A CG2 1 
ATOM   835   N N   . LYS A 1 109 ? -33.092 30.508  63.830  1.00 25.24  ? 129  LYS A N   1 
ATOM   836   C CA  . LYS A 1 109 ? -33.947 29.609  63.076  1.00 26.25  ? 129  LYS A CA  1 
ATOM   837   C C   . LYS A 1 109 ? -33.218 29.081  61.857  1.00 26.88  ? 129  LYS A C   1 
ATOM   838   O O   . LYS A 1 109 ? -32.172 29.611  61.486  1.00 28.90  ? 129  LYS A O   1 
ATOM   839   C CB  . LYS A 1 109 ? -35.234 30.319  62.676  1.00 25.73  ? 129  LYS A CB  1 
ATOM   840   C CG  . LYS A 1 109 ? -35.056 31.729  62.201  1.00 25.52  ? 129  LYS A CG  1 
ATOM   841   C CD  . LYS A 1 109 ? -36.396 32.442  62.189  1.00 24.13  ? 129  LYS A CD  1 
ATOM   842   C CE  . LYS A 1 109 ? -36.943 32.555  63.593  1.00 23.38  ? 129  LYS A CE  1 
ATOM   843   N NZ  . LYS A 1 109 ? -38.366 32.951  63.581  1.00 25.20  ? 129  LYS A NZ  1 
ATOM   844   N N   . LYS A 1 110 ? -33.763 28.033  61.245  1.00 27.58  ? 130  LYS A N   1 
ATOM   845   C CA  . LYS A 1 110 ? -33.143 27.417  60.075  1.00 27.47  ? 130  LYS A CA  1 
ATOM   846   C C   . LYS A 1 110 ? -33.184 28.327  58.856  1.00 25.29  ? 130  LYS A C   1 
ATOM   847   O O   . LYS A 1 110 ? -34.197 28.967  58.575  1.00 27.46  ? 130  LYS A O   1 
ATOM   848   C CB  . LYS A 1 110 ? -33.837 26.098  59.732  1.00 31.25  ? 130  LYS A CB  1 
ATOM   849   C CG  . LYS A 1 110 ? -33.020 25.213  58.797  1.00 35.18  ? 130  LYS A CG  1 
ATOM   850   C CD  . LYS A 1 110 ? -33.889 24.442  57.812  1.00 38.58  ? 130  LYS A CD  1 
ATOM   851   C CE  . LYS A 1 110 ? -34.914 23.544  58.497  1.00 41.12  ? 130  LYS A CE  1 
ATOM   852   N NZ  . LYS A 1 110 ? -35.778 22.869  57.471  1.00 42.77  ? 130  LYS A NZ  1 
ATOM   853   N N   . ASN A 1 111 ? -32.078 28.377  58.132  1.00 21.44  ? 131  ASN A N   1 
ATOM   854   C CA  . ASN A 1 111 ? -31.984 29.207  56.951  1.00 18.75  ? 131  ASN A CA  1 
ATOM   855   C C   . ASN A 1 111 ? -30.970 28.621  56.014  1.00 17.13  ? 131  ASN A C   1 
ATOM   856   O O   . ASN A 1 111 ? -29.892 28.217  56.434  1.00 15.80  ? 131  ASN A O   1 
ATOM   857   C CB  . ASN A 1 111 ? -31.535 30.611  57.315  1.00 21.85  ? 131  ASN A CB  1 
ATOM   858   C CG  . ASN A 1 111 ? -32.650 31.625  57.218  1.00 23.78  ? 131  ASN A CG  1 
ATOM   859   O OD1 . ASN A 1 111 ? -33.353 31.718  56.198  1.00 23.17  ? 131  ASN A OD1 1 
ATOM   860   N ND2 . ASN A 1 111 ? -32.811 32.412  58.277  1.00 25.50  ? 131  ASN A ND2 1 
ATOM   861   N N   . ARG A 1 112 ? -31.312 28.587  54.736  1.00 17.13  ? 132  ARG A N   1 
ATOM   862   C CA  . ARG A 1 112 ? -30.415 28.051  53.728  1.00 17.36  ? 132  ARG A CA  1 
ATOM   863   C C   . ARG A 1 112 ? -30.233 29.065  52.610  1.00 16.22  ? 132  ARG A C   1 
ATOM   864   O O   . ARG A 1 112 ? -30.863 28.972  51.553  1.00 15.53  ? 132  ARG A O   1 
ATOM   865   C CB  . ARG A 1 112 ? -30.965 26.723  53.189  1.00 18.94  ? 132  ARG A CB  1 
ATOM   866   C CG  . ARG A 1 112 ? -30.432 25.481  53.923  1.00 20.36  ? 132  ARG A CG  1 
ATOM   867   C CD  . ARG A 1 112 ? -30.502 25.652  55.430  1.00 21.24  ? 132  ARG A CD  1 
ATOM   868   N NE  . ARG A 1 112 ? -29.848 24.577  56.171  1.00 22.26  ? 132  ARG A NE  1 
ATOM   869   C CZ  . ARG A 1 112 ? -29.591 24.631  57.474  1.00 22.15  ? 132  ARG A CZ  1 
ATOM   870   N NH1 . ARG A 1 112 ? -29.927 25.702  58.167  1.00 22.43  ? 132  ARG A NH1 1 
ATOM   871   N NH2 . ARG A 1 112 ? -29.009 23.614  58.091  1.00 24.55  ? 132  ARG A NH2 1 
ATOM   872   N N   . LEU A 1 113 ? -29.360 30.039  52.862  1.00 14.35  ? 133  LEU A N   1 
ATOM   873   C CA  . LEU A 1 113 ? -29.080 31.101  51.903  1.00 11.51  ? 133  LEU A CA  1 
ATOM   874   C C   . LEU A 1 113 ? -27.947 30.762  50.955  1.00 9.82   ? 133  LEU A C   1 
ATOM   875   O O   . LEU A 1 113 ? -27.072 29.972  51.281  1.00 10.76  ? 133  LEU A O   1 
ATOM   876   C CB  . LEU A 1 113 ? -28.728 32.392  52.640  1.00 9.58   ? 133  LEU A CB  1 
ATOM   877   C CG  . LEU A 1 113 ? -29.819 33.008  53.511  1.00 8.53   ? 133  LEU A CG  1 
ATOM   878   C CD1 . LEU A 1 113 ? -29.383 34.388  54.023  1.00 7.88   ? 133  LEU A CD1 1 
ATOM   879   C CD2 . LEU A 1 113 ? -31.075 33.134  52.689  1.00 6.41   ? 133  LEU A CD2 1 
ATOM   880   N N   . PRO A 1 114 ? -27.959 31.345  49.753  1.00 8.60   ? 134  PRO A N   1 
ATOM   881   C CA  . PRO A 1 114 ? -26.866 31.041  48.833  1.00 8.51   ? 134  PRO A CA  1 
ATOM   882   C C   . PRO A 1 114 ? -25.556 31.542  49.448  1.00 8.34   ? 134  PRO A C   1 
ATOM   883   O O   . PRO A 1 114 ? -25.537 32.545  50.175  1.00 7.82   ? 134  PRO A O   1 
ATOM   884   C CB  . PRO A 1 114 ? -27.266 31.789  47.565  1.00 7.91   ? 134  PRO A CB  1 
ATOM   885   C CG  . PRO A 1 114 ? -28.074 32.922  48.084  1.00 8.93   ? 134  PRO A CG  1 
ATOM   886   C CD  . PRO A 1 114 ? -28.916 32.277  49.142  1.00 8.86   ? 134  PRO A CD  1 
ATOM   887   N N   . VAL A 1 115 ? -24.469 30.832  49.161  1.00 8.22   ? 135  VAL A N   1 
ATOM   888   C CA  . VAL A 1 115 ? -23.158 31.170  49.708  1.00 7.22   ? 135  VAL A CA  1 
ATOM   889   C C   . VAL A 1 115 ? -22.148 31.586  48.638  1.00 7.33   ? 135  VAL A C   1 
ATOM   890   O O   . VAL A 1 115 ? -21.992 30.924  47.609  1.00 7.32   ? 135  VAL A O   1 
ATOM   891   C CB  . VAL A 1 115 ? -22.592 29.974  50.520  1.00 6.51   ? 135  VAL A CB  1 
ATOM   892   C CG1 . VAL A 1 115 ? -21.334 30.382  51.275  1.00 3.14   ? 135  VAL A CG1 1 
ATOM   893   C CG2 . VAL A 1 115 ? -23.658 29.467  51.493  1.00 5.30   ? 135  VAL A CG2 1 
ATOM   894   N N   . MET A 1 116 ? -21.474 32.702  48.898  1.00 7.83   ? 136  MET A N   1 
ATOM   895   C CA  . MET A 1 116 ? -20.470 33.247  47.995  1.00 7.32   ? 136  MET A CA  1 
ATOM   896   C C   . MET A 1 116 ? -19.120 33.363  48.718  1.00 7.34   ? 136  MET A C   1 
ATOM   897   O O   . MET A 1 116 ? -18.965 34.140  49.671  1.00 4.20   ? 136  MET A O   1 
ATOM   898   C CB  . MET A 1 116 ? -20.908 34.627  47.494  1.00 6.99   ? 136  MET A CB  1 
ATOM   899   C CG  . MET A 1 116 ? -22.214 34.634  46.724  1.00 7.13   ? 136  MET A CG  1 
ATOM   900   S SD  . MET A 1 116 ? -22.673 36.277  46.096  1.00 7.75   ? 136  MET A SD  1 
ATOM   901   C CE  . MET A 1 116 ? -21.494 36.489  44.747  1.00 4.97   ? 136  MET A CE  1 
ATOM   902   N N   . VAL A 1 117 ? -18.149 32.578  48.261  1.00 8.26   ? 137  VAL A N   1 
ATOM   903   C CA  . VAL A 1 117 ? -16.817 32.590  48.849  1.00 9.86   ? 137  VAL A CA  1 
ATOM   904   C C   . VAL A 1 117 ? -15.909 33.511  48.026  1.00 10.80  ? 137  VAL A C   1 
ATOM   905   O O   . VAL A 1 117 ? -15.749 33.315  46.815  1.00 11.00  ? 137  VAL A O   1 
ATOM   906   C CB  . VAL A 1 117 ? -16.230 31.156  48.884  1.00 10.06  ? 137  VAL A CB  1 
ATOM   907   C CG1 . VAL A 1 117 ? -14.876 31.143  49.614  1.00 6.10   ? 137  VAL A CG1 1 
ATOM   908   C CG2 . VAL A 1 117 ? -17.226 30.224  49.560  1.00 8.21   ? 137  VAL A CG2 1 
ATOM   909   N N   . TRP A 1 118 ? -15.323 34.511  48.685  1.00 10.28  ? 138  TRP A N   1 
ATOM   910   C CA  . TRP A 1 118 ? -14.452 35.470  48.014  1.00 11.21  ? 138  TRP A CA  1 
ATOM   911   C C   . TRP A 1 118 ? -12.956 35.180  48.121  1.00 11.90  ? 138  TRP A C   1 
ATOM   912   O O   . TRP A 1 118 ? -12.434 34.988  49.218  1.00 13.11  ? 138  TRP A O   1 
ATOM   913   C CB  . TRP A 1 118 ? -14.722 36.869  48.551  1.00 10.15  ? 138  TRP A CB  1 
ATOM   914   C CG  . TRP A 1 118 ? -13.749 37.883  48.038  1.00 12.19  ? 138  TRP A CG  1 
ATOM   915   C CD1 . TRP A 1 118 ? -12.665 38.402  48.700  1.00 12.30  ? 138  TRP A CD1 1 
ATOM   916   C CD2 . TRP A 1 118 ? -13.751 38.483  46.742  1.00 11.85  ? 138  TRP A CD2 1 
ATOM   917   N NE1 . TRP A 1 118 ? -11.996 39.291  47.889  1.00 11.90  ? 138  TRP A NE1 1 
ATOM   918   C CE2 . TRP A 1 118 ? -12.642 39.358  46.682  1.00 12.57  ? 138  TRP A CE2 1 
ATOM   919   C CE3 . TRP A 1 118 ? -14.583 38.367  45.624  1.00 11.21  ? 138  TRP A CE3 1 
ATOM   920   C CZ2 . TRP A 1 118 ? -12.348 40.111  45.544  1.00 13.86  ? 138  TRP A CZ2 1 
ATOM   921   C CZ3 . TRP A 1 118 ? -14.293 39.114  44.495  1.00 12.00  ? 138  TRP A CZ3 1 
ATOM   922   C CH2 . TRP A 1 118 ? -13.183 39.977  44.462  1.00 13.45  ? 138  TRP A CH2 1 
ATOM   923   N N   . ILE A 1 119 ? -12.267 35.170  46.979  1.00 12.19  ? 139  ILE A N   1 
ATOM   924   C CA  . ILE A 1 119 ? -10.821 34.922  46.946  1.00 11.27  ? 139  ILE A CA  1 
ATOM   925   C C   . ILE A 1 119 ? -10.086 36.177  46.489  1.00 11.85  ? 139  ILE A C   1 
ATOM   926   O O   . ILE A 1 119 ? -10.091 36.507  45.303  1.00 11.63  ? 139  ILE A O   1 
ATOM   927   C CB  . ILE A 1 119 ? -10.467 33.766  45.994  1.00 9.05   ? 139  ILE A CB  1 
ATOM   928   C CG1 . ILE A 1 119 ? -11.190 32.494  46.438  1.00 8.16   ? 139  ILE A CG1 1 
ATOM   929   C CG2 . ILE A 1 119 ? -8.971  33.543  45.992  1.00 6.58   ? 139  ILE A CG2 1 
ATOM   930   C CD1 . ILE A 1 119 ? -10.863 31.270  45.603  1.00 8.52   ? 139  ILE A CD1 1 
ATOM   931   N N   . HIS A 1 120 ? -9.451  36.864  47.440  1.00 12.66  ? 140  HIS A N   1 
ATOM   932   C CA  . HIS A 1 120 ? -8.730  38.110  47.172  1.00 12.36  ? 140  HIS A CA  1 
ATOM   933   C C   . HIS A 1 120 ? -7.565  37.962  46.216  1.00 11.92  ? 140  HIS A C   1 
ATOM   934   O O   . HIS A 1 120 ? -6.934  36.913  46.150  1.00 14.08  ? 140  HIS A O   1 
ATOM   935   C CB  . HIS A 1 120 ? -8.184  38.698  48.465  1.00 12.78  ? 140  HIS A CB  1 
ATOM   936   C CG  . HIS A 1 120 ? -6.955  38.006  48.955  1.00 13.83  ? 140  HIS A CG  1 
ATOM   937   N ND1 . HIS A 1 120 ? -6.980  37.068  49.961  1.00 15.88  ? 140  HIS A ND1 1 
ATOM   938   C CD2 . HIS A 1 120 ? -5.671  38.072  48.533  1.00 13.60  ? 140  HIS A CD2 1 
ATOM   939   C CE1 . HIS A 1 120 ? -5.763  36.585  50.138  1.00 16.31  ? 140  HIS A CE1 1 
ATOM   940   N NE2 . HIS A 1 120 ? -4.951  37.177  49.281  1.00 13.53  ? 140  HIS A NE2 1 
ATOM   941   N N   . GLY A 1 121 ? -7.260  39.034  45.499  1.00 11.37  ? 141  GLY A N   1 
ATOM   942   C CA  . GLY A 1 121 ? -6.149  38.998  44.567  1.00 10.48  ? 141  GLY A CA  1 
ATOM   943   C C   . GLY A 1 121 ? -4.876  39.514  45.207  1.00 9.19   ? 141  GLY A C   1 
ATOM   944   O O   . GLY A 1 121 ? -4.818  39.732  46.412  1.00 8.74   ? 141  GLY A O   1 
ATOM   945   N N   . GLY A 1 122 ? -3.852  39.724  44.396  1.00 9.66   ? 142  GLY A N   1 
ATOM   946   C CA  . GLY A 1 122 ? -2.595  40.210  44.926  1.00 11.66  ? 142  GLY A CA  1 
ATOM   947   C C   . GLY A 1 122 ? -1.439  39.429  44.341  1.00 12.22  ? 142  GLY A C   1 
ATOM   948   O O   . GLY A 1 122 ? -0.423  39.216  44.994  1.00 13.50  ? 142  GLY A O   1 
ATOM   949   N N   . GLY A 1 123 ? -1.612  38.988  43.101  1.00 12.55  ? 143  GLY A N   1 
ATOM   950   C CA  . GLY A 1 123 ? -0.582  38.235  42.412  1.00 12.28  ? 143  GLY A CA  1 
ATOM   951   C C   . GLY A 1 123 ? -0.045  37.032  43.154  1.00 12.07  ? 143  GLY A C   1 
ATOM   952   O O   . GLY A 1 123 ? 1.092   36.630  42.932  1.00 13.61  ? 143  GLY A O   1 
ATOM   953   N N   . LEU A 1 124 ? -0.854  36.447  44.028  1.00 11.40  ? 144  LEU A N   1 
ATOM   954   C CA  . LEU A 1 124 ? -0.418  35.286  44.793  1.00 10.73  ? 144  LEU A CA  1 
ATOM   955   C C   . LEU A 1 124 ? 0.775   35.656  45.677  1.00 12.08  ? 144  LEU A C   1 
ATOM   956   O O   . LEU A 1 124 ? 1.383   34.786  46.293  1.00 12.78  ? 144  LEU A O   1 
ATOM   957   C CB  . LEU A 1 124 ? -0.030  34.151  43.848  1.00 7.63   ? 144  LEU A CB  1 
ATOM   958   C CG  . LEU A 1 124 ? -1.077  33.773  42.799  1.00 7.22   ? 144  LEU A CG  1 
ATOM   959   C CD1 . LEU A 1 124 ? -0.535  32.658  41.942  1.00 6.81   ? 144  LEU A CD1 1 
ATOM   960   C CD2 . LEU A 1 124 ? -2.373  33.335  43.466  1.00 6.52   ? 144  LEU A CD2 1 
ATOM   961   N N   . MET A 1 125 ? 1.101   36.949  45.728  1.00 13.75  ? 145  MET A N   1 
ATOM   962   C CA  . MET A 1 125 ? 2.213   37.461  46.536  1.00 14.08  ? 145  MET A CA  1 
ATOM   963   C C   . MET A 1 125 ? 1.742   38.288  47.747  1.00 13.74  ? 145  MET A C   1 
ATOM   964   O O   . MET A 1 125 ? 2.399   38.306  48.788  1.00 14.90  ? 145  MET A O   1 
ATOM   965   C CB  . MET A 1 125 ? 3.143   38.343  45.687  1.00 16.20  ? 145  MET A CB  1 
ATOM   966   C CG  . MET A 1 125 ? 3.945   37.638  44.596  1.00 20.25  ? 145  MET A CG  1 
ATOM   967   S SD  . MET A 1 125 ? 5.069   36.350  45.179  1.00 24.83  ? 145  MET A SD  1 
ATOM   968   C CE  . MET A 1 125 ? 6.121   37.268  46.393  1.00 25.21  ? 145  MET A CE  1 
ATOM   969   N N   . VAL A 1 126 ? 0.614   38.979  47.611  1.00 11.81  ? 146  VAL A N   1 
ATOM   970   C CA  . VAL A 1 126 ? 0.097   39.806  48.694  1.00 8.89   ? 146  VAL A CA  1 
ATOM   971   C C   . VAL A 1 126 ? -1.415  39.731  48.744  1.00 8.47   ? 146  VAL A C   1 
ATOM   972   O O   . VAL A 1 126 ? -2.043  39.230  47.816  1.00 8.92   ? 146  VAL A O   1 
ATOM   973   C CB  . VAL A 1 126 ? 0.498   41.291  48.505  1.00 9.27   ? 146  VAL A CB  1 
ATOM   974   C CG1 . VAL A 1 126 ? 2.013   41.445  48.619  1.00 9.14   ? 146  VAL A CG1 1 
ATOM   975   C CG2 . VAL A 1 126 ? 0.003   41.800  47.154  1.00 3.39   ? 146  VAL A CG2 1 
ATOM   976   N N   . GLY A 1 127 ? -1.997  40.244  49.823  1.00 7.16   ? 147  GLY A N   1 
ATOM   977   C CA  . GLY A 1 127 ? -3.441  40.222  49.953  1.00 6.99   ? 147  GLY A CA  1 
ATOM   978   C C   . GLY A 1 127 ? -3.915  39.663  51.279  1.00 7.65   ? 147  GLY A C   1 
ATOM   979   O O   . GLY A 1 127 ? -3.154  39.014  51.993  1.00 6.83   ? 147  GLY A O   1 
ATOM   980   N N   . ALA A 1 128 ? -5.179  39.918  51.608  1.00 9.85   ? 148  ALA A N   1 
ATOM   981   C CA  . ALA A 1 128 ? -5.775  39.446  52.860  1.00 11.48  ? 148  ALA A CA  1 
ATOM   982   C C   . ALA A 1 128 ? -7.289  39.383  52.722  1.00 12.10  ? 148  ALA A C   1 
ATOM   983   O O   . ALA A 1 128 ? -7.866  40.052  51.860  1.00 13.15  ? 148  ALA A O   1 
ATOM   984   C CB  . ALA A 1 128 ? -5.407  40.377  53.995  1.00 12.16  ? 148  ALA A CB  1 
ATOM   985   N N   . ALA A 1 129 ? -7.935  38.586  53.571  1.00 11.92  ? 149  ALA A N   1 
ATOM   986   C CA  . ALA A 1 129 ? -9.390  38.454  53.508  1.00 10.96  ? 149  ALA A CA  1 
ATOM   987   C C   . ALA A 1 129 ? -10.051 39.666  54.126  1.00 9.66   ? 149  ALA A C   1 
ATOM   988   O O   . ALA A 1 129 ? -10.972 40.235  53.544  1.00 10.03  ? 149  ALA A O   1 
ATOM   989   C CB  . ALA A 1 129 ? -9.847  37.189  54.223  1.00 10.03  ? 149  ALA A CB  1 
ATOM   990   N N   . SER A 1 130 ? -9.560  40.059  55.300  1.00 9.01   ? 150  SER A N   1 
ATOM   991   C CA  . SER A 1 130 ? -10.084 41.204  56.044  1.00 8.43   ? 150  SER A CA  1 
ATOM   992   C C   . SER A 1 130 ? -10.252 42.492  55.230  1.00 8.39   ? 150  SER A C   1 
ATOM   993   O O   . SER A 1 130 ? -11.061 43.352  55.575  1.00 7.95   ? 150  SER A O   1 
ATOM   994   C CB  . SER A 1 130 ? -9.197  41.476  57.257  1.00 6.67   ? 150  SER A CB  1 
ATOM   995   O OG  . SER A 1 130 ? -9.314  40.433  58.201  1.00 8.17   ? 150  SER A OG  1 
ATOM   996   N N   . THR A 1 131 ? -9.488  42.627  54.154  1.00 9.44   ? 151  THR A N   1 
ATOM   997   C CA  . THR A 1 131 ? -9.574  43.809  53.308  1.00 9.57   ? 151  THR A CA  1 
ATOM   998   C C   . THR A 1 131 ? -11.001 43.998  52.799  1.00 10.90  ? 151  THR A C   1 
ATOM   999   O O   . THR A 1 131 ? -11.505 45.126  52.715  1.00 11.02  ? 151  THR A O   1 
ATOM   1000  C CB  . THR A 1 131 ? -8.606  43.693  52.094  1.00 7.96   ? 151  THR A CB  1 
ATOM   1001  O OG1 . THR A 1 131 ? -7.264  43.953  52.527  1.00 6.57   ? 151  THR A OG1 1 
ATOM   1002  C CG2 . THR A 1 131 ? -8.986  44.674  50.991  1.00 5.85   ? 151  THR A CG2 1 
ATOM   1003  N N   . TYR A 1 132 ? -11.654 42.885  52.482  1.00 11.39  ? 152  TYR A N   1 
ATOM   1004  C CA  . TYR A 1 132 ? -13.004 42.925  51.952  1.00 11.52  ? 152  TYR A CA  1 
ATOM   1005  C C   . TYR A 1 132 ? -14.055 42.664  53.019  1.00 12.81  ? 152  TYR A C   1 
ATOM   1006  O O   . TYR A 1 132 ? -14.119 41.587  53.598  1.00 13.95  ? 152  TYR A O   1 
ATOM   1007  C CB  . TYR A 1 132 ? -13.109 41.935  50.794  1.00 9.30   ? 152  TYR A CB  1 
ATOM   1008  C CG  . TYR A 1 132 ? -11.937 42.081  49.844  1.00 10.31  ? 152  TYR A CG  1 
ATOM   1009  C CD1 . TYR A 1 132 ? -10.680 41.569  50.175  1.00 9.45   ? 152  TYR A CD1 1 
ATOM   1010  C CD2 . TYR A 1 132 ? -12.061 42.786  48.647  1.00 9.69   ? 152  TYR A CD2 1 
ATOM   1011  C CE1 . TYR A 1 132 ? -9.589  41.754  49.346  1.00 8.72   ? 152  TYR A CE1 1 
ATOM   1012  C CE2 . TYR A 1 132 ? -10.958 42.979  47.807  1.00 8.42   ? 152  TYR A CE2 1 
ATOM   1013  C CZ  . TYR A 1 132 ? -9.728  42.458  48.163  1.00 8.38   ? 152  TYR A CZ  1 
ATOM   1014  O OH  . TYR A 1 132 ? -8.633  42.610  47.333  1.00 8.55   ? 152  TYR A OH  1 
ATOM   1015  N N   . ASP A 1 133 ? -14.859 43.689  53.282  1.00 14.03  ? 153  ASP A N   1 
ATOM   1016  C CA  . ASP A 1 133 ? -15.917 43.637  54.276  1.00 15.35  ? 153  ASP A CA  1 
ATOM   1017  C C   . ASP A 1 133 ? -17.216 43.222  53.590  1.00 15.27  ? 153  ASP A C   1 
ATOM   1018  O O   . ASP A 1 133 ? -17.683 43.898  52.676  1.00 17.16  ? 153  ASP A O   1 
ATOM   1019  C CB  . ASP A 1 133 ? -16.071 45.015  54.911  1.00 17.08  ? 153  ASP A CB  1 
ATOM   1020  C CG  . ASP A 1 133 ? -17.155 45.051  55.957  1.00 20.08  ? 153  ASP A CG  1 
ATOM   1021  O OD1 . ASP A 1 133 ? -17.422 46.144  56.499  1.00 20.62  ? 153  ASP A OD1 1 
ATOM   1022  O OD2 . ASP A 1 133 ? -17.741 43.983  56.240  1.00 22.31  ? 153  ASP A OD2 1 
ATOM   1023  N N   . GLY A 1 134 ? -17.807 42.119  54.037  1.00 13.93  ? 154  GLY A N   1 
ATOM   1024  C CA  . GLY A 1 134 ? -19.026 41.641  53.408  1.00 13.30  ? 154  GLY A CA  1 
ATOM   1025  C C   . GLY A 1 134 ? -20.353 42.115  53.973  1.00 12.68  ? 154  GLY A C   1 
ATOM   1026  O O   . GLY A 1 134 ? -21.404 41.716  53.476  1.00 11.61  ? 154  GLY A O   1 
ATOM   1027  N N   . LEU A 1 135 ? -20.310 42.973  54.989  1.00 12.32  ? 155  LEU A N   1 
ATOM   1028  C CA  . LEU A 1 135 ? -21.518 43.486  55.640  1.00 10.35  ? 155  LEU A CA  1 
ATOM   1029  C C   . LEU A 1 135 ? -22.632 43.969  54.705  1.00 10.07  ? 155  LEU A C   1 
ATOM   1030  O O   . LEU A 1 135 ? -23.807 43.625  54.896  1.00 8.96   ? 155  LEU A O   1 
ATOM   1031  C CB  . LEU A 1 135 ? -21.156 44.623  56.599  1.00 8.97   ? 155  LEU A CB  1 
ATOM   1032  C CG  . LEU A 1 135 ? -22.361 45.276  57.282  1.00 9.47   ? 155  LEU A CG  1 
ATOM   1033  C CD1 . LEU A 1 135 ? -23.043 44.265  58.193  1.00 12.38  ? 155  LEU A CD1 1 
ATOM   1034  C CD2 . LEU A 1 135 ? -21.923 46.468  58.083  1.00 9.72   ? 155  LEU A CD2 1 
ATOM   1035  N N   . ALA A 1 136 ? -22.267 44.768  53.705  1.00 8.44   ? 156  ALA A N   1 
ATOM   1036  C CA  . ALA A 1 136 ? -23.248 45.305  52.772  1.00 7.52   ? 156  ALA A CA  1 
ATOM   1037  C C   . ALA A 1 136 ? -23.829 44.246  51.847  1.00 8.06   ? 156  ALA A C   1 
ATOM   1038  O O   . ALA A 1 136 ? -25.051 44.083  51.778  1.00 6.39   ? 156  ALA A O   1 
ATOM   1039  C CB  . ALA A 1 136 ? -22.633 46.432  51.956  1.00 5.80   ? 156  ALA A CB  1 
ATOM   1040  N N   . LEU A 1 137 ? -22.960 43.521  51.143  1.00 8.43   ? 157  LEU A N   1 
ATOM   1041  C CA  . LEU A 1 137 ? -23.412 42.490  50.209  1.00 7.85   ? 157  LEU A CA  1 
ATOM   1042  C C   . LEU A 1 137 ? -24.326 41.475  50.869  1.00 8.16   ? 157  LEU A C   1 
ATOM   1043  O O   . LEU A 1 137 ? -25.330 41.072  50.292  1.00 8.34   ? 157  LEU A O   1 
ATOM   1044  C CB  . LEU A 1 137 ? -22.222 41.772  49.577  1.00 6.42   ? 157  LEU A CB  1 
ATOM   1045  C CG  . LEU A 1 137 ? -22.530 40.592  48.652  1.00 6.22   ? 157  LEU A CG  1 
ATOM   1046  C CD1 . LEU A 1 137 ? -23.596 40.962  47.632  1.00 4.39   ? 157  LEU A CD1 1 
ATOM   1047  C CD2 . LEU A 1 137 ? -21.242 40.167  47.963  1.00 4.79   ? 157  LEU A CD2 1 
ATOM   1048  N N   . ALA A 1 138 ? -23.979 41.065  52.083  1.00 9.04   ? 158  ALA A N   1 
ATOM   1049  C CA  . ALA A 1 138 ? -24.789 40.100  52.807  1.00 9.70   ? 158  ALA A CA  1 
ATOM   1050  C C   . ALA A 1 138 ? -26.160 40.684  53.130  1.00 11.13  ? 158  ALA A C   1 
ATOM   1051  O O   . ALA A 1 138 ? -27.187 40.038  52.909  1.00 11.22  ? 158  ALA A O   1 
ATOM   1052  C CB  . ALA A 1 138 ? -24.087 39.683  54.081  1.00 9.22   ? 158  ALA A CB  1 
ATOM   1053  N N   . ALA A 1 139 ? -26.188 41.904  53.653  1.00 12.59  ? 159  ALA A N   1 
ATOM   1054  C CA  . ALA A 1 139 ? -27.470 42.531  53.986  1.00 14.36  ? 159  ALA A CA  1 
ATOM   1055  C C   . ALA A 1 139 ? -28.321 42.811  52.737  1.00 13.72  ? 159  ALA A C   1 
ATOM   1056  O O   . ALA A 1 139 ? -29.479 42.412  52.660  1.00 13.22  ? 159  ALA A O   1 
ATOM   1057  C CB  . ALA A 1 139 ? -27.242 43.827  54.771  1.00 13.74  ? 159  ALA A CB  1 
ATOM   1058  N N   . HIS A 1 140 ? -27.737 43.478  51.752  1.00 14.75  ? 160  HIS A N   1 
ATOM   1059  C CA  . HIS A 1 140 ? -28.468 43.809  50.540  1.00 15.67  ? 160  HIS A CA  1 
ATOM   1060  C C   . HIS A 1 140 ? -28.948 42.651  49.678  1.00 16.60  ? 160  HIS A C   1 
ATOM   1061  O O   . HIS A 1 140 ? -30.002 42.761  49.073  1.00 18.79  ? 160  HIS A O   1 
ATOM   1062  C CB  . HIS A 1 140 ? -27.646 44.753  49.667  1.00 14.67  ? 160  HIS A CB  1 
ATOM   1063  C CG  . HIS A 1 140 ? -27.582 46.151  50.191  1.00 16.42  ? 160  HIS A CG  1 
ATOM   1064  N ND1 . HIS A 1 140 ? -28.315 47.182  49.649  1.00 15.68  ? 160  HIS A ND1 1 
ATOM   1065  C CD2 . HIS A 1 140 ? -26.893 46.684  51.230  1.00 17.15  ? 160  HIS A CD2 1 
ATOM   1066  C CE1 . HIS A 1 140 ? -28.083 48.290  50.331  1.00 16.88  ? 160  HIS A CE1 1 
ATOM   1067  N NE2 . HIS A 1 140 ? -27.223 48.013  51.296  1.00 16.50  ? 160  HIS A NE2 1 
ATOM   1068  N N   . GLU A 1 141 ? -28.211 41.547  49.609  1.00 16.60  ? 161  GLU A N   1 
ATOM   1069  C CA  . GLU A 1 141 ? -28.641 40.448  48.743  1.00 14.89  ? 161  GLU A CA  1 
ATOM   1070  C C   . GLU A 1 141 ? -29.042 39.157  49.426  1.00 14.11  ? 161  GLU A C   1 
ATOM   1071  O O   . GLU A 1 141 ? -29.355 38.161  48.778  1.00 14.01  ? 161  GLU A O   1 
ATOM   1072  C CB  . GLU A 1 141 ? -27.572 40.169  47.691  1.00 14.31  ? 161  GLU A CB  1 
ATOM   1073  C CG  . GLU A 1 141 ? -27.607 41.153  46.558  1.00 15.09  ? 161  GLU A CG  1 
ATOM   1074  C CD  . GLU A 1 141 ? -29.001 41.275  45.965  1.00 17.49  ? 161  GLU A CD  1 
ATOM   1075  O OE1 . GLU A 1 141 ? -29.680 40.234  45.846  1.00 18.23  ? 161  GLU A OE1 1 
ATOM   1076  O OE2 . GLU A 1 141 ? -29.418 42.400  45.609  1.00 18.97  ? 161  GLU A OE2 1 
ATOM   1077  N N   . ASN A 1 142 ? -29.035 39.180  50.746  1.00 14.45  ? 162  ASN A N   1 
ATOM   1078  C CA  . ASN A 1 142 ? -29.425 38.023  51.524  1.00 12.66  ? 162  ASN A CA  1 
ATOM   1079  C C   . ASN A 1 142 ? -28.653 36.765  51.190  1.00 9.57   ? 162  ASN A C   1 
ATOM   1080  O O   . ASN A 1 142 ? -29.232 35.743  50.841  1.00 8.35   ? 162  ASN A O   1 
ATOM   1081  C CB  . ASN A 1 142 ? -30.904 37.763  51.346  1.00 15.20  ? 162  ASN A CB  1 
ATOM   1082  C CG  . ASN A 1 142 ? -31.533 37.255  52.598  1.00 20.72  ? 162  ASN A CG  1 
ATOM   1083  O OD1 . ASN A 1 142 ? -32.164 36.200  52.606  1.00 24.81  ? 162  ASN A OD1 1 
ATOM   1084  N ND2 . ASN A 1 142 ? -31.360 38.002  53.686  1.00 23.69  ? 162  ASN A ND2 1 
ATOM   1085  N N   . VAL A 1 143 ? -27.336 36.852  51.307  1.00 7.51   ? 163  VAL A N   1 
ATOM   1086  C CA  . VAL A 1 143 ? -26.465 35.729  51.045  1.00 5.76   ? 163  VAL A CA  1 
ATOM   1087  C C   . VAL A 1 143 ? -25.372 35.730  52.099  1.00 6.31   ? 163  VAL A C   1 
ATOM   1088  O O   . VAL A 1 143 ? -25.083 36.756  52.717  1.00 4.38   ? 163  VAL A O   1 
ATOM   1089  C CB  . VAL A 1 143 ? -25.814 35.844  49.675  1.00 3.97   ? 163  VAL A CB  1 
ATOM   1090  C CG1 . VAL A 1 143 ? -26.877 35.950  48.606  1.00 6.74   ? 163  VAL A CG1 1 
ATOM   1091  C CG2 . VAL A 1 143 ? -24.923 37.058  49.633  1.00 3.94   ? 163  VAL A CG2 1 
ATOM   1092  N N   . VAL A 1 144 ? -24.776 34.568  52.317  1.00 7.80   ? 164  VAL A N   1 
ATOM   1093  C CA  . VAL A 1 144 ? -23.695 34.460  53.278  1.00 6.89   ? 164  VAL A CA  1 
ATOM   1094  C C   . VAL A 1 144 ? -22.427 34.778  52.505  1.00 6.93   ? 164  VAL A C   1 
ATOM   1095  O O   . VAL A 1 144 ? -22.222 34.280  51.395  1.00 6.85   ? 164  VAL A O   1 
ATOM   1096  C CB  . VAL A 1 144 ? -23.602 33.036  53.855  1.00 6.55   ? 164  VAL A CB  1 
ATOM   1097  C CG1 . VAL A 1 144 ? -22.361 32.899  54.722  1.00 5.78   ? 164  VAL A CG1 1 
ATOM   1098  C CG2 . VAL A 1 144 ? -24.848 32.736  54.666  1.00 7.68   ? 164  VAL A CG2 1 
ATOM   1099  N N   . VAL A 1 145 ? -21.591 35.633  53.073  1.00 6.37   ? 165  VAL A N   1 
ATOM   1100  C CA  . VAL A 1 145 ? -20.352 35.986  52.413  1.00 6.31   ? 165  VAL A CA  1 
ATOM   1101  C C   . VAL A 1 145 ? -19.194 35.435  53.228  1.00 7.65   ? 165  VAL A C   1 
ATOM   1102  O O   . VAL A 1 145 ? -19.099 35.676  54.440  1.00 7.58   ? 165  VAL A O   1 
ATOM   1103  C CB  . VAL A 1 145 ? -20.204 37.515  52.262  1.00 4.50   ? 165  VAL A CB  1 
ATOM   1104  C CG1 . VAL A 1 145 ? -18.873 37.849  51.589  1.00 2.29   ? 165  VAL A CG1 1 
ATOM   1105  C CG2 . VAL A 1 145 ? -21.359 38.063  51.452  1.00 1.44   ? 165  VAL A CG2 1 
ATOM   1106  N N   . VAL A 1 146 ? -18.328 34.680  52.552  1.00 8.06   ? 166  VAL A N   1 
ATOM   1107  C CA  . VAL A 1 146 ? -17.162 34.072  53.178  1.00 8.44   ? 166  VAL A CA  1 
ATOM   1108  C C   . VAL A 1 146 ? -15.893 34.523  52.471  1.00 9.41   ? 166  VAL A C   1 
ATOM   1109  O O   . VAL A 1 146 ? -15.731 34.302  51.270  1.00 11.33  ? 166  VAL A O   1 
ATOM   1110  C CB  . VAL A 1 146 ? -17.230 32.525  53.116  1.00 7.32   ? 166  VAL A CB  1 
ATOM   1111  C CG1 . VAL A 1 146 ? -16.009 31.921  53.768  1.00 8.11   ? 166  VAL A CG1 1 
ATOM   1112  C CG2 . VAL A 1 146 ? -18.475 32.033  53.816  1.00 8.05   ? 166  VAL A CG2 1 
ATOM   1113  N N   . THR A 1 147 ? -15.006 35.177  53.216  1.00 10.74  ? 167  THR A N   1 
ATOM   1114  C CA  . THR A 1 147 ? -13.727 35.638  52.682  1.00 9.49   ? 167  THR A CA  1 
ATOM   1115  C C   . THR A 1 147 ? -12.663 34.716  53.284  1.00 9.47   ? 167  THR A C   1 
ATOM   1116  O O   . THR A 1 147 ? -12.647 34.484  54.503  1.00 9.39   ? 167  THR A O   1 
ATOM   1117  C CB  . THR A 1 147 ? -13.448 37.111  53.069  1.00 9.31   ? 167  THR A CB  1 
ATOM   1118  O OG1 . THR A 1 147 ? -13.556 37.269  54.488  1.00 8.43   ? 167  THR A OG1 1 
ATOM   1119  C CG2 . THR A 1 147 ? -14.446 38.035  52.383  1.00 7.93   ? 167  THR A CG2 1 
ATOM   1120  N N   . ILE A 1 148 ? -11.796 34.178  52.425  1.00 8.12   ? 168  ILE A N   1 
ATOM   1121  C CA  . ILE A 1 148 ? -10.753 33.245  52.853  1.00 6.75   ? 168  ILE A CA  1 
ATOM   1122  C C   . ILE A 1 148 ? -9.341  33.731  52.574  1.00 7.21   ? 168  ILE A C   1 
ATOM   1123  O O   . ILE A 1 148 ? -9.127  34.586  51.723  1.00 10.26  ? 168  ILE A O   1 
ATOM   1124  C CB  . ILE A 1 148 ? -10.897 31.898  52.137  1.00 4.79   ? 168  ILE A CB  1 
ATOM   1125  C CG1 . ILE A 1 148 ? -10.521 32.061  50.662  1.00 3.36   ? 168  ILE A CG1 1 
ATOM   1126  C CG2 . ILE A 1 148 ? -12.324 31.390  52.265  1.00 4.26   ? 168  ILE A CG2 1 
ATOM   1127  C CD1 . ILE A 1 148 ? -10.513 30.776  49.879  1.00 1.44   ? 168  ILE A CD1 1 
ATOM   1128  N N   . GLN A 1 149 ? -8.379  33.171  53.293  1.00 6.76   ? 169  GLN A N   1 
ATOM   1129  C CA  . GLN A 1 149 ? -6.987  33.521  53.094  1.00 8.17   ? 169  GLN A CA  1 
ATOM   1130  C C   . GLN A 1 149 ? -6.238  32.264  52.715  1.00 11.33  ? 169  GLN A C   1 
ATOM   1131  O O   . GLN A 1 149 ? -6.618  31.169  53.115  1.00 13.88  ? 169  GLN A O   1 
ATOM   1132  C CB  . GLN A 1 149 ? -6.405  34.131  54.357  1.00 5.80   ? 169  GLN A CB  1 
ATOM   1133  C CG  . GLN A 1 149 ? -6.923  35.542  54.576  1.00 6.81   ? 169  GLN A CG  1 
ATOM   1134  C CD  . GLN A 1 149 ? -6.280  36.268  55.747  1.00 6.50   ? 169  GLN A CD  1 
ATOM   1135  O OE1 . GLN A 1 149 ? -6.504  37.468  55.937  1.00 5.96   ? 169  GLN A OE1 1 
ATOM   1136  N NE2 . GLN A 1 149 ? -5.485  35.548  56.539  1.00 4.00   ? 169  GLN A NE2 1 
ATOM   1137  N N   . TYR A 1 150 ? -5.192  32.411  51.915  1.00 13.58  ? 170  TYR A N   1 
ATOM   1138  C CA  . TYR A 1 150 ? -4.401  31.262  51.495  1.00 14.68  ? 170  TYR A CA  1 
ATOM   1139  C C   . TYR A 1 150 ? -2.947  31.687  51.490  1.00 15.75  ? 170  TYR A C   1 
ATOM   1140  O O   . TYR A 1 150 ? -2.649  32.873  51.308  1.00 18.28  ? 170  TYR A O   1 
ATOM   1141  C CB  . TYR A 1 150 ? -4.812  30.820  50.098  1.00 14.41  ? 170  TYR A CB  1 
ATOM   1142  C CG  . TYR A 1 150 ? -4.894  31.968  49.123  1.00 15.48  ? 170  TYR A CG  1 
ATOM   1143  C CD1 . TYR A 1 150 ? -6.011  32.788  49.082  1.00 15.85  ? 170  TYR A CD1 1 
ATOM   1144  C CD2 . TYR A 1 150 ? -3.843  32.248  48.255  1.00 15.62  ? 170  TYR A CD2 1 
ATOM   1145  C CE1 . TYR A 1 150 ? -6.084  33.856  48.201  1.00 14.86  ? 170  TYR A CE1 1 
ATOM   1146  C CE2 . TYR A 1 150 ? -3.905  33.313  47.373  1.00 13.79  ? 170  TYR A CE2 1 
ATOM   1147  C CZ  . TYR A 1 150 ? -5.028  34.112  47.351  1.00 14.29  ? 170  TYR A CZ  1 
ATOM   1148  O OH  . TYR A 1 150 ? -5.097  35.174  46.479  1.00 15.55  ? 170  TYR A OH  1 
ATOM   1149  N N   . ARG A 1 151 ? -2.047  30.730  51.695  1.00 15.22  ? 171  ARG A N   1 
ATOM   1150  C CA  . ARG A 1 151 ? -0.616  31.026  51.720  1.00 13.89  ? 171  ARG A CA  1 
ATOM   1151  C C   . ARG A 1 151 ? -0.178  31.740  50.445  1.00 13.19  ? 171  ARG A C   1 
ATOM   1152  O O   . ARG A 1 151 ? -0.686  31.469  49.364  1.00 13.60  ? 171  ARG A O   1 
ATOM   1153  C CB  . ARG A 1 151 ? 0.188   29.731  51.918  1.00 13.43  ? 171  ARG A CB  1 
ATOM   1154  C CG  . ARG A 1 151 ? 0.175   29.205  53.353  1.00 9.76   ? 171  ARG A CG  1 
ATOM   1155  C CD  . ARG A 1 151 ? 0.820   27.839  53.467  1.00 7.76   ? 171  ARG A CD  1 
ATOM   1156  N NE  . ARG A 1 151 ? -0.120  26.750  53.216  1.00 7.32   ? 171  ARG A NE  1 
ATOM   1157  C CZ  . ARG A 1 151 ? 0.216   25.462  53.175  1.00 6.70   ? 171  ARG A CZ  1 
ATOM   1158  N NH1 . ARG A 1 151 ? 1.473   25.084  53.367  1.00 3.67   ? 171  ARG A NH1 1 
ATOM   1159  N NH2 . ARG A 1 151 ? -0.709  24.544  52.942  1.00 6.10   ? 171  ARG A NH2 1 
ATOM   1160  N N   . LEU A 1 152 ? 0.773   32.654  50.584  1.00 13.54  ? 172  LEU A N   1 
ATOM   1161  C CA  . LEU A 1 152 ? 1.271   33.435  49.459  1.00 12.18  ? 172  LEU A CA  1 
ATOM   1162  C C   . LEU A 1 152 ? 2.786   33.276  49.271  1.00 12.59  ? 172  LEU A C   1 
ATOM   1163  O O   . LEU A 1 152 ? 3.486   32.739  50.137  1.00 12.53  ? 172  LEU A O   1 
ATOM   1164  C CB  . LEU A 1 152 ? 0.936   34.915  49.693  1.00 10.16  ? 172  LEU A CB  1 
ATOM   1165  C CG  . LEU A 1 152 ? -0.522  35.250  50.037  1.00 10.15  ? 172  LEU A CG  1 
ATOM   1166  C CD1 . LEU A 1 152 ? -0.606  36.573  50.784  1.00 9.05   ? 172  LEU A CD1 1 
ATOM   1167  C CD2 . LEU A 1 152 ? -1.345  35.297  48.763  1.00 10.35  ? 172  LEU A CD2 1 
ATOM   1168  N N   . GLY A 1 153 ? 3.278   33.755  48.130  1.00 11.85  ? 173  GLY A N   1 
ATOM   1169  C CA  . GLY A 1 153 ? 4.696   33.700  47.828  1.00 10.99  ? 173  GLY A CA  1 
ATOM   1170  C C   . GLY A 1 153 ? 5.388   32.371  48.060  1.00 11.41  ? 173  GLY A C   1 
ATOM   1171  O O   . GLY A 1 153 ? 4.863   31.308  47.726  1.00 12.30  ? 173  GLY A O   1 
ATOM   1172  N N   . ILE A 1 154 ? 6.589   32.438  48.624  1.00 10.72  ? 174  ILE A N   1 
ATOM   1173  C CA  . ILE A 1 154 ? 7.366   31.247  48.901  1.00 9.92   ? 174  ILE A CA  1 
ATOM   1174  C C   . ILE A 1 154 ? 6.530   30.243  49.682  1.00 10.63  ? 174  ILE A C   1 
ATOM   1175  O O   . ILE A 1 154 ? 6.398   29.085  49.284  1.00 11.71  ? 174  ILE A O   1 
ATOM   1176  C CB  . ILE A 1 154 ? 8.626   31.587  49.714  1.00 8.56   ? 174  ILE A CB  1 
ATOM   1177  C CG1 . ILE A 1 154 ? 9.475   32.598  48.958  1.00 7.56   ? 174  ILE A CG1 1 
ATOM   1178  C CG2 . ILE A 1 154 ? 9.451   30.347  49.948  1.00 7.89   ? 174  ILE A CG2 1 
ATOM   1179  C CD1 . ILE A 1 154 ? 10.796  32.892  49.634  1.00 8.92   ? 174  ILE A CD1 1 
ATOM   1180  N N   . TRP A 1 155 ? 5.958   30.696  50.790  1.00 10.51  ? 175  TRP A N   1 
ATOM   1181  C CA  . TRP A 1 155 ? 5.143   29.837  51.643  1.00 11.91  ? 175  TRP A CA  1 
ATOM   1182  C C   . TRP A 1 155 ? 4.053   29.042  50.939  1.00 12.31  ? 175  TRP A C   1 
ATOM   1183  O O   . TRP A 1 155 ? 3.761   27.910  51.332  1.00 13.88  ? 175  TRP A O   1 
ATOM   1184  C CB  . TRP A 1 155 ? 4.482   30.663  52.739  1.00 12.86  ? 175  TRP A CB  1 
ATOM   1185  C CG  . TRP A 1 155 ? 5.428   31.191  53.754  1.00 13.76  ? 175  TRP A CG  1 
ATOM   1186  C CD1 . TRP A 1 155 ? 5.819   30.581  54.906  1.00 14.18  ? 175  TRP A CD1 1 
ATOM   1187  C CD2 . TRP A 1 155 ? 6.116   32.442  53.705  1.00 15.10  ? 175  TRP A CD2 1 
ATOM   1188  N NE1 . TRP A 1 155 ? 6.711   31.374  55.584  1.00 15.83  ? 175  TRP A NE1 1 
ATOM   1189  C CE2 . TRP A 1 155 ? 6.910   32.524  54.869  1.00 16.43  ? 175  TRP A CE2 1 
ATOM   1190  C CE3 . TRP A 1 155 ? 6.140   33.502  52.790  1.00 15.51  ? 175  TRP A CE3 1 
ATOM   1191  C CZ2 . TRP A 1 155 ? 7.719   33.628  55.141  1.00 16.32  ? 175  TRP A CZ2 1 
ATOM   1192  C CZ3 . TRP A 1 155 ? 6.944   34.597  53.060  1.00 14.99  ? 175  TRP A CZ3 1 
ATOM   1193  C CH2 . TRP A 1 155 ? 7.722   34.651  54.226  1.00 16.62  ? 175  TRP A CH2 1 
ATOM   1194  N N   . GLY A 1 156 ? 3.447   29.624  49.909  1.00 11.71  ? 176  GLY A N   1 
ATOM   1195  C CA  . GLY A 1 156 ? 2.370   28.929  49.233  1.00 10.62  ? 176  GLY A CA  1 
ATOM   1196  C C   . GLY A 1 156 ? 2.600   28.544  47.796  1.00 10.07  ? 176  GLY A C   1 
ATOM   1197  O O   . GLY A 1 156 ? 1.740   27.929  47.171  1.00 10.45  ? 176  GLY A O   1 
ATOM   1198  N N   . PHE A 1 157 ? 3.757   28.878  47.251  1.00 10.07  ? 177  PHE A N   1 
ATOM   1199  C CA  . PHE A 1 157 ? 3.991   28.534  45.862  1.00 9.11   ? 177  PHE A CA  1 
ATOM   1200  C C   . PHE A 1 157 ? 5.383   28.030  45.530  1.00 7.17   ? 177  PHE A C   1 
ATOM   1201  O O   . PHE A 1 157 ? 5.690   27.787  44.365  1.00 8.22   ? 177  PHE A O   1 
ATOM   1202  C CB  . PHE A 1 157 ? 3.601   29.728  44.985  1.00 8.04   ? 177  PHE A CB  1 
ATOM   1203  C CG  . PHE A 1 157 ? 2.146   30.042  45.049  1.00 6.96   ? 177  PHE A CG  1 
ATOM   1204  C CD1 . PHE A 1 157 ? 1.218   29.178  44.486  1.00 8.57   ? 177  PHE A CD1 1 
ATOM   1205  C CD2 . PHE A 1 157 ? 1.687   31.147  45.747  1.00 8.70   ? 177  PHE A CD2 1 
ATOM   1206  C CE1 . PHE A 1 157 ? -0.158  29.406  44.622  1.00 8.51   ? 177  PHE A CE1 1 
ATOM   1207  C CE2 . PHE A 1 157 ? 0.312   31.386  45.889  1.00 8.92   ? 177  PHE A CE2 1 
ATOM   1208  C CZ  . PHE A 1 157 ? -0.609  30.509  45.324  1.00 6.40   ? 177  PHE A CZ  1 
ATOM   1209  N N   . PHE A 1 158 ? 6.219   27.861  46.547  1.00 4.89   ? 178  PHE A N   1 
ATOM   1210  C CA  . PHE A 1 158 ? 7.566   27.356  46.325  1.00 5.24   ? 178  PHE A CA  1 
ATOM   1211  C C   . PHE A 1 158 ? 7.476   25.967  45.704  1.00 4.37   ? 178  PHE A C   1 
ATOM   1212  O O   . PHE A 1 158 ? 6.720   25.124  46.172  1.00 3.03   ? 178  PHE A O   1 
ATOM   1213  C CB  . PHE A 1 158 ? 8.344   27.295  47.651  1.00 5.81   ? 178  PHE A CB  1 
ATOM   1214  C CG  . PHE A 1 158 ? 9.679   26.629  47.532  1.00 5.03   ? 178  PHE A CG  1 
ATOM   1215  C CD1 . PHE A 1 158 ? 9.832   25.293  47.865  1.00 5.35   ? 178  PHE A CD1 1 
ATOM   1216  C CD2 . PHE A 1 158 ? 10.770  27.317  47.007  1.00 4.99   ? 178  PHE A CD2 1 
ATOM   1217  C CE1 . PHE A 1 158 ? 11.057  24.646  47.668  1.00 7.84   ? 178  PHE A CE1 1 
ATOM   1218  C CE2 . PHE A 1 158 ? 11.993  26.682  46.807  1.00 4.70   ? 178  PHE A CE2 1 
ATOM   1219  C CZ  . PHE A 1 158 ? 12.137  25.343  47.136  1.00 4.55   ? 178  PHE A CZ  1 
ATOM   1220  N N   . SER A 1 159 ? 8.242   25.724  44.648  1.00 6.00   ? 179  SER A N   1 
ATOM   1221  C CA  . SER A 1 159 ? 8.197   24.418  43.990  1.00 9.02   ? 179  SER A CA  1 
ATOM   1222  C C   . SER A 1 159 ? 9.545   23.952  43.456  1.00 9.73   ? 179  SER A C   1 
ATOM   1223  O O   . SER A 1 159 ? 10.276  24.727  42.841  1.00 12.25  ? 179  SER A O   1 
ATOM   1224  C CB  . SER A 1 159 ? 7.196   24.444  42.831  1.00 7.14   ? 179  SER A CB  1 
ATOM   1225  O OG  . SER A 1 159 ? 7.236   23.222  42.117  1.00 8.35   ? 179  SER A OG  1 
ATOM   1226  N N   . THR A 1 160 ? 9.863   22.683  43.684  1.00 8.26   ? 180  THR A N   1 
ATOM   1227  C CA  . THR A 1 160 ? 11.117  22.121  43.207  1.00 8.46   ? 180  THR A CA  1 
ATOM   1228  C C   . THR A 1 160 ? 10.857  21.425  41.891  1.00 8.86   ? 180  THR A C   1 
ATOM   1229  O O   . THR A 1 160 ? 11.775  20.897  41.269  1.00 10.55  ? 180  THR A O   1 
ATOM   1230  C CB  . THR A 1 160 ? 11.695  21.068  44.185  1.00 9.34   ? 180  THR A CB  1 
ATOM   1231  O OG1 . THR A 1 160 ? 10.734  20.021  44.385  1.00 7.35   ? 180  THR A OG1 1 
ATOM   1232  C CG2 . THR A 1 160 ? 12.047  21.702  45.521  1.00 7.60   ? 180  THR A CG2 1 
ATOM   1233  N N   . GLY A 1 161 ? 9.597   21.413  41.476  1.00 9.46   ? 181  GLY A N   1 
ATOM   1234  C CA  . GLY A 1 161 ? 9.240   20.751  40.236  1.00 10.31  ? 181  GLY A CA  1 
ATOM   1235  C C   . GLY A 1 161 ? 9.131   19.234  40.359  1.00 10.90  ? 181  GLY A C   1 
ATOM   1236  O O   . GLY A 1 161 ? 8.981   18.532  39.359  1.00 9.92   ? 181  GLY A O   1 
ATOM   1237  N N   . ASP A 1 162 ? 9.212   18.708  41.574  1.00 12.00  ? 182  ASP A N   1 
ATOM   1238  C CA  . ASP A 1 162 ? 9.101   17.267  41.756  1.00 13.74  ? 182  ASP A CA  1 
ATOM   1239  C C   . ASP A 1 162 ? 8.309   16.906  43.017  1.00 14.24  ? 182  ASP A C   1 
ATOM   1240  O O   . ASP A 1 162 ? 7.717   17.771  43.654  1.00 13.92  ? 182  ASP A O   1 
ATOM   1241  C CB  . ASP A 1 162 ? 10.494  16.632  41.782  1.00 15.04  ? 182  ASP A CB  1 
ATOM   1242  C CG  . ASP A 1 162 ? 11.278  17.003  43.009  1.00 17.10  ? 182  ASP A CG  1 
ATOM   1243  O OD1 . ASP A 1 162 ? 12.496  16.749  43.029  1.00 18.99  ? 182  ASP A OD1 1 
ATOM   1244  O OD2 . ASP A 1 162 ? 10.678  17.539  43.960  1.00 20.17  ? 182  ASP A OD2 1 
ATOM   1245  N N   . GLU A 1 163 ? 8.315   15.634  43.391  1.00 15.50  ? 183  GLU A N   1 
ATOM   1246  C CA  . GLU A 1 163 ? 7.541   15.199  44.538  1.00 17.03  ? 183  GLU A CA  1 
ATOM   1247  C C   . GLU A 1 163 ? 8.005   15.693  45.900  1.00 17.31  ? 183  GLU A C   1 
ATOM   1248  O O   . GLU A 1 163 ? 7.236   15.651  46.863  1.00 17.08  ? 183  GLU A O   1 
ATOM   1249  C CB  . GLU A 1 163 ? 7.416   13.665  44.551  1.00 19.39  ? 183  GLU A CB  1 
ATOM   1250  C CG  . GLU A 1 163 ? 8.573   12.891  45.186  1.00 22.54  ? 183  GLU A CG  1 
ATOM   1251  C CD  . GLU A 1 163 ? 9.811   12.801  44.305  1.00 24.01  ? 183  GLU A CD  1 
ATOM   1252  O OE1 . GLU A 1 163 ? 10.722  12.022  44.669  1.00 25.81  ? 183  GLU A OE1 1 
ATOM   1253  O OE2 . GLU A 1 163 ? 9.875   13.495  43.266  1.00 22.01  ? 183  GLU A OE2 1 
ATOM   1254  N N   . HIS A 1 164 ? 9.241   16.168  46.004  1.00 17.13  ? 184  HIS A N   1 
ATOM   1255  C CA  . HIS A 1 164 ? 9.717   16.651  47.303  1.00 18.31  ? 184  HIS A CA  1 
ATOM   1256  C C   . HIS A 1 164 ? 9.085   17.993  47.688  1.00 18.53  ? 184  HIS A C   1 
ATOM   1257  O O   . HIS A 1 164 ? 9.102   18.393  48.858  1.00 18.63  ? 184  HIS A O   1 
ATOM   1258  C CB  . HIS A 1 164 ? 11.245  16.745  47.312  1.00 17.99  ? 184  HIS A CB  1 
ATOM   1259  C CG  . HIS A 1 164 ? 11.928  15.416  47.181  1.00 17.48  ? 184  HIS A CG  1 
ATOM   1260  N ND1 . HIS A 1 164 ? 11.707  14.379  48.063  1.00 15.87  ? 184  HIS A ND1 1 
ATOM   1261  C CD2 . HIS A 1 164 ? 12.803  14.950  46.262  1.00 16.22  ? 184  HIS A CD2 1 
ATOM   1262  C CE1 . HIS A 1 164 ? 12.416  13.331  47.687  1.00 15.86  ? 184  HIS A CE1 1 
ATOM   1263  N NE2 . HIS A 1 164 ? 13.090  13.649  46.598  1.00 14.73  ? 184  HIS A NE2 1 
ATOM   1264  N N   . SER A 1 165 ? 8.511   18.670  46.698  1.00 18.56  ? 185  SER A N   1 
ATOM   1265  C CA  . SER A 1 165 ? 7.838   19.946  46.910  1.00 18.42  ? 185  SER A CA  1 
ATOM   1266  C C   . SER A 1 165 ? 7.058   20.341  45.650  1.00 17.87  ? 185  SER A C   1 
ATOM   1267  O O   . SER A 1 165 ? 7.443   21.264  44.916  1.00 17.27  ? 185  SER A O   1 
ATOM   1268  C CB  . SER A 1 165 ? 8.855   21.030  47.268  1.00 18.87  ? 185  SER A CB  1 
ATOM   1269  O OG  . SER A 1 165 ? 8.197   22.242  47.582  1.00 19.60  ? 185  SER A OG  1 
ATOM   1270  N N   . ARG A 1 166 ? 5.959   19.631  45.408  1.00 16.08  ? 186  ARG A N   1 
ATOM   1271  C CA  . ARG A 1 166 ? 5.123   19.877  44.242  1.00 15.40  ? 186  ARG A CA  1 
ATOM   1272  C C   . ARG A 1 166 ? 4.802   21.340  44.033  1.00 14.69  ? 186  ARG A C   1 
ATOM   1273  O O   . ARG A 1 166 ? 5.135   21.912  42.996  1.00 15.16  ? 186  ARG A O   1 
ATOM   1274  C CB  . ARG A 1 166 ? 3.815   19.108  44.350  1.00 15.77  ? 186  ARG A CB  1 
ATOM   1275  C CG  . ARG A 1 166 ? 3.940   17.625  44.135  1.00 16.31  ? 186  ARG A CG  1 
ATOM   1276  C CD  . ARG A 1 166 ? 2.569   17.033  43.965  1.00 18.77  ? 186  ARG A CD  1 
ATOM   1277  N NE  . ARG A 1 166 ? 2.645   15.722  43.349  1.00 22.50  ? 186  ARG A NE  1 
ATOM   1278  C CZ  . ARG A 1 166 ? 3.122   14.645  43.957  1.00 24.93  ? 186  ARG A CZ  1 
ATOM   1279  N NH1 . ARG A 1 166 ? 3.557   14.734  45.208  1.00 24.12  ? 186  ARG A NH1 1 
ATOM   1280  N NH2 . ARG A 1 166 ? 3.179   13.486  43.307  1.00 25.65  ? 186  ARG A NH2 1 
ATOM   1281  N N   . GLY A 1 167 ? 4.136   21.932  45.019  1.00 14.46  ? 187  GLY A N   1 
ATOM   1282  C CA  . GLY A 1 167 ? 3.765   23.332  44.935  1.00 13.70  ? 187  GLY A CA  1 
ATOM   1283  C C   . GLY A 1 167 ? 2.264   23.546  45.011  1.00 13.17  ? 187  GLY A C   1 
ATOM   1284  O O   . GLY A 1 167 ? 1.505   22.615  45.275  1.00 12.74  ? 187  GLY A O   1 
ATOM   1285  N N   . ASN A 1 168 ? 1.841   24.784  44.788  1.00 12.72  ? 188  ASN A N   1 
ATOM   1286  C CA  . ASN A 1 168 ? 0.431   25.138  44.822  1.00 13.01  ? 188  ASN A CA  1 
ATOM   1287  C C   . ASN A 1 168 ? -0.213  25.022  46.194  1.00 11.35  ? 188  ASN A C   1 
ATOM   1288  O O   . ASN A 1 168 ? -1.432  24.871  46.308  1.00 9.73   ? 188  ASN A O   1 
ATOM   1289  C CB  . ASN A 1 168 ? -0.349  24.280  43.838  1.00 14.23  ? 188  ASN A CB  1 
ATOM   1290  C CG  . ASN A 1 168 ? 0.106   24.476  42.428  1.00 15.60  ? 188  ASN A CG  1 
ATOM   1291  O OD1 . ASN A 1 168 ? 0.447   25.591  42.030  1.00 18.86  ? 188  ASN A OD1 1 
ATOM   1292  N ND2 . ASN A 1 168 ? 0.101   23.400  41.646  1.00 15.04  ? 188  ASN A ND2 1 
ATOM   1293  N N   . TRP A 1 169 ? 0.602   25.095  47.234  1.00 10.52  ? 189  TRP A N   1 
ATOM   1294  C CA  . TRP A 1 169 ? 0.085   25.009  48.586  1.00 11.40  ? 189  TRP A CA  1 
ATOM   1295  C C   . TRP A 1 169 ? -1.100  25.963  48.747  1.00 12.38  ? 189  TRP A C   1 
ATOM   1296  O O   . TRP A 1 169 ? -2.103  25.621  49.385  1.00 13.46  ? 189  TRP A O   1 
ATOM   1297  C CB  . TRP A 1 169 ? 1.195   25.356  49.567  1.00 9.94   ? 189  TRP A CB  1 
ATOM   1298  C CG  . TRP A 1 169 ? 2.469   24.703  49.172  1.00 10.36  ? 189  TRP A CG  1 
ATOM   1299  C CD1 . TRP A 1 169 ? 3.653   25.315  48.901  1.00 10.44  ? 189  TRP A CD1 1 
ATOM   1300  C CD2 . TRP A 1 169 ? 2.678   23.304  48.946  1.00 11.37  ? 189  TRP A CD2 1 
ATOM   1301  N NE1 . TRP A 1 169 ? 4.591   24.389  48.517  1.00 10.45  ? 189  TRP A NE1 1 
ATOM   1302  C CE2 . TRP A 1 169 ? 4.019   23.144  48.536  1.00 11.28  ? 189  TRP A CE2 1 
ATOM   1303  C CE3 . TRP A 1 169 ? 1.860   22.166  49.051  1.00 10.78  ? 189  TRP A CE3 1 
ATOM   1304  C CZ2 . TRP A 1 169 ? 4.567   21.894  48.229  1.00 11.13  ? 189  TRP A CZ2 1 
ATOM   1305  C CZ3 . TRP A 1 169 ? 2.402   20.926  48.749  1.00 9.05   ? 189  TRP A CZ3 1 
ATOM   1306  C CH2 . TRP A 1 169 ? 3.745   20.800  48.342  1.00 10.99  ? 189  TRP A CH2 1 
ATOM   1307  N N   . GLY A 1 170 ? -0.986  27.149  48.147  1.00 12.48  ? 190  GLY A N   1 
ATOM   1308  C CA  . GLY A 1 170 ? -2.046  28.143  48.226  1.00 11.73  ? 190  GLY A CA  1 
ATOM   1309  C C   . GLY A 1 170 ? -3.383  27.683  47.665  1.00 10.61  ? 190  GLY A C   1 
ATOM   1310  O O   . GLY A 1 170 ? -4.426  27.873  48.295  1.00 9.03   ? 190  GLY A O   1 
ATOM   1311  N N   . HIS A 1 171 ? -3.357  27.083  46.478  1.00 10.00  ? 191  HIS A N   1 
ATOM   1312  C CA  . HIS A 1 171 ? -4.577  26.597  45.855  1.00 10.68  ? 191  HIS A CA  1 
ATOM   1313  C C   . HIS A 1 171 ? -5.173  25.497  46.714  1.00 11.14  ? 191  HIS A C   1 
ATOM   1314  O O   . HIS A 1 171 ? -6.393  25.371  46.825  1.00 12.15  ? 191  HIS A O   1 
ATOM   1315  C CB  . HIS A 1 171 ? -4.291  26.071  44.448  1.00 11.85  ? 191  HIS A CB  1 
ATOM   1316  C CG  . HIS A 1 171 ? -3.872  27.136  43.483  1.00 14.66  ? 191  HIS A CG  1 
ATOM   1317  N ND1 . HIS A 1 171 ? -4.499  28.363  43.413  1.00 15.46  ? 191  HIS A ND1 1 
ATOM   1318  C CD2 . HIS A 1 171 ? -2.882  27.166  42.561  1.00 14.77  ? 191  HIS A CD2 1 
ATOM   1319  C CE1 . HIS A 1 171 ? -3.909  29.104  42.492  1.00 15.94  ? 191  HIS A CE1 1 
ATOM   1320  N NE2 . HIS A 1 171 ? -2.925  28.402  41.960  1.00 15.67  ? 191  HIS A NE2 1 
ATOM   1321  N N   . LEU A 1 172 ? -4.303  24.700  47.326  1.00 11.22  ? 192  LEU A N   1 
ATOM   1322  C CA  . LEU A 1 172 ? -4.750  23.625  48.190  1.00 9.17   ? 192  LEU A CA  1 
ATOM   1323  C C   . LEU A 1 172 ? -5.470  24.196  49.399  1.00 9.03   ? 192  LEU A C   1 
ATOM   1324  O O   . LEU A 1 172 ? -6.466  23.624  49.859  1.00 7.67   ? 192  LEU A O   1 
ATOM   1325  C CB  . LEU A 1 172 ? -3.566  22.777  48.630  1.00 6.95   ? 192  LEU A CB  1 
ATOM   1326  C CG  . LEU A 1 172 ? -2.998  21.977  47.461  1.00 6.71   ? 192  LEU A CG  1 
ATOM   1327  C CD1 . LEU A 1 172 ? -1.948  20.991  47.965  1.00 1.66   ? 192  LEU A CD1 1 
ATOM   1328  C CD2 . LEU A 1 172 ? -4.150  21.253  46.748  1.00 3.94   ? 192  LEU A CD2 1 
ATOM   1329  N N   . ASP A 1 173 ? -4.961  25.324  49.902  1.00 8.80   ? 193  ASP A N   1 
ATOM   1330  C CA  . ASP A 1 173 ? -5.567  26.008  51.044  1.00 7.96   ? 193  ASP A CA  1 
ATOM   1331  C C   . ASP A 1 173 ? -6.968  26.467  50.627  1.00 7.17   ? 193  ASP A C   1 
ATOM   1332  O O   . ASP A 1 173 ? -7.936  26.392  51.405  1.00 4.79   ? 193  ASP A O   1 
ATOM   1333  C CB  . ASP A 1 173 ? -4.737  27.232  51.470  1.00 8.50   ? 193  ASP A CB  1 
ATOM   1334  C CG  . ASP A 1 173 ? -3.378  26.861  52.069  1.00 10.07  ? 193  ASP A CG  1 
ATOM   1335  O OD1 . ASP A 1 173 ? -3.235  25.749  52.624  1.00 9.00   ? 193  ASP A OD1 1 
ATOM   1336  O OD2 . ASP A 1 173 ? -2.454  27.704  52.003  1.00 8.66   ? 193  ASP A OD2 1 
ATOM   1337  N N   . GLN A 1 174 ? -7.069  26.945  49.390  1.00 6.75   ? 194  GLN A N   1 
ATOM   1338  C CA  . GLN A 1 174 ? -8.347  27.400  48.873  1.00 5.77   ? 194  GLN A CA  1 
ATOM   1339  C C   . GLN A 1 174 ? -9.271  26.199  48.833  1.00 5.26   ? 194  GLN A C   1 
ATOM   1340  O O   . GLN A 1 174 ? -10.345 26.225  49.422  1.00 5.84   ? 194  GLN A O   1 
ATOM   1341  C CB  . GLN A 1 174 ? -8.161  28.028  47.492  1.00 6.49   ? 194  GLN A CB  1 
ATOM   1342  C CG  . GLN A 1 174 ? -7.243  29.242  47.554  1.00 8.95   ? 194  GLN A CG  1 
ATOM   1343  C CD  . GLN A 1 174 ? -6.874  29.799  46.195  1.00 10.25  ? 194  GLN A CD  1 
ATOM   1344  O OE1 . GLN A 1 174 ? -6.844  29.076  45.195  1.00 10.00  ? 194  GLN A OE1 1 
ATOM   1345  N NE2 . GLN A 1 174 ? -6.561  31.089  46.158  1.00 9.66   ? 194  GLN A NE2 1 
ATOM   1346  N N   . VAL A 1 175 ? -8.854  25.131  48.166  1.00 5.84   ? 195  VAL A N   1 
ATOM   1347  C CA  . VAL A 1 175 ? -9.691  23.939  48.136  1.00 7.28   ? 195  VAL A CA  1 
ATOM   1348  C C   . VAL A 1 175 ? -10.069 23.551  49.575  1.00 7.48   ? 195  VAL A C   1 
ATOM   1349  O O   . VAL A 1 175 ? -11.203 23.165  49.840  1.00 9.04   ? 195  VAL A O   1 
ATOM   1350  C CB  . VAL A 1 175 ? -8.971  22.744  47.446  1.00 5.49   ? 195  VAL A CB  1 
ATOM   1351  C CG1 . VAL A 1 175 ? -9.630  21.434  47.844  1.00 4.63   ? 195  VAL A CG1 1 
ATOM   1352  C CG2 . VAL A 1 175 ? -9.046  22.899  45.941  1.00 1.96   ? 195  VAL A CG2 1 
ATOM   1353  N N   . ALA A 1 176 ? -9.125  23.682  50.502  1.00 7.74   ? 196  ALA A N   1 
ATOM   1354  C CA  . ALA A 1 176 ? -9.371  23.343  51.903  1.00 6.55   ? 196  ALA A CA  1 
ATOM   1355  C C   . ALA A 1 176 ? -10.513 24.133  52.524  1.00 6.48   ? 196  ALA A C   1 
ATOM   1356  O O   . ALA A 1 176 ? -11.322 23.583  53.268  1.00 5.46   ? 196  ALA A O   1 
ATOM   1357  C CB  . ALA A 1 176 ? -8.107  23.555  52.721  1.00 6.86   ? 196  ALA A CB  1 
ATOM   1358  N N   . ALA A 1 177 ? -10.570 25.428  52.235  1.00 7.57   ? 197  ALA A N   1 
ATOM   1359  C CA  . ALA A 1 177 ? -11.623 26.265  52.790  1.00 8.26   ? 197  ALA A CA  1 
ATOM   1360  C C   . ALA A 1 177 ? -12.990 25.926  52.184  1.00 10.52  ? 197  ALA A C   1 
ATOM   1361  O O   . ALA A 1 177 ? -14.028 26.100  52.833  1.00 11.03  ? 197  ALA A O   1 
ATOM   1362  C CB  . ALA A 1 177 ? -11.290 27.720  52.568  1.00 6.14   ? 197  ALA A CB  1 
ATOM   1363  N N   . LEU A 1 178 ? -12.999 25.442  50.945  1.00 11.77  ? 198  LEU A N   1 
ATOM   1364  C CA  . LEU A 1 178 ? -14.257 25.087  50.302  1.00 12.99  ? 198  LEU A CA  1 
ATOM   1365  C C   . LEU A 1 178 ? -14.825 23.851  50.971  1.00 14.46  ? 198  LEU A C   1 
ATOM   1366  O O   . LEU A 1 178 ? -16.052 23.695  51.073  1.00 16.62  ? 198  LEU A O   1 
ATOM   1367  C CB  . LEU A 1 178 ? -14.053 24.837  48.810  1.00 12.75  ? 198  LEU A CB  1 
ATOM   1368  C CG  . LEU A 1 178 ? -13.784 26.127  48.033  1.00 11.90  ? 198  LEU A CG  1 
ATOM   1369  C CD1 . LEU A 1 178 ? -13.419 25.805  46.595  1.00 12.52  ? 198  LEU A CD1 1 
ATOM   1370  C CD2 . LEU A 1 178 ? -15.005 27.020  48.104  1.00 8.71   ? 198  LEU A CD2 1 
ATOM   1371  N N   . ARG A 1 179 ? -13.934 22.970  51.425  1.00 14.13  ? 199  ARG A N   1 
ATOM   1372  C CA  . ARG A 1 179 ? -14.367 21.766  52.120  1.00 14.29  ? 199  ARG A CA  1 
ATOM   1373  C C   . ARG A 1 179 ? -14.857 22.161  53.504  1.00 12.33  ? 199  ARG A C   1 
ATOM   1374  O O   . ARG A 1 179 ? -15.825 21.598  53.998  1.00 14.33  ? 199  ARG A O   1 
ATOM   1375  C CB  . ARG A 1 179 ? -13.235 20.747  52.251  1.00 16.23  ? 199  ARG A CB  1 
ATOM   1376  C CG  . ARG A 1 179 ? -12.971 19.959  50.993  1.00 23.88  ? 199  ARG A CG  1 
ATOM   1377  C CD  . ARG A 1 179 ? -11.928 18.870  51.213  1.00 30.23  ? 199  ARG A CD  1 
ATOM   1378  N NE  . ARG A 1 179 ? -11.425 18.338  49.946  1.00 35.99  ? 199  ARG A NE  1 
ATOM   1379  C CZ  . ARG A 1 179 ? -12.133 17.592  49.097  1.00 38.98  ? 199  ARG A CZ  1 
ATOM   1380  N NH1 . ARG A 1 179 ? -13.395 17.265  49.365  1.00 39.41  ? 199  ARG A NH1 1 
ATOM   1381  N NH2 . ARG A 1 179 ? -11.578 17.182  47.962  1.00 40.74  ? 199  ARG A NH2 1 
ATOM   1382  N N   . TRP A 1 180 ? -14.196 23.122  54.137  1.00 9.17   ? 200  TRP A N   1 
ATOM   1383  C CA  . TRP A 1 180 ? -14.642 23.544  55.446  1.00 7.44   ? 200  TRP A CA  1 
ATOM   1384  C C   . TRP A 1 180 ? -16.068 24.053  55.305  1.00 9.21   ? 200  TRP A C   1 
ATOM   1385  O O   . TRP A 1 180 ? -16.938 23.725  56.118  1.00 10.71  ? 200  TRP A O   1 
ATOM   1386  C CB  . TRP A 1 180 ? -13.775 24.666  55.999  1.00 6.76   ? 200  TRP A CB  1 
ATOM   1387  C CG  . TRP A 1 180 ? -14.174 25.060  57.399  1.00 5.82   ? 200  TRP A CG  1 
ATOM   1388  C CD1 . TRP A 1 180 ? -13.701 24.531  58.567  1.00 5.04   ? 200  TRP A CD1 1 
ATOM   1389  C CD2 . TRP A 1 180 ? -15.183 26.010  57.772  1.00 5.22   ? 200  TRP A CD2 1 
ATOM   1390  N NE1 . TRP A 1 180 ? -14.353 25.086  59.638  1.00 5.37   ? 200  TRP A NE1 1 
ATOM   1391  C CE2 . TRP A 1 180 ? -15.268 25.998  59.180  1.00 4.79   ? 200  TRP A CE2 1 
ATOM   1392  C CE3 . TRP A 1 180 ? -16.026 26.867  57.051  1.00 3.70   ? 200  TRP A CE3 1 
ATOM   1393  C CZ2 . TRP A 1 180 ? -16.158 26.809  59.883  1.00 3.77   ? 200  TRP A CZ2 1 
ATOM   1394  C CZ3 . TRP A 1 180 ? -16.912 27.672  57.750  1.00 2.63   ? 200  TRP A CZ3 1 
ATOM   1395  C CH2 . TRP A 1 180 ? -16.969 27.638  59.153  1.00 3.60   ? 200  TRP A CH2 1 
ATOM   1396  N N   . VAL A 1 181 ? -16.301 24.858  54.270  1.00 9.74   ? 201  VAL A N   1 
ATOM   1397  C CA  . VAL A 1 181 ? -17.628 25.421  54.018  1.00 10.56  ? 201  VAL A CA  1 
ATOM   1398  C C   . VAL A 1 181 ? -18.663 24.323  53.789  1.00 10.78  ? 201  VAL A C   1 
ATOM   1399  O O   . VAL A 1 181 ? -19.763 24.368  54.334  1.00 10.87  ? 201  VAL A O   1 
ATOM   1400  C CB  . VAL A 1 181 ? -17.614 26.381  52.793  1.00 10.83  ? 201  VAL A CB  1 
ATOM   1401  C CG1 . VAL A 1 181 ? -19.042 26.807  52.420  1.00 7.48   ? 201  VAL A CG1 1 
ATOM   1402  C CG2 . VAL A 1 181 ? -16.776 27.603  53.116  1.00 8.63   ? 201  VAL A CG2 1 
ATOM   1403  N N   . GLN A 1 182 ? -18.313 23.336  52.981  1.00 11.68  ? 202  GLN A N   1 
ATOM   1404  C CA  . GLN A 1 182 ? -19.233 22.244  52.720  1.00 13.27  ? 202  GLN A CA  1 
ATOM   1405  C C   . GLN A 1 182 ? -19.664 21.554  54.015  1.00 12.18  ? 202  GLN A C   1 
ATOM   1406  O O   . GLN A 1 182 ? -20.778 21.054  54.117  1.00 13.02  ? 202  GLN A O   1 
ATOM   1407  C CB  . GLN A 1 182 ? -18.579 21.210  51.808  1.00 16.35  ? 202  GLN A CB  1 
ATOM   1408  C CG  . GLN A 1 182 ? -19.486 20.040  51.485  1.00 20.20  ? 202  GLN A CG  1 
ATOM   1409  C CD  . GLN A 1 182 ? -18.775 18.944  50.731  1.00 25.19  ? 202  GLN A CD  1 
ATOM   1410  O OE1 . GLN A 1 182 ? -17.955 18.205  51.296  1.00 28.45  ? 202  GLN A OE1 1 
ATOM   1411  N NE2 . GLN A 1 182 ? -19.071 18.833  49.438  1.00 26.13  ? 202  GLN A NE2 1 
ATOM   1412  N N   . ASP A 1 183 ? -18.782 21.528  55.004  1.00 10.52  ? 203  ASP A N   1 
ATOM   1413  C CA  . ASP A 1 183 ? -19.088 20.861  56.249  1.00 8.75   ? 203  ASP A CA  1 
ATOM   1414  C C   . ASP A 1 183 ? -19.637 21.738  57.349  1.00 8.65   ? 203  ASP A C   1 
ATOM   1415  O O   . ASP A 1 183 ? -20.246 21.230  58.284  1.00 7.31   ? 203  ASP A O   1 
ATOM   1416  C CB  . ASP A 1 183 ? -17.846 20.149  56.770  1.00 12.28  ? 203  ASP A CB  1 
ATOM   1417  C CG  . ASP A 1 183 ? -17.416 19.003  55.884  1.00 16.87  ? 203  ASP A CG  1 
ATOM   1418  O OD1 . ASP A 1 183 ? -18.102 18.743  54.880  1.00 21.50  ? 203  ASP A OD1 1 
ATOM   1419  O OD2 . ASP A 1 183 ? -16.391 18.355  56.184  1.00 21.14  ? 203  ASP A OD2 1 
ATOM   1420  N N   . ASN A 1 184 ? -19.450 23.049  57.242  1.00 9.73   ? 204  ASN A N   1 
ATOM   1421  C CA  . ASN A 1 184 ? -19.898 23.945  58.303  1.00 10.40  ? 204  ASN A CA  1 
ATOM   1422  C C   . ASN A 1 184 ? -20.820 25.109  57.955  1.00 9.90   ? 204  ASN A C   1 
ATOM   1423  O O   . ASN A 1 184 ? -21.548 25.607  58.823  1.00 10.69  ? 204  ASN A O   1 
ATOM   1424  C CB  . ASN A 1 184 ? -18.671 24.517  59.015  1.00 11.26  ? 204  ASN A CB  1 
ATOM   1425  C CG  . ASN A 1 184 ? -17.794 23.443  59.615  1.00 13.93  ? 204  ASN A CG  1 
ATOM   1426  O OD1 . ASN A 1 184 ? -18.130 22.857  60.654  1.00 14.28  ? 204  ASN A OD1 1 
ATOM   1427  N ND2 . ASN A 1 184 ? -16.661 23.168  58.962  1.00 12.80  ? 204  ASN A ND2 1 
ATOM   1428  N N   . ILE A 1 185 ? -20.803 25.552  56.705  1.00 8.47   ? 205  ILE A N   1 
ATOM   1429  C CA  . ILE A 1 185 ? -21.609 26.707  56.335  1.00 8.09   ? 205  ILE A CA  1 
ATOM   1430  C C   . ILE A 1 185 ? -23.108 26.651  56.652  1.00 10.14  ? 205  ILE A C   1 
ATOM   1431  O O   . ILE A 1 185 ? -23.785 27.680  56.605  1.00 11.93  ? 205  ILE A O   1 
ATOM   1432  C CB  . ILE A 1 185 ? -21.414 27.064  54.851  1.00 3.99   ? 205  ILE A CB  1 
ATOM   1433  C CG1 . ILE A 1 185 ? -21.696 28.552  54.650  1.00 2.36   ? 205  ILE A CG1 1 
ATOM   1434  C CG2 . ILE A 1 185 ? -22.320 26.218  53.980  1.00 1.44   ? 205  ILE A CG2 1 
ATOM   1435  C CD1 . ILE A 1 185 ? -20.864 29.459  55.521  1.00 1.44   ? 205  ILE A CD1 1 
ATOM   1436  N N   . ALA A 1 186 ? -23.633 25.477  56.989  1.00 10.35  ? 206  ALA A N   1 
ATOM   1437  C CA  . ALA A 1 186 ? -25.050 25.383  57.301  1.00 10.18  ? 206  ALA A CA  1 
ATOM   1438  C C   . ALA A 1 186 ? -25.313 25.931  58.691  1.00 12.57  ? 206  ALA A C   1 
ATOM   1439  O O   . ALA A 1 186 ? -26.405 26.414  58.967  1.00 13.82  ? 206  ALA A O   1 
ATOM   1440  C CB  . ALA A 1 186 ? -25.514 23.958  57.216  1.00 9.96   ? 206  ALA A CB  1 
ATOM   1441  N N   . SER A 1 187 ? -24.316 25.852  59.568  1.00 14.15  ? 207  SER A N   1 
ATOM   1442  C CA  . SER A 1 187 ? -24.460 26.353  60.935  1.00 14.76  ? 207  SER A CA  1 
ATOM   1443  C C   . SER A 1 187 ? -24.568 27.877  60.939  1.00 15.32  ? 207  SER A C   1 
ATOM   1444  O O   . SER A 1 187 ? -24.945 28.487  61.943  1.00 15.17  ? 207  SER A O   1 
ATOM   1445  C CB  . SER A 1 187 ? -23.260 25.938  61.789  1.00 15.73  ? 207  SER A CB  1 
ATOM   1446  O OG  . SER A 1 187 ? -23.310 24.569  62.129  1.00 18.51  ? 207  SER A OG  1 
ATOM   1447  N N   . PHE A 1 188 ? -24.232 28.488  59.810  1.00 14.79  ? 208  PHE A N   1 
ATOM   1448  C CA  . PHE A 1 188 ? -24.294 29.931  59.695  1.00 13.15  ? 208  PHE A CA  1 
ATOM   1449  C C   . PHE A 1 188 ? -25.426 30.398  58.797  1.00 12.75  ? 208  PHE A C   1 
ATOM   1450  O O   . PHE A 1 188 ? -25.456 31.553  58.391  1.00 14.98  ? 208  PHE A O   1 
ATOM   1451  C CB  . PHE A 1 188 ? -22.972 30.475  59.169  1.00 12.79  ? 208  PHE A CB  1 
ATOM   1452  C CG  . PHE A 1 188 ? -21.806 30.234  60.087  1.00 11.53  ? 208  PHE A CG  1 
ATOM   1453  C CD1 . PHE A 1 188 ? -21.134 29.021  60.073  1.00 10.09  ? 208  PHE A CD1 1 
ATOM   1454  C CD2 . PHE A 1 188 ? -21.367 31.238  60.953  1.00 10.12  ? 208  PHE A CD2 1 
ATOM   1455  C CE1 . PHE A 1 188 ? -20.039 28.812  60.903  1.00 11.31  ? 208  PHE A CE1 1 
ATOM   1456  C CE2 . PHE A 1 188 ? -20.277 31.039  61.785  1.00 8.52   ? 208  PHE A CE2 1 
ATOM   1457  C CZ  . PHE A 1 188 ? -19.609 29.827  61.763  1.00 10.02  ? 208  PHE A CZ  1 
ATOM   1458  N N   . GLY A 1 189 ? -26.350 29.500  58.482  1.00 11.35  ? 209  GLY A N   1 
ATOM   1459  C CA  . GLY A 1 189 ? -27.475 29.868  57.649  1.00 10.22  ? 209  GLY A CA  1 
ATOM   1460  C C   . GLY A 1 189 ? -27.232 29.703  56.168  1.00 11.36  ? 209  GLY A C   1 
ATOM   1461  O O   . GLY A 1 189 ? -28.018 30.176  55.351  1.00 14.32  ? 209  GLY A O   1 
ATOM   1462  N N   . GLY A 1 190 ? -26.151 29.031  55.804  1.00 11.82  ? 210  GLY A N   1 
ATOM   1463  C CA  . GLY A 1 190 ? -25.870 28.843  54.393  1.00 12.36  ? 210  GLY A CA  1 
ATOM   1464  C C   . GLY A 1 190 ? -26.358 27.518  53.841  1.00 12.88  ? 210  GLY A C   1 
ATOM   1465  O O   . GLY A 1 190 ? -26.675 26.597  54.593  1.00 14.43  ? 210  GLY A O   1 
ATOM   1466  N N   . ASN A 1 191 ? -26.423 27.423  52.517  1.00 12.26  ? 211  ASN A N   1 
ATOM   1467  C CA  . ASN A 1 191 ? -26.845 26.196  51.850  1.00 10.02  ? 211  ASN A CA  1 
ATOM   1468  C C   . ASN A 1 191 ? -25.633 25.596  51.146  1.00 7.20   ? 211  ASN A C   1 
ATOM   1469  O O   . ASN A 1 191 ? -25.227 26.062  50.093  1.00 7.48   ? 211  ASN A O   1 
ATOM   1470  C CB  . ASN A 1 191 ? -27.949 26.499  50.835  1.00 11.49  ? 211  ASN A CB  1 
ATOM   1471  C CG  . ASN A 1 191 ? -28.212 25.338  49.895  1.00 13.99  ? 211  ASN A CG  1 
ATOM   1472  O OD1 . ASN A 1 191 ? -27.698 24.234  50.100  1.00 16.71  ? 211  ASN A OD1 1 
ATOM   1473  N ND2 . ASN A 1 191 ? -29.017 25.579  48.858  1.00 12.22  ? 211  ASN A ND2 1 
ATOM   1474  N N   . PRO A 1 192 ? -25.034 24.553  51.726  1.00 5.87   ? 212  PRO A N   1 
ATOM   1475  C CA  . PRO A 1 192 ? -23.860 23.940  51.093  1.00 6.40   ? 212  PRO A CA  1 
ATOM   1476  C C   . PRO A 1 192 ? -24.110 23.461  49.672  1.00 7.30   ? 212  PRO A C   1 
ATOM   1477  O O   . PRO A 1 192 ? -23.165 23.222  48.918  1.00 7.29   ? 212  PRO A O   1 
ATOM   1478  C CB  . PRO A 1 192 ? -23.518 22.792  52.034  1.00 3.76   ? 212  PRO A CB  1 
ATOM   1479  C CG  . PRO A 1 192 ? -24.853 22.448  52.631  1.00 4.61   ? 212  PRO A CG  1 
ATOM   1480  C CD  . PRO A 1 192 ? -25.442 23.798  52.918  1.00 4.36   ? 212  PRO A CD  1 
ATOM   1481  N N   . GLY A 1 193 ? -25.382 23.330  49.312  1.00 7.44   ? 213  GLY A N   1 
ATOM   1482  C CA  . GLY A 1 193 ? -25.725 22.868  47.983  1.00 8.83   ? 213  GLY A CA  1 
ATOM   1483  C C   . GLY A 1 193 ? -25.663 23.954  46.935  1.00 10.65  ? 213  GLY A C   1 
ATOM   1484  O O   . GLY A 1 193 ? -25.837 23.682  45.748  1.00 11.34  ? 213  GLY A O   1 
ATOM   1485  N N   . SER A 1 194 ? -25.408 25.185  47.367  1.00 12.42  ? 214  SER A N   1 
ATOM   1486  C CA  . SER A 1 194 ? -25.323 26.313  46.448  1.00 14.58  ? 214  SER A CA  1 
ATOM   1487  C C   . SER A 1 194 ? -24.183 27.285  46.806  1.00 14.93  ? 214  SER A C   1 
ATOM   1488  O O   . SER A 1 194 ? -24.423 28.417  47.249  1.00 14.94  ? 214  SER A O   1 
ATOM   1489  C CB  . SER A 1 194 ? -26.665 27.056  46.424  1.00 16.50  ? 214  SER A CB  1 
ATOM   1490  O OG  . SER A 1 194 ? -26.722 28.020  45.380  1.00 20.82  ? 214  SER A OG  1 
ATOM   1491  N N   . VAL A 1 195 ? -22.943 26.844  46.603  1.00 13.70  ? 215  VAL A N   1 
ATOM   1492  C CA  . VAL A 1 195 ? -21.792 27.688  46.896  1.00 13.08  ? 215  VAL A CA  1 
ATOM   1493  C C   . VAL A 1 195 ? -21.181 28.277  45.631  1.00 12.64  ? 215  VAL A C   1 
ATOM   1494  O O   . VAL A 1 195 ? -20.809 27.553  44.714  1.00 13.03  ? 215  VAL A O   1 
ATOM   1495  C CB  . VAL A 1 195 ? -20.709 26.916  47.669  1.00 12.68  ? 215  VAL A CB  1 
ATOM   1496  C CG1 . VAL A 1 195 ? -19.386 27.680  47.640  1.00 9.59   ? 215  VAL A CG1 1 
ATOM   1497  C CG2 . VAL A 1 195 ? -21.164 26.722  49.105  1.00 12.71  ? 215  VAL A CG2 1 
ATOM   1498  N N   . THR A 1 196 ? -21.088 29.602  45.603  1.00 11.45  ? 216  THR A N   1 
ATOM   1499  C CA  . THR A 1 196 ? -20.534 30.334  44.474  1.00 9.72   ? 216  THR A CA  1 
ATOM   1500  C C   . THR A 1 196 ? -19.160 30.866  44.858  1.00 9.50   ? 216  THR A C   1 
ATOM   1501  O O   . THR A 1 196 ? -19.021 31.497  45.910  1.00 10.81  ? 216  THR A O   1 
ATOM   1502  C CB  . THR A 1 196 ? -21.432 31.543  44.126  1.00 9.93   ? 216  THR A CB  1 
ATOM   1503  O OG1 . THR A 1 196 ? -22.763 31.092  43.849  1.00 7.33   ? 216  THR A OG1 1 
ATOM   1504  C CG2 . THR A 1 196 ? -20.880 32.297  42.927  1.00 8.41   ? 216  THR A CG2 1 
ATOM   1505  N N   . ILE A 1 197 ? -18.144 30.609  44.034  1.00 8.60   ? 217  ILE A N   1 
ATOM   1506  C CA  . ILE A 1 197 ? -16.800 31.118  44.326  1.00 9.27   ? 217  ILE A CA  1 
ATOM   1507  C C   . ILE A 1 197 ? -16.489 32.246  43.364  1.00 10.32  ? 217  ILE A C   1 
ATOM   1508  O O   . ILE A 1 197 ? -16.739 32.135  42.165  1.00 11.79  ? 217  ILE A O   1 
ATOM   1509  C CB  . ILE A 1 197 ? -15.676 30.057  44.163  1.00 7.98   ? 217  ILE A CB  1 
ATOM   1510  C CG1 . ILE A 1 197 ? -15.663 29.505  42.732  1.00 9.70   ? 217  ILE A CG1 1 
ATOM   1511  C CG2 . ILE A 1 197 ? -15.848 28.952  45.188  1.00 8.84   ? 217  ILE A CG2 1 
ATOM   1512  C CD1 . ILE A 1 197 ? -14.391 28.729  42.363  1.00 6.65   ? 217  ILE A CD1 1 
ATOM   1513  N N   . PHE A 1 198 ? -15.968 33.346  43.890  1.00 11.32  ? 218  PHE A N   1 
ATOM   1514  C CA  . PHE A 1 198 ? -15.611 34.464  43.041  1.00 11.16  ? 218  PHE A CA  1 
ATOM   1515  C C   . PHE A 1 198 ? -14.377 35.182  43.574  1.00 12.12  ? 218  PHE A C   1 
ATOM   1516  O O   . PHE A 1 198 ? -14.095 35.165  44.776  1.00 11.97  ? 218  PHE A O   1 
ATOM   1517  C CB  . PHE A 1 198 ? -16.797 35.420  42.877  1.00 9.23   ? 218  PHE A CB  1 
ATOM   1518  C CG  . PHE A 1 198 ? -17.198 36.142  44.131  1.00 10.57  ? 218  PHE A CG  1 
ATOM   1519  C CD1 . PHE A 1 198 ? -17.393 35.457  45.323  1.00 10.24  ? 218  PHE A CD1 1 
ATOM   1520  C CD2 . PHE A 1 198 ? -17.460 37.514  44.097  1.00 10.98  ? 218  PHE A CD2 1 
ATOM   1521  C CE1 . PHE A 1 198 ? -17.851 36.128  46.462  1.00 10.89  ? 218  PHE A CE1 1 
ATOM   1522  C CE2 . PHE A 1 198 ? -17.916 38.189  45.227  1.00 9.86   ? 218  PHE A CE2 1 
ATOM   1523  C CZ  . PHE A 1 198 ? -18.113 37.493  46.411  1.00 10.34  ? 218  PHE A CZ  1 
ATOM   1524  N N   . GLY A 1 199 ? -13.621 35.778  42.659  1.00 12.54  ? 219  GLY A N   1 
ATOM   1525  C CA  . GLY A 1 199 ? -12.415 36.478  43.044  1.00 13.12  ? 219  GLY A CA  1 
ATOM   1526  C C   . GLY A 1 199 ? -11.958 37.401  41.942  1.00 12.59  ? 219  GLY A C   1 
ATOM   1527  O O   . GLY A 1 199 ? -12.370 37.252  40.798  1.00 12.49  ? 219  GLY A O   1 
ATOM   1528  N N   . GLU A 1 200 ? -11.091 38.343  42.292  1.00 13.77  ? 220  GLU A N   1 
ATOM   1529  C CA  . GLU A 1 200 ? -10.576 39.327  41.353  1.00 15.36  ? 220  GLU A CA  1 
ATOM   1530  C C   . GLU A 1 200 ? -9.056  39.220  41.194  1.00 16.16  ? 220  GLU A C   1 
ATOM   1531  O O   . GLU A 1 200 ? -8.331  38.962  42.155  1.00 16.31  ? 220  GLU A O   1 
ATOM   1532  C CB  . GLU A 1 200 ? -10.968 40.728  41.858  1.00 16.17  ? 220  GLU A CB  1 
ATOM   1533  C CG  . GLU A 1 200 ? -10.701 41.916  40.925  1.00 18.63  ? 220  GLU A CG  1 
ATOM   1534  C CD  . GLU A 1 200 ? -9.276  42.454  41.009  1.00 20.50  ? 220  GLU A CD  1 
ATOM   1535  O OE1 . GLU A 1 200 ? -8.628  42.297  42.068  1.00 20.92  ? 220  GLU A OE1 1 
ATOM   1536  O OE2 . GLU A 1 200 ? -8.810  43.052  40.014  1.00 22.41  ? 220  GLU A OE2 1 
ATOM   1537  N N   . SER A 1 201 ? -8.582  39.414  39.968  1.00 17.31  ? 221  SER A N   1 
ATOM   1538  C CA  . SER A 1 201 ? -7.153  39.376  39.676  1.00 16.21  ? 221  SER A CA  1 
ATOM   1539  C C   . SER A 1 201 ? -6.570  38.001  39.949  1.00 15.14  ? 221  SER A C   1 
ATOM   1540  O O   . SER A 1 201 ? -7.021  37.007  39.377  1.00 14.58  ? 221  SER A O   1 
ATOM   1541  C CB  . SER A 1 201 ? -6.434  40.427  40.518  1.00 16.37  ? 221  SER A CB  1 
ATOM   1542  O OG  . SER A 1 201 ? -5.060  40.456  40.211  1.00 19.41  ? 221  SER A OG  1 
ATOM   1543  N N   . ALA A 1 202 ? -5.560  37.944  40.815  1.00 14.97  ? 222  ALA A N   1 
ATOM   1544  C CA  . ALA A 1 202 ? -4.941  36.671  41.167  1.00 13.35  ? 222  ALA A CA  1 
ATOM   1545  C C   . ALA A 1 202 ? -6.046  35.758  41.693  1.00 12.85  ? 222  ALA A C   1 
ATOM   1546  O O   . ALA A 1 202 ? -6.008  34.548  41.491  1.00 12.39  ? 222  ALA A O   1 
ATOM   1547  C CB  . ALA A 1 202 ? -3.880  36.879  42.229  1.00 12.58  ? 222  ALA A CB  1 
ATOM   1548  N N   . GLY A 1 203 ? -7.036  36.362  42.354  1.00 12.12  ? 223  GLY A N   1 
ATOM   1549  C CA  . GLY A 1 203 ? -8.160  35.618  42.896  1.00 10.76  ? 223  GLY A CA  1 
ATOM   1550  C C   . GLY A 1 203 ? -9.039  35.096  41.781  1.00 10.60  ? 223  GLY A C   1 
ATOM   1551  O O   . GLY A 1 203 ? -9.625  34.021  41.885  1.00 9.59   ? 223  GLY A O   1 
ATOM   1552  N N   . GLY A 1 204 ? -9.144  35.874  40.711  1.00 12.14  ? 224  GLY A N   1 
ATOM   1553  C CA  . GLY A 1 204 ? -9.931  35.442  39.574  1.00 13.17  ? 224  GLY A CA  1 
ATOM   1554  C C   . GLY A 1 204 ? -9.164  34.312  38.917  1.00 14.15  ? 224  GLY A C   1 
ATOM   1555  O O   . GLY A 1 204 ? -9.757  33.367  38.388  1.00 15.26  ? 224  GLY A O   1 
ATOM   1556  N N   . GLU A 1 205 ? -7.836  34.418  38.962  1.00 13.78  ? 225  GLU A N   1 
ATOM   1557  C CA  . GLU A 1 205 ? -6.937  33.412  38.402  1.00 14.86  ? 225  GLU A CA  1 
ATOM   1558  C C   . GLU A 1 205 ? -7.143  32.127  39.198  1.00 14.24  ? 225  GLU A C   1 
ATOM   1559  O O   . GLU A 1 205 ? -7.162  31.026  38.646  1.00 14.24  ? 225  GLU A O   1 
ATOM   1560  C CB  . GLU A 1 205 ? -5.482  33.889  38.531  1.00 17.02  ? 225  GLU A CB  1 
ATOM   1561  C CG  . GLU A 1 205 ? -4.416  33.056  37.802  1.00 19.73  ? 225  GLU A CG  1 
ATOM   1562  C CD  . GLU A 1 205 ? -3.780  31.978  38.678  1.00 22.68  ? 225  GLU A CD  1 
ATOM   1563  O OE1 . GLU A 1 205 ? -3.501  32.250  39.866  1.00 23.66  ? 225  GLU A OE1 1 
ATOM   1564  O OE2 . GLU A 1 205 ? -3.538  30.860  38.172  1.00 23.97  ? 225  GLU A OE2 1 
ATOM   1565  N N   . SER A 1 206 ? -7.307  32.285  40.504  1.00 13.19  ? 226  SER A N   1 
ATOM   1566  C CA  . SER A 1 206 ? -7.523  31.150  41.380  1.00 13.64  ? 226  SER A CA  1 
ATOM   1567  C C   . SER A 1 206 ? -8.847  30.461  41.054  1.00 13.95  ? 226  SER A C   1 
ATOM   1568  O O   . SER A 1 206 ? -8.918  29.226  40.981  1.00 13.78  ? 226  SER A O   1 
ATOM   1569  C CB  . SER A 1 206 ? -7.513  31.603  42.844  1.00 12.69  ? 226  SER A CB  1 
ATOM   1570  O OG  . SER A 1 206 ? -6.199  31.933  43.257  1.00 11.42  ? 226  SER A OG  1 
ATOM   1571  N N   . VAL A 1 207 ? -9.898  31.254  40.862  1.00 12.28  ? 227  VAL A N   1 
ATOM   1572  C CA  . VAL A 1 207 ? -11.195 30.685  40.541  1.00 11.03  ? 227  VAL A CA  1 
ATOM   1573  C C   . VAL A 1 207 ? -11.071 29.876  39.249  1.00 11.30  ? 227  VAL A C   1 
ATOM   1574  O O   . VAL A 1 207 ? -11.560 28.745  39.149  1.00 10.01  ? 227  VAL A O   1 
ATOM   1575  C CB  . VAL A 1 207 ? -12.253 31.788  40.389  1.00 9.43   ? 227  VAL A CB  1 
ATOM   1576  C CG1 . VAL A 1 207 ? -13.477 31.249  39.684  1.00 10.47  ? 227  VAL A CG1 1 
ATOM   1577  C CG2 . VAL A 1 207 ? -12.645 32.306  41.756  1.00 7.60   ? 227  VAL A CG2 1 
ATOM   1578  N N   . SER A 1 208 ? -10.385 30.448  38.272  1.00 12.13  ? 228  SER A N   1 
ATOM   1579  C CA  . SER A 1 208 ? -10.189 29.775  36.999  1.00 13.48  ? 228  SER A CA  1 
ATOM   1580  C C   . SER A 1 208 ? -9.519  28.404  37.181  1.00 13.85  ? 228  SER A C   1 
ATOM   1581  O O   . SER A 1 208 ? -9.984  27.386  36.637  1.00 13.02  ? 228  SER A O   1 
ATOM   1582  C CB  . SER A 1 208 ? -9.341  30.654  36.086  1.00 13.62  ? 228  SER A CB  1 
ATOM   1583  O OG  . SER A 1 208 ? -9.302  30.110  34.781  1.00 18.90  ? 228  SER A OG  1 
ATOM   1584  N N   . VAL A 1 209 ? -8.425  28.391  37.947  1.00 13.77  ? 229  VAL A N   1 
ATOM   1585  C CA  . VAL A 1 209 ? -7.669  27.168  38.220  1.00 11.08  ? 229  VAL A CA  1 
ATOM   1586  C C   . VAL A 1 209 ? -8.553  26.137  38.900  1.00 10.01  ? 229  VAL A C   1 
ATOM   1587  O O   . VAL A 1 209 ? -8.540  24.974  38.531  1.00 9.19   ? 229  VAL A O   1 
ATOM   1588  C CB  . VAL A 1 209 ? -6.442  27.442  39.128  1.00 10.49  ? 229  VAL A CB  1 
ATOM   1589  C CG1 . VAL A 1 209 ? -5.693  26.150  39.394  1.00 10.08  ? 229  VAL A CG1 1 
ATOM   1590  C CG2 . VAL A 1 209 ? -5.519  28.447  38.479  1.00 8.59   ? 229  VAL A CG2 1 
ATOM   1591  N N   . LEU A 1 210 ? -9.320  26.568  39.896  1.00 10.43  ? 230  LEU A N   1 
ATOM   1592  C CA  . LEU A 1 210 ? -10.213 25.660  40.605  1.00 11.35  ? 230  LEU A CA  1 
ATOM   1593  C C   . LEU A 1 210 ? -11.262 25.069  39.665  1.00 12.70  ? 230  LEU A C   1 
ATOM   1594  O O   . LEU A 1 210 ? -11.697 23.928  39.841  1.00 12.53  ? 230  LEU A O   1 
ATOM   1595  C CB  . LEU A 1 210 ? -10.923 26.377  41.753  1.00 9.78   ? 230  LEU A CB  1 
ATOM   1596  C CG  . LEU A 1 210 ? -10.136 26.753  43.004  1.00 7.73   ? 230  LEU A CG  1 
ATOM   1597  C CD1 . LEU A 1 210 ? -11.081 27.429  43.976  1.00 9.51   ? 230  LEU A CD1 1 
ATOM   1598  C CD2 . LEU A 1 210 ? -9.516  25.526  43.640  1.00 4.44   ? 230  LEU A CD2 1 
ATOM   1599  N N   . VAL A 1 211 ? -11.679 25.841  38.670  1.00 13.76  ? 231  VAL A N   1 
ATOM   1600  C CA  . VAL A 1 211 ? -12.669 25.335  37.738  1.00 15.05  ? 231  VAL A CA  1 
ATOM   1601  C C   . VAL A 1 211 ? -12.077 24.225  36.889  1.00 15.32  ? 231  VAL A C   1 
ATOM   1602  O O   . VAL A 1 211 ? -12.805 23.425  36.309  1.00 16.35  ? 231  VAL A O   1 
ATOM   1603  C CB  . VAL A 1 211 ? -13.188 26.427  36.806  1.00 15.17  ? 231  VAL A CB  1 
ATOM   1604  C CG1 . VAL A 1 211 ? -14.270 25.855  35.917  1.00 16.15  ? 231  VAL A CG1 1 
ATOM   1605  C CG2 . VAL A 1 211 ? -13.739 27.584  37.616  1.00 17.19  ? 231  VAL A CG2 1 
ATOM   1606  N N   . LEU A 1 212 ? -10.754 24.174  36.817  1.00 16.07  ? 232  LEU A N   1 
ATOM   1607  C CA  . LEU A 1 212 ? -10.082 23.149  36.029  1.00 17.22  ? 232  LEU A CA  1 
ATOM   1608  C C   . LEU A 1 212 ? -9.496  22.017  36.869  1.00 17.55  ? 232  LEU A C   1 
ATOM   1609  O O   . LEU A 1 212 ? -8.936  21.072  36.318  1.00 19.22  ? 232  LEU A O   1 
ATOM   1610  C CB  . LEU A 1 212 ? -8.954  23.766  35.205  1.00 17.43  ? 232  LEU A CB  1 
ATOM   1611  C CG  . LEU A 1 212 ? -9.309  24.800  34.139  1.00 18.46  ? 232  LEU A CG  1 
ATOM   1612  C CD1 . LEU A 1 212 ? -8.035  25.351  33.535  1.00 20.06  ? 232  LEU A CD1 1 
ATOM   1613  C CD2 . LEU A 1 212 ? -10.150 24.161  33.065  1.00 19.50  ? 232  LEU A CD2 1 
ATOM   1614  N N   . SER A 1 213 ? -9.627  22.094  38.192  1.00 16.66  ? 233  SER A N   1 
ATOM   1615  C CA  . SER A 1 213 ? -9.058  21.062  39.055  1.00 15.17  ? 233  SER A CA  1 
ATOM   1616  C C   . SER A 1 213 ? -10.041 20.038  39.616  1.00 14.47  ? 233  SER A C   1 
ATOM   1617  O O   . SER A 1 213 ? -11.097 20.393  40.132  1.00 14.13  ? 233  SER A O   1 
ATOM   1618  C CB  . SER A 1 213 ? -8.304  21.716  40.216  1.00 15.19  ? 233  SER A CB  1 
ATOM   1619  O OG  . SER A 1 213 ? -7.660  20.744  41.028  1.00 16.64  ? 233  SER A OG  1 
ATOM   1620  N N   . PRO A 1 214 ? -9.689  18.744  39.529  1.00 13.82  ? 234  PRO A N   1 
ATOM   1621  C CA  . PRO A 1 214 ? -10.496 17.623  40.017  1.00 14.57  ? 234  PRO A CA  1 
ATOM   1622  C C   . PRO A 1 214 ? -10.663 17.732  41.524  1.00 15.93  ? 234  PRO A C   1 
ATOM   1623  O O   . PRO A 1 214 ? -11.623 17.228  42.099  1.00 17.13  ? 234  PRO A O   1 
ATOM   1624  C CB  . PRO A 1 214 ? -9.650  16.407  39.668  1.00 12.49  ? 234  PRO A CB  1 
ATOM   1625  C CG  . PRO A 1 214 ? -8.870  16.854  38.511  1.00 14.49  ? 234  PRO A CG  1 
ATOM   1626  C CD  . PRO A 1 214 ? -8.474  18.247  38.873  1.00 13.51  ? 234  PRO A CD  1 
ATOM   1627  N N   . LEU A 1 215 ? -9.701  18.390  42.158  1.00 16.76  ? 235  LEU A N   1 
ATOM   1628  C CA  . LEU A 1 215 ? -9.708  18.545  43.596  1.00 16.68  ? 235  LEU A CA  1 
ATOM   1629  C C   . LEU A 1 215 ? -10.836 19.432  44.081  1.00 18.83  ? 235  LEU A C   1 
ATOM   1630  O O   . LEU A 1 215 ? -11.317 19.264  45.198  1.00 21.92  ? 235  LEU A O   1 
ATOM   1631  C CB  . LEU A 1 215 ? -8.368  19.107  44.065  1.00 13.70  ? 235  LEU A CB  1 
ATOM   1632  C CG  . LEU A 1 215 ? -7.147  18.221  43.816  1.00 12.41  ? 235  LEU A CG  1 
ATOM   1633  C CD1 . LEU A 1 215 ? -5.872  18.974  44.194  1.00 11.47  ? 235  LEU A CD1 1 
ATOM   1634  C CD2 . LEU A 1 215 ? -7.283  16.934  44.618  1.00 7.62   ? 235  LEU A CD2 1 
ATOM   1635  N N   . ALA A 1 216 ? -11.264 20.376  43.251  1.00 19.36  ? 236  ALA A N   1 
ATOM   1636  C CA  . ALA A 1 216 ? -12.334 21.277  43.650  1.00 19.84  ? 236  ALA A CA  1 
ATOM   1637  C C   . ALA A 1 216 ? -13.703 20.779  43.192  1.00 20.76  ? 236  ALA A C   1 
ATOM   1638  O O   . ALA A 1 216 ? -14.735 21.338  43.560  1.00 19.20  ? 236  ALA A O   1 
ATOM   1639  C CB  . ALA A 1 216 ? -12.064 22.660  43.099  1.00 21.15  ? 236  ALA A CB  1 
ATOM   1640  N N   . LYS A 1 217 ? -13.696 19.721  42.388  1.00 23.47  ? 237  LYS A N   1 
ATOM   1641  C CA  . LYS A 1 217 ? -14.916 19.113  41.864  1.00 26.19  ? 237  LYS A CA  1 
ATOM   1642  C C   . LYS A 1 217 ? -15.907 18.849  42.989  1.00 26.45  ? 237  LYS A C   1 
ATOM   1643  O O   . LYS A 1 217 ? -15.571 18.199  43.978  1.00 28.69  ? 237  LYS A O   1 
ATOM   1644  C CB  . LYS A 1 217 ? -14.564 17.798  41.166  1.00 29.02  ? 237  LYS A CB  1 
ATOM   1645  C CG  . LYS A 1 217 ? -15.725 17.079  40.514  1.00 36.31  ? 237  LYS A CG  1 
ATOM   1646  C CD  . LYS A 1 217 ? -15.240 15.839  39.748  1.00 42.17  ? 237  LYS A CD  1 
ATOM   1647  C CE  . LYS A 1 217 ? -16.389 15.133  39.000  1.00 45.68  ? 237  LYS A CE  1 
ATOM   1648  N NZ  . LYS A 1 217 ? -15.955 13.875  38.303  1.00 45.38  ? 237  LYS A NZ  1 
ATOM   1649  N N   . ASN A 1 218 ? -17.123 19.362  42.841  1.00 26.55  ? 238  ASN A N   1 
ATOM   1650  C CA  . ASN A 1 218 ? -18.179 19.185  43.841  1.00 27.27  ? 238  ASN A CA  1 
ATOM   1651  C C   . ASN A 1 218 ? -18.021 19.985  45.130  1.00 25.20  ? 238  ASN A C   1 
ATOM   1652  O O   . ASN A 1 218 ? -18.546 19.601  46.168  1.00 25.75  ? 238  ASN A O   1 
ATOM   1653  C CB  . ASN A 1 218 ? -18.344 17.705  44.197  1.00 30.51  ? 238  ASN A CB  1 
ATOM   1654  C CG  . ASN A 1 218 ? -18.810 16.877  43.020  1.00 34.90  ? 238  ASN A CG  1 
ATOM   1655  O OD1 . ASN A 1 218 ? -19.800 17.217  42.359  1.00 36.94  ? 238  ASN A OD1 1 
ATOM   1656  N ND2 . ASN A 1 218 ? -18.102 15.781  42.748  1.00 35.76  ? 238  ASN A ND2 1 
ATOM   1657  N N   . LEU A 1 219 ? -17.303 21.096  45.070  1.00 23.16  ? 239  LEU A N   1 
ATOM   1658  C CA  . LEU A 1 219 ? -17.130 21.919  46.251  1.00 20.41  ? 239  LEU A CA  1 
ATOM   1659  C C   . LEU A 1 219 ? -17.772 23.275  46.014  1.00 19.79  ? 239  LEU A C   1 
ATOM   1660  O O   . LEU A 1 219 ? -17.981 24.047  46.954  1.00 20.08  ? 239  LEU A O   1 
ATOM   1661  C CB  . LEU A 1 219 ? -15.648 22.064  46.590  1.00 19.77  ? 239  LEU A CB  1 
ATOM   1662  C CG  . LEU A 1 219 ? -14.996 20.799  47.155  1.00 18.19  ? 239  LEU A CG  1 
ATOM   1663  C CD1 . LEU A 1 219 ? -13.510 21.038  47.357  1.00 18.16  ? 239  LEU A CD1 1 
ATOM   1664  C CD2 . LEU A 1 219 ? -15.655 20.422  48.473  1.00 17.52  ? 239  LEU A CD2 1 
ATOM   1665  N N   . PHE A 1 220 ? -18.073 23.560  44.747  1.00 18.78  ? 240  PHE A N   1 
ATOM   1666  C CA  . PHE A 1 220 ? -18.734 24.803  44.361  1.00 17.29  ? 240  PHE A CA  1 
ATOM   1667  C C   . PHE A 1 220 ? -19.707 24.505  43.236  1.00 17.08  ? 240  PHE A C   1 
ATOM   1668  O O   . PHE A 1 220 ? -19.610 23.467  42.571  1.00 17.14  ? 240  PHE A O   1 
ATOM   1669  C CB  . PHE A 1 220 ? -17.739 25.884  43.925  1.00 17.05  ? 240  PHE A CB  1 
ATOM   1670  C CG  . PHE A 1 220 ? -16.996 25.566  42.670  1.00 16.93  ? 240  PHE A CG  1 
ATOM   1671  C CD1 . PHE A 1 220 ? -15.859 24.765  42.701  1.00 17.63  ? 240  PHE A CD1 1 
ATOM   1672  C CD2 . PHE A 1 220 ? -17.426 26.075  41.453  1.00 16.19  ? 240  PHE A CD2 1 
ATOM   1673  C CE1 . PHE A 1 220 ? -15.161 24.477  41.530  1.00 19.04  ? 240  PHE A CE1 1 
ATOM   1674  C CE2 . PHE A 1 220 ? -16.736 25.793  40.279  1.00 17.43  ? 240  PHE A CE2 1 
ATOM   1675  C CZ  . PHE A 1 220 ? -15.601 24.993  40.314  1.00 17.52  ? 240  PHE A CZ  1 
ATOM   1676  N N   . HIS A 1 221 ? -20.638 25.427  43.019  1.00 16.60  ? 241  HIS A N   1 
ATOM   1677  C CA  . HIS A 1 221 ? -21.674 25.240  42.018  1.00 15.34  ? 241  HIS A CA  1 
ATOM   1678  C C   . HIS A 1 221 ? -21.809 26.380  41.023  1.00 15.79  ? 241  HIS A C   1 
ATOM   1679  O O   . HIS A 1 221 ? -22.693 26.348  40.163  1.00 16.89  ? 241  HIS A O   1 
ATOM   1680  C CB  . HIS A 1 221 ? -23.002 25.032  42.730  1.00 15.32  ? 241  HIS A CB  1 
ATOM   1681  C CG  . HIS A 1 221 ? -22.931 24.042  43.851  1.00 14.65  ? 241  HIS A CG  1 
ATOM   1682  N ND1 . HIS A 1 221 ? -22.879 22.681  43.639  1.00 13.97  ? 241  HIS A ND1 1 
ATOM   1683  C CD2 . HIS A 1 221 ? -22.881 24.217  45.190  1.00 14.70  ? 241  HIS A CD2 1 
ATOM   1684  C CE1 . HIS A 1 221 ? -22.806 22.061  44.801  1.00 15.18  ? 241  HIS A CE1 1 
ATOM   1685  N NE2 . HIS A 1 221 ? -22.805 22.969  45.759  1.00 16.03  ? 241  HIS A NE2 1 
ATOM   1686  N N   . ARG A 1 222 ? -20.949 27.385  41.150  1.00 14.57  ? 242  ARG A N   1 
ATOM   1687  C CA  . ARG A 1 222 ? -20.957 28.534  40.256  1.00 14.45  ? 242  ARG A CA  1 
ATOM   1688  C C   . ARG A 1 222 ? -19.616 29.198  40.426  1.00 14.90  ? 242  ARG A C   1 
ATOM   1689  O O   . ARG A 1 222 ? -18.942 28.966  41.423  1.00 16.90  ? 242  ARG A O   1 
ATOM   1690  C CB  . ARG A 1 222 ? -22.059 29.512  40.638  1.00 15.56  ? 242  ARG A CB  1 
ATOM   1691  C CG  . ARG A 1 222 ? -23.418 28.876  40.675  1.00 15.73  ? 242  ARG A CG  1 
ATOM   1692  C CD  . ARG A 1 222 ? -24.424 29.749  41.348  1.00 16.80  ? 242  ARG A CD  1 
ATOM   1693  N NE  . ARG A 1 222 ? -25.548 28.967  41.843  1.00 17.31  ? 242  ARG A NE  1 
ATOM   1694  C CZ  . ARG A 1 222 ? -26.138 27.990  41.168  1.00 18.02  ? 242  ARG A CZ  1 
ATOM   1695  N NH1 . ARG A 1 222 ? -25.716 27.651  39.958  1.00 17.99  ? 242  ARG A NH1 1 
ATOM   1696  N NH2 . ARG A 1 222 ? -27.175 27.369  41.698  1.00 18.93  ? 242  ARG A NH2 1 
ATOM   1697  N N   . ALA A 1 223 ? -19.227 30.028  39.463  1.00 14.97  ? 243  ALA A N   1 
ATOM   1698  C CA  . ALA A 1 223 ? -17.940 30.697  39.534  1.00 13.07  ? 243  ALA A CA  1 
ATOM   1699  C C   . ALA A 1 223 ? -17.912 31.977  38.730  1.00 13.00  ? 243  ALA A C   1 
ATOM   1700  O O   . ALA A 1 223 ? -18.468 32.042  37.633  1.00 13.37  ? 243  ALA A O   1 
ATOM   1701  C CB  . ALA A 1 223 ? -16.853 29.765  39.046  1.00 13.56  ? 243  ALA A CB  1 
ATOM   1702  N N   . ILE A 1 224 ? -17.258 32.990  39.295  1.00 12.34  ? 244  ILE A N   1 
ATOM   1703  C CA  . ILE A 1 224 ? -17.109 34.295  38.657  1.00 10.88  ? 244  ILE A CA  1 
ATOM   1704  C C   . ILE A 1 224 ? -15.640 34.697  38.709  1.00 9.78   ? 244  ILE A C   1 
ATOM   1705  O O   . ILE A 1 224 ? -14.992 34.562  39.741  1.00 9.70   ? 244  ILE A O   1 
ATOM   1706  C CB  . ILE A 1 224 ? -17.890 35.406  39.397  1.00 10.87  ? 244  ILE A CB  1 
ATOM   1707  C CG1 . ILE A 1 224 ? -19.359 35.035  39.563  1.00 9.65   ? 244  ILE A CG1 1 
ATOM   1708  C CG2 . ILE A 1 224 ? -17.807 36.701  38.614  1.00 10.54  ? 244  ILE A CG2 1 
ATOM   1709  C CD1 . ILE A 1 224 ? -20.124 36.061  40.390  1.00 6.76   ? 244  ILE A CD1 1 
ATOM   1710  N N   . SER A 1 225 ? -15.116 35.189  37.598  1.00 10.08  ? 245  SER A N   1 
ATOM   1711  C CA  . SER A 1 225 ? -13.732 35.640  37.554  1.00 10.73  ? 245  SER A CA  1 
ATOM   1712  C C   . SER A 1 225 ? -13.720 37.125  37.205  1.00 12.12  ? 245  SER A C   1 
ATOM   1713  O O   . SER A 1 225 ? -14.149 37.516  36.122  1.00 13.89  ? 245  SER A O   1 
ATOM   1714  C CB  . SER A 1 225 ? -12.936 34.858  36.507  1.00 9.26   ? 245  SER A CB  1 
ATOM   1715  O OG  . SER A 1 225 ? -12.638 33.555  36.961  1.00 6.28   ? 245  SER A OG  1 
ATOM   1716  N N   . GLU A 1 226 ? -13.239 37.952  38.126  1.00 13.30  ? 246  GLU A N   1 
ATOM   1717  C CA  . GLU A 1 226 ? -13.178 39.391  37.891  1.00 14.57  ? 246  GLU A CA  1 
ATOM   1718  C C   . GLU A 1 226 ? -11.790 39.873  37.467  1.00 14.46  ? 246  GLU A C   1 
ATOM   1719  O O   . GLU A 1 226 ? -10.920 40.120  38.301  1.00 12.90  ? 246  GLU A O   1 
ATOM   1720  C CB  . GLU A 1 226 ? -13.615 40.152  39.144  1.00 13.39  ? 246  GLU A CB  1 
ATOM   1721  C CG  . GLU A 1 226 ? -15.072 39.987  39.487  1.00 15.00  ? 246  GLU A CG  1 
ATOM   1722  C CD  . GLU A 1 226 ? -15.404 40.534  40.862  1.00 17.93  ? 246  GLU A CD  1 
ATOM   1723  O OE1 . GLU A 1 226 ? -14.845 41.588  41.231  1.00 20.90  ? 246  GLU A OE1 1 
ATOM   1724  O OE2 . GLU A 1 226 ? -16.228 39.921  41.573  1.00 17.68  ? 246  GLU A OE2 1 
ATOM   1725  N N   . SER A 1 227 ? -11.589 40.003  36.161  1.00 14.98  ? 247  SER A N   1 
ATOM   1726  C CA  . SER A 1 227 ? -10.319 40.484  35.645  1.00 16.73  ? 247  SER A CA  1 
ATOM   1727  C C   . SER A 1 227 ? -9.166  39.549  35.984  1.00 16.60  ? 247  SER A C   1 
ATOM   1728  O O   . SER A 1 227 ? -8.263  39.935  36.730  1.00 16.65  ? 247  SER A O   1 
ATOM   1729  C CB  . SER A 1 227 ? -10.013 41.882  36.211  1.00 17.71  ? 247  SER A CB  1 
ATOM   1730  O OG  . SER A 1 227 ? -11.054 42.808  35.921  1.00 19.28  ? 247  SER A OG  1 
ATOM   1731  N N   . GLY A 1 228 ? -9.202  38.332  35.436  1.00 15.79  ? 248  GLY A N   1 
ATOM   1732  C CA  . GLY A 1 228 ? -8.145  37.361  35.673  1.00 14.03  ? 248  GLY A CA  1 
ATOM   1733  C C   . GLY A 1 228 ? -8.567  35.920  35.433  1.00 15.30  ? 248  GLY A C   1 
ATOM   1734  O O   . GLY A 1 228 ? -9.581  35.484  35.965  1.00 16.01  ? 248  GLY A O   1 
ATOM   1735  N N   . VAL A 1 229 ? -7.803  35.183  34.625  1.00 16.62  ? 249  VAL A N   1 
ATOM   1736  C CA  . VAL A 1 229 ? -8.099  33.775  34.340  1.00 16.90  ? 249  VAL A CA  1 
ATOM   1737  C C   . VAL A 1 229 ? -6.851  32.883  34.271  1.00 19.38  ? 249  VAL A C   1 
ATOM   1738  O O   . VAL A 1 229 ? -5.734  33.329  34.530  1.00 18.06  ? 249  VAL A O   1 
ATOM   1739  C CB  . VAL A 1 229 ? -8.904  33.595  33.027  1.00 15.39  ? 249  VAL A CB  1 
ATOM   1740  C CG1 . VAL A 1 229 ? -10.323 34.067  33.218  1.00 15.12  ? 249  VAL A CG1 1 
ATOM   1741  C CG2 . VAL A 1 229 ? -8.249  34.352  31.904  1.00 15.69  ? 249  VAL A CG2 1 
ATOM   1742  N N   . ALA A 1 230 ? -7.063  31.619  33.910  1.00 23.65  ? 250  ALA A N   1 
ATOM   1743  C CA  . ALA A 1 230 ? -6.010  30.602  33.835  1.00 25.50  ? 250  ALA A CA  1 
ATOM   1744  C C   . ALA A 1 230 ? -4.945  30.828  32.782  1.00 27.48  ? 250  ALA A C   1 
ATOM   1745  O O   . ALA A 1 230 ? -3.760  30.666  33.058  1.00 27.21  ? 250  ALA A O   1 
ATOM   1746  C CB  . ALA A 1 230 ? -6.640  29.235  33.626  1.00 25.92  ? 250  ALA A CB  1 
ATOM   1747  N N   . LEU A 1 231 ? -5.368  31.177  31.571  1.00 31.16  ? 251  LEU A N   1 
ATOM   1748  C CA  . LEU A 1 231 ? -4.434  31.423  30.476  1.00 33.45  ? 251  LEU A CA  1 
ATOM   1749  C C   . LEU A 1 231 ? -3.528  32.620  30.785  1.00 37.15  ? 251  LEU A C   1 
ATOM   1750  O O   . LEU A 1 231 ? -2.492  32.792  30.132  1.00 36.23  ? 251  LEU A O   1 
ATOM   1751  C CB  . LEU A 1 231 ? -5.200  31.691  29.193  1.00 32.09  ? 251  LEU A CB  1 
ATOM   1752  C CG  . LEU A 1 231 ? -6.328  30.705  28.914  1.00 31.17  ? 251  LEU A CG  1 
ATOM   1753  C CD1 . LEU A 1 231 ? -7.054  31.117  27.638  1.00 30.76  ? 251  LEU A CD1 1 
ATOM   1754  C CD2 . LEU A 1 231 ? -5.762  29.304  28.793  1.00 30.35  ? 251  LEU A CD2 1 
ATOM   1755  N N   . THR A 1 232 ? -3.945  33.441  31.765  1.00 40.24  ? 252  THR A N   1 
ATOM   1756  C CA  . THR A 1 232 ? -3.187  34.617  32.228  1.00 41.57  ? 252  THR A CA  1 
ATOM   1757  C C   . THR A 1 232 ? -1.825  34.111  32.707  1.00 40.10  ? 252  THR A C   1 
ATOM   1758  O O   . THR A 1 232 ? -1.481  34.109  33.899  1.00 36.53  ? 252  THR A O   1 
ATOM   1759  C CB  . THR A 1 232 ? -3.946  35.380  33.390  1.00 44.24  ? 252  THR A CB  1 
ATOM   1760  O OG1 . THR A 1 232 ? -5.119  36.023  32.873  1.00 43.17  ? 252  THR A OG1 1 
ATOM   1761  C CG2 . THR A 1 232 ? -3.059  36.451  34.039  1.00 45.15  ? 252  THR A CG2 1 
ATOM   1762  N N   . SER A 1 233 ? -1.080  33.658  31.709  1.00 40.30  ? 253  SER A N   1 
ATOM   1763  C CA  . SER A 1 233 ? 0.260   33.107  31.787  1.00 41.38  ? 253  SER A CA  1 
ATOM   1764  C C   . SER A 1 233 ? 1.112   33.529  32.970  1.00 40.83  ? 253  SER A C   1 
ATOM   1765  O O   . SER A 1 233 ? 1.540   32.684  33.740  1.00 41.20  ? 253  SER A O   1 
ATOM   1766  C CB  . SER A 1 233 ? 0.987   33.429  30.471  1.00 42.69  ? 253  SER A CB  1 
ATOM   1767  O OG  . SER A 1 233 ? 0.115   33.204  29.370  1.00 40.49  ? 253  SER A OG  1 
ATOM   1768  N N   . VAL A 1 234 ? 1.350   34.830  33.101  1.00 40.13  ? 254  VAL A N   1 
ATOM   1769  C CA  . VAL A 1 234 ? 2.170   35.371  34.182  1.00 40.28  ? 254  VAL A CA  1 
ATOM   1770  C C   . VAL A 1 234 ? 2.093   34.676  35.564  1.00 39.60  ? 254  VAL A C   1 
ATOM   1771  O O   . VAL A 1 234 ? 3.117   34.533  36.250  1.00 39.31  ? 254  VAL A O   1 
ATOM   1772  C CB  . VAL A 1 234 ? 1.878   36.886  34.327  1.00 40.52  ? 254  VAL A CB  1 
ATOM   1773  C CG1 . VAL A 1 234 ? 0.399   37.146  34.093  1.00 41.29  ? 254  VAL A CG1 1 
ATOM   1774  C CG2 . VAL A 1 234 ? 2.305   37.386  35.696  1.00 41.39  ? 254  VAL A CG2 1 
ATOM   1775  N N   . LEU A 1 235 ? 0.897   34.241  35.964  1.00 38.29  ? 255  LEU A N   1 
ATOM   1776  C CA  . LEU A 1 235 ? 0.708   33.571  37.256  1.00 35.43  ? 255  LEU A CA  1 
ATOM   1777  C C   . LEU A 1 235 ? 0.823   32.051  37.185  1.00 34.85  ? 255  LEU A C   1 
ATOM   1778  O O   . LEU A 1 235 ? 0.696   31.369  38.207  1.00 34.53  ? 255  LEU A O   1 
ATOM   1779  C CB  . LEU A 1 235 ? -0.657  33.925  37.848  1.00 33.97  ? 255  LEU A CB  1 
ATOM   1780  C CG  . LEU A 1 235 ? -0.865  35.364  38.303  1.00 32.24  ? 255  LEU A CG  1 
ATOM   1781  C CD1 . LEU A 1 235 ? -2.244  35.507  38.929  1.00 31.11  ? 255  LEU A CD1 1 
ATOM   1782  C CD2 . LEU A 1 235 ? 0.215   35.736  39.301  1.00 30.93  ? 255  LEU A CD2 1 
ATOM   1783  N N   . VAL A 1 236 ? 1.059   31.529  35.982  1.00 34.19  ? 256  VAL A N   1 
ATOM   1784  C CA  . VAL A 1 236 ? 1.190   30.092  35.758  1.00 33.71  ? 256  VAL A CA  1 
ATOM   1785  C C   . VAL A 1 236 ? 2.545   29.731  35.153  1.00 33.92  ? 256  VAL A C   1 
ATOM   1786  O O   . VAL A 1 236 ? 2.725   29.766  33.940  1.00 33.99  ? 256  VAL A O   1 
ATOM   1787  C CB  . VAL A 1 236 ? 0.080   29.583  34.821  1.00 34.08  ? 256  VAL A CB  1 
ATOM   1788  C CG1 . VAL A 1 236 ? 0.194   28.076  34.648  1.00 33.26  ? 256  VAL A CG1 1 
ATOM   1789  C CG2 . VAL A 1 236 ? -1.284  29.962  35.382  1.00 33.25  ? 256  VAL A CG2 1 
ATOM   1790  N N   . LYS A 1 237 ? 3.492   29.376  36.013  1.00 35.80  ? 257  LYS A N   1 
ATOM   1791  C CA  . LYS A 1 237 ? 4.840   29.010  35.588  1.00 37.58  ? 257  LYS A CA  1 
ATOM   1792  C C   . LYS A 1 237 ? 4.824   27.755  34.727  1.00 38.67  ? 257  LYS A C   1 
ATOM   1793  O O   . LYS A 1 237 ? 4.171   26.770  35.068  1.00 38.88  ? 257  LYS A O   1 
ATOM   1794  C CB  . LYS A 1 237 ? 5.727   28.751  36.806  1.00 36.86  ? 257  LYS A CB  1 
ATOM   1795  C CG  . LYS A 1 237 ? 5.660   29.814  37.884  1.00 39.35  ? 257  LYS A CG  1 
ATOM   1796  C CD  . LYS A 1 237 ? 6.809   30.814  37.818  1.00 42.59  ? 257  LYS A CD  1 
ATOM   1797  C CE  . LYS A 1 237 ? 6.710   31.790  36.638  1.00 45.06  ? 257  LYS A CE  1 
ATOM   1798  N NZ  . LYS A 1 237 ? 7.374   31.310  35.381  1.00 46.07  ? 257  LYS A NZ  1 
ATOM   1799  N N   . LYS A 1 238 ? 5.556   27.791  33.618  1.00 40.60  ? 258  LYS A N   1 
ATOM   1800  C CA  . LYS A 1 238 ? 5.644   26.643  32.720  1.00 41.26  ? 258  LYS A CA  1 
ATOM   1801  C C   . LYS A 1 238 ? 7.118   26.325  32.434  1.00 39.66  ? 258  LYS A C   1 
ATOM   1802  O O   . LYS A 1 238 ? 7.978   27.201  32.505  1.00 39.79  ? 258  LYS A O   1 
ATOM   1803  C CB  . LYS A 1 238 ? 4.880   26.933  31.426  1.00 42.35  ? 258  LYS A CB  1 
ATOM   1804  C CG  . LYS A 1 238 ? 3.443   27.381  31.671  1.00 43.85  ? 258  LYS A CG  1 
ATOM   1805  C CD  . LYS A 1 238 ? 2.736   27.764  30.374  1.00 45.71  ? 258  LYS A CD  1 
ATOM   1806  C CE  . LYS A 1 238 ? 1.406   28.483  30.639  1.00 46.35  ? 258  LYS A CE  1 
ATOM   1807  N NZ  . LYS A 1 238 ? 1.578   29.853  31.230  1.00 44.75  ? 258  LYS A NZ  1 
ATOM   1808  N N   . GLY A 1 239 ? 7.404   25.068  32.124  1.00 37.92  ? 259  GLY A N   1 
ATOM   1809  C CA  . GLY A 1 239 ? 8.775   24.674  31.866  1.00 36.14  ? 259  GLY A CA  1 
ATOM   1810  C C   . GLY A 1 239 ? 9.347   24.105  33.144  1.00 34.84  ? 259  GLY A C   1 
ATOM   1811  O O   . GLY A 1 239 ? 8.593   23.687  34.016  1.00 35.74  ? 259  GLY A O   1 
ATOM   1812  N N   . ASP A 1 240 ? 10.667  24.086  33.272  1.00 33.76  ? 260  ASP A N   1 
ATOM   1813  C CA  . ASP A 1 240 ? 11.302  23.560  34.480  1.00 32.14  ? 260  ASP A CA  1 
ATOM   1814  C C   . ASP A 1 240 ? 11.351  24.641  35.574  1.00 29.41  ? 260  ASP A C   1 
ATOM   1815  O O   . ASP A 1 240 ? 11.871  25.732  35.358  1.00 29.20  ? 260  ASP A O   1 
ATOM   1816  C CB  . ASP A 1 240 ? 12.710  23.050  34.133  1.00 33.88  ? 260  ASP A CB  1 
ATOM   1817  C CG  . ASP A 1 240 ? 13.432  22.457  35.325  1.00 35.54  ? 260  ASP A CG  1 
ATOM   1818  O OD1 . ASP A 1 240 ? 12.773  21.792  36.148  1.00 36.79  ? 260  ASP A OD1 1 
ATOM   1819  O OD2 . ASP A 1 240 ? 14.664  22.642  35.431  1.00 37.20  ? 260  ASP A OD2 1 
ATOM   1820  N N   . VAL A 1 241 ? 10.797  24.340  36.744  1.00 26.00  ? 261  VAL A N   1 
ATOM   1821  C CA  . VAL A 1 241 ? 10.774  25.300  37.844  1.00 23.38  ? 261  VAL A CA  1 
ATOM   1822  C C   . VAL A 1 241 ? 12.005  25.158  38.749  1.00 23.34  ? 261  VAL A C   1 
ATOM   1823  O O   . VAL A 1 241 ? 12.296  26.032  39.575  1.00 22.07  ? 261  VAL A O   1 
ATOM   1824  C CB  . VAL A 1 241 ? 9.487   25.129  38.682  1.00 20.45  ? 261  VAL A CB  1 
ATOM   1825  C CG1 . VAL A 1 241 ? 9.445   26.148  39.802  1.00 22.48  ? 261  VAL A CG1 1 
ATOM   1826  C CG2 . VAL A 1 241 ? 8.288   25.300  37.801  1.00 16.68  ? 261  VAL A CG2 1 
ATOM   1827  N N   . LYS A 1 242 ? 12.731  24.058  38.572  1.00 22.47  ? 262  LYS A N   1 
ATOM   1828  C CA  . LYS A 1 242 ? 13.930  23.766  39.354  1.00 22.05  ? 262  LYS A CA  1 
ATOM   1829  C C   . LYS A 1 242 ? 14.894  24.956  39.448  1.00 20.67  ? 262  LYS A C   1 
ATOM   1830  O O   . LYS A 1 242 ? 15.395  25.282  40.520  1.00 20.47  ? 262  LYS A O   1 
ATOM   1831  C CB  . LYS A 1 242 ? 14.645  22.565  38.742  1.00 23.45  ? 262  LYS A CB  1 
ATOM   1832  C CG  . LYS A 1 242 ? 15.700  21.928  39.627  1.00 24.80  ? 262  LYS A CG  1 
ATOM   1833  C CD  . LYS A 1 242 ? 15.082  21.307  40.860  1.00 24.47  ? 262  LYS A CD  1 
ATOM   1834  C CE  . LYS A 1 242 ? 15.986  20.233  41.426  1.00 25.38  ? 262  LYS A CE  1 
ATOM   1835  N NZ  . LYS A 1 242 ? 16.111  19.071  40.500  1.00 25.82  ? 262  LYS A NZ  1 
ATOM   1836  N N   . PRO A 1 243 ? 15.187  25.601  38.314  1.00 20.00  ? 263  PRO A N   1 
ATOM   1837  C CA  . PRO A 1 243 ? 16.092  26.755  38.296  1.00 19.87  ? 263  PRO A CA  1 
ATOM   1838  C C   . PRO A 1 243 ? 15.668  27.895  39.221  1.00 19.51  ? 263  PRO A C   1 
ATOM   1839  O O   . PRO A 1 243 ? 16.497  28.479  39.915  1.00 20.23  ? 263  PRO A O   1 
ATOM   1840  C CB  . PRO A 1 243 ? 16.077  27.169  36.833  1.00 19.24  ? 263  PRO A CB  1 
ATOM   1841  C CG  . PRO A 1 243 ? 15.978  25.836  36.139  1.00 19.46  ? 263  PRO A CG  1 
ATOM   1842  C CD  . PRO A 1 243 ? 14.927  25.119  36.945  1.00 19.22  ? 263  PRO A CD  1 
ATOM   1843  N N   . LEU A 1 244 ? 14.378  28.214  39.220  1.00 19.58  ? 264  LEU A N   1 
ATOM   1844  C CA  . LEU A 1 244 ? 13.857  29.284  40.059  1.00 18.49  ? 264  LEU A CA  1 
ATOM   1845  C C   . LEU A 1 244 ? 13.944  28.845  41.515  1.00 18.29  ? 264  LEU A C   1 
ATOM   1846  O O   . LEU A 1 244 ? 14.273  29.642  42.392  1.00 18.56  ? 264  LEU A O   1 
ATOM   1847  C CB  . LEU A 1 244 ? 12.405  29.597  39.668  1.00 20.17  ? 264  LEU A CB  1 
ATOM   1848  C CG  . LEU A 1 244 ? 11.672  30.852  40.183  1.00 21.93  ? 264  LEU A CG  1 
ATOM   1849  C CD1 . LEU A 1 244 ? 10.716  30.493  41.299  1.00 21.19  ? 264  LEU A CD1 1 
ATOM   1850  C CD2 . LEU A 1 244 ? 12.675  31.901  40.646  1.00 23.82  ? 264  LEU A CD2 1 
ATOM   1851  N N   . ALA A 1 245 ? 13.660  27.569  41.766  1.00 17.81  ? 265  ALA A N   1 
ATOM   1852  C CA  . ALA A 1 245 ? 13.719  27.017  43.115  1.00 15.42  ? 265  ALA A CA  1 
ATOM   1853  C C   . ALA A 1 245 ? 15.104  27.233  43.695  1.00 16.44  ? 265  ALA A C   1 
ATOM   1854  O O   . ALA A 1 245 ? 15.245  27.683  44.834  1.00 16.25  ? 265  ALA A O   1 
ATOM   1855  C CB  . ALA A 1 245 ? 13.413  25.555  43.080  1.00 14.98  ? 265  ALA A CB  1 
ATOM   1856  N N   . GLU A 1 246 ? 16.121  26.910  42.895  1.00 17.26  ? 266  GLU A N   1 
ATOM   1857  C CA  . GLU A 1 246 ? 17.518  27.066  43.281  1.00 17.23  ? 266  GLU A CA  1 
ATOM   1858  C C   . GLU A 1 246 ? 17.873  28.527  43.489  1.00 17.35  ? 266  GLU A C   1 
ATOM   1859  O O   . GLU A 1 246 ? 18.524  28.881  44.475  1.00 15.01  ? 266  GLU A O   1 
ATOM   1860  C CB  . GLU A 1 246 ? 18.409  26.455  42.214  1.00 20.35  ? 266  GLU A CB  1 
ATOM   1861  C CG  . GLU A 1 246 ? 18.481  24.946  42.320  1.00 28.71  ? 266  GLU A CG  1 
ATOM   1862  C CD  . GLU A 1 246 ? 19.042  24.278  41.077  1.00 32.95  ? 266  GLU A CD  1 
ATOM   1863  O OE1 . GLU A 1 246 ? 20.093  24.722  40.559  1.00 34.79  ? 266  GLU A OE1 1 
ATOM   1864  O OE2 . GLU A 1 246 ? 18.426  23.291  40.624  1.00 36.55  ? 266  GLU A OE2 1 
ATOM   1865  N N   . GLN A 1 247 ? 17.448  29.378  42.560  1.00 19.21  ? 267  GLN A N   1 
ATOM   1866  C CA  . GLN A 1 247 ? 17.707  30.807  42.689  1.00 20.61  ? 267  GLN A CA  1 
ATOM   1867  C C   . GLN A 1 247 ? 17.196  31.223  44.073  1.00 18.46  ? 267  GLN A C   1 
ATOM   1868  O O   . GLN A 1 247 ? 17.842  31.998  44.782  1.00 17.74  ? 267  GLN A O   1 
ATOM   1869  C CB  . GLN A 1 247 ? 16.973  31.605  41.590  1.00 25.10  ? 267  GLN A CB  1 
ATOM   1870  C CG  . GLN A 1 247 ? 17.667  31.650  40.199  1.00 32.72  ? 267  GLN A CG  1 
ATOM   1871  C CD  . GLN A 1 247 ? 16.890  32.463  39.119  1.00 36.15  ? 267  GLN A CD  1 
ATOM   1872  O OE1 . GLN A 1 247 ? 16.278  33.500  39.406  1.00 37.22  ? 267  GLN A OE1 1 
ATOM   1873  N NE2 . GLN A 1 247 ? 16.944  31.993  37.875  1.00 36.61  ? 267  GLN A NE2 1 
ATOM   1874  N N   . ILE A 1 248 ? 16.046  30.679  44.465  1.00 15.90  ? 268  ILE A N   1 
ATOM   1875  C CA  . ILE A 1 248 ? 15.460  31.013  45.753  1.00 14.57  ? 268  ILE A CA  1 
ATOM   1876  C C   . ILE A 1 248 ? 16.238  30.415  46.918  1.00 15.11  ? 268  ILE A C   1 
ATOM   1877  O O   . ILE A 1 248 ? 16.486  31.094  47.925  1.00 14.75  ? 268  ILE A O   1 
ATOM   1878  C CB  . ILE A 1 248 ? 14.000  30.550  45.835  1.00 13.72  ? 268  ILE A CB  1 
ATOM   1879  C CG1 . ILE A 1 248 ? 13.197  31.206  44.707  1.00 14.27  ? 268  ILE A CG1 1 
ATOM   1880  C CG2 . ILE A 1 248 ? 13.406  30.927  47.191  1.00 11.83  ? 268  ILE A CG2 1 
ATOM   1881  C CD1 . ILE A 1 248 ? 11.714  30.910  44.726  1.00 13.41  ? 268  ILE A CD1 1 
ATOM   1882  N N   . ALA A 1 249 ? 16.630  29.151  46.780  1.00 13.80  ? 269  ALA A N   1 
ATOM   1883  C CA  . ALA A 1 249 ? 17.385  28.471  47.826  1.00 11.84  ? 269  ALA A CA  1 
ATOM   1884  C C   . ALA A 1 249 ? 18.682  29.220  48.122  1.00 11.53  ? 269  ALA A C   1 
ATOM   1885  O O   . ALA A 1 249 ? 19.014  29.477  49.281  1.00 12.76  ? 269  ALA A O   1 
ATOM   1886  C CB  . ALA A 1 249 ? 17.687  27.036  47.408  1.00 10.33  ? 269  ALA A CB  1 
ATOM   1887  N N   . ILE A 1 250 ? 19.417  29.581  47.080  1.00 10.49  ? 270  ILE A N   1 
ATOM   1888  C CA  . ILE A 1 250 ? 20.666  30.299  47.286  1.00 9.65   ? 270  ILE A CA  1 
ATOM   1889  C C   . ILE A 1 250 ? 20.430  31.634  47.989  1.00 9.75   ? 270  ILE A C   1 
ATOM   1890  O O   . ILE A 1 250 ? 21.114  31.946  48.950  1.00 12.09  ? 270  ILE A O   1 
ATOM   1891  C CB  . ILE A 1 250 ? 21.402  30.545  45.949  1.00 8.69   ? 270  ILE A CB  1 
ATOM   1892  C CG1 . ILE A 1 250 ? 21.675  29.208  45.263  1.00 8.03   ? 270  ILE A CG1 1 
ATOM   1893  C CG2 . ILE A 1 250 ? 22.721  31.266  46.194  1.00 7.43   ? 270  ILE A CG2 1 
ATOM   1894  C CD1 . ILE A 1 250 ? 22.318  29.335  43.928  1.00 7.04   ? 270  ILE A CD1 1 
ATOM   1895  N N   . THR A 1 251 ? 19.461  32.414  47.526  1.00 9.58   ? 271  THR A N   1 
ATOM   1896  C CA  . THR A 1 251 ? 19.193  33.706  48.144  1.00 11.18  ? 271  THR A CA  1 
ATOM   1897  C C   . THR A 1 251 ? 18.914  33.580  49.643  1.00 12.35  ? 271  THR A C   1 
ATOM   1898  O O   . THR A 1 251 ? 19.290  34.454  50.433  1.00 11.45  ? 271  THR A O   1 
ATOM   1899  C CB  . THR A 1 251 ? 17.980  34.427  47.468  1.00 12.43  ? 271  THR A CB  1 
ATOM   1900  O OG1 . THR A 1 251 ? 18.243  34.616  46.070  1.00 11.25  ? 271  THR A OG1 1 
ATOM   1901  C CG2 . THR A 1 251 ? 17.724  35.802  48.120  1.00 7.51   ? 271  THR A CG2 1 
ATOM   1902  N N   . ALA A 1 252 ? 18.258  32.490  50.030  1.00 13.52  ? 272  ALA A N   1 
ATOM   1903  C CA  . ALA A 1 252 ? 17.911  32.265  51.432  1.00 14.27  ? 272  ALA A CA  1 
ATOM   1904  C C   . ALA A 1 252 ? 19.074  31.707  52.233  1.00 15.17  ? 272  ALA A C   1 
ATOM   1905  O O   . ALA A 1 252 ? 18.974  31.537  53.447  1.00 16.36  ? 272  ALA A O   1 
ATOM   1906  C CB  . ALA A 1 252 ? 16.729  31.331  51.526  1.00 13.63  ? 272  ALA A CB  1 
ATOM   1907  N N   . GLY A 1 253 ? 20.172  31.411  51.545  1.00 15.94  ? 273  GLY A N   1 
ATOM   1908  C CA  . GLY A 1 253 ? 21.353  30.883  52.209  1.00 14.60  ? 273  GLY A CA  1 
ATOM   1909  C C   . GLY A 1 253 ? 21.346  29.386  52.409  1.00 12.93  ? 273  GLY A C   1 
ATOM   1910  O O   . GLY A 1 253 ? 21.769  28.911  53.458  1.00 12.61  ? 273  GLY A O   1 
ATOM   1911  N N   . CYS A 1 254 ? 20.880  28.652  51.397  1.00 13.05  ? 274  CYS A N   1 
ATOM   1912  C CA  . CYS A 1 254 ? 20.788  27.187  51.436  1.00 13.52  ? 274  CYS A CA  1 
ATOM   1913  C C   . CYS A 1 254 ? 21.667  26.482  50.402  1.00 13.51  ? 274  CYS A C   1 
ATOM   1914  O O   . CYS A 1 254 ? 22.147  27.102  49.451  1.00 14.47  ? 274  CYS A O   1 
ATOM   1915  C CB  . CYS A 1 254 ? 19.340  26.745  51.190  1.00 12.79  ? 274  CYS A CB  1 
ATOM   1916  S SG  . CYS A 1 254 ? 18.173  26.917  52.577  1.00 14.46  ? 274  CYS A SG  1 
ATOM   1917  N N   . LYS A 1 255 ? 21.880  25.182  50.591  1.00 14.47  ? 275  LYS A N   1 
ATOM   1918  C CA  . LYS A 1 255 ? 22.650  24.404  49.621  1.00 15.49  ? 275  LYS A CA  1 
ATOM   1919  C C   . LYS A 1 255 ? 21.677  24.107  48.486  1.00 14.02  ? 275  LYS A C   1 
ATOM   1920  O O   . LYS A 1 255 ? 20.525  24.515  48.536  1.00 14.93  ? 275  LYS A O   1 
ATOM   1921  C CB  . LYS A 1 255 ? 23.108  23.072  50.200  1.00 17.28  ? 275  LYS A CB  1 
ATOM   1922  C CG  . LYS A 1 255 ? 24.243  23.121  51.191  1.00 20.55  ? 275  LYS A CG  1 
ATOM   1923  C CD  . LYS A 1 255 ? 24.544  21.694  51.634  1.00 23.06  ? 275  LYS A CD  1 
ATOM   1924  C CE  . LYS A 1 255 ? 25.466  21.626  52.834  1.00 24.56  ? 275  LYS A CE  1 
ATOM   1925  N NZ  . LYS A 1 255 ? 25.272  20.316  53.519  1.00 25.86  ? 275  LYS A NZ  1 
ATOM   1926  N N   . THR A 1 256 ? 22.121  23.386  47.470  1.00 12.68  ? 276  THR A N   1 
ATOM   1927  C CA  . THR A 1 256 ? 21.227  23.066  46.367  1.00 11.67  ? 276  THR A CA  1 
ATOM   1928  C C   . THR A 1 256 ? 21.529  21.690  45.801  1.00 11.07  ? 276  THR A C   1 
ATOM   1929  O O   . THR A 1 256 ? 21.202  21.393  44.663  1.00 10.94  ? 276  THR A O   1 
ATOM   1930  C CB  . THR A 1 256 ? 21.329  24.125  45.248  1.00 12.17  ? 276  THR A CB  1 
ATOM   1931  O OG1 . THR A 1 256 ? 22.702  24.460  45.021  1.00 9.85   ? 276  THR A OG1 1 
ATOM   1932  C CG2 . THR A 1 256 ? 20.564  25.375  45.631  1.00 11.72  ? 276  THR A CG2 1 
ATOM   1933  N N   . THR A 1 257 ? 22.138  20.852  46.628  1.00 11.95  ? 277  THR A N   1 
ATOM   1934  C CA  . THR A 1 257 ? 22.526  19.501  46.251  1.00 12.47  ? 277  THR A CA  1 
ATOM   1935  C C   . THR A 1 257 ? 21.423  18.669  45.599  1.00 12.43  ? 277  THR A C   1 
ATOM   1936  O O   . THR A 1 257 ? 21.650  18.064  44.550  1.00 12.32  ? 277  THR A O   1 
ATOM   1937  C CB  . THR A 1 257 ? 23.069  18.755  47.468  1.00 12.73  ? 277  THR A CB  1 
ATOM   1938  O OG1 . THR A 1 257 ? 23.937  19.630  48.201  1.00 14.15  ? 277  THR A OG1 1 
ATOM   1939  C CG2 . THR A 1 257 ? 23.854  17.531  47.027  1.00 11.37  ? 277  THR A CG2 1 
ATOM   1940  N N   . THR A 1 258 ? 20.247  18.615  46.226  1.00 12.54  ? 278  THR A N   1 
ATOM   1941  C CA  . THR A 1 258 ? 19.105  17.875  45.669  1.00 11.75  ? 278  THR A CA  1 
ATOM   1942  C C   . THR A 1 258 ? 17.850  18.619  46.085  1.00 11.28  ? 278  THR A C   1 
ATOM   1943  O O   . THR A 1 258 ? 17.877  19.406  47.033  1.00 10.88  ? 278  THR A O   1 
ATOM   1944  C CB  . THR A 1 258 ? 18.974  16.422  46.214  1.00 11.97  ? 278  THR A CB  1 
ATOM   1945  O OG1 . THR A 1 258 ? 18.651  16.463  47.606  1.00 12.23  ? 278  THR A OG1 1 
ATOM   1946  C CG2 . THR A 1 258 ? 20.258  15.635  46.020  1.00 12.05  ? 278  THR A CG2 1 
ATOM   1947  N N   . SER A 1 259 ? 16.753  18.371  45.380  1.00 11.45  ? 279  SER A N   1 
ATOM   1948  C CA  . SER A 1 259 ? 15.488  19.024  45.704  1.00 11.81  ? 279  SER A CA  1 
ATOM   1949  C C   . SER A 1 259 ? 15.147  18.824  47.174  1.00 10.49  ? 279  SER A C   1 
ATOM   1950  O O   . SER A 1 259 ? 14.786  19.769  47.869  1.00 9.12   ? 279  SER A O   1 
ATOM   1951  C CB  . SER A 1 259 ? 14.349  18.459  44.847  1.00 12.30  ? 279  SER A CB  1 
ATOM   1952  O OG  . SER A 1 259 ? 14.517  18.775  43.474  1.00 12.89  ? 279  SER A OG  1 
ATOM   1953  N N   . ALA A 1 260 ? 15.263  17.584  47.636  1.00 11.40  ? 280  ALA A N   1 
ATOM   1954  C CA  . ALA A 1 260 ? 14.958  17.252  49.022  1.00 12.84  ? 280  ALA A CA  1 
ATOM   1955  C C   . ALA A 1 260 ? 15.809  18.095  49.964  1.00 13.51  ? 280  ALA A C   1 
ATOM   1956  O O   . ALA A 1 260 ? 15.343  18.556  51.010  1.00 14.42  ? 280  ALA A O   1 
ATOM   1957  C CB  . ALA A 1 260 ? 15.205  15.764  49.270  1.00 10.92  ? 280  ALA A CB  1 
ATOM   1958  N N   . VAL A 1 261 ? 17.062  18.297  49.585  1.00 13.74  ? 281  VAL A N   1 
ATOM   1959  C CA  . VAL A 1 261 ? 17.964  19.081  50.400  1.00 13.33  ? 281  VAL A CA  1 
ATOM   1960  C C   . VAL A 1 261 ? 17.484  20.523  50.458  1.00 13.72  ? 281  VAL A C   1 
ATOM   1961  O O   . VAL A 1 261 ? 17.437  21.117  51.531  1.00 14.66  ? 281  VAL A O   1 
ATOM   1962  C CB  . VAL A 1 261 ? 19.390  19.028  49.839  1.00 13.18  ? 281  VAL A CB  1 
ATOM   1963  C CG1 . VAL A 1 261 ? 20.311  19.884  50.679  1.00 13.14  ? 281  VAL A CG1 1 
ATOM   1964  C CG2 . VAL A 1 261 ? 19.876  17.601  49.834  1.00 13.21  ? 281  VAL A CG2 1 
ATOM   1965  N N   . MET A 1 262 ? 17.124  21.090  49.309  1.00 14.02  ? 282  MET A N   1 
ATOM   1966  C CA  . MET A 1 262 ? 16.640  22.466  49.286  1.00 13.55  ? 282  MET A CA  1 
ATOM   1967  C C   . MET A 1 262 ? 15.431  22.628  50.210  1.00 14.05  ? 282  MET A C   1 
ATOM   1968  O O   . MET A 1 262 ? 15.445  23.457  51.130  1.00 14.73  ? 282  MET A O   1 
ATOM   1969  C CB  . MET A 1 262 ? 16.265  22.882  47.864  1.00 11.72  ? 282  MET A CB  1 
ATOM   1970  C CG  . MET A 1 262 ? 17.464  23.146  46.988  1.00 13.22  ? 282  MET A CG  1 
ATOM   1971  S SD  . MET A 1 262 ? 17.069  23.869  45.377  1.00 13.79  ? 282  MET A SD  1 
ATOM   1972  C CE  . MET A 1 262 ? 16.979  22.413  44.352  1.00 12.15  ? 282  MET A CE  1 
ATOM   1973  N N   . VAL A 1 263 ? 14.397  21.825  49.978  1.00 11.93  ? 283  VAL A N   1 
ATOM   1974  C CA  . VAL A 1 263 ? 13.194  21.897  50.788  1.00 10.64  ? 283  VAL A CA  1 
ATOM   1975  C C   . VAL A 1 263 ? 13.495  21.712  52.263  1.00 9.49   ? 283  VAL A C   1 
ATOM   1976  O O   . VAL A 1 263 ? 12.997  22.469  53.096  1.00 9.30   ? 283  VAL A O   1 
ATOM   1977  C CB  . VAL A 1 263 ? 12.142  20.855  50.342  1.00 9.82   ? 283  VAL A CB  1 
ATOM   1978  C CG1 . VAL A 1 263 ? 10.876  20.989  51.174  1.00 8.88   ? 283  VAL A CG1 1 
ATOM   1979  C CG2 . VAL A 1 263 ? 11.796  21.075  48.889  1.00 11.54  ? 283  VAL A CG2 1 
ATOM   1980  N N   . HIS A 1 264 ? 14.309  20.718  52.594  1.00 10.00  ? 284  HIS A N   1 
ATOM   1981  C CA  . HIS A 1 264 ? 14.645  20.475  53.992  1.00 11.94  ? 284  HIS A CA  1 
ATOM   1982  C C   . HIS A 1 264 ? 15.270  21.715  54.625  1.00 13.87  ? 284  HIS A C   1 
ATOM   1983  O O   . HIS A 1 264 ? 15.025  22.019  55.800  1.00 13.88  ? 284  HIS A O   1 
ATOM   1984  C CB  . HIS A 1 264 ? 15.622  19.306  54.127  1.00 13.00  ? 284  HIS A CB  1 
ATOM   1985  C CG  . HIS A 1 264 ? 16.147  19.124  55.519  1.00 14.03  ? 284  HIS A CG  1 
ATOM   1986  N ND1 . HIS A 1 264 ? 15.346  18.736  56.574  1.00 14.94  ? 284  HIS A ND1 1 
ATOM   1987  C CD2 . HIS A 1 264 ? 17.376  19.336  56.042  1.00 13.04  ? 284  HIS A CD2 1 
ATOM   1988  C CE1 . HIS A 1 264 ? 16.058  18.724  57.685  1.00 12.56  ? 284  HIS A CE1 1 
ATOM   1989  N NE2 . HIS A 1 264 ? 17.293  19.085  57.391  1.00 12.52  ? 284  HIS A NE2 1 
ATOM   1990  N N   . CYS A 1 265 ? 16.073  22.429  53.835  1.00 15.28  ? 285  CYS A N   1 
ATOM   1991  C CA  . CYS A 1 265 ? 16.757  23.635  54.298  1.00 15.15  ? 285  CYS A CA  1 
ATOM   1992  C C   . CYS A 1 265 ? 15.842  24.850  54.471  1.00 14.33  ? 285  CYS A C   1 
ATOM   1993  O O   . CYS A 1 265 ? 15.921  25.553  55.479  1.00 14.03  ? 285  CYS A O   1 
ATOM   1994  C CB  . CYS A 1 265 ? 17.894  23.984  53.345  1.00 15.36  ? 285  CYS A CB  1 
ATOM   1995  S SG  . CYS A 1 265 ? 18.814  25.465  53.854  1.00 17.93  ? 285  CYS A SG  1 
ATOM   1996  N N   . LEU A 1 266 ? 14.985  25.113  53.490  1.00 12.78  ? 286  LEU A N   1 
ATOM   1997  C CA  . LEU A 1 266 ? 14.076  26.237  53.607  1.00 11.81  ? 286  LEU A CA  1 
ATOM   1998  C C   . LEU A 1 266 ? 13.090  25.978  54.739  1.00 13.21  ? 286  LEU A C   1 
ATOM   1999  O O   . LEU A 1 266 ? 12.643  26.909  55.413  1.00 12.96  ? 286  LEU A O   1 
ATOM   2000  C CB  . LEU A 1 266 ? 13.344  26.456  52.294  1.00 10.96  ? 286  LEU A CB  1 
ATOM   2001  C CG  . LEU A 1 266 ? 14.244  27.050  51.211  1.00 11.11  ? 286  LEU A CG  1 
ATOM   2002  C CD1 . LEU A 1 266 ? 13.574  26.944  49.858  1.00 10.88  ? 286  LEU A CD1 1 
ATOM   2003  C CD2 . LEU A 1 266 ? 14.560  28.494  51.553  1.00 9.53   ? 286  LEU A CD2 1 
ATOM   2004  N N   . ARG A 1 267 ? 12.751  24.710  54.955  1.00 13.90  ? 287  ARG A N   1 
ATOM   2005  C CA  . ARG A 1 267 ? 11.833  24.358  56.033  1.00 13.89  ? 287  ARG A CA  1 
ATOM   2006  C C   . ARG A 1 267 ? 12.392  24.811  57.371  1.00 13.95  ? 287  ARG A C   1 
ATOM   2007  O O   . ARG A 1 267 ? 11.639  25.072  58.307  1.00 13.98  ? 287  ARG A O   1 
ATOM   2008  C CB  . ARG A 1 267 ? 11.607  22.850  56.093  1.00 14.35  ? 287  ARG A CB  1 
ATOM   2009  C CG  . ARG A 1 267 ? 10.702  22.308  55.014  1.00 17.17  ? 287  ARG A CG  1 
ATOM   2010  C CD  . ARG A 1 267 ? 9.531   21.533  55.604  1.00 17.06  ? 287  ARG A CD  1 
ATOM   2011  N NE  . ARG A 1 267 ? 8.657   20.997  54.561  1.00 19.36  ? 287  ARG A NE  1 
ATOM   2012  C CZ  . ARG A 1 267 ? 8.982   20.004  53.737  1.00 19.53  ? 287  ARG A CZ  1 
ATOM   2013  N NH1 . ARG A 1 267 ? 10.169  19.423  53.830  1.00 19.90  ? 287  ARG A NH1 1 
ATOM   2014  N NH2 . ARG A 1 267 ? 8.122   19.596  52.813  1.00 20.30  ? 287  ARG A NH2 1 
ATOM   2015  N N   . GLN A 1 268 ? 13.715  24.909  57.451  1.00 14.68  ? 288  GLN A N   1 
ATOM   2016  C CA  . GLN A 1 268 ? 14.394  25.301  58.679  1.00 14.93  ? 288  GLN A CA  1 
ATOM   2017  C C   . GLN A 1 268 ? 14.559  26.798  58.881  1.00 14.05  ? 288  GLN A C   1 
ATOM   2018  O O   . GLN A 1 268 ? 14.834  27.241  59.987  1.00 13.49  ? 288  GLN A O   1 
ATOM   2019  C CB  . GLN A 1 268 ? 15.763  24.637  58.742  1.00 19.07  ? 288  GLN A CB  1 
ATOM   2020  C CG  . GLN A 1 268 ? 15.720  23.119  58.700  1.00 27.03  ? 288  GLN A CG  1 
ATOM   2021  C CD  . GLN A 1 268 ? 17.114  22.502  58.673  1.00 32.91  ? 288  GLN A CD  1 
ATOM   2022  O OE1 . GLN A 1 268 ? 17.887  22.639  59.628  1.00 37.17  ? 288  GLN A OE1 1 
ATOM   2023  N NE2 . GLN A 1 268 ? 17.444  21.825  57.574  1.00 35.05  ? 288  GLN A NE2 1 
ATOM   2024  N N   . LYS A 1 269 ? 14.401  27.582  57.821  1.00 14.33  ? 289  LYS A N   1 
ATOM   2025  C CA  . LYS A 1 269 ? 14.526  29.032  57.937  1.00 12.43  ? 289  LYS A CA  1 
ATOM   2026  C C   . LYS A 1 269 ? 13.391  29.599  58.786  1.00 11.76  ? 289  LYS A C   1 
ATOM   2027  O O   . LYS A 1 269 ? 12.401  28.921  59.040  1.00 11.39  ? 289  LYS A O   1 
ATOM   2028  C CB  . LYS A 1 269 ? 14.500  29.671  56.552  1.00 12.74  ? 289  LYS A CB  1 
ATOM   2029  C CG  . LYS A 1 269 ? 15.655  29.259  55.668  1.00 11.86  ? 289  LYS A CG  1 
ATOM   2030  C CD  . LYS A 1 269 ? 16.962  29.713  56.262  1.00 13.30  ? 289  LYS A CD  1 
ATOM   2031  C CE  . LYS A 1 269 ? 18.127  29.366  55.359  1.00 16.39  ? 289  LYS A CE  1 
ATOM   2032  N NZ  . LYS A 1 269 ? 19.414  29.764  55.992  1.00 19.90  ? 289  LYS A NZ  1 
ATOM   2033  N N   . THR A 1 270 ? 13.542  30.842  59.228  1.00 13.13  ? 290  THR A N   1 
ATOM   2034  C CA  . THR A 1 270 ? 12.520  31.489  60.048  1.00 13.70  ? 290  THR A CA  1 
ATOM   2035  C C   . THR A 1 270 ? 11.697  32.429  59.192  1.00 14.38  ? 290  THR A C   1 
ATOM   2036  O O   . THR A 1 270 ? 12.147  32.857  58.131  1.00 14.35  ? 290  THR A O   1 
ATOM   2037  C CB  . THR A 1 270 ? 13.122  32.326  61.197  1.00 12.74  ? 290  THR A CB  1 
ATOM   2038  O OG1 . THR A 1 270 ? 13.848  33.435  60.655  1.00 12.25  ? 290  THR A OG1 1 
ATOM   2039  C CG2 . THR A 1 270 ? 14.041  31.481  62.053  1.00 12.03  ? 290  THR A CG2 1 
ATOM   2040  N N   . GLU A 1 271 ? 10.500  32.755  59.666  1.00 15.33  ? 291  GLU A N   1 
ATOM   2041  C CA  . GLU A 1 271 ? 9.622   33.640  58.931  1.00 18.39  ? 291  GLU A CA  1 
ATOM   2042  C C   . GLU A 1 271 ? 10.367  34.873  58.452  1.00 19.00  ? 291  GLU A C   1 
ATOM   2043  O O   . GLU A 1 271 ? 10.267  35.257  57.287  1.00 18.49  ? 291  GLU A O   1 
ATOM   2044  C CB  . GLU A 1 271 ? 8.431   34.063  59.789  1.00 20.41  ? 291  GLU A CB  1 
ATOM   2045  C CG  . GLU A 1 271 ? 7.506   35.028  59.056  1.00 24.50  ? 291  GLU A CG  1 
ATOM   2046  C CD  . GLU A 1 271 ? 6.267   35.375  59.847  1.00 27.36  ? 291  GLU A CD  1 
ATOM   2047  O OE1 . GLU A 1 271 ? 5.191   34.817  59.543  1.00 30.60  ? 291  GLU A OE1 1 
ATOM   2048  O OE2 . GLU A 1 271 ? 6.368   36.202  60.778  1.00 28.22  ? 291  GLU A OE2 1 
ATOM   2049  N N   . GLU A 1 272 ? 11.128  35.492  59.342  1.00 20.69  ? 292  GLU A N   1 
ATOM   2050  C CA  . GLU A 1 272 ? 11.862  36.681  58.951  1.00 23.43  ? 292  GLU A CA  1 
ATOM   2051  C C   . GLU A 1 272 ? 12.927  36.433  57.892  1.00 21.77  ? 292  GLU A C   1 
ATOM   2052  O O   . GLU A 1 272 ? 13.157  37.291  57.043  1.00 22.52  ? 292  GLU A O   1 
ATOM   2053  C CB  . GLU A 1 272 ? 12.460  37.359  60.181  1.00 27.87  ? 292  GLU A CB  1 
ATOM   2054  C CG  . GLU A 1 272 ? 11.430  38.222  60.892  1.00 38.36  ? 292  GLU A CG  1 
ATOM   2055  C CD  . GLU A 1 272 ? 11.940  38.841  62.180  1.00 44.35  ? 292  GLU A CD  1 
ATOM   2056  O OE1 . GLU A 1 272 ? 13.104  39.309  62.206  1.00 47.65  ? 292  GLU A OE1 1 
ATOM   2057  O OE2 . GLU A 1 272 ? 11.164  38.873  63.165  1.00 47.37  ? 292  GLU A OE2 1 
ATOM   2058  N N   . GLU A 1 273 ? 13.565  35.266  57.915  1.00 19.73  ? 293  GLU A N   1 
ATOM   2059  C CA  . GLU A 1 273 ? 14.589  34.969  56.920  1.00 17.41  ? 293  GLU A CA  1 
ATOM   2060  C C   . GLU A 1 273 ? 13.941  34.831  55.542  1.00 17.20  ? 293  GLU A C   1 
ATOM   2061  O O   . GLU A 1 273 ? 14.449  35.350  54.541  1.00 16.67  ? 293  GLU A O   1 
ATOM   2062  C CB  . GLU A 1 273 ? 15.323  33.685  57.288  1.00 17.14  ? 293  GLU A CB  1 
ATOM   2063  C CG  . GLU A 1 273 ? 15.815  33.667  58.717  1.00 18.18  ? 293  GLU A CG  1 
ATOM   2064  C CD  . GLU A 1 273 ? 16.899  32.639  58.964  1.00 18.25  ? 293  GLU A CD  1 
ATOM   2065  O OE1 . GLU A 1 273 ? 18.044  32.849  58.500  1.00 21.68  ? 293  GLU A OE1 1 
ATOM   2066  O OE2 . GLU A 1 273 ? 16.607  31.621  59.619  1.00 16.86  ? 293  GLU A OE2 1 
ATOM   2067  N N   . LEU A 1 274 ? 12.812  34.130  55.500  1.00 15.80  ? 294  LEU A N   1 
ATOM   2068  C CA  . LEU A 1 274 ? 12.086  33.935  54.260  1.00 13.36  ? 294  LEU A CA  1 
ATOM   2069  C C   . LEU A 1 274 ? 11.458  35.250  53.844  1.00 12.47  ? 294  LEU A C   1 
ATOM   2070  O O   . LEU A 1 274 ? 11.306  35.531  52.658  1.00 12.71  ? 294  LEU A O   1 
ATOM   2071  C CB  . LEU A 1 274 ? 11.009  32.867  54.437  1.00 13.26  ? 294  LEU A CB  1 
ATOM   2072  C CG  . LEU A 1 274 ? 11.549  31.451  54.642  1.00 12.02  ? 294  LEU A CG  1 
ATOM   2073  C CD1 . LEU A 1 274 ? 10.381  30.485  54.701  1.00 10.21  ? 294  LEU A CD1 1 
ATOM   2074  C CD2 . LEU A 1 274 ? 12.504  31.087  53.504  1.00 8.28   ? 294  LEU A CD2 1 
ATOM   2075  N N   . LEU A 1 275 ? 11.084  36.064  54.819  1.00 11.65  ? 295  LEU A N   1 
ATOM   2076  C CA  . LEU A 1 275 ? 10.503  37.355  54.492  1.00 11.87  ? 295  LEU A CA  1 
ATOM   2077  C C   . LEU A 1 275 ? 11.593  38.236  53.896  1.00 12.54  ? 295  LEU A C   1 
ATOM   2078  O O   . LEU A 1 275 ? 11.369  38.911  52.896  1.00 12.37  ? 295  LEU A O   1 
ATOM   2079  C CB  . LEU A 1 275 ? 9.913   38.022  55.737  1.00 10.86  ? 295  LEU A CB  1 
ATOM   2080  C CG  . LEU A 1 275 ? 9.484   39.485  55.590  1.00 8.65   ? 295  LEU A CG  1 
ATOM   2081  C CD1 . LEU A 1 275 ? 8.550   39.632  54.407  1.00 7.80   ? 295  LEU A CD1 1 
ATOM   2082  C CD2 . LEU A 1 275 ? 8.821   39.954  56.870  1.00 6.82   ? 295  LEU A CD2 1 
ATOM   2083  N N   . GLU A 1 276 ? 12.779  38.219  54.497  1.00 14.46  ? 296  GLU A N   1 
ATOM   2084  C CA  . GLU A 1 276 ? 13.863  39.035  53.977  1.00 17.13  ? 296  GLU A CA  1 
ATOM   2085  C C   . GLU A 1 276 ? 14.345  38.464  52.647  1.00 14.75  ? 296  GLU A C   1 
ATOM   2086  O O   . GLU A 1 276 ? 14.860  39.193  51.808  1.00 14.14  ? 296  GLU A O   1 
ATOM   2087  C CB  . GLU A 1 276 ? 15.016  39.151  54.992  1.00 21.57  ? 296  GLU A CB  1 
ATOM   2088  C CG  . GLU A 1 276 ? 15.995  37.997  55.021  1.00 31.55  ? 296  GLU A CG  1 
ATOM   2089  C CD  . GLU A 1 276 ? 17.232  38.304  55.872  1.00 37.65  ? 296  GLU A CD  1 
ATOM   2090  O OE1 . GLU A 1 276 ? 17.860  39.367  55.647  1.00 39.34  ? 296  GLU A OE1 1 
ATOM   2091  O OE2 . GLU A 1 276 ? 17.583  37.483  56.760  1.00 40.48  ? 296  GLU A OE2 1 
ATOM   2092  N N   . THR A 1 277 ? 14.164  37.164  52.444  1.00 14.17  ? 297  THR A N   1 
ATOM   2093  C CA  . THR A 1 277 ? 14.559  36.550  51.180  1.00 14.81  ? 297  THR A CA  1 
ATOM   2094  C C   . THR A 1 277 ? 13.595  37.016  50.093  1.00 16.33  ? 297  THR A C   1 
ATOM   2095  O O   . THR A 1 277 ? 14.000  37.284  48.957  1.00 15.55  ? 297  THR A O   1 
ATOM   2096  C CB  . THR A 1 277 ? 14.491  35.024  51.234  1.00 13.58  ? 297  THR A CB  1 
ATOM   2097  O OG1 . THR A 1 277 ? 15.478  34.533  52.144  1.00 14.39  ? 297  THR A OG1 1 
ATOM   2098  C CG2 . THR A 1 277 ? 14.741  34.443  49.861  1.00 11.36  ? 297  THR A CG2 1 
ATOM   2099  N N   . THR A 1 278 ? 12.317  37.097  50.464  1.00 17.47  ? 298  THR A N   1 
ATOM   2100  C CA  . THR A 1 278 ? 11.249  37.533  49.572  1.00 16.65  ? 298  THR A CA  1 
ATOM   2101  C C   . THR A 1 278 ? 11.521  38.964  49.130  1.00 17.88  ? 298  THR A C   1 
ATOM   2102  O O   . THR A 1 278 ? 11.415  39.293  47.943  1.00 19.17  ? 298  THR A O   1 
ATOM   2103  C CB  . THR A 1 278 ? 9.881   37.513  50.282  1.00 15.68  ? 298  THR A CB  1 
ATOM   2104  O OG1 . THR A 1 278 ? 9.622   36.206  50.805  1.00 15.32  ? 298  THR A OG1 1 
ATOM   2105  C CG2 . THR A 1 278 ? 8.779   37.885  49.312  1.00 16.12  ? 298  THR A CG2 1 
ATOM   2106  N N   . LEU A 1 279 ? 11.872  39.813  50.091  1.00 17.03  ? 299  LEU A N   1 
ATOM   2107  C CA  . LEU A 1 279 ? 12.159  41.208  49.800  1.00 16.72  ? 299  LEU A CA  1 
ATOM   2108  C C   . LEU A 1 279 ? 13.348  41.384  48.858  1.00 18.14  ? 299  LEU A C   1 
ATOM   2109  O O   . LEU A 1 279 ? 13.390  42.333  48.083  1.00 18.34  ? 299  LEU A O   1 
ATOM   2110  C CB  . LEU A 1 279 ? 12.385  41.972  51.104  1.00 14.89  ? 299  LEU A CB  1 
ATOM   2111  C CG  . LEU A 1 279 ? 11.123  42.130  51.968  1.00 14.62  ? 299  LEU A CG  1 
ATOM   2112  C CD1 . LEU A 1 279 ? 11.474  42.665  53.340  1.00 12.80  ? 299  LEU A CD1 1 
ATOM   2113  C CD2 . LEU A 1 279 ? 10.145  43.052  51.270  1.00 13.21  ? 299  LEU A CD2 1 
ATOM   2114  N N   . LYS A 1 280 ? 14.306  40.466  48.900  1.00 20.81  ? 300  LYS A N   1 
ATOM   2115  C CA  . LYS A 1 280 ? 15.470  40.570  48.028  1.00 23.92  ? 300  LYS A CA  1 
ATOM   2116  C C   . LYS A 1 280 ? 15.192  40.198  46.577  1.00 26.80  ? 300  LYS A C   1 
ATOM   2117  O O   . LYS A 1 280 ? 15.786  40.773  45.668  1.00 27.66  ? 300  LYS A O   1 
ATOM   2118  C CB  . LYS A 1 280 ? 16.608  39.687  48.528  1.00 24.15  ? 300  LYS A CB  1 
ATOM   2119  C CG  . LYS A 1 280 ? 17.273  40.121  49.812  1.00 25.86  ? 300  LYS A CG  1 
ATOM   2120  C CD  . LYS A 1 280 ? 18.542  39.301  49.992  1.00 28.16  ? 300  LYS A CD  1 
ATOM   2121  C CE  . LYS A 1 280 ? 19.053  39.288  51.420  1.00 28.86  ? 300  LYS A CE  1 
ATOM   2122  N NZ  . LYS A 1 280 ? 20.316  38.495  51.505  1.00 29.79  ? 300  LYS A NZ  1 
ATOM   2123  N N   . MET A 1 281 ? 14.308  39.228  46.357  1.00 30.50  ? 301  MET A N   1 
ATOM   2124  C CA  . MET A 1 281 ? 13.983  38.776  45.003  1.00 33.57  ? 301  MET A CA  1 
ATOM   2125  C C   . MET A 1 281 ? 13.253  39.853  44.203  1.00 36.57  ? 301  MET A C   1 
ATOM   2126  O O   . MET A 1 281 ? 13.253  39.831  42.969  1.00 35.32  ? 301  MET A O   1 
ATOM   2127  C CB  . MET A 1 281 ? 13.113  37.518  45.058  1.00 33.94  ? 301  MET A CB  1 
ATOM   2128  C CG  . MET A 1 281 ? 13.670  36.348  45.881  1.00 35.55  ? 301  MET A CG  1 
ATOM   2129  S SD  . MET A 1 281 ? 15.033  35.437  45.116  1.00 36.28  ? 301  MET A SD  1 
ATOM   2130  C CE  . MET A 1 281 ? 14.168  34.505  43.841  1.00 37.98  ? 301  MET A CE  1 
ATOM   2131  N N   . LYS A 1 282 ? 12.631  40.790  44.916  1.00 40.92  ? 302  LYS A N   1 
ATOM   2132  C CA  . LYS A 1 282 ? 11.890  41.887  44.294  1.00 44.93  ? 302  LYS A CA  1 
ATOM   2133  C C   . LYS A 1 282 ? 10.950  41.360  43.219  1.00 47.20  ? 302  LYS A C   1 
ATOM   2134  O O   . LYS A 1 282 ? 10.962  41.827  42.078  1.00 48.56  ? 302  LYS A O   1 
ATOM   2135  C CB  . LYS A 1 282 ? 12.860  42.906  43.687  1.00 45.42  ? 302  LYS A CB  1 
ATOM   2136  C CG  . LYS A 1 282 ? 13.828  43.502  44.690  1.00 47.50  ? 302  LYS A CG  1 
ATOM   2137  C CD  . LYS A 1 282 ? 14.753  44.522  44.049  1.00 50.57  ? 302  LYS A CD  1 
ATOM   2138  C CE  . LYS A 1 282 ? 15.705  45.109  45.083  1.00 52.76  ? 302  LYS A CE  1 
ATOM   2139  N NZ  . LYS A 1 282 ? 16.550  46.218  44.548  1.00 54.46  ? 302  LYS A NZ  1 
ATOM   2140  N N   . PHE A 1 283 ? 10.132  40.385  43.592  1.00 49.41  ? 303  PHE A N   1 
ATOM   2141  C CA  . PHE A 1 283 ? 9.192   39.787  42.658  1.00 51.63  ? 303  PHE A CA  1 
ATOM   2142  C C   . PHE A 1 283 ? 8.233   40.821  42.068  1.00 53.33  ? 303  PHE A C   1 
ATOM   2143  O O   . PHE A 1 283 ? 7.953   40.808  40.872  1.00 53.28  ? 303  PHE A O   1 
ATOM   2144  C CB  . PHE A 1 283 ? 8.376   38.688  43.350  1.00 51.76  ? 303  PHE A CB  1 
ATOM   2145  C CG  . PHE A 1 283 ? 9.204   37.560  43.911  1.00 51.09  ? 303  PHE A CG  1 
ATOM   2146  C CD1 . PHE A 1 283 ? 9.484   37.493  45.277  1.00 50.93  ? 303  PHE A CD1 1 
ATOM   2147  C CD2 . PHE A 1 283 ? 9.665   36.541  43.082  1.00 50.81  ? 303  PHE A CD2 1 
ATOM   2148  C CE1 . PHE A 1 283 ? 10.208  36.421  45.810  1.00 50.43  ? 303  PHE A CE1 1 
ATOM   2149  C CE2 . PHE A 1 283 ? 10.390  35.465  43.600  1.00 50.38  ? 303  PHE A CE2 1 
ATOM   2150  C CZ  . PHE A 1 283 ? 10.660  35.404  44.967  1.00 50.72  ? 303  PHE A CZ  1 
ATOM   2151  N N   . LEU A 1 284 ? 7.744   41.722  42.912  1.00 55.76  ? 304  LEU A N   1 
ATOM   2152  C CA  . LEU A 1 284 ? 6.794   42.740  42.486  1.00 58.65  ? 304  LEU A CA  1 
ATOM   2153  C C   . LEU A 1 284 ? 7.287   43.713  41.410  1.00 61.45  ? 304  LEU A C   1 
ATOM   2154  O O   . LEU A 1 284 ? 6.691   43.801  40.339  1.00 63.18  ? 304  LEU A O   1 
ATOM   2155  C CB  . LEU A 1 284 ? 6.298   43.517  43.709  1.00 57.43  ? 304  LEU A CB  1 
ATOM   2156  C CG  . LEU A 1 284 ? 5.805   42.624  44.858  1.00 57.96  ? 304  LEU A CG  1 
ATOM   2157  C CD1 . LEU A 1 284 ? 5.384   43.482  46.040  1.00 57.28  ? 304  LEU A CD1 1 
ATOM   2158  C CD2 . LEU A 1 284 ? 4.650   41.753  44.383  1.00 57.48  ? 304  LEU A CD2 1 
ATOM   2159  N N   . SER A 1 285 ? 8.369   44.437  41.677  1.00 64.41  ? 305  SER A N   1 
ATOM   2160  C CA  . SER A 1 285 ? 8.880   45.403  40.703  1.00 66.94  ? 305  SER A CA  1 
ATOM   2161  C C   . SER A 1 285 ? 9.464   44.807  39.428  1.00 68.59  ? 305  SER A C   1 
ATOM   2162  O O   . SER A 1 285 ? 9.954   43.673  39.418  1.00 67.74  ? 305  SER A O   1 
ATOM   2163  C CB  . SER A 1 285 ? 9.921   46.317  41.353  1.00 67.10  ? 305  SER A CB  1 
ATOM   2164  O OG  . SER A 1 285 ? 9.295   47.299  42.160  1.00 67.65  ? 305  SER A OG  1 
ATOM   2165  N N   . LEU A 1 286 ? 9.404   45.600  38.358  1.00 71.06  ? 306  LEU A N   1 
ATOM   2166  C CA  . LEU A 1 286 ? 9.908   45.208  37.044  1.00 74.23  ? 306  LEU A CA  1 
ATOM   2167  C C   . LEU A 1 286 ? 11.318  45.747  36.816  1.00 76.16  ? 306  LEU A C   1 
ATOM   2168  O O   . LEU A 1 286 ? 11.543  46.961  36.868  1.00 76.33  ? 306  LEU A O   1 
ATOM   2169  C CB  . LEU A 1 286 ? 8.976   45.736  35.944  1.00 74.76  ? 306  LEU A CB  1 
ATOM   2170  C CG  . LEU A 1 286 ? 9.333   45.468  34.474  1.00 74.75  ? 306  LEU A CG  1 
ATOM   2171  C CD1 . LEU A 1 286 ? 9.409   43.971  34.218  1.00 74.23  ? 306  LEU A CD1 1 
ATOM   2172  C CD2 . LEU A 1 286 ? 8.284   46.103  33.571  1.00 74.40  ? 306  LEU A CD2 1 
ATOM   2173  N N   . ASP A 1 287 ? 12.261  44.840  36.562  1.00 78.00  ? 307  ASP A N   1 
ATOM   2174  C CA  . ASP A 1 287 ? 13.654  45.220  36.326  1.00 79.28  ? 307  ASP A CA  1 
ATOM   2175  C C   . ASP A 1 287 ? 13.792  45.890  34.961  1.00 79.63  ? 307  ASP A C   1 
ATOM   2176  O O   . ASP A 1 287 ? 13.404  45.325  33.934  1.00 79.57  ? 307  ASP A O   1 
ATOM   2177  C CB  . ASP A 1 287 ? 14.561  43.988  36.383  1.00 80.04  ? 307  ASP A CB  1 
ATOM   2178  C CG  . ASP A 1 287 ? 16.035  44.344  36.283  1.00 80.67  ? 307  ASP A CG  1 
ATOM   2179  O OD1 . ASP A 1 287 ? 16.839  43.454  35.924  1.00 80.42  ? 307  ASP A OD1 1 
ATOM   2180  O OD2 . ASP A 1 287 ? 16.388  45.511  36.570  1.00 80.85  ? 307  ASP A OD2 1 
ATOM   2181  N N   . LEU A 1 288 ? 14.359  47.090  34.953  1.00 79.62  ? 308  LEU A N   1 
ATOM   2182  C CA  . LEU A 1 288 ? 14.521  47.831  33.713  1.00 79.96  ? 308  LEU A CA  1 
ATOM   2183  C C   . LEU A 1 288 ? 15.761  47.485  32.895  1.00 80.20  ? 308  LEU A C   1 
ATOM   2184  O O   . LEU A 1 288 ? 15.751  47.632  31.672  1.00 80.05  ? 308  LEU A O   1 
ATOM   2185  C CB  . LEU A 1 288 ? 14.496  49.337  34.001  1.00 79.57  ? 308  LEU A CB  1 
ATOM   2186  C CG  . LEU A 1 288 ? 13.128  49.937  34.340  1.00 78.01  ? 308  LEU A CG  1 
ATOM   2187  C CD1 . LEU A 1 288 ? 13.277  51.415  34.663  1.00 77.37  ? 308  LEU A CD1 1 
ATOM   2188  C CD2 . LEU A 1 288 ? 12.187  49.740  33.162  1.00 77.18  ? 308  LEU A CD2 1 
ATOM   2189  N N   . GLN A 1 289 ? 16.825  47.022  33.544  1.00 80.90  ? 309  GLN A N   1 
ATOM   2190  C CA  . GLN A 1 289 ? 18.036  46.701  32.793  1.00 81.34  ? 309  GLN A CA  1 
ATOM   2191  C C   . GLN A 1 289 ? 18.389  45.227  32.673  1.00 80.76  ? 309  GLN A C   1 
ATOM   2192  O O   . GLN A 1 289 ? 17.698  44.356  33.201  1.00 80.54  ? 309  GLN A O   1 
ATOM   2193  C CB  . GLN A 1 289 ? 19.233  47.468  33.357  1.00 81.90  ? 309  GLN A CB  1 
ATOM   2194  C CG  . GLN A 1 289 ? 19.668  47.071  34.742  1.00 83.33  ? 309  GLN A CG  1 
ATOM   2195  C CD  . GLN A 1 289 ? 20.869  47.878  35.199  1.00 85.22  ? 309  GLN A CD  1 
ATOM   2196  O OE1 . GLN A 1 289 ? 20.764  49.077  35.463  1.00 85.66  ? 309  GLN A OE1 1 
ATOM   2197  N NE2 . GLN A 1 289 ? 22.023  47.227  35.277  1.00 86.62  ? 309  GLN A NE2 1 
ATOM   2198  N N   . GLY A 1 290 ? 19.484  44.964  31.967  1.00 80.58  ? 310  GLY A N   1 
ATOM   2199  C CA  . GLY A 1 290 ? 19.917  43.601  31.752  1.00 80.70  ? 310  GLY A CA  1 
ATOM   2200  C C   . GLY A 1 290 ? 19.034  42.988  30.688  1.00 81.40  ? 310  GLY A C   1 
ATOM   2201  O O   . GLY A 1 290 ? 18.070  43.610  30.239  1.00 80.90  ? 310  GLY A O   1 
ATOM   2202  N N   . ASP A 1 291 ? 19.359  41.770  30.278  1.00 82.70  ? 311  ASP A N   1 
ATOM   2203  C CA  . ASP A 1 291 ? 18.578  41.079  29.262  1.00 84.64  ? 311  ASP A CA  1 
ATOM   2204  C C   . ASP A 1 291 ? 17.172  40.783  29.801  1.00 85.56  ? 311  ASP A C   1 
ATOM   2205  O O   . ASP A 1 291 ? 17.023  40.174  30.863  1.00 85.77  ? 311  ASP A O   1 
ATOM   2206  C CB  . ASP A 1 291 ? 19.283  39.775  28.875  1.00 85.39  ? 311  ASP A CB  1 
ATOM   2207  C CG  . ASP A 1 291 ? 18.675  39.121  27.649  1.00 86.08  ? 311  ASP A CG  1 
ATOM   2208  O OD1 . ASP A 1 291 ? 17.490  38.723  27.706  1.00 86.05  ? 311  ASP A OD1 1 
ATOM   2209  O OD2 . ASP A 1 291 ? 19.389  39.006  26.627  1.00 85.98  ? 311  ASP A OD2 1 
ATOM   2210  N N   . PRO A 1 292 ? 16.126  41.222  29.073  1.00 86.03  ? 312  PRO A N   1 
ATOM   2211  C CA  . PRO A 1 292 ? 14.706  41.044  29.411  1.00 86.32  ? 312  PRO A CA  1 
ATOM   2212  C C   . PRO A 1 292 ? 14.256  39.622  29.796  1.00 86.83  ? 312  PRO A C   1 
ATOM   2213  O O   . PRO A 1 292 ? 13.809  39.392  30.924  1.00 86.21  ? 312  PRO A O   1 
ATOM   2214  C CB  . PRO A 1 292 ? 13.995  41.546  28.157  1.00 85.83  ? 312  PRO A CB  1 
ATOM   2215  C CG  . PRO A 1 292 ? 14.880  42.652  27.715  1.00 85.69  ? 312  PRO A CG  1 
ATOM   2216  C CD  . PRO A 1 292 ? 16.262  42.045  27.856  1.00 85.78  ? 312  PRO A CD  1 
ATOM   2217  N N   . ARG A 1 293 ? 14.366  38.686  28.852  1.00 87.30  ? 313  ARG A N   1 
ATOM   2218  C CA  . ARG A 1 293 ? 13.958  37.292  29.061  1.00 87.54  ? 313  ARG A CA  1 
ATOM   2219  C C   . ARG A 1 293 ? 14.549  36.664  30.299  1.00 87.67  ? 313  ARG A C   1 
ATOM   2220  O O   . ARG A 1 293 ? 13.993  35.718  30.853  1.00 87.74  ? 313  ARG A O   1 
ATOM   2221  C CB  . ARG A 1 293 ? 14.332  36.441  27.857  1.00 87.40  ? 313  ARG A CB  1 
ATOM   2222  C CG  . ARG A 1 293 ? 13.581  36.796  26.607  1.00 88.20  ? 313  ARG A CG  1 
ATOM   2223  C CD  . ARG A 1 293 ? 14.201  36.085  25.439  1.00 89.44  ? 313  ARG A CD  1 
ATOM   2224  N NE  . ARG A 1 293 ? 15.619  36.415  25.334  1.00 90.57  ? 313  ARG A NE  1 
ATOM   2225  C CZ  . ARG A 1 293 ? 16.425  35.966  24.377  1.00 91.43  ? 313  ARG A CZ  1 
ATOM   2226  N NH1 . ARG A 1 293 ? 15.955  35.158  23.433  1.00 92.02  ? 313  ARG A NH1 1 
ATOM   2227  N NH2 . ARG A 1 293 ? 17.700  36.333  24.356  1.00 91.31  ? 313  ARG A NH2 1 
ATOM   2228  N N   . GLU A 1 294 ? 15.692  37.178  30.728  1.00 88.37  ? 314  GLU A N   1 
ATOM   2229  C CA  . GLU A 1 294 ? 16.329  36.654  31.925  1.00 88.72  ? 314  GLU A CA  1 
ATOM   2230  C C   . GLU A 1 294 ? 15.644  37.174  33.175  1.00 88.18  ? 314  GLU A C   1 
ATOM   2231  O O   . GLU A 1 294 ? 15.415  36.423  34.130  1.00 88.44  ? 314  GLU A O   1 
ATOM   2232  C CB  . GLU A 1 294 ? 17.797  37.060  31.986  1.00 89.01  ? 314  GLU A CB  1 
ATOM   2233  C CG  . GLU A 1 294 ? 18.673  36.508  30.889  1.00 90.45  ? 314  GLU A CG  1 
ATOM   2234  C CD  . GLU A 1 294 ? 20.146  36.743  31.164  1.00 91.57  ? 314  GLU A CD  1 
ATOM   2235  O OE1 . GLU A 1 294 ? 20.541  37.913  31.378  1.00 91.28  ? 314  GLU A OE1 1 
ATOM   2236  O OE2 . GLU A 1 294 ? 20.906  35.752  31.158  1.00 91.57  ? 314  GLU A OE2 1 
ATOM   2237  N N   . SER A 1 295 ? 15.316  38.456  33.160  1.00 87.32  ? 315  SER A N   1 
ATOM   2238  C CA  . SER A 1 295 ? 14.697  39.076  34.316  1.00 85.83  ? 315  SER A CA  1 
ATOM   2239  C C   . SER A 1 295 ? 13.922  38.085  35.180  1.00 84.19  ? 315  SER A C   1 
ATOM   2240  O O   . SER A 1 295 ? 13.155  37.246  34.718  1.00 83.73  ? 315  SER A O   1 
ATOM   2241  C CB  . SER A 1 295 ? 13.855  40.277  33.903  1.00 86.08  ? 315  SER A CB  1 
ATOM   2242  O OG  . SER A 1 295 ? 14.543  41.473  34.267  1.00 86.24  ? 315  SER A OG  1 
ATOM   2243  N N   . GLN A 1 296 ? 14.192  38.191  36.466  1.00 82.38  ? 316  GLN A N   1 
ATOM   2244  C CA  . GLN A 1 296 ? 13.654  37.308  37.473  1.00 79.89  ? 316  GLN A CA  1 
ATOM   2245  C C   . GLN A 1 296 ? 12.172  36.998  37.518  1.00 78.01  ? 316  GLN A C   1 
ATOM   2246  O O   . GLN A 1 296 ? 11.287  37.890  37.508  1.00 78.33  ? 316  GLN A O   1 
ATOM   2247  C CB  . GLN A 1 296 ? 14.169  37.771  38.828  1.00 79.57  ? 316  GLN A CB  1 
ATOM   2248  C CG  . GLN A 1 296 ? 13.180  37.760  39.938  1.00 79.15  ? 316  GLN A CG  1 
ATOM   2249  C CD  . GLN A 1 296 ? 13.033  36.403  40.568  1.00 79.16  ? 316  GLN A CD  1 
ATOM   2250  O OE1 . GLN A 1 296 ? 12.254  36.237  41.502  1.00 79.67  ? 316  GLN A OE1 1 
ATOM   2251  N NE2 . GLN A 1 296 ? 13.766  35.396  40.075  1.00 78.12  ? 316  GLN A NE2 1 
ATOM   2252  N N   . PRO A 1 297 ? 11.894  35.694  37.513  1.00 75.79  ? 317  PRO A N   1 
ATOM   2253  C CA  . PRO A 1 297 ? 10.629  34.984  37.565  1.00 72.23  ? 317  PRO A CA  1 
ATOM   2254  C C   . PRO A 1 297 ? 9.861   35.471  38.741  1.00 69.05  ? 317  PRO A C   1 
ATOM   2255  O O   . PRO A 1 297 ? 10.156  36.494  39.337  1.00 70.85  ? 317  PRO A O   1 
ATOM   2256  C CB  . PRO A 1 297 ? 11.064  33.537  37.722  1.00 73.26  ? 317  PRO A CB  1 
ATOM   2257  C CG  . PRO A 1 297 ? 12.217  33.483  36.816  1.00 73.43  ? 317  PRO A CG  1 
ATOM   2258  C CD  . PRO A 1 297 ? 12.945  34.817  36.973  1.00 74.25  ? 317  PRO A CD  1 
ATOM   2259  N N   . LEU A 1 298 ? 8.837   34.725  39.033  1.00 63.54  ? 318  LEU A N   1 
ATOM   2260  C CA  . LEU A 1 298 ? 7.968   34.989  40.139  1.00 57.76  ? 318  LEU A CA  1 
ATOM   2261  C C   . LEU A 1 298 ? 7.512   33.562  40.165  1.00 52.19  ? 318  LEU A C   1 
ATOM   2262  O O   . LEU A 1 298 ? 7.630   32.871  39.161  1.00 51.09  ? 318  LEU A O   1 
ATOM   2263  C CB  . LEU A 1 298 ? 6.831   35.918  39.716  1.00 57.64  ? 318  LEU A CB  1 
ATOM   2264  C CG  . LEU A 1 298 ? 7.129   36.692  38.425  1.00 57.31  ? 318  LEU A CG  1 
ATOM   2265  C CD1 . LEU A 1 298 ? 7.217   35.749  37.217  1.00 57.64  ? 318  LEU A CD1 1 
ATOM   2266  C CD2 . LEU A 1 298 ? 6.046   37.697  38.190  1.00 58.00  ? 318  LEU A CD2 1 
ATOM   2267  N N   . LEU A 1 299 ? 7.027   33.100  41.289  1.00 45.22  ? 319  LEU A N   1 
ATOM   2268  C CA  . LEU A 1 299 ? 6.562   31.742  41.366  1.00 39.15  ? 319  LEU A CA  1 
ATOM   2269  C C   . LEU A 1 299 ? 5.053   31.847  41.330  1.00 35.01  ? 319  LEU A C   1 
ATOM   2270  O O   . LEU A 1 299 ? 4.524   32.921  41.536  1.00 34.46  ? 319  LEU A O   1 
ATOM   2271  C CB  . LEU A 1 299 ? 7.035   31.131  42.677  1.00 36.92  ? 319  LEU A CB  1 
ATOM   2272  C CG  . LEU A 1 299 ? 6.889   31.997  43.937  1.00 34.17  ? 319  LEU A CG  1 
ATOM   2273  C CD1 . LEU A 1 299 ? 7.842   31.433  44.967  1.00 33.32  ? 319  LEU A CD1 1 
ATOM   2274  C CD2 . LEU A 1 299 ? 7.230   33.476  43.702  1.00 33.87  ? 319  LEU A CD2 1 
ATOM   2275  N N   . GLY A 1 300 ? 4.357   30.756  41.068  1.00 31.31  ? 320  GLY A N   1 
ATOM   2276  C CA  . GLY A 1 300 ? 2.909   30.815  41.058  1.00 26.28  ? 320  GLY A CA  1 
ATOM   2277  C C   . GLY A 1 300 ? 2.346   29.440  40.793  1.00 23.84  ? 320  GLY A C   1 
ATOM   2278  O O   . GLY A 1 300 ? 2.938   28.426  41.158  1.00 24.07  ? 320  GLY A O   1 
ATOM   2279  N N   . THR A 1 301 ? 1.198   29.407  40.140  1.00 20.68  ? 321  THR A N   1 
ATOM   2280  C CA  . THR A 1 301 ? 0.539   28.158  39.820  1.00 17.24  ? 321  THR A CA  1 
ATOM   2281  C C   . THR A 1 301 ? 1.448   27.285  38.968  1.00 15.60  ? 321  THR A C   1 
ATOM   2282  O O   . THR A 1 301 ? 2.076   27.769  38.036  1.00 16.25  ? 321  THR A O   1 
ATOM   2283  C CB  . THR A 1 301 ? -0.754  28.437  39.051  1.00 16.49  ? 321  THR A CB  1 
ATOM   2284  O OG1 . THR A 1 301 ? -1.558  29.350  39.804  1.00 16.13  ? 321  THR A OG1 1 
ATOM   2285  C CG2 . THR A 1 301 ? -1.535  27.158  38.818  1.00 16.09  ? 321  THR A CG2 1 
ATOM   2286  N N   . VAL A 1 302 ? 1.528   26.000  39.293  1.00 13.16  ? 322  VAL A N   1 
ATOM   2287  C CA  . VAL A 1 302 ? 2.348   25.079  38.510  1.00 12.18  ? 322  VAL A CA  1 
ATOM   2288  C C   . VAL A 1 302 ? 1.531   23.835  38.183  1.00 11.20  ? 322  VAL A C   1 
ATOM   2289  O O   . VAL A 1 302 ? 0.498   23.587  38.807  1.00 11.70  ? 322  VAL A O   1 
ATOM   2290  C CB  . VAL A 1 302 ? 3.660   24.670  39.263  1.00 12.13  ? 322  VAL A CB  1 
ATOM   2291  C CG1 . VAL A 1 302 ? 4.460   25.914  39.600  1.00 11.58  ? 322  VAL A CG1 1 
ATOM   2292  C CG2 . VAL A 1 302 ? 3.347   23.863  40.525  1.00 8.13   ? 322  VAL A CG2 1 
ATOM   2293  N N   . ILE A 1 303 ? 1.972   23.070  37.189  1.00 10.30  ? 323  ILE A N   1 
ATOM   2294  C CA  . ILE A 1 303 ? 1.266   21.850  36.807  1.00 9.49   ? 323  ILE A CA  1 
ATOM   2295  C C   . ILE A 1 303 ? 1.847   20.721  37.654  1.00 9.49   ? 323  ILE A C   1 
ATOM   2296  O O   . ILE A 1 303 ? 2.731   19.998  37.206  1.00 9.32   ? 323  ILE A O   1 
ATOM   2297  C CB  . ILE A 1 303 ? 1.487   21.516  35.312  1.00 9.13   ? 323  ILE A CB  1 
ATOM   2298  C CG1 . ILE A 1 303 ? 1.154   22.732  34.444  1.00 5.32   ? 323  ILE A CG1 1 
ATOM   2299  C CG2 . ILE A 1 303 ? 0.648   20.308  34.917  1.00 6.69   ? 323  ILE A CG2 1 
ATOM   2300  C CD1 . ILE A 1 303 ? -0.245  23.222  34.610  1.00 8.22   ? 323  ILE A CD1 1 
ATOM   2301  N N   . ASP A 1 304 ? 1.331   20.570  38.870  1.00 9.62   ? 324  ASP A N   1 
ATOM   2302  C CA  . ASP A 1 304 ? 1.816   19.571  39.818  1.00 11.86  ? 324  ASP A CA  1 
ATOM   2303  C C   . ASP A 1 304 ? 1.339   18.119  39.666  1.00 13.26  ? 324  ASP A C   1 
ATOM   2304  O O   . ASP A 1 304 ? 1.881   17.205  40.302  1.00 11.89  ? 324  ASP A O   1 
ATOM   2305  C CB  . ASP A 1 304 ? 1.476   20.027  41.226  1.00 12.39  ? 324  ASP A CB  1 
ATOM   2306  C CG  . ASP A 1 304 ? -0.008  20.101  41.452  1.00 13.77  ? 324  ASP A CG  1 
ATOM   2307  O OD1 . ASP A 1 304 ? -0.433  20.080  42.622  1.00 15.90  ? 324  ASP A OD1 1 
ATOM   2308  O OD2 . ASP A 1 304 ? -0.752  20.183  40.454  1.00 14.82  ? 324  ASP A OD2 1 
ATOM   2309  N N   . GLY A 1 305 ? 0.327   17.895  38.845  1.00 14.48  ? 325  GLY A N   1 
ATOM   2310  C CA  . GLY A 1 305 ? -0.163  16.543  38.693  1.00 16.58  ? 325  GLY A CA  1 
ATOM   2311  C C   . GLY A 1 305 ? -1.076  16.157  39.846  1.00 18.42  ? 325  GLY A C   1 
ATOM   2312  O O   . GLY A 1 305 ? -1.377  14.976  40.037  1.00 20.93  ? 325  GLY A O   1 
ATOM   2313  N N   . MET A 1 306 ? -1.508  17.146  40.626  1.00 17.55  ? 326  MET A N   1 
ATOM   2314  C CA  . MET A 1 306 ? -2.412  16.903  41.742  1.00 17.35  ? 326  MET A CA  1 
ATOM   2315  C C   . MET A 1 306 ? -3.562  17.915  41.681  1.00 18.85  ? 326  MET A C   1 
ATOM   2316  O O   . MET A 1 306 ? -4.727  17.548  41.849  1.00 21.21  ? 326  MET A O   1 
ATOM   2317  C CB  . MET A 1 306 ? -1.677  17.034  43.074  1.00 17.71  ? 326  MET A CB  1 
ATOM   2318  C CG  . MET A 1 306 ? -0.545  16.029  43.298  1.00 20.36  ? 326  MET A CG  1 
ATOM   2319  S SD  . MET A 1 306 ? -0.996  14.522  44.203  1.00 18.01  ? 326  MET A SD  1 
ATOM   2320  C CE  . MET A 1 306 ? -1.653  15.258  45.735  1.00 20.18  ? 326  MET A CE  1 
ATOM   2321  N N   . LEU A 1 307 ? -3.241  19.186  41.442  1.00 16.55  ? 327  LEU A N   1 
ATOM   2322  C CA  . LEU A 1 307 ? -4.264  20.222  41.346  1.00 13.13  ? 327  LEU A CA  1 
ATOM   2323  C C   . LEU A 1 307 ? -4.555  20.463  39.866  1.00 14.30  ? 327  LEU A C   1 
ATOM   2324  O O   . LEU A 1 307 ? -5.699  20.650  39.469  1.00 13.67  ? 327  LEU A O   1 
ATOM   2325  C CB  . LEU A 1 307 ? -3.775  21.507  41.997  1.00 8.67   ? 327  LEU A CB  1 
ATOM   2326  C CG  . LEU A 1 307 ? -4.776  22.658  41.970  1.00 6.51   ? 327  LEU A CG  1 
ATOM   2327  C CD1 . LEU A 1 307 ? -5.839  22.485  43.038  1.00 1.63   ? 327  LEU A CD1 1 
ATOM   2328  C CD2 . LEU A 1 307 ? -4.026  23.947  42.177  1.00 7.38   ? 327  LEU A CD2 1 
ATOM   2329  N N   . LEU A 1 308 ? -3.503  20.478  39.057  1.00 16.05  ? 328  LEU A N   1 
ATOM   2330  C CA  . LEU A 1 308 ? -3.627  20.645  37.610  1.00 18.59  ? 328  LEU A CA  1 
ATOM   2331  C C   . LEU A 1 308 ? -2.855  19.474  37.007  1.00 20.58  ? 328  LEU A C   1 
ATOM   2332  O O   . LEU A 1 308 ? -1.697  19.251  37.359  1.00 21.34  ? 328  LEU A O   1 
ATOM   2333  C CB  . LEU A 1 308 ? -3.007  21.967  37.141  1.00 17.55  ? 328  LEU A CB  1 
ATOM   2334  C CG  . LEU A 1 308 ? -3.745  23.270  37.463  1.00 17.11  ? 328  LEU A CG  1 
ATOM   2335  C CD1 . LEU A 1 308 ? -2.920  24.449  36.974  1.00 14.60  ? 328  LEU A CD1 1 
ATOM   2336  C CD2 . LEU A 1 308 ? -5.117  23.269  36.809  1.00 15.35  ? 328  LEU A CD2 1 
ATOM   2337  N N   . LEU A 1 309 ? -3.490  18.720  36.117  1.00 21.26  ? 329  LEU A N   1 
ATOM   2338  C CA  . LEU A 1 309 ? -2.826  17.579  35.511  1.00 22.37  ? 329  LEU A CA  1 
ATOM   2339  C C   . LEU A 1 309 ? -2.138  17.965  34.216  1.00 23.55  ? 329  LEU A C   1 
ATOM   2340  O O   . LEU A 1 309 ? -1.395  17.184  33.634  1.00 24.62  ? 329  LEU A O   1 
ATOM   2341  C CB  . LEU A 1 309 ? -3.831  16.461  35.284  1.00 22.97  ? 329  LEU A CB  1 
ATOM   2342  C CG  . LEU A 1 309 ? -4.421  15.999  36.620  1.00 23.72  ? 329  LEU A CG  1 
ATOM   2343  C CD1 . LEU A 1 309 ? -5.544  14.996  36.392  1.00 22.87  ? 329  LEU A CD1 1 
ATOM   2344  C CD2 . LEU A 1 309 ? -3.313  15.401  37.473  1.00 23.67  ? 329  LEU A CD2 1 
ATOM   2345  N N   . LYS A 1 310 ? -2.395  19.182  33.772  1.00 24.16  ? 330  LYS A N   1 
ATOM   2346  C CA  . LYS A 1 310 ? -1.767  19.712  32.577  1.00 26.56  ? 330  LYS A CA  1 
ATOM   2347  C C   . LYS A 1 310 ? -2.081  21.193  32.489  1.00 27.04  ? 330  LYS A C   1 
ATOM   2348  O O   . LYS A 1 310 ? -2.788  21.725  33.344  1.00 28.35  ? 330  LYS A O   1 
ATOM   2349  C CB  . LYS A 1 310 ? -2.224  18.961  31.327  1.00 27.58  ? 330  LYS A CB  1 
ATOM   2350  C CG  . LYS A 1 310 ? -3.686  18.643  31.262  1.00 30.84  ? 330  LYS A CG  1 
ATOM   2351  C CD  . LYS A 1 310 ? -3.972  17.725  30.079  1.00 33.01  ? 330  LYS A CD  1 
ATOM   2352  C CE  . LYS A 1 310 ? -3.166  16.434  30.180  1.00 33.66  ? 330  LYS A CE  1 
ATOM   2353  N NZ  . LYS A 1 310 ? -3.480  15.497  29.066  1.00 35.54  ? 330  LYS A NZ  1 
ATOM   2354  N N   . THR A 1 311 ? -1.551  21.869  31.479  1.00 27.41  ? 331  THR A N   1 
ATOM   2355  C CA  . THR A 1 311 ? -1.779  23.301  31.354  1.00 27.31  ? 331  THR A CA  1 
ATOM   2356  C C   . THR A 1 311 ? -3.231  23.659  31.126  1.00 27.44  ? 331  THR A C   1 
ATOM   2357  O O   . THR A 1 311 ? -3.996  22.876  30.572  1.00 25.61  ? 331  THR A O   1 
ATOM   2358  C CB  . THR A 1 311 ? -0.983  23.905  30.197  1.00 27.70  ? 331  THR A CB  1 
ATOM   2359  O OG1 . THR A 1 311 ? -1.622  23.580  28.954  1.00 27.55  ? 331  THR A OG1 1 
ATOM   2360  C CG2 . THR A 1 311 ? 0.436   23.378  30.207  1.00 26.92  ? 331  THR A CG2 1 
ATOM   2361  N N   . PRO A 1 312 ? -3.634  24.856  31.573  1.00 29.13  ? 332  PRO A N   1 
ATOM   2362  C CA  . PRO A 1 312 ? -5.016  25.297  31.389  1.00 31.33  ? 332  PRO A CA  1 
ATOM   2363  C C   . PRO A 1 312 ? -5.293  25.260  29.891  1.00 33.90  ? 332  PRO A C   1 
ATOM   2364  O O   . PRO A 1 312 ? -6.379  24.893  29.446  1.00 32.73  ? 332  PRO A O   1 
ATOM   2365  C CB  . PRO A 1 312 ? -4.991  26.719  31.938  1.00 29.66  ? 332  PRO A CB  1 
ATOM   2366  C CG  . PRO A 1 312 ? -3.974  26.627  33.024  1.00 27.90  ? 332  PRO A CG  1 
ATOM   2367  C CD  . PRO A 1 312 ? -2.877  25.822  32.389  1.00 27.33  ? 332  PRO A CD  1 
ATOM   2368  N N   . GLU A 1 313 ? -4.271  25.634  29.127  1.00 38.52  ? 333  GLU A N   1 
ATOM   2369  C CA  . GLU A 1 313 ? -4.334  25.656  27.672  1.00 42.82  ? 333  GLU A CA  1 
ATOM   2370  C C   . GLU A 1 313 ? -4.703  24.281  27.117  1.00 44.83  ? 333  GLU A C   1 
ATOM   2371  O O   . GLU A 1 313 ? -5.294  24.178  26.046  1.00 45.04  ? 333  GLU A O   1 
ATOM   2372  C CB  . GLU A 1 313 ? -2.981  26.092  27.101  1.00 44.13  ? 333  GLU A CB  1 
ATOM   2373  C CG  . GLU A 1 313 ? -2.569  27.548  27.398  1.00 47.83  ? 333  GLU A CG  1 
ATOM   2374  C CD  . GLU A 1 313 ? -2.219  27.815  28.865  1.00 48.61  ? 333  GLU A CD  1 
ATOM   2375  O OE1 . GLU A 1 313 ? -1.528  26.977  29.479  1.00 49.01  ? 333  GLU A OE1 1 
ATOM   2376  O OE2 . GLU A 1 313 ? -2.616  28.878  29.398  1.00 50.06  ? 333  GLU A OE2 1 
ATOM   2377  N N   . GLU A 1 314 ? -4.344  23.233  27.855  1.00 48.05  ? 334  GLU A N   1 
ATOM   2378  C CA  . GLU A 1 314 ? -4.626  21.852  27.462  1.00 50.27  ? 334  GLU A CA  1 
ATOM   2379  C C   . GLU A 1 314 ? -5.951  21.345  28.021  1.00 51.77  ? 334  GLU A C   1 
ATOM   2380  O O   . GLU A 1 314 ? -6.710  20.684  27.323  1.00 52.61  ? 334  GLU A O   1 
ATOM   2381  C CB  . GLU A 1 314 ? -3.527  20.913  27.961  1.00 51.66  ? 334  GLU A CB  1 
ATOM   2382  C CG  . GLU A 1 314 ? -2.155  21.103  27.345  1.00 54.92  ? 334  GLU A CG  1 
ATOM   2383  C CD  . GLU A 1 314 ? -1.093  20.266  28.050  1.00 56.88  ? 334  GLU A CD  1 
ATOM   2384  O OE1 . GLU A 1 314 ? -1.273  19.034  28.167  1.00 58.23  ? 334  GLU A OE1 1 
ATOM   2385  O OE2 . GLU A 1 314 ? -0.078  20.839  28.493  1.00 58.08  ? 334  GLU A OE2 1 
ATOM   2386  N N   . LEU A 1 315 ? -6.213  21.642  29.291  1.00 54.00  ? 335  LEU A N   1 
ATOM   2387  C CA  . LEU A 1 315 ? -7.431  21.192  29.953  1.00 56.01  ? 335  LEU A CA  1 
ATOM   2388  C C   . LEU A 1 315 ? -8.725  21.765  29.382  1.00 58.88  ? 335  LEU A C   1 
ATOM   2389  O O   . LEU A 1 315 ? -9.757  21.094  29.401  1.00 59.68  ? 335  LEU A O   1 
ATOM   2390  C CB  . LEU A 1 315 ? -7.349  21.484  31.456  1.00 53.82  ? 335  LEU A CB  1 
ATOM   2391  C CG  . LEU A 1 315 ? -6.392  20.569  32.228  1.00 51.64  ? 335  LEU A CG  1 
ATOM   2392  C CD1 . LEU A 1 315 ? -6.276  21.011  33.670  1.00 50.93  ? 335  LEU A CD1 1 
ATOM   2393  C CD2 . LEU A 1 315 ? -6.898  19.146  32.153  1.00 50.86  ? 335  LEU A CD2 1 
ATOM   2394  N N   . GLN A 1 316 ? -8.678  22.989  28.863  1.00 62.01  ? 336  GLN A N   1 
ATOM   2395  C CA  . GLN A 1 316 ? -9.873  23.613  28.298  1.00 64.48  ? 336  GLN A CA  1 
ATOM   2396  C C   . GLN A 1 316 ? -10.262 22.964  26.984  1.00 66.04  ? 336  GLN A C   1 
ATOM   2397  O O   . GLN A 1 316 ? -11.432 22.624  26.775  1.00 66.54  ? 336  GLN A O   1 
ATOM   2398  C CB  . GLN A 1 316 ? -9.646  25.103  28.072  1.00 64.90  ? 336  GLN A CB  1 
ATOM   2399  C CG  . GLN A 1 316 ? -9.398  25.883  29.341  1.00 65.80  ? 336  GLN A CG  1 
ATOM   2400  C CD  . GLN A 1 316 ? -9.542  27.361  29.118  1.00 65.57  ? 336  GLN A CD  1 
ATOM   2401  O OE1 . GLN A 1 316 ? -8.919  27.920  28.220  1.00 65.40  ? 336  GLN A OE1 1 
ATOM   2402  N NE2 . GLN A 1 316 ? -10.372 28.007  29.928  1.00 66.68  ? 336  GLN A NE2 1 
ATOM   2403  N N   . ALA A 1 317 ? -9.292  22.803  26.095  1.00 68.34  ? 337  ALA A N   1 
ATOM   2404  C CA  . ALA A 1 317 ? -9.560  22.169  24.817  1.00 71.33  ? 337  ALA A CA  1 
ATOM   2405  C C   . ALA A 1 317 ? -9.662  20.655  25.057  1.00 73.47  ? 337  ALA A C   1 
ATOM   2406  O O   . ALA A 1 317 ? -8.977  19.899  24.363  1.00 72.92  ? 337  ALA A O   1 
ATOM   2407  C CB  . ALA A 1 317 ? -8.414  22.453  23.843  1.00 70.27  ? 337  ALA A CB  1 
ATOM   2408  N N   . GLU A 1 318 ? -10.498 20.209  25.997  1.00 76.60  ? 338  GLU A N   1 
ATOM   2409  C CA  . GLU A 1 318 ? -10.564 18.820  26.235  1.00 79.94  ? 338  GLU A CA  1 
ATOM   2410  C C   . GLU A 1 318 ? -11.708 18.178  27.051  1.00 81.78  ? 338  GLU A C   1 
ATOM   2411  O O   . GLU A 1 318 ? -12.819 18.067  26.563  1.00 81.66  ? 338  GLU A O   1 
ATOM   2412  C CB  . GLU A 1 318 ? -9.193  18.349  26.789  1.00 81.02  ? 338  GLU A CB  1 
ATOM   2413  C CG  . GLU A 1 318 ? -8.768  17.012  26.254  1.00 82.89  ? 338  GLU A CG  1 
ATOM   2414  C CD  . GLU A 1 318 ? -7.904  16.291  27.237  1.00 83.58  ? 338  GLU A CD  1 
ATOM   2415  O OE1 . GLU A 1 318 ? -8.466  15.536  28.071  1.00 83.95  ? 338  GLU A OE1 1 
ATOM   2416  O OE2 . GLU A 1 318 ? -6.673  16.511  27.194  1.00 84.08  ? 338  GLU A OE2 1 
ATOM   2417  N N   . ARG A 1 319 ? -11.398 17.896  28.327  1.00 84.34  ? 339  ARG A N   1 
ATOM   2418  C CA  . ARG A 1 319 ? -12.193 16.966  29.153  1.00 87.14  ? 339  ARG A CA  1 
ATOM   2419  C C   . ARG A 1 319 ? -13.576 17.239  29.529  1.00 87.31  ? 339  ARG A C   1 
ATOM   2420  O O   . ARG A 1 319 ? -13.934 18.376  29.784  1.00 87.13  ? 339  ARG A O   1 
ATOM   2421  C CB  . ARG A 1 319 ? -11.422 16.516  30.433  1.00 89.20  ? 339  ARG A CB  1 
ATOM   2422  C CG  . ARG A 1 319 ? -10.739 15.141  30.289  1.00 92.13  ? 339  ARG A CG  1 
ATOM   2423  C CD  . ARG A 1 319 ? -11.685 14.102  30.852  1.00 94.24  ? 339  ARG A CD  1 
ATOM   2424  N NE  . ARG A 1 319 ? -11.481 12.790  30.272  1.00 96.42  ? 339  ARG A NE  1 
ATOM   2425  C CZ  . ARG A 1 319 ? -12.008 11.680  30.767  1.00 96.90  ? 339  ARG A CZ  1 
ATOM   2426  N NH1 . ARG A 1 319 ? -12.762 11.733  31.853  1.00 97.15  ? 339  ARG A NH1 1 
ATOM   2427  N NH2 . ARG A 1 319 ? -11.781 10.526  30.162  1.00 97.18  ? 339  ARG A NH2 1 
ATOM   2428  N N   . ASN A 1 320 ? -14.337 16.136  29.519  1.00 87.30  ? 340  ASN A N   1 
ATOM   2429  C CA  . ASN A 1 320 ? -15.765 15.960  29.754  1.00 86.95  ? 340  ASN A CA  1 
ATOM   2430  C C   . ASN A 1 320 ? -16.177 16.117  31.217  1.00 85.76  ? 340  ASN A C   1 
ATOM   2431  O O   . ASN A 1 320 ? -17.140 15.500  31.683  1.00 86.21  ? 340  ASN A O   1 
ATOM   2432  C CB  . ASN A 1 320 ? -16.084 14.552  29.222  1.00 87.84  ? 340  ASN A CB  1 
ATOM   2433  C CG  . ASN A 1 320 ? -14.947 13.989  28.342  1.00 88.56  ? 340  ASN A CG  1 
ATOM   2434  O OD1 . ASN A 1 320 ? -14.414 14.698  27.485  1.00 88.82  ? 340  ASN A OD1 1 
ATOM   2435  N ND2 . ASN A 1 320 ? -14.569 12.727  28.566  1.00 88.32  ? 340  ASN A ND2 1 
ATOM   2436  N N   . PHE A 1 321 ? -15.462 16.982  31.919  1.00 83.66  ? 341  PHE A N   1 
ATOM   2437  C CA  . PHE A 1 321 ? -15.682 17.252  33.340  1.00 80.64  ? 341  PHE A CA  1 
ATOM   2438  C C   . PHE A 1 321 ? -17.092 17.615  33.809  1.00 77.92  ? 341  PHE A C   1 
ATOM   2439  O O   . PHE A 1 321 ? -18.082 17.480  33.082  1.00 77.28  ? 341  PHE A O   1 
ATOM   2440  C CB  . PHE A 1 321 ? -14.747 18.373  33.807  1.00 81.79  ? 341  PHE A CB  1 
ATOM   2441  C CG  . PHE A 1 321 ? -14.933 19.679  33.067  1.00 83.24  ? 341  PHE A CG  1 
ATOM   2442  C CD1 . PHE A 1 321 ? -14.434 20.875  33.589  1.00 83.95  ? 341  PHE A CD1 1 
ATOM   2443  C CD2 . PHE A 1 321 ? -15.560 19.708  31.821  1.00 83.50  ? 341  PHE A CD2 1 
ATOM   2444  C CE1 . PHE A 1 321 ? -14.555 22.082  32.875  1.00 84.28  ? 341  PHE A CE1 1 
ATOM   2445  C CE2 . PHE A 1 321 ? -15.686 20.896  31.101  1.00 84.05  ? 341  PHE A CE2 1 
ATOM   2446  C CZ  . PHE A 1 321 ? -15.183 22.088  31.627  1.00 84.45  ? 341  PHE A CZ  1 
ATOM   2447  N N   . HIS A 1 322 ? -17.129 18.081  35.058  1.00 74.20  ? 342  HIS A N   1 
ATOM   2448  C CA  . HIS A 1 322 ? -18.329 18.534  35.765  1.00 69.89  ? 342  HIS A CA  1 
ATOM   2449  C C   . HIS A 1 322 ? -18.315 20.065  35.678  1.00 65.17  ? 342  HIS A C   1 
ATOM   2450  O O   . HIS A 1 322 ? -17.681 20.738  36.494  1.00 65.53  ? 342  HIS A O   1 
ATOM   2451  C CB  . HIS A 1 322 ? -18.253 18.090  37.235  1.00 72.31  ? 342  HIS A CB  1 
ATOM   2452  C CG  . HIS A 1 322 ? -19.329 18.657  38.114  1.00 74.47  ? 342  HIS A CG  1 
ATOM   2453  N ND1 . HIS A 1 322 ? -19.216 18.696  39.487  1.00 75.37  ? 342  HIS A ND1 1 
ATOM   2454  C CD2 . HIS A 1 322 ? -20.537 19.199  37.822  1.00 75.02  ? 342  HIS A CD2 1 
ATOM   2455  C CE1 . HIS A 1 322 ? -20.304 19.239  40.004  1.00 75.75  ? 342  HIS A CE1 1 
ATOM   2456  N NE2 . HIS A 1 322 ? -21.122 19.552  39.014  1.00 75.85  ? 342  HIS A NE2 1 
ATOM   2457  N N   . THR A 1 323 ? -19.011 20.603  34.683  1.00 58.64  ? 343  THR A N   1 
ATOM   2458  C CA  . THR A 1 323 ? -19.073 22.043  34.453  1.00 50.97  ? 343  THR A CA  1 
ATOM   2459  C C   . THR A 1 323 ? -20.024 22.778  35.380  1.00 45.58  ? 343  THR A C   1 
ATOM   2460  O O   . THR A 1 323 ? -20.831 22.166  36.070  1.00 46.39  ? 343  THR A O   1 
ATOM   2461  C CB  . THR A 1 323 ? -19.521 22.330  33.025  1.00 51.94  ? 343  THR A CB  1 
ATOM   2462  O OG1 . THR A 1 323 ? -20.770 21.670  32.785  1.00 51.66  ? 343  THR A OG1 1 
ATOM   2463  C CG2 . THR A 1 323 ? -18.501 21.823  32.037  1.00 52.72  ? 343  THR A CG2 1 
ATOM   2464  N N   . VAL A 1 324 ? -19.926 24.101  35.383  1.00 38.26  ? 344  VAL A N   1 
ATOM   2465  C CA  . VAL A 1 324 ? -20.792 24.935  36.204  1.00 31.09  ? 344  VAL A CA  1 
ATOM   2466  C C   . VAL A 1 324 ? -20.910 26.296  35.550  1.00 26.99  ? 344  VAL A C   1 
ATOM   2467  O O   . VAL A 1 324 ? -20.034 26.698  34.794  1.00 27.12  ? 344  VAL A O   1 
ATOM   2468  C CB  . VAL A 1 324 ? -20.215 25.159  37.610  1.00 29.88  ? 344  VAL A CB  1 
ATOM   2469  C CG1 . VAL A 1 324 ? -20.169 23.857  38.379  1.00 29.16  ? 344  VAL A CG1 1 
ATOM   2470  C CG2 . VAL A 1 324 ? -18.840 25.775  37.500  1.00 27.42  ? 344  VAL A CG2 1 
ATOM   2471  N N   . PRO A 1 325 ? -22.005 27.021  35.820  1.00 22.66  ? 345  PRO A N   1 
ATOM   2472  C CA  . PRO A 1 325 ? -22.155 28.344  35.218  1.00 20.42  ? 345  PRO A CA  1 
ATOM   2473  C C   . PRO A 1 325 ? -20.896 29.139  35.539  1.00 19.14  ? 345  PRO A C   1 
ATOM   2474  O O   . PRO A 1 325 ? -20.415 29.119  36.668  1.00 18.45  ? 345  PRO A O   1 
ATOM   2475  C CB  . PRO A 1 325 ? -23.388 28.890  35.917  1.00 19.38  ? 345  PRO A CB  1 
ATOM   2476  C CG  . PRO A 1 325 ? -24.204 27.667  36.101  1.00 18.74  ? 345  PRO A CG  1 
ATOM   2477  C CD  . PRO A 1 325 ? -23.204 26.658  36.589  1.00 19.50  ? 345  PRO A CD  1 
ATOM   2478  N N   . TYR A 1 326 ? -20.361 29.833  34.546  1.00 17.49  ? 346  TYR A N   1 
ATOM   2479  C CA  . TYR A 1 326 ? -19.142 30.594  34.746  1.00 17.26  ? 346  TYR A CA  1 
ATOM   2480  C C   . TYR A 1 326 ? -19.299 32.023  34.231  1.00 17.95  ? 346  TYR A C   1 
ATOM   2481  O O   . TYR A 1 326 ? -19.742 32.236  33.102  1.00 20.15  ? 346  TYR A O   1 
ATOM   2482  C CB  . TYR A 1 326 ? -17.998 29.883  34.007  1.00 15.37  ? 346  TYR A CB  1 
ATOM   2483  C CG  . TYR A 1 326 ? -16.581 30.338  34.328  1.00 14.71  ? 346  TYR A CG  1 
ATOM   2484  C CD1 . TYR A 1 326 ? -15.506 29.837  33.598  1.00 14.80  ? 346  TYR A CD1 1 
ATOM   2485  C CD2 . TYR A 1 326 ? -16.310 31.263  35.344  1.00 13.44  ? 346  TYR A CD2 1 
ATOM   2486  C CE1 . TYR A 1 326 ? -14.202 30.239  33.858  1.00 13.96  ? 346  TYR A CE1 1 
ATOM   2487  C CE2 . TYR A 1 326 ? -15.002 31.674  35.612  1.00 12.52  ? 346  TYR A CE2 1 
ATOM   2488  C CZ  . TYR A 1 326 ? -13.953 31.154  34.860  1.00 13.28  ? 346  TYR A CZ  1 
ATOM   2489  O OH  . TYR A 1 326 ? -12.647 31.538  35.085  1.00 12.49  ? 346  TYR A OH  1 
ATOM   2490  N N   . MET A 1 327 ? -18.951 33.000  35.065  1.00 17.39  ? 347  MET A N   1 
ATOM   2491  C CA  . MET A 1 327 ? -19.019 34.404  34.671  1.00 16.33  ? 347  MET A CA  1 
ATOM   2492  C C   . MET A 1 327 ? -17.593 34.952  34.597  1.00 16.85  ? 347  MET A C   1 
ATOM   2493  O O   . MET A 1 327 ? -16.859 34.930  35.588  1.00 16.93  ? 347  MET A O   1 
ATOM   2494  C CB  . MET A 1 327 ? -19.818 35.220  35.688  1.00 16.24  ? 347  MET A CB  1 
ATOM   2495  C CG  . MET A 1 327 ? -20.014 36.669  35.272  1.00 14.89  ? 347  MET A CG  1 
ATOM   2496  S SD  . MET A 1 327 ? -20.644 37.743  36.576  1.00 14.47  ? 347  MET A SD  1 
ATOM   2497  C CE  . MET A 1 327 ? -22.338 37.207  36.685  1.00 11.68  ? 347  MET A CE  1 
ATOM   2498  N N   . VAL A 1 328 ? -17.201 35.433  33.422  1.00 17.07  ? 348  VAL A N   1 
ATOM   2499  C CA  . VAL A 1 328 ? -15.863 35.987  33.229  1.00 16.47  ? 348  VAL A CA  1 
ATOM   2500  C C   . VAL A 1 328 ? -15.948 37.439  32.760  1.00 15.95  ? 348  VAL A C   1 
ATOM   2501  O O   . VAL A 1 328 ? -16.650 37.751  31.802  1.00 16.85  ? 348  VAL A O   1 
ATOM   2502  C CB  . VAL A 1 328 ? -15.076 35.159  32.202  1.00 15.45  ? 348  VAL A CB  1 
ATOM   2503  C CG1 . VAL A 1 328 ? -13.743 35.817  31.903  1.00 17.49  ? 348  VAL A CG1 1 
ATOM   2504  C CG2 . VAL A 1 328 ? -14.849 33.771  32.745  1.00 15.04  ? 348  VAL A CG2 1 
ATOM   2505  N N   . GLY A 1 329 ? -15.236 38.329  33.434  1.00 14.97  ? 349  GLY A N   1 
ATOM   2506  C CA  . GLY A 1 329 ? -15.302 39.718  33.042  1.00 16.18  ? 349  GLY A CA  1 
ATOM   2507  C C   . GLY A 1 329 ? -14.015 40.496  33.189  1.00 17.40  ? 349  GLY A C   1 
ATOM   2508  O O   . GLY A 1 329 ? -13.110 40.104  33.927  1.00 19.23  ? 349  GLY A O   1 
ATOM   2509  N N   . ILE A 1 330 ? -13.953 41.620  32.483  1.00 17.43  ? 350  ILE A N   1 
ATOM   2510  C CA  . ILE A 1 330 ? -12.790 42.493  32.498  1.00 17.73  ? 350  ILE A CA  1 
ATOM   2511  C C   . ILE A 1 330 ? -13.276 43.918  32.677  1.00 18.49  ? 350  ILE A C   1 
ATOM   2512  O O   . ILE A 1 330 ? -14.471 44.187  32.557  1.00 18.46  ? 350  ILE A O   1 
ATOM   2513  C CB  . ILE A 1 330 ? -12.032 42.420  31.159  1.00 17.14  ? 350  ILE A CB  1 
ATOM   2514  C CG1 . ILE A 1 330 ? -12.907 43.002  30.042  1.00 15.27  ? 350  ILE A CG1 1 
ATOM   2515  C CG2 . ILE A 1 330 ? -11.687 40.967  30.836  1.00 16.25  ? 350  ILE A CG2 1 
ATOM   2516  C CD1 . ILE A 1 330 ? -12.182 43.234  28.740  1.00 13.26  ? 350  ILE A CD1 1 
ATOM   2517  N N   . ASN A 1 331 ? -12.353 44.828  32.965  1.00 20.09  ? 351  ASN A N   1 
ATOM   2518  C CA  . ASN A 1 331 ? -12.701 46.234  33.117  1.00 22.15  ? 351  ASN A CA  1 
ATOM   2519  C C   . ASN A 1 331 ? -12.318 46.940  31.826  1.00 24.69  ? 351  ASN A C   1 
ATOM   2520  O O   . ASN A 1 331 ? -11.684 46.337  30.960  1.00 26.79  ? 351  ASN A O   1 
ATOM   2521  C CB  . ASN A 1 331 ? -11.964 46.841  34.304  1.00 20.42  ? 351  ASN A CB  1 
ATOM   2522  C CG  . ASN A 1 331 ? -12.549 46.399  35.626  1.00 20.18  ? 351  ASN A CG  1 
ATOM   2523  O OD1 . ASN A 1 331 ? -12.010 46.689  36.694  1.00 19.93  ? 351  ASN A OD1 1 
ATOM   2524  N ND2 . ASN A 1 331 ? -13.667 45.692  35.559  1.00 20.23  ? 351  ASN A ND2 1 
ATOM   2525  N N   . LYS A 1 332 ? -12.703 48.205  31.687  1.00 26.68  ? 352  LYS A N   1 
ATOM   2526  C CA  . LYS A 1 332 ? -12.404 48.959  30.470  1.00 26.78  ? 352  LYS A CA  1 
ATOM   2527  C C   . LYS A 1 332 ? -10.917 49.228  30.267  1.00 25.54  ? 352  LYS A C   1 
ATOM   2528  O O   . LYS A 1 332 ? -10.397 49.045  29.170  1.00 24.32  ? 352  LYS A O   1 
ATOM   2529  C CB  . LYS A 1 332 ? -13.162 50.287  30.468  1.00 28.74  ? 352  LYS A CB  1 
ATOM   2530  C CG  . LYS A 1 332 ? -13.131 50.996  29.130  1.00 30.43  ? 352  LYS A CG  1 
ATOM   2531  C CD  . LYS A 1 332 ? -13.655 50.083  28.029  1.00 32.37  ? 352  LYS A CD  1 
ATOM   2532  C CE  . LYS A 1 332 ? -13.842 50.857  26.747  1.00 33.87  ? 352  LYS A CE  1 
ATOM   2533  N NZ  . LYS A 1 332 ? -14.651 52.081  27.012  1.00 35.55  ? 352  LYS A NZ  1 
ATOM   2534  N N   . GLN A 1 333 ? -10.244 49.669  31.324  1.00 24.98  ? 353  GLN A N   1 
ATOM   2535  C CA  . GLN A 1 333 ? -8.818  49.961  31.262  1.00 26.32  ? 353  GLN A CA  1 
ATOM   2536  C C   . GLN A 1 333 ? -8.058  49.198  32.359  1.00 26.78  ? 353  GLN A C   1 
ATOM   2537  O O   . GLN A 1 333 ? -7.753  49.754  33.417  1.00 27.25  ? 353  GLN A O   1 
ATOM   2538  C CB  . GLN A 1 333 ? -8.603  51.469  31.407  1.00 25.80  ? 353  GLN A CB  1 
ATOM   2539  C CG  . GLN A 1 333 ? -9.236  52.274  30.284  1.00 27.12  ? 353  GLN A CG  1 
ATOM   2540  C CD  . GLN A 1 333 ? -9.155  53.777  30.498  1.00 27.85  ? 353  GLN A CD  1 
ATOM   2541  O OE1 . GLN A 1 333 ? -8.135  54.296  30.942  1.00 30.04  ? 353  GLN A OE1 1 
ATOM   2542  N NE2 . GLN A 1 333 ? -10.229 54.483  30.164  1.00 27.66  ? 353  GLN A NE2 1 
ATOM   2543  N N   . GLU A 1 334 ? -7.750  47.929  32.094  1.00 26.43  ? 354  GLU A N   1 
ATOM   2544  C CA  . GLU A 1 334 ? -7.051  47.083  33.060  1.00 27.37  ? 354  GLU A CA  1 
ATOM   2545  C C   . GLU A 1 334 ? -5.651  47.552  33.456  1.00 28.43  ? 354  GLU A C   1 
ATOM   2546  O O   . GLU A 1 334 ? -5.243  47.385  34.607  1.00 28.16  ? 354  GLU A O   1 
ATOM   2547  C CB  . GLU A 1 334 ? -6.976  45.639  32.545  1.00 26.69  ? 354  GLU A CB  1 
ATOM   2548  C CG  . GLU A 1 334 ? -8.317  44.907  32.471  1.00 24.46  ? 354  GLU A CG  1 
ATOM   2549  C CD  . GLU A 1 334 ? -8.970  44.719  33.830  1.00 23.55  ? 354  GLU A CD  1 
ATOM   2550  O OE1 . GLU A 1 334 ? -8.403  45.192  34.835  1.00 23.82  ? 354  GLU A OE1 1 
ATOM   2551  O OE2 . GLU A 1 334 ? -10.053 44.098  33.897  1.00 22.19  ? 354  GLU A OE2 1 
ATOM   2552  N N   . PHE A 1 335 ? -4.913  48.129  32.512  1.00 30.30  ? 355  PHE A N   1 
ATOM   2553  C CA  . PHE A 1 335 ? -3.556  48.609  32.787  1.00 31.04  ? 355  PHE A CA  1 
ATOM   2554  C C   . PHE A 1 335 ? -3.529  50.138  32.793  1.00 31.98  ? 355  PHE A C   1 
ATOM   2555  O O   . PHE A 1 335 ? -2.486  50.756  32.589  1.00 31.16  ? 355  PHE A O   1 
ATOM   2556  C CB  . PHE A 1 335 ? -2.594  48.074  31.723  1.00 31.02  ? 355  PHE A CB  1 
ATOM   2557  C CG  . PHE A 1 335 ? -1.207  47.794  32.238  1.00 31.15  ? 355  PHE A CG  1 
ATOM   2558  C CD1 . PHE A 1 335 ? -0.104  48.452  31.708  1.00 30.93  ? 355  PHE A CD1 1 
ATOM   2559  C CD2 . PHE A 1 335 ? -1.003  46.871  33.256  1.00 31.54  ? 355  PHE A CD2 1 
ATOM   2560  C CE1 . PHE A 1 335 ? 1.178   48.195  32.187  1.00 29.08  ? 355  PHE A CE1 1 
ATOM   2561  C CE2 . PHE A 1 335 ? 0.278   46.611  33.738  1.00 30.33  ? 355  PHE A CE2 1 
ATOM   2562  C CZ  . PHE A 1 335 ? 1.366   47.275  33.202  1.00 29.07  ? 355  PHE A CZ  1 
ATOM   2563  N N   . GLY A 1 336 ? -4.689  50.733  33.054  1.00 33.65  ? 356  GLY A N   1 
ATOM   2564  C CA  . GLY A 1 336 ? -4.823  52.179  33.063  1.00 34.67  ? 356  GLY A CA  1 
ATOM   2565  C C   . GLY A 1 336 ? -4.049  52.984  34.090  1.00 35.76  ? 356  GLY A C   1 
ATOM   2566  O O   . GLY A 1 336 ? -3.621  54.095  33.783  1.00 37.70  ? 356  GLY A O   1 
ATOM   2567  N N   . TRP A 1 337 ? -3.872  52.465  35.301  1.00 35.99  ? 357  TRP A N   1 
ATOM   2568  C CA  . TRP A 1 337 ? -3.137  53.215  36.320  1.00 35.67  ? 357  TRP A CA  1 
ATOM   2569  C C   . TRP A 1 337 ? -2.614  52.400  37.506  1.00 35.39  ? 357  TRP A C   1 
ATOM   2570  O O   . TRP A 1 337 ? -1.401  52.317  37.715  1.00 35.36  ? 357  TRP A O   1 
ATOM   2571  C CB  . TRP A 1 337 ? -3.999  54.356  36.869  1.00 36.23  ? 357  TRP A CB  1 
ATOM   2572  C CG  . TRP A 1 337 ? -3.264  55.188  37.884  1.00 37.88  ? 357  TRP A CG  1 
ATOM   2573  C CD1 . TRP A 1 337 ? -2.272  56.092  37.633  1.00 38.46  ? 357  TRP A CD1 1 
ATOM   2574  C CD2 . TRP A 1 337 ? -3.409  55.140  39.315  1.00 38.46  ? 357  TRP A CD2 1 
ATOM   2575  N NE1 . TRP A 1 337 ? -1.788  56.607  38.814  1.00 38.47  ? 357  TRP A NE1 1 
ATOM   2576  C CE2 . TRP A 1 337 ? -2.467  56.039  39.862  1.00 37.68  ? 357  TRP A CE2 1 
ATOM   2577  C CE3 . TRP A 1 337 ? -4.240  54.420  40.189  1.00 39.60  ? 357  TRP A CE3 1 
ATOM   2578  C CZ2 . TRP A 1 337 ? -2.330  56.240  41.243  1.00 37.07  ? 357  TRP A CZ2 1 
ATOM   2579  C CZ3 . TRP A 1 337 ? -4.101  54.621  41.569  1.00 38.63  ? 357  TRP A CZ3 1 
ATOM   2580  C CH2 . TRP A 1 337 ? -3.152  55.524  42.076  1.00 37.03  ? 357  TRP A CH2 1 
ATOM   2581  N N   . LEU A 1 338 ? -3.534  51.824  38.284  1.00 34.58  ? 358  LEU A N   1 
ATOM   2582  C CA  . LEU A 1 338 ? -3.192  51.038  39.475  1.00 32.83  ? 358  LEU A CA  1 
ATOM   2583  C C   . LEU A 1 338 ? -2.004  50.090  39.332  1.00 31.13  ? 358  LEU A C   1 
ATOM   2584  O O   . LEU A 1 338 ? -1.078  50.121  40.147  1.00 29.97  ? 358  LEU A O   1 
ATOM   2585  C CB  . LEU A 1 338 ? -4.404  50.231  39.951  1.00 33.47  ? 358  LEU A CB  1 
ATOM   2586  C CG  . LEU A 1 338 ? -4.113  49.210  41.062  1.00 33.38  ? 358  LEU A CG  1 
ATOM   2587  C CD1 . LEU A 1 338 ? -3.750  49.918  42.356  1.00 34.06  ? 358  LEU A CD1 1 
ATOM   2588  C CD2 . LEU A 1 338 ? -5.328  48.341  41.272  1.00 34.71  ? 358  LEU A CD2 1 
ATOM   2589  N N   . ILE A 1 339 ? -2.037  49.236  38.316  1.00 28.96  ? 359  ILE A N   1 
ATOM   2590  C CA  . ILE A 1 339 ? -0.943  48.303  38.118  1.00 28.83  ? 359  ILE A CA  1 
ATOM   2591  C C   . ILE A 1 339 ? 0.350   49.039  37.767  1.00 29.85  ? 359  ILE A C   1 
ATOM   2592  O O   . ILE A 1 339 ? 1.328   48.954  38.508  1.00 29.53  ? 359  ILE A O   1 
ATOM   2593  C CB  . ILE A 1 339 ? -1.275  47.262  37.025  1.00 28.23  ? 359  ILE A CB  1 
ATOM   2594  C CG1 . ILE A 1 339 ? -2.532  46.487  37.419  1.00 27.68  ? 359  ILE A CG1 1 
ATOM   2595  C CG2 . ILE A 1 339 ? -0.109  46.295  36.851  1.00 26.87  ? 359  ILE A CG2 1 
ATOM   2596  C CD1 . ILE A 1 339 ? -2.936  45.432  36.419  1.00 28.38  ? 359  ILE A CD1 1 
ATOM   2597  N N   . PRO A 1 340 ? 0.374   49.783  36.645  1.00 31.08  ? 360  PRO A N   1 
ATOM   2598  C CA  . PRO A 1 340 ? 1.602   50.497  36.288  1.00 32.30  ? 360  PRO A CA  1 
ATOM   2599  C C   . PRO A 1 340 ? 2.169   51.325  37.439  1.00 33.76  ? 360  PRO A C   1 
ATOM   2600  O O   . PRO A 1 340 ? 3.386   51.398  37.613  1.00 35.50  ? 360  PRO A O   1 
ATOM   2601  C CB  . PRO A 1 340 ? 1.166   51.355  35.108  1.00 31.77  ? 360  PRO A CB  1 
ATOM   2602  C CG  . PRO A 1 340 ? 0.131   50.503  34.457  1.00 30.57  ? 360  PRO A CG  1 
ATOM   2603  C CD  . PRO A 1 340 ? -0.674  50.030  35.638  1.00 31.12  ? 360  PRO A CD  1 
ATOM   2604  N N   . MET A 1 341 ? 1.286   51.940  38.222  1.00 34.48  ? 361  MET A N   1 
ATOM   2605  C CA  . MET A 1 341 ? 1.701   52.755  39.363  1.00 35.98  ? 361  MET A CA  1 
ATOM   2606  C C   . MET A 1 341 ? 2.452   51.929  40.403  1.00 36.77  ? 361  MET A C   1 
ATOM   2607  O O   . MET A 1 341 ? 3.436   52.386  40.987  1.00 35.84  ? 361  MET A O   1 
ATOM   2608  C CB  . MET A 1 341 ? 0.475   53.404  40.011  1.00 36.72  ? 361  MET A CB  1 
ATOM   2609  C CG  . MET A 1 341 ? 0.760   54.226  41.269  1.00 38.28  ? 361  MET A CG  1 
ATOM   2610  S SD  . MET A 1 341 ? 0.867   53.255  42.787  1.00 39.78  ? 361  MET A SD  1 
ATOM   2611  C CE  . MET A 1 341 ? -0.850  52.742  42.948  1.00 40.13  ? 361  MET A CE  1 
ATOM   2612  N N   . LEU A 1 342 ? 1.980   50.707  40.625  1.00 38.41  ? 363  LEU A N   1 
ATOM   2613  C CA  . LEU A 1 342 ? 2.588   49.817  41.601  1.00 39.75  ? 363  LEU A CA  1 
ATOM   2614  C C   . LEU A 1 342 ? 3.839   49.107  41.104  1.00 41.71  ? 363  LEU A C   1 
ATOM   2615  O O   . LEU A 1 342 ? 4.671   48.701  41.910  1.00 43.28  ? 363  LEU A O   1 
ATOM   2616  C CB  . LEU A 1 342 ? 1.572   48.776  42.071  1.00 38.49  ? 363  LEU A CB  1 
ATOM   2617  C CG  . LEU A 1 342 ? 0.338   49.256  42.835  1.00 37.21  ? 363  LEU A CG  1 
ATOM   2618  C CD1 . LEU A 1 342 ? -0.545  48.055  43.120  1.00 36.68  ? 363  LEU A CD1 1 
ATOM   2619  C CD2 . LEU A 1 342 ? 0.741   49.944  44.131  1.00 36.30  ? 363  LEU A CD2 1 
ATOM   2620  N N   . MET A 1 343 ? 3.976   48.937  39.793  1.00 44.15  ? 364  MET A N   1 
ATOM   2621  C CA  . MET A 1 343 ? 5.162   48.272  39.257  1.00 46.52  ? 364  MET A CA  1 
ATOM   2622  C C   . MET A 1 343 ? 6.234   49.292  38.934  1.00 48.96  ? 364  MET A C   1 
ATOM   2623  O O   . MET A 1 343 ? 7.341   48.938  38.518  1.00 49.10  ? 364  MET A O   1 
ATOM   2624  C CB  . MET A 1 343 ? 4.820   47.460  38.005  1.00 45.60  ? 364  MET A CB  1 
ATOM   2625  C CG  . MET A 1 343 ? 4.167   46.137  38.331  1.00 46.01  ? 364  MET A CG  1 
ATOM   2626  S SD  . MET A 1 343 ? 4.541   44.841  37.154  1.00 46.69  ? 364  MET A SD  1 
ATOM   2627  C CE  . MET A 1 343 ? 2.908   44.452  36.581  1.00 47.30  ? 364  MET A CE  1 
ATOM   2628  N N   . SER A 1 344 ? 5.897   50.561  39.154  1.00 51.74  ? 365  SER A N   1 
ATOM   2629  C CA  . SER A 1 344 ? 6.802   51.668  38.882  1.00 54.12  ? 365  SER A CA  1 
ATOM   2630  C C   . SER A 1 344 ? 7.176   51.624  37.412  1.00 55.62  ? 365  SER A C   1 
ATOM   2631  O O   . SER A 1 344 ? 8.346   51.686  37.048  1.00 56.67  ? 365  SER A O   1 
ATOM   2632  C CB  . SER A 1 344 ? 8.056   51.564  39.753  1.00 53.97  ? 365  SER A CB  1 
ATOM   2633  O OG  . SER A 1 344 ? 7.740   51.738  41.123  1.00 55.23  ? 365  SER A OG  1 
ATOM   2634  N N   . TYR A 1 345 ? 6.163   51.499  36.569  1.00 57.61  ? 366  TYR A N   1 
ATOM   2635  C CA  . TYR A 1 345 ? 6.371   51.449  35.136  1.00 60.49  ? 366  TYR A CA  1 
ATOM   2636  C C   . TYR A 1 345 ? 6.891   52.821  34.725  1.00 63.62  ? 366  TYR A C   1 
ATOM   2637  O O   . TYR A 1 345 ? 6.380   53.847  35.180  1.00 63.30  ? 366  TYR A O   1 
ATOM   2638  C CB  . TYR A 1 345 ? 5.045   51.165  34.444  1.00 60.44  ? 366  TYR A CB  1 
ATOM   2639  C CG  . TYR A 1 345 ? 5.145   50.385  33.158  1.00 59.94  ? 366  TYR A CG  1 
ATOM   2640  C CD1 . TYR A 1 345 ? 5.362   49.006  33.168  1.00 58.97  ? 366  TYR A CD1 1 
ATOM   2641  C CD2 . TYR A 1 345 ? 4.960   51.018  31.930  1.00 60.78  ? 366  TYR A CD2 1 
ATOM   2642  C CE1 . TYR A 1 345 ? 5.382   48.275  31.983  1.00 59.30  ? 366  TYR A CE1 1 
ATOM   2643  C CE2 . TYR A 1 345 ? 4.979   50.300  30.740  1.00 60.79  ? 366  TYR A CE2 1 
ATOM   2644  C CZ  . TYR A 1 345 ? 5.187   48.932  30.773  1.00 60.36  ? 366  TYR A CZ  1 
ATOM   2645  O OH  . TYR A 1 345 ? 5.185   48.233  29.590  1.00 60.10  ? 366  TYR A OH  1 
ATOM   2646  N N   . PRO A 1 346 ? 7.930   52.859  33.875  1.00 67.14  ? 367  PRO A N   1 
ATOM   2647  C CA  . PRO A 1 346 ? 8.534   54.111  33.394  1.00 69.47  ? 367  PRO A CA  1 
ATOM   2648  C C   . PRO A 1 346 ? 7.656   54.917  32.428  1.00 71.23  ? 367  PRO A C   1 
ATOM   2649  O O   . PRO A 1 346 ? 7.745   54.761  31.205  1.00 70.86  ? 367  PRO A O   1 
ATOM   2650  C CB  . PRO A 1 346 ? 9.831   53.635  32.735  1.00 69.69  ? 367  PRO A CB  1 
ATOM   2651  C CG  . PRO A 1 346 ? 10.164  52.390  33.504  1.00 69.45  ? 367  PRO A CG  1 
ATOM   2652  C CD  . PRO A 1 346 ? 8.815   51.718  33.586  1.00 68.31  ? 367  PRO A CD  1 
ATOM   2653  N N   . LEU A 1 347 ? 6.816   55.782  32.987  1.00 73.21  ? 368  LEU A N   1 
ATOM   2654  C CA  . LEU A 1 347 ? 5.925   56.620  32.190  1.00 75.14  ? 368  LEU A CA  1 
ATOM   2655  C C   . LEU A 1 347 ? 5.757   57.996  32.832  1.00 76.81  ? 368  LEU A C   1 
ATOM   2656  O O   . LEU A 1 347 ? 4.651   58.527  32.907  1.00 77.60  ? 368  LEU A O   1 
ATOM   2657  C CB  . LEU A 1 347 ? 4.557   55.951  32.044  1.00 74.09  ? 368  LEU A CB  1 
ATOM   2658  C CG  . LEU A 1 347 ? 4.546   54.623  31.292  1.00 73.56  ? 368  LEU A CG  1 
ATOM   2659  C CD1 . LEU A 1 347 ? 3.138   54.064  31.288  1.00 73.96  ? 368  LEU A CD1 1 
ATOM   2660  C CD2 . LEU A 1 347 ? 5.049   54.828  29.872  1.00 73.04  ? 368  LEU A CD2 1 
ATOM   2661  N N   . SER A 1 348 ? 6.867   58.564  33.291  1.00 77.79  ? 369  SER A N   1 
ATOM   2662  C CA  . SER A 1 348 ? 6.869   59.873  33.930  1.00 78.45  ? 369  SER A CA  1 
ATOM   2663  C C   . SER A 1 348 ? 6.690   61.010  32.922  1.00 79.31  ? 369  SER A C   1 
ATOM   2664  O O   . SER A 1 348 ? 6.450   62.160  33.301  1.00 79.17  ? 369  SER A O   1 
ATOM   2665  C CB  . SER A 1 348 ? 8.182   60.054  34.686  1.00 78.39  ? 369  SER A CB  1 
ATOM   2666  O OG  . SER A 1 348 ? 9.278   59.673  33.871  1.00 78.19  ? 369  SER A OG  1 
ATOM   2667  N N   . GLU A 1 349 ? 6.799   60.676  31.639  1.00 79.94  ? 370  GLU A N   1 
ATOM   2668  C CA  . GLU A 1 349 ? 6.671   61.655  30.562  1.00 80.18  ? 370  GLU A CA  1 
ATOM   2669  C C   . GLU A 1 349 ? 5.224   61.963  30.182  1.00 79.72  ? 370  GLU A C   1 
ATOM   2670  O O   . GLU A 1 349 ? 4.888   63.103  29.859  1.00 80.25  ? 370  GLU A O   1 
ATOM   2671  C CB  . GLU A 1 349 ? 7.413   61.157  29.315  1.00 80.63  ? 370  GLU A CB  1 
ATOM   2672  C CG  . GLU A 1 349 ? 8.871   60.791  29.554  1.00 80.82  ? 370  GLU A CG  1 
ATOM   2673  C CD  . GLU A 1 349 ? 9.677   61.948  30.110  1.00 80.58  ? 370  GLU A CD  1 
ATOM   2674  O OE1 . GLU A 1 349 ? 9.705   63.013  29.461  1.00 80.89  ? 370  GLU A OE1 1 
ATOM   2675  O OE2 . GLU A 1 349 ? 10.283  61.792  31.192  1.00 79.85  ? 370  GLU A OE2 1 
ATOM   2676  N N   . GLY A 1 350 ? 4.371   60.946  30.224  1.00 79.12  ? 371  GLY A N   1 
ATOM   2677  C CA  . GLY A 1 350 ? 2.986   61.139  29.845  1.00 78.56  ? 371  GLY A CA  1 
ATOM   2678  C C   . GLY A 1 350 ? 2.900   60.996  28.335  1.00 78.46  ? 371  GLY A C   1 
ATOM   2679  O O   . GLY A 1 350 ? 1.856   61.245  27.726  1.00 78.16  ? 371  GLY A O   1 
ATOM   2680  N N   . GLN A 1 351 ? 4.016   60.584  27.735  1.00 78.25  ? 372  GLN A N   1 
ATOM   2681  C CA  . GLN A 1 351 ? 4.102   60.403  26.291  1.00 78.38  ? 372  GLN A CA  1 
ATOM   2682  C C   . GLN A 1 351 ? 5.093   59.306  25.902  1.00 77.47  ? 372  GLN A C   1 
ATOM   2683  O O   . GLN A 1 351 ? 6.071   59.053  26.607  1.00 76.45  ? 372  GLN A O   1 
ATOM   2684  C CB  . GLN A 1 351 ? 4.523   61.712  25.634  1.00 79.68  ? 372  GLN A CB  1 
ATOM   2685  C CG  . GLN A 1 351 ? 5.915   62.163  26.037  1.00 82.57  ? 372  GLN A CG  1 
ATOM   2686  C CD  . GLN A 1 351 ? 6.212   63.590  25.616  1.00 84.46  ? 372  GLN A CD  1 
ATOM   2687  O OE1 . GLN A 1 351 ? 7.311   64.101  25.844  1.00 85.29  ? 372  GLN A OE1 1 
ATOM   2688  N NE2 . GLN A 1 351 ? 5.230   64.244  25.003  1.00 85.18  ? 372  GLN A NE2 1 
ATOM   2689  N N   . LEU A 1 352 ? 4.832   58.670  24.763  1.00 76.94  ? 373  LEU A N   1 
ATOM   2690  C CA  . LEU A 1 352 ? 5.684   57.603  24.254  1.00 76.28  ? 373  LEU A CA  1 
ATOM   2691  C C   . LEU A 1 352 ? 5.739   57.703  22.722  1.00 76.47  ? 373  LEU A C   1 
ATOM   2692  O O   . LEU A 1 352 ? 4.930   58.407  22.110  1.00 76.78  ? 373  LEU A O   1 
ATOM   2693  C CB  . LEU A 1 352 ? 5.113   56.243  24.669  1.00 75.34  ? 373  LEU A CB  1 
ATOM   2694  C CG  . LEU A 1 352 ? 6.098   55.095  24.890  1.00 74.16  ? 373  LEU A CG  1 
ATOM   2695  C CD1 . LEU A 1 352 ? 6.882   55.357  26.164  1.00 73.84  ? 373  LEU A CD1 1 
ATOM   2696  C CD2 . LEU A 1 352 ? 5.350   53.780  24.997  1.00 73.34  ? 373  LEU A CD2 1 
ATOM   2697  N N   . ASP A 1 353 ? 6.688   57.000  22.107  1.00 76.42  ? 374  ASP A N   1 
ATOM   2698  C CA  . ASP A 1 353 ? 6.836   57.018  20.651  1.00 75.61  ? 374  ASP A CA  1 
ATOM   2699  C C   . ASP A 1 353 ? 7.161   55.629  20.092  1.00 75.13  ? 374  ASP A C   1 
ATOM   2700  O O   . ASP A 1 353 ? 7.823   54.820  20.747  1.00 74.81  ? 374  ASP A O   1 
ATOM   2701  C CB  . ASP A 1 353 ? 7.943   57.988  20.249  1.00 76.02  ? 374  ASP A CB  1 
ATOM   2702  C CG  . ASP A 1 353 ? 9.326   57.441  20.543  1.00 77.11  ? 374  ASP A CG  1 
ATOM   2703  O OD1 . ASP A 1 353 ? 9.593   57.096  21.712  1.00 77.29  ? 374  ASP A OD1 1 
ATOM   2704  O OD2 . ASP A 1 353 ? 10.146  57.354  19.604  1.00 78.13  ? 374  ASP A OD2 1 
ATOM   2705  N N   . GLN A 1 354 ? 6.696   55.374  18.872  1.00 74.34  ? 375  GLN A N   1 
ATOM   2706  C CA  . GLN A 1 354 ? 6.908   54.106  18.182  1.00 73.52  ? 375  GLN A CA  1 
ATOM   2707  C C   . GLN A 1 354 ? 8.180   53.358  18.545  1.00 73.41  ? 375  GLN A C   1 
ATOM   2708  O O   . GLN A 1 354 ? 8.177   52.129  18.617  1.00 73.44  ? 375  GLN A O   1 
ATOM   2709  C CB  . GLN A 1 354 ? 6.879   54.331  16.676  1.00 73.80  ? 375  GLN A CB  1 
ATOM   2710  C CG  . GLN A 1 354 ? 5.486   54.491  16.119  1.00 74.35  ? 375  GLN A CG  1 
ATOM   2711  C CD  . GLN A 1 354 ? 4.696   53.203  16.178  1.00 75.03  ? 375  GLN A CD  1 
ATOM   2712  O OE1 . GLN A 1 354 ? 3.540   53.152  15.756  1.00 75.57  ? 375  GLN A OE1 1 
ATOM   2713  N NE2 . GLN A 1 354 ? 5.318   52.147  16.700  1.00 75.09  ? 375  GLN A NE2 1 
ATOM   2714  N N   . LYS A 1 355 ? 9.272   54.089  18.751  1.00 73.32  ? 376  LYS A N   1 
ATOM   2715  C CA  . LYS A 1 355 ? 10.530  53.450  19.113  1.00 73.25  ? 376  LYS A CA  1 
ATOM   2716  C C   . LYS A 1 355 ? 10.546  53.056  20.585  1.00 72.65  ? 376  LYS A C   1 
ATOM   2717  O O   . LYS A 1 355 ? 10.657  51.873  20.912  1.00 73.44  ? 376  LYS A O   1 
ATOM   2718  C CB  . LYS A 1 355 ? 11.724  54.362  18.806  1.00 73.76  ? 376  LYS A CB  1 
ATOM   2719  C CG  . LYS A 1 355 ? 12.286  54.198  17.396  1.00 74.12  ? 376  LYS A CG  1 
ATOM   2720  C CD  . LYS A 1 355 ? 13.685  54.795  17.279  1.00 74.38  ? 376  LYS A CD  1 
ATOM   2721  C CE  . LYS A 1 355 ? 14.321  54.479  15.928  1.00 74.57  ? 376  LYS A CE  1 
ATOM   2722  N NZ  . LYS A 1 355 ? 15.725  54.984  15.829  1.00 74.39  ? 376  LYS A NZ  1 
ATOM   2723  N N   . THR A 1 356 ? 10.433  54.040  21.473  1.00 71.10  ? 377  THR A N   1 
ATOM   2724  C CA  . THR A 1 356 ? 10.437  53.754  22.901  1.00 69.99  ? 377  THR A CA  1 
ATOM   2725  C C   . THR A 1 356 ? 9.424   52.673  23.221  1.00 69.97  ? 377  THR A C   1 
ATOM   2726  O O   . THR A 1 356 ? 9.620   51.876  24.136  1.00 70.53  ? 377  THR A O   1 
ATOM   2727  C CB  . THR A 1 356 ? 10.095  54.993  23.727  1.00 69.50  ? 377  THR A CB  1 
ATOM   2728  O OG1 . THR A 1 356 ? 11.163  55.938  23.622  1.00 69.75  ? 377  THR A OG1 1 
ATOM   2729  C CG2 . THR A 1 356 ? 9.896   54.622  25.185  1.00 68.91  ? 377  THR A CG2 1 
ATOM   2730  N N   . ALA A 1 357 ? 8.335   52.655  22.462  1.00 69.01  ? 378  ALA A N   1 
ATOM   2731  C CA  . ALA A 1 357 ? 7.297   51.659  22.662  1.00 68.23  ? 378  ALA A CA  1 
ATOM   2732  C C   . ALA A 1 357 ? 7.915   50.273  22.552  1.00 67.82  ? 378  ALA A C   1 
ATOM   2733  O O   . ALA A 1 357 ? 7.913   49.502  23.515  1.00 67.57  ? 378  ALA A O   1 
ATOM   2734  C CB  . ALA A 1 357 ? 6.212   51.828  21.619  1.00 68.60  ? 378  ALA A CB  1 
ATOM   2735  N N   . MET A 1 358 ? 8.452   49.970  21.373  1.00 67.30  ? 379  MET A N   1 
ATOM   2736  C CA  . MET A 1 358 ? 9.071   48.678  21.122  1.00 66.98  ? 379  MET A CA  1 
ATOM   2737  C C   . MET A 1 358 ? 10.175  48.366  22.115  1.00 66.86  ? 379  MET A C   1 
ATOM   2738  O O   . MET A 1 358 ? 10.466  47.203  22.385  1.00 67.25  ? 379  MET A O   1 
ATOM   2739  C CB  . MET A 1 358 ? 9.611   48.625  19.695  1.00 66.73  ? 379  MET A CB  1 
ATOM   2740  C CG  . MET A 1 358 ? 8.508   48.527  18.667  1.00 67.88  ? 379  MET A CG  1 
ATOM   2741  S SD  . MET A 1 358 ? 9.099   48.425  16.987  1.00 68.94  ? 379  MET A SD  1 
ATOM   2742  C CE  . MET A 1 358 ? 8.598   50.043  16.367  1.00 69.16  ? 379  MET A CE  1 
ATOM   2743  N N   . SER A 1 359 ? 10.788  49.408  22.661  1.00 66.83  ? 380  SER A N   1 
ATOM   2744  C CA  . SER A 1 359 ? 11.846  49.222  23.641  1.00 67.21  ? 380  SER A CA  1 
ATOM   2745  C C   . SER A 1 359 ? 11.200  48.708  24.932  1.00 67.45  ? 380  SER A C   1 
ATOM   2746  O O   . SER A 1 359 ? 11.604  47.678  25.485  1.00 66.88  ? 380  SER A O   1 
ATOM   2747  C CB  . SER A 1 359 ? 12.565  50.551  23.896  1.00 66.62  ? 380  SER A CB  1 
ATOM   2748  O OG  . SER A 1 359 ? 13.693  50.373  24.736  1.00 66.56  ? 380  SER A OG  1 
ATOM   2749  N N   . LEU A 1 360 ? 10.183  49.435  25.390  1.00 67.68  ? 381  LEU A N   1 
ATOM   2750  C CA  . LEU A 1 360 ? 9.445   49.092  26.601  1.00 66.73  ? 381  LEU A CA  1 
ATOM   2751  C C   . LEU A 1 360 ? 8.780   47.730  26.464  1.00 66.73  ? 381  LEU A C   1 
ATOM   2752  O O   . LEU A 1 360 ? 8.976   46.851  27.300  1.00 66.04  ? 381  LEU A O   1 
ATOM   2753  C CB  . LEU A 1 360 ? 8.375   50.152  26.883  1.00 66.16  ? 381  LEU A CB  1 
ATOM   2754  C CG  . LEU A 1 360 ? 8.494   50.941  28.189  1.00 65.41  ? 381  LEU A CG  1 
ATOM   2755  C CD1 . LEU A 1 360 ? 7.449   52.042  28.226  1.00 65.13  ? 381  LEU A CD1 1 
ATOM   2756  C CD2 . LEU A 1 360 ? 8.323   50.007  29.367  1.00 65.19  ? 381  LEU A CD2 1 
ATOM   2757  N N   . LEU A 1 361 ? 7.998   47.558  25.401  1.00 66.84  ? 382  LEU A N   1 
ATOM   2758  C CA  . LEU A 1 361 ? 7.297   46.301  25.173  1.00 67.54  ? 382  LEU A CA  1 
ATOM   2759  C C   . LEU A 1 361 ? 8.218   45.077  25.184  1.00 68.64  ? 382  LEU A C   1 
ATOM   2760  O O   . LEU A 1 361 ? 7.767   43.968  25.471  1.00 69.62  ? 382  LEU A O   1 
ATOM   2761  C CB  . LEU A 1 361 ? 6.520   46.357  23.854  1.00 66.29  ? 382  LEU A CB  1 
ATOM   2762  C CG  . LEU A 1 361 ? 5.672   45.122  23.529  1.00 65.76  ? 382  LEU A CG  1 
ATOM   2763  C CD1 . LEU A 1 361 ? 4.695   44.852  24.658  1.00 65.30  ? 382  LEU A CD1 1 
ATOM   2764  C CD2 . LEU A 1 361 ? 4.928   45.341  22.225  1.00 65.09  ? 382  LEU A CD2 1 
ATOM   2765  N N   . TRP A 1 362 ? 9.499   45.267  24.873  1.00 69.37  ? 383  TRP A N   1 
ATOM   2766  C CA  . TRP A 1 362 ? 10.447  44.152  24.878  1.00 69.59  ? 383  TRP A CA  1 
ATOM   2767  C C   . TRP A 1 362 ? 10.932  43.887  26.297  1.00 69.43  ? 383  TRP A C   1 
ATOM   2768  O O   . TRP A 1 362 ? 11.157  42.743  26.686  1.00 69.54  ? 383  TRP A O   1 
ATOM   2769  C CB  . TRP A 1 362 ? 11.649  44.448  23.975  1.00 70.68  ? 383  TRP A CB  1 
ATOM   2770  C CG  . TRP A 1 362 ? 12.791  43.467  24.142  1.00 71.71  ? 383  TRP A CG  1 
ATOM   2771  C CD1 . TRP A 1 362 ? 14.077  43.763  24.497  1.00 71.87  ? 383  TRP A CD1 1 
ATOM   2772  C CD2 . TRP A 1 362 ? 12.741  42.039  23.978  1.00 71.77  ? 383  TRP A CD2 1 
ATOM   2773  N NE1 . TRP A 1 362 ? 14.828  42.613  24.565  1.00 71.83  ? 383  TRP A NE1 1 
ATOM   2774  C CE2 . TRP A 1 362 ? 14.036  41.544  24.254  1.00 71.35  ? 383  TRP A CE2 1 
ATOM   2775  C CE3 . TRP A 1 362 ? 11.730  41.137  23.627  1.00 71.85  ? 383  TRP A CE3 1 
ATOM   2776  C CZ2 . TRP A 1 362 ? 14.344  40.180  24.189  1.00 71.04  ? 383  TRP A CZ2 1 
ATOM   2777  C CZ3 . TRP A 1 362 ? 12.041  39.778  23.563  1.00 71.84  ? 383  TRP A CZ3 1 
ATOM   2778  C CH2 . TRP A 1 362 ? 13.339  39.316  23.844  1.00 71.12  ? 383  TRP A CH2 1 
ATOM   2779  N N   . LYS A 1 363 ? 11.096  44.955  27.066  1.00 69.32  ? 384  LYS A N   1 
ATOM   2780  C CA  . LYS A 1 363 ? 11.548  44.833  28.443  1.00 69.74  ? 384  LYS A CA  1 
ATOM   2781  C C   . LYS A 1 363 ? 10.386  44.356  29.313  1.00 70.06  ? 384  LYS A C   1 
ATOM   2782  O O   . LYS A 1 363 ? 10.579  43.822  30.406  1.00 69.84  ? 384  LYS A O   1 
ATOM   2783  C CB  . LYS A 1 363 ? 12.051  46.189  28.945  1.00 69.88  ? 384  LYS A CB  1 
ATOM   2784  C CG  . LYS A 1 363 ? 13.112  46.823  28.063  1.00 70.14  ? 384  LYS A CG  1 
ATOM   2785  C CD  . LYS A 1 363 ? 13.561  48.164  28.623  1.00 71.19  ? 384  LYS A CD  1 
ATOM   2786  C CE  . LYS A 1 363 ? 14.609  48.817  27.729  1.00 71.79  ? 384  LYS A CE  1 
ATOM   2787  N NZ  . LYS A 1 363 ? 14.992  50.175  28.217  1.00 71.31  ? 384  LYS A NZ  1 
ATOM   2788  N N   . SER A 1 364 ? 9.174   44.551  28.809  1.00 70.73  ? 385  SER A N   1 
ATOM   2789  C CA  . SER A 1 364 ? 7.963   44.164  29.521  1.00 70.63  ? 385  SER A CA  1 
ATOM   2790  C C   . SER A 1 364 ? 7.678   42.682  29.333  1.00 70.13  ? 385  SER A C   1 
ATOM   2791  O O   . SER A 1 364 ? 6.633   42.185  29.749  1.00 70.39  ? 385  SER A O   1 
ATOM   2792  C CB  . SER A 1 364 ? 6.779   44.976  28.998  1.00 71.38  ? 385  SER A CB  1 
ATOM   2793  O OG  . SER A 1 364 ? 7.098   46.356  28.934  1.00 71.97  ? 385  SER A OG  1 
ATOM   2794  N N   . TYR A 1 365 ? 8.616   41.985  28.702  1.00 69.39  ? 386  TYR A N   1 
ATOM   2795  C CA  . TYR A 1 365 ? 8.472   40.560  28.437  1.00 68.51  ? 386  TYR A CA  1 
ATOM   2796  C C   . TYR A 1 365 ? 7.909   39.763  29.615  1.00 67.65  ? 386  TYR A C   1 
ATOM   2797  O O   . TYR A 1 365 ? 6.953   39.004  29.455  1.00 68.09  ? 386  TYR A O   1 
ATOM   2798  C CB  . TYR A 1 365 ? 9.818   39.962  28.026  1.00 68.03  ? 386  TYR A CB  1 
ATOM   2799  C CG  . TYR A 1 365 ? 9.686   38.607  27.375  1.00 67.11  ? 386  TYR A CG  1 
ATOM   2800  C CD1 . TYR A 1 365 ? 9.129   38.482  26.106  1.00 66.59  ? 386  TYR A CD1 1 
ATOM   2801  C CD2 . TYR A 1 365 ? 10.106  37.450  28.030  1.00 66.46  ? 386  TYR A CD2 1 
ATOM   2802  C CE1 . TYR A 1 365 ? 8.993   37.238  25.501  1.00 66.39  ? 386  TYR A CE1 1 
ATOM   2803  C CE2 . TYR A 1 365 ? 9.974   36.199  27.435  1.00 66.00  ? 386  TYR A CE2 1 
ATOM   2804  C CZ  . TYR A 1 365 ? 9.417   36.103  26.170  1.00 66.01  ? 386  TYR A CZ  1 
ATOM   2805  O OH  . TYR A 1 365 ? 9.285   34.875  25.566  1.00 66.55  ? 386  TYR A OH  1 
ATOM   2806  N N   . PRO A 1 366 ? 8.494   39.921  30.815  1.00 66.48  ? 387  PRO A N   1 
ATOM   2807  C CA  . PRO A 1 366 ? 8.004   39.183  31.986  1.00 65.74  ? 387  PRO A CA  1 
ATOM   2808  C C   . PRO A 1 366 ? 6.549   39.492  32.368  1.00 65.16  ? 387  PRO A C   1 
ATOM   2809  O O   . PRO A 1 366 ? 6.065   39.052  33.418  1.00 64.82  ? 387  PRO A O   1 
ATOM   2810  C CB  . PRO A 1 366 ? 8.997   39.579  33.078  1.00 65.87  ? 387  PRO A CB  1 
ATOM   2811  C CG  . PRO A 1 366 ? 9.401   40.963  32.675  1.00 65.64  ? 387  PRO A CG  1 
ATOM   2812  C CD  . PRO A 1 366 ? 9.602   40.817  31.191  1.00 65.76  ? 387  PRO A CD  1 
ATOM   2813  N N   . LEU A 1 367 ? 5.862   40.247  31.513  1.00 63.41  ? 388  LEU A N   1 
ATOM   2814  C CA  . LEU A 1 367 ? 4.469   40.612  31.743  1.00 61.16  ? 388  LEU A CA  1 
ATOM   2815  C C   . LEU A 1 367 ? 3.595   40.294  30.538  1.00 60.41  ? 388  LEU A C   1 
ATOM   2816  O O   . LEU A 1 367 ? 2.429   39.937  30.692  1.00 60.80  ? 388  LEU A O   1 
ATOM   2817  C CB  . LEU A 1 367 ? 4.353   42.100  32.084  1.00 60.49  ? 388  LEU A CB  1 
ATOM   2818  C CG  . LEU A 1 367 ? 4.718   42.496  33.518  1.00 60.29  ? 388  LEU A CG  1 
ATOM   2819  C CD1 . LEU A 1 367 ? 4.711   44.007  33.665  1.00 59.99  ? 388  LEU A CD1 1 
ATOM   2820  C CD2 . LEU A 1 367 ? 3.729   41.863  34.484  1.00 60.66  ? 388  LEU A CD2 1 
ATOM   2821  N N   . VAL A 1 368 ? 4.154   40.422  29.340  1.00 59.44  ? 389  VAL A N   1 
ATOM   2822  C CA  . VAL A 1 368 ? 3.396   40.142  28.127  1.00 59.10  ? 389  VAL A CA  1 
ATOM   2823  C C   . VAL A 1 368 ? 3.871   38.874  27.435  1.00 59.61  ? 389  VAL A C   1 
ATOM   2824  O O   . VAL A 1 368 ? 3.079   38.158  26.826  1.00 59.91  ? 389  VAL A O   1 
ATOM   2825  C CB  . VAL A 1 368 ? 3.489   41.302  27.128  1.00 58.04  ? 389  VAL A CB  1 
ATOM   2826  C CG1 . VAL A 1 368 ? 2.874   42.551  27.729  1.00 57.43  ? 389  VAL A CG1 1 
ATOM   2827  C CG2 . VAL A 1 368 ? 4.937   41.540  26.750  1.00 58.37  ? 389  VAL A CG2 1 
ATOM   2828  N N   . CYS A 1 369 ? 5.167   38.603  27.530  1.00 60.25  ? 390  CYS A N   1 
ATOM   2829  C CA  . CYS A 1 369 ? 5.751   37.418  26.915  1.00 61.00  ? 390  CYS A CA  1 
ATOM   2830  C C   . CYS A 1 369 ? 5.577   37.418  25.403  1.00 61.80  ? 390  CYS A C   1 
ATOM   2831  O O   . CYS A 1 369 ? 5.012   36.487  24.832  1.00 61.31  ? 390  CYS A O   1 
ATOM   2832  C CB  . CYS A 1 369 ? 5.129   36.147  27.503  1.00 60.78  ? 390  CYS A CB  1 
ATOM   2833  S SG  . CYS A 1 369 ? 5.419   35.916  29.272  1.00 61.12  ? 390  CYS A SG  1 
ATOM   2834  N N   . ILE A 1 370 ? 6.065   38.472  24.758  1.00 63.58  ? 391  ILE A N   1 
ATOM   2835  C CA  . ILE A 1 370 ? 5.980   38.588  23.307  1.00 65.04  ? 391  ILE A CA  1 
ATOM   2836  C C   . ILE A 1 370 ? 7.401   38.579  22.747  1.00 66.64  ? 391  ILE A C   1 
ATOM   2837  O O   . ILE A 1 370 ? 8.263   39.323  23.216  1.00 66.62  ? 391  ILE A O   1 
ATOM   2838  C CB  . ILE A 1 370 ? 5.292   39.905  22.884  1.00 64.27  ? 391  ILE A CB  1 
ATOM   2839  C CG1 . ILE A 1 370 ? 3.991   40.093  23.660  1.00 63.70  ? 391  ILE A CG1 1 
ATOM   2840  C CG2 . ILE A 1 370 ? 4.982   39.871  21.397  1.00 64.62  ? 391  ILE A CG2 1 
ATOM   2841  C CD1 . ILE A 1 370 ? 3.303   41.408  23.382  1.00 63.40  ? 391  ILE A CD1 1 
ATOM   2842  N N   . ALA A 1 371 ? 7.642   37.733  21.751  1.00 68.70  ? 392  ALA A N   1 
ATOM   2843  C CA  . ALA A 1 371 ? 8.962   37.637  21.129  1.00 70.77  ? 392  ALA A CA  1 
ATOM   2844  C C   . ALA A 1 371 ? 9.382   38.989  20.563  1.00 72.29  ? 392  ALA A C   1 
ATOM   2845  O O   . ALA A 1 371 ? 8.542   39.757  20.090  1.00 72.66  ? 392  ALA A O   1 
ATOM   2846  C CB  . ALA A 1 371 ? 8.940   36.594  20.022  1.00 70.81  ? 392  ALA A CB  1 
ATOM   2847  N N   . LYS A 1 372 ? 10.682  39.271  20.601  1.00 73.54  ? 393  LYS A N   1 
ATOM   2848  C CA  . LYS A 1 372 ? 11.197  40.543  20.106  1.00 74.85  ? 393  LYS A CA  1 
ATOM   2849  C C   . LYS A 1 372 ? 11.000  40.743  18.606  1.00 75.29  ? 393  LYS A C   1 
ATOM   2850  O O   . LYS A 1 372 ? 10.984  41.875  18.131  1.00 75.70  ? 393  LYS A O   1 
ATOM   2851  C CB  . LYS A 1 372 ? 12.680  40.688  20.452  1.00 75.61  ? 393  LYS A CB  1 
ATOM   2852  C CG  . LYS A 1 372 ? 13.230  42.079  20.186  1.00 77.28  ? 393  LYS A CG  1 
ATOM   2853  C CD  . LYS A 1 372 ? 14.628  42.250  20.758  1.00 79.10  ? 393  LYS A CD  1 
ATOM   2854  C CE  . LYS A 1 372 ? 15.132  43.676  20.558  1.00 80.56  ? 393  LYS A CE  1 
ATOM   2855  N NZ  . LYS A 1 372 ? 14.235  44.687  21.199  1.00 81.33  ? 393  LYS A NZ  1 
ATOM   2856  N N   . GLU A 1 373 ? 10.853  39.653  17.860  1.00 76.34  ? 394  GLU A N   1 
ATOM   2857  C CA  . GLU A 1 373 ? 10.649  39.755  16.416  1.00 77.59  ? 394  GLU A CA  1 
ATOM   2858  C C   . GLU A 1 373 ? 9.190   40.064  16.102  1.00 76.87  ? 394  GLU A C   1 
ATOM   2859  O O   . GLU A 1 373 ? 8.852   40.458  14.985  1.00 77.53  ? 394  GLU A O   1 
ATOM   2860  C CB  . GLU A 1 373 ? 11.056  38.456  15.705  1.00 79.57  ? 394  GLU A CB  1 
ATOM   2861  C CG  . GLU A 1 373 ? 10.366  37.194  16.218  1.00 82.37  ? 394  GLU A CG  1 
ATOM   2862  C CD  . GLU A 1 373 ? 11.143  36.513  17.336  1.00 84.26  ? 394  GLU A CD  1 
ATOM   2863  O OE1 . GLU A 1 373 ? 11.389  37.160  18.377  1.00 85.75  ? 394  GLU A OE1 1 
ATOM   2864  O OE2 . GLU A 1 373 ? 11.513  35.328  17.172  1.00 84.93  ? 394  GLU A OE2 1 
ATOM   2865  N N   . LEU A 1 374 ? 8.329   39.885  17.099  1.00 75.26  ? 395  LEU A N   1 
ATOM   2866  C CA  . LEU A 1 374 ? 6.904   40.136  16.938  1.00 73.36  ? 395  LEU A CA  1 
ATOM   2867  C C   . LEU A 1 374 ? 6.559   41.579  17.295  1.00 72.52  ? 395  LEU A C   1 
ATOM   2868  O O   . LEU A 1 374 ? 5.666   42.177  16.696  1.00 72.24  ? 395  LEU A O   1 
ATOM   2869  C CB  . LEU A 1 374 ? 6.113   39.185  17.835  1.00 72.51  ? 395  LEU A CB  1 
ATOM   2870  C CG  . LEU A 1 374 ? 6.406   37.691  17.684  1.00 71.10  ? 395  LEU A CG  1 
ATOM   2871  C CD1 . LEU A 1 374 ? 5.683   36.915  18.773  1.00 70.44  ? 395  LEU A CD1 1 
ATOM   2872  C CD2 . LEU A 1 374 ? 5.972   37.220  16.307  1.00 70.61  ? 395  LEU A CD2 1 
ATOM   2873  N N   . ILE A 1 375 ? 7.286   42.120  18.271  1.00 71.83  ? 396  ILE A N   1 
ATOM   2874  C CA  . ILE A 1 375 ? 7.090   43.482  18.778  1.00 71.01  ? 396  ILE A CA  1 
ATOM   2875  C C   . ILE A 1 375 ? 6.654   44.526  17.745  1.00 70.37  ? 396  ILE A C   1 
ATOM   2876  O O   . ILE A 1 375 ? 5.603   45.151  17.894  1.00 70.67  ? 396  ILE A O   1 
ATOM   2877  C CB  . ILE A 1 375 ? 8.378   44.012  19.489  1.00 70.91  ? 396  ILE A CB  1 
ATOM   2878  C CG1 . ILE A 1 375 ? 8.795   43.071  20.627  1.00 70.58  ? 396  ILE A CG1 1 
ATOM   2879  C CG2 . ILE A 1 375 ? 8.134   45.413  20.035  1.00 70.55  ? 396  ILE A CG2 1 
ATOM   2880  C CD1 . ILE A 1 375 ? 7.839   43.037  21.806  1.00 70.31  ? 396  ILE A CD1 1 
ATOM   2881  N N   . PRO A 1 376 ? 7.455   44.734  16.687  1.00 69.58  ? 397  PRO A N   1 
ATOM   2882  C CA  . PRO A 1 376 ? 7.111   45.722  15.657  1.00 68.20  ? 397  PRO A CA  1 
ATOM   2883  C C   . PRO A 1 376 ? 5.704   45.560  15.087  1.00 66.85  ? 397  PRO A C   1 
ATOM   2884  O O   . PRO A 1 376 ? 4.944   46.524  15.001  1.00 65.31  ? 397  PRO A O   1 
ATOM   2885  C CB  . PRO A 1 376 ? 8.190   45.500  14.602  1.00 68.54  ? 397  PRO A CB  1 
ATOM   2886  C CG  . PRO A 1 376 ? 9.364   45.057  15.420  1.00 68.77  ? 397  PRO A CG  1 
ATOM   2887  C CD  . PRO A 1 376 ? 8.729   44.068  16.360  1.00 69.22  ? 397  PRO A CD  1 
ATOM   2888  N N   . GLU A 1 377 ? 5.369   44.335  14.698  1.00 66.89  ? 398  GLU A N   1 
ATOM   2889  C CA  . GLU A 1 377 ? 4.060   44.040  14.134  1.00 66.94  ? 398  GLU A CA  1 
ATOM   2890  C C   . GLU A 1 377 ? 2.972   44.397  15.137  1.00 66.79  ? 398  GLU A C   1 
ATOM   2891  O O   . GLU A 1 377 ? 1.988   45.051  14.790  1.00 66.48  ? 398  GLU A O   1 
ATOM   2892  C CB  . GLU A 1 377 ? 3.959   42.556  13.778  1.00 67.38  ? 398  GLU A CB  1 
ATOM   2893  C CG  . GLU A 1 377 ? 2.785   42.235  12.867  1.00 68.73  ? 398  GLU A CG  1 
ATOM   2894  C CD  . GLU A 1 377 ? 2.645   40.751  12.583  1.00 69.04  ? 398  GLU A CD  1 
ATOM   2895  O OE1 . GLU A 1 377 ? 3.680   40.085  12.360  1.00 69.80  ? 398  GLU A OE1 1 
ATOM   2896  O OE2 . GLU A 1 377 ? 1.497   40.255  12.570  1.00 68.13  ? 398  GLU A OE2 1 
ATOM   2897  N N   . ALA A 1 378 ? 3.161   43.958  16.380  1.00 66.52  ? 399  ALA A N   1 
ATOM   2898  C CA  . ALA A 1 378 ? 2.215   44.219  17.461  1.00 65.99  ? 399  ALA A CA  1 
ATOM   2899  C C   . ALA A 1 378 ? 2.151   45.712  17.776  1.00 66.17  ? 399  ALA A C   1 
ATOM   2900  O O   . ALA A 1 378 ? 1.077   46.314  17.745  1.00 66.81  ? 399  ALA A O   1 
ATOM   2901  C CB  . ALA A 1 378 ? 2.623   43.444  18.704  1.00 66.16  ? 399  ALA A CB  1 
ATOM   2902  N N   . THR A 1 379 ? 3.307   46.297  18.081  1.00 65.50  ? 400  THR A N   1 
ATOM   2903  C CA  . THR A 1 379 ? 3.410   47.722  18.398  1.00 65.00  ? 400  THR A CA  1 
ATOM   2904  C C   . THR A 1 379 ? 2.707   48.574  17.342  1.00 64.85  ? 400  THR A C   1 
ATOM   2905  O O   . THR A 1 379 ? 1.939   49.486  17.658  1.00 64.71  ? 400  THR A O   1 
ATOM   2906  C CB  . THR A 1 379 ? 4.889   48.167  18.467  1.00 64.97  ? 400  THR A CB  1 
ATOM   2907  O OG1 . THR A 1 379 ? 5.590   47.365  19.425  1.00 64.37  ? 400  THR A OG1 1 
ATOM   2908  C CG2 . THR A 1 379 ? 4.990   49.634  18.866  1.00 64.48  ? 400  THR A CG2 1 
ATOM   2909  N N   . GLU A 1 380 ? 2.984   48.263  16.083  1.00 64.66  ? 401  GLU A N   1 
ATOM   2910  C CA  . GLU A 1 380 ? 2.403   48.975  14.957  1.00 64.81  ? 401  GLU A CA  1 
ATOM   2911  C C   . GLU A 1 380 ? 0.874   48.931  14.976  1.00 64.50  ? 401  GLU A C   1 
ATOM   2912  O O   . GLU A 1 380 ? 0.210   49.956  14.827  1.00 64.17  ? 401  GLU A O   1 
ATOM   2913  C CB  . GLU A 1 380 ? 2.926   48.363  13.654  1.00 65.50  ? 401  GLU A CB  1 
ATOM   2914  C CG  . GLU A 1 380 ? 2.499   49.086  12.393  1.00 65.96  ? 401  GLU A CG  1 
ATOM   2915  C CD  . GLU A 1 380 ? 2.864   50.556  12.420  1.00 66.95  ? 401  GLU A CD  1 
ATOM   2916  O OE1 . GLU A 1 380 ? 3.997   50.886  12.836  1.00 65.80  ? 401  GLU A OE1 1 
ATOM   2917  O OE2 . GLU A 1 380 ? 2.019   51.383  12.015  1.00 68.22  ? 401  GLU A OE2 1 
ATOM   2918  N N   . LYS A 1 381 ? 0.324   47.735  15.165  1.00 64.14  ? 402  LYS A N   1 
ATOM   2919  C CA  . LYS A 1 381 ? -1.122  47.531  15.184  1.00 63.18  ? 402  LYS A CA  1 
ATOM   2920  C C   . LYS A 1 381 ? -1.857  48.523  16.075  1.00 63.46  ? 402  LYS A C   1 
ATOM   2921  O O   . LYS A 1 381 ? -2.831  49.146  15.654  1.00 62.66  ? 402  LYS A O   1 
ATOM   2922  C CB  . LYS A 1 381 ? -1.438  46.108  15.645  1.00 61.26  ? 402  LYS A CB  1 
ATOM   2923  C CG  . LYS A 1 381 ? -2.902  45.712  15.525  1.00 60.02  ? 402  LYS A CG  1 
ATOM   2924  C CD  . LYS A 1 381 ? -3.323  45.513  14.075  1.00 58.50  ? 402  LYS A CD  1 
ATOM   2925  C CE  . LYS A 1 381 ? -4.685  44.833  13.985  1.00 57.27  ? 402  LYS A CE  1 
ATOM   2926  N NZ  . LYS A 1 381 ? -5.057  44.487  12.587  1.00 56.47  ? 402  LYS A NZ  1 
ATOM   2927  N N   . TYR A 1 382 ? -1.386  48.664  17.308  1.00 64.36  ? 403  TYR A N   1 
ATOM   2928  C CA  . TYR A 1 382 ? -2.016  49.567  18.259  1.00 65.83  ? 403  TYR A CA  1 
ATOM   2929  C C   . TYR A 1 382 ? -1.582  51.017  18.095  1.00 66.70  ? 403  TYR A C   1 
ATOM   2930  O O   . TYR A 1 382 ? -2.411  51.895  17.856  1.00 66.68  ? 403  TYR A O   1 
ATOM   2931  C CB  . TYR A 1 382 ? -1.719  49.119  19.697  1.00 66.35  ? 403  TYR A CB  1 
ATOM   2932  C CG  . TYR A 1 382 ? -2.507  47.912  20.185  1.00 66.41  ? 403  TYR A CG  1 
ATOM   2933  C CD1 . TYR A 1 382 ? -2.329  46.648  19.615  1.00 65.82  ? 403  TYR A CD1 1 
ATOM   2934  C CD2 . TYR A 1 382 ? -3.416  48.035  21.239  1.00 66.32  ? 403  TYR A CD2 1 
ATOM   2935  C CE1 . TYR A 1 382 ? -3.036  45.533  20.089  1.00 64.86  ? 403  TYR A CE1 1 
ATOM   2936  C CE2 . TYR A 1 382 ? -4.128  46.929  21.718  1.00 65.47  ? 403  TYR A CE2 1 
ATOM   2937  C CZ  . TYR A 1 382 ? -3.934  45.682  21.140  1.00 64.94  ? 403  TYR A CZ  1 
ATOM   2938  O OH  . TYR A 1 382 ? -4.632  44.594  21.621  1.00 62.39  ? 403  TYR A OH  1 
ATOM   2939  N N   . LEU A 1 383 ? -0.280  51.258  18.221  1.00 67.65  ? 404  LEU A N   1 
ATOM   2940  C CA  . LEU A 1 383 ? 0.282   52.604  18.130  1.00 68.85  ? 404  LEU A CA  1 
ATOM   2941  C C   . LEU A 1 383 ? 0.365   53.205  16.725  1.00 70.35  ? 404  LEU A C   1 
ATOM   2942  O O   . LEU A 1 383 ? 0.664   54.393  16.570  1.00 70.37  ? 404  LEU A O   1 
ATOM   2943  C CB  . LEU A 1 383 ? 1.670   52.607  18.766  1.00 67.50  ? 404  LEU A CB  1 
ATOM   2944  C CG  . LEU A 1 383 ? 1.711   51.973  20.154  1.00 66.59  ? 404  LEU A CG  1 
ATOM   2945  C CD1 . LEU A 1 383 ? 3.130   51.968  20.666  1.00 66.36  ? 404  LEU A CD1 1 
ATOM   2946  C CD2 . LEU A 1 383 ? 0.803   52.742  21.096  1.00 67.19  ? 404  LEU A CD2 1 
ATOM   2947  N N   . GLY A 1 384 ? 0.100   52.390  15.708  1.00 71.92  ? 405  GLY A N   1 
ATOM   2948  C CA  . GLY A 1 384 ? 0.156   52.876  14.339  1.00 73.29  ? 405  GLY A CA  1 
ATOM   2949  C C   . GLY A 1 384 ? -1.061  53.690  13.937  1.00 74.20  ? 405  GLY A C   1 
ATOM   2950  O O   . GLY A 1 384 ? -1.248  54.003  12.761  1.00 73.90  ? 405  GLY A O   1 
ATOM   2951  N N   . GLY A 1 385 ? -1.894  54.030  14.915  1.00 75.14  ? 406  GLY A N   1 
ATOM   2952  C CA  . GLY A 1 385 ? -3.083  54.809  14.630  1.00 76.28  ? 406  GLY A CA  1 
ATOM   2953  C C   . GLY A 1 385 ? -2.724  56.217  14.204  1.00 77.10  ? 406  GLY A C   1 
ATOM   2954  O O   . GLY A 1 385 ? -2.835  56.567  13.028  1.00 76.86  ? 406  GLY A O   1 
ATOM   2955  N N   . THR A 1 386 ? -2.291  57.025  15.168  1.00 78.08  ? 407  THR A N   1 
ATOM   2956  C CA  . THR A 1 386 ? -1.901  58.404  14.899  1.00 79.33  ? 407  THR A CA  1 
ATOM   2957  C C   . THR A 1 386 ? -0.454  58.661  15.316  1.00 79.65  ? 407  THR A C   1 
ATOM   2958  O O   . THR A 1 386 ? 0.277   57.732  15.668  1.00 79.50  ? 407  THR A O   1 
ATOM   2959  C CB  . THR A 1 386 ? -2.819  59.403  15.633  1.00 79.38  ? 407  THR A CB  1 
ATOM   2960  O OG1 . THR A 1 386 ? -2.973  58.994  16.997  1.00 80.11  ? 407  THR A OG1 1 
ATOM   2961  C CG2 . THR A 1 386 ? -4.185  59.473  14.961  1.00 78.91  ? 407  THR A CG2 1 
ATOM   2962  N N   . ASP A 1 387 ? -0.050  59.928  15.275  1.00 80.20  ? 408  ASP A N   1 
ATOM   2963  C CA  . ASP A 1 387 ? 1.312   60.310  15.629  1.00 80.60  ? 408  ASP A CA  1 
ATOM   2964  C C   . ASP A 1 387 ? 1.378   61.016  16.978  1.00 80.30  ? 408  ASP A C   1 
ATOM   2965  O O   . ASP A 1 387 ? 2.460   61.372  17.445  1.00 80.93  ? 408  ASP A O   1 
ATOM   2966  C CB  . ASP A 1 387 ? 1.888   61.227  14.551  1.00 81.62  ? 408  ASP A CB  1 
ATOM   2967  C CG  . ASP A 1 387 ? 1.533   60.769  13.153  1.00 82.76  ? 408  ASP A CG  1 
ATOM   2968  O OD1 . ASP A 1 387 ? 1.898   59.629  12.788  1.00 83.02  ? 408  ASP A OD1 1 
ATOM   2969  O OD2 . ASP A 1 387 ? 0.884   61.550  12.422  1.00 83.39  ? 408  ASP A OD2 1 
ATOM   2970  N N   . ASP A 1 388 ? 0.222   61.223  17.599  1.00 79.24  ? 409  ASP A N   1 
ATOM   2971  C CA  . ASP A 1 388 ? 0.167   61.885  18.897  1.00 78.06  ? 409  ASP A CA  1 
ATOM   2972  C C   . ASP A 1 388 ? 1.015   61.099  19.893  1.00 76.99  ? 409  ASP A C   1 
ATOM   2973  O O   . ASP A 1 388 ? 0.880   59.882  19.997  1.00 77.09  ? 409  ASP A O   1 
ATOM   2974  C CB  . ASP A 1 388 ? -1.279  61.941  19.393  1.00 79.08  ? 409  ASP A CB  1 
ATOM   2975  C CG  . ASP A 1 388 ? -1.448  62.847  20.599  1.00 80.53  ? 409  ASP A CG  1 
ATOM   2976  O OD1 . ASP A 1 388 ? -0.584  62.811  21.499  1.00 81.29  ? 409  ASP A OD1 1 
ATOM   2977  O OD2 . ASP A 1 388 ? -2.452  63.591  20.652  1.00 81.09  ? 409  ASP A OD2 1 
ATOM   2978  N N   . THR A 1 389 ? 1.891   61.787  20.618  1.00 75.68  ? 410  THR A N   1 
ATOM   2979  C CA  . THR A 1 389 ? 2.743   61.126  21.604  1.00 74.67  ? 410  THR A CA  1 
ATOM   2980  C C   . THR A 1 389 ? 1.959   60.738  22.858  1.00 74.11  ? 410  THR A C   1 
ATOM   2981  O O   . THR A 1 389 ? 2.442   59.976  23.700  1.00 73.51  ? 410  THR A O   1 
ATOM   2982  C CB  . THR A 1 389 ? 3.915   62.026  22.011  1.00 74.56  ? 410  THR A CB  1 
ATOM   2983  O OG1 . THR A 1 389 ? 3.456   63.379  22.136  1.00 74.76  ? 410  THR A OG1 1 
ATOM   2984  C CG2 . THR A 1 389 ? 5.022   61.949  20.978  1.00 74.06  ? 410  THR A CG2 1 
ATOM   2985  N N   . VAL A 1 390 ? 0.748   61.275  22.976  1.00 73.39  ? 411  VAL A N   1 
ATOM   2986  C CA  . VAL A 1 390 ? -0.129  60.978  24.101  1.00 72.15  ? 411  VAL A CA  1 
ATOM   2987  C C   . VAL A 1 390 ? -0.997  59.786  23.724  1.00 71.31  ? 411  VAL A C   1 
ATOM   2988  O O   . VAL A 1 390 ? -0.980  58.762  24.406  1.00 71.81  ? 411  VAL A O   1 
ATOM   2989  C CB  . VAL A 1 390 ? -1.038  62.174  24.438  1.00 72.22  ? 411  VAL A CB  1 
ATOM   2990  C CG1 . VAL A 1 390 ? -2.098  61.761  25.448  1.00 72.02  ? 411  VAL A CG1 1 
ATOM   2991  C CG2 . VAL A 1 390 ? -0.201  63.309  24.993  1.00 72.36  ? 411  VAL A CG2 1 
ATOM   2992  N N   . LYS A 1 391 ? -1.750  59.917  22.634  1.00 69.72  ? 412  LYS A N   1 
ATOM   2993  C CA  . LYS A 1 391 ? -2.606  58.830  22.176  1.00 68.83  ? 412  LYS A CA  1 
ATOM   2994  C C   . LYS A 1 391 ? -1.817  57.524  22.113  1.00 68.53  ? 412  LYS A C   1 
ATOM   2995  O O   . LYS A 1 391 ? -2.388  56.437  22.187  1.00 68.15  ? 412  LYS A O   1 
ATOM   2996  C CB  . LYS A 1 391 ? -3.187  59.148  20.801  1.00 67.91  ? 412  LYS A CB  1 
ATOM   2997  C CG  . LYS A 1 391 ? -4.237  60.238  20.809  1.00 68.03  ? 412  LYS A CG  1 
ATOM   2998  C CD  . LYS A 1 391 ? -4.935  60.310  19.465  1.00 69.35  ? 412  LYS A CD  1 
ATOM   2999  C CE  . LYS A 1 391 ? -6.086  61.304  19.472  1.00 70.02  ? 412  LYS A CE  1 
ATOM   3000  N NZ  . LYS A 1 391 ? -6.791  61.317  18.152  1.00 70.93  ? 412  LYS A NZ  1 
ATOM   3001  N N   . LYS A 1 392 ? -0.502  57.641  21.971  1.00 68.64  ? 413  LYS A N   1 
ATOM   3002  C CA  . LYS A 1 392 ? 0.362   56.469  21.923  1.00 68.85  ? 413  LYS A CA  1 
ATOM   3003  C C   . LYS A 1 392 ? 0.421   55.871  23.321  1.00 67.97  ? 413  LYS A C   1 
ATOM   3004  O O   . LYS A 1 392 ? -0.011  54.738  23.536  1.00 68.77  ? 413  LYS A O   1 
ATOM   3005  C CB  . LYS A 1 392 ? 1.776   56.851  21.468  1.00 69.76  ? 413  LYS A CB  1 
ATOM   3006  C CG  . LYS A 1 392 ? 1.927   57.083  19.973  1.00 70.10  ? 413  LYS A CG  1 
ATOM   3007  C CD  . LYS A 1 392 ? 3.361   57.470  19.637  1.00 70.52  ? 413  LYS A CD  1 
ATOM   3008  C CE  . LYS A 1 392 ? 3.588   57.528  18.136  1.00 71.37  ? 413  LYS A CE  1 
ATOM   3009  N NZ  . LYS A 1 392 ? 3.375   56.202  17.488  1.00 71.94  ? 413  LYS A NZ  1 
ATOM   3010  N N   . LYS A 1 393 ? 0.960   56.639  24.265  1.00 66.34  ? 414  LYS A N   1 
ATOM   3011  C CA  . LYS A 1 393 ? 1.066   56.195  25.649  1.00 64.55  ? 414  LYS A CA  1 
ATOM   3012  C C   . LYS A 1 393 ? -0.154  55.367  26.040  1.00 63.57  ? 414  LYS A C   1 
ATOM   3013  O O   . LYS A 1 393 ? -0.023  54.245  26.525  1.00 64.25  ? 414  LYS A O   1 
ATOM   3014  C CB  . LYS A 1 393 ? 1.166   57.401  26.582  1.00 64.39  ? 414  LYS A CB  1 
ATOM   3015  C CG  . LYS A 1 393 ? 0.817   57.076  28.027  1.00 64.80  ? 414  LYS A CG  1 
ATOM   3016  C CD  . LYS A 1 393 ? 0.508   58.331  28.824  1.00 65.54  ? 414  LYS A CD  1 
ATOM   3017  C CE  . LYS A 1 393 ? 0.017   57.994  30.223  1.00 64.70  ? 414  LYS A CE  1 
ATOM   3018  N NZ  . LYS A 1 393 ? -0.290  59.220  31.006  1.00 64.81  ? 414  LYS A NZ  1 
ATOM   3019  N N   . ASP A 1 394 ? -1.338  55.932  25.814  1.00 61.72  ? 415  ASP A N   1 
ATOM   3020  C CA  . ASP A 1 394 ? -2.597  55.275  26.147  1.00 58.68  ? 415  ASP A CA  1 
ATOM   3021  C C   . ASP A 1 394 ? -2.827  53.986  25.366  1.00 56.72  ? 415  ASP A C   1 
ATOM   3022  O O   . ASP A 1 394 ? -3.066  52.940  25.959  1.00 57.04  ? 415  ASP A O   1 
ATOM   3023  C CB  . ASP A 1 394 ? -3.771  56.230  25.912  1.00 59.55  ? 415  ASP A CB  1 
ATOM   3024  C CG  . ASP A 1 394 ? -3.542  57.605  26.521  1.00 59.98  ? 415  ASP A CG  1 
ATOM   3025  O OD1 . ASP A 1 394 ? -2.952  57.678  27.621  1.00 60.59  ? 415  ASP A OD1 1 
ATOM   3026  O OD2 . ASP A 1 394 ? -3.964  58.610  25.903  1.00 58.99  ? 415  ASP A OD2 1 
ATOM   3027  N N   . LEU A 1 395 ? -2.772  54.054  24.040  1.00 54.93  ? 416  LEU A N   1 
ATOM   3028  C CA  . LEU A 1 395 ? -2.976  52.857  23.227  1.00 53.76  ? 416  LEU A CA  1 
ATOM   3029  C C   . LEU A 1 395 ? -1.992  51.764  23.623  1.00 52.68  ? 416  LEU A C   1 
ATOM   3030  O O   . LEU A 1 395 ? -2.279  50.576  23.475  1.00 52.11  ? 416  LEU A O   1 
ATOM   3031  C CB  . LEU A 1 395 ? -2.813  53.173  21.738  1.00 55.15  ? 416  LEU A CB  1 
ATOM   3032  C CG  . LEU A 1 395 ? -4.057  53.625  20.965  1.00 56.10  ? 416  LEU A CG  1 
ATOM   3033  C CD1 . LEU A 1 395 ? -3.685  53.893  19.516  1.00 56.54  ? 416  LEU A CD1 1 
ATOM   3034  C CD2 . LEU A 1 395 ? -5.132  52.548  21.030  1.00 56.67  ? 416  LEU A CD2 1 
ATOM   3035  N N   . PHE A 1 396 ? -0.829  52.173  24.120  1.00 51.28  ? 417  PHE A N   1 
ATOM   3036  C CA  . PHE A 1 396 ? 0.191   51.229  24.545  1.00 49.42  ? 417  PHE A CA  1 
ATOM   3037  C C   . PHE A 1 396 ? -0.344  50.473  25.746  1.00 47.96  ? 417  PHE A C   1 
ATOM   3038  O O   . PHE A 1 396 ? -0.063  49.288  25.917  1.00 48.59  ? 417  PHE A O   1 
ATOM   3039  C CB  . PHE A 1 396 ? 1.477   51.965  24.924  1.00 50.78  ? 417  PHE A CB  1 
ATOM   3040  C CG  . PHE A 1 396 ? 2.598   51.052  25.350  1.00 52.23  ? 417  PHE A CG  1 
ATOM   3041  C CD1 . PHE A 1 396 ? 3.045   50.036  24.508  1.00 52.57  ? 417  PHE A CD1 1 
ATOM   3042  C CD2 . PHE A 1 396 ? 3.212   51.211  26.591  1.00 52.97  ? 417  PHE A CD2 1 
ATOM   3043  C CE1 . PHE A 1 396 ? 4.091   49.187  24.898  1.00 53.54  ? 417  PHE A CE1 1 
ATOM   3044  C CE2 . PHE A 1 396 ? 4.259   50.370  26.991  1.00 53.65  ? 417  PHE A CE2 1 
ATOM   3045  C CZ  . PHE A 1 396 ? 4.699   49.356  26.142  1.00 53.61  ? 417  PHE A CZ  1 
ATOM   3046  N N   . LEU A 1 397 ? -1.122  51.169  26.574  1.00 46.46  ? 418  LEU A N   1 
ATOM   3047  C CA  . LEU A 1 397 ? -1.726  50.574  27.770  1.00 44.07  ? 418  LEU A CA  1 
ATOM   3048  C C   . LEU A 1 397 ? -2.801  49.557  27.372  1.00 42.81  ? 418  LEU A C   1 
ATOM   3049  O O   . LEU A 1 397 ? -2.921  48.493  27.984  1.00 42.53  ? 418  LEU A O   1 
ATOM   3050  C CB  . LEU A 1 397 ? -2.350  51.660  28.658  1.00 42.13  ? 418  LEU A CB  1 
ATOM   3051  C CG  . LEU A 1 397 ? -1.463  52.791  29.189  1.00 40.89  ? 418  LEU A CG  1 
ATOM   3052  C CD1 . LEU A 1 397 ? -2.299  53.700  30.070  1.00 40.70  ? 418  LEU A CD1 1 
ATOM   3053  C CD2 . LEU A 1 397 ? -0.293  52.233  29.977  1.00 39.88  ? 418  LEU A CD2 1 
ATOM   3054  N N   . ASP A 1 398 ? -3.585  49.886  26.350  1.00 40.98  ? 419  ASP A N   1 
ATOM   3055  C CA  . ASP A 1 398 ? -4.614  48.970  25.890  1.00 40.87  ? 419  ASP A CA  1 
ATOM   3056  C C   . ASP A 1 398 ? -3.898  47.732  25.374  1.00 40.24  ? 419  ASP A C   1 
ATOM   3057  O O   . ASP A 1 398 ? -4.399  46.615  25.482  1.00 39.66  ? 419  ASP A O   1 
ATOM   3058  C CB  . ASP A 1 398 ? -5.445  49.602  24.768  1.00 41.92  ? 419  ASP A CB  1 
ATOM   3059  C CG  . ASP A 1 398 ? -6.143  50.876  25.208  1.00 42.62  ? 419  ASP A CG  1 
ATOM   3060  O OD1 . ASP A 1 398 ? -6.841  50.847  26.244  1.00 43.15  ? 419  ASP A OD1 1 
ATOM   3061  O OD2 . ASP A 1 398 ? -5.998  51.908  24.521  1.00 43.46  ? 419  ASP A OD2 1 
ATOM   3062  N N   . LEU A 1 399 ? -2.713  47.948  24.815  1.00 40.26  ? 420  LEU A N   1 
ATOM   3063  C CA  . LEU A 1 399 ? -1.907  46.858  24.291  1.00 39.27  ? 420  LEU A CA  1 
ATOM   3064  C C   . LEU A 1 399 ? -1.709  45.881  25.432  1.00 38.32  ? 420  LEU A C   1 
ATOM   3065  O O   . LEU A 1 399 ? -2.206  44.756  25.394  1.00 38.61  ? 420  LEU A O   1 
ATOM   3066  C CB  . LEU A 1 399 ? -0.552  47.388  23.805  1.00 40.41  ? 420  LEU A CB  1 
ATOM   3067  C CG  . LEU A 1 399 ? 0.440   46.457  23.087  1.00 41.37  ? 420  LEU A CG  1 
ATOM   3068  C CD1 . LEU A 1 399 ? 1.177   45.569  24.071  1.00 41.45  ? 420  LEU A CD1 1 
ATOM   3069  C CD2 . LEU A 1 399 ? -0.308  45.628  22.064  1.00 41.07  ? 420  LEU A CD2 1 
ATOM   3070  N N   . ILE A 1 400 ? -0.997  46.331  26.458  1.00 36.84  ? 421  ILE A N   1 
ATOM   3071  C CA  . ILE A 1 400 ? -0.725  45.504  27.620  1.00 35.87  ? 421  ILE A CA  1 
ATOM   3072  C C   . ILE A 1 400 ? -1.983  44.860  28.192  1.00 35.19  ? 421  ILE A C   1 
ATOM   3073  O O   . ILE A 1 400 ? -2.061  43.634  28.314  1.00 34.48  ? 421  ILE A O   1 
ATOM   3074  C CB  . ILE A 1 400 ? -0.027  46.332  28.707  1.00 36.14  ? 421  ILE A CB  1 
ATOM   3075  C CG1 . ILE A 1 400 ? 1.374   46.704  28.220  1.00 36.72  ? 421  ILE A CG1 1 
ATOM   3076  C CG2 . ILE A 1 400 ? 0.037   45.558  30.012  1.00 35.26  ? 421  ILE A CG2 1 
ATOM   3077  C CD1 . ILE A 1 400 ? 2.178   47.500  29.213  1.00 37.62  ? 421  ILE A CD1 1 
ATOM   3078  N N   . ALA A 1 401 ? -2.973  45.683  28.523  1.00 34.48  ? 422  ALA A N   1 
ATOM   3079  C CA  . ALA A 1 401 ? -4.222  45.184  29.095  1.00 33.81  ? 422  ALA A CA  1 
ATOM   3080  C C   . ALA A 1 401 ? -4.912  44.093  28.266  1.00 33.15  ? 422  ALA A C   1 
ATOM   3081  O O   . ALA A 1 401 ? -5.555  43.206  28.815  1.00 32.41  ? 422  ALA A O   1 
ATOM   3082  C CB  . ALA A 1 401 ? -5.176  46.344  29.329  1.00 33.66  ? 422  ALA A CB  1 
ATOM   3083  N N   . ASP A 1 402 ? -4.778  44.155  26.948  1.00 34.14  ? 423  ASP A N   1 
ATOM   3084  C CA  . ASP A 1 402 ? -5.401  43.164  26.077  1.00 34.33  ? 423  ASP A CA  1 
ATOM   3085  C C   . ASP A 1 402 ? -4.714  41.810  26.161  1.00 33.47  ? 423  ASP A C   1 
ATOM   3086  O O   . ASP A 1 402 ? -5.369  40.768  26.140  1.00 32.87  ? 423  ASP A O   1 
ATOM   3087  C CB  . ASP A 1 402 ? -5.389  43.662  24.631  1.00 36.02  ? 423  ASP A CB  1 
ATOM   3088  C CG  . ASP A 1 402 ? -6.547  44.598  24.327  1.00 38.42  ? 423  ASP A CG  1 
ATOM   3089  O OD1 . ASP A 1 402 ? -6.817  45.522  25.127  1.00 38.91  ? 423  ASP A OD1 1 
ATOM   3090  O OD2 . ASP A 1 402 ? -7.190  44.411  23.275  1.00 40.10  ? 423  ASP A OD2 1 
ATOM   3091  N N   . VAL A 1 403 ? -3.390  41.836  26.263  1.00 33.44  ? 424  VAL A N   1 
ATOM   3092  C CA  . VAL A 1 403 ? -2.591  40.616  26.345  1.00 32.96  ? 424  VAL A CA  1 
ATOM   3093  C C   . VAL A 1 403 ? -2.714  39.926  27.700  1.00 32.20  ? 424  VAL A C   1 
ATOM   3094  O O   . VAL A 1 403 ? -2.611  38.703  27.783  1.00 33.11  ? 424  VAL A O   1 
ATOM   3095  C CB  . VAL A 1 403 ? -1.087  40.909  26.104  1.00 33.13  ? 424  VAL A CB  1 
ATOM   3096  C CG1 . VAL A 1 403 ? -0.292  39.621  26.151  1.00 32.40  ? 424  VAL A CG1 1 
ATOM   3097  C CG2 . VAL A 1 403 ? -0.892  41.601  24.768  1.00 32.92  ? 424  VAL A CG2 1 
ATOM   3098  N N   . MET A 1 404 ? -2.939  40.711  28.753  1.00 30.72  ? 425  MET A N   1 
ATOM   3099  C CA  . MET A 1 404 ? -3.050  40.176  30.112  1.00 28.58  ? 425  MET A CA  1 
ATOM   3100  C C   . MET A 1 404 ? -4.448  39.803  30.627  1.00 28.23  ? 425  MET A C   1 
ATOM   3101  O O   . MET A 1 404 ? -4.567  38.974  31.535  1.00 29.33  ? 425  MET A O   1 
ATOM   3102  C CB  . MET A 1 404 ? -2.421  41.152  31.108  1.00 26.17  ? 425  MET A CB  1 
ATOM   3103  C CG  . MET A 1 404 ? -0.940  41.391  30.911  1.00 25.35  ? 425  MET A CG  1 
ATOM   3104  S SD  . MET A 1 404 ? -0.123  41.808  32.469  1.00 24.24  ? 425  MET A SD  1 
ATOM   3105  C CE  . MET A 1 404 ? -0.430  43.556  32.598  1.00 22.67  ? 425  MET A CE  1 
ATOM   3106  N N   . PHE A 1 405 ? -5.497  40.406  30.071  1.00 27.24  ? 426  PHE A N   1 
ATOM   3107  C CA  . PHE A 1 405 ? -6.859  40.128  30.534  1.00 25.83  ? 426  PHE A CA  1 
ATOM   3108  C C   . PHE A 1 405 ? -7.865  39.948  29.409  1.00 25.43  ? 426  PHE A C   1 
ATOM   3109  O O   . PHE A 1 405 ? -8.510  38.902  29.286  1.00 25.52  ? 426  PHE A O   1 
ATOM   3110  C CB  . PHE A 1 405 ? -7.353  41.262  31.435  1.00 24.56  ? 426  PHE A CB  1 
ATOM   3111  C CG  . PHE A 1 405 ? -6.351  41.705  32.461  1.00 24.09  ? 426  PHE A CG  1 
ATOM   3112  C CD1 . PHE A 1 405 ? -5.359  42.613  32.131  1.00 23.72  ? 426  PHE A CD1 1 
ATOM   3113  C CD2 . PHE A 1 405 ? -6.401  41.212  33.762  1.00 22.97  ? 426  PHE A CD2 1 
ATOM   3114  C CE1 . PHE A 1 405 ? -4.432  43.022  33.080  1.00 24.63  ? 426  PHE A CE1 1 
ATOM   3115  C CE2 . PHE A 1 405 ? -5.479  41.615  34.716  1.00 21.53  ? 426  PHE A CE2 1 
ATOM   3116  C CZ  . PHE A 1 405 ? -4.496  42.521  34.378  1.00 23.52  ? 426  PHE A CZ  1 
ATOM   3117  N N   . GLY A 1 406 ? -7.998  40.993  28.603  1.00 25.45  ? 427  GLY A N   1 
ATOM   3118  C CA  . GLY A 1 406 ? -8.927  40.985  27.492  1.00 23.50  ? 427  GLY A CA  1 
ATOM   3119  C C   . GLY A 1 406 ? -9.005  39.718  26.666  1.00 22.92  ? 427  GLY A C   1 
ATOM   3120  O O   . GLY A 1 406 ? -9.994  38.989  26.743  1.00 23.59  ? 427  GLY A O   1 
ATOM   3121  N N   . VAL A 1 407 ? -7.971  39.442  25.879  1.00 21.84  ? 428  VAL A N   1 
ATOM   3122  C CA  . VAL A 1 407 ? -7.998  38.269  25.022  1.00 22.74  ? 428  VAL A CA  1 
ATOM   3123  C C   . VAL A 1 407 ? -8.137  36.940  25.756  1.00 23.40  ? 428  VAL A C   1 
ATOM   3124  O O   . VAL A 1 407 ? -8.994  36.124  25.398  1.00 22.80  ? 428  VAL A O   1 
ATOM   3125  C CB  . VAL A 1 407 ? -6.762  38.220  24.116  1.00 23.14  ? 428  VAL A CB  1 
ATOM   3126  C CG1 . VAL A 1 407 ? -6.889  37.071  23.131  1.00 22.54  ? 428  VAL A CG1 1 
ATOM   3127  C CG2 . VAL A 1 407 ? -6.630  39.531  23.368  1.00 23.22  ? 428  VAL A CG2 1 
ATOM   3128  N N   . PRO A 1 408 ? -7.305  36.704  26.793  1.00 23.86  ? 429  PRO A N   1 
ATOM   3129  C CA  . PRO A 1 408 ? -7.338  35.462  27.581  1.00 22.73  ? 429  PRO A CA  1 
ATOM   3130  C C   . PRO A 1 408 ? -8.728  35.215  28.145  1.00 21.75  ? 429  PRO A C   1 
ATOM   3131  O O   . PRO A 1 408 ? -9.240  34.095  28.113  1.00 21.79  ? 429  PRO A O   1 
ATOM   3132  C CB  . PRO A 1 408 ? -6.327  35.725  28.694  1.00 22.95  ? 429  PRO A CB  1 
ATOM   3133  C CG  . PRO A 1 408 ? -5.373  36.684  28.078  1.00 24.35  ? 429  PRO A CG  1 
ATOM   3134  C CD  . PRO A 1 408 ? -6.285  37.624  27.324  1.00 24.72  ? 429  PRO A CD  1 
ATOM   3135  N N   . SER A 1 409 ? -9.328  36.278  28.662  1.00 19.76  ? 430  SER A N   1 
ATOM   3136  C CA  . SER A 1 409 ? -10.650 36.186  29.233  1.00 20.20  ? 430  SER A CA  1 
ATOM   3137  C C   . SER A 1 409 ? -11.679 35.683  28.228  1.00 21.88  ? 430  SER A C   1 
ATOM   3138  O O   . SER A 1 409 ? -12.426 34.751  28.527  1.00 22.67  ? 430  SER A O   1 
ATOM   3139  C CB  . SER A 1 409 ? -11.063 37.544  29.781  1.00 20.00  ? 430  SER A CB  1 
ATOM   3140  O OG  . SER A 1 409 ? -10.186 37.930  30.822  1.00 19.17  ? 430  SER A OG  1 
ATOM   3141  N N   . VAL A 1 410 ? -11.714 36.283  27.039  1.00 22.72  ? 431  VAL A N   1 
ATOM   3142  C CA  . VAL A 1 410 ? -12.678 35.879  26.007  1.00 22.89  ? 431  VAL A CA  1 
ATOM   3143  C C   . VAL A 1 410 ? -12.427 34.460  25.482  1.00 23.16  ? 431  VAL A C   1 
ATOM   3144  O O   . VAL A 1 410 ? -13.372 33.714  25.193  1.00 22.26  ? 431  VAL A O   1 
ATOM   3145  C CB  . VAL A 1 410 ? -12.676 36.870  24.805  1.00 23.02  ? 431  VAL A CB  1 
ATOM   3146  C CG1 . VAL A 1 410 ? -13.558 36.340  23.673  1.00 21.30  ? 431  VAL A CG1 1 
ATOM   3147  C CG2 . VAL A 1 410 ? -13.177 38.233  25.258  1.00 20.75  ? 431  VAL A CG2 1 
ATOM   3148  N N   . ILE A 1 411 ? -11.159 34.087  25.350  1.00 22.11  ? 432  ILE A N   1 
ATOM   3149  C CA  . ILE A 1 411 ? -10.840 32.752  24.870  1.00 21.27  ? 432  ILE A CA  1 
ATOM   3150  C C   . ILE A 1 411 ? -11.436 31.767  25.853  1.00 20.97  ? 432  ILE A C   1 
ATOM   3151  O O   . ILE A 1 411 ? -12.139 30.829  25.462  1.00 20.91  ? 432  ILE A O   1 
ATOM   3152  C CB  . ILE A 1 411 ? -9.332  32.526  24.798  1.00 21.76  ? 432  ILE A CB  1 
ATOM   3153  C CG1 . ILE A 1 411 ? -8.717  33.472  23.762  1.00 22.86  ? 432  ILE A CG1 1 
ATOM   3154  C CG2 . ILE A 1 411 ? -9.055  31.077  24.452  1.00 22.22  ? 432  ILE A CG2 1 
ATOM   3155  C CD1 . ILE A 1 411 ? -7.213  33.367  23.625  1.00 22.44  ? 432  ILE A CD1 1 
ATOM   3156  N N   . VAL A 1 412 ? -11.151 31.999  27.134  1.00 19.83  ? 433  VAL A N   1 
ATOM   3157  C CA  . VAL A 1 412 ? -11.661 31.163  28.212  1.00 17.70  ? 433  VAL A CA  1 
ATOM   3158  C C   . VAL A 1 412 ? -13.185 31.075  28.120  1.00 18.78  ? 433  VAL A C   1 
ATOM   3159  O O   . VAL A 1 412 ? -13.751 29.978  28.102  1.00 18.67  ? 433  VAL A O   1 
ATOM   3160  C CB  . VAL A 1 412 ? -11.252 31.735  29.575  1.00 15.18  ? 433  VAL A CB  1 
ATOM   3161  C CG1 . VAL A 1 412 ? -12.011 31.047  30.692  1.00 12.92  ? 433  VAL A CG1 1 
ATOM   3162  C CG2 . VAL A 1 412 ? -9.762  31.562  29.761  1.00 13.27  ? 433  VAL A CG2 1 
ATOM   3163  N N   . ALA A 1 413 ? -13.843 32.230  28.044  1.00 18.86  ? 434  ALA A N   1 
ATOM   3164  C CA  . ALA A 1 413 ? -15.300 32.274  27.937  1.00 20.15  ? 434  ALA A CA  1 
ATOM   3165  C C   . ALA A 1 413 ? -15.773 31.371  26.802  1.00 21.62  ? 434  ALA A C   1 
ATOM   3166  O O   . ALA A 1 413 ? -16.639 30.505  26.985  1.00 21.24  ? 434  ALA A O   1 
ATOM   3167  C CB  . ALA A 1 413 ? -15.766 33.702  27.687  1.00 18.40  ? 434  ALA A CB  1 
ATOM   3168  N N   . ARG A 1 414 ? -15.199 31.582  25.623  1.00 22.99  ? 435  ARG A N   1 
ATOM   3169  C CA  . ARG A 1 414 ? -15.568 30.789  24.463  1.00 23.32  ? 435  ARG A CA  1 
ATOM   3170  C C   . ARG A 1 414 ? -15.365 29.316  24.766  1.00 23.23  ? 435  ARG A C   1 
ATOM   3171  O O   . ARG A 1 414 ? -16.285 28.512  24.617  1.00 23.49  ? 435  ARG A O   1 
ATOM   3172  C CB  . ARG A 1 414 ? -14.729 31.200  23.251  1.00 23.58  ? 435  ARG A CB  1 
ATOM   3173  C CG  . ARG A 1 414 ? -15.103 32.556  22.670  1.00 22.49  ? 435  ARG A CG  1 
ATOM   3174  C CD  . ARG A 1 414 ? -14.209 32.911  21.508  1.00 21.26  ? 435  ARG A CD  1 
ATOM   3175  N NE  . ARG A 1 414 ? -14.602 34.170  20.894  1.00 23.52  ? 435  ARG A NE  1 
ATOM   3176  C CZ  . ARG A 1 414 ? -13.859 34.827  20.010  1.00 24.46  ? 435  ARG A CZ  1 
ATOM   3177  N NH1 . ARG A 1 414 ? -12.686 34.335  19.643  1.00 23.93  ? 435  ARG A NH1 1 
ATOM   3178  N NH2 . ARG A 1 414 ? -14.281 35.979  19.499  1.00 24.23  ? 435  ARG A NH2 1 
ATOM   3179  N N   . ASN A 1 415 ? -14.164 28.969  25.210  1.00 22.38  ? 436  ASN A N   1 
ATOM   3180  C CA  . ASN A 1 415 ? -13.851 27.585  25.528  1.00 22.25  ? 436  ASN A CA  1 
ATOM   3181  C C   . ASN A 1 415 ? -14.855 26.970  26.490  1.00 22.12  ? 436  ASN A C   1 
ATOM   3182  O O   . ASN A 1 415 ? -15.215 25.799  26.355  1.00 21.51  ? 436  ASN A O   1 
ATOM   3183  C CB  . ASN A 1 415 ? -12.442 27.495  26.105  1.00 22.84  ? 436  ASN A CB  1 
ATOM   3184  C CG  . ASN A 1 415 ? -11.371 27.616  25.036  1.00 22.91  ? 436  ASN A CG  1 
ATOM   3185  O OD1 . ASN A 1 415 ? -10.236 28.000  25.316  1.00 23.03  ? 436  ASN A OD1 1 
ATOM   3186  N ND2 . ASN A 1 415 ? -11.727 27.272  23.805  1.00 23.18  ? 436  ASN A ND2 1 
ATOM   3187  N N   . HIS A 1 416 ? -15.311 27.761  27.455  1.00 22.77  ? 437  HIS A N   1 
ATOM   3188  C CA  . HIS A 1 416 ? -16.275 27.275  28.433  1.00 23.11  ? 437  HIS A CA  1 
ATOM   3189  C C   . HIS A 1 416 ? -17.616 27.123  27.744  1.00 25.20  ? 437  HIS A C   1 
ATOM   3190  O O   . HIS A 1 416 ? -18.292 26.108  27.897  1.00 25.54  ? 437  HIS A O   1 
ATOM   3191  C CB  . HIS A 1 416 ? -16.403 28.259  29.589  1.00 21.73  ? 437  HIS A CB  1 
ATOM   3192  C CG  . HIS A 1 416 ? -17.316 27.799  30.682  1.00 20.16  ? 437  HIS A CG  1 
ATOM   3193  N ND1 . HIS A 1 416 ? -16.877 27.049  31.751  1.00 20.38  ? 437  HIS A ND1 1 
ATOM   3194  C CD2 . HIS A 1 416 ? -18.643 27.979  30.869  1.00 19.40  ? 437  HIS A CD2 1 
ATOM   3195  C CE1 . HIS A 1 416 ? -17.896 26.788  32.550  1.00 19.26  ? 437  HIS A CE1 1 
ATOM   3196  N NE2 . HIS A 1 416 ? -18.980 27.341  32.038  1.00 19.46  ? 437  HIS A NE2 1 
ATOM   3197  N N   . ARG A 1 417 ? -17.999 28.144  26.986  1.00 27.68  ? 438  ARG A N   1 
ATOM   3198  C CA  . ARG A 1 417 ? -19.261 28.112  26.255  1.00 30.22  ? 438  ARG A CA  1 
ATOM   3199  C C   . ARG A 1 417 ? -19.306 26.850  25.398  1.00 31.85  ? 438  ARG A C   1 
ATOM   3200  O O   . ARG A 1 417 ? -20.251 26.066  25.481  1.00 31.78  ? 438  ARG A O   1 
ATOM   3201  C CB  . ARG A 1 417 ? -19.381 29.339  25.351  1.00 30.57  ? 438  ARG A CB  1 
ATOM   3202  C CG  . ARG A 1 417 ? -20.605 29.330  24.457  1.00 31.35  ? 438  ARG A CG  1 
ATOM   3203  C CD  . ARG A 1 417 ? -20.407 30.295  23.314  1.00 34.72  ? 438  ARG A CD  1 
ATOM   3204  N NE  . ARG A 1 417 ? -19.294 29.870  22.470  1.00 38.17  ? 438  ARG A NE  1 
ATOM   3205  C CZ  . ARG A 1 417 ? -18.570 30.681  21.703  1.00 38.80  ? 438  ARG A CZ  1 
ATOM   3206  N NH1 . ARG A 1 417 ? -18.828 31.983  21.661  1.00 39.78  ? 438  ARG A NH1 1 
ATOM   3207  N NH2 . ARG A 1 417 ? -17.579 30.186  20.977  1.00 39.55  ? 438  ARG A NH2 1 
ATOM   3208  N N   . ASP A 1 418 ? -18.266 26.665  24.582  1.00 33.17  ? 439  ASP A N   1 
ATOM   3209  C CA  . ASP A 1 418 ? -18.151 25.511  23.692  1.00 33.05  ? 439  ASP A CA  1 
ATOM   3210  C C   . ASP A 1 418 ? -18.188 24.183  24.452  1.00 32.92  ? 439  ASP A C   1 
ATOM   3211  O O   . ASP A 1 418 ? -18.640 23.166  23.922  1.00 32.55  ? 439  ASP A O   1 
ATOM   3212  C CB  . ASP A 1 418 ? -16.857 25.597  22.869  1.00 33.52  ? 439  ASP A CB  1 
ATOM   3213  C CG  . ASP A 1 418 ? -16.768 26.873  22.036  1.00 33.78  ? 439  ASP A CG  1 
ATOM   3214  O OD1 . ASP A 1 418 ? -17.809 27.315  21.503  1.00 33.85  ? 439  ASP A OD1 1 
ATOM   3215  O OD2 . ASP A 1 418 ? -15.652 27.423  21.900  1.00 33.11  ? 439  ASP A OD2 1 
ATOM   3216  N N   . ALA A 1 419 ? -17.700 24.188  25.689  1.00 32.99  ? 440  ALA A N   1 
ATOM   3217  C CA  . ALA A 1 419 ? -17.714 22.979  26.499  1.00 32.61  ? 440  ALA A CA  1 
ATOM   3218  C C   . ALA A 1 419 ? -19.177 22.616  26.749  1.00 32.84  ? 440  ALA A C   1 
ATOM   3219  O O   . ALA A 1 419 ? -19.503 21.477  27.076  1.00 33.03  ? 440  ALA A O   1 
ATOM   3220  C CB  . ALA A 1 419 ? -16.993 23.219  27.815  1.00 32.57  ? 440  ALA A CB  1 
ATOM   3221  N N   . GLY A 1 420 ? -20.055 23.604  26.596  1.00 32.87  ? 441  GLY A N   1 
ATOM   3222  C CA  . GLY A 1 420 ? -21.477 23.375  26.787  1.00 32.13  ? 441  GLY A CA  1 
ATOM   3223  C C   . GLY A 1 420 ? -22.037 23.759  28.144  1.00 31.26  ? 441  GLY A C   1 
ATOM   3224  O O   . GLY A 1 420 ? -23.048 23.209  28.584  1.00 32.50  ? 441  GLY A O   1 
ATOM   3225  N N   . ALA A 1 421 ? -21.399 24.709  28.811  1.00 29.26  ? 442  ALA A N   1 
ATOM   3226  C CA  . ALA A 1 421 ? -21.866 25.125  30.119  1.00 26.24  ? 442  ALA A CA  1 
ATOM   3227  C C   . ALA A 1 421 ? -22.229 26.597  30.106  1.00 25.06  ? 442  ALA A C   1 
ATOM   3228  O O   . ALA A 1 421 ? -21.572 27.397  29.434  1.00 25.24  ? 442  ALA A O   1 
ATOM   3229  C CB  . ALA A 1 421 ? -20.790 24.867  31.144  1.00 27.64  ? 442  ALA A CB  1 
ATOM   3230  N N   . PRO A 1 422 ? -23.281 26.978  30.854  1.00 23.09  ? 443  PRO A N   1 
ATOM   3231  C CA  . PRO A 1 422 ? -23.701 28.381  30.903  1.00 22.31  ? 443  PRO A CA  1 
ATOM   3232  C C   . PRO A 1 422 ? -22.469 29.272  30.937  1.00 22.21  ? 443  PRO A C   1 
ATOM   3233  O O   . PRO A 1 422 ? -21.466 28.920  31.559  1.00 23.47  ? 443  PRO A O   1 
ATOM   3234  C CB  . PRO A 1 422 ? -24.495 28.453  32.201  1.00 20.84  ? 443  PRO A CB  1 
ATOM   3235  C CG  . PRO A 1 422 ? -25.140 27.110  32.256  1.00 20.64  ? 443  PRO A CG  1 
ATOM   3236  C CD  . PRO A 1 422 ? -24.031 26.169  31.833  1.00 21.55  ? 443  PRO A CD  1 
ATOM   3237  N N   . THR A 1 423 ? -22.529 30.411  30.261  1.00 21.24  ? 444  THR A N   1 
ATOM   3238  C CA  . THR A 1 423 ? -21.391 31.321  30.248  1.00 20.45  ? 444  THR A CA  1 
ATOM   3239  C C   . THR A 1 423 ? -21.879 32.760  30.148  1.00 20.61  ? 444  THR A C   1 
ATOM   3240  O O   . THR A 1 423 ? -22.777 33.069  29.365  1.00 21.40  ? 444  THR A O   1 
ATOM   3241  C CB  . THR A 1 423 ? -20.444 31.006  29.058  1.00 20.08  ? 444  THR A CB  1 
ATOM   3242  O OG1 . THR A 1 423 ? -20.057 29.629  29.109  1.00 20.25  ? 444  THR A OG1 1 
ATOM   3243  C CG2 . THR A 1 423 ? -19.196 31.861  29.115  1.00 18.30  ? 444  THR A CG2 1 
ATOM   3244  N N   . TYR A 1 424 ? -21.292 33.637  30.949  1.00 20.10  ? 445  TYR A N   1 
ATOM   3245  C CA  . TYR A 1 424 ? -21.667 35.044  30.938  1.00 20.78  ? 445  TYR A CA  1 
ATOM   3246  C C   . TYR A 1 424 ? -20.415 35.900  30.943  1.00 19.53  ? 445  TYR A C   1 
ATOM   3247  O O   . TYR A 1 424 ? -19.412 35.540  31.555  1.00 19.33  ? 445  TYR A O   1 
ATOM   3248  C CB  . TYR A 1 424 ? -22.518 35.379  32.171  1.00 22.93  ? 445  TYR A CB  1 
ATOM   3249  C CG  . TYR A 1 424 ? -23.926 34.831  32.124  1.00 25.03  ? 445  TYR A CG  1 
ATOM   3250  C CD1 . TYR A 1 424 ? -24.939 35.528  31.468  1.00 26.33  ? 445  TYR A CD1 1 
ATOM   3251  C CD2 . TYR A 1 424 ? -24.242 33.601  32.714  1.00 25.79  ? 445  TYR A CD2 1 
ATOM   3252  C CE1 . TYR A 1 424 ? -26.236 35.018  31.394  1.00 27.99  ? 445  TYR A CE1 1 
ATOM   3253  C CE2 . TYR A 1 424 ? -25.538 33.078  32.649  1.00 26.91  ? 445  TYR A CE2 1 
ATOM   3254  C CZ  . TYR A 1 424 ? -26.530 33.794  31.985  1.00 28.88  ? 445  TYR A CZ  1 
ATOM   3255  O OH  . TYR A 1 424 ? -27.814 33.297  31.894  1.00 29.05  ? 445  TYR A OH  1 
ATOM   3256  N N   . MET A 1 425 ? -20.472 37.030  30.255  1.00 18.39  ? 446  MET A N   1 
ATOM   3257  C CA  . MET A 1 425 ? -19.343 37.942  30.220  1.00 18.04  ? 446  MET A CA  1 
ATOM   3258  C C   . MET A 1 425 ? -19.807 39.361  30.508  1.00 18.47  ? 446  MET A C   1 
ATOM   3259  O O   . MET A 1 425 ? -20.993 39.672  30.377  1.00 18.71  ? 446  MET A O   1 
ATOM   3260  C CB  . MET A 1 425 ? -18.643 37.881  28.869  1.00 15.38  ? 446  MET A CB  1 
ATOM   3261  C CG  . MET A 1 425 ? -17.882 36.600  28.654  1.00 16.01  ? 446  MET A CG  1 
ATOM   3262  S SD  . MET A 1 425 ? -16.482 36.850  27.545  1.00 18.82  ? 446  MET A SD  1 
ATOM   3263  C CE  . MET A 1 425 ? -15.201 37.357  28.694  1.00 15.86  ? 446  MET A CE  1 
ATOM   3264  N N   . TYR A 1 426 ? -18.876 40.217  30.920  1.00 18.10  ? 447  TYR A N   1 
ATOM   3265  C CA  . TYR A 1 426 ? -19.212 41.600  31.217  1.00 18.00  ? 447  TYR A CA  1 
ATOM   3266  C C   . TYR A 1 426 ? -17.990 42.480  31.043  1.00 18.45  ? 447  TYR A C   1 
ATOM   3267  O O   . TYR A 1 426 ? -16.870 41.990  30.977  1.00 19.19  ? 447  TYR A O   1 
ATOM   3268  C CB  . TYR A 1 426 ? -19.739 41.736  32.657  1.00 18.00  ? 447  TYR A CB  1 
ATOM   3269  C CG  . TYR A 1 426 ? -18.679 41.668  33.746  1.00 17.77  ? 447  TYR A CG  1 
ATOM   3270  C CD1 . TYR A 1 426 ? -18.478 40.507  34.498  1.00 17.71  ? 447  TYR A CD1 1 
ATOM   3271  C CD2 . TYR A 1 426 ? -17.865 42.765  34.014  1.00 17.42  ? 447  TYR A CD2 1 
ATOM   3272  C CE1 . TYR A 1 426 ? -17.486 40.449  35.487  1.00 16.17  ? 447  TYR A CE1 1 
ATOM   3273  C CE2 . TYR A 1 426 ? -16.878 42.715  34.994  1.00 17.29  ? 447  TYR A CE2 1 
ATOM   3274  C CZ  . TYR A 1 426 ? -16.690 41.558  35.723  1.00 16.68  ? 447  TYR A CZ  1 
ATOM   3275  O OH  . TYR A 1 426 ? -15.681 41.528  36.660  1.00 18.10  ? 447  TYR A OH  1 
ATOM   3276  N N   . GLU A 1 427 ? -18.212 43.784  30.959  1.00 19.22  ? 448  GLU A N   1 
ATOM   3277  C CA  . GLU A 1 427 ? -17.117 44.729  30.833  1.00 21.34  ? 448  GLU A CA  1 
ATOM   3278  C C   . GLU A 1 427 ? -17.501 45.939  31.676  1.00 22.16  ? 448  GLU A C   1 
ATOM   3279  O O   . GLU A 1 427 ? -18.418 46.683  31.331  1.00 22.57  ? 448  GLU A O   1 
ATOM   3280  C CB  . GLU A 1 427 ? -16.904 45.131  29.372  1.00 22.64  ? 448  GLU A CB  1 
ATOM   3281  C CG  . GLU A 1 427 ? -15.586 45.876  29.125  1.00 26.32  ? 448  GLU A CG  1 
ATOM   3282  C CD  . GLU A 1 427 ? -15.424 46.358  27.684  1.00 28.27  ? 448  GLU A CD  1 
ATOM   3283  O OE1 . GLU A 1 427 ? -14.376 46.971  27.368  1.00 27.50  ? 448  GLU A OE1 1 
ATOM   3284  O OE2 . GLU A 1 427 ? -16.347 46.125  26.869  1.00 30.48  ? 448  GLU A OE2 1 
ATOM   3285  N N   . PHE A 1 428 ? -16.801 46.115  32.793  1.00 22.68  ? 449  PHE A N   1 
ATOM   3286  C CA  . PHE A 1 428 ? -17.062 47.213  33.715  1.00 22.99  ? 449  PHE A CA  1 
ATOM   3287  C C   . PHE A 1 428 ? -16.328 48.486  33.308  1.00 24.13  ? 449  PHE A C   1 
ATOM   3288  O O   . PHE A 1 428 ? -15.100 48.530  33.306  1.00 23.62  ? 449  PHE A O   1 
ATOM   3289  C CB  . PHE A 1 428 ? -16.629 46.808  35.121  1.00 22.50  ? 449  PHE A CB  1 
ATOM   3290  C CG  . PHE A 1 428 ? -17.050 47.772  36.188  1.00 20.88  ? 449  PHE A CG  1 
ATOM   3291  C CD1 . PHE A 1 428 ? -18.357 47.784  36.655  1.00 20.56  ? 449  PHE A CD1 1 
ATOM   3292  C CD2 . PHE A 1 428 ? -16.138 48.661  36.734  1.00 19.01  ? 449  PHE A CD2 1 
ATOM   3293  C CE1 . PHE A 1 428 ? -18.749 48.669  37.655  1.00 20.81  ? 449  PHE A CE1 1 
ATOM   3294  C CE2 . PHE A 1 428 ? -16.520 49.544  37.727  1.00 19.61  ? 449  PHE A CE2 1 
ATOM   3295  C CZ  . PHE A 1 428 ? -17.829 49.549  38.192  1.00 19.41  ? 449  PHE A CZ  1 
ATOM   3296  N N   . GLN A 1 429 ? -17.094 49.521  32.980  1.00 26.54  ? 450  GLN A N   1 
ATOM   3297  C CA  . GLN A 1 429 ? -16.547 50.814  32.561  1.00 28.35  ? 450  GLN A CA  1 
ATOM   3298  C C   . GLN A 1 429 ? -17.135 51.933  33.399  1.00 27.86  ? 450  GLN A C   1 
ATOM   3299  O O   . GLN A 1 429 ? -18.161 52.507  33.032  1.00 27.91  ? 450  GLN A O   1 
ATOM   3300  C CB  . GLN A 1 429 ? -16.877 51.058  31.091  1.00 30.00  ? 450  GLN A CB  1 
ATOM   3301  C CG  . GLN A 1 429 ? -18.147 50.357  30.653  1.00 33.81  ? 450  GLN A CG  1 
ATOM   3302  C CD  . GLN A 1 429 ? -18.459 50.579  29.196  1.00 37.30  ? 450  GLN A CD  1 
ATOM   3303  O OE1 . GLN A 1 429 ? -17.566 50.532  28.350  1.00 40.05  ? 450  GLN A OE1 1 
ATOM   3304  N NE2 . GLN A 1 429 ? -19.732 50.810  28.886  1.00 38.35  ? 450  GLN A NE2 1 
ATOM   3305  N N   . TYR A 1 430 ? -16.488 52.233  34.524  1.00 27.76  ? 451  TYR A N   1 
ATOM   3306  C CA  . TYR A 1 430 ? -16.944 53.284  35.435  1.00 27.92  ? 451  TYR A CA  1 
ATOM   3307  C C   . TYR A 1 430 ? -15.805 53.689  36.366  1.00 29.02  ? 451  TYR A C   1 
ATOM   3308  O O   . TYR A 1 430 ? -15.033 52.838  36.801  1.00 30.87  ? 451  TYR A O   1 
ATOM   3309  C CB  . TYR A 1 430 ? -18.123 52.783  36.274  1.00 26.04  ? 451  TYR A CB  1 
ATOM   3310  C CG  . TYR A 1 430 ? -18.785 53.853  37.107  1.00 24.68  ? 451  TYR A CG  1 
ATOM   3311  C CD1 . TYR A 1 430 ? -19.812 54.637  36.583  1.00 24.29  ? 451  TYR A CD1 1 
ATOM   3312  C CD2 . TYR A 1 430 ? -18.372 54.097  38.417  1.00 24.86  ? 451  TYR A CD2 1 
ATOM   3313  C CE1 . TYR A 1 430 ? -20.416 55.641  37.344  1.00 23.62  ? 451  TYR A CE1 1 
ATOM   3314  C CE2 . TYR A 1 430 ? -18.967 55.099  39.188  1.00 24.35  ? 451  TYR A CE2 1 
ATOM   3315  C CZ  . TYR A 1 430 ? -19.987 55.865  38.644  1.00 24.05  ? 451  TYR A CZ  1 
ATOM   3316  O OH  . TYR A 1 430 ? -20.574 56.849  39.400  1.00 23.35  ? 451  TYR A OH  1 
ATOM   3317  N N   . ARG A 1 431 ? -15.696 54.983  36.668  1.00 29.48  ? 452  ARG A N   1 
ATOM   3318  C CA  . ARG A 1 431 ? -14.648 55.472  37.560  1.00 29.25  ? 452  ARG A CA  1 
ATOM   3319  C C   . ARG A 1 431 ? -15.193 55.709  38.957  1.00 28.39  ? 452  ARG A C   1 
ATOM   3320  O O   . ARG A 1 431 ? -15.836 56.723  39.214  1.00 29.85  ? 452  ARG A O   1 
ATOM   3321  C CB  . ARG A 1 431 ? -14.055 56.782  37.044  1.00 30.65  ? 452  ARG A CB  1 
ATOM   3322  C CG  . ARG A 1 431 ? -12.998 57.377  37.978  1.00 33.94  ? 452  ARG A CG  1 
ATOM   3323  C CD  . ARG A 1 431 ? -12.380 58.641  37.388  1.00 37.82  ? 452  ARG A CD  1 
ATOM   3324  N NE  . ARG A 1 431 ? -11.085 58.987  37.981  1.00 39.24  ? 452  ARG A NE  1 
ATOM   3325  C CZ  . ARG A 1 431 ? -10.901 59.279  39.265  1.00 40.33  ? 452  ARG A CZ  1 
ATOM   3326  N NH1 . ARG A 1 431 ? -11.930 59.266  40.105  1.00 41.75  ? 452  ARG A NH1 1 
ATOM   3327  N NH2 . ARG A 1 431 ? -9.690  59.595  39.710  1.00 39.20  ? 452  ARG A NH2 1 
ATOM   3328  N N   . PRO A 1 432 ? -14.942 54.781  39.887  1.00 27.37  ? 453  PRO A N   1 
ATOM   3329  C CA  . PRO A 1 432 ? -15.464 55.007  41.233  1.00 27.13  ? 453  PRO A CA  1 
ATOM   3330  C C   . PRO A 1 432 ? -14.983 56.323  41.831  1.00 27.00  ? 453  PRO A C   1 
ATOM   3331  O O   . PRO A 1 432 ? -13.935 56.851  41.453  1.00 26.13  ? 453  PRO A O   1 
ATOM   3332  C CB  . PRO A 1 432 ? -14.977 53.781  42.008  1.00 26.76  ? 453  PRO A CB  1 
ATOM   3333  C CG  . PRO A 1 432 ? -13.754 53.359  41.267  1.00 27.16  ? 453  PRO A CG  1 
ATOM   3334  C CD  . PRO A 1 432 ? -14.157 53.538  39.830  1.00 27.36  ? 453  PRO A CD  1 
ATOM   3335  N N   . SER A 1 433 ? -15.775 56.853  42.752  1.00 27.70  ? 454  SER A N   1 
ATOM   3336  C CA  . SER A 1 433 ? -15.450 58.098  43.423  1.00 29.39  ? 454  SER A CA  1 
ATOM   3337  C C   . SER A 1 433 ? -14.565 57.797  44.619  1.00 32.28  ? 454  SER A C   1 
ATOM   3338  O O   . SER A 1 433 ? -14.207 58.696  45.378  1.00 33.06  ? 454  SER A O   1 
ATOM   3339  C CB  . SER A 1 433 ? -16.718 58.768  43.917  1.00 28.51  ? 454  SER A CB  1 
ATOM   3340  O OG  . SER A 1 433 ? -17.314 57.978  44.927  1.00 27.59  ? 454  SER A OG  1 
ATOM   3341  N N   . PHE A 1 434 ? -14.231 56.523  44.798  1.00 35.20  ? 455  PHE A N   1 
ATOM   3342  C CA  . PHE A 1 434 ? -13.383 56.114  45.910  1.00 36.99  ? 455  PHE A CA  1 
ATOM   3343  C C   . PHE A 1 434 ? -11.962 55.852  45.429  1.00 39.39  ? 455  PHE A C   1 
ATOM   3344  O O   . PHE A 1 434 ? -11.137 55.316  46.175  1.00 40.33  ? 455  PHE A O   1 
ATOM   3345  C CB  . PHE A 1 434 ? -13.924 54.845  46.562  1.00 35.13  ? 455  PHE A CB  1 
ATOM   3346  C CG  . PHE A 1 434 ? -15.394 54.870  46.811  1.00 32.99  ? 455  PHE A CG  1 
ATOM   3347  C CD1 . PHE A 1 434 ? -16.262 54.190  45.962  1.00 32.83  ? 455  PHE A CD1 1 
ATOM   3348  C CD2 . PHE A 1 434 ? -15.913 55.543  47.909  1.00 31.62  ? 455  PHE A CD2 1 
ATOM   3349  C CE1 . PHE A 1 434 ? -17.628 54.176  46.209  1.00 32.32  ? 455  PHE A CE1 1 
ATOM   3350  C CE2 . PHE A 1 434 ? -17.278 55.536  48.165  1.00 31.13  ? 455  PHE A CE2 1 
ATOM   3351  C CZ  . PHE A 1 434 ? -18.138 54.851  47.315  1.00 31.54  ? 455  PHE A CZ  1 
ATOM   3352  N N   . SER A 1 435 ? -11.688 56.218  44.178  1.00 41.38  ? 456  SER A N   1 
ATOM   3353  C CA  . SER A 1 435 ? -10.368 56.035  43.590  1.00 43.04  ? 456  SER A CA  1 
ATOM   3354  C C   . SER A 1 435 ? -9.364  56.938  44.297  1.00 44.49  ? 456  SER A C   1 
ATOM   3355  O O   . SER A 1 435 ? -9.743  57.924  44.939  1.00 43.39  ? 456  SER A O   1 
ATOM   3356  C CB  . SER A 1 435 ? -10.399 56.367  42.095  1.00 43.15  ? 456  SER A CB  1 
ATOM   3357  O OG  . SER A 1 435 ? -11.229 55.466  41.378  1.00 43.79  ? 456  SER A OG  1 
ATOM   3358  N N   . SER A 1 436 ? -8.084  56.596  44.180  1.00 46.85  ? 457  SER A N   1 
ATOM   3359  C CA  . SER A 1 436 ? -7.024  57.376  44.810  1.00 49.03  ? 457  SER A CA  1 
ATOM   3360  C C   . SER A 1 436 ? -6.835  58.725  44.107  1.00 49.88  ? 457  SER A C   1 
ATOM   3361  O O   . SER A 1 436 ? -7.084  58.858  42.908  1.00 49.42  ? 457  SER A O   1 
ATOM   3362  C CB  . SER A 1 436 ? -5.712  56.586  44.794  1.00 48.19  ? 457  SER A CB  1 
ATOM   3363  O OG  . SER A 1 436 ? -4.723  57.230  45.579  1.00 49.42  ? 457  SER A OG  1 
ATOM   3364  N N   . ASP A 1 437 ? -6.396  59.722  44.864  1.00 50.98  ? 458  ASP A N   1 
ATOM   3365  C CA  . ASP A 1 437 ? -6.179  61.054  44.325  1.00 53.06  ? 458  ASP A CA  1 
ATOM   3366  C C   . ASP A 1 437 ? -5.190  61.034  43.164  1.00 54.09  ? 458  ASP A C   1 
ATOM   3367  O O   . ASP A 1 437 ? -5.479  61.547  42.081  1.00 54.98  ? 458  ASP A O   1 
ATOM   3368  C CB  . ASP A 1 437 ? -5.650  61.966  45.424  1.00 55.36  ? 458  ASP A CB  1 
ATOM   3369  C CG  . ASP A 1 437 ? -6.357  61.745  46.743  1.00 58.25  ? 458  ASP A CG  1 
ATOM   3370  O OD1 . ASP A 1 437 ? -7.604  61.839  46.769  1.00 59.95  ? 458  ASP A OD1 1 
ATOM   3371  O OD2 . ASP A 1 437 ? -5.669  61.474  47.752  1.00 59.67  ? 458  ASP A OD2 1 
ATOM   3372  N N   . MET A 1 438 ? -4.027  60.433  43.401  1.00 54.15  ? 459  MET A N   1 
ATOM   3373  C CA  . MET A 1 438 ? -2.962  60.343  42.401  1.00 53.60  ? 459  MET A CA  1 
ATOM   3374  C C   . MET A 1 438 ? -3.376  59.697  41.078  1.00 52.38  ? 459  MET A C   1 
ATOM   3375  O O   . MET A 1 438 ? -2.548  59.530  40.179  1.00 53.01  ? 459  MET A O   1 
ATOM   3376  C CB  . MET A 1 438 ? -1.780  59.568  42.983  1.00 54.34  ? 459  MET A CB  1 
ATOM   3377  C CG  . MET A 1 438 ? -1.181  60.191  44.221  1.00 56.36  ? 459  MET A CG  1 
ATOM   3378  S SD  . MET A 1 438 ? 0.062   59.120  44.965  1.00 60.67  ? 459  MET A SD  1 
ATOM   3379  C CE  . MET A 1 438 ? -0.899  58.321  46.280  1.00 60.69  ? 459  MET A CE  1 
ATOM   3380  N N   . LYS A 1 439 ? -4.650  59.338  40.961  1.00 50.16  ? 460  LYS A N   1 
ATOM   3381  C CA  . LYS A 1 439 ? -5.166  58.696  39.758  1.00 48.12  ? 460  LYS A CA  1 
ATOM   3382  C C   . LYS A 1 439 ? -5.789  59.700  38.800  1.00 46.79  ? 460  LYS A C   1 
ATOM   3383  O O   . LYS A 1 439 ? -6.751  60.383  39.145  1.00 45.70  ? 460  LYS A O   1 
ATOM   3384  C CB  . LYS A 1 439 ? -6.209  57.641  40.147  1.00 48.87  ? 460  LYS A CB  1 
ATOM   3385  C CG  . LYS A 1 439 ? -7.009  57.040  38.992  1.00 48.01  ? 460  LYS A CG  1 
ATOM   3386  C CD  . LYS A 1 439 ? -8.138  56.160  39.529  1.00 47.75  ? 460  LYS A CD  1 
ATOM   3387  C CE  . LYS A 1 439 ? -9.007  55.585  38.414  1.00 48.44  ? 460  LYS A CE  1 
ATOM   3388  N NZ  . LYS A 1 439 ? -10.129 54.742  38.943  1.00 47.93  ? 460  LYS A NZ  1 
ATOM   3389  N N   . PRO A 1 440 ? -5.239  59.808  37.581  1.00 46.07  ? 461  PRO A N   1 
ATOM   3390  C CA  . PRO A 1 440 ? -5.800  60.750  36.613  1.00 46.00  ? 461  PRO A CA  1 
ATOM   3391  C C   . PRO A 1 440 ? -7.291  60.484  36.419  1.00 46.26  ? 461  PRO A C   1 
ATOM   3392  O O   . PRO A 1 440 ? -7.756  59.359  36.586  1.00 46.48  ? 461  PRO A O   1 
ATOM   3393  C CB  . PRO A 1 440 ? -4.968  60.492  35.354  1.00 45.88  ? 461  PRO A CB  1 
ATOM   3394  C CG  . PRO A 1 440 ? -4.410  59.105  35.557  1.00 44.45  ? 461  PRO A CG  1 
ATOM   3395  C CD  . PRO A 1 440 ? -4.083  59.097  37.012  1.00 45.16  ? 461  PRO A CD  1 
ATOM   3396  N N   . LYS A 1 441 ? -8.044  61.520  36.077  1.00 46.74  ? 462  LYS A N   1 
ATOM   3397  C CA  . LYS A 1 441 ? -9.478  61.358  35.902  1.00 47.63  ? 462  LYS A CA  1 
ATOM   3398  C C   . LYS A 1 441 ? -9.852  60.769  34.557  1.00 46.12  ? 462  LYS A C   1 
ATOM   3399  O O   . LYS A 1 441 ? -10.988 60.350  34.349  1.00 45.64  ? 462  LYS A O   1 
ATOM   3400  C CB  . LYS A 1 441 ? -10.192 62.699  36.083  1.00 51.37  ? 462  LYS A CB  1 
ATOM   3401  C CG  . LYS A 1 441 ? -9.868  63.759  35.029  1.00 55.54  ? 462  LYS A CG  1 
ATOM   3402  C CD  . LYS A 1 441 ? -10.720 65.007  35.264  1.00 58.54  ? 462  LYS A CD  1 
ATOM   3403  C CE  . LYS A 1 441 ? -10.320 66.171  34.366  1.00 59.54  ? 462  LYS A CE  1 
ATOM   3404  N NZ  . LYS A 1 441 ? -11.073 67.413  34.724  1.00 60.65  ? 462  LYS A NZ  1 
ATOM   3405  N N   . THR A 1 442 ? -8.898  60.728  33.643  1.00 44.92  ? 463  THR A N   1 
ATOM   3406  C CA  . THR A 1 442 ? -9.179  60.197  32.321  1.00 45.24  ? 463  THR A CA  1 
ATOM   3407  C C   . THR A 1 442 ? -9.328  58.677  32.343  1.00 44.16  ? 463  THR A C   1 
ATOM   3408  O O   . THR A 1 442 ? -9.777  58.074  31.363  1.00 44.25  ? 463  THR A O   1 
ATOM   3409  C CB  . THR A 1 442 ? -8.060  60.582  31.322  1.00 46.83  ? 463  THR A CB  1 
ATOM   3410  O OG1 . THR A 1 442 ? -6.916  59.739  31.521  1.00 47.76  ? 463  THR A OG1 1 
ATOM   3411  C CG2 . THR A 1 442 ? -7.641  62.037  31.537  1.00 48.25  ? 463  THR A CG2 1 
ATOM   3412  N N   . VAL A 1 443 ? -8.964  58.056  33.464  1.00 42.21  ? 464  VAL A N   1 
ATOM   3413  C CA  . VAL A 1 443 ? -9.046  56.602  33.579  1.00 39.80  ? 464  VAL A CA  1 
ATOM   3414  C C   . VAL A 1 443 ? -10.429 56.130  34.027  1.00 38.75  ? 464  VAL A C   1 
ATOM   3415  O O   . VAL A 1 443 ? -11.016 56.686  34.956  1.00 38.56  ? 464  VAL A O   1 
ATOM   3416  C CB  . VAL A 1 443 ? -8.000  56.059  34.572  1.00 38.95  ? 464  VAL A CB  1 
ATOM   3417  C CG1 . VAL A 1 443 ? -7.635  54.629  34.211  1.00 37.94  ? 464  VAL A CG1 1 
ATOM   3418  C CG2 . VAL A 1 443 ? -6.776  56.936  34.567  1.00 39.16  ? 464  VAL A CG2 1 
ATOM   3419  N N   . ILE A 1 444 ? -10.935 55.099  33.359  1.00 36.72  ? 465  ILE A N   1 
ATOM   3420  C CA  . ILE A 1 444 ? -12.241 54.535  33.668  1.00 35.26  ? 465  ILE A CA  1 
ATOM   3421  C C   . ILE A 1 444 ? -12.181 53.019  33.581  1.00 33.91  ? 465  ILE A C   1 
ATOM   3422  O O   . ILE A 1 444 ? -11.739 52.466  32.571  1.00 34.78  ? 465  ILE A O   1 
ATOM   3423  C CB  . ILE A 1 444 ? -13.304 55.053  32.685  1.00 35.93  ? 465  ILE A CB  1 
ATOM   3424  C CG1 . ILE A 1 444 ? -13.563 56.528  32.960  1.00 37.24  ? 465  ILE A CG1 1 
ATOM   3425  C CG2 . ILE A 1 444 ? -14.588 54.247  32.814  1.00 35.87  ? 465  ILE A CG2 1 
ATOM   3426  C CD1 . ILE A 1 444 ? -14.559 57.149  32.025  1.00 40.58  ? 465  ILE A CD1 1 
ATOM   3427  N N   . GLY A 1 445 ? -12.629 52.349  34.639  1.00 30.98  ? 466  GLY A N   1 
ATOM   3428  C CA  . GLY A 1 445 ? -12.600 50.900  34.646  1.00 27.65  ? 466  GLY A CA  1 
ATOM   3429  C C   . GLY A 1 445 ? -11.178 50.402  34.807  1.00 25.92  ? 466  GLY A C   1 
ATOM   3430  O O   . GLY A 1 445 ? -10.721 49.536  34.060  1.00 25.79  ? 466  GLY A O   1 
ATOM   3431  N N   . ASP A 1 446 ? -10.477 50.971  35.783  1.00 23.58  ? 467  ASP A N   1 
ATOM   3432  C CA  . ASP A 1 446 ? -9.100  50.605  36.080  1.00 21.36  ? 467  ASP A CA  1 
ATOM   3433  C C   . ASP A 1 446 ? -9.127  49.243  36.771  1.00 20.87  ? 467  ASP A C   1 
ATOM   3434  O O   . ASP A 1 446 ? -10.195 48.712  37.075  1.00 20.07  ? 467  ASP A O   1 
ATOM   3435  C CB  . ASP A 1 446 ? -8.477  51.669  37.002  1.00 21.01  ? 467  ASP A CB  1 
ATOM   3436  C CG  . ASP A 1 446 ? -6.970  51.484  37.204  1.00 21.88  ? 467  ASP A CG  1 
ATOM   3437  O OD1 . ASP A 1 446 ? -6.259  51.142  36.231  1.00 21.74  ? 467  ASP A OD1 1 
ATOM   3438  O OD2 . ASP A 1 446 ? -6.491  51.706  38.338  1.00 21.41  ? 467  ASP A OD2 1 
ATOM   3439  N N   . HIS A 1 447 ? -7.957  48.669  37.011  1.00 20.13  ? 468  HIS A N   1 
ATOM   3440  C CA  . HIS A 1 447 ? -7.902  47.386  37.678  1.00 18.72  ? 468  HIS A CA  1 
ATOM   3441  C C   . HIS A 1 447 ? -8.500  47.581  39.076  1.00 17.93  ? 468  HIS A C   1 
ATOM   3442  O O   . HIS A 1 447 ? -8.211  48.571  39.746  1.00 15.79  ? 468  HIS A O   1 
ATOM   3443  C CB  . HIS A 1 447 ? -6.448  46.898  37.768  1.00 18.36  ? 468  HIS A CB  1 
ATOM   3444  C CG  . HIS A 1 447 ? -6.317  45.445  38.116  1.00 19.19  ? 468  HIS A CG  1 
ATOM   3445  N ND1 . HIS A 1 447 ? -6.803  44.439  37.308  1.00 18.72  ? 468  HIS A ND1 1 
ATOM   3446  C CD2 . HIS A 1 447 ? -5.773  44.831  39.194  1.00 18.97  ? 468  HIS A CD2 1 
ATOM   3447  C CE1 . HIS A 1 447 ? -6.567  43.269  37.873  1.00 19.49  ? 468  HIS A CE1 1 
ATOM   3448  N NE2 . HIS A 1 447 ? -5.943  43.479  39.019  1.00 19.56  ? 468  HIS A NE2 1 
ATOM   3449  N N   . GLY A 1 448 ? -9.360  46.649  39.488  1.00 18.53  ? 469  GLY A N   1 
ATOM   3450  C CA  . GLY A 1 448 ? -9.983  46.708  40.803  1.00 19.00  ? 469  GLY A CA  1 
ATOM   3451  C C   . GLY A 1 448 ? -11.183 47.632  40.973  1.00 19.35  ? 469  GLY A C   1 
ATOM   3452  O O   . GLY A 1 448 ? -11.829 47.624  42.021  1.00 18.34  ? 469  GLY A O   1 
ATOM   3453  N N   . ASP A 1 449 ? -11.497 48.415  39.945  1.00 20.38  ? 470  ASP A N   1 
ATOM   3454  C CA  . ASP A 1 449 ? -12.608 49.361  40.011  1.00 19.98  ? 470  ASP A CA  1 
ATOM   3455  C C   . ASP A 1 449 ? -13.986 48.768  40.274  1.00 17.25  ? 470  ASP A C   1 
ATOM   3456  O O   . ASP A 1 449 ? -14.774 49.339  41.025  1.00 16.50  ? 470  ASP A O   1 
ATOM   3457  C CB  . ASP A 1 449 ? -12.645 50.216  38.736  1.00 23.54  ? 470  ASP A CB  1 
ATOM   3458  C CG  . ASP A 1 449 ? -11.630 51.359  38.766  1.00 28.75  ? 470  ASP A CG  1 
ATOM   3459  O OD1 . ASP A 1 449 ? -10.800 51.401  39.712  1.00 30.09  ? 470  ASP A OD1 1 
ATOM   3460  O OD2 . ASP A 1 449 ? -11.665 52.213  37.843  1.00 29.58  ? 470  ASP A OD2 1 
ATOM   3461  N N   . GLU A 1 450 ? -14.283 47.629  39.667  1.00 16.13  ? 471  GLU A N   1 
ATOM   3462  C CA  . GLU A 1 450 ? -15.590 47.016  39.861  1.00 16.11  ? 471  GLU A CA  1 
ATOM   3463  C C   . GLU A 1 450 ? -15.745 46.458  41.272  1.00 14.90  ? 471  GLU A C   1 
ATOM   3464  O O   . GLU A 1 450 ? -16.826 46.024  41.657  1.00 13.96  ? 471  GLU A O   1 
ATOM   3465  C CB  . GLU A 1 450 ? -15.821 45.904  38.825  1.00 17.71  ? 471  GLU A CB  1 
ATOM   3466  C CG  . GLU A 1 450 ? -15.279 44.513  39.182  1.00 19.65  ? 471  GLU A CG  1 
ATOM   3467  C CD  . GLU A 1 450 ? -13.781 44.500  39.467  1.00 22.93  ? 471  GLU A CD  1 
ATOM   3468  O OE1 . GLU A 1 450 ? -13.066 45.419  38.998  1.00 23.53  ? 471  GLU A OE1 1 
ATOM   3469  O OE2 . GLU A 1 450 ? -13.318 43.558  40.150  1.00 22.69  ? 471  GLU A OE2 1 
ATOM   3470  N N   . LEU A 1 451 ? -14.663 46.482  42.043  1.00 14.28  ? 472  LEU A N   1 
ATOM   3471  C CA  . LEU A 1 451 ? -14.693 45.962  43.401  1.00 13.48  ? 472  LEU A CA  1 
ATOM   3472  C C   . LEU A 1 451 ? -15.559 46.773  44.353  1.00 13.79  ? 472  LEU A C   1 
ATOM   3473  O O   . LEU A 1 451 ? -16.214 46.209  45.228  1.00 14.21  ? 472  LEU A O   1 
ATOM   3474  C CB  . LEU A 1 451 ? -13.276 45.848  43.959  1.00 12.86  ? 472  LEU A CB  1 
ATOM   3475  C CG  . LEU A 1 451 ? -12.502 44.646  43.414  1.00 12.18  ? 472  LEU A CG  1 
ATOM   3476  C CD1 . LEU A 1 451 ? -11.068 44.674  43.929  1.00 13.37  ? 472  LEU A CD1 1 
ATOM   3477  C CD2 . LEU A 1 451 ? -13.195 43.365  43.829  1.00 9.54   ? 472  LEU A CD2 1 
ATOM   3478  N N   . PHE A 1 452 ? -15.578 48.090  44.185  1.00 13.48  ? 473  PHE A N   1 
ATOM   3479  C CA  . PHE A 1 452 ? -16.384 48.934  45.058  1.00 12.13  ? 473  PHE A CA  1 
ATOM   3480  C C   . PHE A 1 452 ? -17.877 48.689  44.853  1.00 11.82  ? 473  PHE A C   1 
ATOM   3481  O O   . PHE A 1 452 ? -18.665 48.765  45.798  1.00 10.15  ? 473  PHE A O   1 
ATOM   3482  C CB  . PHE A 1 452 ? -16.030 50.398  44.823  1.00 11.45  ? 473  PHE A CB  1 
ATOM   3483  C CG  . PHE A 1 452 ? -14.582 50.680  45.002  1.00 10.34  ? 473  PHE A CG  1 
ATOM   3484  C CD1 . PHE A 1 452 ? -13.682 50.402  43.988  1.00 8.60   ? 473  PHE A CD1 1 
ATOM   3485  C CD2 . PHE A 1 452 ? -14.097 51.134  46.223  1.00 11.56  ? 473  PHE A CD2 1 
ATOM   3486  C CE1 . PHE A 1 452 ? -12.319 50.567  44.187  1.00 8.22   ? 473  PHE A CE1 1 
ATOM   3487  C CE2 . PHE A 1 452 ? -12.733 51.301  46.431  1.00 9.03   ? 473  PHE A CE2 1 
ATOM   3488  C CZ  . PHE A 1 452 ? -11.845 51.015  45.411  1.00 7.72   ? 473  PHE A CZ  1 
ATOM   3489  N N   . SER A 1 453 ? -18.260 48.385  43.619  1.00 12.28  ? 474  SER A N   1 
ATOM   3490  C CA  . SER A 1 453 ? -19.653 48.115  43.314  1.00 13.00  ? 474  SER A CA  1 
ATOM   3491  C C   . SER A 1 453 ? -20.043 46.730  43.818  1.00 13.46  ? 474  SER A C   1 
ATOM   3492  O O   . SER A 1 453 ? -21.090 46.561  44.442  1.00 14.81  ? 474  SER A O   1 
ATOM   3493  C CB  . SER A 1 453 ? -19.893 48.212  41.809  1.00 12.60  ? 474  SER A CB  1 
ATOM   3494  O OG  . SER A 1 453 ? -19.842 49.561  41.378  1.00 15.24  ? 474  SER A OG  1 
ATOM   3495  N N   . VAL A 1 454 ? -19.190 45.743  43.564  1.00 13.07  ? 475  VAL A N   1 
ATOM   3496  C CA  . VAL A 1 454 ? -19.459 44.375  43.988  1.00 12.35  ? 475  VAL A CA  1 
ATOM   3497  C C   . VAL A 1 454 ? -19.655 44.217  45.497  1.00 13.26  ? 475  VAL A C   1 
ATOM   3498  O O   . VAL A 1 454 ? -20.580 43.528  45.933  1.00 13.38  ? 475  VAL A O   1 
ATOM   3499  C CB  . VAL A 1 454 ? -18.345 43.432  43.527  1.00 10.48  ? 475  VAL A CB  1 
ATOM   3500  C CG1 . VAL A 1 454 ? -18.496 42.088  44.205  1.00 10.29  ? 475  VAL A CG1 1 
ATOM   3501  C CG2 . VAL A 1 454 ? -18.404 43.273  42.016  1.00 9.56   ? 475  VAL A CG2 1 
ATOM   3502  N N   . PHE A 1 455 ? -18.791 44.838  46.296  1.00 12.84  ? 476  PHE A N   1 
ATOM   3503  C CA  . PHE A 1 455 ? -18.937 44.746  47.748  1.00 13.12  ? 476  PHE A CA  1 
ATOM   3504  C C   . PHE A 1 455 ? -19.602 45.986  48.332  1.00 13.29  ? 476  PHE A C   1 
ATOM   3505  O O   . PHE A 1 455 ? -19.335 46.351  49.476  1.00 13.66  ? 476  PHE A O   1 
ATOM   3506  C CB  . PHE A 1 455 ? -17.593 44.548  48.444  1.00 12.67  ? 476  PHE A CB  1 
ATOM   3507  C CG  . PHE A 1 455 ? -17.019 43.184  48.278  1.00 13.79  ? 476  PHE A CG  1 
ATOM   3508  C CD1 . PHE A 1 455 ? -16.364 42.823  47.102  1.00 15.06  ? 476  PHE A CD1 1 
ATOM   3509  C CD2 . PHE A 1 455 ? -17.116 42.255  49.303  1.00 14.69  ? 476  PHE A CD2 1 
ATOM   3510  C CE1 . PHE A 1 455 ? -15.809 41.552  46.946  1.00 13.94  ? 476  PHE A CE1 1 
ATOM   3511  C CE2 . PHE A 1 455 ? -16.567 40.982  49.157  1.00 15.48  ? 476  PHE A CE2 1 
ATOM   3512  C CZ  . PHE A 1 455 ? -15.911 40.632  47.973  1.00 14.09  ? 476  PHE A CZ  1 
ATOM   3513  N N   . GLY A 1 456 ? -20.454 46.634  47.543  1.00 12.33  ? 477  GLY A N   1 
ATOM   3514  C CA  . GLY A 1 456 ? -21.153 47.815  48.012  1.00 12.23  ? 477  GLY A CA  1 
ATOM   3515  C C   . GLY A 1 456 ? -20.377 48.828  48.844  1.00 12.56  ? 477  GLY A C   1 
ATOM   3516  O O   . GLY A 1 456 ? -20.724 49.096  49.996  1.00 12.07  ? 477  GLY A O   1 
ATOM   3517  N N   . ALA A 1 457 ? -19.323 49.397  48.271  1.00 12.73  ? 478  ALA A N   1 
ATOM   3518  C CA  . ALA A 1 457 ? -18.548 50.409  48.980  1.00 13.93  ? 478  ALA A CA  1 
ATOM   3519  C C   . ALA A 1 457 ? -19.443 51.623  49.252  1.00 13.66  ? 478  ALA A C   1 
ATOM   3520  O O   . ALA A 1 457 ? -19.354 52.244  50.310  1.00 14.67  ? 478  ALA A O   1 
ATOM   3521  C CB  . ALA A 1 457 ? -17.329 50.829  48.153  1.00 14.30  ? 478  ALA A CB  1 
ATOM   3522  N N   . PRO A 1 458 ? -20.313 51.982  48.292  1.00 13.29  ? 479  PRO A N   1 
ATOM   3523  C CA  . PRO A 1 458 ? -21.204 53.126  48.480  1.00 13.02  ? 479  PRO A CA  1 
ATOM   3524  C C   . PRO A 1 458 ? -22.024 53.100  49.772  1.00 13.48  ? 479  PRO A C   1 
ATOM   3525  O O   . PRO A 1 458 ? -22.544 54.136  50.193  1.00 12.98  ? 479  PRO A O   1 
ATOM   3526  C CB  . PRO A 1 458 ? -22.086 53.069  47.240  1.00 12.33  ? 479  PRO A CB  1 
ATOM   3527  C CG  . PRO A 1 458 ? -21.125 52.620  46.202  1.00 12.70  ? 479  PRO A CG  1 
ATOM   3528  C CD  . PRO A 1 458 ? -20.390 51.500  46.899  1.00 13.00  ? 479  PRO A CD  1 
ATOM   3529  N N   . PHE A 1 459 ? -22.136 51.931  50.403  1.00 13.22  ? 480  PHE A N   1 
ATOM   3530  C CA  . PHE A 1 459 ? -22.917 51.811  51.630  1.00 13.29  ? 480  PHE A CA  1 
ATOM   3531  C C   . PHE A 1 459 ? -22.095 51.766  52.907  1.00 14.74  ? 480  PHE A C   1 
ATOM   3532  O O   . PHE A 1 459 ? -22.643 51.667  54.009  1.00 14.08  ? 480  PHE A O   1 
ATOM   3533  C CB  . PHE A 1 459 ? -23.802 50.586  51.549  1.00 13.32  ? 480  PHE A CB  1 
ATOM   3534  C CG  . PHE A 1 459 ? -24.651 50.561  50.327  1.00 16.18  ? 480  PHE A CG  1 
ATOM   3535  C CD1 . PHE A 1 459 ? -24.146 50.068  49.126  1.00 17.45  ? 480  PHE A CD1 1 
ATOM   3536  C CD2 . PHE A 1 459 ? -25.942 51.094  50.354  1.00 15.78  ? 480  PHE A CD2 1 
ATOM   3537  C CE1 . PHE A 1 459 ? -24.914 50.107  47.963  1.00 19.05  ? 480  PHE A CE1 1 
ATOM   3538  C CE2 . PHE A 1 459 ? -26.717 51.141  49.203  1.00 15.78  ? 480  PHE A CE2 1 
ATOM   3539  C CZ  . PHE A 1 459 ? -26.204 50.647  48.003  1.00 18.98  ? 480  PHE A CZ  1 
ATOM   3540  N N   . LEU A 1 460 ? -20.781 51.850  52.750  1.00 15.50  ? 481  LEU A N   1 
ATOM   3541  C CA  . LEU A 1 460 ? -19.874 51.830  53.877  1.00 17.48  ? 481  LEU A CA  1 
ATOM   3542  C C   . LEU A 1 460 ? -19.074 53.114  53.842  1.00 20.37  ? 481  LEU A C   1 
ATOM   3543  O O   . LEU A 1 460 ? -18.949 53.809  54.856  1.00 20.94  ? 481  LEU A O   1 
ATOM   3544  C CB  . LEU A 1 460 ? -18.938 50.627  53.777  1.00 17.36  ? 481  LEU A CB  1 
ATOM   3545  C CG  . LEU A 1 460 ? -19.646 49.275  53.719  1.00 17.37  ? 481  LEU A CG  1 
ATOM   3546  C CD1 . LEU A 1 460 ? -18.619 48.168  53.735  1.00 18.89  ? 481  LEU A CD1 1 
ATOM   3547  C CD2 . LEU A 1 460 ? -20.581 49.136  54.900  1.00 16.54  ? 481  LEU A CD2 1 
ATOM   3548  N N   . LYS A 1 461 ? -18.528 53.427  52.670  1.00 22.99  ? 482  LYS A N   1 
ATOM   3549  C CA  . LYS A 1 461 ? -17.746 54.643  52.504  1.00 25.86  ? 482  LYS A CA  1 
ATOM   3550  C C   . LYS A 1 461 ? -18.695 55.826  52.441  1.00 27.16  ? 482  LYS A C   1 
ATOM   3551  O O   . LYS A 1 461 ? -19.901 55.659  52.605  1.00 27.49  ? 482  LYS A O   1 
ATOM   3552  C CB  . LYS A 1 461 ? -16.886 54.567  51.238  1.00 26.42  ? 482  LYS A CB  1 
ATOM   3553  C CG  . LYS A 1 461 ? -15.816 53.490  51.322  1.00 27.35  ? 482  LYS A CG  1 
ATOM   3554  C CD  . LYS A 1 461 ? -14.621 53.766  50.424  1.00 25.93  ? 482  LYS A CD  1 
ATOM   3555  C CE  . LYS A 1 461 ? -13.481 52.841  50.808  1.00 26.15  ? 482  LYS A CE  1 
ATOM   3556  N NZ  . LYS A 1 461 ? -12.204 53.164  50.133  1.00 29.77  ? 482  LYS A NZ  1 
ATOM   3557  N N   . GLU A 1 462 ? -18.167 57.020  52.204  1.00 29.33  ? 483  GLU A N   1 
ATOM   3558  C CA  . GLU A 1 462 ? -19.030 58.189  52.164  1.00 30.56  ? 483  GLU A CA  1 
ATOM   3559  C C   . GLU A 1 462 ? -18.945 59.035  50.901  1.00 28.90  ? 483  GLU A C   1 
ATOM   3560  O O   . GLU A 1 462 ? -17.912 59.081  50.233  1.00 28.56  ? 483  GLU A O   1 
ATOM   3561  C CB  . GLU A 1 462 ? -18.759 59.071  53.385  1.00 32.93  ? 483  GLU A CB  1 
ATOM   3562  C CG  . GLU A 1 462 ? -19.894 60.023  53.681  1.00 39.54  ? 483  GLU A CG  1 
ATOM   3563  C CD  . GLU A 1 462 ? -21.241 59.304  53.767  1.00 43.91  ? 483  GLU A CD  1 
ATOM   3564  O OE1 . GLU A 1 462 ? -21.415 58.466  54.685  1.00 45.37  ? 483  GLU A OE1 1 
ATOM   3565  O OE2 . GLU A 1 462 ? -22.121 59.571  52.909  1.00 44.93  ? 483  GLU A OE2 1 
ATOM   3566  N N   . GLY A 1 463 ? -20.056 59.688  50.577  1.00 27.23  ? 484  GLY A N   1 
ATOM   3567  C CA  . GLY A 1 463 ? -20.092 60.554  49.420  1.00 26.89  ? 484  GLY A CA  1 
ATOM   3568  C C   . GLY A 1 463 ? -20.592 59.953  48.130  1.00 26.73  ? 484  GLY A C   1 
ATOM   3569  O O   . GLY A 1 463 ? -20.706 60.652  47.127  1.00 28.25  ? 484  GLY A O   1 
ATOM   3570  N N   . ALA A 1 464 ? -20.894 58.667  48.125  1.00 26.32  ? 485  ALA A N   1 
ATOM   3571  C CA  . ALA A 1 464 ? -21.374 58.063  46.896  1.00 26.03  ? 485  ALA A CA  1 
ATOM   3572  C C   . ALA A 1 464 ? -22.558 58.862  46.332  1.00 25.73  ? 485  ALA A C   1 
ATOM   3573  O O   . ALA A 1 464 ? -23.440 59.303  47.074  1.00 25.00  ? 485  ALA A O   1 
ATOM   3574  C CB  . ALA A 1 464 ? -21.776 56.613  47.153  1.00 25.58  ? 485  ALA A CB  1 
ATOM   3575  N N   . SER A 1 465 ? -22.557 59.069  45.019  1.00 24.97  ? 486  SER A N   1 
ATOM   3576  C CA  . SER A 1 465 ? -23.643 59.782  44.361  1.00 24.09  ? 486  SER A CA  1 
ATOM   3577  C C   . SER A 1 465 ? -24.752 58.771  44.104  1.00 23.76  ? 486  SER A C   1 
ATOM   3578  O O   . SER A 1 465 ? -24.499 57.568  44.039  1.00 23.08  ? 486  SER A O   1 
ATOM   3579  C CB  . SER A 1 465 ? -23.178 60.357  43.028  1.00 24.61  ? 486  SER A CB  1 
ATOM   3580  O OG  . SER A 1 465 ? -22.858 59.315  42.124  1.00 24.54  ? 486  SER A OG  1 
ATOM   3581  N N   . GLU A 1 466 ? -25.975 59.258  43.945  1.00 22.81  ? 487  GLU A N   1 
ATOM   3582  C CA  . GLU A 1 466 ? -27.108 58.380  43.709  1.00 22.26  ? 487  GLU A CA  1 
ATOM   3583  C C   . GLU A 1 466 ? -26.880 57.422  42.553  1.00 21.62  ? 487  GLU A C   1 
ATOM   3584  O O   . GLU A 1 466 ? -27.416 56.318  42.537  1.00 21.37  ? 487  GLU A O   1 
ATOM   3585  C CB  . GLU A 1 466 ? -28.364 59.199  43.442  1.00 23.39  ? 487  GLU A CB  1 
ATOM   3586  C CG  . GLU A 1 466 ? -29.616 58.354  43.390  1.00 25.30  ? 487  GLU A CG  1 
ATOM   3587  C CD  . GLU A 1 466 ? -29.695 57.396  44.566  1.00 27.25  ? 487  GLU A CD  1 
ATOM   3588  O OE1 . GLU A 1 466 ? -29.537 57.843  45.723  1.00 27.86  ? 487  GLU A OE1 1 
ATOM   3589  O OE2 . GLU A 1 466 ? -29.914 56.193  44.336  1.00 27.77  ? 487  GLU A OE2 1 
ATOM   3590  N N   . GLU A 1 467 ? -26.085 57.850  41.584  1.00 21.90  ? 488  GLU A N   1 
ATOM   3591  C CA  . GLU A 1 467 ? -25.782 57.030  40.414  1.00 23.13  ? 488  GLU A CA  1 
ATOM   3592  C C   . GLU A 1 467 ? -24.832 55.892  40.759  1.00 22.64  ? 488  GLU A C   1 
ATOM   3593  O O   . GLU A 1 467 ? -24.975 54.771  40.266  1.00 20.50  ? 488  GLU A O   1 
ATOM   3594  C CB  . GLU A 1 467 ? -25.160 57.906  39.331  1.00 26.15  ? 488  GLU A CB  1 
ATOM   3595  C CG  . GLU A 1 467 ? -24.242 57.184  38.371  1.00 28.83  ? 488  GLU A CG  1 
ATOM   3596  C CD  . GLU A 1 467 ? -23.540 58.152  37.444  1.00 31.69  ? 488  GLU A CD  1 
ATOM   3597  O OE1 . GLU A 1 467 ? -24.223 58.717  36.561  1.00 32.34  ? 488  GLU A OE1 1 
ATOM   3598  O OE2 . GLU A 1 467 ? -22.313 58.356  37.610  1.00 32.82  ? 488  GLU A OE2 1 
ATOM   3599  N N   . GLU A 1 468 ? -23.855 56.197  41.608  1.00 22.89  ? 489  GLU A N   1 
ATOM   3600  C CA  . GLU A 1 468 ? -22.870 55.211  42.034  1.00 22.10  ? 489  GLU A CA  1 
ATOM   3601  C C   . GLU A 1 468 ? -23.532 54.229  42.995  1.00 20.16  ? 489  GLU A C   1 
ATOM   3602  O O   . GLU A 1 468 ? -23.219 53.038  43.004  1.00 20.71  ? 489  GLU A O   1 
ATOM   3603  C CB  . GLU A 1 468 ? -21.693 55.907  42.716  1.00 20.77  ? 489  GLU A CB  1 
ATOM   3604  C CG  . GLU A 1 468 ? -20.396 55.141  42.623  1.00 18.84  ? 489  GLU A CG  1 
ATOM   3605  C CD  . GLU A 1 468 ? -19.285 55.832  43.367  1.00 18.71  ? 489  GLU A CD  1 
ATOM   3606  O OE1 . GLU A 1 468 ? -18.116 55.403  43.232  1.00 16.94  ? 489  GLU A OE1 1 
ATOM   3607  O OE2 . GLU A 1 468 ? -19.591 56.805  44.090  1.00 18.35  ? 489  GLU A OE2 1 
ATOM   3608  N N   . ILE A 1 469 ? -24.445 54.745  43.806  1.00 17.36  ? 490  ILE A N   1 
ATOM   3609  C CA  . ILE A 1 469 ? -25.169 53.914  44.744  1.00 16.70  ? 490  ILE A CA  1 
ATOM   3610  C C   . ILE A 1 469 ? -25.940 52.893  43.930  1.00 17.42  ? 490  ILE A C   1 
ATOM   3611  O O   . ILE A 1 469 ? -25.899 51.693  44.208  1.00 16.88  ? 490  ILE A O   1 
ATOM   3612  C CB  . ILE A 1 469 ? -26.148 54.760  45.581  1.00 14.75  ? 490  ILE A CB  1 
ATOM   3613  C CG1 . ILE A 1 469 ? -25.342 55.742  46.433  1.00 15.14  ? 490  ILE A CG1 1 
ATOM   3614  C CG2 . ILE A 1 469 ? -27.025 53.862  46.443  1.00 10.40  ? 490  ILE A CG2 1 
ATOM   3615  C CD1 . ILE A 1 469 ? -26.154 56.631  47.318  1.00 15.54  ? 490  ILE A CD1 1 
ATOM   3616  N N   . ARG A 1 470 ? -26.629 53.384  42.905  1.00 18.66  ? 491  ARG A N   1 
ATOM   3617  C CA  . ARG A 1 470 ? -27.415 52.531  42.039  1.00 19.23  ? 491  ARG A CA  1 
ATOM   3618  C C   . ARG A 1 470 ? -26.582 51.505  41.307  1.00 18.25  ? 491  ARG A C   1 
ATOM   3619  O O   . ARG A 1 470 ? -26.977 50.348  41.215  1.00 18.61  ? 491  ARG A O   1 
ATOM   3620  C CB  . ARG A 1 470 ? -28.193 53.366  41.032  1.00 23.54  ? 491  ARG A CB  1 
ATOM   3621  C CG  . ARG A 1 470 ? -29.600 53.670  41.485  1.00 32.19  ? 491  ARG A CG  1 
ATOM   3622  C CD  . ARG A 1 470 ? -30.384 54.491  40.460  1.00 39.45  ? 491  ARG A CD  1 
ATOM   3623  N NE  . ARG A 1 470 ? -31.811 54.524  40.798  1.00 46.84  ? 491  ARG A NE  1 
ATOM   3624  C CZ  . ARG A 1 470 ? -32.318 55.029  41.925  1.00 48.29  ? 491  ARG A CZ  1 
ATOM   3625  N NH1 . ARG A 1 470 ? -31.523 55.561  42.843  1.00 48.24  ? 491  ARG A NH1 1 
ATOM   3626  N NH2 . ARG A 1 470 ? -33.626 54.980  42.148  1.00 48.88  ? 491  ARG A NH2 1 
ATOM   3627  N N   . LEU A 1 471 ? -25.429 51.909  40.784  1.00 17.84  ? 492  LEU A N   1 
ATOM   3628  C CA  . LEU A 1 471 ? -24.597 50.954  40.061  1.00 16.85  ? 492  LEU A CA  1 
ATOM   3629  C C   . LEU A 1 471 ? -24.252 49.786  40.966  1.00 16.34  ? 492  LEU A C   1 
ATOM   3630  O O   . LEU A 1 471 ? -24.171 48.648  40.520  1.00 15.65  ? 492  LEU A O   1 
ATOM   3631  C CB  . LEU A 1 471 ? -23.307 51.605  39.559  1.00 16.12  ? 492  LEU A CB  1 
ATOM   3632  C CG  . LEU A 1 471 ? -22.410 50.634  38.774  1.00 17.20  ? 492  LEU A CG  1 
ATOM   3633  C CD1 . LEU A 1 471 ? -23.142 50.112  37.545  1.00 14.54  ? 492  LEU A CD1 1 
ATOM   3634  C CD2 . LEU A 1 471 ? -21.122 51.332  38.368  1.00 18.58  ? 492  LEU A CD2 1 
ATOM   3635  N N   . SER A 1 472 ? -24.060 50.074  42.246  1.00 17.44  ? 493  SER A N   1 
ATOM   3636  C CA  . SER A 1 472 ? -23.720 49.036  43.205  1.00 19.38  ? 493  SER A CA  1 
ATOM   3637  C C   . SER A 1 472 ? -24.907 48.111  43.498  1.00 19.98  ? 493  SER A C   1 
ATOM   3638  O O   . SER A 1 472 ? -24.756 46.884  43.495  1.00 20.19  ? 493  SER A O   1 
ATOM   3639  C CB  . SER A 1 472 ? -23.207 49.667  44.503  1.00 20.42  ? 493  SER A CB  1 
ATOM   3640  O OG  . SER A 1 472 ? -22.764 48.676  45.415  1.00 20.39  ? 493  SER A OG  1 
ATOM   3641  N N   . LYS A 1 473 ? -26.082 48.685  43.754  1.00 19.57  ? 494  LYS A N   1 
ATOM   3642  C CA  . LYS A 1 473 ? -27.259 47.867  44.031  1.00 19.70  ? 494  LYS A CA  1 
ATOM   3643  C C   . LYS A 1 473 ? -27.463 46.898  42.885  1.00 19.87  ? 494  LYS A C   1 
ATOM   3644  O O   . LYS A 1 473 ? -27.774 45.719  43.084  1.00 20.60  ? 494  LYS A O   1 
ATOM   3645  C CB  . LYS A 1 473 ? -28.502 48.741  44.191  1.00 19.79  ? 494  LYS A CB  1 
ATOM   3646  C CG  . LYS A 1 473 ? -28.548 49.476  45.508  1.00 23.27  ? 494  LYS A CG  1 
ATOM   3647  C CD  . LYS A 1 473 ? -29.805 50.313  45.668  1.00 25.63  ? 494  LYS A CD  1 
ATOM   3648  C CE  . LYS A 1 473 ? -29.856 50.922  47.071  1.00 27.68  ? 494  LYS A CE  1 
ATOM   3649  N NZ  . LYS A 1 473 ? -30.978 51.881  47.270  1.00 29.24  ? 494  LYS A NZ  1 
ATOM   3650  N N   . MET A 1 474 ? -27.261 47.414  41.681  1.00 20.15  ? 495  MET A N   1 
ATOM   3651  C CA  . MET A 1 474 ? -27.418 46.652  40.455  1.00 20.06  ? 495  MET A CA  1 
ATOM   3652  C C   . MET A 1 474 ? -26.441 45.481  40.360  1.00 18.31  ? 495  MET A C   1 
ATOM   3653  O O   . MET A 1 474 ? -26.855 44.322  40.303  1.00 17.50  ? 495  MET A O   1 
ATOM   3654  C CB  . MET A 1 474 ? -27.247 47.602  39.269  1.00 22.54  ? 495  MET A CB  1 
ATOM   3655  C CG  . MET A 1 474 ? -27.463 46.982  37.901  1.00 26.83  ? 495  MET A CG  1 
ATOM   3656  S SD  . MET A 1 474 ? -27.642 48.273  36.651  1.00 28.64  ? 495  MET A SD  1 
ATOM   3657  C CE  . MET A 1 474 ? -26.110 49.147  36.884  1.00 27.87  ? 495  MET A CE  1 
ATOM   3658  N N   . VAL A 1 475 ? -25.148 45.789  40.350  1.00 17.58  ? 496  VAL A N   1 
ATOM   3659  C CA  . VAL A 1 475 ? -24.117 44.761  40.254  1.00 17.32  ? 496  VAL A CA  1 
ATOM   3660  C C   . VAL A 1 475 ? -24.334 43.657  41.278  1.00 17.60  ? 496  VAL A C   1 
ATOM   3661  O O   . VAL A 1 475 ? -24.252 42.471  40.946  1.00 18.69  ? 496  VAL A O   1 
ATOM   3662  C CB  . VAL A 1 475 ? -22.697 45.340  40.468  1.00 16.26  ? 496  VAL A CB  1 
ATOM   3663  C CG1 . VAL A 1 475 ? -21.676 44.210  40.513  1.00 14.97  ? 496  VAL A CG1 1 
ATOM   3664  C CG2 . VAL A 1 475 ? -22.357 46.312  39.352  1.00 14.48  ? 496  VAL A CG2 1 
ATOM   3665  N N   . MET A 1 476 ? -24.606 44.042  42.520  1.00 16.40  ? 497  MET A N   1 
ATOM   3666  C CA  . MET A 1 476 ? -24.824 43.058  43.564  1.00 14.70  ? 497  MET A CA  1 
ATOM   3667  C C   . MET A 1 476 ? -25.995 42.136  43.222  1.00 15.16  ? 497  MET A C   1 
ATOM   3668  O O   . MET A 1 476 ? -25.871 40.920  43.327  1.00 15.50  ? 497  MET A O   1 
ATOM   3669  C CB  . MET A 1 476 ? -25.049 43.755  44.900  1.00 14.09  ? 497  MET A CB  1 
ATOM   3670  C CG  . MET A 1 476 ? -23.877 44.609  45.315  1.00 14.26  ? 497  MET A CG  1 
ATOM   3671  S SD  . MET A 1 476 ? -23.971 45.131  47.030  1.00 17.07  ? 497  MET A SD  1 
ATOM   3672  C CE  . MET A 1 476 ? -25.087 46.491  46.905  1.00 13.84  ? 497  MET A CE  1 
ATOM   3673  N N   . LYS A 1 477 ? -27.126 42.698  42.804  1.00 16.14  ? 498  LYS A N   1 
ATOM   3674  C CA  . LYS A 1 477 ? -28.268 41.867  42.442  1.00 16.59  ? 498  LYS A CA  1 
ATOM   3675  C C   . LYS A 1 477 ? -27.851 40.836  41.408  1.00 16.53  ? 498  LYS A C   1 
ATOM   3676  O O   . LYS A 1 477 ? -28.175 39.654  41.528  1.00 16.64  ? 498  LYS A O   1 
ATOM   3677  C CB  . LYS A 1 477 ? -29.389 42.705  41.851  1.00 18.91  ? 498  LYS A CB  1 
ATOM   3678  C CG  . LYS A 1 477 ? -30.479 43.019  42.825  1.00 20.83  ? 498  LYS A CG  1 
ATOM   3679  C CD  . LYS A 1 477 ? -31.812 43.072  42.118  1.00 22.49  ? 498  LYS A CD  1 
ATOM   3680  C CE  . LYS A 1 477 ? -32.882 43.471  43.097  1.00 24.66  ? 498  LYS A CE  1 
ATOM   3681  N NZ  . LYS A 1 477 ? -32.689 42.727  44.375  1.00 29.31  ? 498  LYS A NZ  1 
ATOM   3682  N N   . PHE A 1 478 ? -27.145 41.304  40.381  1.00 15.60  ? 499  PHE A N   1 
ATOM   3683  C CA  . PHE A 1 478 ? -26.658 40.443  39.311  1.00 14.17  ? 499  PHE A CA  1 
ATOM   3684  C C   . PHE A 1 478 ? -25.791 39.317  39.850  1.00 12.67  ? 499  PHE A C   1 
ATOM   3685  O O   . PHE A 1 478 ? -26.019 38.146  39.535  1.00 11.69  ? 499  PHE A O   1 
ATOM   3686  C CB  . PHE A 1 478 ? -25.861 41.268  38.301  1.00 15.65  ? 499  PHE A CB  1 
ATOM   3687  C CG  . PHE A 1 478 ? -26.692 41.841  37.194  1.00 15.33  ? 499  PHE A CG  1 
ATOM   3688  C CD1 . PHE A 1 478 ? -26.354 43.056  36.617  1.00 16.92  ? 499  PHE A CD1 1 
ATOM   3689  C CD2 . PHE A 1 478 ? -27.797 41.153  36.711  1.00 15.85  ? 499  PHE A CD2 1 
ATOM   3690  C CE1 . PHE A 1 478 ? -27.105 43.582  35.573  1.00 18.60  ? 499  PHE A CE1 1 
ATOM   3691  C CE2 . PHE A 1 478 ? -28.553 41.664  35.674  1.00 16.36  ? 499  PHE A CE2 1 
ATOM   3692  C CZ  . PHE A 1 478 ? -28.209 42.883  35.101  1.00 18.49  ? 499  PHE A CZ  1 
ATOM   3693  N N   . TRP A 1 479 ? -24.789 39.673  40.651  1.00 11.73  ? 500  TRP A N   1 
ATOM   3694  C CA  . TRP A 1 479 ? -23.906 38.668  41.240  1.00 10.98  ? 500  TRP A CA  1 
ATOM   3695  C C   . TRP A 1 479 ? -24.757 37.691  42.039  1.00 9.37   ? 500  TRP A C   1 
ATOM   3696  O O   . TRP A 1 479 ? -24.814 36.507  41.725  1.00 10.27  ? 500  TRP A O   1 
ATOM   3697  C CB  . TRP A 1 479 ? -22.858 39.320  42.158  1.00 10.59  ? 500  TRP A CB  1 
ATOM   3698  C CG  . TRP A 1 479 ? -21.514 39.579  41.499  1.00 11.64  ? 500  TRP A CG  1 
ATOM   3699  C CD1 . TRP A 1 479 ? -20.293 39.225  41.985  1.00 11.33  ? 500  TRP A CD1 1 
ATOM   3700  C CD2 . TRP A 1 479 ? -21.266 40.255  40.251  1.00 13.14  ? 500  TRP A CD2 1 
ATOM   3701  N NE1 . TRP A 1 479 ? -19.299 39.632  41.127  1.00 13.20  ? 500  TRP A NE1 1 
ATOM   3702  C CE2 . TRP A 1 479 ? -19.865 40.267  40.055  1.00 13.12  ? 500  TRP A CE2 1 
ATOM   3703  C CE3 . TRP A 1 479 ? -22.089 40.849  39.284  1.00 13.72  ? 500  TRP A CE3 1 
ATOM   3704  C CZ2 . TRP A 1 479 ? -19.267 40.850  38.930  1.00 12.86  ? 500  TRP A CZ2 1 
ATOM   3705  C CZ3 . TRP A 1 479 ? -21.490 41.431  38.161  1.00 15.14  ? 500  TRP A CZ3 1 
ATOM   3706  C CH2 . TRP A 1 479 ? -20.092 41.424  37.997  1.00 13.77  ? 500  TRP A CH2 1 
ATOM   3707  N N   . ALA A 1 480 ? -25.437 38.200  43.060  1.00 8.10   ? 501  ALA A N   1 
ATOM   3708  C CA  . ALA A 1 480 ? -26.293 37.374  43.895  1.00 7.34   ? 501  ALA A CA  1 
ATOM   3709  C C   . ALA A 1 480 ? -27.231 36.501  43.057  1.00 7.59   ? 501  ALA A C   1 
ATOM   3710  O O   . ALA A 1 480 ? -27.330 35.301  43.287  1.00 7.57   ? 501  ALA A O   1 
ATOM   3711  C CB  . ALA A 1 480 ? -27.090 38.255  44.844  1.00 5.63   ? 501  ALA A CB  1 
ATOM   3712  N N   . ASN A 1 481 ? -27.924 37.097  42.092  1.00 8.74   ? 502  ASN A N   1 
ATOM   3713  C CA  . ASN A 1 481 ? -28.826 36.328  41.244  1.00 9.63   ? 502  ASN A CA  1 
ATOM   3714  C C   . ASN A 1 481 ? -28.094 35.150  40.640  1.00 9.98   ? 502  ASN A C   1 
ATOM   3715  O O   . ASN A 1 481 ? -28.589 34.024  40.655  1.00 10.71  ? 502  ASN A O   1 
ATOM   3716  C CB  . ASN A 1 481 ? -29.375 37.173  40.102  1.00 11.08  ? 502  ASN A CB  1 
ATOM   3717  C CG  . ASN A 1 481 ? -30.522 38.028  40.523  1.00 13.58  ? 502  ASN A CG  1 
ATOM   3718  O OD1 . ASN A 1 481 ? -31.170 37.749  41.532  1.00 15.60  ? 502  ASN A OD1 1 
ATOM   3719  N ND2 . ASN A 1 481 ? -30.805 39.072  39.745  1.00 14.95  ? 502  ASN A ND2 1 
ATOM   3720  N N   . PHE A 1 482 ? -26.920 35.429  40.085  1.00 9.43   ? 503  PHE A N   1 
ATOM   3721  C CA  . PHE A 1 482 ? -26.100 34.404  39.462  1.00 9.90   ? 503  PHE A CA  1 
ATOM   3722  C C   . PHE A 1 482 ? -25.780 33.328  40.499  1.00 10.60  ? 503  PHE A C   1 
ATOM   3723  O O   . PHE A 1 482 ? -25.771 32.141  40.197  1.00 10.16  ? 503  PHE A O   1 
ATOM   3724  C CB  . PHE A 1 482 ? -24.805 35.037  38.935  1.00 10.30  ? 503  PHE A CB  1 
ATOM   3725  C CG  . PHE A 1 482 ? -23.901 34.074  38.226  1.00 8.68   ? 503  PHE A CG  1 
ATOM   3726  C CD1 . PHE A 1 482 ? -24.269 33.529  37.006  1.00 6.76   ? 503  PHE A CD1 1 
ATOM   3727  C CD2 . PHE A 1 482 ? -22.681 33.703  38.788  1.00 9.16   ? 503  PHE A CD2 1 
ATOM   3728  C CE1 . PHE A 1 482 ? -23.434 32.621  36.349  1.00 7.25   ? 503  PHE A CE1 1 
ATOM   3729  C CE2 . PHE A 1 482 ? -21.837 32.796  38.143  1.00 8.92   ? 503  PHE A CE2 1 
ATOM   3730  C CZ  . PHE A 1 482 ? -22.216 32.255  36.919  1.00 8.40   ? 503  PHE A CZ  1 
ATOM   3731  N N   . ALA A 1 483 ? -25.543 33.766  41.729  1.00 11.25  ? 504  ALA A N   1 
ATOM   3732  C CA  . ALA A 1 483 ? -25.205 32.876  42.826  1.00 12.88  ? 504  ALA A CA  1 
ATOM   3733  C C   . ALA A 1 483 ? -26.378 32.009  43.281  1.00 14.77  ? 504  ALA A C   1 
ATOM   3734  O O   . ALA A 1 483 ? -26.185 30.970  43.917  1.00 16.69  ? 504  ALA A O   1 
ATOM   3735  C CB  . ALA A 1 483 ? -24.683 33.698  43.994  1.00 12.48  ? 504  ALA A CB  1 
ATOM   3736  N N   . ARG A 1 484 ? -27.592 32.449  42.968  1.00 16.37  ? 505  ARG A N   1 
ATOM   3737  C CA  . ARG A 1 484 ? -28.794 31.723  43.349  1.00 15.42  ? 505  ARG A CA  1 
ATOM   3738  C C   . ARG A 1 484 ? -29.194 30.762  42.261  1.00 16.50  ? 505  ARG A C   1 
ATOM   3739  O O   . ARG A 1 484 ? -29.421 29.590  42.522  1.00 17.79  ? 505  ARG A O   1 
ATOM   3740  C CB  . ARG A 1 484 ? -29.956 32.688  43.599  1.00 13.95  ? 505  ARG A CB  1 
ATOM   3741  C CG  . ARG A 1 484 ? -29.937 33.371  44.956  1.00 12.76  ? 505  ARG A CG  1 
ATOM   3742  C CD  . ARG A 1 484 ? -31.103 34.352  45.103  1.00 8.97   ? 505  ARG A CD  1 
ATOM   3743  N NE  . ARG A 1 484 ? -30.853 35.616  44.409  1.00 7.28   ? 505  ARG A NE  1 
ATOM   3744  C CZ  . ARG A 1 484 ? -30.412 36.729  44.996  1.00 4.73   ? 505  ARG A CZ  1 
ATOM   3745  N NH1 . ARG A 1 484 ? -30.168 36.756  46.300  1.00 2.45   ? 505  ARG A NH1 1 
ATOM   3746  N NH2 . ARG A 1 484 ? -30.207 37.819  44.274  1.00 2.69   ? 505  ARG A NH2 1 
ATOM   3747  N N   . ASN A 1 485 ? -29.268 31.265  41.033  1.00 18.37  ? 506  ASN A N   1 
ATOM   3748  C CA  . ASN A 1 485 ? -29.685 30.447  39.904  1.00 18.83  ? 506  ASN A CA  1 
ATOM   3749  C C   . ASN A 1 485 ? -28.581 30.119  38.920  1.00 17.56  ? 506  ASN A C   1 
ATOM   3750  O O   . ASN A 1 485 ? -28.646 29.117  38.232  1.00 18.45  ? 506  ASN A O   1 
ATOM   3751  C CB  . ASN A 1 485 ? -30.814 31.140  39.137  1.00 21.81  ? 506  ASN A CB  1 
ATOM   3752  C CG  . ASN A 1 485 ? -31.869 31.751  40.055  1.00 25.56  ? 506  ASN A CG  1 
ATOM   3753  O OD1 . ASN A 1 485 ? -32.371 31.099  40.970  1.00 27.19  ? 506  ASN A OD1 1 
ATOM   3754  N ND2 . ASN A 1 485 ? -32.216 33.009  39.800  1.00 27.58  ? 506  ASN A ND2 1 
ATOM   3755  N N   . GLY A 1 486 ? -27.559 30.949  38.843  1.00 17.77  ? 507  GLY A N   1 
ATOM   3756  C CA  . GLY A 1 486 ? -26.520 30.673  37.875  1.00 17.04  ? 507  GLY A CA  1 
ATOM   3757  C C   . GLY A 1 486 ? -26.929 31.424  36.624  1.00 17.67  ? 507  GLY A C   1 
ATOM   3758  O O   . GLY A 1 486 ? -26.599 31.045  35.501  1.00 17.60  ? 507  GLY A O   1 
ATOM   3759  N N   . ASN A 1 487 ? -27.687 32.493  36.844  1.00 17.06  ? 508  ASN A N   1 
ATOM   3760  C CA  . ASN A 1 487 ? -28.168 33.372  35.788  1.00 15.79  ? 508  ASN A CA  1 
ATOM   3761  C C   . ASN A 1 487 ? -28.323 34.740  36.440  1.00 14.76  ? 508  ASN A C   1 
ATOM   3762  O O   . ASN A 1 487 ? -29.093 34.903  37.392  1.00 14.99  ? 508  ASN A O   1 
ATOM   3763  C CB  . ASN A 1 487 ? -29.522 32.908  35.265  1.00 16.87  ? 508  ASN A CB  1 
ATOM   3764  C CG  . ASN A 1 487 ? -29.992 33.726  34.077  1.00 17.79  ? 508  ASN A CG  1 
ATOM   3765  O OD1 . ASN A 1 487 ? -29.849 34.950  34.058  1.00 18.94  ? 508  ASN A OD1 1 
ATOM   3766  N ND2 . ASN A 1 487 ? -30.562 33.055  33.083  1.00 18.79  ? 508  ASN A ND2 1 
ATOM   3767  N N   . PRO A 1 488 ? -27.591 35.742  35.941  1.00 13.45  ? 509  PRO A N   1 
ATOM   3768  C CA  . PRO A 1 488 ? -27.686 37.078  36.529  1.00 13.73  ? 509  PRO A CA  1 
ATOM   3769  C C   . PRO A 1 488 ? -29.041 37.761  36.411  1.00 16.17  ? 509  PRO A C   1 
ATOM   3770  O O   . PRO A 1 488 ? -29.418 38.562  37.274  1.00 17.87  ? 509  PRO A O   1 
ATOM   3771  C CB  . PRO A 1 488 ? -26.574 37.847  35.816  1.00 11.84  ? 509  PRO A CB  1 
ATOM   3772  C CG  . PRO A 1 488 ? -26.461 37.144  34.496  1.00 10.93  ? 509  PRO A CG  1 
ATOM   3773  C CD  . PRO A 1 488 ? -26.567 35.700  34.883  1.00 11.70  ? 509  PRO A CD  1 
ATOM   3774  N N   . ASN A 1 489 ? -29.782 37.443  35.358  1.00 17.49  ? 510  ASN A N   1 
ATOM   3775  C CA  . ASN A 1 489 ? -31.076 38.070  35.139  1.00 18.99  ? 510  ASN A CA  1 
ATOM   3776  C C   . ASN A 1 489 ? -32.057 37.899  36.294  1.00 20.39  ? 510  ASN A C   1 
ATOM   3777  O O   . ASN A 1 489 ? -31.952 36.959  37.084  1.00 20.98  ? 510  ASN A O   1 
ATOM   3778  C CB  . ASN A 1 489 ? -31.657 37.563  33.825  1.00 19.14  ? 510  ASN A CB  1 
ATOM   3779  C CG  . ASN A 1 489 ? -30.749 37.876  32.641  1.00 21.25  ? 510  ASN A CG  1 
ATOM   3780  O OD1 . ASN A 1 489 ? -30.506 39.044  32.315  1.00 19.29  ? 510  ASN A OD1 1 
ATOM   3781  N ND2 . ASN A 1 489 ? -30.227 36.833  32.002  1.00 23.49  ? 510  ASN A ND2 1 
ATOM   3782  N N   . GLY A 1 490 ? -32.991 38.842  36.397  1.00 22.41  ? 511  GLY A N   1 
ATOM   3783  C CA  . GLY A 1 490 ? -33.986 38.835  37.460  1.00 24.96  ? 511  GLY A CA  1 
ATOM   3784  C C   . GLY A 1 490 ? -34.753 40.138  37.355  1.00 26.67  ? 511  GLY A C   1 
ATOM   3785  O O   . GLY A 1 490 ? -34.275 41.066  36.709  1.00 27.73  ? 511  GLY A O   1 
ATOM   3786  N N   . GLU A 1 491 ? -35.918 40.240  37.985  1.00 28.42  ? 512  GLU A N   1 
ATOM   3787  C CA  . GLU A 1 491 ? -36.696 41.467  37.859  1.00 31.09  ? 512  GLU A CA  1 
ATOM   3788  C C   . GLU A 1 491 ? -36.078 42.754  38.398  1.00 29.89  ? 512  GLU A C   1 
ATOM   3789  O O   . GLU A 1 491 ? -35.492 42.790  39.488  1.00 28.54  ? 512  GLU A O   1 
ATOM   3790  C CB  . GLU A 1 491 ? -38.110 41.284  38.434  1.00 36.54  ? 512  GLU A CB  1 
ATOM   3791  C CG  . GLU A 1 491 ? -38.222 40.554  39.767  1.00 45.36  ? 512  GLU A CG  1 
ATOM   3792  C CD  . GLU A 1 491 ? -39.684 40.321  40.175  1.00 48.98  ? 512  GLU A CD  1 
ATOM   3793  O OE1 . GLU A 1 491 ? -40.494 39.979  39.286  1.00 51.66  ? 512  GLU A OE1 1 
ATOM   3794  O OE2 . GLU A 1 491 ? -40.022 40.470  41.374  1.00 49.66  ? 512  GLU A OE2 1 
ATOM   3795  N N   . GLY A 1 492 ? -36.225 43.808  37.595  1.00 28.24  ? 513  GLY A N   1 
ATOM   3796  C CA  . GLY A 1 492 ? -35.708 45.119  37.935  1.00 26.97  ? 513  GLY A CA  1 
ATOM   3797  C C   . GLY A 1 492 ? -34.316 45.342  37.375  1.00 26.51  ? 513  GLY A C   1 
ATOM   3798  O O   . GLY A 1 492 ? -33.632 46.310  37.730  1.00 27.49  ? 513  GLY A O   1 
ATOM   3799  N N   . LEU A 1 493 ? -33.892 44.455  36.485  1.00 24.36  ? 514  LEU A N   1 
ATOM   3800  C CA  . LEU A 1 493 ? -32.561 44.567  35.913  1.00 23.40  ? 514  LEU A CA  1 
ATOM   3801  C C   . LEU A 1 493 ? -32.561 44.504  34.398  1.00 21.92  ? 514  LEU A C   1 
ATOM   3802  O O   . LEU A 1 493 ? -33.433 43.887  33.792  1.00 21.09  ? 514  LEU A O   1 
ATOM   3803  C CB  . LEU A 1 493 ? -31.663 43.445  36.457  1.00 23.74  ? 514  LEU A CB  1 
ATOM   3804  C CG  . LEU A 1 493 ? -31.408 43.382  37.965  1.00 22.77  ? 514  LEU A CG  1 
ATOM   3805  C CD1 . LEU A 1 493 ? -30.912 41.995  38.336  1.00 24.59  ? 514  LEU A CD1 1 
ATOM   3806  C CD2 . LEU A 1 493 ? -30.403 44.449  38.365  1.00 21.34  ? 514  LEU A CD2 1 
ATOM   3807  N N   . PRO A 1 494 ? -31.572 45.153  33.767  1.00 21.46  ? 515  PRO A N   1 
ATOM   3808  C CA  . PRO A 1 494 ? -31.440 45.168  32.310  1.00 21.46  ? 515  PRO A CA  1 
ATOM   3809  C C   . PRO A 1 494 ? -31.186 43.723  31.892  1.00 20.88  ? 515  PRO A C   1 
ATOM   3810  O O   . PRO A 1 494 ? -30.597 42.966  32.655  1.00 19.94  ? 515  PRO A O   1 
ATOM   3811  C CB  . PRO A 1 494 ? -30.209 46.040  32.088  1.00 21.64  ? 515  PRO A CB  1 
ATOM   3812  C CG  . PRO A 1 494 ? -30.200 46.943  33.291  1.00 21.64  ? 515  PRO A CG  1 
ATOM   3813  C CD  . PRO A 1 494 ? -30.545 46.002  34.394  1.00 21.87  ? 515  PRO A CD  1 
ATOM   3814  N N   . HIS A 1 495 ? -31.628 43.322  30.706  1.00 20.65  ? 516  HIS A N   1 
ATOM   3815  C CA  . HIS A 1 495 ? -31.384 41.952  30.303  1.00 19.69  ? 516  HIS A CA  1 
ATOM   3816  C C   . HIS A 1 495 ? -29.924 41.717  29.972  1.00 21.04  ? 516  HIS A C   1 
ATOM   3817  O O   . HIS A 1 495 ? -29.341 42.428  29.157  1.00 20.23  ? 516  HIS A O   1 
ATOM   3818  C CB  . HIS A 1 495 ? -32.187 41.563  29.083  1.00 18.90  ? 516  HIS A CB  1 
ATOM   3819  C CG  . HIS A 1 495 ? -31.953 40.147  28.667  1.00 19.41  ? 516  HIS A CG  1 
ATOM   3820  N ND1 . HIS A 1 495 ? -32.499 39.076  29.341  1.00 21.66  ? 516  HIS A ND1 1 
ATOM   3821  C CD2 . HIS A 1 495 ? -31.172 39.621  27.695  1.00 19.31  ? 516  HIS A CD2 1 
ATOM   3822  C CE1 . HIS A 1 495 ? -32.066 37.949  28.802  1.00 20.26  ? 516  HIS A CE1 1 
ATOM   3823  N NE2 . HIS A 1 495 ? -31.258 38.253  27.802  1.00 20.81  ? 516  HIS A NE2 1 
ATOM   3824  N N   . TRP A 1 496 ? -29.355 40.696  30.606  1.00 21.90  ? 517  TRP A N   1 
ATOM   3825  C CA  . TRP A 1 496 ? -27.966 40.293  30.413  1.00 20.80  ? 517  TRP A CA  1 
ATOM   3826  C C   . TRP A 1 496 ? -28.041 39.004  29.589  1.00 20.78  ? 517  TRP A C   1 
ATOM   3827  O O   . TRP A 1 496 ? -28.453 37.961  30.094  1.00 19.51  ? 517  TRP A O   1 
ATOM   3828  C CB  . TRP A 1 496 ? -27.340 40.007  31.777  1.00 21.17  ? 517  TRP A CB  1 
ATOM   3829  C CG  . TRP A 1 496 ? -25.865 39.747  31.790  1.00 20.38  ? 517  TRP A CG  1 
ATOM   3830  C CD1 . TRP A 1 496 ? -25.107 39.175  30.802  1.00 18.78  ? 517  TRP A CD1 1 
ATOM   3831  C CD2 . TRP A 1 496 ? -24.978 39.996  32.884  1.00 19.58  ? 517  TRP A CD2 1 
ATOM   3832  N NE1 . TRP A 1 496 ? -23.800 39.053  31.220  1.00 17.72  ? 517  TRP A NE1 1 
ATOM   3833  C CE2 . TRP A 1 496 ? -23.696 39.550  32.492  1.00 18.77  ? 517  TRP A CE2 1 
ATOM   3834  C CE3 . TRP A 1 496 ? -25.144 40.552  34.159  1.00 19.02  ? 517  TRP A CE3 1 
ATOM   3835  C CZ2 . TRP A 1 496 ? -22.586 39.646  33.337  1.00 19.24  ? 517  TRP A CZ2 1 
ATOM   3836  C CZ3 . TRP A 1 496 ? -24.038 40.645  34.997  1.00 18.01  ? 517  TRP A CZ3 1 
ATOM   3837  C CH2 . TRP A 1 496 ? -22.777 40.194  34.582  1.00 17.98  ? 517  TRP A CH2 1 
ATOM   3838  N N   . PRO A 1 497 ? -27.663 39.066  28.303  1.00 21.64  ? 518  PRO A N   1 
ATOM   3839  C CA  . PRO A 1 497 ? -27.698 37.895  27.420  1.00 22.74  ? 518  PRO A CA  1 
ATOM   3840  C C   . PRO A 1 497 ? -26.623 36.878  27.747  1.00 23.23  ? 518  PRO A C   1 
ATOM   3841  O O   . PRO A 1 497 ? -25.594 37.215  28.320  1.00 24.25  ? 518  PRO A O   1 
ATOM   3842  C CB  . PRO A 1 497 ? -27.496 38.507  26.038  1.00 22.00  ? 518  PRO A CB  1 
ATOM   3843  C CG  . PRO A 1 497 ? -26.561 39.635  26.320  1.00 21.58  ? 518  PRO A CG  1 
ATOM   3844  C CD  . PRO A 1 497 ? -27.149 40.246  27.582  1.00 21.92  ? 518  PRO A CD  1 
ATOM   3845  N N   . GLU A 1 498 ? -26.850 35.627  27.389  1.00 24.63  ? 519  GLU A N   1 
ATOM   3846  C CA  . GLU A 1 498 ? -25.833 34.637  27.669  1.00 27.56  ? 519  GLU A CA  1 
ATOM   3847  C C   . GLU A 1 498 ? -24.713 34.793  26.662  1.00 28.56  ? 519  GLU A C   1 
ATOM   3848  O O   . GLU A 1 498 ? -24.941 35.286  25.559  1.00 30.41  ? 519  GLU A O   1 
ATOM   3849  C CB  . GLU A 1 498 ? -26.392 33.230  27.572  1.00 27.74  ? 519  GLU A CB  1 
ATOM   3850  C CG  . GLU A 1 498 ? -25.340 32.209  27.865  1.00 31.88  ? 519  GLU A CG  1 
ATOM   3851  C CD  . GLU A 1 498 ? -25.908 30.840  28.031  1.00 34.79  ? 519  GLU A CD  1 
ATOM   3852  O OE1 . GLU A 1 498 ? -26.938 30.714  28.727  1.00 37.96  ? 519  GLU A OE1 1 
ATOM   3853  O OE2 . GLU A 1 498 ? -25.321 29.890  27.479  1.00 36.81  ? 519  GLU A OE2 1 
ATOM   3854  N N   . TYR A 1 499 ? -23.501 34.395  27.042  1.00 29.34  ? 520  TYR A N   1 
ATOM   3855  C CA  . TYR A 1 499 ? -22.375 34.479  26.122  1.00 29.35  ? 520  TYR A CA  1 
ATOM   3856  C C   . TYR A 1 499 ? -22.389 33.191  25.306  1.00 30.59  ? 520  TYR A C   1 
ATOM   3857  O O   . TYR A 1 499 ? -21.591 32.279  25.545  1.00 29.92  ? 520  TYR A O   1 
ATOM   3858  C CB  . TYR A 1 499 ? -21.042 34.608  26.867  1.00 28.01  ? 520  TYR A CB  1 
ATOM   3859  C CG  . TYR A 1 499 ? -19.854 34.854  25.949  1.00 26.62  ? 520  TYR A CG  1 
ATOM   3860  C CD1 . TYR A 1 499 ? -19.495 36.147  25.559  1.00 25.07  ? 520  TYR A CD1 1 
ATOM   3861  C CD2 . TYR A 1 499 ? -19.110 33.788  25.437  1.00 26.53  ? 520  TYR A CD2 1 
ATOM   3862  C CE1 . TYR A 1 499 ? -18.422 36.370  24.678  1.00 22.63  ? 520  TYR A CE1 1 
ATOM   3863  C CE2 . TYR A 1 499 ? -18.042 33.999  24.555  1.00 23.95  ? 520  TYR A CE2 1 
ATOM   3864  C CZ  . TYR A 1 499 ? -17.704 35.289  24.178  1.00 23.06  ? 520  TYR A CZ  1 
ATOM   3865  O OH  . TYR A 1 499 ? -16.665 35.484  23.287  1.00 20.60  ? 520  TYR A OH  1 
ATOM   3866  N N   . ASN A 1 500 ? -23.332 33.119  24.368  1.00 31.45  ? 521  ASN A N   1 
ATOM   3867  C CA  . ASN A 1 500 ? -23.481 31.971  23.483  1.00 32.28  ? 521  ASN A CA  1 
ATOM   3868  C C   . ASN A 1 500 ? -22.802 32.285  22.156  1.00 32.89  ? 521  ASN A C   1 
ATOM   3869  O O   . ASN A 1 500 ? -21.821 33.030  22.106  1.00 32.33  ? 521  ASN A O   1 
ATOM   3870  C CB  . ASN A 1 500 ? -24.964 31.667  23.236  1.00 32.38  ? 521  ASN A CB  1 
ATOM   3871  C CG  . ASN A 1 500 ? -25.743 32.885  22.757  1.00 33.58  ? 521  ASN A CG  1 
ATOM   3872  O OD1 . ASN A 1 500 ? -25.173 33.827  22.213  1.00 35.13  ? 521  ASN A OD1 1 
ATOM   3873  N ND2 . ASN A 1 500 ? -27.057 32.862  22.950  1.00 33.27  ? 521  ASN A ND2 1 
ATOM   3874  N N   . GLN A 1 501 ? -23.346 31.728  21.082  1.00 33.99  ? 522  GLN A N   1 
ATOM   3875  C CA  . GLN A 1 501 ? -22.807 31.944  19.750  1.00 35.53  ? 522  GLN A CA  1 
ATOM   3876  C C   . GLN A 1 501 ? -22.737 33.406  19.317  1.00 35.06  ? 522  GLN A C   1 
ATOM   3877  O O   . GLN A 1 501 ? -21.748 33.816  18.714  1.00 35.78  ? 522  GLN A O   1 
ATOM   3878  C CB  . GLN A 1 501 ? -23.614 31.144  18.737  1.00 38.64  ? 522  GLN A CB  1 
ATOM   3879  C CG  . GLN A 1 501 ? -23.443 29.649  18.911  1.00 44.94  ? 522  GLN A CG  1 
ATOM   3880  C CD  . GLN A 1 501 ? -21.974 29.255  18.963  1.00 48.94  ? 522  GLN A CD  1 
ATOM   3881  O OE1 . GLN A 1 501 ? -21.167 29.729  18.158  1.00 51.45  ? 522  GLN A OE1 1 
ATOM   3882  N NE2 . GLN A 1 501 ? -21.619 28.382  19.906  1.00 49.62  ? 522  GLN A NE2 1 
ATOM   3883  N N   . LYS A 1 502 ? -23.771 34.192  19.612  1.00 34.01  ? 523  LYS A N   1 
ATOM   3884  C CA  . LYS A 1 502 ? -23.774 35.607  19.233  1.00 33.64  ? 523  LYS A CA  1 
ATOM   3885  C C   . LYS A 1 502 ? -22.736 36.390  20.029  1.00 33.04  ? 523  LYS A C   1 
ATOM   3886  O O   . LYS A 1 502 ? -22.436 37.547  19.708  1.00 31.74  ? 523  LYS A O   1 
ATOM   3887  C CB  . LYS A 1 502 ? -25.149 36.247  19.464  1.00 35.77  ? 523  LYS A CB  1 
ATOM   3888  C CG  . LYS A 1 502 ? -26.240 35.865  18.471  1.00 38.98  ? 523  LYS A CG  1 
ATOM   3889  C CD  . LYS A 1 502 ? -26.735 34.435  18.675  1.00 43.44  ? 523  LYS A CD  1 
ATOM   3890  C CE  . LYS A 1 502 ? -27.957 34.128  17.796  1.00 45.69  ? 523  LYS A CE  1 
ATOM   3891  N NZ  . LYS A 1 502 ? -29.132 35.016  18.085  1.00 45.30  ? 523  LYS A NZ  1 
ATOM   3892  N N   . GLU A 1 503 ? -22.199 35.753  21.068  1.00 32.69  ? 524  GLU A N   1 
ATOM   3893  C CA  . GLU A 1 503 ? -21.195 36.369  21.933  1.00 31.68  ? 524  GLU A CA  1 
ATOM   3894  C C   . GLU A 1 503 ? -21.707 37.627  22.628  1.00 30.80  ? 524  GLU A C   1 
ATOM   3895  O O   . GLU A 1 503 ? -20.987 38.621  22.756  1.00 29.76  ? 524  GLU A O   1 
ATOM   3896  C CB  . GLU A 1 503 ? -19.931 36.704  21.138  1.00 32.01  ? 524  GLU A CB  1 
ATOM   3897  C CG  . GLU A 1 503 ? -19.039 35.507  20.850  1.00 33.52  ? 524  GLU A CG  1 
ATOM   3898  C CD  . GLU A 1 503 ? -17.785 35.898  20.083  1.00 35.64  ? 524  GLU A CD  1 
ATOM   3899  O OE1 . GLU A 1 503 ? -16.875 35.047  19.954  1.00 35.77  ? 524  GLU A OE1 1 
ATOM   3900  O OE2 . GLU A 1 503 ? -17.712 37.056  19.607  1.00 35.42  ? 524  GLU A OE2 1 
ATOM   3901  N N   . GLY A 1 504 ? -22.954 37.579  23.082  1.00 30.46  ? 525  GLY A N   1 
ATOM   3902  C CA  . GLY A 1 504 ? -23.517 38.724  23.769  1.00 30.43  ? 525  GLY A CA  1 
ATOM   3903  C C   . GLY A 1 504 ? -22.940 38.870  25.164  1.00 30.07  ? 525  GLY A C   1 
ATOM   3904  O O   . GLY A 1 504 ? -22.577 37.881  25.812  1.00 30.56  ? 525  GLY A O   1 
ATOM   3905  N N   . TYR A 1 505 ? -22.844 40.105  25.635  1.00 29.09  ? 526  TYR A N   1 
ATOM   3906  C CA  . TYR A 1 505 ? -22.321 40.345  26.968  1.00 28.93  ? 526  TYR A CA  1 
ATOM   3907  C C   . TYR A 1 505 ? -22.909 41.641  27.502  1.00 28.30  ? 526  TYR A C   1 
ATOM   3908  O O   . TYR A 1 505 ? -23.559 42.376  26.766  1.00 28.47  ? 526  TYR A O   1 
ATOM   3909  C CB  . TYR A 1 505 ? -20.791 40.395  26.930  1.00 28.69  ? 526  TYR A CB  1 
ATOM   3910  C CG  . TYR A 1 505 ? -20.230 41.573  26.184  1.00 29.03  ? 526  TYR A CG  1 
ATOM   3911  C CD1 . TYR A 1 505 ? -19.848 42.727  26.867  1.00 30.28  ? 526  TYR A CD1 1 
ATOM   3912  C CD2 . TYR A 1 505 ? -20.108 41.553  24.794  1.00 28.71  ? 526  TYR A CD2 1 
ATOM   3913  C CE1 . TYR A 1 505 ? -19.357 43.841  26.188  1.00 30.82  ? 526  TYR A CE1 1 
ATOM   3914  C CE2 . TYR A 1 505 ? -19.618 42.663  24.101  1.00 30.08  ? 526  TYR A CE2 1 
ATOM   3915  C CZ  . TYR A 1 505 ? -19.247 43.805  24.809  1.00 30.27  ? 526  TYR A CZ  1 
ATOM   3916  O OH  . TYR A 1 505 ? -18.788 44.919  24.151  1.00 29.44  ? 526  TYR A OH  1 
ATOM   3917  N N   . LEU A 1 506 ? -22.694 41.916  28.781  1.00 29.04  ? 527  LEU A N   1 
ATOM   3918  C CA  . LEU A 1 506 ? -23.240 43.122  29.386  1.00 30.06  ? 527  LEU A CA  1 
ATOM   3919  C C   . LEU A 1 506 ? -22.210 44.209  29.599  1.00 30.42  ? 527  LEU A C   1 
ATOM   3920  O O   . LEU A 1 506 ? -21.142 43.973  30.156  1.00 31.59  ? 527  LEU A O   1 
ATOM   3921  C CB  . LEU A 1 506 ? -23.894 42.801  30.735  1.00 30.00  ? 527  LEU A CB  1 
ATOM   3922  C CG  . LEU A 1 506 ? -24.566 43.971  31.468  1.00 29.93  ? 527  LEU A CG  1 
ATOM   3923  C CD1 . LEU A 1 506 ? -25.753 44.450  30.653  1.00 28.85  ? 527  LEU A CD1 1 
ATOM   3924  C CD2 . LEU A 1 506 ? -25.026 43.546  32.858  1.00 29.26  ? 527  LEU A CD2 1 
ATOM   3925  N N   . GLN A 1 507 ? -22.541 45.407  29.139  1.00 30.98  ? 528  GLN A N   1 
ATOM   3926  C CA  . GLN A 1 507 ? -21.675 46.560  29.317  1.00 30.79  ? 528  GLN A CA  1 
ATOM   3927  C C   . GLN A 1 507 ? -22.218 47.213  30.579  1.00 29.63  ? 528  GLN A C   1 
ATOM   3928  O O   . GLN A 1 507 ? -23.349 47.695  30.602  1.00 30.53  ? 528  GLN A O   1 
ATOM   3929  C CB  . GLN A 1 507 ? -21.798 47.503  28.123  1.00 31.20  ? 528  GLN A CB  1 
ATOM   3930  C CG  . GLN A 1 507 ? -20.486 47.741  27.413  1.00 32.28  ? 528  GLN A CG  1 
ATOM   3931  C CD  . GLN A 1 507 ? -20.677 48.160  25.973  1.00 32.02  ? 528  GLN A CD  1 
ATOM   3932  O OE1 . GLN A 1 507 ? -21.427 49.090  25.678  1.00 32.12  ? 528  GLN A OE1 1 
ATOM   3933  N NE2 . GLN A 1 507 ? -19.991 47.475  25.065  1.00 31.00  ? 528  GLN A NE2 1 
ATOM   3934  N N   . ILE A 1 508 ? -21.422 47.211  31.637  1.00 27.79  ? 529  ILE A N   1 
ATOM   3935  C CA  . ILE A 1 508 ? -21.870 47.771  32.897  1.00 25.97  ? 529  ILE A CA  1 
ATOM   3936  C C   . ILE A 1 508 ? -21.259 49.119  33.184  1.00 26.18  ? 529  ILE A C   1 
ATOM   3937  O O   . ILE A 1 508 ? -20.058 49.313  33.029  1.00 25.69  ? 529  ILE A O   1 
ATOM   3938  C CB  . ILE A 1 508 ? -21.548 46.808  34.039  1.00 24.89  ? 529  ILE A CB  1 
ATOM   3939  C CG1 . ILE A 1 508 ? -22.215 45.459  33.750  1.00 24.16  ? 529  ILE A CG1 1 
ATOM   3940  C CG2 . ILE A 1 508 ? -22.017 47.390  35.358  1.00 23.54  ? 529  ILE A CG2 1 
ATOM   3941  C CD1 . ILE A 1 508 ? -21.723 44.327  34.596  1.00 23.45  ? 529  ILE A CD1 1 
ATOM   3942  N N   . GLY A 1 509 ? -22.103 50.052  33.606  1.00 27.47  ? 530  GLY A N   1 
ATOM   3943  C CA  . GLY A 1 509 ? -21.641 51.391  33.915  1.00 29.52  ? 530  GLY A CA  1 
ATOM   3944  C C   . GLY A 1 509 ? -22.821 52.307  34.151  1.00 31.12  ? 530  GLY A C   1 
ATOM   3945  O O   . GLY A 1 509 ? -23.941 51.827  34.349  1.00 31.82  ? 530  GLY A O   1 
ATOM   3946  N N   . ALA A 1 510 ? -22.580 53.617  34.125  1.00 32.19  ? 531  ALA A N   1 
ATOM   3947  C CA  . ALA A 1 510 ? -23.639 54.600  34.343  1.00 32.69  ? 531  ALA A CA  1 
ATOM   3948  C C   . ALA A 1 510 ? -24.813 54.308  33.417  1.00 33.95  ? 531  ALA A C   1 
ATOM   3949  O O   . ALA A 1 510 ? -25.951 54.682  33.697  1.00 33.61  ? 531  ALA A O   1 
ATOM   3950  C CB  . ALA A 1 510 ? -23.110 55.994  34.101  1.00 31.22  ? 531  ALA A CB  1 
ATOM   3951  N N   . ASN A 1 511 ? -24.518 53.638  32.309  1.00 35.62  ? 532  ASN A N   1 
ATOM   3952  C CA  . ASN A 1 511 ? -25.526 53.245  31.337  1.00 37.71  ? 532  ASN A CA  1 
ATOM   3953  C C   . ASN A 1 511 ? -25.219 51.802  30.980  1.00 37.37  ? 532  ASN A C   1 
ATOM   3954  O O   . ASN A 1 511 ? -24.377 51.532  30.123  1.00 38.64  ? 532  ASN A O   1 
ATOM   3955  C CB  . ASN A 1 511 ? -25.446 54.116  30.085  1.00 41.45  ? 532  ASN A CB  1 
ATOM   3956  C CG  . ASN A 1 511 ? -25.858 55.552  30.348  1.00 46.33  ? 532  ASN A CG  1 
ATOM   3957  O OD1 . ASN A 1 511 ? -26.991 55.820  30.766  1.00 49.70  ? 532  ASN A OD1 1 
ATOM   3958  N ND2 . ASN A 1 511 ? -24.942 56.488  30.102  1.00 47.47  ? 532  ASN A ND2 1 
ATOM   3959  N N   . THR A 1 512 ? -25.894 50.877  31.650  1.00 35.39  ? 533  THR A N   1 
ATOM   3960  C CA  . THR A 1 512 ? -25.681 49.457  31.422  1.00 33.25  ? 533  THR A CA  1 
ATOM   3961  C C   . THR A 1 512 ? -26.579 48.878  30.324  1.00 32.14  ? 533  THR A C   1 
ATOM   3962  O O   . THR A 1 512 ? -27.799 49.047  30.362  1.00 31.74  ? 533  THR A O   1 
ATOM   3963  C CB  . THR A 1 512 ? -25.904 48.681  32.740  1.00 32.60  ? 533  THR A CB  1 
ATOM   3964  O OG1 . THR A 1 512 ? -24.960 49.136  33.712  1.00 32.37  ? 533  THR A OG1 1 
ATOM   3965  C CG2 . THR A 1 512 ? -25.727 47.191  32.538  1.00 32.32  ? 533  THR A CG2 1 
ATOM   3966  N N   . GLN A 1 513 ? -25.968 48.213  29.342  1.00 30.62  ? 534  GLN A N   1 
ATOM   3967  C CA  . GLN A 1 513 ? -26.707 47.580  28.249  1.00 30.34  ? 534  GLN A CA  1 
ATOM   3968  C C   . GLN A 1 513 ? -25.903 46.438  27.650  1.00 29.13  ? 534  GLN A C   1 
ATOM   3969  O O   . GLN A 1 513 ? -24.706 46.321  27.903  1.00 28.95  ? 534  GLN A O   1 
ATOM   3970  C CB  . GLN A 1 513 ? -27.054 48.580  27.144  1.00 32.65  ? 534  GLN A CB  1 
ATOM   3971  C CG  . GLN A 1 513 ? -25.868 49.143  26.395  1.00 36.90  ? 534  GLN A CG  1 
ATOM   3972  C CD  . GLN A 1 513 ? -25.173 50.246  27.163  1.00 40.18  ? 534  GLN A CD  1 
ATOM   3973  O OE1 . GLN A 1 513 ? -25.790 51.257  27.503  1.00 41.54  ? 534  GLN A OE1 1 
ATOM   3974  N NE2 . GLN A 1 513 ? -23.881 50.062  27.440  1.00 41.45  ? 534  GLN A NE2 1 
ATOM   3975  N N   . ALA A 1 514 ? -26.563 45.600  26.852  1.00 28.26  ? 535  ALA A N   1 
ATOM   3976  C CA  . ALA A 1 514 ? -25.903 44.456  26.228  1.00 26.76  ? 535  ALA A CA  1 
ATOM   3977  C C   . ALA A 1 514 ? -25.186 44.826  24.950  1.00 26.65  ? 535  ALA A C   1 
ATOM   3978  O O   . ALA A 1 514 ? -25.534 45.799  24.291  1.00 27.39  ? 535  ALA A O   1 
ATOM   3979  C CB  . ALA A 1 514 ? -26.905 43.362  25.941  1.00 24.81  ? 535  ALA A CB  1 
ATOM   3980  N N   . ALA A 1 515 ? -24.180 44.032  24.608  1.00 27.26  ? 536  ALA A N   1 
ATOM   3981  C CA  . ALA A 1 515 ? -23.395 44.239  23.398  1.00 27.87  ? 536  ALA A CA  1 
ATOM   3982  C C   . ALA A 1 515 ? -22.978 42.871  22.866  1.00 28.88  ? 536  ALA A C   1 
ATOM   3983  O O   . ALA A 1 515 ? -23.426 41.840  23.371  1.00 29.22  ? 536  ALA A O   1 
ATOM   3984  C CB  . ALA A 1 515 ? -22.168 45.081  23.708  1.00 26.85  ? 536  ALA A CB  1 
ATOM   3985  N N   . GLN A 1 516 ? -22.121 42.857  21.852  1.00 30.30  ? 537  GLN A N   1 
ATOM   3986  C CA  . GLN A 1 516 ? -21.661 41.598  21.282  1.00 31.56  ? 537  GLN A CA  1 
ATOM   3987  C C   . GLN A 1 516 ? -20.204 41.638  20.854  1.00 32.66  ? 537  GLN A C   1 
ATOM   3988  O O   . GLN A 1 516 ? -19.650 42.705  20.603  1.00 33.75  ? 537  GLN A O   1 
ATOM   3989  C CB  . GLN A 1 516 ? -22.528 41.217  20.080  1.00 31.03  ? 537  GLN A CB  1 
ATOM   3990  C CG  . GLN A 1 516 ? -23.942 40.802  20.452  1.00 32.22  ? 537  GLN A CG  1 
ATOM   3991  C CD  . GLN A 1 516 ? -24.825 40.544  19.242  1.00 32.42  ? 537  GLN A CD  1 
ATOM   3992  O OE1 . GLN A 1 516 ? -25.716 39.698  19.286  1.00 32.24  ? 537  GLN A OE1 1 
ATOM   3993  N NE2 . GLN A 1 516 ? -24.589 41.280  18.162  1.00 32.71  ? 537  GLN A NE2 1 
ATOM   3994  N N   . LYS A 1 517 ? -19.593 40.459  20.796  1.00 33.93  ? 538  LYS A N   1 
ATOM   3995  C CA  . LYS A 1 517 ? -18.207 40.291  20.366  1.00 34.73  ? 538  LYS A CA  1 
ATOM   3996  C C   . LYS A 1 517 ? -17.130 41.049  21.138  1.00 33.68  ? 538  LYS A C   1 
ATOM   3997  O O   . LYS A 1 517 ? -16.273 41.689  20.531  1.00 33.26  ? 538  LYS A O   1 
ATOM   3998  C CB  . LYS A 1 517 ? -18.092 40.646  18.886  1.00 36.94  ? 538  LYS A CB  1 
ATOM   3999  C CG  . LYS A 1 517 ? -19.024 39.860  17.987  1.00 41.12  ? 538  LYS A CG  1 
ATOM   4000  C CD  . LYS A 1 517 ? -18.780 40.215  16.529  1.00 44.43  ? 538  LYS A CD  1 
ATOM   4001  C CE  . LYS A 1 517 ? -19.514 39.264  15.600  1.00 46.33  ? 538  LYS A CE  1 
ATOM   4002  N NZ  . LYS A 1 517 ? -19.072 39.453  14.187  1.00 49.30  ? 538  LYS A NZ  1 
ATOM   4003  N N   . LEU A 1 518 ? -17.159 40.969  22.462  1.00 32.37  ? 539  LEU A N   1 
ATOM   4004  C CA  . LEU A 1 518 ? -16.163 41.646  23.279  1.00 32.20  ? 539  LEU A CA  1 
ATOM   4005  C C   . LEU A 1 518 ? -14.744 41.235  22.871  1.00 32.63  ? 539  LEU A C   1 
ATOM   4006  O O   . LEU A 1 518 ? -14.432 40.050  22.814  1.00 33.41  ? 539  LEU A O   1 
ATOM   4007  C CB  . LEU A 1 518 ? -16.392 41.313  24.758  1.00 31.85  ? 539  LEU A CB  1 
ATOM   4008  C CG  . LEU A 1 518 ? -15.348 41.757  25.793  1.00 31.02  ? 539  LEU A CG  1 
ATOM   4009  C CD1 . LEU A 1 518 ? -15.192 43.271  25.803  1.00 28.29  ? 539  LEU A CD1 1 
ATOM   4010  C CD2 . LEU A 1 518 ? -15.784 41.258  27.159  1.00 30.73  ? 539  LEU A CD2 1 
ATOM   4011  N N   . LYS A 1 519 ? -13.897 42.220  22.579  1.00 32.79  ? 540  LYS A N   1 
ATOM   4012  C CA  . LYS A 1 519 ? -12.504 41.984  22.195  1.00 33.88  ? 540  LYS A CA  1 
ATOM   4013  C C   . LYS A 1 519 ? -12.298 41.061  20.993  1.00 36.37  ? 540  LYS A C   1 
ATOM   4014  O O   . LYS A 1 519 ? -11.173 40.664  20.688  1.00 36.65  ? 540  LYS A O   1 
ATOM   4015  C CB  . LYS A 1 519 ? -11.737 41.423  23.389  1.00 31.73  ? 540  LYS A CB  1 
ATOM   4016  C CG  . LYS A 1 519 ? -11.661 42.371  24.562  1.00 29.68  ? 540  LYS A CG  1 
ATOM   4017  C CD  . LYS A 1 519 ? -10.813 43.580  24.231  1.00 26.94  ? 540  LYS A CD  1 
ATOM   4018  C CE  . LYS A 1 519 ? -10.714 44.508  25.420  1.00 25.80  ? 540  LYS A CE  1 
ATOM   4019  N NZ  . LYS A 1 519 ? -9.810  45.646  25.130  1.00 26.60  ? 540  LYS A NZ  1 
ATOM   4020  N N   . ASP A 1 520 ? -13.385 40.731  20.310  1.00 39.28  ? 541  ASP A N   1 
ATOM   4021  C CA  . ASP A 1 520 ? -13.340 39.840  19.155  1.00 41.27  ? 541  ASP A CA  1 
ATOM   4022  C C   . ASP A 1 520 ? -12.177 40.130  18.198  1.00 41.19  ? 541  ASP A C   1 
ATOM   4023  O O   . ASP A 1 520 ? -11.461 39.218  17.771  1.00 39.81  ? 541  ASP A O   1 
ATOM   4024  C CB  . ASP A 1 520 ? -14.668 39.933  18.406  1.00 42.89  ? 541  ASP A CB  1 
ATOM   4025  C CG  . ASP A 1 520 ? -14.837 38.834  17.398  1.00 44.77  ? 541  ASP A CG  1 
ATOM   4026  O OD1 . ASP A 1 520 ? -13.987 38.730  16.488  1.00 46.61  ? 541  ASP A OD1 1 
ATOM   4027  O OD2 . ASP A 1 520 ? -15.819 38.072  17.521  1.00 46.41  ? 541  ASP A OD2 1 
ATOM   4028  N N   . LYS A 1 521 ? -12.007 41.407  17.872  1.00 41.83  ? 542  LYS A N   1 
ATOM   4029  C CA  . LYS A 1 521 ? -10.952 41.870  16.969  1.00 41.56  ? 542  LYS A CA  1 
ATOM   4030  C C   . LYS A 1 521 ? -9.553  41.517  17.478  1.00 39.15  ? 542  LYS A C   1 
ATOM   4031  O O   . LYS A 1 521 ? -8.734  40.960  16.747  1.00 37.73  ? 542  LYS A O   1 
ATOM   4032  C CB  . LYS A 1 521 ? -11.085 43.388  16.794  1.00 44.01  ? 542  LYS A CB  1 
ATOM   4033  C CG  . LYS A 1 521 ? -10.006 44.045  15.953  1.00 48.12  ? 542  LYS A CG  1 
ATOM   4034  C CD  . LYS A 1 521 ? -10.326 45.522  15.682  1.00 51.25  ? 542  LYS A CD  1 
ATOM   4035  C CE  . LYS A 1 521 ? -10.245 46.394  16.944  1.00 53.08  ? 542  LYS A CE  1 
ATOM   4036  N NZ  . LYS A 1 521 ? -8.846  46.662  17.416  1.00 53.88  ? 542  LYS A NZ  1 
ATOM   4037  N N   . GLU A 1 522 ? -9.297  41.845  18.739  1.00 37.70  ? 543  GLU A N   1 
ATOM   4038  C CA  . GLU A 1 522 ? -8.014  41.584  19.376  1.00 36.80  ? 543  GLU A CA  1 
ATOM   4039  C C   . GLU A 1 522 ? -7.719  40.093  19.483  1.00 35.83  ? 543  GLU A C   1 
ATOM   4040  O O   . GLU A 1 522 ? -6.648  39.631  19.092  1.00 34.96  ? 543  GLU A O   1 
ATOM   4041  C CB  . GLU A 1 522 ? -7.985  42.212  20.770  1.00 36.56  ? 543  GLU A CB  1 
ATOM   4042  C CG  . GLU A 1 522 ? -8.083  43.736  20.784  1.00 36.63  ? 543  GLU A CG  1 
ATOM   4043  C CD  . GLU A 1 522 ? -9.468  44.262  20.435  1.00 37.42  ? 543  GLU A CD  1 
ATOM   4044  O OE1 . GLU A 1 522 ? -9.661  45.494  20.501  1.00 36.89  ? 543  GLU A OE1 1 
ATOM   4045  O OE2 . GLU A 1 522 ? -10.364 43.459  20.099  1.00 37.60  ? 543  GLU A OE2 1 
ATOM   4046  N N   . VAL A 1 523 ? -8.671  39.342  20.027  1.00 35.71  ? 544  VAL A N   1 
ATOM   4047  C CA  . VAL A 1 523 ? -8.502  37.904  20.170  1.00 35.12  ? 544  VAL A CA  1 
ATOM   4048  C C   . VAL A 1 523 ? -7.901  37.382  18.873  1.00 35.38  ? 544  VAL A C   1 
ATOM   4049  O O   . VAL A 1 523 ? -6.870  36.712  18.880  1.00 34.94  ? 544  VAL A O   1 
ATOM   4050  C CB  . VAL A 1 523 ? -9.859  37.209  20.425  1.00 34.24  ? 544  VAL A CB  1 
ATOM   4051  C CG1 . VAL A 1 523 ? -9.673  35.711  20.531  1.00 32.59  ? 544  VAL A CG1 1 
ATOM   4052  C CG2 . VAL A 1 523 ? -10.476 37.746  21.699  1.00 34.61  ? 544  VAL A CG2 1 
ATOM   4053  N N   . ALA A 1 524 ? -8.545  37.729  17.761  1.00 36.64  ? 545  ALA A N   1 
ATOM   4054  C CA  . ALA A 1 524 ? -8.109  37.309  16.430  1.00 36.22  ? 545  ALA A CA  1 
ATOM   4055  C C   . ALA A 1 524 ? -6.676  37.725  16.121  1.00 36.29  ? 545  ALA A C   1 
ATOM   4056  O O   . ALA A 1 524 ? -5.827  36.889  15.811  1.00 35.83  ? 545  ALA A O   1 
ATOM   4057  C CB  . ALA A 1 524 ? -9.044  37.877  15.385  1.00 35.19  ? 545  ALA A CB  1 
ATOM   4058  N N   . PHE A 1 525 ? -6.414  39.022  16.200  1.00 36.86  ? 546  PHE A N   1 
ATOM   4059  C CA  . PHE A 1 525 ? -5.087  39.538  15.922  1.00 38.41  ? 546  PHE A CA  1 
ATOM   4060  C C   . PHE A 1 525 ? -4.015  38.817  16.726  1.00 39.88  ? 546  PHE A C   1 
ATOM   4061  O O   . PHE A 1 525 ? -3.015  38.370  16.173  1.00 41.68  ? 546  PHE A O   1 
ATOM   4062  C CB  . PHE A 1 525 ? -5.025  41.037  16.229  1.00 37.92  ? 546  PHE A CB  1 
ATOM   4063  C CG  . PHE A 1 525 ? -3.634  41.606  16.184  1.00 38.25  ? 546  PHE A CG  1 
ATOM   4064  C CD1 . PHE A 1 525 ? -2.950  41.721  14.979  1.00 38.19  ? 546  PHE A CD1 1 
ATOM   4065  C CD2 . PHE A 1 525 ? -2.991  41.998  17.358  1.00 38.59  ? 546  PHE A CD2 1 
ATOM   4066  C CE1 . PHE A 1 525 ? -1.641  42.217  14.945  1.00 38.45  ? 546  PHE A CE1 1 
ATOM   4067  C CE2 . PHE A 1 525 ? -1.685  42.494  17.334  1.00 38.59  ? 546  PHE A CE2 1 
ATOM   4068  C CZ  . PHE A 1 525 ? -1.009  42.603  16.126  1.00 38.41  ? 546  PHE A CZ  1 
ATOM   4069  N N   . TRP A 1 526 ? -4.226  38.699  18.030  1.00 41.38  ? 547  TRP A N   1 
ATOM   4070  C CA  . TRP A 1 526 ? -3.243  38.060  18.893  1.00 42.82  ? 547  TRP A CA  1 
ATOM   4071  C C   . TRP A 1 526 ? -3.094  36.552  18.736  1.00 45.36  ? 547  TRP A C   1 
ATOM   4072  O O   . TRP A 1 526 ? -2.086  35.981  19.165  1.00 45.97  ? 547  TRP A O   1 
ATOM   4073  C CB  . TRP A 1 526 ? -3.538  38.397  20.351  1.00 40.26  ? 547  TRP A CB  1 
ATOM   4074  C CG  . TRP A 1 526 ? -3.234  39.815  20.687  1.00 39.16  ? 547  TRP A CG  1 
ATOM   4075  C CD1 . TRP A 1 526 ? -4.130  40.823  20.882  1.00 38.53  ? 547  TRP A CD1 1 
ATOM   4076  C CD2 . TRP A 1 526 ? -1.937  40.382  20.902  1.00 38.47  ? 547  TRP A CD2 1 
ATOM   4077  N NE1 . TRP A 1 526 ? -3.472  41.983  21.215  1.00 37.96  ? 547  TRP A NE1 1 
ATOM   4078  C CE2 . TRP A 1 526 ? -2.125  41.740  21.234  1.00 37.40  ? 547  TRP A CE2 1 
ATOM   4079  C CE3 . TRP A 1 526 ? -0.632  39.873  20.848  1.00 38.46  ? 547  TRP A CE3 1 
ATOM   4080  C CZ2 . TRP A 1 526 ? -1.060  42.596  21.514  1.00 37.70  ? 547  TRP A CZ2 1 
ATOM   4081  C CZ3 . TRP A 1 526 ? 0.432   40.727  21.126  1.00 38.04  ? 547  TRP A CZ3 1 
ATOM   4082  C CH2 . TRP A 1 526 ? 0.209   42.074  21.455  1.00 38.15  ? 547  TRP A CH2 1 
ATOM   4083  N N   . THR A 1 527 ? -4.087  35.904  18.132  1.00 47.21  ? 548  THR A N   1 
ATOM   4084  C CA  . THR A 1 527 ? -4.028  34.462  17.929  1.00 48.69  ? 548  THR A CA  1 
ATOM   4085  C C   . THR A 1 527 ? -3.029  34.143  16.815  1.00 50.81  ? 548  THR A C   1 
ATOM   4086  O O   . THR A 1 527 ? -2.264  33.175  16.903  1.00 51.51  ? 548  THR A O   1 
ATOM   4087  C CB  . THR A 1 527 ? -5.410  33.898  17.562  1.00 48.43  ? 548  THR A CB  1 
ATOM   4088  O OG1 . THR A 1 527 ? -6.326  34.157  18.633  1.00 47.63  ? 548  THR A OG1 1 
ATOM   4089  C CG2 . THR A 1 527 ? -5.333  32.397  17.330  1.00 48.18  ? 548  THR A CG2 1 
ATOM   4090  N N   . ASN A 1 528 ? -3.029  34.972  15.774  1.00 52.13  ? 549  ASN A N   1 
ATOM   4091  C CA  . ASN A 1 528 ? -2.116  34.794  14.649  1.00 52.55  ? 549  ASN A CA  1 
ATOM   4092  C C   . ASN A 1 528 ? -0.715  35.234  15.054  1.00 52.02  ? 549  ASN A C   1 
ATOM   4093  O O   . ASN A 1 528 ? 0.239   34.468  14.937  1.00 51.73  ? 549  ASN A O   1 
ATOM   4094  C CB  . ASN A 1 528 ? -2.586  35.619  13.454  1.00 53.47  ? 549  ASN A CB  1 
ATOM   4095  C CG  . ASN A 1 528 ? -4.081  35.515  13.233  1.00 55.79  ? 549  ASN A CG  1 
ATOM   4096  O OD1 . ASN A 1 528 ? -4.640  34.414  13.169  1.00 56.67  ? 549  ASN A OD1 1 
ATOM   4097  N ND2 . ASN A 1 528 ? -4.741  36.664  13.115  1.00 56.75  ? 549  ASN A ND2 1 
ATOM   4098  N N   . LEU A 1 529 ? -0.599  36.467  15.539  1.00 51.99  ? 550  LEU A N   1 
ATOM   4099  C CA  . LEU A 1 529 ? 0.690   37.002  15.961  1.00 52.64  ? 550  LEU A CA  1 
ATOM   4100  C C   . LEU A 1 529 ? 1.424   36.041  16.889  1.00 53.80  ? 550  LEU A C   1 
ATOM   4101  O O   . LEU A 1 529 ? 2.624   35.823  16.738  1.00 54.07  ? 550  LEU A O   1 
ATOM   4102  C CB  . LEU A 1 529 ? 0.508   38.359  16.651  1.00 50.88  ? 550  LEU A CB  1 
ATOM   4103  C CG  . LEU A 1 529 ? 1.776   39.076  17.130  1.00 49.42  ? 550  LEU A CG  1 
ATOM   4104  C CD1 . LEU A 1 529 ? 2.790   39.168  16.010  1.00 50.25  ? 550  LEU A CD1 1 
ATOM   4105  C CD2 . LEU A 1 529 ? 1.415   40.462  17.618  1.00 50.33  ? 550  LEU A CD2 1 
ATOM   4106  N N   . PHE A 1 530 ? 0.706   35.462  17.846  1.00 55.52  ? 551  PHE A N   1 
ATOM   4107  C CA  . PHE A 1 530 ? 1.313   34.520  18.780  1.00 57.19  ? 551  PHE A CA  1 
ATOM   4108  C C   . PHE A 1 530 ? 1.626   33.171  18.135  1.00 58.38  ? 551  PHE A C   1 
ATOM   4109  O O   . PHE A 1 530 ? 2.424   32.395  18.659  1.00 58.89  ? 551  PHE A O   1 
ATOM   4110  C CB  . PHE A 1 530 ? 0.409   34.328  19.999  1.00 57.80  ? 551  PHE A CB  1 
ATOM   4111  C CG  . PHE A 1 530 ? 0.654   35.326  21.096  1.00 58.91  ? 551  PHE A CG  1 
ATOM   4112  C CD1 . PHE A 1 530 ? -0.342  35.617  22.025  1.00 59.59  ? 551  PHE A CD1 1 
ATOM   4113  C CD2 . PHE A 1 530 ? 1.885   35.970  21.209  1.00 59.49  ? 551  PHE A CD2 1 
ATOM   4114  C CE1 . PHE A 1 530 ? -0.117  36.534  23.049  1.00 59.45  ? 551  PHE A CE1 1 
ATOM   4115  C CE2 . PHE A 1 530 ? 2.123   36.890  22.229  1.00 59.17  ? 551  PHE A CE2 1 
ATOM   4116  C CZ  . PHE A 1 530 ? 1.120   37.173  23.150  1.00 59.83  ? 551  PHE A CZ  1 
ATOM   4117  N N   . ALA A 1 531 ? 0.995   32.890  17.000  1.00 58.77  ? 552  ALA A N   1 
ATOM   4118  C CA  . ALA A 1 531 ? 1.252   31.643  16.292  1.00 59.70  ? 552  ALA A CA  1 
ATOM   4119  C C   . ALA A 1 531 ? 2.455   31.870  15.366  1.00 61.10  ? 552  ALA A C   1 
ATOM   4120  O O   . ALA A 1 531 ? 2.523   31.327  14.257  1.00 60.77  ? 552  ALA A O   1 
ATOM   4121  C CB  . ALA A 1 531 ? 0.026   31.241  15.489  1.00 59.28  ? 552  ALA A CB  1 
ATOM   4122  N N   . LYS A 1 532 ? 3.399   32.681  15.845  1.00 62.19  ? 553  LYS A N   1 
ATOM   4123  C CA  . LYS A 1 532 ? 4.612   33.030  15.105  1.00 62.96  ? 553  LYS A CA  1 
ATOM   4124  C C   . LYS A 1 532 ? 4.331   33.353  13.643  1.00 62.99  ? 553  LYS A C   1 
ATOM   4125  O O   . LYS A 1 532 ? 4.647   34.447  13.170  1.00 62.73  ? 553  LYS A O   1 
ATOM   4126  C CB  . LYS A 1 532 ? 5.646   31.903  15.195  1.00 63.55  ? 553  LYS A CB  1 
ATOM   4127  C CG  . LYS A 1 532 ? 6.415   31.855  16.513  1.00 64.58  ? 553  LYS A CG  1 
ATOM   4128  C CD  . LYS A 1 532 ? 7.373   30.674  16.555  1.00 65.05  ? 553  LYS A CD  1 
ATOM   4129  C CE  . LYS A 1 532 ? 8.331   30.701  15.373  1.00 66.24  ? 553  LYS A CE  1 
ATOM   4130  N NZ  . LYS A 1 532 ? 9.185   29.481  15.311  1.00 66.97  ? 553  LYS A NZ  1 
ATOM   4131  N N   . SER B 1 1   ? 22.303  -14.608 94.338  1.00 54.94  ? 21   SER B N   1 
ATOM   4132  C CA  . SER B 1 1   ? 20.942  -14.282 93.918  1.00 55.18  ? 21   SER B CA  1 
ATOM   4133  C C   . SER B 1 1   ? 20.936  -13.838 92.458  1.00 54.48  ? 21   SER B C   1 
ATOM   4134  O O   . SER B 1 1   ? 21.688  -12.937 92.080  1.00 55.98  ? 21   SER B O   1 
ATOM   4135  C CB  . SER B 1 1   ? 20.370  -13.151 94.781  1.00 55.83  ? 21   SER B CB  1 
ATOM   4136  O OG  . SER B 1 1   ? 20.963  -11.900 94.454  1.00 55.41  ? 21   SER B OG  1 
ATOM   4137  N N   . SER B 1 2   ? 20.093  -14.467 91.642  1.00 52.18  ? 22   SER B N   1 
ATOM   4138  C CA  . SER B 1 2   ? 19.999  -14.105 90.231  1.00 48.83  ? 22   SER B CA  1 
ATOM   4139  C C   . SER B 1 2   ? 18.959  -12.990 90.099  1.00 46.02  ? 22   SER B C   1 
ATOM   4140  O O   . SER B 1 2   ? 17.804  -13.153 90.498  1.00 46.51  ? 22   SER B O   1 
ATOM   4141  C CB  . SER B 1 2   ? 19.589  -15.318 89.394  1.00 49.16  ? 22   SER B CB  1 
ATOM   4142  O OG  . SER B 1 2   ? 19.908  -15.114 88.030  1.00 49.36  ? 22   SER B OG  1 
ATOM   4143  N N   . PRO B 1 3   ? 19.363  -11.843 89.530  1.00 42.10  ? 23   PRO B N   1 
ATOM   4144  C CA  . PRO B 1 3   ? 18.514  -10.666 89.330  1.00 38.90  ? 23   PRO B CA  1 
ATOM   4145  C C   . PRO B 1 3   ? 17.085  -10.979 88.889  1.00 36.34  ? 23   PRO B C   1 
ATOM   4146  O O   . PRO B 1 3   ? 16.861  -11.838 88.030  1.00 36.43  ? 23   PRO B O   1 
ATOM   4147  C CB  . PRO B 1 3   ? 19.280  -9.878  88.276  1.00 39.24  ? 23   PRO B CB  1 
ATOM   4148  C CG  . PRO B 1 3   ? 20.694  -10.203 88.591  1.00 39.99  ? 23   PRO B CG  1 
ATOM   4149  C CD  . PRO B 1 3   ? 20.630  -11.688 88.797  1.00 40.70  ? 23   PRO B CD  1 
ATOM   4150  N N   . PRO B 1 4   ? 16.096  -10.275 89.469  1.00 32.82  ? 24   PRO B N   1 
ATOM   4151  C CA  . PRO B 1 4   ? 14.696  -10.508 89.105  1.00 29.62  ? 24   PRO B CA  1 
ATOM   4152  C C   . PRO B 1 4   ? 14.453  -9.993  87.692  1.00 27.80  ? 24   PRO B C   1 
ATOM   4153  O O   . PRO B 1 4   ? 14.712  -8.818  87.410  1.00 27.43  ? 24   PRO B O   1 
ATOM   4154  C CB  . PRO B 1 4   ? 13.910  -9.682  90.130  1.00 28.44  ? 24   PRO B CB  1 
ATOM   4155  C CG  . PRO B 1 4   ? 14.914  -9.286  91.173  1.00 30.17  ? 24   PRO B CG  1 
ATOM   4156  C CD  . PRO B 1 4   ? 16.207  -9.168  90.430  1.00 31.41  ? 24   PRO B CD  1 
ATOM   4157  N N   . VAL B 1 5   ? 13.984  -10.856 86.798  1.00 25.77  ? 25   VAL B N   1 
ATOM   4158  C CA  . VAL B 1 5   ? 13.696  -10.406 85.443  1.00 25.30  ? 25   VAL B CA  1 
ATOM   4159  C C   . VAL B 1 5   ? 12.229  -10.568 85.151  1.00 25.52  ? 25   VAL B C   1 
ATOM   4160  O O   . VAL B 1 5   ? 11.709  -11.674 85.172  1.00 24.79  ? 25   VAL B O   1 
ATOM   4161  C CB  . VAL B 1 5   ? 14.471  -11.177 84.374  1.00 24.09  ? 25   VAL B CB  1 
ATOM   4162  C CG1 . VAL B 1 5   ? 13.894  -10.858 82.999  1.00 21.51  ? 25   VAL B CG1 1 
ATOM   4163  C CG2 . VAL B 1 5   ? 15.933  -10.786 84.415  1.00 23.73  ? 25   VAL B CG2 1 
ATOM   4164  N N   . VAL B 1 6   ? 11.567  -9.451  84.874  1.00 27.43  ? 26   VAL B N   1 
ATOM   4165  C CA  . VAL B 1 6   ? 10.146  -9.465  84.582  1.00 28.54  ? 26   VAL B CA  1 
ATOM   4166  C C   . VAL B 1 6   ? 9.851   -9.148  83.131  1.00 29.33  ? 26   VAL B C   1 
ATOM   4167  O O   . VAL B 1 6   ? 10.532  -8.343  82.492  1.00 29.11  ? 26   VAL B O   1 
ATOM   4168  C CB  . VAL B 1 6   ? 9.372   -8.469  85.474  1.00 28.64  ? 26   VAL B CB  1 
ATOM   4169  C CG1 . VAL B 1 6   ? 7.939   -8.313  84.974  1.00 27.31  ? 26   VAL B CG1 1 
ATOM   4170  C CG2 . VAL B 1 6   ? 9.370   -8.964  86.914  1.00 29.05  ? 26   VAL B CG2 1 
ATOM   4171  N N   . ASP B 1 7   ? 8.811   -9.796  82.629  1.00 31.00  ? 27   ASP B N   1 
ATOM   4172  C CA  . ASP B 1 7   ? 8.372   -9.627  81.261  1.00 31.66  ? 27   ASP B CA  1 
ATOM   4173  C C   . ASP B 1 7   ? 7.202   -8.650  81.211  1.00 29.78  ? 27   ASP B C   1 
ATOM   4174  O O   . ASP B 1 7   ? 6.172   -8.874  81.843  1.00 30.86  ? 27   ASP B O   1 
ATOM   4175  C CB  . ASP B 1 7   ? 7.937   -10.978 80.708  1.00 35.17  ? 27   ASP B CB  1 
ATOM   4176  C CG  . ASP B 1 7   ? 8.139   -11.081 79.223  1.00 40.13  ? 27   ASP B CG  1 
ATOM   4177  O OD1 . ASP B 1 7   ? 7.580   -10.240 78.485  1.00 43.26  ? 27   ASP B OD1 1 
ATOM   4178  O OD2 . ASP B 1 7   ? 8.863   -12.005 78.795  1.00 43.08  ? 27   ASP B OD2 1 
ATOM   4179  N N   . THR B 1 8   ? 7.366   -7.559  80.475  1.00 27.44  ? 28   THR B N   1 
ATOM   4180  C CA  . THR B 1 8   ? 6.300   -6.576  80.341  1.00 25.48  ? 28   THR B CA  1 
ATOM   4181  C C   . THR B 1 8   ? 5.961   -6.478  78.862  1.00 24.07  ? 28   THR B C   1 
ATOM   4182  O O   . THR B 1 8   ? 6.729   -6.932  78.019  1.00 24.03  ? 28   THR B O   1 
ATOM   4183  C CB  . THR B 1 8   ? 6.727   -5.186  80.886  1.00 24.87  ? 28   THR B CB  1 
ATOM   4184  O OG1 . THR B 1 8   ? 6.715   -4.217  79.829  1.00 25.69  ? 28   THR B OG1 1 
ATOM   4185  C CG2 . THR B 1 8   ? 8.114   -5.258  81.488  1.00 24.20  ? 28   THR B CG2 1 
ATOM   4186  N N   . VAL B 1 9   ? 4.808   -5.899  78.552  1.00 23.37  ? 29   VAL B N   1 
ATOM   4187  C CA  . VAL B 1 9   ? 4.369   -5.751  77.164  1.00 23.33  ? 29   VAL B CA  1 
ATOM   4188  C C   . VAL B 1 9   ? 5.493   -5.272  76.240  1.00 24.21  ? 29   VAL B C   1 
ATOM   4189  O O   . VAL B 1 9   ? 5.789   -5.899  75.212  1.00 24.04  ? 29   VAL B O   1 
ATOM   4190  C CB  . VAL B 1 9   ? 3.203   -4.746  77.058  1.00 22.16  ? 29   VAL B CB  1 
ATOM   4191  C CG1 . VAL B 1 9   ? 2.729   -4.659  75.618  1.00 18.78  ? 29   VAL B CG1 1 
ATOM   4192  C CG2 . VAL B 1 9   ? 2.075   -5.152  78.006  1.00 19.77  ? 29   VAL B CG2 1 
ATOM   4193  N N   . HIS B 1 10  ? 6.112   -4.157  76.617  1.00 22.98  ? 30   HIS B N   1 
ATOM   4194  C CA  . HIS B 1 10  ? 7.180   -3.577  75.832  1.00 22.72  ? 30   HIS B CA  1 
ATOM   4195  C C   . HIS B 1 10  ? 8.489   -4.370  75.866  1.00 22.85  ? 30   HIS B C   1 
ATOM   4196  O O   . HIS B 1 10  ? 9.427   -4.070  75.117  1.00 22.04  ? 30   HIS B O   1 
ATOM   4197  C CB  . HIS B 1 10  ? 7.423   -2.147  76.296  1.00 24.46  ? 30   HIS B CB  1 
ATOM   4198  C CG  . HIS B 1 10  ? 6.254   -1.238  76.084  1.00 25.84  ? 30   HIS B CG  1 
ATOM   4199  N ND1 . HIS B 1 10  ? 5.585   -1.156  74.884  1.00 26.55  ? 30   HIS B ND1 1 
ATOM   4200  C CD2 . HIS B 1 10  ? 5.652   -0.350  76.911  1.00 27.59  ? 30   HIS B CD2 1 
ATOM   4201  C CE1 . HIS B 1 10  ? 4.620   -0.257  74.978  1.00 26.47  ? 30   HIS B CE1 1 
ATOM   4202  N NE2 . HIS B 1 10  ? 4.639   0.246   76.198  1.00 27.07  ? 30   HIS B NE2 1 
ATOM   4203  N N   . GLY B 1 11  ? 8.561   -5.380  76.729  1.00 22.47  ? 31   GLY B N   1 
ATOM   4204  C CA  . GLY B 1 11  ? 9.775   -6.174  76.812  1.00 22.61  ? 31   GLY B CA  1 
ATOM   4205  C C   . GLY B 1 11  ? 10.169  -6.524  78.231  1.00 22.66  ? 31   GLY B C   1 
ATOM   4206  O O   . GLY B 1 11  ? 9.440   -6.217  79.169  1.00 23.54  ? 31   GLY B O   1 
ATOM   4207  N N   . LYS B 1 12  ? 11.334  -7.151  78.385  1.00 22.97  ? 32   LYS B N   1 
ATOM   4208  C CA  . LYS B 1 12  ? 11.838  -7.575  79.692  1.00 21.33  ? 32   LYS B CA  1 
ATOM   4209  C C   . LYS B 1 12  ? 12.596  -6.510  80.467  1.00 20.93  ? 32   LYS B C   1 
ATOM   4210  O O   . LYS B 1 12  ? 13.245  -5.636  79.896  1.00 20.71  ? 32   LYS B O   1 
ATOM   4211  C CB  . LYS B 1 12  ? 12.757  -8.783  79.535  1.00 21.63  ? 32   LYS B CB  1 
ATOM   4212  C CG  . LYS B 1 12  ? 12.115  -10.006 78.906  1.00 23.80  ? 32   LYS B CG  1 
ATOM   4213  C CD  . LYS B 1 12  ? 13.181  -11.056 78.633  1.00 26.14  ? 32   LYS B CD  1 
ATOM   4214  C CE  . LYS B 1 12  ? 12.617  -12.276 77.915  1.00 29.43  ? 32   LYS B CE  1 
ATOM   4215  N NZ  . LYS B 1 12  ? 11.714  -13.105 78.767  1.00 30.37  ? 32   LYS B NZ  1 
ATOM   4216  N N   . VAL B 1 13  ? 12.513  -6.611  81.786  1.00 21.65  ? 33   VAL B N   1 
ATOM   4217  C CA  . VAL B 1 13  ? 13.197  -5.694  82.685  1.00 22.91  ? 33   VAL B CA  1 
ATOM   4218  C C   . VAL B 1 13  ? 14.024  -6.494  83.685  1.00 23.07  ? 33   VAL B C   1 
ATOM   4219  O O   . VAL B 1 13  ? 13.606  -7.562  84.151  1.00 21.79  ? 33   VAL B O   1 
ATOM   4220  C CB  . VAL B 1 13  ? 12.202  -4.816  83.464  1.00 23.37  ? 33   VAL B CB  1 
ATOM   4221  C CG1 . VAL B 1 13  ? 11.877  -3.563  82.678  1.00 24.07  ? 33   VAL B CG1 1 
ATOM   4222  C CG2 . VAL B 1 13  ? 10.930  -5.604  83.723  1.00 25.44  ? 33   VAL B CG2 1 
ATOM   4223  N N   . LEU B 1 14  ? 15.203  -5.966  84.003  1.00 22.95  ? 34   LEU B N   1 
ATOM   4224  C CA  . LEU B 1 14  ? 16.122  -6.596  84.941  1.00 21.24  ? 34   LEU B CA  1 
ATOM   4225  C C   . LEU B 1 14  ? 16.239  -5.668  86.133  1.00 21.52  ? 34   LEU B C   1 
ATOM   4226  O O   . LEU B 1 14  ? 16.490  -4.473  85.965  1.00 20.56  ? 34   LEU B O   1 
ATOM   4227  C CB  . LEU B 1 14  ? 17.496  -6.768  84.282  1.00 20.42  ? 34   LEU B CB  1 
ATOM   4228  C CG  . LEU B 1 14  ? 18.686  -7.431  84.990  1.00 18.21  ? 34   LEU B CG  1 
ATOM   4229  C CD1 . LEU B 1 14  ? 19.166  -6.612  86.184  1.00 16.65  ? 34   LEU B CD1 1 
ATOM   4230  C CD2 . LEU B 1 14  ? 18.270  -8.812  85.408  1.00 17.58  ? 34   LEU B CD2 1 
ATOM   4231  N N   . GLY B 1 15  ? 16.043  -6.218  87.329  1.00 22.07  ? 35   GLY B N   1 
ATOM   4232  C CA  . GLY B 1 15  ? 16.150  -5.422  88.540  1.00 22.51  ? 35   GLY B CA  1 
ATOM   4233  C C   . GLY B 1 15  ? 17.158  -6.023  89.503  1.00 22.25  ? 35   GLY B C   1 
ATOM   4234  O O   . GLY B 1 15  ? 18.016  -6.804  89.100  1.00 22.37  ? 35   GLY B O   1 
ATOM   4235  N N   . LYS B 1 16  ? 17.071  -5.648  90.773  1.00 22.76  ? 36   LYS B N   1 
ATOM   4236  C CA  . LYS B 1 16  ? 17.971  -6.190  91.782  1.00 24.06  ? 36   LYS B CA  1 
ATOM   4237  C C   . LYS B 1 16  ? 17.149  -6.560  93.004  1.00 24.23  ? 36   LYS B C   1 
ATOM   4238  O O   . LYS B 1 16  ? 16.075  -5.994  93.233  1.00 24.40  ? 36   LYS B O   1 
ATOM   4239  C CB  . LYS B 1 16  ? 19.038  -5.165  92.183  1.00 25.67  ? 36   LYS B CB  1 
ATOM   4240  C CG  . LYS B 1 16  ? 18.526  -4.036  93.073  1.00 29.40  ? 36   LYS B CG  1 
ATOM   4241  C CD  . LYS B 1 16  ? 19.597  -2.971  93.334  1.00 32.21  ? 36   LYS B CD  1 
ATOM   4242  C CE  . LYS B 1 16  ? 19.035  -1.781  94.127  1.00 34.21  ? 36   LYS B CE  1 
ATOM   4243  N NZ  . LYS B 1 16  ? 19.993  -0.633  94.272  1.00 34.86  ? 36   LYS B NZ  1 
ATOM   4244  N N   . PHE B 1 17  ? 17.644  -7.524  93.776  1.00 23.82  ? 37   PHE B N   1 
ATOM   4245  C CA  . PHE B 1 17  ? 16.963  -7.951  94.995  1.00 21.80  ? 37   PHE B CA  1 
ATOM   4246  C C   . PHE B 1 17  ? 17.562  -7.221  96.205  1.00 21.75  ? 37   PHE B C   1 
ATOM   4247  O O   . PHE B 1 17  ? 18.784  -7.078  96.326  1.00 21.24  ? 37   PHE B O   1 
ATOM   4248  C CB  . PHE B 1 17  ? 17.104  -9.468  95.192  1.00 18.77  ? 37   PHE B CB  1 
ATOM   4249  C CG  . PHE B 1 17  ? 16.060  -10.285 94.479  1.00 14.96  ? 37   PHE B CG  1 
ATOM   4250  C CD1 . PHE B 1 17  ? 16.427  -11.246 93.547  1.00 14.70  ? 37   PHE B CD1 1 
ATOM   4251  C CD2 . PHE B 1 17  ? 14.711  -10.108 94.752  1.00 14.63  ? 37   PHE B CD2 1 
ATOM   4252  C CE1 . PHE B 1 17  ? 15.463  -12.017 92.896  1.00 12.82  ? 37   PHE B CE1 1 
ATOM   4253  C CE2 . PHE B 1 17  ? 13.736  -10.875 94.106  1.00 12.64  ? 37   PHE B CE2 1 
ATOM   4254  C CZ  . PHE B 1 17  ? 14.114  -11.828 93.178  1.00 12.59  ? 37   PHE B CZ  1 
ATOM   4255  N N   . VAL B 1 18  ? 16.697  -6.737  97.087  1.00 21.69  ? 38   VAL B N   1 
ATOM   4256  C CA  . VAL B 1 18  ? 17.152  -6.061  98.290  1.00 21.74  ? 38   VAL B CA  1 
ATOM   4257  C C   . VAL B 1 18  ? 16.366  -6.646  99.452  1.00 23.95  ? 38   VAL B C   1 
ATOM   4258  O O   . VAL B 1 18  ? 15.138  -6.664  99.419  1.00 24.64  ? 38   VAL B O   1 
ATOM   4259  C CB  . VAL B 1 18  ? 16.910  -4.540  98.221  1.00 19.42  ? 38   VAL B CB  1 
ATOM   4260  C CG1 . VAL B 1 18  ? 17.197  -3.911  99.566  1.00 16.03  ? 38   VAL B CG1 1 
ATOM   4261  C CG2 . VAL B 1 18  ? 17.805  -3.921  97.167  1.00 17.01  ? 38   VAL B CG2 1 
ATOM   4262  N N   . SER B 1 19  ? 17.071  -7.154  100.461 1.00 26.29  ? 39   SER B N   1 
ATOM   4263  C CA  . SER B 1 19  ? 16.412  -7.736  101.629 1.00 27.97  ? 39   SER B CA  1 
ATOM   4264  C C   . SER B 1 19  ? 16.329  -6.708  102.741 1.00 28.89  ? 39   SER B C   1 
ATOM   4265  O O   . SER B 1 19  ? 17.204  -5.858  102.882 1.00 28.33  ? 39   SER B O   1 
ATOM   4266  C CB  . SER B 1 19  ? 17.169  -8.968  102.138 1.00 28.10  ? 39   SER B CB  1 
ATOM   4267  O OG  . SER B 1 19  ? 16.886  -10.121 101.359 1.00 29.48  ? 39   SER B OG  1 
ATOM   4268  N N   . LEU B 1 20  ? 15.267  -6.778  103.529 1.00 31.35  ? 40   LEU B N   1 
ATOM   4269  C CA  . LEU B 1 20  ? 15.118  -5.836  104.620 1.00 34.07  ? 40   LEU B CA  1 
ATOM   4270  C C   . LEU B 1 20  ? 15.136  -6.544  105.964 1.00 36.17  ? 40   LEU B C   1 
ATOM   4271  O O   . LEU B 1 20  ? 14.553  -7.622  106.136 1.00 34.92  ? 40   LEU B O   1 
ATOM   4272  C CB  . LEU B 1 20  ? 13.821  -5.037  104.483 1.00 33.55  ? 40   LEU B CB  1 
ATOM   4273  C CG  . LEU B 1 20  ? 13.655  -3.973  105.573 1.00 34.01  ? 40   LEU B CG  1 
ATOM   4274  C CD1 . LEU B 1 20  ? 14.666  -2.856  105.364 1.00 32.67  ? 40   LEU B CD1 1 
ATOM   4275  C CD2 . LEU B 1 20  ? 12.245  -3.425  105.548 1.00 34.94  ? 40   LEU B CD2 1 
ATOM   4276  N N   . GLU B 1 21  ? 15.825  -5.916  106.907 1.00 38.66  ? 41   GLU B N   1 
ATOM   4277  C CA  . GLU B 1 21  ? 15.950  -6.419  108.261 1.00 42.08  ? 41   GLU B CA  1 
ATOM   4278  C C   . GLU B 1 21  ? 14.634  -7.025  108.746 1.00 42.11  ? 41   GLU B C   1 
ATOM   4279  O O   . GLU B 1 21  ? 13.628  -6.326  108.875 1.00 41.77  ? 41   GLU B O   1 
ATOM   4280  C CB  . GLU B 1 21  ? 16.381  -5.263  109.174 1.00 46.67  ? 41   GLU B CB  1 
ATOM   4281  C CG  . GLU B 1 21  ? 16.360  -5.551  110.672 1.00 53.74  ? 41   GLU B CG  1 
ATOM   4282  C CD  . GLU B 1 21  ? 17.223  -6.739  111.065 1.00 57.40  ? 41   GLU B CD  1 
ATOM   4283  O OE1 . GLU B 1 21  ? 18.399  -6.791  110.637 1.00 59.94  ? 41   GLU B OE1 1 
ATOM   4284  O OE2 . GLU B 1 21  ? 16.725  -7.614  111.809 1.00 58.77  ? 41   GLU B OE2 1 
ATOM   4285  N N   . GLY B 1 22  ? 14.643  -8.334  108.985 1.00 42.65  ? 42   GLY B N   1 
ATOM   4286  C CA  . GLY B 1 22  ? 13.452  -9.004  109.479 1.00 42.78  ? 42   GLY B CA  1 
ATOM   4287  C C   . GLY B 1 22  ? 12.480  -9.581  108.463 1.00 43.10  ? 42   GLY B C   1 
ATOM   4288  O O   . GLY B 1 22  ? 11.331  -9.875  108.808 1.00 42.49  ? 42   GLY B O   1 
ATOM   4289  N N   . PHE B 1 23  ? 12.916  -9.743  107.216 1.00 43.27  ? 43   PHE B N   1 
ATOM   4290  C CA  . PHE B 1 23  ? 12.041  -10.306 106.188 1.00 42.31  ? 43   PHE B CA  1 
ATOM   4291  C C   . PHE B 1 23  ? 12.726  -11.350 105.314 1.00 42.42  ? 43   PHE B C   1 
ATOM   4292  O O   . PHE B 1 23  ? 13.769  -11.090 104.705 1.00 42.01  ? 43   PHE B O   1 
ATOM   4293  C CB  . PHE B 1 23  ? 11.462  -9.201  105.309 1.00 40.00  ? 43   PHE B CB  1 
ATOM   4294  C CG  . PHE B 1 23  ? 10.572  -8.251  106.049 1.00 37.02  ? 43   PHE B CG  1 
ATOM   4295  C CD1 . PHE B 1 23  ? 11.114  -7.228  106.822 1.00 35.99  ? 43   PHE B CD1 1 
ATOM   4296  C CD2 . PHE B 1 23  ? 9.189   -8.382  105.981 1.00 35.71  ? 43   PHE B CD2 1 
ATOM   4297  C CE1 . PHE B 1 23  ? 10.295  -6.345  107.517 1.00 34.43  ? 43   PHE B CE1 1 
ATOM   4298  C CE2 . PHE B 1 23  ? 8.361   -7.508  106.670 1.00 35.12  ? 43   PHE B CE2 1 
ATOM   4299  C CZ  . PHE B 1 23  ? 8.917   -6.484  107.441 1.00 34.57  ? 43   PHE B CZ  1 
ATOM   4300  N N   . ALA B 1 24  ? 12.112  -12.530 105.260 1.00 42.83  ? 44   ALA B N   1 
ATOM   4301  C CA  . ALA B 1 24  ? 12.619  -13.662 104.489 1.00 42.54  ? 44   ALA B CA  1 
ATOM   4302  C C   . ALA B 1 24  ? 12.778  -13.352 103.005 1.00 41.97  ? 44   ALA B C   1 
ATOM   4303  O O   . ALA B 1 24  ? 13.870  -13.443 102.448 1.00 41.99  ? 44   ALA B O   1 
ATOM   4304  C CB  . ALA B 1 24  ? 11.687  -14.857 104.667 1.00 41.66  ? 44   ALA B CB  1 
ATOM   4305  N N   . GLN B 1 25  ? 11.667  -12.981 102.381 1.00 42.13  ? 45   GLN B N   1 
ATOM   4306  C CA  . GLN B 1 25  ? 11.613  -12.672 100.956 1.00 40.71  ? 45   GLN B CA  1 
ATOM   4307  C C   . GLN B 1 25  ? 12.203  -11.301 100.584 1.00 37.82  ? 45   GLN B C   1 
ATOM   4308  O O   . GLN B 1 25  ? 11.661  -10.252 100.951 1.00 36.53  ? 45   GLN B O   1 
ATOM   4309  C CB  . GLN B 1 25  ? 10.150  -12.755 100.493 1.00 42.44  ? 45   GLN B CB  1 
ATOM   4310  C CG  . GLN B 1 25  ? 9.935   -12.606 99.004  1.00 46.01  ? 45   GLN B CG  1 
ATOM   4311  C CD  . GLN B 1 25  ? 10.508  -13.763 98.224  1.00 48.38  ? 45   GLN B CD  1 
ATOM   4312  O OE1 . GLN B 1 25  ? 10.108  -14.916 98.418  1.00 50.33  ? 45   GLN B OE1 1 
ATOM   4313  N NE2 . GLN B 1 25  ? 11.452  -13.468 97.334  1.00 48.30  ? 45   GLN B NE2 1 
ATOM   4314  N N   . PRO B 1 26  ? 13.324  -11.295 99.843  1.00 34.94  ? 46   PRO B N   1 
ATOM   4315  C CA  . PRO B 1 26  ? 13.905  -10.005 99.466  1.00 33.06  ? 46   PRO B CA  1 
ATOM   4316  C C   . PRO B 1 26  ? 12.952  -9.308  98.497  1.00 31.01  ? 46   PRO B C   1 
ATOM   4317  O O   . PRO B 1 26  ? 12.246  -9.958  97.721  1.00 29.75  ? 46   PRO B O   1 
ATOM   4318  C CB  . PRO B 1 26  ? 15.226  -10.400 98.808  1.00 32.15  ? 46   PRO B CB  1 
ATOM   4319  C CG  . PRO B 1 26  ? 14.873  -11.682 98.135  1.00 33.01  ? 46   PRO B CG  1 
ATOM   4320  C CD  . PRO B 1 26  ? 14.045  -12.405 99.196  1.00 34.16  ? 46   PRO B CD  1 
ATOM   4321  N N   . VAL B 1 27  ? 12.925  -7.984  98.555  1.00 29.26  ? 47   VAL B N   1 
ATOM   4322  C CA  . VAL B 1 27  ? 12.059  -7.207  97.688  1.00 26.24  ? 47   VAL B CA  1 
ATOM   4323  C C   . VAL B 1 27  ? 12.715  -7.002  96.326  1.00 25.36  ? 47   VAL B C   1 
ATOM   4324  O O   . VAL B 1 27  ? 13.908  -6.687  96.242  1.00 25.29  ? 47   VAL B O   1 
ATOM   4325  C CB  . VAL B 1 27  ? 11.762  -5.837  98.311  1.00 25.13  ? 47   VAL B CB  1 
ATOM   4326  C CG1 . VAL B 1 27  ? 10.864  -5.043  97.395  1.00 25.85  ? 47   VAL B CG1 1 
ATOM   4327  C CG2 . VAL B 1 27  ? 11.120  -6.013  99.677  1.00 23.58  ? 47   VAL B CG2 1 
ATOM   4328  N N   . ALA B 1 28  ? 11.939  -7.201  95.262  1.00 23.97  ? 48   ALA B N   1 
ATOM   4329  C CA  . ALA B 1 28  ? 12.438  -7.012  93.905  1.00 22.27  ? 48   ALA B CA  1 
ATOM   4330  C C   . ALA B 1 28  ? 12.245  -5.530  93.578  1.00 22.44  ? 48   ALA B C   1 
ATOM   4331  O O   . ALA B 1 28  ? 11.136  -5.009  93.689  1.00 23.15  ? 48   ALA B O   1 
ATOM   4332  C CB  . ALA B 1 28  ? 11.655  -7.879  92.934  1.00 19.95  ? 48   ALA B CB  1 
ATOM   4333  N N   . ILE B 1 29  ? 13.321  -4.849  93.193  1.00 21.19  ? 49   ILE B N   1 
ATOM   4334  C CA  . ILE B 1 29  ? 13.241  -3.427  92.875  1.00 19.90  ? 49   ILE B CA  1 
ATOM   4335  C C   . ILE B 1 29  ? 13.573  -3.111  91.416  1.00 18.94  ? 49   ILE B C   1 
ATOM   4336  O O   . ILE B 1 29  ? 14.452  -3.727  90.817  1.00 19.40  ? 49   ILE B O   1 
ATOM   4337  C CB  . ILE B 1 29  ? 14.193  -2.619  93.766  1.00 20.37  ? 49   ILE B CB  1 
ATOM   4338  C CG1 . ILE B 1 29  ? 13.861  -2.871  95.237  1.00 20.75  ? 49   ILE B CG1 1 
ATOM   4339  C CG2 . ILE B 1 29  ? 14.092  -1.140  93.430  1.00 19.12  ? 49   ILE B CG2 1 
ATOM   4340  C CD1 . ILE B 1 29  ? 14.810  -2.173  96.196  1.00 22.25  ? 49   ILE B CD1 1 
ATOM   4341  N N   . PHE B 1 30  ? 12.865  -2.144  90.847  1.00 17.24  ? 50   PHE B N   1 
ATOM   4342  C CA  . PHE B 1 30  ? 13.107  -1.740  89.469  1.00 15.89  ? 50   PHE B CA  1 
ATOM   4343  C C   . PHE B 1 30  ? 13.180  -0.212  89.380  1.00 15.65  ? 50   PHE B C   1 
ATOM   4344  O O   . PHE B 1 30  ? 12.300  0.496   89.868  1.00 16.34  ? 50   PHE B O   1 
ATOM   4345  C CB  . PHE B 1 30  ? 12.008  -2.293  88.564  1.00 13.62  ? 50   PHE B CB  1 
ATOM   4346  C CG  . PHE B 1 30  ? 11.893  -3.787  88.604  1.00 13.27  ? 50   PHE B CG  1 
ATOM   4347  C CD1 . PHE B 1 30  ? 11.240  -4.421  89.656  1.00 12.54  ? 50   PHE B CD1 1 
ATOM   4348  C CD2 . PHE B 1 30  ? 12.444  -4.570  87.595  1.00 12.70  ? 50   PHE B CD2 1 
ATOM   4349  C CE1 . PHE B 1 30  ? 11.134  -5.815  89.698  1.00 9.74   ? 50   PHE B CE1 1 
ATOM   4350  C CE2 . PHE B 1 30  ? 12.342  -5.962  87.630  1.00 11.05  ? 50   PHE B CE2 1 
ATOM   4351  C CZ  . PHE B 1 30  ? 11.684  -6.582  88.685  1.00 9.39   ? 50   PHE B CZ  1 
ATOM   4352  N N   . LEU B 1 31  ? 14.237  0.295   88.758  1.00 15.39  ? 51   LEU B N   1 
ATOM   4353  C CA  . LEU B 1 31  ? 14.431  1.736   88.643  1.00 14.45  ? 51   LEU B CA  1 
ATOM   4354  C C   . LEU B 1 31  ? 14.478  2.257   87.206  1.00 13.27  ? 51   LEU B C   1 
ATOM   4355  O O   . LEU B 1 31  ? 15.199  1.727   86.368  1.00 14.48  ? 51   LEU B O   1 
ATOM   4356  C CB  . LEU B 1 31  ? 15.721  2.120   89.370  1.00 14.12  ? 51   LEU B CB  1 
ATOM   4357  C CG  . LEU B 1 31  ? 15.786  1.630   90.822  1.00 13.55  ? 51   LEU B CG  1 
ATOM   4358  C CD1 . LEU B 1 31  ? 17.181  1.831   91.392  1.00 12.01  ? 51   LEU B CD1 1 
ATOM   4359  C CD2 . LEU B 1 31  ? 14.748  2.372   91.650  1.00 13.51  ? 51   LEU B CD2 1 
ATOM   4360  N N   . GLY B 1 32  ? 13.699  3.295   86.926  1.00 11.63  ? 52   GLY B N   1 
ATOM   4361  C CA  . GLY B 1 32  ? 13.700  3.880   85.599  1.00 10.51  ? 52   GLY B CA  1 
ATOM   4362  C C   . GLY B 1 32  ? 13.073  3.077   84.480  1.00 10.22  ? 52   GLY B C   1 
ATOM   4363  O O   . GLY B 1 32  ? 13.658  2.916   83.404  1.00 11.16  ? 52   GLY B O   1 
ATOM   4364  N N   . ILE B 1 33  ? 11.880  2.558   84.726  1.00 10.17  ? 53   ILE B N   1 
ATOM   4365  C CA  . ILE B 1 33  ? 11.170  1.816   83.701  1.00 8.71   ? 53   ILE B CA  1 
ATOM   4366  C C   . ILE B 1 33  ? 10.369  2.878   82.986  1.00 8.36   ? 53   ILE B C   1 
ATOM   4367  O O   . ILE B 1 33  ? 9.614   3.609   83.615  1.00 8.53   ? 53   ILE B O   1 
ATOM   4368  C CB  . ILE B 1 33  ? 10.191  0.790   84.304  1.00 9.94   ? 53   ILE B CB  1 
ATOM   4369  C CG1 . ILE B 1 33  ? 10.971  -0.374  84.927  1.00 10.62  ? 53   ILE B CG1 1 
ATOM   4370  C CG2 . ILE B 1 33  ? 9.211   0.317   83.235  1.00 9.80   ? 53   ILE B CG2 1 
ATOM   4371  C CD1 . ILE B 1 33  ? 10.109  -1.565  85.340  1.00 10.34  ? 53   ILE B CD1 1 
ATOM   4372  N N   . PRO B 1 34  ? 10.542  3.003   81.668  1.00 9.03   ? 54   PRO B N   1 
ATOM   4373  C CA  . PRO B 1 34  ? 9.800   4.006   80.899  1.00 8.74   ? 54   PRO B CA  1 
ATOM   4374  C C   . PRO B 1 34  ? 8.322   3.636   80.754  1.00 8.72   ? 54   PRO B C   1 
ATOM   4375  O O   . PRO B 1 34  ? 7.994   2.485   80.482  1.00 7.89   ? 54   PRO B O   1 
ATOM   4376  C CB  . PRO B 1 34  ? 10.525  4.009   79.556  1.00 8.92   ? 54   PRO B CB  1 
ATOM   4377  C CG  . PRO B 1 34  ? 10.965  2.590   79.416  1.00 8.81   ? 54   PRO B CG  1 
ATOM   4378  C CD  . PRO B 1 34  ? 11.484  2.267   80.806  1.00 9.68   ? 54   PRO B CD  1 
ATOM   4379  N N   . PHE B 1 35  ? 7.428   4.600   80.956  1.00 10.03  ? 55   PHE B N   1 
ATOM   4380  C CA  . PHE B 1 35  ? 6.001   4.323   80.813  1.00 12.39  ? 55   PHE B CA  1 
ATOM   4381  C C   . PHE B 1 35  ? 5.416   5.170   79.694  1.00 14.58  ? 55   PHE B C   1 
ATOM   4382  O O   . PHE B 1 35  ? 4.238   5.040   79.353  1.00 15.65  ? 55   PHE B O   1 
ATOM   4383  C CB  . PHE B 1 35  ? 5.244   4.560   82.133  1.00 10.35  ? 55   PHE B CB  1 
ATOM   4384  C CG  . PHE B 1 35  ? 5.203   5.988   82.578  1.00 7.90   ? 55   PHE B CG  1 
ATOM   4385  C CD1 . PHE B 1 35  ? 4.226   6.852   82.096  1.00 8.14   ? 55   PHE B CD1 1 
ATOM   4386  C CD2 . PHE B 1 35  ? 6.125   6.467   83.497  1.00 5.71   ? 55   PHE B CD2 1 
ATOM   4387  C CE1 . PHE B 1 35  ? 4.166   8.179   82.527  1.00 6.92   ? 55   PHE B CE1 1 
ATOM   4388  C CE2 . PHE B 1 35  ? 6.074   7.792   83.936  1.00 6.73   ? 55   PHE B CE2 1 
ATOM   4389  C CZ  . PHE B 1 35  ? 5.092   8.649   83.450  1.00 6.06   ? 55   PHE B CZ  1 
ATOM   4390  N N   . ALA B 1 36  ? 6.257   6.029   79.120  1.00 14.59  ? 56   ALA B N   1 
ATOM   4391  C CA  . ALA B 1 36  ? 5.851   6.890   78.019  1.00 13.81  ? 56   ALA B CA  1 
ATOM   4392  C C   . ALA B 1 36  ? 7.052   7.158   77.126  1.00 13.57  ? 56   ALA B C   1 
ATOM   4393  O O   . ALA B 1 36  ? 8.187   6.901   77.508  1.00 15.13  ? 56   ALA B O   1 
ATOM   4394  C CB  . ALA B 1 36  ? 5.304   8.193   78.555  1.00 11.47  ? 56   ALA B CB  1 
ATOM   4395  N N   . LYS B 1 37  ? 6.793   7.661   75.930  1.00 13.79  ? 57   LYS B N   1 
ATOM   4396  C CA  . LYS B 1 37  ? 7.853   8.005   74.995  1.00 14.56  ? 57   LYS B CA  1 
ATOM   4397  C C   . LYS B 1 37  ? 8.391   9.360   75.452  1.00 13.42  ? 57   LYS B C   1 
ATOM   4398  O O   . LYS B 1 37  ? 7.615   10.243  75.816  1.00 13.04  ? 57   LYS B O   1 
ATOM   4399  C CB  . LYS B 1 37  ? 7.283   8.134   73.582  1.00 16.50  ? 57   LYS B CB  1 
ATOM   4400  C CG  . LYS B 1 37  ? 8.306   8.443   72.509  1.00 19.84  ? 57   LYS B CG  1 
ATOM   4401  C CD  . LYS B 1 37  ? 7.625   8.618   71.159  1.00 24.18  ? 57   LYS B CD  1 
ATOM   4402  C CE  . LYS B 1 37  ? 8.630   8.642   70.005  1.00 28.05  ? 57   LYS B CE  1 
ATOM   4403  N NZ  . LYS B 1 37  ? 9.232   7.294   69.722  1.00 30.64  ? 57   LYS B NZ  1 
ATOM   4404  N N   . PRO B 1 38  ? 9.722   9.542   75.434  1.00 12.06  ? 58   PRO B N   1 
ATOM   4405  C CA  . PRO B 1 38  ? 10.397  10.781  75.843  1.00 12.70  ? 58   PRO B CA  1 
ATOM   4406  C C   . PRO B 1 38  ? 9.779   12.011  75.174  1.00 14.49  ? 58   PRO B C   1 
ATOM   4407  O O   . PRO B 1 38  ? 9.790   12.120  73.949  1.00 15.04  ? 58   PRO B O   1 
ATOM   4408  C CB  . PRO B 1 38  ? 11.833  10.547  75.401  1.00 12.00  ? 58   PRO B CB  1 
ATOM   4409  C CG  . PRO B 1 38  ? 11.982  9.071   75.543  1.00 12.16  ? 58   PRO B CG  1 
ATOM   4410  C CD  . PRO B 1 38  ? 10.699  8.553   74.955  1.00 11.83  ? 58   PRO B CD  1 
ATOM   4411  N N   . PRO B 1 39  ? 9.243   12.959  75.975  1.00 15.21  ? 59   PRO B N   1 
ATOM   4412  C CA  . PRO B 1 39  ? 8.610   14.181  75.464  1.00 14.98  ? 59   PRO B CA  1 
ATOM   4413  C C   . PRO B 1 39  ? 9.565   15.245  74.924  1.00 15.60  ? 59   PRO B C   1 
ATOM   4414  O O   . PRO B 1 39  ? 9.594   16.380  75.413  1.00 18.26  ? 59   PRO B O   1 
ATOM   4415  C CB  . PRO B 1 39  ? 7.806   14.666  76.668  1.00 13.13  ? 59   PRO B CB  1 
ATOM   4416  C CG  . PRO B 1 39  ? 8.686   14.298  77.803  1.00 12.75  ? 59   PRO B CG  1 
ATOM   4417  C CD  . PRO B 1 39  ? 9.144   12.904  77.447  1.00 14.56  ? 59   PRO B CD  1 
ATOM   4418  N N   . LEU B 1 40  ? 10.324  14.884  73.894  1.00 14.34  ? 60   LEU B N   1 
ATOM   4419  C CA  . LEU B 1 40  ? 11.284  15.804  73.300  1.00 13.06  ? 60   LEU B CA  1 
ATOM   4420  C C   . LEU B 1 40  ? 10.842  16.393  71.963  1.00 11.92  ? 60   LEU B C   1 
ATOM   4421  O O   . LEU B 1 40  ? 9.883   15.940  71.338  1.00 10.28  ? 60   LEU B O   1 
ATOM   4422  C CB  . LEU B 1 40  ? 12.627  15.100  73.130  1.00 11.20  ? 60   LEU B CB  1 
ATOM   4423  C CG  . LEU B 1 40  ? 12.992  14.276  74.359  1.00 12.27  ? 60   LEU B CG  1 
ATOM   4424  C CD1 . LEU B 1 40  ? 14.353  13.650  74.156  1.00 13.95  ? 60   LEU B CD1 1 
ATOM   4425  C CD2 . LEU B 1 40  ? 12.974  15.154  75.606  1.00 11.14  ? 60   LEU B CD2 1 
ATOM   4426  N N   . GLY B 1 41  ? 11.559  17.420  71.533  1.00 11.95  ? 61   GLY B N   1 
ATOM   4427  C CA  . GLY B 1 41  ? 11.236  18.052  70.277  1.00 12.73  ? 61   GLY B CA  1 
ATOM   4428  C C   . GLY B 1 41  ? 9.766   18.381  70.164  1.00 13.12  ? 61   GLY B C   1 
ATOM   4429  O O   . GLY B 1 41  ? 9.193   19.004  71.057  1.00 14.18  ? 61   GLY B O   1 
ATOM   4430  N N   . PRO B 1 42  ? 9.121   17.964  69.069  1.00 12.81  ? 62   PRO B N   1 
ATOM   4431  C CA  . PRO B 1 42  ? 7.700   18.217  68.823  1.00 12.51  ? 62   PRO B CA  1 
ATOM   4432  C C   . PRO B 1 42  ? 6.718   17.621  69.830  1.00 11.74  ? 62   PRO B C   1 
ATOM   4433  O O   . PRO B 1 42  ? 5.520   17.916  69.777  1.00 11.67  ? 62   PRO B O   1 
ATOM   4434  C CB  . PRO B 1 42  ? 7.500   17.671  67.410  1.00 10.89  ? 62   PRO B CB  1 
ATOM   4435  C CG  . PRO B 1 42  ? 8.493   16.580  67.328  1.00 10.09  ? 62   PRO B CG  1 
ATOM   4436  C CD  . PRO B 1 42  ? 9.711   17.203  67.955  1.00 11.91  ? 62   PRO B CD  1 
ATOM   4437  N N   . LEU B 1 43  ? 7.222   16.792  70.739  1.00 10.39  ? 63   LEU B N   1 
ATOM   4438  C CA  . LEU B 1 43  ? 6.373   16.166  71.749  1.00 10.33  ? 63   LEU B CA  1 
ATOM   4439  C C   . LEU B 1 43  ? 6.191   17.027  73.007  1.00 10.57  ? 63   LEU B C   1 
ATOM   4440  O O   . LEU B 1 43  ? 5.417   16.681  73.909  1.00 11.17  ? 63   LEU B O   1 
ATOM   4441  C CB  . LEU B 1 43  ? 6.937   14.798  72.123  1.00 7.64   ? 63   LEU B CB  1 
ATOM   4442  C CG  . LEU B 1 43  ? 6.743   13.747  71.035  1.00 4.66   ? 63   LEU B CG  1 
ATOM   4443  C CD1 . LEU B 1 43  ? 7.397   12.446  71.443  1.00 2.09   ? 63   LEU B CD1 1 
ATOM   4444  C CD2 . LEU B 1 43  ? 5.261   13.548  70.807  1.00 3.77   ? 63   LEU B CD2 1 
ATOM   4445  N N   . ARG B 1 44  ? 6.910   18.143  73.055  1.00 9.36   ? 64   ARG B N   1 
ATOM   4446  C CA  . ARG B 1 44  ? 6.825   19.079  74.163  1.00 9.10   ? 64   ARG B CA  1 
ATOM   4447  C C   . ARG B 1 44  ? 5.460   19.787  74.083  1.00 9.49   ? 64   ARG B C   1 
ATOM   4448  O O   . ARG B 1 44  ? 5.042   20.226  73.007  1.00 8.45   ? 64   ARG B O   1 
ATOM   4449  C CB  . ARG B 1 44  ? 7.979   20.086  74.059  1.00 9.38   ? 64   ARG B CB  1 
ATOM   4450  C CG  . ARG B 1 44  ? 8.031   21.150  75.148  1.00 9.88   ? 64   ARG B CG  1 
ATOM   4451  C CD  . ARG B 1 44  ? 9.142   22.173  74.877  1.00 10.82  ? 64   ARG B CD  1 
ATOM   4452  N NE  . ARG B 1 44  ? 10.492  21.635  75.052  1.00 12.36  ? 64   ARG B NE  1 
ATOM   4453  C CZ  . ARG B 1 44  ? 11.600  22.249  74.638  1.00 13.51  ? 64   ARG B CZ  1 
ATOM   4454  N NH1 . ARG B 1 44  ? 11.521  23.419  74.017  1.00 13.65  ? 64   ARG B NH1 1 
ATOM   4455  N NH2 . ARG B 1 44  ? 12.791  21.707  74.853  1.00 12.79  ? 64   ARG B NH2 1 
ATOM   4456  N N   . PHE B 1 45  ? 4.773   19.878  75.223  1.00 9.25   ? 65   PHE B N   1 
ATOM   4457  C CA  . PHE B 1 45  ? 3.457   20.509  75.323  1.00 8.72   ? 65   PHE B CA  1 
ATOM   4458  C C   . PHE B 1 45  ? 2.396   19.710  74.582  1.00 10.62  ? 65   PHE B C   1 
ATOM   4459  O O   . PHE B 1 45  ? 1.550   20.281  73.882  1.00 13.10  ? 65   PHE B O   1 
ATOM   4460  C CB  . PHE B 1 45  ? 3.460   21.930  74.757  1.00 8.27   ? 65   PHE B CB  1 
ATOM   4461  C CG  . PHE B 1 45  ? 4.527   22.808  75.316  1.00 8.45   ? 65   PHE B CG  1 
ATOM   4462  C CD1 . PHE B 1 45  ? 4.735   22.891  76.681  1.00 10.22  ? 65   PHE B CD1 1 
ATOM   4463  C CD2 . PHE B 1 45  ? 5.325   23.563  74.471  1.00 9.05   ? 65   PHE B CD2 1 
ATOM   4464  C CE1 . PHE B 1 45  ? 5.730   23.714  77.202  1.00 10.10  ? 65   PHE B CE1 1 
ATOM   4465  C CE2 . PHE B 1 45  ? 6.318   24.388  74.979  1.00 8.87   ? 65   PHE B CE2 1 
ATOM   4466  C CZ  . PHE B 1 45  ? 6.521   24.464  76.347  1.00 9.57   ? 65   PHE B CZ  1 
ATOM   4467  N N   . THR B 1 46  ? 2.445   18.389  74.717  1.00 9.83   ? 66   THR B N   1 
ATOM   4468  C CA  . THR B 1 46  ? 1.466   17.524  74.068  1.00 7.45   ? 66   THR B CA  1 
ATOM   4469  C C   . THR B 1 46  ? 1.273   16.340  74.997  1.00 8.89   ? 66   THR B C   1 
ATOM   4470  O O   . THR B 1 46  ? 2.072   16.128  75.911  1.00 9.31   ? 66   THR B O   1 
ATOM   4471  C CB  . THR B 1 46  ? 1.959   17.016  72.695  1.00 5.08   ? 66   THR B CB  1 
ATOM   4472  O OG1 . THR B 1 46  ? 2.498   15.703  72.830  1.00 4.89   ? 66   THR B OG1 1 
ATOM   4473  C CG2 . THR B 1 46  ? 3.044   17.918  72.145  1.00 3.43   ? 66   THR B CG2 1 
ATOM   4474  N N   . PRO B 1 47  ? 0.204   15.562  74.792  1.00 9.30   ? 67   PRO B N   1 
ATOM   4475  C CA  . PRO B 1 47  ? -0.064  14.395  75.643  1.00 10.33  ? 67   PRO B CA  1 
ATOM   4476  C C   . PRO B 1 47  ? 0.992   13.299  75.487  1.00 10.53  ? 67   PRO B C   1 
ATOM   4477  O O   . PRO B 1 47  ? 1.492   13.063  74.398  1.00 11.99  ? 67   PRO B O   1 
ATOM   4478  C CB  . PRO B 1 47  ? -1.447  13.951  75.185  1.00 9.60   ? 67   PRO B CB  1 
ATOM   4479  C CG  . PRO B 1 47  ? -2.076  15.250  74.737  1.00 8.58   ? 67   PRO B CG  1 
ATOM   4480  C CD  . PRO B 1 47  ? -0.957  15.867  73.944  1.00 8.46   ? 67   PRO B CD  1 
ATOM   4481  N N   . PRO B 1 48  ? 1.328   12.601  76.578  1.00 11.33  ? 68   PRO B N   1 
ATOM   4482  C CA  . PRO B 1 48  ? 2.336   11.542  76.527  1.00 11.70  ? 68   PRO B CA  1 
ATOM   4483  C C   . PRO B 1 48  ? 1.966   10.364  75.656  1.00 12.05  ? 68   PRO B C   1 
ATOM   4484  O O   . PRO B 1 48  ? 0.833   9.877   75.686  1.00 10.26  ? 68   PRO B O   1 
ATOM   4485  C CB  . PRO B 1 48  ? 2.486   11.146  77.988  1.00 11.54  ? 68   PRO B CB  1 
ATOM   4486  C CG  . PRO B 1 48  ? 1.099   11.288  78.488  1.00 12.23  ? 68   PRO B CG  1 
ATOM   4487  C CD  . PRO B 1 48  ? 0.672   12.622  77.896  1.00 12.00  ? 68   PRO B CD  1 
ATOM   4488  N N   . GLN B 1 49  ? 2.939   9.897   74.884  1.00 13.55  ? 69   GLN B N   1 
ATOM   4489  C CA  . GLN B 1 49  ? 2.705   8.768   74.010  1.00 14.42  ? 69   GLN B CA  1 
ATOM   4490  C C   . GLN B 1 49  ? 3.324   7.487   74.516  1.00 14.60  ? 69   GLN B C   1 
ATOM   4491  O O   . GLN B 1 49  ? 4.250   7.504   75.324  1.00 15.44  ? 69   GLN B O   1 
ATOM   4492  C CB  . GLN B 1 49  ? 3.206   9.085   72.620  1.00 16.38  ? 69   GLN B CB  1 
ATOM   4493  C CG  . GLN B 1 49  ? 2.161   9.804   71.819  1.00 22.58  ? 69   GLN B CG  1 
ATOM   4494  C CD  . GLN B 1 49  ? 2.764   10.685  70.765  1.00 27.96  ? 69   GLN B CD  1 
ATOM   4495  O OE1 . GLN B 1 49  ? 3.485   10.212  69.874  1.00 30.95  ? 69   GLN B OE1 1 
ATOM   4496  N NE2 . GLN B 1 49  ? 2.482   11.987  70.856  1.00 29.15  ? 69   GLN B NE2 1 
ATOM   4497  N N   . PRO B 1 50  ? 2.809   6.346   74.047  1.00 14.88  ? 70   PRO B N   1 
ATOM   4498  C CA  . PRO B 1 50  ? 3.318   5.040   74.468  1.00 15.15  ? 70   PRO B CA  1 
ATOM   4499  C C   . PRO B 1 50  ? 4.826   4.931   74.283  1.00 16.62  ? 70   PRO B C   1 
ATOM   4500  O O   . PRO B 1 50  ? 5.405   5.555   73.387  1.00 17.51  ? 70   PRO B O   1 
ATOM   4501  C CB  . PRO B 1 50  ? 2.561   4.074   73.568  1.00 13.38  ? 70   PRO B CB  1 
ATOM   4502  C CG  . PRO B 1 50  ? 1.294   4.805   73.270  1.00 12.83  ? 70   PRO B CG  1 
ATOM   4503  C CD  . PRO B 1 50  ? 1.771   6.192   73.016  1.00 13.38  ? 70   PRO B CD  1 
ATOM   4504  N N   . ALA B 1 51  ? 5.455   4.138   75.139  1.00 17.24  ? 71   ALA B N   1 
ATOM   4505  C CA  . ALA B 1 51  ? 6.888   3.925   75.056  1.00 18.09  ? 71   ALA B CA  1 
ATOM   4506  C C   . ALA B 1 51  ? 7.187   2.939   73.911  1.00 17.81  ? 71   ALA B C   1 
ATOM   4507  O O   . ALA B 1 51  ? 6.386   2.048   73.621  1.00 17.07  ? 71   ALA B O   1 
ATOM   4508  C CB  . ALA B 1 51  ? 7.404   3.377   76.393  1.00 17.23  ? 71   ALA B CB  1 
ATOM   4509  N N   . GLU B 1 52  ? 8.324   3.116   73.246  1.00 18.90  ? 72   GLU B N   1 
ATOM   4510  C CA  . GLU B 1 52  ? 8.709   2.220   72.161  1.00 20.59  ? 72   GLU B CA  1 
ATOM   4511  C C   . GLU B 1 52  ? 9.231   0.950   72.812  1.00 19.19  ? 72   GLU B C   1 
ATOM   4512  O O   . GLU B 1 52  ? 10.017  1.003   73.760  1.00 20.24  ? 72   GLU B O   1 
ATOM   4513  C CB  . GLU B 1 52  ? 9.810   2.847   71.310  1.00 25.79  ? 72   GLU B CB  1 
ATOM   4514  C CG  . GLU B 1 52  ? 9.449   4.201   70.714  1.00 35.25  ? 72   GLU B CG  1 
ATOM   4515  C CD  . GLU B 1 52  ? 8.473   4.090   69.554  1.00 40.41  ? 72   GLU B CD  1 
ATOM   4516  O OE1 . GLU B 1 52  ? 7.481   3.332   69.679  1.00 43.29  ? 72   GLU B OE1 1 
ATOM   4517  O OE2 . GLU B 1 52  ? 8.697   4.766   68.520  1.00 43.18  ? 72   GLU B OE2 1 
ATOM   4518  N N   . PRO B 1 53  ? 8.800   -0.211  72.316  1.00 17.20  ? 73   PRO B N   1 
ATOM   4519  C CA  . PRO B 1 53  ? 9.220   -1.508  72.852  1.00 16.77  ? 73   PRO B CA  1 
ATOM   4520  C C   . PRO B 1 53  ? 10.715  -1.782  72.657  1.00 17.90  ? 73   PRO B C   1 
ATOM   4521  O O   . PRO B 1 53  ? 11.309  -1.328  71.680  1.00 18.15  ? 73   PRO B O   1 
ATOM   4522  C CB  . PRO B 1 53  ? 8.346   -2.478  72.081  1.00 15.35  ? 73   PRO B CB  1 
ATOM   4523  C CG  . PRO B 1 53  ? 8.236   -1.805  70.746  1.00 15.33  ? 73   PRO B CG  1 
ATOM   4524  C CD  . PRO B 1 53  ? 7.973   -0.377  71.111  1.00 14.93  ? 73   PRO B CD  1 
ATOM   4525  N N   . TRP B 1 54  ? 11.322  -2.530  73.575  1.00 19.65  ? 74   TRP B N   1 
ATOM   4526  C CA  . TRP B 1 54  ? 12.754  -2.831  73.472  1.00 20.86  ? 74   TRP B CA  1 
ATOM   4527  C C   . TRP B 1 54  ? 13.097  -4.276  73.118  1.00 20.74  ? 74   TRP B C   1 
ATOM   4528  O O   . TRP B 1 54  ? 12.476  -5.221  73.603  1.00 19.80  ? 74   TRP B O   1 
ATOM   4529  C CB  . TRP B 1 54  ? 13.474  -2.418  74.762  1.00 21.11  ? 74   TRP B CB  1 
ATOM   4530  C CG  . TRP B 1 54  ? 12.848  -2.934  76.016  1.00 22.18  ? 74   TRP B CG  1 
ATOM   4531  C CD1 . TRP B 1 54  ? 13.088  -4.136  76.625  1.00 23.84  ? 74   TRP B CD1 1 
ATOM   4532  C CD2 . TRP B 1 54  ? 11.885  -2.258  76.828  1.00 22.01  ? 74   TRP B CD2 1 
ATOM   4533  N NE1 . TRP B 1 54  ? 12.334  -4.246  77.772  1.00 24.05  ? 74   TRP B NE1 1 
ATOM   4534  C CE2 . TRP B 1 54  ? 11.586  -3.106  77.918  1.00 23.61  ? 74   TRP B CE2 1 
ATOM   4535  C CE3 . TRP B 1 54  ? 11.243  -1.016  76.740  1.00 20.51  ? 74   TRP B CE3 1 
ATOM   4536  C CZ2 . TRP B 1 54  ? 10.674  -2.750  78.913  1.00 24.16  ? 74   TRP B CZ2 1 
ATOM   4537  C CZ3 . TRP B 1 54  ? 10.340  -0.662  77.725  1.00 21.40  ? 74   TRP B CZ3 1 
ATOM   4538  C CH2 . TRP B 1 54  ? 10.062  -1.524  78.799  1.00 24.33  ? 74   TRP B CH2 1 
ATOM   4539  N N   . SER B 1 55  ? 14.118  -4.423  72.279  1.00 22.75  ? 75   SER B N   1 
ATOM   4540  C CA  . SER B 1 55  ? 14.573  -5.722  71.789  1.00 24.80  ? 75   SER B CA  1 
ATOM   4541  C C   . SER B 1 55  ? 15.089  -6.775  72.757  1.00 24.86  ? 75   SER B C   1 
ATOM   4542  O O   . SER B 1 55  ? 14.693  -7.939  72.653  1.00 27.14  ? 75   SER B O   1 
ATOM   4543  C CB  . SER B 1 55  ? 15.615  -5.529  70.687  1.00 25.01  ? 75   SER B CB  1 
ATOM   4544  O OG  . SER B 1 55  ? 14.975  -5.234  69.454  1.00 28.32  ? 75   SER B OG  1 
ATOM   4545  N N   . PHE B 1 56  ? 15.963  -6.413  73.687  1.00 23.29  ? 76   PHE B N   1 
ATOM   4546  C CA  . PHE B 1 56  ? 16.471  -7.436  74.595  1.00 22.56  ? 76   PHE B CA  1 
ATOM   4547  C C   . PHE B 1 56  ? 16.014  -7.277  76.034  1.00 21.58  ? 76   PHE B C   1 
ATOM   4548  O O   . PHE B 1 56  ? 14.829  -7.069  76.290  1.00 23.04  ? 76   PHE B O   1 
ATOM   4549  C CB  . PHE B 1 56  ? 17.995  -7.481  74.512  1.00 23.45  ? 76   PHE B CB  1 
ATOM   4550  C CG  . PHE B 1 56  ? 18.507  -7.764  73.129  1.00 23.61  ? 76   PHE B CG  1 
ATOM   4551  C CD1 . PHE B 1 56  ? 18.890  -6.725  72.285  1.00 24.24  ? 76   PHE B CD1 1 
ATOM   4552  C CD2 . PHE B 1 56  ? 18.572  -9.075  72.655  1.00 22.74  ? 76   PHE B CD2 1 
ATOM   4553  C CE1 . PHE B 1 56  ? 19.334  -6.989  70.983  1.00 24.65  ? 76   PHE B CE1 1 
ATOM   4554  C CE2 . PHE B 1 56  ? 19.011  -9.351  71.360  1.00 22.34  ? 76   PHE B CE2 1 
ATOM   4555  C CZ  . PHE B 1 56  ? 19.394  -8.306  70.521  1.00 23.77  ? 76   PHE B CZ  1 
ATOM   4556  N N   . VAL B 1 57  ? 16.945  -7.404  76.972  1.00 19.97  ? 77   VAL B N   1 
ATOM   4557  C CA  . VAL B 1 57  ? 16.630  -7.250  78.386  1.00 19.73  ? 77   VAL B CA  1 
ATOM   4558  C C   . VAL B 1 57  ? 17.091  -5.867  78.845  1.00 19.66  ? 77   VAL B C   1 
ATOM   4559  O O   . VAL B 1 57  ? 18.277  -5.552  78.767  1.00 19.76  ? 77   VAL B O   1 
ATOM   4560  C CB  . VAL B 1 57  ? 17.337  -8.341  79.247  1.00 19.86  ? 77   VAL B CB  1 
ATOM   4561  C CG1 . VAL B 1 57  ? 17.320  -7.944  80.716  1.00 19.31  ? 77   VAL B CG1 1 
ATOM   4562  C CG2 . VAL B 1 57  ? 16.637  -9.681  79.077  1.00 17.03  ? 77   VAL B CG2 1 
ATOM   4563  N N   . LYS B 1 58  ? 16.152  -5.049  79.320  1.00 20.23  ? 78   LYS B N   1 
ATOM   4564  C CA  . LYS B 1 58  ? 16.462  -3.695  79.797  1.00 20.38  ? 78   LYS B CA  1 
ATOM   4565  C C   . LYS B 1 58  ? 16.803  -3.670  81.293  1.00 20.23  ? 78   LYS B C   1 
ATOM   4566  O O   . LYS B 1 58  ? 16.033  -4.138  82.129  1.00 19.83  ? 78   LYS B O   1 
ATOM   4567  C CB  . LYS B 1 58  ? 15.274  -2.757  79.520  1.00 20.00  ? 78   LYS B CB  1 
ATOM   4568  C CG  . LYS B 1 58  ? 15.488  -1.308  79.964  1.00 19.48  ? 78   LYS B CG  1 
ATOM   4569  C CD  . LYS B 1 58  ? 14.239  -0.449  79.769  1.00 19.62  ? 78   LYS B CD  1 
ATOM   4570  C CE  . LYS B 1 58  ? 13.962  -0.094  78.305  1.00 20.01  ? 78   LYS B CE  1 
ATOM   4571  N NZ  . LYS B 1 58  ? 14.804  1.023   77.763  1.00 20.51  ? 78   LYS B NZ  1 
ATOM   4572  N N   . ASN B 1 59  ? 17.959  -3.111  81.625  1.00 21.84  ? 79   ASN B N   1 
ATOM   4573  C CA  . ASN B 1 59  ? 18.406  -3.031  83.013  1.00 24.96  ? 79   ASN B CA  1 
ATOM   4574  C C   . ASN B 1 59  ? 17.758  -1.906  83.807  1.00 23.68  ? 79   ASN B C   1 
ATOM   4575  O O   . ASN B 1 59  ? 18.290  -0.804  83.861  1.00 24.55  ? 79   ASN B O   1 
ATOM   4576  C CB  . ASN B 1 59  ? 19.929  -2.845  83.071  1.00 29.50  ? 79   ASN B CB  1 
ATOM   4577  C CG  . ASN B 1 59  ? 20.682  -4.099  82.702  1.00 35.91  ? 79   ASN B CG  1 
ATOM   4578  O OD1 . ASN B 1 59  ? 20.175  -4.927  81.945  1.00 38.76  ? 79   ASN B OD1 1 
ATOM   4579  N ND2 . ASN B 1 59  ? 21.899  -4.241  83.220  1.00 41.76  ? 79   ASN B ND2 1 
ATOM   4580  N N   . ALA B 1 60  ? 16.620  -2.167  84.434  1.00 22.09  ? 80   ALA B N   1 
ATOM   4581  C CA  . ALA B 1 60  ? 15.989  -1.124  85.234  1.00 20.23  ? 80   ALA B CA  1 
ATOM   4582  C C   . ALA B 1 60  ? 16.759  -1.103  86.544  1.00 18.71  ? 80   ALA B C   1 
ATOM   4583  O O   . ALA B 1 60  ? 16.268  -1.564  87.568  1.00 17.31  ? 80   ALA B O   1 
ATOM   4584  C CB  . ALA B 1 60  ? 14.528  -1.452  85.485  1.00 21.29  ? 80   ALA B CB  1 
ATOM   4585  N N   . THR B 1 61  ? 17.971  -0.560  86.504  1.00 18.32  ? 81   THR B N   1 
ATOM   4586  C CA  . THR B 1 61  ? 18.817  -0.533  87.687  1.00 17.59  ? 81   THR B CA  1 
ATOM   4587  C C   . THR B 1 61  ? 19.542  0.772   87.962  1.00 17.55  ? 81   THR B C   1 
ATOM   4588  O O   . THR B 1 61  ? 20.571  0.773   88.633  1.00 16.74  ? 81   THR B O   1 
ATOM   4589  C CB  . THR B 1 61  ? 19.875  -1.652  87.619  1.00 16.71  ? 81   THR B CB  1 
ATOM   4590  O OG1 . THR B 1 61  ? 20.497  -1.640  86.328  1.00 15.98  ? 81   THR B OG1 1 
ATOM   4591  C CG2 . THR B 1 61  ? 19.239  -3.009  87.859  1.00 16.58  ? 81   THR B CG2 1 
ATOM   4592  N N   . SER B 1 62  ? 19.015  1.878   87.450  1.00 18.75  ? 82   SER B N   1 
ATOM   4593  C CA  . SER B 1 62  ? 19.625  3.188   87.679  1.00 18.92  ? 82   SER B CA  1 
ATOM   4594  C C   . SER B 1 62  ? 18.553  4.238   87.875  1.00 18.16  ? 82   SER B C   1 
ATOM   4595  O O   . SER B 1 62  ? 17.678  4.411   87.025  1.00 19.63  ? 82   SER B O   1 
ATOM   4596  C CB  . SER B 1 62  ? 20.511  3.609   86.501  1.00 18.98  ? 82   SER B CB  1 
ATOM   4597  O OG  . SER B 1 62  ? 21.732  2.891   86.480  1.00 23.51  ? 82   SER B OG  1 
ATOM   4598  N N   . TYR B 1 63  ? 18.619  4.939   88.996  1.00 16.17  ? 83   TYR B N   1 
ATOM   4599  C CA  . TYR B 1 63  ? 17.655  5.983   89.262  1.00 14.42  ? 83   TYR B CA  1 
ATOM   4600  C C   . TYR B 1 63  ? 17.565  6.866   88.037  1.00 13.13  ? 83   TYR B C   1 
ATOM   4601  O O   . TYR B 1 63  ? 18.583  7.291   87.497  1.00 13.79  ? 83   TYR B O   1 
ATOM   4602  C CB  . TYR B 1 63  ? 18.093  6.794   90.469  1.00 15.14  ? 83   TYR B CB  1 
ATOM   4603  C CG  . TYR B 1 63  ? 17.954  6.007   91.734  1.00 19.45  ? 83   TYR B CG  1 
ATOM   4604  C CD1 . TYR B 1 63  ? 16.697  5.603   92.177  1.00 21.84  ? 83   TYR B CD1 1 
ATOM   4605  C CD2 . TYR B 1 63  ? 19.070  5.618   92.465  1.00 20.17  ? 83   TYR B CD2 1 
ATOM   4606  C CE1 . TYR B 1 63  ? 16.550  4.824   93.321  1.00 24.38  ? 83   TYR B CE1 1 
ATOM   4607  C CE2 . TYR B 1 63  ? 18.938  4.840   93.610  1.00 23.57  ? 83   TYR B CE2 1 
ATOM   4608  C CZ  . TYR B 1 63  ? 17.672  4.445   94.034  1.00 24.58  ? 83   TYR B CZ  1 
ATOM   4609  O OH  . TYR B 1 63  ? 17.522  3.672   95.169  1.00 26.56  ? 83   TYR B OH  1 
ATOM   4610  N N   . PRO B 1 64  ? 16.340  7.124   87.558  1.00 12.13  ? 84   PRO B N   1 
ATOM   4611  C CA  . PRO B 1 64  ? 16.130  7.965   86.382  1.00 11.76  ? 84   PRO B CA  1 
ATOM   4612  C C   . PRO B 1 64  ? 16.233  9.436   86.733  1.00 11.86  ? 84   PRO B C   1 
ATOM   4613  O O   . PRO B 1 64  ? 16.150  9.818   87.907  1.00 12.21  ? 84   PRO B O   1 
ATOM   4614  C CB  . PRO B 1 64  ? 14.721  7.593   85.949  1.00 12.16  ? 84   PRO B CB  1 
ATOM   4615  C CG  . PRO B 1 64  ? 14.048  7.375   87.262  1.00 12.08  ? 84   PRO B CG  1 
ATOM   4616  C CD  . PRO B 1 64  ? 15.065  6.539   88.008  1.00 11.45  ? 84   PRO B CD  1 
ATOM   4617  N N   . PRO B 1 65  ? 16.409  10.285  85.711  1.00 11.05  ? 85   PRO B N   1 
ATOM   4618  C CA  . PRO B 1 65  ? 16.522  11.734  85.889  1.00 10.55  ? 85   PRO B CA  1 
ATOM   4619  C C   . PRO B 1 65  ? 15.211  12.287  86.424  1.00 11.22  ? 85   PRO B C   1 
ATOM   4620  O O   . PRO B 1 65  ? 14.153  11.683  86.218  1.00 11.35  ? 85   PRO B O   1 
ATOM   4621  C CB  . PRO B 1 65  ? 16.783  12.240  84.470  1.00 7.46   ? 85   PRO B CB  1 
ATOM   4622  C CG  . PRO B 1 65  ? 17.400  11.075  83.786  1.00 8.86   ? 85   PRO B CG  1 
ATOM   4623  C CD  . PRO B 1 65  ? 16.608  9.915   84.302  1.00 10.02  ? 85   PRO B CD  1 
ATOM   4624  N N   . MET B 1 66  ? 15.279  13.418  87.118  1.00 11.33  ? 86   MET B N   1 
ATOM   4625  C CA  . MET B 1 66  ? 14.072  14.067  87.605  1.00 11.94  ? 86   MET B CA  1 
ATOM   4626  C C   . MET B 1 66  ? 13.802  15.170  86.579  1.00 12.55  ? 86   MET B C   1 
ATOM   4627  O O   . MET B 1 66  ? 14.733  15.839  86.132  1.00 12.18  ? 86   MET B O   1 
ATOM   4628  C CB  . MET B 1 66  ? 14.295  14.665  88.987  1.00 12.71  ? 86   MET B CB  1 
ATOM   4629  C CG  . MET B 1 66  ? 15.258  15.830  89.039  1.00 15.35  ? 86   MET B CG  1 
ATOM   4630  S SD  . MET B 1 66  ? 15.590  16.299  90.752  1.00 18.96  ? 86   MET B SD  1 
ATOM   4631  C CE  . MET B 1 66  ? 16.790  17.590  90.522  1.00 19.58  ? 86   MET B CE  1 
ATOM   4632  N N   . CYS B 1 67  ? 12.543  15.340  86.183  1.00 13.75  ? 87   CYS B N   1 
ATOM   4633  C CA  . CYS B 1 67  ? 12.185  16.349  85.187  1.00 14.10  ? 87   CYS B CA  1 
ATOM   4634  C C   . CYS B 1 67  ? 12.839  17.699  85.452  1.00 13.11  ? 87   CYS B C   1 
ATOM   4635  O O   . CYS B 1 67  ? 13.025  18.094  86.600  1.00 14.20  ? 87   CYS B O   1 
ATOM   4636  C CB  . CYS B 1 67  ? 10.668  16.510  85.133  1.00 16.32  ? 87   CYS B CB  1 
ATOM   4637  S SG  . CYS B 1 67  ? 9.769   14.990  84.672  1.00 19.74  ? 87   CYS B SG  1 
ATOM   4638  N N   . THR B 1 68  ? 13.179  18.411  84.384  1.00 13.34  ? 88   THR B N   1 
ATOM   4639  C CA  . THR B 1 68  ? 13.833  19.712  84.510  1.00 13.00  ? 88   THR B CA  1 
ATOM   4640  C C   . THR B 1 68  ? 13.095  20.602  85.493  1.00 13.16  ? 88   THR B C   1 
ATOM   4641  O O   . THR B 1 68  ? 11.894  20.812  85.381  1.00 13.40  ? 88   THR B O   1 
ATOM   4642  C CB  . THR B 1 68  ? 13.927  20.437  83.151  1.00 13.16  ? 88   THR B CB  1 
ATOM   4643  O OG1 . THR B 1 68  ? 14.012  19.471  82.095  1.00 12.92  ? 88   THR B OG1 1 
ATOM   4644  C CG2 . THR B 1 68  ? 15.176  21.311  83.107  1.00 10.91  ? 88   THR B CG2 1 
ATOM   4645  N N   . GLN B 1 69  ? 13.834  21.118  86.462  1.00 15.06  ? 89   GLN B N   1 
ATOM   4646  C CA  . GLN B 1 69  ? 13.286  21.980  87.502  1.00 17.15  ? 89   GLN B CA  1 
ATOM   4647  C C   . GLN B 1 69  ? 14.460  22.768  88.062  1.00 19.23  ? 89   GLN B C   1 
ATOM   4648  O O   . GLN B 1 69  ? 15.582  22.650  87.563  1.00 20.92  ? 89   GLN B O   1 
ATOM   4649  C CB  . GLN B 1 69  ? 12.684  21.118  88.606  1.00 15.24  ? 89   GLN B CB  1 
ATOM   4650  C CG  . GLN B 1 69  ? 13.642  20.028  89.030  1.00 16.79  ? 89   GLN B CG  1 
ATOM   4651  C CD  . GLN B 1 69  ? 13.053  19.049  90.019  1.00 17.52  ? 89   GLN B CD  1 
ATOM   4652  O OE1 . GLN B 1 69  ? 12.970  19.324  91.215  1.00 16.47  ? 89   GLN B OE1 1 
ATOM   4653  N NE2 . GLN B 1 69  ? 12.639  17.890  89.521  1.00 18.17  ? 89   GLN B NE2 1 
ATOM   4654  N N   . ASP B 1 70  ? 14.212  23.583  89.081  1.00 20.32  ? 90   ASP B N   1 
ATOM   4655  C CA  . ASP B 1 70  ? 15.296  24.334  89.699  1.00 20.48  ? 90   ASP B CA  1 
ATOM   4656  C C   . ASP B 1 70  ? 16.094  23.265  90.432  1.00 20.08  ? 90   ASP B C   1 
ATOM   4657  O O   . ASP B 1 70  ? 15.631  22.723  91.428  1.00 19.90  ? 90   ASP B O   1 
ATOM   4658  C CB  . ASP B 1 70  ? 14.747  25.330  90.704  1.00 23.24  ? 90   ASP B CB  1 
ATOM   4659  C CG  . ASP B 1 70  ? 15.832  26.144  91.354  1.00 25.62  ? 90   ASP B CG  1 
ATOM   4660  O OD1 . ASP B 1 70  ? 16.915  25.578  91.617  1.00 24.47  ? 90   ASP B OD1 1 
ATOM   4661  O OD2 . ASP B 1 70  ? 15.595  27.345  91.606  1.00 28.50  ? 90   ASP B OD2 1 
ATOM   4662  N N   . PRO B 1 71  ? 17.304  22.950  89.949  1.00 19.68  ? 91   PRO B N   1 
ATOM   4663  C CA  . PRO B 1 71  ? 18.179  21.932  90.541  1.00 19.83  ? 91   PRO B CA  1 
ATOM   4664  C C   . PRO B 1 71  ? 18.488  22.170  92.013  1.00 21.66  ? 91   PRO B C   1 
ATOM   4665  O O   . PRO B 1 71  ? 18.548  21.231  92.819  1.00 21.63  ? 91   PRO B O   1 
ATOM   4666  C CB  . PRO B 1 71  ? 19.419  22.011  89.670  1.00 18.46  ? 91   PRO B CB  1 
ATOM   4667  C CG  . PRO B 1 71  ? 19.482  23.455  89.346  1.00 17.89  ? 91   PRO B CG  1 
ATOM   4668  C CD  . PRO B 1 71  ? 18.053  23.778  88.991  1.00 19.00  ? 91   PRO B CD  1 
ATOM   4669  N N   . LYS B 1 72  ? 18.693  23.436  92.349  1.00 23.22  ? 92   LYS B N   1 
ATOM   4670  C CA  . LYS B 1 72  ? 18.985  23.845  93.712  1.00 24.60  ? 92   LYS B CA  1 
ATOM   4671  C C   . LYS B 1 72  ? 17.735  23.545  94.557  1.00 25.02  ? 92   LYS B C   1 
ATOM   4672  O O   . LYS B 1 72  ? 17.782  22.760  95.512  1.00 24.08  ? 92   LYS B O   1 
ATOM   4673  C CB  . LYS B 1 72  ? 19.310  25.340  93.712  1.00 26.16  ? 92   LYS B CB  1 
ATOM   4674  C CG  . LYS B 1 72  ? 20.062  25.844  94.922  1.00 31.02  ? 92   LYS B CG  1 
ATOM   4675  C CD  . LYS B 1 72  ? 20.795  27.150  94.603  1.00 34.25  ? 92   LYS B CD  1 
ATOM   4676  C CE  . LYS B 1 72  ? 21.914  26.936  93.572  1.00 35.27  ? 92   LYS B CE  1 
ATOM   4677  N NZ  . LYS B 1 72  ? 22.601  28.212  93.176  1.00 35.85  ? 92   LYS B NZ  1 
ATOM   4678  N N   . ALA B 1 73  ? 16.618  24.163  94.179  1.00 24.63  ? 93   ALA B N   1 
ATOM   4679  C CA  . ALA B 1 73  ? 15.347  23.977  94.865  1.00 23.90  ? 93   ALA B CA  1 
ATOM   4680  C C   . ALA B 1 73  ? 14.954  22.499  94.873  1.00 24.25  ? 93   ALA B C   1 
ATOM   4681  O O   . ALA B 1 73  ? 14.486  21.967  95.881  1.00 24.99  ? 93   ALA B O   1 
ATOM   4682  C CB  . ALA B 1 73  ? 14.269  24.798  94.174  1.00 23.19  ? 93   ALA B CB  1 
ATOM   4683  N N   . GLY B 1 74  ? 15.142  21.843  93.735  1.00 24.37  ? 94   GLY B N   1 
ATOM   4684  C CA  . GLY B 1 74  ? 14.811  20.438  93.623  1.00 23.28  ? 94   GLY B CA  1 
ATOM   4685  C C   . GLY B 1 74  ? 15.568  19.575  94.612  1.00 23.06  ? 94   GLY B C   1 
ATOM   4686  O O   . GLY B 1 74  ? 14.948  18.878  95.414  1.00 22.38  ? 94   GLY B O   1 
ATOM   4687  N N   . GLN B 1 75  ? 16.900  19.619  94.569  1.00 23.06  ? 95   GLN B N   1 
ATOM   4688  C CA  . GLN B 1 75  ? 17.698  18.811  95.482  1.00 23.79  ? 95   GLN B CA  1 
ATOM   4689  C C   . GLN B 1 75  ? 17.352  19.039  96.950  1.00 23.13  ? 95   GLN B C   1 
ATOM   4690  O O   . GLN B 1 75  ? 17.385  18.110  97.752  1.00 23.73  ? 95   GLN B O   1 
ATOM   4691  C CB  . GLN B 1 75  ? 19.194  19.063  95.307  1.00 24.68  ? 95   GLN B CB  1 
ATOM   4692  C CG  . GLN B 1 75  ? 19.996  18.154  96.235  1.00 29.91  ? 95   GLN B CG  1 
ATOM   4693  C CD  . GLN B 1 75  ? 21.439  18.577  96.436  1.00 33.60  ? 95   GLN B CD  1 
ATOM   4694  O OE1 . GLN B 1 75  ? 22.295  18.361  95.572  1.00 36.46  ? 95   GLN B OE1 1 
ATOM   4695  N NE2 . GLN B 1 75  ? 21.720  19.183  97.592  1.00 33.36  ? 95   GLN B NE2 1 
ATOM   4696  N N   . LEU B 1 76  ? 17.022  20.273  97.307  1.00 22.39  ? 96   LEU B N   1 
ATOM   4697  C CA  . LEU B 1 76  ? 16.683  20.587  98.692  1.00 21.97  ? 96   LEU B CA  1 
ATOM   4698  C C   . LEU B 1 76  ? 15.446  19.854  99.200  1.00 21.25  ? 96   LEU B C   1 
ATOM   4699  O O   . LEU B 1 76  ? 15.478  19.228  100.259 1.00 19.93  ? 96   LEU B O   1 
ATOM   4700  C CB  . LEU B 1 76  ? 16.462  22.088  98.860  1.00 22.07  ? 96   LEU B CB  1 
ATOM   4701  C CG  . LEU B 1 76  ? 16.212  22.496  100.308 1.00 20.24  ? 96   LEU B CG  1 
ATOM   4702  C CD1 . LEU B 1 76  ? 17.464  22.228  101.128 1.00 18.65  ? 96   LEU B CD1 1 
ATOM   4703  C CD2 . LEU B 1 76  ? 15.837  23.953  100.362 1.00 21.15  ? 96   LEU B CD2 1 
ATOM   4704  N N   . LEU B 1 77  ? 14.350  19.959  98.454  1.00 20.50  ? 97   LEU B N   1 
ATOM   4705  C CA  . LEU B 1 77  ? 13.115  19.299  98.840  1.00 20.96  ? 97   LEU B CA  1 
ATOM   4706  C C   . LEU B 1 77  ? 13.336  17.789  98.891  1.00 22.00  ? 97   LEU B C   1 
ATOM   4707  O O   . LEU B 1 77  ? 12.758  17.096  99.736  1.00 22.38  ? 97   LEU B O   1 
ATOM   4708  C CB  . LEU B 1 77  ? 12.003  19.636  97.847  1.00 19.73  ? 97   LEU B CB  1 
ATOM   4709  C CG  . LEU B 1 77  ? 10.591  19.142  98.170  1.00 17.90  ? 97   LEU B CG  1 
ATOM   4710  C CD1 . LEU B 1 77  ? 10.173  19.611  99.551  1.00 18.63  ? 97   LEU B CD1 1 
ATOM   4711  C CD2 . LEU B 1 77  ? 9.634   19.663  97.124  1.00 18.43  ? 97   LEU B CD2 1 
ATOM   4712  N N   . SER B 1 78  ? 14.176  17.280  97.990  1.00 22.03  ? 98   SER B N   1 
ATOM   4713  C CA  . SER B 1 78  ? 14.474  15.853  97.958  1.00 21.25  ? 98   SER B CA  1 
ATOM   4714  C C   . SER B 1 78  ? 15.095  15.453  99.286  1.00 22.50  ? 98   SER B C   1 
ATOM   4715  O O   . SER B 1 78  ? 14.740  14.431  99.867  1.00 22.70  ? 98   SER B O   1 
ATOM   4716  C CB  . SER B 1 78  ? 15.444  15.531  96.827  1.00 19.27  ? 98   SER B CB  1 
ATOM   4717  O OG  . SER B 1 78  ? 15.776  14.155  96.840  1.00 18.24  ? 98   SER B OG  1 
ATOM   4718  N N   . GLU B 1 79  ? 16.021  16.277  99.765  1.00 24.38  ? 99   GLU B N   1 
ATOM   4719  C CA  . GLU B 1 79  ? 16.697  16.018  101.033 1.00 25.70  ? 99   GLU B CA  1 
ATOM   4720  C C   . GLU B 1 79  ? 15.713  16.057  102.204 1.00 25.26  ? 99   GLU B C   1 
ATOM   4721  O O   . GLU B 1 79  ? 15.627  15.104  102.976 1.00 26.11  ? 99   GLU B O   1 
ATOM   4722  C CB  . GLU B 1 79  ? 17.811  17.048  101.261 1.00 27.18  ? 99   GLU B CB  1 
ATOM   4723  C CG  . GLU B 1 79  ? 18.767  17.187  100.085 1.00 30.85  ? 99   GLU B CG  1 
ATOM   4724  C CD  . GLU B 1 79  ? 19.888  18.190  100.325 1.00 32.66  ? 99   GLU B CD  1 
ATOM   4725  O OE1 . GLU B 1 79  ? 19.598  19.311  100.805 1.00 34.40  ? 99   GLU B OE1 1 
ATOM   4726  O OE2 . GLU B 1 79  ? 21.056  17.860  100.016 1.00 31.28  ? 99   GLU B OE2 1 
ATOM   4727  N N   . LEU B 1 80  ? 14.970  17.155  102.327 1.00 24.00  ? 100  LEU B N   1 
ATOM   4728  C CA  . LEU B 1 80  ? 14.005  17.317  103.411 1.00 22.36  ? 100  LEU B CA  1 
ATOM   4729  C C   . LEU B 1 80  ? 12.928  16.226  103.457 1.00 22.66  ? 100  LEU B C   1 
ATOM   4730  O O   . LEU B 1 80  ? 12.579  15.743  104.535 1.00 23.67  ? 100  LEU B O   1 
ATOM   4731  C CB  . LEU B 1 80  ? 13.335  18.691  103.314 1.00 20.63  ? 100  LEU B CB  1 
ATOM   4732  C CG  . LEU B 1 80  ? 14.235  19.926  103.413 1.00 19.92  ? 100  LEU B CG  1 
ATOM   4733  C CD1 . LEU B 1 80  ? 13.452  21.155  103.011 1.00 19.94  ? 100  LEU B CD1 1 
ATOM   4734  C CD2 . LEU B 1 80  ? 14.767  20.083  104.820 1.00 18.80  ? 100  LEU B CD2 1 
ATOM   4735  N N   . PHE B 1 81  ? 12.411  15.831  102.296 1.00 21.65  ? 101  PHE B N   1 
ATOM   4736  C CA  . PHE B 1 81  ? 11.364  14.814  102.234 1.00 20.79  ? 101  PHE B CA  1 
ATOM   4737  C C   . PHE B 1 81  ? 11.846  13.364  102.132 1.00 19.01  ? 101  PHE B C   1 
ATOM   4738  O O   . PHE B 1 81  ? 11.118  12.452  102.510 1.00 19.56  ? 101  PHE B O   1 
ATOM   4739  C CB  . PHE B 1 81  ? 10.423  15.075  101.041 1.00 24.18  ? 101  PHE B CB  1 
ATOM   4740  C CG  . PHE B 1 81  ? 9.403   16.179  101.258 1.00 25.29  ? 101  PHE B CG  1 
ATOM   4741  C CD1 . PHE B 1 81  ? 9.346   16.894  102.450 1.00 25.39  ? 101  PHE B CD1 1 
ATOM   4742  C CD2 . PHE B 1 81  ? 8.481   16.485  100.250 1.00 24.45  ? 101  PHE B CD2 1 
ATOM   4743  C CE1 . PHE B 1 81  ? 8.386   17.892  102.634 1.00 24.70  ? 101  PHE B CE1 1 
ATOM   4744  C CE2 . PHE B 1 81  ? 7.524   17.476  100.424 1.00 23.75  ? 101  PHE B CE2 1 
ATOM   4745  C CZ  . PHE B 1 81  ? 7.474   18.182  101.619 1.00 24.52  ? 101  PHE B CZ  1 
ATOM   4746  N N   . THR B 1 82  ? 13.047  13.124  101.622 1.00 17.07  ? 102  THR B N   1 
ATOM   4747  C CA  . THR B 1 82  ? 13.482  11.739  101.478 1.00 17.29  ? 102  THR B CA  1 
ATOM   4748  C C   . THR B 1 82  ? 13.314  10.933  102.751 1.00 18.60  ? 102  THR B C   1 
ATOM   4749  O O   . THR B 1 82  ? 13.276  11.483  103.842 1.00 19.96  ? 102  THR B O   1 
ATOM   4750  C CB  . THR B 1 82  ? 14.941  11.625  101.022 1.00 16.37  ? 102  THR B CB  1 
ATOM   4751  O OG1 . THR B 1 82  ? 15.301  10.243  100.947 1.00 13.91  ? 102  THR B OG1 1 
ATOM   4752  C CG2 . THR B 1 82  ? 15.860  12.315  101.989 1.00 17.51  ? 102  THR B CG2 1 
ATOM   4753  N N   . ASN B 1 83  ? 13.208  9.619   102.609 1.00 19.97  ? 103  ASN B N   1 
ATOM   4754  C CA  . ASN B 1 83  ? 13.036  8.755   103.763 1.00 21.35  ? 103  ASN B CA  1 
ATOM   4755  C C   . ASN B 1 83  ? 14.190  7.772   103.858 1.00 23.39  ? 103  ASN B C   1 
ATOM   4756  O O   . ASN B 1 83  ? 14.269  6.983   104.792 1.00 23.26  ? 103  ASN B O   1 
ATOM   4757  C CB  . ASN B 1 83  ? 11.706  8.002   103.655 1.00 20.67  ? 103  ASN B CB  1 
ATOM   4758  C CG  . ASN B 1 83  ? 11.753  6.858   102.650 1.00 19.59  ? 103  ASN B CG  1 
ATOM   4759  O OD1 . ASN B 1 83  ? 12.213  7.016   101.517 1.00 16.17  ? 103  ASN B OD1 1 
ATOM   4760  N ND2 . ASN B 1 83  ? 11.260  5.696   103.065 1.00 19.58  ? 103  ASN B ND2 1 
ATOM   4761  N N   . ARG B 1 84  ? 15.085  7.817   102.881 1.00 27.01  ? 104  ARG B N   1 
ATOM   4762  C CA  . ARG B 1 84  ? 16.229  6.921   102.881 1.00 31.09  ? 104  ARG B CA  1 
ATOM   4763  C C   . ARG B 1 84  ? 17.386  7.541   103.675 1.00 34.50  ? 104  ARG B C   1 
ATOM   4764  O O   . ARG B 1 84  ? 17.428  8.756   103.888 1.00 35.05  ? 104  ARG B O   1 
ATOM   4765  C CB  . ARG B 1 84  ? 16.660  6.609   101.439 1.00 29.06  ? 104  ARG B CB  1 
ATOM   4766  C CG  . ARG B 1 84  ? 17.012  7.830   100.633 1.00 30.49  ? 104  ARG B CG  1 
ATOM   4767  C CD  . ARG B 1 84  ? 17.612  7.500   99.268  1.00 32.01  ? 104  ARG B CD  1 
ATOM   4768  N NE  . ARG B 1 84  ? 16.626  7.254   98.214  1.00 31.72  ? 104  ARG B NE  1 
ATOM   4769  C CZ  . ARG B 1 84  ? 16.122  6.061   97.917  1.00 31.92  ? 104  ARG B CZ  1 
ATOM   4770  N NH1 . ARG B 1 84  ? 16.505  4.989   98.598  1.00 32.54  ? 104  ARG B NH1 1 
ATOM   4771  N NH2 . ARG B 1 84  ? 15.248  5.938   96.927  1.00 30.83  ? 104  ARG B NH2 1 
ATOM   4772  N N   . LYS B 1 85  ? 18.303  6.688   104.130 1.00 37.75  ? 105  LYS B N   1 
ATOM   4773  C CA  . LYS B 1 85  ? 19.484  7.089   104.904 1.00 40.55  ? 105  LYS B CA  1 
ATOM   4774  C C   . LYS B 1 85  ? 20.213  8.272   104.284 1.00 40.38  ? 105  LYS B C   1 
ATOM   4775  O O   . LYS B 1 85  ? 20.310  9.353   104.858 1.00 40.23  ? 105  LYS B O   1 
ATOM   4776  C CB  . LYS B 1 85  ? 20.459  5.914   104.978 1.00 43.53  ? 105  LYS B CB  1 
ATOM   4777  C CG  . LYS B 1 85  ? 20.620  5.219   103.620 1.00 48.76  ? 105  LYS B CG  1 
ATOM   4778  C CD  . LYS B 1 85  ? 21.749  4.192   103.566 1.00 52.11  ? 105  LYS B CD  1 
ATOM   4779  C CE  . LYS B 1 85  ? 23.104  4.857   103.367 1.00 53.62  ? 105  LYS B CE  1 
ATOM   4780  N NZ  . LYS B 1 85  ? 24.138  3.872   102.928 1.00 55.72  ? 105  LYS B NZ  1 
ATOM   4781  N N   . GLU B 1 86  ? 20.737  8.023   103.098 1.00 41.08  ? 106  GLU B N   1 
ATOM   4782  C CA  . GLU B 1 86  ? 21.486  8.995   102.336 1.00 42.27  ? 106  GLU B CA  1 
ATOM   4783  C C   . GLU B 1 86  ? 20.591  9.512   101.229 1.00 39.78  ? 106  GLU B C   1 
ATOM   4784  O O   . GLU B 1 86  ? 19.854  8.735   100.622 1.00 38.27  ? 106  GLU B O   1 
ATOM   4785  C CB  . GLU B 1 86  ? 22.683  8.295   101.711 1.00 48.23  ? 106  GLU B CB  1 
ATOM   4786  C CG  . GLU B 1 86  ? 22.284  6.955   101.076 1.00 55.37  ? 106  GLU B CG  1 
ATOM   4787  C CD  . GLU B 1 86  ? 23.243  6.494   99.989  1.00 60.82  ? 106  GLU B CD  1 
ATOM   4788  O OE1 . GLU B 1 86  ? 23.225  7.093   98.886  1.00 63.33  ? 106  GLU B OE1 1 
ATOM   4789  O OE2 . GLU B 1 86  ? 24.015  5.537   100.237 1.00 63.49  ? 106  GLU B OE2 1 
ATOM   4790  N N   . ASN B 1 87  ? 20.653  10.809  100.952 1.00 37.74  ? 107  ASN B N   1 
ATOM   4791  C CA  . ASN B 1 87  ? 19.833  11.343  99.881  1.00 36.59  ? 107  ASN B CA  1 
ATOM   4792  C C   . ASN B 1 87  ? 20.516  11.030  98.562  1.00 34.85  ? 107  ASN B C   1 
ATOM   4793  O O   . ASN B 1 87  ? 21.741  11.057  98.479  1.00 33.50  ? 107  ASN B O   1 
ATOM   4794  C CB  . ASN B 1 87  ? 19.648  12.851  100.007 1.00 36.91  ? 107  ASN B CB  1 
ATOM   4795  C CG  . ASN B 1 87  ? 18.561  13.370  99.078  1.00 37.86  ? 107  ASN B CG  1 
ATOM   4796  O OD1 . ASN B 1 87  ? 18.407  14.572  98.888  1.00 38.76  ? 107  ASN B OD1 1 
ATOM   4797  N ND2 . ASN B 1 87  ? 17.794  12.452  98.500  1.00 37.78  ? 107  ASN B ND2 1 
ATOM   4798  N N   . ILE B 1 88  ? 19.720  10.727  97.540  1.00 33.66  ? 108  ILE B N   1 
ATOM   4799  C CA  . ILE B 1 88  ? 20.252  10.401  96.221  1.00 32.32  ? 108  ILE B CA  1 
ATOM   4800  C C   . ILE B 1 88  ? 20.214  11.590  95.275  1.00 31.06  ? 108  ILE B C   1 
ATOM   4801  O O   . ILE B 1 88  ? 19.146  12.052  94.881  1.00 31.45  ? 108  ILE B O   1 
ATOM   4802  C CB  . ILE B 1 88  ? 19.469  9.255   95.551  1.00 32.73  ? 108  ILE B CB  1 
ATOM   4803  C CG1 . ILE B 1 88  ? 19.492  8.014   96.435  1.00 32.80  ? 108  ILE B CG1 1 
ATOM   4804  C CG2 . ILE B 1 88  ? 20.081  8.934   94.201  1.00 32.84  ? 108  ILE B CG2 1 
ATOM   4805  C CD1 . ILE B 1 88  ? 20.881  7.580   96.818  1.00 35.45  ? 108  ILE B CD1 1 
ATOM   4806  N N   . PRO B 1 89  ? 21.390  12.088  94.878  1.00 29.61  ? 109  PRO B N   1 
ATOM   4807  C CA  . PRO B 1 89  ? 21.444  13.230  93.968  1.00 27.84  ? 109  PRO B CA  1 
ATOM   4808  C C   . PRO B 1 89  ? 20.887  12.816  92.611  1.00 26.00  ? 109  PRO B C   1 
ATOM   4809  O O   . PRO B 1 89  ? 21.054  11.678  92.176  1.00 25.68  ? 109  PRO B O   1 
ATOM   4810  C CB  . PRO B 1 89  ? 22.927  13.549  93.924  1.00 27.93  ? 109  PRO B CB  1 
ATOM   4811  C CG  . PRO B 1 89  ? 23.528  12.173  93.976  1.00 29.63  ? 109  PRO B CG  1 
ATOM   4812  C CD  . PRO B 1 89  ? 22.728  11.499  95.063  1.00 28.87  ? 109  PRO B CD  1 
ATOM   4813  N N   . LEU B 1 90  ? 20.223  13.741  91.938  1.00 24.59  ? 110  LEU B N   1 
ATOM   4814  C CA  . LEU B 1 90  ? 19.636  13.418  90.655  1.00 22.72  ? 110  LEU B CA  1 
ATOM   4815  C C   . LEU B 1 90  ? 19.965  14.407  89.553  1.00 21.88  ? 110  LEU B C   1 
ATOM   4816  O O   . LEU B 1 90  ? 20.259  15.579  89.806  1.00 21.11  ? 110  LEU B O   1 
ATOM   4817  C CB  . LEU B 1 90  ? 18.120  13.308  90.803  1.00 20.88  ? 110  LEU B CB  1 
ATOM   4818  C CG  . LEU B 1 90  ? 17.625  12.257  91.795  1.00 19.47  ? 110  LEU B CG  1 
ATOM   4819  C CD1 . LEU B 1 90  ? 16.117  12.381  91.909  1.00 20.08  ? 110  LEU B CD1 1 
ATOM   4820  C CD2 . LEU B 1 90  ? 18.030  10.860  91.351  1.00 15.90  ? 110  LEU B CD2 1 
ATOM   4821  N N   . LYS B 1 91  ? 19.901  13.911  88.323  1.00 20.95  ? 111  LYS B N   1 
ATOM   4822  C CA  . LYS B 1 91  ? 20.173  14.715  87.147  1.00 20.71  ? 111  LYS B CA  1 
ATOM   4823  C C   . LYS B 1 91  ? 18.863  15.230  86.541  1.00 18.65  ? 111  LYS B C   1 
ATOM   4824  O O   . LYS B 1 91  ? 17.802  14.642  86.753  1.00 17.75  ? 111  LYS B O   1 
ATOM   4825  C CB  . LYS B 1 91  ? 20.948  13.879  86.131  1.00 22.68  ? 111  LYS B CB  1 
ATOM   4826  C CG  . LYS B 1 91  ? 22.273  13.377  86.671  1.00 25.95  ? 111  LYS B CG  1 
ATOM   4827  C CD  . LYS B 1 91  ? 23.156  12.776  85.588  1.00 31.19  ? 111  LYS B CD  1 
ATOM   4828  C CE  . LYS B 1 91  ? 24.602  12.639  86.082  1.00 34.71  ? 111  LYS B CE  1 
ATOM   4829  N NZ  . LYS B 1 91  ? 25.547  12.074  85.063  1.00 36.32  ? 111  LYS B NZ  1 
ATOM   4830  N N   . LEU B 1 92  ? 18.942  16.337  85.808  1.00 16.19  ? 112  LEU B N   1 
ATOM   4831  C CA  . LEU B 1 92  ? 17.765  16.917  85.175  1.00 13.72  ? 112  LEU B CA  1 
ATOM   4832  C C   . LEU B 1 92  ? 17.660  16.416  83.758  1.00 13.30  ? 112  LEU B C   1 
ATOM   4833  O O   . LEU B 1 92  ? 18.657  16.009  83.161  1.00 14.69  ? 112  LEU B O   1 
ATOM   4834  C CB  . LEU B 1 92  ? 17.860  18.436  85.103  1.00 12.68  ? 112  LEU B CB  1 
ATOM   4835  C CG  . LEU B 1 92  ? 18.012  19.289  86.351  1.00 14.23  ? 112  LEU B CG  1 
ATOM   4836  C CD1 . LEU B 1 92  ? 17.863  20.746  85.939  1.00 14.67  ? 112  LEU B CD1 1 
ATOM   4837  C CD2 . LEU B 1 92  ? 16.961  18.924  87.386  1.00 16.27  ? 112  LEU B CD2 1 
ATOM   4838  N N   . SER B 1 93  ? 16.453  16.461  83.217  1.00 11.75  ? 113  SER B N   1 
ATOM   4839  C CA  . SER B 1 93  ? 16.231  16.050  81.847  1.00 12.12  ? 113  SER B CA  1 
ATOM   4840  C C   . SER B 1 93  ? 14.769  16.079  81.486  1.00 11.89  ? 113  SER B C   1 
ATOM   4841  O O   . SER B 1 93  ? 13.904  15.824  82.320  1.00 12.87  ? 113  SER B O   1 
ATOM   4842  C CB  . SER B 1 93  ? 16.766  14.645  81.601  1.00 12.86  ? 113  SER B CB  1 
ATOM   4843  O OG  . SER B 1 93  ? 16.661  14.312  80.225  1.00 14.65  ? 113  SER B OG  1 
ATOM   4844  N N   . GLU B 1 94  ? 14.498  16.410  80.232  1.00 12.49  ? 114  GLU B N   1 
ATOM   4845  C CA  . GLU B 1 94  ? 13.136  16.433  79.733  1.00 11.68  ? 114  GLU B CA  1 
ATOM   4846  C C   . GLU B 1 94  ? 12.729  14.971  79.644  1.00 10.90  ? 114  GLU B C   1 
ATOM   4847  O O   . GLU B 1 94  ? 11.544  14.638  79.706  1.00 11.54  ? 114  GLU B O   1 
ATOM   4848  C CB  . GLU B 1 94  ? 13.090  17.094  78.352  1.00 12.80  ? 114  GLU B CB  1 
ATOM   4849  C CG  . GLU B 1 94  ? 13.093  18.615  78.394  1.00 15.39  ? 114  GLU B CG  1 
ATOM   4850  C CD  . GLU B 1 94  ? 13.166  19.259  77.017  1.00 17.85  ? 114  GLU B CD  1 
ATOM   4851  O OE1 . GLU B 1 94  ? 12.508  18.762  76.066  1.00 20.25  ? 114  GLU B OE1 1 
ATOM   4852  O OE2 . GLU B 1 94  ? 13.874  20.282  76.894  1.00 17.79  ? 114  GLU B OE2 1 
ATOM   4853  N N   . ASP B 1 95  ? 13.741  14.113  79.509  1.00 10.29  ? 115  ASP B N   1 
ATOM   4854  C CA  . ASP B 1 95  ? 13.586  12.660  79.422  1.00 10.17  ? 115  ASP B CA  1 
ATOM   4855  C C   . ASP B 1 95  ? 13.485  12.173  80.853  1.00 9.52   ? 115  ASP B C   1 
ATOM   4856  O O   . ASP B 1 95  ? 14.477  11.748  81.438  1.00 9.12   ? 115  ASP B O   1 
ATOM   4857  C CB  . ASP B 1 95  ? 14.816  12.057  78.723  1.00 10.11  ? 115  ASP B CB  1 
ATOM   4858  C CG  . ASP B 1 95  ? 14.775  10.540  78.639  1.00 8.36   ? 115  ASP B CG  1 
ATOM   4859  O OD1 . ASP B 1 95  ? 13.676  9.965   78.533  1.00 8.96   ? 115  ASP B OD1 1 
ATOM   4860  O OD2 . ASP B 1 95  ? 15.855  9.921   78.657  1.00 6.75   ? 115  ASP B OD2 1 
ATOM   4861  N N   . CYS B 1 96  ? 12.271  12.229  81.402  1.00 10.48  ? 116  CYS B N   1 
ATOM   4862  C CA  . CYS B 1 96  ? 12.030  11.868  82.797  1.00 10.30  ? 116  CYS B CA  1 
ATOM   4863  C C   . CYS B 1 96  ? 10.768  11.067  83.083  1.00 7.09   ? 116  CYS B C   1 
ATOM   4864  O O   . CYS B 1 96  ? 10.501  10.734  84.232  1.00 5.35   ? 116  CYS B O   1 
ATOM   4865  C CB  . CYS B 1 96  ? 11.991  13.152  83.629  1.00 12.63  ? 116  CYS B CB  1 
ATOM   4866  S SG  . CYS B 1 96  ? 10.742  14.331  83.012  1.00 16.66  ? 116  CYS B SG  1 
ATOM   4867  N N   . LEU B 1 97  ? 9.985   10.763  82.060  1.00 6.91   ? 117  LEU B N   1 
ATOM   4868  C CA  . LEU B 1 97  ? 8.760   10.013  82.294  1.00 7.85   ? 117  LEU B CA  1 
ATOM   4869  C C   . LEU B 1 97  ? 9.027   8.541   82.630  1.00 8.24   ? 117  LEU B C   1 
ATOM   4870  O O   . LEU B 1 97  ? 8.796   7.646   81.814  1.00 8.78   ? 117  LEU B O   1 
ATOM   4871  C CB  . LEU B 1 97  ? 7.824   10.128  81.086  1.00 7.20   ? 117  LEU B CB  1 
ATOM   4872  C CG  . LEU B 1 97  ? 7.406   11.541  80.652  1.00 8.13   ? 117  LEU B CG  1 
ATOM   4873  C CD1 . LEU B 1 97  ? 6.316   11.428  79.599  1.00 8.70   ? 117  LEU B CD1 1 
ATOM   4874  C CD2 . LEU B 1 97  ? 6.896   12.358  81.838  1.00 9.14   ? 117  LEU B CD2 1 
ATOM   4875  N N   . TYR B 1 98  ? 9.509   8.309   83.847  1.00 8.48   ? 118  TYR B N   1 
ATOM   4876  C CA  . TYR B 1 98  ? 9.816   6.968   84.334  1.00 9.97   ? 118  TYR B CA  1 
ATOM   4877  C C   . TYR B 1 98  ? 9.082   6.684   85.645  1.00 10.08  ? 118  TYR B C   1 
ATOM   4878  O O   . TYR B 1 98  ? 8.494   7.583   86.253  1.00 10.86  ? 118  TYR B O   1 
ATOM   4879  C CB  . TYR B 1 98  ? 11.326  6.811   84.586  1.00 11.38  ? 118  TYR B CB  1 
ATOM   4880  C CG  . TYR B 1 98  ? 12.198  7.008   83.367  1.00 12.91  ? 118  TYR B CG  1 
ATOM   4881  C CD1 . TYR B 1 98  ? 12.594  8.283   82.961  1.00 12.28  ? 118  TYR B CD1 1 
ATOM   4882  C CD2 . TYR B 1 98  ? 12.602  5.915   82.601  1.00 13.42  ? 118  TYR B CD2 1 
ATOM   4883  C CE1 . TYR B 1 98  ? 13.368  8.459   81.820  1.00 14.79  ? 118  TYR B CE1 1 
ATOM   4884  C CE2 . TYR B 1 98  ? 13.372  6.076   81.463  1.00 13.94  ? 118  TYR B CE2 1 
ATOM   4885  C CZ  . TYR B 1 98  ? 13.754  7.346   81.070  1.00 15.69  ? 118  TYR B CZ  1 
ATOM   4886  O OH  . TYR B 1 98  ? 14.496  7.494   79.914  1.00 15.87  ? 118  TYR B OH  1 
ATOM   4887  N N   . LEU B 1 99  ? 9.124   5.426   86.078  1.00 9.85   ? 119  LEU B N   1 
ATOM   4888  C CA  . LEU B 1 99  ? 8.499   5.024   87.332  1.00 9.01   ? 119  LEU B CA  1 
ATOM   4889  C C   . LEU B 1 99  ? 9.334   3.924   87.982  1.00 8.97   ? 119  LEU B C   1 
ATOM   4890  O O   . LEU B 1 99  ? 9.960   3.118   87.293  1.00 7.66   ? 119  LEU B O   1 
ATOM   4891  C CB  . LEU B 1 99  ? 7.051   4.545   87.102  1.00 7.19   ? 119  LEU B CB  1 
ATOM   4892  C CG  . LEU B 1 99  ? 6.694   3.314   86.252  1.00 6.63   ? 119  LEU B CG  1 
ATOM   4893  C CD1 . LEU B 1 99  ? 7.123   2.030   86.937  1.00 5.05   ? 119  LEU B CD1 1 
ATOM   4894  C CD2 . LEU B 1 99  ? 5.186   3.286   86.040  1.00 5.79   ? 119  LEU B CD2 1 
ATOM   4895  N N   . ASN B 1 100 ? 9.362   3.916   89.310  1.00 9.73   ? 120  ASN B N   1 
ATOM   4896  C CA  . ASN B 1 100 ? 10.102  2.902   90.046  1.00 11.00  ? 120  ASN B CA  1 
ATOM   4897  C C   . ASN B 1 100 ? 9.119   1.923   90.670  1.00 11.17  ? 120  ASN B C   1 
ATOM   4898  O O   . ASN B 1 100 ? 8.012   2.307   91.051  1.00 13.41  ? 120  ASN B O   1 
ATOM   4899  C CB  . ASN B 1 100 ? 10.956  3.550   91.131  1.00 10.64  ? 120  ASN B CB  1 
ATOM   4900  C CG  . ASN B 1 100 ? 11.948  4.532   90.564  1.00 11.48  ? 120  ASN B CG  1 
ATOM   4901  O OD1 . ASN B 1 100 ? 12.341  4.420   89.404  1.00 10.70  ? 120  ASN B OD1 1 
ATOM   4902  N ND2 . ASN B 1 100 ? 12.372  5.496   91.378  1.00 11.27  ? 120  ASN B ND2 1 
ATOM   4903  N N   . ILE B 1 101 ? 9.515   0.656   90.756  1.00 11.28  ? 121  ILE B N   1 
ATOM   4904  C CA  . ILE B 1 101 ? 8.654   -0.373  91.341  1.00 11.33  ? 121  ILE B CA  1 
ATOM   4905  C C   . ILE B 1 101 ? 9.338   -1.140  92.483  1.00 11.90  ? 121  ILE B C   1 
ATOM   4906  O O   . ILE B 1 101 ? 10.521  -1.488  92.411  1.00 11.06  ? 121  ILE B O   1 
ATOM   4907  C CB  . ILE B 1 101 ? 8.176   -1.387  90.269  1.00 8.41   ? 121  ILE B CB  1 
ATOM   4908  C CG1 . ILE B 1 101 ? 7.228   -0.701  89.292  1.00 7.81   ? 121  ILE B CG1 1 
ATOM   4909  C CG2 . ILE B 1 101 ? 7.472   -2.556  90.927  1.00 5.48   ? 121  ILE B CG2 1 
ATOM   4910  C CD1 . ILE B 1 101 ? 6.894   -1.548  88.057  1.00 9.75   ? 121  ILE B CD1 1 
ATOM   4911  N N   . TYR B 1 102 ? 8.576   -1.379  93.543  1.00 12.07  ? 122  TYR B N   1 
ATOM   4912  C CA  . TYR B 1 102 ? 9.070   -2.109  94.693  1.00 13.61  ? 122  TYR B CA  1 
ATOM   4913  C C   . TYR B 1 102 ? 8.058   -3.212  94.973  1.00 15.09  ? 122  TYR B C   1 
ATOM   4914  O O   . TYR B 1 102 ? 6.996   -2.965  95.545  1.00 17.34  ? 122  TYR B O   1 
ATOM   4915  C CB  . TYR B 1 102 ? 9.199   -1.184  95.910  1.00 13.11  ? 122  TYR B CB  1 
ATOM   4916  C CG  . TYR B 1 102 ? 10.102  0.014   95.694  1.00 13.86  ? 122  TYR B CG  1 
ATOM   4917  C CD1 . TYR B 1 102 ? 9.677   1.110   94.936  1.00 13.93  ? 122  TYR B CD1 1 
ATOM   4918  C CD2 . TYR B 1 102 ? 11.386  0.052   96.237  1.00 13.04  ? 122  TYR B CD2 1 
ATOM   4919  C CE1 . TYR B 1 102 ? 10.514  2.213   94.725  1.00 13.06  ? 122  TYR B CE1 1 
ATOM   4920  C CE2 . TYR B 1 102 ? 12.229  1.148   96.032  1.00 12.53  ? 122  TYR B CE2 1 
ATOM   4921  C CZ  . TYR B 1 102 ? 11.787  2.223   95.275  1.00 12.54  ? 122  TYR B CZ  1 
ATOM   4922  O OH  . TYR B 1 102 ? 12.620  3.294   95.051  1.00 11.34  ? 122  TYR B OH  1 
ATOM   4923  N N   . THR B 1 103 ? 8.373   -4.428  94.546  1.00 15.83  ? 123  THR B N   1 
ATOM   4924  C CA  . THR B 1 103 ? 7.471   -5.544  94.769  1.00 17.42  ? 123  THR B CA  1 
ATOM   4925  C C   . THR B 1 103 ? 8.059   -6.542  95.761  1.00 19.91  ? 123  THR B C   1 
ATOM   4926  O O   . THR B 1 103 ? 9.227   -6.932  95.670  1.00 20.21  ? 123  THR B O   1 
ATOM   4927  C CB  . THR B 1 103 ? 7.125   -6.278  93.446  1.00 16.74  ? 123  THR B CB  1 
ATOM   4928  O OG1 . THR B 1 103 ? 6.143   -7.285  93.711  1.00 15.53  ? 123  THR B OG1 1 
ATOM   4929  C CG2 . THR B 1 103 ? 8.361   -6.924  92.832  1.00 14.51  ? 123  THR B CG2 1 
ATOM   4930  N N   . PRO B 1 104 ? 7.259   -6.943  96.751  1.00 21.36  ? 124  PRO B N   1 
ATOM   4931  C CA  . PRO B 1 104 ? 7.754   -7.901  97.734  1.00 22.98  ? 124  PRO B CA  1 
ATOM   4932  C C   . PRO B 1 104 ? 7.326   -9.309  97.321  1.00 25.33  ? 124  PRO B C   1 
ATOM   4933  O O   . PRO B 1 104 ? 7.794   -10.304 97.877  1.00 26.30  ? 124  PRO B O   1 
ATOM   4934  C CB  . PRO B 1 104 ? 7.082   -7.430  99.015  1.00 22.52  ? 124  PRO B CB  1 
ATOM   4935  C CG  . PRO B 1 104 ? 5.724   -7.020  98.522  1.00 21.02  ? 124  PRO B CG  1 
ATOM   4936  C CD  . PRO B 1 104 ? 6.027   -6.283  97.227  1.00 21.62  ? 124  PRO B CD  1 
ATOM   4937  N N   . ALA B 1 105 ? 6.442   -9.378  96.329  1.00 26.43  ? 125  ALA B N   1 
ATOM   4938  C CA  . ALA B 1 105 ? 5.920   -10.646 95.841  1.00 28.45  ? 125  ALA B CA  1 
ATOM   4939  C C   . ALA B 1 105 ? 6.993   -11.608 95.357  1.00 31.03  ? 125  ALA B C   1 
ATOM   4940  O O   . ALA B 1 105 ? 8.097   -11.208 94.996  1.00 31.91  ? 125  ALA B O   1 
ATOM   4941  C CB  . ALA B 1 105 ? 4.921   -10.396 94.727  1.00 28.23  ? 125  ALA B CB  1 
ATOM   4942  N N   . ASP B 1 106 ? 6.655   -12.891 95.366  1.00 34.17  ? 126  ASP B N   1 
ATOM   4943  C CA  . ASP B 1 106 ? 7.564   -13.932 94.908  1.00 36.53  ? 126  ASP B CA  1 
ATOM   4944  C C   . ASP B 1 106 ? 7.231   -14.128 93.429  1.00 37.12  ? 126  ASP B C   1 
ATOM   4945  O O   . ASP B 1 106 ? 6.352   -14.911 93.065  1.00 36.89  ? 126  ASP B O   1 
ATOM   4946  C CB  . ASP B 1 106 ? 7.329   -15.218 95.708  1.00 37.92  ? 126  ASP B CB  1 
ATOM   4947  C CG  . ASP B 1 106 ? 8.255   -16.345 95.297  1.00 39.80  ? 126  ASP B CG  1 
ATOM   4948  O OD1 . ASP B 1 106 ? 9.480   -16.118 95.178  1.00 40.97  ? 126  ASP B OD1 1 
ATOM   4949  O OD2 . ASP B 1 106 ? 7.750   -17.468 95.107  1.00 39.89  ? 126  ASP B OD2 1 
ATOM   4950  N N   . LEU B 1 107 ? 7.936   -13.380 92.588  1.00 37.23  ? 127  LEU B N   1 
ATOM   4951  C CA  . LEU B 1 107 ? 7.739   -13.402 91.147  1.00 37.05  ? 127  LEU B CA  1 
ATOM   4952  C C   . LEU B 1 107 ? 7.683   -14.796 90.541  1.00 38.04  ? 127  LEU B C   1 
ATOM   4953  O O   . LEU B 1 107 ? 7.112   -14.991 89.467  1.00 38.02  ? 127  LEU B O   1 
ATOM   4954  C CB  . LEU B 1 107 ? 8.839   -12.572 90.497  1.00 34.48  ? 127  LEU B CB  1 
ATOM   4955  C CG  . LEU B 1 107 ? 8.795   -11.164 91.094  1.00 33.56  ? 127  LEU B CG  1 
ATOM   4956  C CD1 . LEU B 1 107 ? 10.062  -10.397 90.776  1.00 34.38  ? 127  LEU B CD1 1 
ATOM   4957  C CD2 . LEU B 1 107 ? 7.557   -10.447 90.568  1.00 33.88  ? 127  LEU B CD2 1 
ATOM   4958  N N   . THR B 1 108 ? 8.262   -15.764 91.245  1.00 39.46  ? 128  THR B N   1 
ATOM   4959  C CA  . THR B 1 108 ? 8.292   -17.153 90.793  1.00 40.40  ? 128  THR B CA  1 
ATOM   4960  C C   . THR B 1 108 ? 6.888   -17.723 90.606  1.00 41.24  ? 128  THR B C   1 
ATOM   4961  O O   . THR B 1 108 ? 6.686   -18.659 89.841  1.00 41.01  ? 128  THR B O   1 
ATOM   4962  C CB  . THR B 1 108 ? 9.019   -18.038 91.808  1.00 39.76  ? 128  THR B CB  1 
ATOM   4963  O OG1 . THR B 1 108 ? 8.179   -18.229 92.950  1.00 39.97  ? 128  THR B OG1 1 
ATOM   4964  C CG2 . THR B 1 108 ? 10.310  -17.381 92.257  1.00 39.13  ? 128  THR B CG2 1 
ATOM   4965  N N   . LYS B 1 109 ? 5.922   -17.159 91.321  1.00 43.09  ? 129  LYS B N   1 
ATOM   4966  C CA  . LYS B 1 109 ? 4.543   -17.616 91.238  1.00 44.92  ? 129  LYS B CA  1 
ATOM   4967  C C   . LYS B 1 109 ? 3.571   -16.451 91.041  1.00 45.46  ? 129  LYS B C   1 
ATOM   4968  O O   . LYS B 1 109 ? 3.961   -15.279 91.091  1.00 46.17  ? 129  LYS B O   1 
ATOM   4969  C CB  . LYS B 1 109 ? 4.191   -18.402 92.504  1.00 46.28  ? 129  LYS B CB  1 
ATOM   4970  C CG  . LYS B 1 109 ? 4.527   -17.673 93.789  1.00 48.81  ? 129  LYS B CG  1 
ATOM   4971  C CD  . LYS B 1 109 ? 4.682   -18.631 94.961  1.00 52.50  ? 129  LYS B CD  1 
ATOM   4972  C CE  . LYS B 1 109 ? 5.886   -19.554 94.773  1.00 55.11  ? 129  LYS B CE  1 
ATOM   4973  N NZ  . LYS B 1 109 ? 6.167   -20.403 95.975  1.00 57.08  ? 129  LYS B NZ  1 
ATOM   4974  N N   . LYS B 1 110 ? 2.306   -16.782 90.806  1.00 45.10  ? 130  LYS B N   1 
ATOM   4975  C CA  . LYS B 1 110 ? 1.276   -15.775 90.594  1.00 45.45  ? 130  LYS B CA  1 
ATOM   4976  C C   . LYS B 1 110 ? 0.993   -15.024 91.888  1.00 44.66  ? 130  LYS B C   1 
ATOM   4977  O O   . LYS B 1 110 ? 0.991   -15.609 92.972  1.00 45.92  ? 130  LYS B O   1 
ATOM   4978  C CB  . LYS B 1 110 ? -0.016  -16.434 90.104  1.00 48.00  ? 130  LYS B CB  1 
ATOM   4979  C CG  . LYS B 1 110 ? -1.145  -15.458 89.774  1.00 50.32  ? 130  LYS B CG  1 
ATOM   4980  C CD  . LYS B 1 110 ? -2.503  -15.999 90.209  1.00 53.41  ? 130  LYS B CD  1 
ATOM   4981  C CE  . LYS B 1 110 ? -2.777  -17.389 89.639  1.00 57.16  ? 130  LYS B CE  1 
ATOM   4982  N NZ  . LYS B 1 110 ? -4.038  -17.999 90.176  1.00 58.97  ? 130  LYS B NZ  1 
ATOM   4983  N N   . ASN B 1 111 ? 0.747   -13.725 91.765  1.00 42.20  ? 131  ASN B N   1 
ATOM   4984  C CA  . ASN B 1 111 ? 0.450   -12.883 92.912  1.00 39.34  ? 131  ASN B CA  1 
ATOM   4985  C C   . ASN B 1 111 ? -0.367  -11.688 92.477  1.00 38.68  ? 131  ASN B C   1 
ATOM   4986  O O   . ASN B 1 111 ? -0.144  -11.127 91.403  1.00 40.23  ? 131  ASN B O   1 
ATOM   4987  C CB  . ASN B 1 111 ? 1.738   -12.391 93.568  1.00 39.18  ? 131  ASN B CB  1 
ATOM   4988  C CG  . ASN B 1 111 ? 2.375   -13.434 94.442  1.00 38.34  ? 131  ASN B CG  1 
ATOM   4989  O OD1 . ASN B 1 111 ? 1.736   -13.963 95.344  1.00 39.19  ? 131  ASN B OD1 1 
ATOM   4990  N ND2 . ASN B 1 111 ? 3.641   -13.737 94.186  1.00 37.83  ? 131  ASN B ND2 1 
ATOM   4991  N N   . ARG B 1 112 ? -1.324  -11.303 93.308  1.00 36.98  ? 132  ARG B N   1 
ATOM   4992  C CA  . ARG B 1 112 ? -2.162  -10.153 93.015  1.00 35.21  ? 132  ARG B CA  1 
ATOM   4993  C C   . ARG B 1 112 ? -2.261  -9.297  94.257  1.00 32.47  ? 132  ARG B C   1 
ATOM   4994  O O   . ARG B 1 112 ? -3.322  -9.184  94.869  1.00 31.66  ? 132  ARG B O   1 
ATOM   4995  C CB  . ARG B 1 112 ? -3.555  -10.593 92.553  1.00 37.16  ? 132  ARG B CB  1 
ATOM   4996  C CG  . ARG B 1 112 ? -3.648  -10.819 91.044  1.00 39.69  ? 132  ARG B CG  1 
ATOM   4997  C CD  . ARG B 1 112 ? -2.805  -12.000 90.631  1.00 43.45  ? 132  ARG B CD  1 
ATOM   4998  N NE  . ARG B 1 112 ? -1.930  -11.731 89.489  1.00 45.92  ? 132  ARG B NE  1 
ATOM   4999  C CZ  . ARG B 1 112 ? -2.343  -11.572 88.234  1.00 47.00  ? 132  ARG B CZ  1 
ATOM   5000  N NH1 . ARG B 1 112 ? -3.634  -11.641 87.927  1.00 46.54  ? 132  ARG B NH1 1 
ATOM   5001  N NH2 . ARG B 1 112 ? -1.450  -11.372 87.276  1.00 48.89  ? 132  ARG B NH2 1 
ATOM   5002  N N   . LEU B 1 113 ? -1.133  -8.694  94.620  1.00 29.74  ? 133  LEU B N   1 
ATOM   5003  C CA  . LEU B 1 113 ? -1.053  -7.840  95.798  1.00 26.52  ? 133  LEU B CA  1 
ATOM   5004  C C   . LEU B 1 113 ? -1.574  -6.443  95.523  1.00 23.81  ? 133  LEU B C   1 
ATOM   5005  O O   . LEU B 1 113 ? -1.416  -5.913  94.425  1.00 22.61  ? 133  LEU B O   1 
ATOM   5006  C CB  . LEU B 1 113 ? 0.393   -7.728  96.276  1.00 25.74  ? 133  LEU B CB  1 
ATOM   5007  C CG  . LEU B 1 113 ? 1.170   -9.021  96.486  1.00 24.77  ? 133  LEU B CG  1 
ATOM   5008  C CD1 . LEU B 1 113 ? 2.488   -8.692  97.155  1.00 25.39  ? 133  LEU B CD1 1 
ATOM   5009  C CD2 . LEU B 1 113 ? 0.368   -9.974  97.346  1.00 25.42  ? 133  LEU B CD2 1 
ATOM   5010  N N   . PRO B 1 114 ? -2.207  -5.823  96.522  1.00 22.16  ? 134  PRO B N   1 
ATOM   5011  C CA  . PRO B 1 114 ? -2.701  -4.471  96.256  1.00 21.12  ? 134  PRO B CA  1 
ATOM   5012  C C   . PRO B 1 114 ? -1.528  -3.565  95.843  1.00 19.58  ? 134  PRO B C   1 
ATOM   5013  O O   . PRO B 1 114 ? -0.404  -3.713  96.334  1.00 18.05  ? 134  PRO B O   1 
ATOM   5014  C CB  . PRO B 1 114 ? -3.350  -4.073  97.583  1.00 20.73  ? 134  PRO B CB  1 
ATOM   5015  C CG  . PRO B 1 114 ? -2.583  -4.888  98.602  1.00 21.26  ? 134  PRO B CG  1 
ATOM   5016  C CD  . PRO B 1 114 ? -2.434  -6.219  97.921  1.00 20.79  ? 134  PRO B CD  1 
ATOM   5017  N N   . VAL B 1 115 ? -1.797  -2.646  94.924  1.00 18.41  ? 135  VAL B N   1 
ATOM   5018  C CA  . VAL B 1 115 ? -0.779  -1.732  94.423  1.00 16.59  ? 135  VAL B CA  1 
ATOM   5019  C C   . VAL B 1 115 ? -1.024  -0.319  94.926  1.00 15.41  ? 135  VAL B C   1 
ATOM   5020  O O   . VAL B 1 115 ? -2.156  0.144   94.969  1.00 16.84  ? 135  VAL B O   1 
ATOM   5021  C CB  . VAL B 1 115 ? -0.774  -1.699  92.875  1.00 16.11  ? 135  VAL B CB  1 
ATOM   5022  C CG1 . VAL B 1 115 ? 0.480   -1.006  92.375  1.00 15.03  ? 135  VAL B CG1 1 
ATOM   5023  C CG2 . VAL B 1 115 ? -0.871  -3.105  92.319  1.00 15.04  ? 135  VAL B CG2 1 
ATOM   5024  N N   . MET B 1 116 ? 0.044   0.365   95.305  1.00 14.74  ? 136  MET B N   1 
ATOM   5025  C CA  . MET B 1 116 ? -0.064  1.728   95.787  1.00 15.38  ? 136  MET B CA  1 
ATOM   5026  C C   . MET B 1 116 ? 0.844   2.615   94.949  1.00 14.76  ? 136  MET B C   1 
ATOM   5027  O O   . MET B 1 116 ? 2.070   2.505   95.024  1.00 14.87  ? 136  MET B O   1 
ATOM   5028  C CB  . MET B 1 116 ? 0.326   1.799   97.267  1.00 17.28  ? 136  MET B CB  1 
ATOM   5029  C CG  . MET B 1 116 ? -0.727  1.210   98.207  1.00 20.18  ? 136  MET B CG  1 
ATOM   5030  S SD  . MET B 1 116 ? -0.302  1.277   99.982  1.00 22.55  ? 136  MET B SD  1 
ATOM   5031  C CE  . MET B 1 116 ? -0.690  3.017   100.375 1.00 19.73  ? 136  MET B CE  1 
ATOM   5032  N N   . VAL B 1 117 ? 0.234   3.481   94.137  1.00 14.33  ? 137  VAL B N   1 
ATOM   5033  C CA  . VAL B 1 117 ? 0.979   4.392   93.268  1.00 12.95  ? 137  VAL B CA  1 
ATOM   5034  C C   . VAL B 1 117 ? 1.116   5.758   93.930  1.00 13.01  ? 137  VAL B C   1 
ATOM   5035  O O   . VAL B 1 117 ? 0.118   6.385   94.281  1.00 13.16  ? 137  VAL B O   1 
ATOM   5036  C CB  . VAL B 1 117 ? 0.283   4.552   91.912  1.00 11.26  ? 137  VAL B CB  1 
ATOM   5037  C CG1 . VAL B 1 117 ? 1.167   5.347   90.967  1.00 9.52   ? 137  VAL B CG1 1 
ATOM   5038  C CG2 . VAL B 1 117 ? -0.039  3.184   91.335  1.00 9.98   ? 137  VAL B CG2 1 
ATOM   5039  N N   . TRP B 1 118 ? 2.360   6.209   94.089  1.00 12.54  ? 138  TRP B N   1 
ATOM   5040  C CA  . TRP B 1 118 ? 2.665   7.477   94.747  1.00 12.77  ? 138  TRP B CA  1 
ATOM   5041  C C   . TRP B 1 118 ? 3.001   8.621   93.800  1.00 12.45  ? 138  TRP B C   1 
ATOM   5042  O O   . TRP B 1 118 ? 3.774   8.450   92.865  1.00 13.88  ? 138  TRP B O   1 
ATOM   5043  C CB  . TRP B 1 118 ? 3.826   7.261   95.725  1.00 12.70  ? 138  TRP B CB  1 
ATOM   5044  C CG  . TRP B 1 118 ? 4.360   8.508   96.366  1.00 12.97  ? 138  TRP B CG  1 
ATOM   5045  C CD1 . TRP B 1 118 ? 5.466   9.217   95.989  1.00 12.25  ? 138  TRP B CD1 1 
ATOM   5046  C CD2 . TRP B 1 118 ? 3.820   9.184   97.510  1.00 12.35  ? 138  TRP B CD2 1 
ATOM   5047  N NE1 . TRP B 1 118 ? 5.649   10.291  96.830  1.00 11.30  ? 138  TRP B NE1 1 
ATOM   5048  C CE2 . TRP B 1 118 ? 4.654   10.293  97.773  1.00 11.59  ? 138  TRP B CE2 1 
ATOM   5049  C CE3 . TRP B 1 118 ? 2.714   8.957   98.342  1.00 11.56  ? 138  TRP B CE3 1 
ATOM   5050  C CZ2 . TRP B 1 118 ? 4.415   11.176  98.837  1.00 12.40  ? 138  TRP B CZ2 1 
ATOM   5051  C CZ3 . TRP B 1 118 ? 2.476   9.838   99.402  1.00 10.28  ? 138  TRP B CZ3 1 
ATOM   5052  C CH2 . TRP B 1 118 ? 3.323   10.930  99.638  1.00 10.89  ? 138  TRP B CH2 1 
ATOM   5053  N N   . ILE B 1 119 ? 2.420   9.789   94.066  1.00 11.93  ? 139  ILE B N   1 
ATOM   5054  C CA  . ILE B 1 119 ? 2.651   10.990  93.263  1.00 11.73  ? 139  ILE B CA  1 
ATOM   5055  C C   . ILE B 1 119 ? 3.286   12.024  94.176  1.00 11.50  ? 139  ILE B C   1 
ATOM   5056  O O   . ILE B 1 119 ? 2.622   12.563  95.063  1.00 11.30  ? 139  ILE B O   1 
ATOM   5057  C CB  . ILE B 1 119 ? 1.328   11.561  92.722  1.00 11.69  ? 139  ILE B CB  1 
ATOM   5058  C CG1 . ILE B 1 119 ? 0.602   10.489  91.906  1.00 8.80   ? 139  ILE B CG1 1 
ATOM   5059  C CG2 . ILE B 1 119 ? 1.603   12.797  91.880  1.00 11.08  ? 139  ILE B CG2 1 
ATOM   5060  C CD1 . ILE B 1 119 ? -0.756  10.905  91.437  1.00 7.23   ? 139  ILE B CD1 1 
ATOM   5061  N N   . HIS B 1 120 ? 4.567   12.299  93.962  1.00 11.22  ? 140  HIS B N   1 
ATOM   5062  C CA  . HIS B 1 120 ? 5.284   13.242  94.808  1.00 11.73  ? 140  HIS B CA  1 
ATOM   5063  C C   . HIS B 1 120 ? 4.775   14.668  94.716  1.00 12.00  ? 140  HIS B C   1 
ATOM   5064  O O   . HIS B 1 120 ? 4.143   15.052  93.738  1.00 12.64  ? 140  HIS B O   1 
ATOM   5065  C CB  . HIS B 1 120 ? 6.770   13.245  94.478  1.00 13.16  ? 140  HIS B CB  1 
ATOM   5066  C CG  . HIS B 1 120 ? 7.097   13.929  93.187  1.00 15.26  ? 140  HIS B CG  1 
ATOM   5067  N ND1 . HIS B 1 120 ? 7.234   13.249  91.996  1.00 16.99  ? 140  HIS B ND1 1 
ATOM   5068  C CD2 . HIS B 1 120 ? 7.267   15.238  92.893  1.00 15.08  ? 140  HIS B CD2 1 
ATOM   5069  C CE1 . HIS B 1 120 ? 7.472   14.110  91.024  1.00 15.50  ? 140  HIS B CE1 1 
ATOM   5070  N NE2 . HIS B 1 120 ? 7.497   15.324  91.542  1.00 15.82  ? 140  HIS B NE2 1 
ATOM   5071  N N   . GLY B 1 121 ? 5.071   15.442  95.755  1.00 12.48  ? 141  GLY B N   1 
ATOM   5072  C CA  . GLY B 1 121 ? 4.673   16.835  95.812  1.00 11.74  ? 141  GLY B CA  1 
ATOM   5073  C C   . GLY B 1 121 ? 5.808   17.710  95.318  1.00 11.07  ? 141  GLY B C   1 
ATOM   5074  O O   . GLY B 1 121 ? 6.792   17.214  94.788  1.00 10.16  ? 141  GLY B O   1 
ATOM   5075  N N   . GLY B 1 122 ? 5.681   19.015  95.502  1.00 12.08  ? 142  GLY B N   1 
ATOM   5076  C CA  . GLY B 1 122 ? 6.707   19.925  95.039  1.00 13.32  ? 142  GLY B CA  1 
ATOM   5077  C C   . GLY B 1 122 ? 6.057   21.035  94.240  1.00 15.14  ? 142  GLY B C   1 
ATOM   5078  O O   . GLY B 1 122 ? 6.691   21.670  93.398  1.00 16.19  ? 142  GLY B O   1 
ATOM   5079  N N   . GLY B 1 123 ? 4.772   21.249  94.502  1.00 16.05  ? 143  GLY B N   1 
ATOM   5080  C CA  . GLY B 1 123 ? 4.016   22.294  93.832  1.00 17.21  ? 143  GLY B CA  1 
ATOM   5081  C C   . GLY B 1 123 ? 4.008   22.274  92.319  1.00 16.86  ? 143  GLY B C   1 
ATOM   5082  O O   . GLY B 1 123 ? 3.816   23.312  91.694  1.00 17.80  ? 143  GLY B O   1 
ATOM   5083  N N   . LEU B 1 124 ? 4.212   21.103  91.728  1.00 17.73  ? 144  LEU B N   1 
ATOM   5084  C CA  . LEU B 1 124 ? 4.226   20.958  90.273  1.00 17.18  ? 144  LEU B CA  1 
ATOM   5085  C C   . LEU B 1 124 ? 5.389   21.699  89.620  1.00 16.98  ? 144  LEU B C   1 
ATOM   5086  O O   . LEU B 1 124 ? 5.447   21.801  88.402  1.00 17.56  ? 144  LEU B O   1 
ATOM   5087  C CB  . LEU B 1 124 ? 2.908   21.467  89.683  1.00 15.24  ? 144  LEU B CB  1 
ATOM   5088  C CG  . LEU B 1 124 ? 1.634   20.966  90.365  1.00 14.06  ? 144  LEU B CG  1 
ATOM   5089  C CD1 . LEU B 1 124 ? 0.427   21.685  89.775  1.00 11.78  ? 144  LEU B CD1 1 
ATOM   5090  C CD2 . LEU B 1 124 ? 1.519   19.457  90.200  1.00 11.35  ? 144  LEU B CD2 1 
ATOM   5091  N N   . MET B 1 125 ? 6.312   22.209  90.432  1.00 18.90  ? 145  MET B N   1 
ATOM   5092  C CA  . MET B 1 125 ? 7.475   22.952  89.937  1.00 19.76  ? 145  MET B CA  1 
ATOM   5093  C C   . MET B 1 125 ? 8.770   22.166  90.144  1.00 18.26  ? 145  MET B C   1 
ATOM   5094  O O   . MET B 1 125 ? 9.750   22.357  89.420  1.00 19.09  ? 145  MET B O   1 
ATOM   5095  C CB  . MET B 1 125 ? 7.611   24.303  90.662  1.00 24.48  ? 145  MET B CB  1 
ATOM   5096  C CG  . MET B 1 125 ? 6.504   25.323  90.418  1.00 29.05  ? 145  MET B CG  1 
ATOM   5097  S SD  . MET B 1 125 ? 6.482   25.933  88.721  1.00 38.38  ? 145  MET B SD  1 
ATOM   5098  C CE  . MET B 1 125 ? 8.185   26.583  88.582  1.00 36.88  ? 145  MET B CE  1 
ATOM   5099  N N   . VAL B 1 126 ? 8.777   21.294  91.146  1.00 15.19  ? 146  VAL B N   1 
ATOM   5100  C CA  . VAL B 1 126 ? 9.958   20.497  91.447  1.00 13.09  ? 146  VAL B CA  1 
ATOM   5101  C C   . VAL B 1 126 ? 9.563   19.145  92.047  1.00 12.36  ? 146  VAL B C   1 
ATOM   5102  O O   . VAL B 1 126 ? 8.388   18.894  92.313  1.00 13.14  ? 146  VAL B O   1 
ATOM   5103  C CB  . VAL B 1 126 ? 10.877  21.240  92.450  1.00 13.67  ? 146  VAL B CB  1 
ATOM   5104  C CG1 . VAL B 1 126 ? 11.325  22.581  91.864  1.00 10.21  ? 146  VAL B CG1 1 
ATOM   5105  C CG2 . VAL B 1 126 ? 10.140  21.446  93.779  1.00 12.91  ? 146  VAL B CG2 1 
ATOM   5106  N N   . GLY B 1 127 ? 10.543  18.273  92.252  1.00 10.68  ? 147  GLY B N   1 
ATOM   5107  C CA  . GLY B 1 127 ? 10.253  16.975  92.831  1.00 10.49  ? 147  GLY B CA  1 
ATOM   5108  C C   . GLY B 1 127 ? 10.681  15.797  91.979  1.00 10.94  ? 147  GLY B C   1 
ATOM   5109  O O   . GLY B 1 127 ? 10.968  15.944  90.791  1.00 11.13  ? 147  GLY B O   1 
ATOM   5110  N N   . ALA B 1 128 ? 10.724  14.615  92.579  1.00 10.24  ? 148  ALA B N   1 
ATOM   5111  C CA  . ALA B 1 128 ? 11.113  13.429  91.840  1.00 11.24  ? 148  ALA B CA  1 
ATOM   5112  C C   . ALA B 1 128 ? 10.561  12.199  92.530  1.00 12.66  ? 148  ALA B C   1 
ATOM   5113  O O   . ALA B 1 128 ? 10.144  12.270  93.681  1.00 13.27  ? 148  ALA B O   1 
ATOM   5114  C CB  . ALA B 1 128 ? 12.617  13.343  91.747  1.00 12.03  ? 148  ALA B CB  1 
ATOM   5115  N N   . ALA B 1 129 ? 10.563  11.071  91.826  1.00 12.70  ? 149  ALA B N   1 
ATOM   5116  C CA  . ALA B 1 129 ? 10.047  9.837   92.388  1.00 12.70  ? 149  ALA B CA  1 
ATOM   5117  C C   . ALA B 1 129 ? 11.093  9.126   93.233  1.00 13.18  ? 149  ALA B C   1 
ATOM   5118  O O   . ALA B 1 129 ? 10.780  8.540   94.270  1.00 13.20  ? 149  ALA B O   1 
ATOM   5119  C CB  . ALA B 1 129 ? 9.564   8.925   91.274  1.00 10.82  ? 149  ALA B CB  1 
ATOM   5120  N N   . SER B 1 130 ? 12.341  9.193   92.791  1.00 14.28  ? 150  SER B N   1 
ATOM   5121  C CA  . SER B 1 130 ? 13.438  8.531   93.486  1.00 15.76  ? 150  SER B CA  1 
ATOM   5122  C C   . SER B 1 130 ? 13.645  9.016   94.923  1.00 16.40  ? 150  SER B C   1 
ATOM   5123  O O   . SER B 1 130 ? 14.358  8.378   95.706  1.00 15.53  ? 150  SER B O   1 
ATOM   5124  C CB  . SER B 1 130 ? 14.719  8.706   92.679  1.00 13.93  ? 150  SER B CB  1 
ATOM   5125  O OG  . SER B 1 130 ? 14.465  8.418   91.317  1.00 16.00  ? 150  SER B OG  1 
ATOM   5126  N N   . THR B 1 131 ? 13.013  10.135  95.271  1.00 18.19  ? 151  THR B N   1 
ATOM   5127  C CA  . THR B 1 131 ? 13.128  10.696  96.619  1.00 19.32  ? 151  THR B CA  1 
ATOM   5128  C C   . THR B 1 131 ? 12.497  9.762   97.656  1.00 18.03  ? 151  THR B C   1 
ATOM   5129  O O   . THR B 1 131 ? 12.874  9.776   98.828  1.00 17.70  ? 151  THR B O   1 
ATOM   5130  C CB  . THR B 1 131 ? 12.430  12.093  96.722  1.00 20.67  ? 151  THR B CB  1 
ATOM   5131  O OG1 . THR B 1 131 ? 13.144  13.064  95.943  1.00 22.78  ? 151  THR B OG1 1 
ATOM   5132  C CG2 . THR B 1 131 ? 12.382  12.563  98.167  1.00 21.84  ? 151  THR B CG2 1 
ATOM   5133  N N   . TYR B 1 132 ? 11.551  8.940   97.214  1.00 16.54  ? 152  TYR B N   1 
ATOM   5134  C CA  . TYR B 1 132 ? 10.860  8.030   98.111  1.00 16.51  ? 152  TYR B CA  1 
ATOM   5135  C C   . TYR B 1 132 ? 11.179  6.559   97.840  1.00 17.42  ? 152  TYR B C   1 
ATOM   5136  O O   . TYR B 1 132 ? 10.898  6.034   96.760  1.00 17.67  ? 152  TYR B O   1 
ATOM   5137  C CB  . TYR B 1 132 ? 9.347   8.278   98.021  1.00 15.97  ? 152  TYR B CB  1 
ATOM   5138  C CG  . TYR B 1 132 ? 8.988   9.750   98.074  1.00 16.12  ? 152  TYR B CG  1 
ATOM   5139  C CD1 . TYR B 1 132 ? 9.313   10.600  97.021  1.00 16.49  ? 152  TYR B CD1 1 
ATOM   5140  C CD2 . TYR B 1 132 ? 8.382   10.307  99.197  1.00 16.30  ? 152  TYR B CD2 1 
ATOM   5141  C CE1 . TYR B 1 132 ? 9.054   11.959  97.086  1.00 15.94  ? 152  TYR B CE1 1 
ATOM   5142  C CE2 . TYR B 1 132 ? 8.121   11.677  99.271  1.00 16.25  ? 152  TYR B CE2 1 
ATOM   5143  C CZ  . TYR B 1 132 ? 8.463   12.491  98.209  1.00 15.96  ? 152  TYR B CZ  1 
ATOM   5144  O OH  . TYR B 1 132 ? 8.240   13.845  98.265  1.00 17.61  ? 152  TYR B OH  1 
ATOM   5145  N N   . ASP B 1 133 ? 11.774  5.901   98.829  1.00 17.27  ? 153  ASP B N   1 
ATOM   5146  C CA  . ASP B 1 133 ? 12.122  4.497   98.705  1.00 17.95  ? 153  ASP B CA  1 
ATOM   5147  C C   . ASP B 1 133 ? 10.949  3.681   99.229  1.00 18.05  ? 153  ASP B C   1 
ATOM   5148  O O   . ASP B 1 133 ? 10.578  3.806   100.395 1.00 19.28  ? 153  ASP B O   1 
ATOM   5149  C CB  . ASP B 1 133 ? 13.381  4.201   99.521  1.00 19.24  ? 153  ASP B CB  1 
ATOM   5150  C CG  . ASP B 1 133 ? 13.808  2.748   99.429  1.00 22.00  ? 153  ASP B CG  1 
ATOM   5151  O OD1 . ASP B 1 133 ? 14.913  2.413   99.919  1.00 23.02  ? 153  ASP B OD1 1 
ATOM   5152  O OD2 . ASP B 1 133 ? 13.037  1.939   98.868  1.00 22.24  ? 153  ASP B OD2 1 
ATOM   5153  N N   . GLY B 1 134 ? 10.367  2.848   98.372  1.00 16.97  ? 154  GLY B N   1 
ATOM   5154  C CA  . GLY B 1 134 ? 9.234   2.042   98.788  1.00 17.19  ? 154  GLY B CA  1 
ATOM   5155  C C   . GLY B 1 134 ? 9.620   0.692   99.362  1.00 18.77  ? 154  GLY B C   1 
ATOM   5156  O O   . GLY B 1 134 ? 8.817   -0.236  99.374  1.00 19.46  ? 154  GLY B O   1 
ATOM   5157  N N   . LEU B 1 135 ? 10.847  0.581   99.858  1.00 19.64  ? 155  LEU B N   1 
ATOM   5158  C CA  . LEU B 1 135 ? 11.332  -0.676  100.414 1.00 19.49  ? 155  LEU B CA  1 
ATOM   5159  C C   . LEU B 1 135 ? 10.566  -1.147  101.638 1.00 18.67  ? 155  LEU B C   1 
ATOM   5160  O O   . LEU B 1 135 ? 9.976   -2.222  101.629 1.00 19.89  ? 155  LEU B O   1 
ATOM   5161  C CB  . LEU B 1 135 ? 12.818  -0.559  100.764 1.00 20.81  ? 155  LEU B CB  1 
ATOM   5162  C CG  . LEU B 1 135 ? 13.443  -1.839  101.326 1.00 23.14  ? 155  LEU B CG  1 
ATOM   5163  C CD1 . LEU B 1 135 ? 13.266  -2.983  100.335 1.00 23.20  ? 155  LEU B CD1 1 
ATOM   5164  C CD2 . LEU B 1 135 ? 14.915  -1.609  101.619 1.00 22.79  ? 155  LEU B CD2 1 
ATOM   5165  N N   . ALA B 1 136 ? 10.585  -0.338  102.691 1.00 18.07  ? 156  ALA B N   1 
ATOM   5166  C CA  . ALA B 1 136 ? 9.912   -0.671  103.941 1.00 17.40  ? 156  ALA B CA  1 
ATOM   5167  C C   . ALA B 1 136 ? 8.437   -0.962  103.750 1.00 18.03  ? 156  ALA B C   1 
ATOM   5168  O O   . ALA B 1 136 ? 7.940   -2.006  104.179 1.00 17.78  ? 156  ALA B O   1 
ATOM   5169  C CB  . ALA B 1 136 ? 10.080  0.464   104.942 1.00 16.89  ? 156  ALA B CB  1 
ATOM   5170  N N   . LEU B 1 137 ? 7.743   -0.027  103.106 1.00 18.60  ? 157  LEU B N   1 
ATOM   5171  C CA  . LEU B 1 137 ? 6.312   -0.151  102.866 1.00 17.07  ? 157  LEU B CA  1 
ATOM   5172  C C   . LEU B 1 137 ? 5.951   -1.485  102.225 1.00 17.07  ? 157  LEU B C   1 
ATOM   5173  O O   . LEU B 1 137 ? 5.044   -2.181  102.686 1.00 16.08  ? 157  LEU B O   1 
ATOM   5174  C CB  . LEU B 1 137 ? 5.837   0.997   101.981 1.00 15.43  ? 157  LEU B CB  1 
ATOM   5175  C CG  . LEU B 1 137 ? 4.323   1.183   101.933 1.00 15.43  ? 157  LEU B CG  1 
ATOM   5176  C CD1 . LEU B 1 137 ? 3.790   1.336   103.340 1.00 14.39  ? 157  LEU B CD1 1 
ATOM   5177  C CD2 . LEU B 1 137 ? 3.983   2.408   101.105 1.00 15.50  ? 157  LEU B CD2 1 
ATOM   5178  N N   . ALA B 1 138 ? 6.674   -1.839  101.169 1.00 17.04  ? 158  ALA B N   1 
ATOM   5179  C CA  . ALA B 1 138 ? 6.435   -3.087  100.452 1.00 17.98  ? 158  ALA B CA  1 
ATOM   5180  C C   . ALA B 1 138 ? 6.603   -4.321  101.343 1.00 18.30  ? 158  ALA B C   1 
ATOM   5181  O O   . ALA B 1 138 ? 5.728   -5.189  101.392 1.00 15.92  ? 158  ALA B O   1 
ATOM   5182  C CB  . ALA B 1 138 ? 7.379   -3.184  99.245  1.00 16.62  ? 158  ALA B CB  1 
ATOM   5183  N N   . ALA B 1 139 ? 7.737   -4.392  102.036 1.00 19.35  ? 159  ALA B N   1 
ATOM   5184  C CA  . ALA B 1 139 ? 8.046   -5.515  102.911 1.00 19.16  ? 159  ALA B CA  1 
ATOM   5185  C C   . ALA B 1 139 ? 7.137   -5.558  104.137 1.00 20.35  ? 159  ALA B C   1 
ATOM   5186  O O   . ALA B 1 139 ? 6.560   -6.600  104.457 1.00 19.50  ? 159  ALA B O   1 
ATOM   5187  C CB  . ALA B 1 139 ? 9.495   -5.438  103.344 1.00 16.65  ? 159  ALA B CB  1 
ATOM   5188  N N   . HIS B 1 140 ? 7.013   -4.419  104.813 1.00 21.82  ? 160  HIS B N   1 
ATOM   5189  C CA  . HIS B 1 140 ? 6.194   -4.310  106.013 1.00 22.93  ? 160  HIS B CA  1 
ATOM   5190  C C   . HIS B 1 140 ? 4.690   -4.556  105.833 1.00 24.39  ? 160  HIS B C   1 
ATOM   5191  O O   . HIS B 1 140 ? 4.053   -5.111  106.728 1.00 25.16  ? 160  HIS B O   1 
ATOM   5192  C CB  . HIS B 1 140 ? 6.418   -2.939  106.666 1.00 23.57  ? 160  HIS B CB  1 
ATOM   5193  C CG  . HIS B 1 140 ? 7.661   -2.860  107.499 1.00 27.32  ? 160  HIS B CG  1 
ATOM   5194  N ND1 . HIS B 1 140 ? 7.719   -3.321  108.797 1.00 28.04  ? 160  HIS B ND1 1 
ATOM   5195  C CD2 . HIS B 1 140 ? 8.902   -2.396  107.212 1.00 28.34  ? 160  HIS B CD2 1 
ATOM   5196  C CE1 . HIS B 1 140 ? 8.939   -3.145  109.274 1.00 27.48  ? 160  HIS B CE1 1 
ATOM   5197  N NE2 . HIS B 1 140 ? 9.677   -2.587  108.331 1.00 27.90  ? 160  HIS B NE2 1 
ATOM   5198  N N   . GLU B 1 141 ? 4.117   -4.159  104.695 1.00 24.95  ? 161  GLU B N   1 
ATOM   5199  C CA  . GLU B 1 141 ? 2.677   -4.335  104.478 1.00 24.75  ? 161  GLU B CA  1 
ATOM   5200  C C   . GLU B 1 141 ? 2.306   -5.160  103.256 1.00 25.05  ? 161  GLU B C   1 
ATOM   5201  O O   . GLU B 1 141 ? 1.148   -5.180  102.831 1.00 25.41  ? 161  GLU B O   1 
ATOM   5202  C CB  . GLU B 1 141 ? 1.980   -2.976  104.384 1.00 25.53  ? 161  GLU B CB  1 
ATOM   5203  C CG  . GLU B 1 141 ? 1.822   -2.259  105.713 1.00 28.21  ? 161  GLU B CG  1 
ATOM   5204  C CD  . GLU B 1 141 ? 1.159   -3.128  106.775 1.00 30.46  ? 161  GLU B CD  1 
ATOM   5205  O OE1 . GLU B 1 141 ? 0.169   -3.826  106.455 1.00 30.15  ? 161  GLU B OE1 1 
ATOM   5206  O OE2 . GLU B 1 141 ? 1.626   -3.103  107.937 1.00 31.85  ? 161  GLU B OE2 1 
ATOM   5207  N N   . ASN B 1 142 ? 3.293   -5.837  102.692 1.00 25.13  ? 162  ASN B N   1 
ATOM   5208  C CA  . ASN B 1 142 ? 3.082   -6.681  101.526 1.00 24.94  ? 162  ASN B CA  1 
ATOM   5209  C C   . ASN B 1 142 ? 2.222   -6.038  100.427 1.00 22.72  ? 162  ASN B C   1 
ATOM   5210  O O   . ASN B 1 142 ? 1.163   -6.549  100.055 1.00 23.16  ? 162  ASN B O   1 
ATOM   5211  C CB  . ASN B 1 142 ? 2.492   -8.030  101.967 1.00 26.25  ? 162  ASN B CB  1 
ATOM   5212  C CG  . ASN B 1 142 ? 2.622   -9.097  100.898 1.00 29.31  ? 162  ASN B CG  1 
ATOM   5213  O OD1 . ASN B 1 142 ? 1.758   -9.231  100.028 1.00 29.93  ? 162  ASN B OD1 1 
ATOM   5214  N ND2 . ASN B 1 142 ? 3.722   -9.848  100.942 1.00 29.80  ? 162  ASN B ND2 1 
ATOM   5215  N N   . VAL B 1 143 ? 2.697   -4.911  99.911  1.00 20.23  ? 163  VAL B N   1 
ATOM   5216  C CA  . VAL B 1 143 ? 2.012   -4.202  98.840  1.00 18.31  ? 163  VAL B CA  1 
ATOM   5217  C C   . VAL B 1 143 ? 3.050   -3.837  97.794  1.00 18.39  ? 163  VAL B C   1 
ATOM   5218  O O   . VAL B 1 143 ? 4.243   -3.784  98.092  1.00 19.51  ? 163  VAL B O   1 
ATOM   5219  C CB  . VAL B 1 143 ? 1.371   -2.897  99.331  1.00 15.42  ? 163  VAL B CB  1 
ATOM   5220  C CG1 . VAL B 1 143 ? 0.212   -3.198  100.246 1.00 13.11  ? 163  VAL B CG1 1 
ATOM   5221  C CG2 . VAL B 1 143 ? 2.417   -2.051  100.022 1.00 12.50  ? 163  VAL B CG2 1 
ATOM   5222  N N   . VAL B 1 144 ? 2.599   -3.595  96.569  1.00 16.86  ? 164  VAL B N   1 
ATOM   5223  C CA  . VAL B 1 144 ? 3.506   -3.205  95.503  1.00 15.95  ? 164  VAL B CA  1 
ATOM   5224  C C   . VAL B 1 144 ? 3.558   -1.679  95.475  1.00 15.34  ? 164  VAL B C   1 
ATOM   5225  O O   . VAL B 1 144 ? 2.557   -1.033  95.178  1.00 16.08  ? 164  VAL B O   1 
ATOM   5226  C CB  . VAL B 1 144 ? 3.010   -3.705  94.138  1.00 16.12  ? 164  VAL B CB  1 
ATOM   5227  C CG1 . VAL B 1 144 ? 3.976   -3.268  93.055  1.00 16.61  ? 164  VAL B CG1 1 
ATOM   5228  C CG2 . VAL B 1 144 ? 2.873   -5.218  94.151  1.00 15.48  ? 164  VAL B CG2 1 
ATOM   5229  N N   . VAL B 1 145 ? 4.712   -1.098  95.793  1.00 14.08  ? 165  VAL B N   1 
ATOM   5230  C CA  . VAL B 1 145 ? 4.832   0.358   95.794  1.00 12.59  ? 165  VAL B CA  1 
ATOM   5231  C C   . VAL B 1 145 ? 5.413   0.874   94.476  1.00 12.57  ? 165  VAL B C   1 
ATOM   5232  O O   . VAL B 1 145 ? 6.497   0.466   94.050  1.00 12.14  ? 165  VAL B O   1 
ATOM   5233  C CB  . VAL B 1 145 ? 5.706   0.854   96.972  1.00 11.08  ? 165  VAL B CB  1 
ATOM   5234  C CG1 . VAL B 1 145 ? 5.790   2.375   96.956  1.00 9.42   ? 165  VAL B CG1 1 
ATOM   5235  C CG2 . VAL B 1 145 ? 5.109   0.390   98.284  1.00 10.89  ? 165  VAL B CG2 1 
ATOM   5236  N N   . VAL B 1 146 ? 4.681   1.775   93.834  1.00 11.07  ? 166  VAL B N   1 
ATOM   5237  C CA  . VAL B 1 146 ? 5.119   2.335   92.569  1.00 11.75  ? 166  VAL B CA  1 
ATOM   5238  C C   . VAL B 1 146 ? 5.238   3.856   92.662  1.00 13.31  ? 166  VAL B C   1 
ATOM   5239  O O   . VAL B 1 146 ? 4.258   4.540   92.953  1.00 14.54  ? 166  VAL B O   1 
ATOM   5240  C CB  . VAL B 1 146 ? 4.121   1.982   91.439  1.00 10.65  ? 166  VAL B CB  1 
ATOM   5241  C CG1 . VAL B 1 146 ? 4.586   2.590   90.131  1.00 10.07  ? 166  VAL B CG1 1 
ATOM   5242  C CG2 . VAL B 1 146 ? 3.980   0.465   91.307  1.00 8.71   ? 166  VAL B CG2 1 
ATOM   5243  N N   . THR B 1 147 ? 6.437   4.386   92.436  1.00 14.29  ? 167  THR B N   1 
ATOM   5244  C CA  . THR B 1 147 ? 6.635   5.836   92.470  1.00 15.21  ? 167  THR B CA  1 
ATOM   5245  C C   . THR B 1 147 ? 6.775   6.321   91.028  1.00 15.95  ? 167  THR B C   1 
ATOM   5246  O O   . THR B 1 147 ? 7.645   5.851   90.284  1.00 16.26  ? 167  THR B O   1 
ATOM   5247  C CB  . THR B 1 147 ? 7.893   6.232   93.267  1.00 14.58  ? 167  THR B CB  1 
ATOM   5248  O OG1 . THR B 1 147 ? 9.039   5.565   92.724  1.00 12.98  ? 167  THR B OG1 1 
ATOM   5249  C CG2 . THR B 1 147 ? 7.721   5.873   94.735  1.00 13.83  ? 167  THR B CG2 1 
ATOM   5250  N N   . ILE B 1 148 ? 5.911   7.256   90.639  1.00 14.68  ? 168  ILE B N   1 
ATOM   5251  C CA  . ILE B 1 148 ? 5.906   7.779   89.276  1.00 12.25  ? 168  ILE B CA  1 
ATOM   5252  C C   . ILE B 1 148 ? 6.390   9.218   89.180  1.00 11.85  ? 168  ILE B C   1 
ATOM   5253  O O   . ILE B 1 148 ? 6.320   9.973   90.149  1.00 11.37  ? 168  ILE B O   1 
ATOM   5254  C CB  . ILE B 1 148 ? 4.485   7.734   88.679  1.00 10.27  ? 168  ILE B CB  1 
ATOM   5255  C CG1 . ILE B 1 148 ? 3.603   8.760   89.386  1.00 7.57   ? 168  ILE B CG1 1 
ATOM   5256  C CG2 . ILE B 1 148 ? 3.889   6.346   88.832  1.00 7.56   ? 168  ILE B CG2 1 
ATOM   5257  C CD1 . ILE B 1 148 ? 2.235   8.869   88.805  1.00 8.57   ? 168  ILE B CD1 1 
ATOM   5258  N N   . GLN B 1 149 ? 6.876   9.589   88.002  1.00 10.71  ? 169  GLN B N   1 
ATOM   5259  C CA  . GLN B 1 149 ? 7.334   10.946  87.762  1.00 11.33  ? 169  GLN B CA  1 
ATOM   5260  C C   . GLN B 1 149 ? 6.468   11.578  86.676  1.00 12.76  ? 169  GLN B C   1 
ATOM   5261  O O   . GLN B 1 149 ? 5.902   10.871  85.838  1.00 14.93  ? 169  GLN B O   1 
ATOM   5262  C CB  . GLN B 1 149 ? 8.804   10.953  87.351  1.00 9.64   ? 169  GLN B CB  1 
ATOM   5263  C CG  . GLN B 1 149 ? 9.744   10.711  88.511  1.00 9.49   ? 169  GLN B CG  1 
ATOM   5264  C CD  . GLN B 1 149 ? 11.179  10.993  88.149  1.00 11.19  ? 169  GLN B CD  1 
ATOM   5265  O OE1 . GLN B 1 149 ? 12.088  10.840  88.971  1.00 11.80  ? 169  GLN B OE1 1 
ATOM   5266  N NE2 . GLN B 1 149 ? 11.397  11.410  86.906  1.00 11.44  ? 169  GLN B NE2 1 
ATOM   5267  N N   . TYR B 1 150 ? 6.348   12.903  86.698  1.00 12.50  ? 170  TYR B N   1 
ATOM   5268  C CA  . TYR B 1 150 ? 5.534   13.612  85.715  1.00 11.98  ? 170  TYR B CA  1 
ATOM   5269  C C   . TYR B 1 150 ? 6.133   14.969  85.389  1.00 10.86  ? 170  TYR B C   1 
ATOM   5270  O O   . TYR B 1 150 ? 6.879   15.531  86.191  1.00 10.51  ? 170  TYR B O   1 
ATOM   5271  C CB  . TYR B 1 150 ? 4.106   13.793  86.239  1.00 12.57  ? 170  TYR B CB  1 
ATOM   5272  C CG  . TYR B 1 150 ? 4.037   14.439  87.602  1.00 11.93  ? 170  TYR B CG  1 
ATOM   5273  C CD1 . TYR B 1 150 ? 4.190   13.686  88.760  1.00 10.67  ? 170  TYR B CD1 1 
ATOM   5274  C CD2 . TYR B 1 150 ? 3.849   15.812  87.729  1.00 13.32  ? 170  TYR B CD2 1 
ATOM   5275  C CE1 . TYR B 1 150 ? 4.161   14.279  90.004  1.00 11.95  ? 170  TYR B CE1 1 
ATOM   5276  C CE2 . TYR B 1 150 ? 3.818   16.420  88.967  1.00 12.97  ? 170  TYR B CE2 1 
ATOM   5277  C CZ  . TYR B 1 150 ? 3.975   15.650  90.103  1.00 14.38  ? 170  TYR B CZ  1 
ATOM   5278  O OH  . TYR B 1 150 ? 3.960   16.264  91.339  1.00 17.29  ? 170  TYR B OH  1 
ATOM   5279  N N   . ARG B 1 151 ? 5.793   15.493  84.211  1.00 9.84   ? 171  ARG B N   1 
ATOM   5280  C CA  . ARG B 1 151 ? 6.309   16.781  83.756  1.00 8.21   ? 171  ARG B CA  1 
ATOM   5281  C C   . ARG B 1 151 ? 5.975   17.930  84.682  1.00 8.88   ? 171  ARG B C   1 
ATOM   5282  O O   . ARG B 1 151 ? 4.831   18.102  85.099  1.00 9.11   ? 171  ARG B O   1 
ATOM   5283  C CB  . ARG B 1 151 ? 5.813   17.077  82.342  1.00 5.61   ? 171  ARG B CB  1 
ATOM   5284  C CG  . ARG B 1 151 ? 6.637   16.358  81.289  1.00 5.06   ? 171  ARG B CG  1 
ATOM   5285  C CD  . ARG B 1 151 ? 6.073   16.510  79.911  1.00 3.37   ? 171  ARG B CD  1 
ATOM   5286  N NE  . ARG B 1 151 ? 4.929   15.637  79.720  1.00 3.16   ? 171  ARG B NE  1 
ATOM   5287  C CZ  . ARG B 1 151 ? 4.123   15.690  78.669  1.00 4.11   ? 171  ARG B CZ  1 
ATOM   5288  N NH1 . ARG B 1 151 ? 4.333   16.580  77.703  1.00 3.99   ? 171  ARG B NH1 1 
ATOM   5289  N NH2 . ARG B 1 151 ? 3.105   14.849  78.586  1.00 4.90   ? 171  ARG B NH2 1 
ATOM   5290  N N   . LEU B 1 152 ? 6.990   18.721  85.000  1.00 10.00  ? 172  LEU B N   1 
ATOM   5291  C CA  . LEU B 1 152 ? 6.815   19.846  85.904  1.00 12.50  ? 172  LEU B CA  1 
ATOM   5292  C C   . LEU B 1 152 ? 6.988   21.194  85.205  1.00 13.94  ? 172  LEU B C   1 
ATOM   5293  O O   . LEU B 1 152 ? 7.412   21.257  84.049  1.00 15.21  ? 172  LEU B O   1 
ATOM   5294  C CB  . LEU B 1 152 ? 7.815   19.723  87.062  1.00 11.12  ? 172  LEU B CB  1 
ATOM   5295  C CG  . LEU B 1 152 ? 7.869   18.349  87.745  1.00 9.03   ? 172  LEU B CG  1 
ATOM   5296  C CD1 . LEU B 1 152 ? 9.098   18.255  88.613  1.00 9.46   ? 172  LEU B CD1 1 
ATOM   5297  C CD2 . LEU B 1 152 ? 6.622   18.127  88.566  1.00 8.62   ? 172  LEU B CD2 1 
ATOM   5298  N N   . GLY B 1 153 ? 6.645   22.262  85.922  1.00 14.87  ? 173  GLY B N   1 
ATOM   5299  C CA  . GLY B 1 153 ? 6.771   23.614  85.402  1.00 16.91  ? 173  GLY B CA  1 
ATOM   5300  C C   . GLY B 1 153 ? 6.201   23.867  84.020  1.00 17.70  ? 173  GLY B C   1 
ATOM   5301  O O   . GLY B 1 153 ? 5.111   23.393  83.695  1.00 19.37  ? 173  GLY B O   1 
ATOM   5302  N N   . ILE B 1 154 ? 6.942   24.622  83.209  1.00 16.82  ? 174  ILE B N   1 
ATOM   5303  C CA  . ILE B 1 154 ? 6.519   24.946  81.851  1.00 16.36  ? 174  ILE B CA  1 
ATOM   5304  C C   . ILE B 1 154 ? 6.225   23.683  81.052  1.00 14.31  ? 174  ILE B C   1 
ATOM   5305  O O   . ILE B 1 154 ? 5.201   23.579  80.375  1.00 13.01  ? 174  ILE B O   1 
ATOM   5306  C CB  . ILE B 1 154 ? 7.607   25.774  81.117  1.00 18.15  ? 174  ILE B CB  1 
ATOM   5307  C CG1 . ILE B 1 154 ? 7.775   27.126  81.813  1.00 20.86  ? 174  ILE B CG1 1 
ATOM   5308  C CG2 . ILE B 1 154 ? 7.219   26.011  79.660  1.00 18.67  ? 174  ILE B CG2 1 
ATOM   5309  C CD1 . ILE B 1 154 ? 8.816   28.025  81.170  1.00 21.10  ? 174  ILE B CD1 1 
ATOM   5310  N N   . TRP B 1 155 ? 7.127   22.717  81.151  1.00 13.54  ? 175  TRP B N   1 
ATOM   5311  C CA  . TRP B 1 155 ? 6.989   21.459  80.437  1.00 11.78  ? 175  TRP B CA  1 
ATOM   5312  C C   . TRP B 1 155 ? 5.691   20.693  80.684  1.00 11.30  ? 175  TRP B C   1 
ATOM   5313  O O   . TRP B 1 155 ? 5.208   19.993  79.797  1.00 10.28  ? 175  TRP B O   1 
ATOM   5314  C CB  . TRP B 1 155 ? 8.165   20.565  80.781  1.00 10.20  ? 175  TRP B CB  1 
ATOM   5315  C CG  . TRP B 1 155 ? 9.467   21.121  80.335  1.00 11.96  ? 175  TRP B CG  1 
ATOM   5316  C CD1 . TRP B 1 155 ? 10.107  20.885  79.142  1.00 11.58  ? 175  TRP B CD1 1 
ATOM   5317  C CD2 . TRP B 1 155 ? 10.314  21.995  81.077  1.00 11.20  ? 175  TRP B CD2 1 
ATOM   5318  N NE1 . TRP B 1 155 ? 11.303  21.557  79.108  1.00 10.60  ? 175  TRP B NE1 1 
ATOM   5319  C CE2 . TRP B 1 155 ? 11.455  22.247  80.284  1.00 11.46  ? 175  TRP B CE2 1 
ATOM   5320  C CE3 . TRP B 1 155 ? 10.221  22.592  82.337  1.00 10.41  ? 175  TRP B CE3 1 
ATOM   5321  C CZ2 . TRP B 1 155 ? 12.494  23.070  80.716  1.00 10.51  ? 175  TRP B CZ2 1 
ATOM   5322  C CZ3 . TRP B 1 155 ? 11.259  23.413  82.763  1.00 10.75  ? 175  TRP B CZ3 1 
ATOM   5323  C CH2 . TRP B 1 155 ? 12.377  23.642  81.955  1.00 9.44   ? 175  TRP B CH2 1 
ATOM   5324  N N   . GLY B 1 156 ? 5.117   20.816  81.874  1.00 10.06  ? 176  GLY B N   1 
ATOM   5325  C CA  . GLY B 1 156 ? 3.904   20.070  82.134  1.00 10.85  ? 176  GLY B CA  1 
ATOM   5326  C C   . GLY B 1 156 ? 2.632   20.867  82.330  1.00 12.01  ? 176  GLY B C   1 
ATOM   5327  O O   . GLY B 1 156 ? 1.540   20.287  82.396  1.00 10.56  ? 176  GLY B O   1 
ATOM   5328  N N   . PHE B 1 157 ? 2.748   22.190  82.402  1.00 13.33  ? 177  PHE B N   1 
ATOM   5329  C CA  . PHE B 1 157 ? 1.564   23.005  82.636  1.00 12.99  ? 177  PHE B CA  1 
ATOM   5330  C C   . PHE B 1 157 ? 1.405   24.286  81.825  1.00 12.94  ? 177  PHE B C   1 
ATOM   5331  O O   . PHE B 1 157 ? 0.466   25.052  82.050  1.00 13.97  ? 177  PHE B O   1 
ATOM   5332  C CB  . PHE B 1 157 ? 1.459   23.279  84.138  1.00 10.83  ? 177  PHE B CB  1 
ATOM   5333  C CG  . PHE B 1 157 ? 1.311   22.026  84.946  1.00 10.54  ? 177  PHE B CG  1 
ATOM   5334  C CD1 . PHE B 1 157 ? 0.083   21.376  85.018  1.00 11.09  ? 177  PHE B CD1 1 
ATOM   5335  C CD2 . PHE B 1 157 ? 2.419   21.430  85.544  1.00 11.62  ? 177  PHE B CD2 1 
ATOM   5336  C CE1 . PHE B 1 157 ? -0.044  20.148  85.668  1.00 11.58  ? 177  PHE B CE1 1 
ATOM   5337  C CE2 . PHE B 1 157 ? 2.306   20.204  86.197  1.00 12.09  ? 177  PHE B CE2 1 
ATOM   5338  C CZ  . PHE B 1 157 ? 1.068   19.560  86.255  1.00 12.18  ? 177  PHE B CZ  1 
ATOM   5339  N N   . PHE B 1 158 ? 2.301   24.522  80.875  1.00 12.70  ? 178  PHE B N   1 
ATOM   5340  C CA  . PHE B 1 158 ? 2.164   25.705  80.039  1.00 13.73  ? 178  PHE B CA  1 
ATOM   5341  C C   . PHE B 1 158 ? 0.850   25.578  79.264  1.00 14.61  ? 178  PHE B C   1 
ATOM   5342  O O   . PHE B 1 158 ? 0.562   24.539  78.661  1.00 15.52  ? 178  PHE B O   1 
ATOM   5343  C CB  . PHE B 1 158 ? 3.336   25.819  79.064  1.00 12.76  ? 178  PHE B CB  1 
ATOM   5344  C CG  . PHE B 1 158 ? 3.142   26.871  78.022  1.00 12.59  ? 178  PHE B CG  1 
ATOM   5345  C CD1 . PHE B 1 158 ? 2.538   26.561  76.812  1.00 13.73  ? 178  PHE B CD1 1 
ATOM   5346  C CD2 . PHE B 1 158 ? 3.514   28.188  78.272  1.00 13.48  ? 178  PHE B CD2 1 
ATOM   5347  C CE1 . PHE B 1 158 ? 2.302   27.549  75.859  1.00 15.08  ? 178  PHE B CE1 1 
ATOM   5348  C CE2 . PHE B 1 158 ? 3.286   29.185  77.336  1.00 13.40  ? 178  PHE B CE2 1 
ATOM   5349  C CZ  . PHE B 1 158 ? 2.676   28.867  76.121  1.00 14.57  ? 178  PHE B CZ  1 
ATOM   5350  N N   . SER B 1 159 ? 0.044   26.628  79.283  1.00 15.33  ? 179  SER B N   1 
ATOM   5351  C CA  . SER B 1 159 ? -1.233  26.577  78.582  1.00 17.08  ? 179  SER B CA  1 
ATOM   5352  C C   . SER B 1 159 ? -1.613  27.886  77.926  1.00 18.11  ? 179  SER B C   1 
ATOM   5353  O O   . SER B 1 159 ? -1.501  28.953  78.530  1.00 20.81  ? 179  SER B O   1 
ATOM   5354  C CB  . SER B 1 159 ? -2.351  26.178  79.537  1.00 15.32  ? 179  SER B CB  1 
ATOM   5355  O OG  . SER B 1 159 ? -3.605  26.393  78.926  1.00 14.90  ? 179  SER B OG  1 
ATOM   5356  N N   . THR B 1 160 ? -2.077  27.795  76.688  1.00 18.08  ? 180  THR B N   1 
ATOM   5357  C CA  . THR B 1 160 ? -2.490  28.976  75.948  1.00 18.88  ? 180  THR B CA  1 
ATOM   5358  C C   . THR B 1 160 ? -3.994  29.155  76.116  1.00 18.50  ? 180  THR B C   1 
ATOM   5359  O O   . THR B 1 160 ? -4.580  30.100  75.592  1.00 19.71  ? 180  THR B O   1 
ATOM   5360  C CB  . THR B 1 160 ? -2.148  28.844  74.446  1.00 18.59  ? 180  THR B CB  1 
ATOM   5361  O OG1 . THR B 1 160 ? -2.789  27.681  73.902  1.00 17.79  ? 180  THR B OG1 1 
ATOM   5362  C CG2 . THR B 1 160 ? -0.647  28.720  74.257  1.00 17.45  ? 180  THR B CG2 1 
ATOM   5363  N N   . GLY B 1 161 ? -4.612  28.242  76.855  1.00 17.44  ? 181  GLY B N   1 
ATOM   5364  C CA  . GLY B 1 161 ? -6.041  28.323  77.079  1.00 17.15  ? 181  GLY B CA  1 
ATOM   5365  C C   . GLY B 1 161 ? -6.881  27.945  75.874  1.00 17.35  ? 181  GLY B C   1 
ATOM   5366  O O   . GLY B 1 161 ? -8.083  28.192  75.850  1.00 16.71  ? 181  GLY B O   1 
ATOM   5367  N N   . ASP B 1 162 ? -6.251  27.355  74.865  1.00 18.65  ? 182  ASP B N   1 
ATOM   5368  C CA  . ASP B 1 162 ? -6.966  26.931  73.668  1.00 17.89  ? 182  ASP B CA  1 
ATOM   5369  C C   . ASP B 1 162 ? -6.449  25.580  73.149  1.00 17.28  ? 182  ASP B C   1 
ATOM   5370  O O   . ASP B 1 162 ? -5.614  24.933  73.782  1.00 16.02  ? 182  ASP B O   1 
ATOM   5371  C CB  . ASP B 1 162 ? -6.857  28.006  72.594  1.00 19.96  ? 182  ASP B CB  1 
ATOM   5372  C CG  . ASP B 1 162 ? -5.448  28.174  72.077  1.00 22.99  ? 182  ASP B CG  1 
ATOM   5373  O OD1 . ASP B 1 162 ? -5.213  29.152  71.336  1.00 23.74  ? 182  ASP B OD1 1 
ATOM   5374  O OD2 . ASP B 1 162 ? -4.580  27.331  72.395  1.00 24.49  ? 182  ASP B OD2 1 
ATOM   5375  N N   . GLU B 1 163 ? -6.935  25.158  71.991  1.00 17.49  ? 183  GLU B N   1 
ATOM   5376  C CA  . GLU B 1 163 ? -6.542  23.864  71.445  1.00 18.05  ? 183  GLU B CA  1 
ATOM   5377  C C   . GLU B 1 163 ? -5.091  23.729  70.984  1.00 18.11  ? 183  GLU B C   1 
ATOM   5378  O O   . GLU B 1 163 ? -4.677  22.642  70.583  1.00 18.02  ? 183  GLU B O   1 
ATOM   5379  C CB  . GLU B 1 163 ? -7.480  23.470  70.291  1.00 19.48  ? 183  GLU B CB  1 
ATOM   5380  C CG  . GLU B 1 163 ? -7.326  24.300  69.003  1.00 22.23  ? 183  GLU B CG  1 
ATOM   5381  C CD  . GLU B 1 163 ? -7.921  25.704  69.088  1.00 22.07  ? 183  GLU B CD  1 
ATOM   5382  O OE1 . GLU B 1 163 ? -7.731  26.481  68.133  1.00 22.31  ? 183  GLU B OE1 1 
ATOM   5383  O OE2 . GLU B 1 163 ? -8.580  26.031  70.095  1.00 23.20  ? 183  GLU B OE2 1 
ATOM   5384  N N   . HIS B 1 164 ? -4.313  24.808  71.035  1.00 17.63  ? 184  HIS B N   1 
ATOM   5385  C CA  . HIS B 1 164 ? -2.924  24.728  70.594  1.00 17.16  ? 184  HIS B CA  1 
ATOM   5386  C C   . HIS B 1 164 ? -1.992  24.251  71.692  1.00 17.70  ? 184  HIS B C   1 
ATOM   5387  O O   . HIS B 1 164 ? -0.884  23.798  71.426  1.00 19.75  ? 184  HIS B O   1 
ATOM   5388  C CB  . HIS B 1 164 ? -2.476  26.074  70.037  1.00 16.31  ? 184  HIS B CB  1 
ATOM   5389  C CG  . HIS B 1 164 ? -3.232  26.476  68.810  1.00 18.37  ? 184  HIS B CG  1 
ATOM   5390  N ND1 . HIS B 1 164 ? -3.269  25.693  67.676  1.00 17.78  ? 184  HIS B ND1 1 
ATOM   5391  C CD2 . HIS B 1 164 ? -4.041  27.532  68.562  1.00 18.72  ? 184  HIS B CD2 1 
ATOM   5392  C CE1 . HIS B 1 164 ? -4.072  26.247  66.786  1.00 16.97  ? 184  HIS B CE1 1 
ATOM   5393  N NE2 . HIS B 1 164 ? -4.554  27.363  67.298  1.00 17.06  ? 184  HIS B NE2 1 
ATOM   5394  N N   . SER B 1 165 ? -2.464  24.330  72.928  1.00 17.96  ? 185  SER B N   1 
ATOM   5395  C CA  . SER B 1 165 ? -1.698  23.899  74.089  1.00 16.85  ? 185  SER B CA  1 
ATOM   5396  C C   . SER B 1 165 ? -2.636  23.936  75.302  1.00 15.76  ? 185  SER B C   1 
ATOM   5397  O O   . SER B 1 165 ? -2.482  24.767  76.197  1.00 16.37  ? 185  SER B O   1 
ATOM   5398  C CB  . SER B 1 165 ? -0.496  24.832  74.297  1.00 16.33  ? 185  SER B CB  1 
ATOM   5399  O OG  . SER B 1 165 ? 0.275   24.440  75.417  1.00 16.42  ? 185  SER B OG  1 
ATOM   5400  N N   . ARG B 1 166 ? -3.616  23.039  75.319  1.00 15.11  ? 186  ARG B N   1 
ATOM   5401  C CA  . ARG B 1 166 ? -4.574  22.991  76.415  1.00 15.59  ? 186  ARG B CA  1 
ATOM   5402  C C   . ARG B 1 166 ? -3.909  23.090  77.775  1.00 16.30  ? 186  ARG B C   1 
ATOM   5403  O O   . ARG B 1 166 ? -4.346  23.870  78.623  1.00 16.31  ? 186  ARG B O   1 
ATOM   5404  C CB  . ARG B 1 166 ? -5.398  21.712  76.360  1.00 14.30  ? 186  ARG B CB  1 
ATOM   5405  C CG  . ARG B 1 166 ? -6.429  21.695  75.265  1.00 14.77  ? 186  ARG B CG  1 
ATOM   5406  C CD  . ARG B 1 166 ? -7.330  20.484  75.419  1.00 18.41  ? 186  ARG B CD  1 
ATOM   5407  N NE  . ARG B 1 166 ? -8.506  20.575  74.565  1.00 19.26  ? 186  ARG B NE  1 
ATOM   5408  C CZ  . ARG B 1 166 ? -8.474  20.471  73.244  1.00 20.12  ? 186  ARG B CZ  1 
ATOM   5409  N NH1 . ARG B 1 166 ? -7.320  20.262  72.618  1.00 19.11  ? 186  ARG B NH1 1 
ATOM   5410  N NH2 . ARG B 1 166 ? -9.596  20.601  72.550  1.00 21.17  ? 186  ARG B NH2 1 
ATOM   5411  N N   . GLY B 1 167 ? -2.857  22.294  77.972  1.00 16.25  ? 187  GLY B N   1 
ATOM   5412  C CA  . GLY B 1 167 ? -2.139  22.284  79.236  1.00 14.50  ? 187  GLY B CA  1 
ATOM   5413  C C   . GLY B 1 167 ? -2.329  20.967  79.975  1.00 14.88  ? 187  GLY B C   1 
ATOM   5414  O O   . GLY B 1 167 ? -2.772  19.981  79.386  1.00 13.95  ? 187  GLY B O   1 
ATOM   5415  N N   . ASN B 1 168 ? -1.986  20.951  81.262  1.00 15.77  ? 188  ASN B N   1 
ATOM   5416  C CA  . ASN B 1 168 ? -2.116  19.766  82.114  1.00 15.95  ? 188  ASN B CA  1 
ATOM   5417  C C   . ASN B 1 168 ? -1.371  18.537  81.624  1.00 14.76  ? 188  ASN B C   1 
ATOM   5418  O O   . ASN B 1 168 ? -1.820  17.403  81.826  1.00 13.60  ? 188  ASN B O   1 
ATOM   5419  C CB  . ASN B 1 168 ? -3.585  19.392  82.289  1.00 18.09  ? 188  ASN B CB  1 
ATOM   5420  C CG  . ASN B 1 168 ? -4.360  20.426  83.057  1.00 20.38  ? 188  ASN B CG  1 
ATOM   5421  O OD1 . ASN B 1 168 ? -3.820  21.097  83.940  1.00 20.42  ? 188  ASN B OD1 1 
ATOM   5422  N ND2 . ASN B 1 168 ? -5.647  20.547  82.746  1.00 22.25  ? 188  ASN B ND2 1 
ATOM   5423  N N   . TRP B 1 169 ? -0.230  18.749  80.987  1.00 14.86  ? 189  TRP B N   1 
ATOM   5424  C CA  . TRP B 1 169 ? 0.542   17.624  80.476  1.00 15.31  ? 189  TRP B CA  1 
ATOM   5425  C C   . TRP B 1 169 ? 1.034   16.792  81.644  1.00 15.24  ? 189  TRP B C   1 
ATOM   5426  O O   . TRP B 1 169 ? 1.047   15.565  81.580  1.00 15.43  ? 189  TRP B O   1 
ATOM   5427  C CB  . TRP B 1 169 ? 1.716   18.129  79.642  1.00 13.07  ? 189  TRP B CB  1 
ATOM   5428  C CG  . TRP B 1 169 ? 1.314   19.267  78.778  1.00 10.51  ? 189  TRP B CG  1 
ATOM   5429  C CD1 . TRP B 1 169 ? 1.713   20.566  78.898  1.00 10.08  ? 189  TRP B CD1 1 
ATOM   5430  C CD2 . TRP B 1 169 ? 0.389   19.228  77.687  1.00 10.26  ? 189  TRP B CD2 1 
ATOM   5431  N NE1 . TRP B 1 169 ? 1.096   21.344  77.947  1.00 11.29  ? 189  TRP B NE1 1 
ATOM   5432  C CE2 . TRP B 1 169 ? 0.277   20.549  77.188  1.00 11.71  ? 189  TRP B CE2 1 
ATOM   5433  C CE3 . TRP B 1 169 ? -0.357  18.210  77.083  1.00 9.30   ? 189  TRP B CE3 1 
ATOM   5434  C CZ2 . TRP B 1 169 ? -0.556  20.878  76.108  1.00 10.03  ? 189  TRP B CZ2 1 
ATOM   5435  C CZ3 . TRP B 1 169 ? -1.183  18.537  76.010  1.00 10.92  ? 189  TRP B CZ3 1 
ATOM   5436  C CH2 . TRP B 1 169 ? -1.274  19.863  75.535  1.00 10.84  ? 189  TRP B CH2 1 
ATOM   5437  N N   . GLY B 1 170 ? 1.425   17.471  82.718  1.00 16.13  ? 190  GLY B N   1 
ATOM   5438  C CA  . GLY B 1 170 ? 1.896   16.768  83.895  1.00 17.02  ? 190  GLY B CA  1 
ATOM   5439  C C   . GLY B 1 170 ? 0.853   15.776  84.373  1.00 17.00  ? 190  GLY B C   1 
ATOM   5440  O O   . GLY B 1 170 ? 1.167   14.605  84.624  1.00 17.04  ? 190  GLY B O   1 
ATOM   5441  N N   . HIS B 1 171 ? -0.390  16.247  84.485  1.00 15.76  ? 191  HIS B N   1 
ATOM   5442  C CA  . HIS B 1 171 ? -1.497  15.412  84.933  1.00 14.98  ? 191  HIS B CA  1 
ATOM   5443  C C   . HIS B 1 171 ? -1.800  14.277  83.958  1.00 14.60  ? 191  HIS B C   1 
ATOM   5444  O O   . HIS B 1 171 ? -2.196  13.182  84.368  1.00 12.89  ? 191  HIS B O   1 
ATOM   5445  C CB  . HIS B 1 171 ? -2.748  16.267  85.144  1.00 15.34  ? 191  HIS B CB  1 
ATOM   5446  C CG  . HIS B 1 171 ? -2.670  17.175  86.338  1.00 17.44  ? 191  HIS B CG  1 
ATOM   5447  N ND1 . HIS B 1 171 ? -2.286  16.733  87.589  1.00 17.08  ? 191  HIS B ND1 1 
ATOM   5448  C CD2 . HIS B 1 171 ? -2.960  18.489  86.479  1.00 16.34  ? 191  HIS B CD2 1 
ATOM   5449  C CE1 . HIS B 1 171 ? -2.342  17.736  88.445  1.00 14.57  ? 191  HIS B CE1 1 
ATOM   5450  N NE2 . HIS B 1 171 ? -2.749  18.813  87.799  1.00 15.84  ? 191  HIS B NE2 1 
ATOM   5451  N N   . LEU B 1 172 ? -1.615  14.537  82.666  1.00 14.71  ? 192  LEU B N   1 
ATOM   5452  C CA  . LEU B 1 172 ? -1.869  13.518  81.657  1.00 12.86  ? 192  LEU B CA  1 
ATOM   5453  C C   . LEU B 1 172 ? -0.823  12.421  81.784  1.00 14.36  ? 192  LEU B C   1 
ATOM   5454  O O   . LEU B 1 172 ? -1.084  11.261  81.441  1.00 14.18  ? 192  LEU B O   1 
ATOM   5455  C CB  . LEU B 1 172 ? -1.825  14.130  80.261  1.00 9.71   ? 192  LEU B CB  1 
ATOM   5456  C CG  . LEU B 1 172 ? -2.935  15.127  79.932  1.00 8.16   ? 192  LEU B CG  1 
ATOM   5457  C CD1 . LEU B 1 172 ? -2.791  15.610  78.496  1.00 4.35   ? 192  LEU B CD1 1 
ATOM   5458  C CD2 . LEU B 1 172 ? -4.283  14.462  80.137  1.00 6.82   ? 192  LEU B CD2 1 
ATOM   5459  N N   . ASP B 1 173 ? 0.361   12.796  82.276  1.00 15.09  ? 193  ASP B N   1 
ATOM   5460  C CA  . ASP B 1 173 ? 1.454   11.847  82.477  1.00 14.92  ? 193  ASP B CA  1 
ATOM   5461  C C   . ASP B 1 173 ? 1.071   10.907  83.618  1.00 14.59  ? 193  ASP B C   1 
ATOM   5462  O O   . ASP B 1 173 ? 1.401   9.722   83.598  1.00 14.19  ? 193  ASP B O   1 
ATOM   5463  C CB  . ASP B 1 173 ? 2.762   12.562  82.847  1.00 16.08  ? 193  ASP B CB  1 
ATOM   5464  C CG  . ASP B 1 173 ? 3.371   13.342  81.686  1.00 17.22  ? 193  ASP B CG  1 
ATOM   5465  O OD1 . ASP B 1 173 ? 3.185   12.952  80.511  1.00 16.89  ? 193  ASP B OD1 1 
ATOM   5466  O OD2 . ASP B 1 173 ? 4.068   14.341  81.960  1.00 17.71  ? 193  ASP B OD2 1 
ATOM   5467  N N   . GLN B 1 174 ? 0.380   11.448  84.620  1.00 14.30  ? 194  GLN B N   1 
ATOM   5468  C CA  . GLN B 1 174 ? -0.062  10.649  85.762  1.00 13.03  ? 194  GLN B CA  1 
ATOM   5469  C C   . GLN B 1 174 ? -1.056  9.589   85.290  1.00 12.92  ? 194  GLN B C   1 
ATOM   5470  O O   . GLN B 1 174 ? -0.953  8.408   85.641  1.00 11.65  ? 194  GLN B O   1 
ATOM   5471  C CB  . GLN B 1 174 ? -0.701  11.556  86.817  1.00 10.59  ? 194  GLN B CB  1 
ATOM   5472  C CG  . GLN B 1 174 ? 0.302   12.191  87.760  1.00 9.39   ? 194  GLN B CG  1 
ATOM   5473  C CD  . GLN B 1 174 ? -0.054  13.619  88.138  1.00 11.73  ? 194  GLN B CD  1 
ATOM   5474  O OE1 . GLN B 1 174 ? -1.230  13.993  88.172  1.00 10.69  ? 194  GLN B OE1 1 
ATOM   5475  N NE2 . GLN B 1 174 ? 0.965   14.424  88.443  1.00 11.00  ? 194  GLN B NE2 1 
ATOM   5476  N N   . VAL B 1 175 ? -2.009  10.019  84.475  1.00 12.85  ? 195  VAL B N   1 
ATOM   5477  C CA  . VAL B 1 175 ? -3.010  9.116   83.942  1.00 13.93  ? 195  VAL B CA  1 
ATOM   5478  C C   . VAL B 1 175 ? -2.355  8.123   82.983  1.00 14.26  ? 195  VAL B C   1 
ATOM   5479  O O   . VAL B 1 175 ? -2.846  7.008   82.787  1.00 16.07  ? 195  VAL B O   1 
ATOM   5480  C CB  . VAL B 1 175 ? -4.098  9.890   83.180  1.00 13.85  ? 195  VAL B CB  1 
ATOM   5481  C CG1 . VAL B 1 175 ? -5.208  8.943   82.762  1.00 13.54  ? 195  VAL B CG1 1 
ATOM   5482  C CG2 . VAL B 1 175 ? -4.641  11.012  84.049  1.00 15.18  ? 195  VAL B CG2 1 
ATOM   5483  N N   . ALA B 1 176 ? -1.248  8.539   82.381  1.00 13.05  ? 196  ALA B N   1 
ATOM   5484  C CA  . ALA B 1 176 ? -0.536  7.688   81.447  1.00 10.42  ? 196  ALA B CA  1 
ATOM   5485  C C   . ALA B 1 176 ? 0.208   6.628   82.232  1.00 10.22  ? 196  ALA B C   1 
ATOM   5486  O O   . ALA B 1 176 ? 0.272   5.470   81.822  1.00 10.76  ? 196  ALA B O   1 
ATOM   5487  C CB  . ALA B 1 176 ? 0.433   8.519   80.628  1.00 10.56  ? 196  ALA B CB  1 
ATOM   5488  N N   . ALA B 1 177 ? 0.774   7.033   83.367  1.00 11.04  ? 197  ALA B N   1 
ATOM   5489  C CA  . ALA B 1 177 ? 1.507   6.116   84.229  1.00 10.96  ? 197  ALA B CA  1 
ATOM   5490  C C   . ALA B 1 177 ? 0.519   5.104   84.817  1.00 12.54  ? 197  ALA B C   1 
ATOM   5491  O O   . ALA B 1 177 ? 0.832   3.921   84.956  1.00 13.01  ? 197  ALA B O   1 
ATOM   5492  C CB  . ALA B 1 177 ? 2.202   6.883   85.332  1.00 8.12   ? 197  ALA B CB  1 
ATOM   5493  N N   . LEU B 1 178 ? -0.682  5.564   85.154  1.00 13.13  ? 198  LEU B N   1 
ATOM   5494  C CA  . LEU B 1 178 ? -1.682  4.661   85.699  1.00 14.91  ? 198  LEU B CA  1 
ATOM   5495  C C   . LEU B 1 178 ? -2.093  3.563   84.712  1.00 16.87  ? 198  LEU B C   1 
ATOM   5496  O O   . LEU B 1 178 ? -2.300  2.416   85.118  1.00 17.94  ? 198  LEU B O   1 
ATOM   5497  C CB  . LEU B 1 178 ? -2.910  5.443   86.161  1.00 14.29  ? 198  LEU B CB  1 
ATOM   5498  C CG  . LEU B 1 178 ? -2.690  6.158   87.494  1.00 14.74  ? 198  LEU B CG  1 
ATOM   5499  C CD1 . LEU B 1 178 ? -3.952  6.901   87.889  1.00 13.16  ? 198  LEU B CD1 1 
ATOM   5500  C CD2 . LEU B 1 178 ? -2.297  5.139   88.568  1.00 12.27  ? 198  LEU B CD2 1 
ATOM   5501  N N   . ARG B 1 179 ? -2.221  3.898   83.427  1.00 17.35  ? 199  ARG B N   1 
ATOM   5502  C CA  . ARG B 1 179 ? -2.587  2.889   82.436  1.00 18.03  ? 199  ARG B CA  1 
ATOM   5503  C C   . ARG B 1 179 ? -1.494  1.842   82.353  1.00 17.84  ? 199  ARG B C   1 
ATOM   5504  O O   . ARG B 1 179 ? -1.775  0.649   82.210  1.00 17.95  ? 199  ARG B O   1 
ATOM   5505  C CB  . ARG B 1 179 ? -2.749  3.492   81.055  1.00 19.92  ? 199  ARG B CB  1 
ATOM   5506  C CG  . ARG B 1 179 ? -3.948  4.344   80.882  1.00 27.24  ? 199  ARG B CG  1 
ATOM   5507  C CD  . ARG B 1 179 ? -3.948  4.933   79.485  1.00 34.02  ? 199  ARG B CD  1 
ATOM   5508  N NE  . ARG B 1 179 ? -5.051  5.870   79.317  1.00 39.57  ? 199  ARG B NE  1 
ATOM   5509  C CZ  . ARG B 1 179 ? -6.331  5.526   79.397  1.00 41.51  ? 199  ARG B CZ  1 
ATOM   5510  N NH1 . ARG B 1 179 ? -6.664  4.260   79.635  1.00 41.75  ? 199  ARG B NH1 1 
ATOM   5511  N NH2 . ARG B 1 179 ? -7.274  6.454   79.266  1.00 43.17  ? 199  ARG B NH2 1 
ATOM   5512  N N   . TRP B 1 180 ? -0.243  2.293   82.422  1.00 16.71  ? 200  TRP B N   1 
ATOM   5513  C CA  . TRP B 1 180 ? 0.887   1.376   82.351  1.00 16.34  ? 200  TRP B CA  1 
ATOM   5514  C C   . TRP B 1 180 ? 0.768   0.345   83.474  1.00 17.45  ? 200  TRP B C   1 
ATOM   5515  O O   . TRP B 1 180 ? 1.048   -0.845  83.277  1.00 17.31  ? 200  TRP B O   1 
ATOM   5516  C CB  . TRP B 1 180 ? 2.205   2.138   82.495  1.00 14.73  ? 200  TRP B CB  1 
ATOM   5517  C CG  . TRP B 1 180 ? 3.398   1.262   82.271  1.00 10.75  ? 200  TRP B CG  1 
ATOM   5518  C CD1 . TRP B 1 180 ? 4.092   1.105   81.107  1.00 8.92   ? 200  TRP B CD1 1 
ATOM   5519  C CD2 . TRP B 1 180 ? 4.008   0.389   83.225  1.00 9.92   ? 200  TRP B CD2 1 
ATOM   5520  N NE1 . TRP B 1 180 ? 5.095   0.190   81.275  1.00 9.87   ? 200  TRP B NE1 1 
ATOM   5521  C CE2 . TRP B 1 180 ? 5.068   -0.269  82.570  1.00 10.20  ? 200  TRP B CE2 1 
ATOM   5522  C CE3 . TRP B 1 180 ? 3.762   0.096   84.575  1.00 8.43   ? 200  TRP B CE3 1 
ATOM   5523  C CZ2 . TRP B 1 180 ? 5.888   -1.203  83.217  1.00 7.92   ? 200  TRP B CZ2 1 
ATOM   5524  C CZ3 . TRP B 1 180 ? 4.578   -0.832  85.217  1.00 7.41   ? 200  TRP B CZ3 1 
ATOM   5525  C CH2 . TRP B 1 180 ? 5.626   -1.468  84.537  1.00 6.97   ? 200  TRP B CH2 1 
ATOM   5526  N N   . VAL B 1 181 ? 0.364   0.828   84.650  1.00 17.32  ? 201  VAL B N   1 
ATOM   5527  C CA  . VAL B 1 181 ? 0.167   -0.003  85.826  1.00 15.61  ? 201  VAL B CA  1 
ATOM   5528  C C   . VAL B 1 181 ? -0.898  -1.046  85.496  1.00 16.93  ? 201  VAL B C   1 
ATOM   5529  O O   . VAL B 1 181 ? -0.704  -2.241  85.708  1.00 17.47  ? 201  VAL B O   1 
ATOM   5530  C CB  . VAL B 1 181 ? -0.284  0.865   87.019  1.00 14.49  ? 201  VAL B CB  1 
ATOM   5531  C CG1 . VAL B 1 181 ? -0.918  0.010   88.091  1.00 15.35  ? 201  VAL B CG1 1 
ATOM   5532  C CG2 . VAL B 1 181 ? 0.909   1.609   87.585  1.00 12.30  ? 201  VAL B CG2 1 
ATOM   5533  N N   . GLN B 1 182 ? -2.017  -0.589  84.948  1.00 18.82  ? 202  GLN B N   1 
ATOM   5534  C CA  . GLN B 1 182 ? -3.106  -1.485  84.578  1.00 20.19  ? 202  GLN B CA  1 
ATOM   5535  C C   . GLN B 1 182 ? -2.702  -2.571  83.586  1.00 19.97  ? 202  GLN B C   1 
ATOM   5536  O O   . GLN B 1 182 ? -3.190  -3.695  83.677  1.00 21.70  ? 202  GLN B O   1 
ATOM   5537  C CB  . GLN B 1 182 ? -4.278  -0.692  83.997  1.00 20.20  ? 202  GLN B CB  1 
ATOM   5538  C CG  . GLN B 1 182 ? -5.032  0.161   85.019  1.00 23.19  ? 202  GLN B CG  1 
ATOM   5539  C CD  . GLN B 1 182 ? -5.800  -0.666  86.045  1.00 22.75  ? 202  GLN B CD  1 
ATOM   5540  O OE1 . GLN B 1 182 ? -6.692  -1.435  85.694  1.00 22.51  ? 202  GLN B OE1 1 
ATOM   5541  N NE2 . GLN B 1 182 ? -5.457  -0.503  87.319  1.00 22.02  ? 202  GLN B NE2 1 
ATOM   5542  N N   . ASP B 1 183 ? -1.817  -2.251  82.648  1.00 18.27  ? 203  ASP B N   1 
ATOM   5543  C CA  . ASP B 1 183 ? -1.406  -3.239  81.660  1.00 17.68  ? 203  ASP B CA  1 
ATOM   5544  C C   . ASP B 1 183 ? -0.201  -4.078  82.034  1.00 18.85  ? 203  ASP B C   1 
ATOM   5545  O O   . ASP B 1 183 ? 0.054   -5.105  81.398  1.00 18.73  ? 203  ASP B O   1 
ATOM   5546  C CB  . ASP B 1 183 ? -1.079  -2.580  80.325  1.00 17.71  ? 203  ASP B CB  1 
ATOM   5547  C CG  . ASP B 1 183 ? -2.251  -1.867  79.722  1.00 18.83  ? 203  ASP B CG  1 
ATOM   5548  O OD1 . ASP B 1 183 ? -3.402  -2.286  79.966  1.00 18.71  ? 203  ASP B OD1 1 
ATOM   5549  O OD2 . ASP B 1 183 ? -2.013  -0.888  78.983  1.00 20.45  ? 203  ASP B OD2 1 
ATOM   5550  N N   . ASN B 1 184 ? 0.548   -3.666  83.050  1.00 19.55  ? 204  ASN B N   1 
ATOM   5551  C CA  . ASN B 1 184 ? 1.753   -4.409  83.388  1.00 20.60  ? 204  ASN B CA  1 
ATOM   5552  C C   . ASN B 1 184 ? 1.934   -4.907  84.814  1.00 21.17  ? 204  ASN B C   1 
ATOM   5553  O O   . ASN B 1 184 ? 2.465   -6.003  85.022  1.00 22.39  ? 204  ASN B O   1 
ATOM   5554  C CB  . ASN B 1 184 ? 2.982   -3.573  83.007  1.00 20.35  ? 204  ASN B CB  1 
ATOM   5555  C CG  . ASN B 1 184 ? 3.171   -3.457  81.506  1.00 21.56  ? 204  ASN B CG  1 
ATOM   5556  O OD1 . ASN B 1 184 ? 3.590   -4.408  80.846  1.00 23.57  ? 204  ASN B OD1 1 
ATOM   5557  N ND2 . ASN B 1 184 ? 2.859   -2.292  80.959  1.00 21.12  ? 204  ASN B ND2 1 
ATOM   5558  N N   . ILE B 1 185 ? 1.496   -4.117  85.791  1.00 20.23  ? 205  ILE B N   1 
ATOM   5559  C CA  . ILE B 1 185 ? 1.688   -4.465  87.194  1.00 19.71  ? 205  ILE B CA  1 
ATOM   5560  C C   . ILE B 1 185 ? 1.456   -5.935  87.593  1.00 20.61  ? 205  ILE B C   1 
ATOM   5561  O O   . ILE B 1 185 ? 2.035   -6.412  88.574  1.00 20.53  ? 205  ILE B O   1 
ATOM   5562  C CB  . ILE B 1 185 ? 0.867   -3.526  88.109  1.00 16.49  ? 205  ILE B CB  1 
ATOM   5563  C CG1 . ILE B 1 185 ? 1.631   -3.299  89.412  1.00 16.04  ? 205  ILE B CG1 1 
ATOM   5564  C CG2 . ILE B 1 185 ? -0.500  -4.118  88.394  1.00 16.46  ? 205  ILE B CG2 1 
ATOM   5565  C CD1 . ILE B 1 185 ? 3.044   -2.740  89.218  1.00 13.51  ? 205  ILE B CD1 1 
ATOM   5566  N N   . ALA B 1 186 ? 0.638   -6.658  86.830  1.00 20.87  ? 206  ALA B N   1 
ATOM   5567  C CA  . ALA B 1 186 ? 0.372   -8.065  87.130  1.00 20.48  ? 206  ALA B CA  1 
ATOM   5568  C C   . ALA B 1 186 ? 1.642   -8.895  87.000  1.00 21.41  ? 206  ALA B C   1 
ATOM   5569  O O   . ALA B 1 186 ? 1.753   -9.958  87.605  1.00 21.72  ? 206  ALA B O   1 
ATOM   5570  C CB  . ALA B 1 186 ? -0.692  -8.606  86.202  1.00 20.12  ? 206  ALA B CB  1 
ATOM   5571  N N   . SER B 1 187 ? 2.593   -8.403  86.206  1.00 22.61  ? 207  SER B N   1 
ATOM   5572  C CA  . SER B 1 187 ? 3.871   -9.081  85.995  1.00 22.59  ? 207  SER B CA  1 
ATOM   5573  C C   . SER B 1 187 ? 4.811   -8.871  87.174  1.00 22.60  ? 207  SER B C   1 
ATOM   5574  O O   . SER B 1 187 ? 5.867   -9.495  87.256  1.00 23.50  ? 207  SER B O   1 
ATOM   5575  C CB  . SER B 1 187 ? 4.552   -8.556  84.734  1.00 22.87  ? 207  SER B CB  1 
ATOM   5576  O OG  . SER B 1 187 ? 3.776   -8.827  83.590  1.00 27.09  ? 207  SER B OG  1 
ATOM   5577  N N   . PHE B 1 188 ? 4.439   -7.975  88.080  1.00 22.47  ? 208  PHE B N   1 
ATOM   5578  C CA  . PHE B 1 188 ? 5.270   -7.719  89.240  1.00 22.37  ? 208  PHE B CA  1 
ATOM   5579  C C   . PHE B 1 188 ? 4.578   -8.212  90.502  1.00 22.76  ? 208  PHE B C   1 
ATOM   5580  O O   . PHE B 1 188 ? 4.973   -7.856  91.614  1.00 24.06  ? 208  PHE B O   1 
ATOM   5581  C CB  . PHE B 1 188 ? 5.566   -6.228  89.368  1.00 22.08  ? 208  PHE B CB  1 
ATOM   5582  C CG  . PHE B 1 188 ? 6.269   -5.639  88.179  1.00 22.02  ? 208  PHE B CG  1 
ATOM   5583  C CD1 . PHE B 1 188 ? 5.550   -5.240  87.054  1.00 21.68  ? 208  PHE B CD1 1 
ATOM   5584  C CD2 . PHE B 1 188 ? 7.651   -5.474  88.187  1.00 20.96  ? 208  PHE B CD2 1 
ATOM   5585  C CE1 . PHE B 1 188 ? 6.197   -4.683  85.955  1.00 21.27  ? 208  PHE B CE1 1 
ATOM   5586  C CE2 . PHE B 1 188 ? 8.311   -4.919  87.096  1.00 21.36  ? 208  PHE B CE2 1 
ATOM   5587  C CZ  . PHE B 1 188 ? 7.582   -4.522  85.975  1.00 21.82  ? 208  PHE B CZ  1 
ATOM   5588  N N   . GLY B 1 189 ? 3.539   -9.025  90.327  1.00 21.88  ? 209  GLY B N   1 
ATOM   5589  C CA  . GLY B 1 189 ? 2.815   -9.556  91.469  1.00 20.49  ? 209  GLY B CA  1 
ATOM   5590  C C   . GLY B 1 189 ? 1.711   -8.642  91.958  1.00 19.14  ? 209  GLY B C   1 
ATOM   5591  O O   . GLY B 1 189 ? 1.136   -8.854  93.021  1.00 18.86  ? 209  GLY B O   1 
ATOM   5592  N N   . GLY B 1 190 ? 1.402   -7.623  91.171  1.00 19.71  ? 210  GLY B N   1 
ATOM   5593  C CA  . GLY B 1 190 ? 0.366   -6.690  91.559  1.00 20.30  ? 210  GLY B CA  1 
ATOM   5594  C C   . GLY B 1 190 ? -1.008  -7.043  91.027  1.00 21.60  ? 210  GLY B C   1 
ATOM   5595  O O   . GLY B 1 190 ? -1.161  -7.862  90.118  1.00 22.81  ? 210  GLY B O   1 
ATOM   5596  N N   . ASN B 1 191 ? -2.022  -6.423  91.615  1.00 21.32  ? 211  ASN B N   1 
ATOM   5597  C CA  . ASN B 1 191 ? -3.393  -6.639  91.198  1.00 20.02  ? 211  ASN B CA  1 
ATOM   5598  C C   . ASN B 1 191 ? -3.892  -5.357  90.546  1.00 19.53  ? 211  ASN B C   1 
ATOM   5599  O O   . ASN B 1 191 ? -4.224  -4.381  91.227  1.00 19.01  ? 211  ASN B O   1 
ATOM   5600  C CB  . ASN B 1 191 ? -4.260  -7.002  92.402  1.00 20.43  ? 211  ASN B CB  1 
ATOM   5601  C CG  . ASN B 1 191 ? -5.736  -7.089  92.055  1.00 21.59  ? 211  ASN B CG  1 
ATOM   5602  O OD1 . ASN B 1 191 ? -6.109  -7.275  90.889  1.00 21.12  ? 211  ASN B OD1 1 
ATOM   5603  N ND2 . ASN B 1 191 ? -6.585  -6.970  93.072  1.00 19.15  ? 211  ASN B ND2 1 
ATOM   5604  N N   . PRO B 1 192 ? -3.934  -5.338  89.207  1.00 18.88  ? 212  PRO B N   1 
ATOM   5605  C CA  . PRO B 1 192 ? -4.399  -4.154  88.479  1.00 18.15  ? 212  PRO B CA  1 
ATOM   5606  C C   . PRO B 1 192 ? -5.801  -3.797  88.920  1.00 17.26  ? 212  PRO B C   1 
ATOM   5607  O O   . PRO B 1 192 ? -6.308  -2.724  88.604  1.00 17.93  ? 212  PRO B O   1 
ATOM   5608  C CB  . PRO B 1 192 ? -4.349  -4.600  87.022  1.00 17.83  ? 212  PRO B CB  1 
ATOM   5609  C CG  . PRO B 1 192 ? -4.584  -6.083  87.120  1.00 18.21  ? 212  PRO B CG  1 
ATOM   5610  C CD  . PRO B 1 192 ? -3.726  -6.472  88.293  1.00 17.50  ? 212  PRO B CD  1 
ATOM   5611  N N   . GLY B 1 193 ? -6.414  -4.711  89.662  1.00 16.07  ? 213  GLY B N   1 
ATOM   5612  C CA  . GLY B 1 193 ? -7.764  -4.495  90.137  1.00 16.18  ? 213  GLY B CA  1 
ATOM   5613  C C   . GLY B 1 193 ? -7.855  -3.869  91.510  1.00 16.11  ? 213  GLY B C   1 
ATOM   5614  O O   . GLY B 1 193 ? -8.950  -3.616  91.999  1.00 16.05  ? 213  GLY B O   1 
ATOM   5615  N N   . SER B 1 194 ? -6.716  -3.628  92.145  1.00 17.30  ? 214  SER B N   1 
ATOM   5616  C CA  . SER B 1 194 ? -6.718  -3.011  93.467  1.00 19.45  ? 214  SER B CA  1 
ATOM   5617  C C   . SER B 1 194 ? -5.613  -1.969  93.525  1.00 19.84  ? 214  SER B C   1 
ATOM   5618  O O   . SER B 1 194 ? -4.662  -2.092  94.296  1.00 22.14  ? 214  SER B O   1 
ATOM   5619  C CB  . SER B 1 194 ? -6.504  -4.059  94.569  1.00 19.53  ? 214  SER B CB  1 
ATOM   5620  O OG  . SER B 1 194 ? -6.684  -3.490  95.863  1.00 17.26  ? 214  SER B OG  1 
ATOM   5621  N N   . VAL B 1 195 ? -5.741  -0.943  92.698  1.00 18.53  ? 215  VAL B N   1 
ATOM   5622  C CA  . VAL B 1 195 ? -4.751  0.109   92.668  1.00 17.89  ? 215  VAL B CA  1 
ATOM   5623  C C   . VAL B 1 195 ? -5.201  1.300   93.502  1.00 17.36  ? 215  VAL B C   1 
ATOM   5624  O O   . VAL B 1 195 ? -6.326  1.783   93.360  1.00 18.22  ? 215  VAL B O   1 
ATOM   5625  C CB  . VAL B 1 195 ? -4.493  0.580   91.232  1.00 17.97  ? 215  VAL B CB  1 
ATOM   5626  C CG1 . VAL B 1 195 ? -3.389  1.615   91.230  1.00 19.63  ? 215  VAL B CG1 1 
ATOM   5627  C CG2 . VAL B 1 195 ? -4.107  -0.603  90.352  1.00 18.71  ? 215  VAL B CG2 1 
ATOM   5628  N N   . THR B 1 196 ? -4.318  1.762   94.380  1.00 15.24  ? 216  THR B N   1 
ATOM   5629  C CA  . THR B 1 196 ? -4.603  2.912   95.223  1.00 14.03  ? 216  THR B CA  1 
ATOM   5630  C C   . THR B 1 196 ? -3.626  4.035   94.902  1.00 14.18  ? 216  THR B C   1 
ATOM   5631  O O   . THR B 1 196 ? -2.419  3.810   94.847  1.00 14.75  ? 216  THR B O   1 
ATOM   5632  C CB  . THR B 1 196 ? -4.462  2.569   96.711  1.00 13.23  ? 216  THR B CB  1 
ATOM   5633  O OG1 . THR B 1 196 ? -5.567  1.763   97.118  1.00 13.05  ? 216  THR B OG1 1 
ATOM   5634  C CG2 . THR B 1 196 ? -4.426  3.835   97.553  1.00 11.30  ? 216  THR B CG2 1 
ATOM   5635  N N   . ILE B 1 197 ? -4.149  5.241   94.686  1.00 14.12  ? 217  ILE B N   1 
ATOM   5636  C CA  . ILE B 1 197 ? -3.301  6.390   94.393  1.00 13.33  ? 217  ILE B CA  1 
ATOM   5637  C C   . ILE B 1 197 ? -3.183  7.292   95.607  1.00 13.32  ? 217  ILE B C   1 
ATOM   5638  O O   . ILE B 1 197 ? -4.187  7.681   96.200  1.00 13.59  ? 217  ILE B O   1 
ATOM   5639  C CB  . ILE B 1 197 ? -3.844  7.227   93.218  1.00 11.83  ? 217  ILE B CB  1 
ATOM   5640  C CG1 . ILE B 1 197 ? -5.322  7.540   93.430  1.00 12.23  ? 217  ILE B CG1 1 
ATOM   5641  C CG2 . ILE B 1 197 ? -3.623  6.488   91.916  1.00 12.53  ? 217  ILE B CG2 1 
ATOM   5642  C CD1 . ILE B 1 197 ? -5.908  8.450   92.367  1.00 11.95  ? 217  ILE B CD1 1 
ATOM   5643  N N   . PHE B 1 198 ? -1.951  7.609   95.989  1.00 14.19  ? 218  PHE B N   1 
ATOM   5644  C CA  . PHE B 1 198 ? -1.731  8.480   97.131  1.00 15.67  ? 218  PHE B CA  1 
ATOM   5645  C C   . PHE B 1 198 ? -0.553  9.412   96.911  1.00 16.51  ? 218  PHE B C   1 
ATOM   5646  O O   . PHE B 1 198 ? 0.481   9.013   96.367  1.00 16.96  ? 218  PHE B O   1 
ATOM   5647  C CB  . PHE B 1 198 ? -1.554  7.657   98.425  1.00 15.18  ? 218  PHE B CB  1 
ATOM   5648  C CG  . PHE B 1 198 ? -0.280  6.847   98.496  1.00 15.35  ? 218  PHE B CG  1 
ATOM   5649  C CD1 . PHE B 1 198 ? 0.167   6.101   97.410  1.00 15.97  ? 218  PHE B CD1 1 
ATOM   5650  C CD2 . PHE B 1 198 ? 0.442   6.783   99.686  1.00 15.48  ? 218  PHE B CD2 1 
ATOM   5651  C CE1 . PHE B 1 198 ? 1.310   5.302   97.512  1.00 15.10  ? 218  PHE B CE1 1 
ATOM   5652  C CE2 . PHE B 1 198 ? 1.582   5.988   99.795  1.00 15.04  ? 218  PHE B CE2 1 
ATOM   5653  C CZ  . PHE B 1 198 ? 2.014   5.247   98.705  1.00 14.55  ? 218  PHE B CZ  1 
ATOM   5654  N N   . GLY B 1 199 ? -0.732  10.665  97.320  1.00 16.81  ? 219  GLY B N   1 
ATOM   5655  C CA  . GLY B 1 199 ? 0.317   11.658  97.173  1.00 18.32  ? 219  GLY B CA  1 
ATOM   5656  C C   . GLY B 1 199 ? 0.274   12.700  98.277  1.00 18.20  ? 219  GLY B C   1 
ATOM   5657  O O   . GLY B 1 199 ? -0.670  12.746  99.057  1.00 19.77  ? 219  GLY B O   1 
ATOM   5658  N N   . GLU B 1 200 ? 1.294   13.550  98.330  1.00 18.30  ? 220  GLU B N   1 
ATOM   5659  C CA  . GLU B 1 200 ? 1.387   14.594  99.343  1.00 18.43  ? 220  GLU B CA  1 
ATOM   5660  C C   . GLU B 1 200 ? 1.534   15.967  98.685  1.00 18.99  ? 220  GLU B C   1 
ATOM   5661  O O   . GLU B 1 200 ? 2.222   16.120  97.668  1.00 19.63  ? 220  GLU B O   1 
ATOM   5662  C CB  . GLU B 1 200 ? 2.590   14.310  100.260 1.00 18.32  ? 220  GLU B CB  1 
ATOM   5663  C CG  . GLU B 1 200 ? 2.752   15.223  101.475 1.00 17.40  ? 220  GLU B CG  1 
ATOM   5664  C CD  . GLU B 1 200 ? 3.708   16.379  101.246 1.00 17.34  ? 220  GLU B CD  1 
ATOM   5665  O OE1 . GLU B 1 200 ? 4.408   16.402  100.215 1.00 20.10  ? 220  GLU B OE1 1 
ATOM   5666  O OE2 . GLU B 1 200 ? 3.772   17.273  102.110 1.00 18.76  ? 220  GLU B OE2 1 
ATOM   5667  N N   . SER B 1 201 ? 0.878   16.964  99.267  1.00 18.89  ? 221  SER B N   1 
ATOM   5668  C CA  . SER B 1 201 ? 0.948   18.319  98.749  1.00 18.74  ? 221  SER B CA  1 
ATOM   5669  C C   . SER B 1 201 ? 0.424   18.360  97.308  1.00 18.72  ? 221  SER B C   1 
ATOM   5670  O O   . SER B 1 201 ? -0.737  17.999  97.042  1.00 16.75  ? 221  SER B O   1 
ATOM   5671  C CB  . SER B 1 201 ? 2.397   18.810  98.803  1.00 18.24  ? 221  SER B CB  1 
ATOM   5672  O OG  . SER B 1 201 ? 2.453   20.221  98.755  1.00 21.27  ? 221  SER B OG  1 
ATOM   5673  N N   . ALA B 1 202 ? 1.279   18.802  96.384  1.00 17.86  ? 222  ALA B N   1 
ATOM   5674  C CA  . ALA B 1 202 ? 0.901   18.890  94.976  1.00 16.24  ? 222  ALA B CA  1 
ATOM   5675  C C   . ALA B 1 202 ? 0.441   17.517  94.506  1.00 15.57  ? 222  ALA B C   1 
ATOM   5676  O O   . ALA B 1 202 ? -0.429  17.401  93.637  1.00 14.38  ? 222  ALA B O   1 
ATOM   5677  C CB  . ALA B 1 202 ? 2.080   19.368  94.143  1.00 16.05  ? 222  ALA B CB  1 
ATOM   5678  N N   . GLY B 1 203 ? 1.041   16.484  95.092  1.00 15.10  ? 223  GLY B N   1 
ATOM   5679  C CA  . GLY B 1 203 ? 0.684   15.122  94.750  1.00 15.48  ? 223  GLY B CA  1 
ATOM   5680  C C   . GLY B 1 203 ? -0.684  14.836  95.324  1.00 16.14  ? 223  GLY B C   1 
ATOM   5681  O O   . GLY B 1 203 ? -1.459  14.049  94.771  1.00 14.79  ? 223  GLY B O   1 
ATOM   5682  N N   . GLY B 1 204 ? -0.974  15.483  96.451  1.00 17.73  ? 224  GLY B N   1 
ATOM   5683  C CA  . GLY B 1 204 ? -2.263  15.314  97.093  1.00 18.53  ? 224  GLY B CA  1 
ATOM   5684  C C   . GLY B 1 204 ? -3.286  15.963  96.188  1.00 19.55  ? 224  GLY B C   1 
ATOM   5685  O O   . GLY B 1 204 ? -4.366  15.402  95.949  1.00 19.27  ? 224  GLY B O   1 
ATOM   5686  N N   . GLU B 1 205 ? -2.930  17.144  95.677  1.00 18.02  ? 225  GLU B N   1 
ATOM   5687  C CA  . GLU B 1 205 ? -3.799  17.882  94.770  1.00 16.74  ? 225  GLU B CA  1 
ATOM   5688  C C   . GLU B 1 205 ? -4.023  17.045  93.509  1.00 15.03  ? 225  GLU B C   1 
ATOM   5689  O O   . GLU B 1 205 ? -5.137  16.981  92.996  1.00 13.72  ? 225  GLU B O   1 
ATOM   5690  C CB  . GLU B 1 205 ? -3.168  19.234  94.418  1.00 18.41  ? 225  GLU B CB  1 
ATOM   5691  C CG  . GLU B 1 205 ? -4.041  20.146  93.553  1.00 21.71  ? 225  GLU B CG  1 
ATOM   5692  C CD  . GLU B 1 205 ? -3.791  19.990  92.052  1.00 24.05  ? 225  GLU B CD  1 
ATOM   5693  O OE1 . GLU B 1 205 ? -3.688  18.837  91.579  1.00 27.05  ? 225  GLU B OE1 1 
ATOM   5694  O OE2 . GLU B 1 205 ? -3.711  21.019  91.341  1.00 23.34  ? 225  GLU B OE2 1 
ATOM   5695  N N   . SER B 1 206 ? -2.968  16.400  93.019  1.00 13.61  ? 226  SER B N   1 
ATOM   5696  C CA  . SER B 1 206 ? -3.081  15.560  91.831  1.00 15.13  ? 226  SER B CA  1 
ATOM   5697  C C   . SER B 1 206 ? -4.105  14.437  92.045  1.00 15.62  ? 226  SER B C   1 
ATOM   5698  O O   . SER B 1 206 ? -4.978  14.201  91.197  1.00 14.90  ? 226  SER B O   1 
ATOM   5699  C CB  . SER B 1 206 ? -1.725  14.944  91.466  1.00 15.39  ? 226  SER B CB  1 
ATOM   5700  O OG  . SER B 1 206 ? -0.784  15.934  91.090  1.00 17.15  ? 226  SER B OG  1 
ATOM   5701  N N   . VAL B 1 207 ? -3.996  13.741  93.175  1.00 15.39  ? 227  VAL B N   1 
ATOM   5702  C CA  . VAL B 1 207 ? -4.929  12.657  93.473  1.00 15.52  ? 227  VAL B CA  1 
ATOM   5703  C C   . VAL B 1 207 ? -6.345  13.234  93.520  1.00 13.84  ? 227  VAL B C   1 
ATOM   5704  O O   . VAL B 1 207 ? -7.306  12.590  93.095  1.00 10.47  ? 227  VAL B O   1 
ATOM   5705  C CB  . VAL B 1 207 ? -4.590  11.957  94.831  1.00 15.69  ? 227  VAL B CB  1 
ATOM   5706  C CG1 . VAL B 1 207 ? -5.703  10.991  95.216  1.00 14.45  ? 227  VAL B CG1 1 
ATOM   5707  C CG2 . VAL B 1 207 ? -3.269  11.194  94.717  1.00 13.15  ? 227  VAL B CG2 1 
ATOM   5708  N N   . SER B 1 208 ? -6.451  14.460  94.028  1.00 14.39  ? 228  SER B N   1 
ATOM   5709  C CA  . SER B 1 208 ? -7.729  15.160  94.136  1.00 14.31  ? 228  SER B CA  1 
ATOM   5710  C C   . SER B 1 208 ? -8.262  15.420  92.735  1.00 14.29  ? 228  SER B C   1 
ATOM   5711  O O   . SER B 1 208 ? -9.448  15.237  92.468  1.00 14.37  ? 228  SER B O   1 
ATOM   5712  C CB  . SER B 1 208 ? -7.543  16.489  94.885  1.00 14.05  ? 228  SER B CB  1 
ATOM   5713  O OG  . SER B 1 208 ? -8.790  17.090  95.204  1.00 13.40  ? 228  SER B OG  1 
ATOM   5714  N N   . VAL B 1 209 ? -7.373  15.834  91.839  1.00 15.09  ? 229  VAL B N   1 
ATOM   5715  C CA  . VAL B 1 209 ? -7.754  16.109  90.460  1.00 16.79  ? 229  VAL B CA  1 
ATOM   5716  C C   . VAL B 1 209 ? -8.171  14.827  89.745  1.00 18.08  ? 229  VAL B C   1 
ATOM   5717  O O   . VAL B 1 209 ? -9.193  14.788  89.063  1.00 18.78  ? 229  VAL B O   1 
ATOM   5718  C CB  . VAL B 1 209 ? -6.592  16.766  89.669  1.00 16.46  ? 229  VAL B CB  1 
ATOM   5719  C CG1 . VAL B 1 209 ? -6.983  16.933  88.212  1.00 16.65  ? 229  VAL B CG1 1 
ATOM   5720  C CG2 . VAL B 1 209 ? -6.253  18.126  90.267  1.00 15.65  ? 229  VAL B CG2 1 
ATOM   5721  N N   . LEU B 1 210 ? -7.372  13.777  89.899  1.00 19.84  ? 230  LEU B N   1 
ATOM   5722  C CA  . LEU B 1 210 ? -7.666  12.500  89.259  1.00 19.27  ? 230  LEU B CA  1 
ATOM   5723  C C   . LEU B 1 210 ? -8.990  11.912  89.726  1.00 19.39  ? 230  LEU B C   1 
ATOM   5724  O O   . LEU B 1 210 ? -9.718  11.301  88.947  1.00 19.26  ? 230  LEU B O   1 
ATOM   5725  C CB  . LEU B 1 210 ? -6.539  11.507  89.532  1.00 17.88  ? 230  LEU B CB  1 
ATOM   5726  C CG  . LEU B 1 210 ? -5.211  11.863  88.873  1.00 17.37  ? 230  LEU B CG  1 
ATOM   5727  C CD1 . LEU B 1 210 ? -4.151  10.898  89.347  1.00 19.48  ? 230  LEU B CD1 1 
ATOM   5728  C CD2 . LEU B 1 210 ? -5.344  11.807  87.365  1.00 15.89  ? 230  LEU B CD2 1 
ATOM   5729  N N   . VAL B 1 211 ? -9.300  12.086  91.005  1.00 21.00  ? 231  VAL B N   1 
ATOM   5730  C CA  . VAL B 1 211 ? -10.546 11.562  91.546  1.00 21.59  ? 231  VAL B CA  1 
ATOM   5731  C C   . VAL B 1 211 ? -11.714 12.253  90.847  1.00 21.31  ? 231  VAL B C   1 
ATOM   5732  O O   . VAL B 1 211 ? -12.840 11.745  90.836  1.00 20.28  ? 231  VAL B O   1 
ATOM   5733  C CB  . VAL B 1 211 ? -10.608 11.769  93.079  1.00 21.03  ? 231  VAL B CB  1 
ATOM   5734  C CG1 . VAL B 1 211 ? -12.007 11.518  93.597  1.00 22.12  ? 231  VAL B CG1 1 
ATOM   5735  C CG2 . VAL B 1 211 ? -9.649  10.804  93.751  1.00 20.83  ? 231  VAL B CG2 1 
ATOM   5736  N N   . LEU B 1 212 ? -11.421 13.400  90.236  1.00 21.38  ? 232  LEU B N   1 
ATOM   5737  C CA  . LEU B 1 212 ? -12.423 14.178  89.513  1.00 20.43  ? 232  LEU B CA  1 
ATOM   5738  C C   . LEU B 1 212 ? -12.384 14.002  87.993  1.00 20.93  ? 232  LEU B C   1 
ATOM   5739  O O   . LEU B 1 212 ? -13.381 14.257  87.328  1.00 22.44  ? 232  LEU B O   1 
ATOM   5740  C CB  . LEU B 1 212 ? -12.271 15.671  89.822  1.00 16.28  ? 232  LEU B CB  1 
ATOM   5741  C CG  . LEU B 1 212 ? -12.651 16.175  91.208  1.00 14.44  ? 232  LEU B CG  1 
ATOM   5742  C CD1 . LEU B 1 212 ? -12.364 17.666  91.297  1.00 13.75  ? 232  LEU B CD1 1 
ATOM   5743  C CD2 . LEU B 1 212 ? -14.123 15.898  91.472  1.00 14.37  ? 232  LEU B CD2 1 
ATOM   5744  N N   . SER B 1 213 ? -11.256 13.565  87.439  1.00 21.69  ? 233  SER B N   1 
ATOM   5745  C CA  . SER B 1 213 ? -11.154 13.425  85.984  1.00 23.24  ? 233  SER B CA  1 
ATOM   5746  C C   . SER B 1 213 ? -11.725 12.178  85.309  1.00 24.39  ? 233  SER B C   1 
ATOM   5747  O O   . SER B 1 213 ? -11.397 11.043  85.670  1.00 25.45  ? 233  SER B O   1 
ATOM   5748  C CB  . SER B 1 213 ? -9.701  13.578  85.529  1.00 22.52  ? 233  SER B CB  1 
ATOM   5749  O OG  . SER B 1 213 ? -9.630  13.532  84.109  1.00 18.44  ? 233  SER B OG  1 
ATOM   5750  N N   . PRO B 1 214 ? -12.581 12.385  84.294  1.00 24.60  ? 234  PRO B N   1 
ATOM   5751  C CA  . PRO B 1 214 ? -13.216 11.309  83.528  1.00 24.19  ? 234  PRO B CA  1 
ATOM   5752  C C   . PRO B 1 214 ? -12.156 10.461  82.824  1.00 24.42  ? 234  PRO B C   1 
ATOM   5753  O O   . PRO B 1 214 ? -12.418 9.333   82.423  1.00 26.17  ? 234  PRO B O   1 
ATOM   5754  C CB  . PRO B 1 214 ? -14.082 12.065  82.528  1.00 24.28  ? 234  PRO B CB  1 
ATOM   5755  C CG  . PRO B 1 214 ? -14.426 13.324  83.262  1.00 25.79  ? 234  PRO B CG  1 
ATOM   5756  C CD  . PRO B 1 214 ? -13.114 13.697  83.887  1.00 24.92  ? 234  PRO B CD  1 
ATOM   5757  N N   . LEU B 1 215 ? -10.959 11.020  82.672  1.00 23.47  ? 235  LEU B N   1 
ATOM   5758  C CA  . LEU B 1 215 ? -9.860  10.324  82.021  1.00 22.68  ? 235  LEU B CA  1 
ATOM   5759  C C   . LEU B 1 215 ? -9.234  9.271   82.918  1.00 24.79  ? 235  LEU B C   1 
ATOM   5760  O O   . LEU B 1 215 ? -8.534  8.375   82.439  1.00 25.03  ? 235  LEU B O   1 
ATOM   5761  C CB  . LEU B 1 215 ? -8.774  11.310  81.616  1.00 21.18  ? 235  LEU B CB  1 
ATOM   5762  C CG  . LEU B 1 215 ? -9.107  12.332  80.538  1.00 21.20  ? 235  LEU B CG  1 
ATOM   5763  C CD1 . LEU B 1 215 ? -7.900  13.233  80.309  1.00 19.97  ? 235  LEU B CD1 1 
ATOM   5764  C CD2 . LEU B 1 215 ? -9.496  11.609  79.254  1.00 21.27  ? 235  LEU B CD2 1 
ATOM   5765  N N   . ALA B 1 216 ? -9.476  9.380   84.221  1.00 26.11  ? 236  ALA B N   1 
ATOM   5766  C CA  . ALA B 1 216 ? -8.902  8.432   85.163  1.00 28.06  ? 236  ALA B CA  1 
ATOM   5767  C C   . ALA B 1 216 ? -9.889  7.342   85.551  1.00 30.00  ? 236  ALA B C   1 
ATOM   5768  O O   . ALA B 1 216 ? -9.487  6.270   86.017  1.00 30.75  ? 236  ALA B O   1 
ATOM   5769  C CB  . ALA B 1 216 ? -8.412  9.167   86.402  1.00 27.28  ? 236  ALA B CB  1 
ATOM   5770  N N   . LYS B 1 217 ? -11.178 7.619   85.361  1.00 30.80  ? 237  LYS B N   1 
ATOM   5771  C CA  . LYS B 1 217 ? -12.227 6.661   85.687  1.00 32.09  ? 237  LYS B CA  1 
ATOM   5772  C C   . LYS B 1 217 ? -11.762 5.232   85.426  1.00 31.96  ? 237  LYS B C   1 
ATOM   5773  O O   . LYS B 1 217 ? -11.365 4.900   84.315  1.00 32.61  ? 237  LYS B O   1 
ATOM   5774  C CB  . LYS B 1 217 ? -13.479 6.945   84.854  1.00 34.56  ? 237  LYS B CB  1 
ATOM   5775  C CG  . LYS B 1 217 ? -14.616 5.959   85.102  1.00 38.87  ? 237  LYS B CG  1 
ATOM   5776  C CD  . LYS B 1 217 ? -15.736 6.077   84.068  1.00 41.15  ? 237  LYS B CD  1 
ATOM   5777  C CE  . LYS B 1 217 ? -16.843 5.062   84.355  1.00 42.35  ? 237  LYS B CE  1 
ATOM   5778  N NZ  . LYS B 1 217 ? -17.809 4.949   83.231  1.00 43.19  ? 237  LYS B NZ  1 
ATOM   5779  N N   . ASN B 1 218 ? -11.795 4.398   86.458  1.00 31.97  ? 238  ASN B N   1 
ATOM   5780  C CA  . ASN B 1 218 ? -11.393 2.999   86.340  1.00 32.91  ? 238  ASN B CA  1 
ATOM   5781  C C   . ASN B 1 218 ? -9.890  2.743   86.332  1.00 31.97  ? 238  ASN B C   1 
ATOM   5782  O O   . ASN B 1 218 ? -9.456  1.621   86.058  1.00 31.64  ? 238  ASN B O   1 
ATOM   5783  C CB  . ASN B 1 218 ? -12.011 2.368   85.088  1.00 35.98  ? 238  ASN B CB  1 
ATOM   5784  C CG  . ASN B 1 218 ? -13.532 2.361   85.125  1.00 40.30  ? 238  ASN B CG  1 
ATOM   5785  O OD1 . ASN B 1 218 ? -14.145 1.746   86.005  1.00 41.58  ? 238  ASN B OD1 1 
ATOM   5786  N ND2 . ASN B 1 218 ? -14.150 3.049   84.167  1.00 41.30  ? 238  ASN B ND2 1 
ATOM   5787  N N   . LEU B 1 219 ? -9.090  3.764   86.626  1.00 30.67  ? 239  LEU B N   1 
ATOM   5788  C CA  . LEU B 1 219 ? -7.645  3.574   86.650  1.00 28.66  ? 239  LEU B CA  1 
ATOM   5789  C C   . LEU B 1 219 ? -7.119  3.334   88.061  1.00 27.84  ? 239  LEU B C   1 
ATOM   5790  O O   . LEU B 1 219 ? -5.988  2.886   88.244  1.00 26.79  ? 239  LEU B O   1 
ATOM   5791  C CB  . LEU B 1 219 ? -6.935  4.762   86.015  1.00 28.13  ? 239  LEU B CB  1 
ATOM   5792  C CG  . LEU B 1 219 ? -7.033  4.822   84.493  1.00 27.76  ? 239  LEU B CG  1 
ATOM   5793  C CD1 . LEU B 1 219 ? -6.024  5.836   83.985  1.00 28.46  ? 239  LEU B CD1 1 
ATOM   5794  C CD2 . LEU B 1 219 ? -6.741  3.451   83.886  1.00 26.48  ? 239  LEU B CD2 1 
ATOM   5795  N N   . PHE B 1 220 ? -7.948  3.638   89.053  1.00 26.92  ? 240  PHE B N   1 
ATOM   5796  C CA  . PHE B 1 220 ? -7.597  3.418   90.449  1.00 25.58  ? 240  PHE B CA  1 
ATOM   5797  C C   . PHE B 1 220 ? -8.859  3.001   91.212  1.00 23.93  ? 240  PHE B C   1 
ATOM   5798  O O   . PHE B 1 220 ? -9.961  3.104   90.685  1.00 23.51  ? 240  PHE B O   1 
ATOM   5799  C CB  . PHE B 1 220 ? -6.976  4.681   91.061  1.00 25.74  ? 240  PHE B CB  1 
ATOM   5800  C CG  . PHE B 1 220 ? -7.833  5.900   90.948  1.00 25.52  ? 240  PHE B CG  1 
ATOM   5801  C CD1 . PHE B 1 220 ? -7.988  6.546   89.730  1.00 26.64  ? 240  PHE B CD1 1 
ATOM   5802  C CD2 . PHE B 1 220 ? -8.471  6.418   92.066  1.00 23.94  ? 240  PHE B CD2 1 
ATOM   5803  C CE1 . PHE B 1 220 ? -8.767  7.699   89.631  1.00 27.67  ? 240  PHE B CE1 1 
ATOM   5804  C CE2 . PHE B 1 220 ? -9.250  7.567   91.976  1.00 24.63  ? 240  PHE B CE2 1 
ATOM   5805  C CZ  . PHE B 1 220 ? -9.399  8.210   90.760  1.00 24.59  ? 240  PHE B CZ  1 
ATOM   5806  N N   . HIS B 1 221 ? -8.703  2.535   92.447  1.00 22.66  ? 241  HIS B N   1 
ATOM   5807  C CA  . HIS B 1 221 ? -9.850  2.086   93.223  1.00 20.35  ? 241  HIS B CA  1 
ATOM   5808  C C   . HIS B 1 221 ? -10.004 2.732   94.583  1.00 19.75  ? 241  HIS B C   1 
ATOM   5809  O O   . HIS B 1 221 ? -11.055 2.603   95.213  1.00 20.26  ? 241  HIS B O   1 
ATOM   5810  C CB  . HIS B 1 221 ? -9.770  0.579   93.381  1.00 20.39  ? 241  HIS B CB  1 
ATOM   5811  C CG  . HIS B 1 221 ? -9.533  -0.132  92.089  1.00 22.52  ? 241  HIS B CG  1 
ATOM   5812  N ND1 . HIS B 1 221 ? -10.448 -0.127  91.059  1.00 22.82  ? 241  HIS B ND1 1 
ATOM   5813  C CD2 . HIS B 1 221 ? -8.460  -0.820  91.634  1.00 24.42  ? 241  HIS B CD2 1 
ATOM   5814  C CE1 . HIS B 1 221 ? -9.949  -0.779  90.025  1.00 24.01  ? 241  HIS B CE1 1 
ATOM   5815  N NE2 . HIS B 1 221 ? -8.742  -1.210  90.348  1.00 24.73  ? 241  HIS B NE2 1 
ATOM   5816  N N   . ARG B 1 222 ? -8.958  3.418   95.037  1.00 18.95  ? 242  ARG B N   1 
ATOM   5817  C CA  . ARG B 1 222 ? -8.958  4.103   96.333  1.00 17.17  ? 242  ARG B CA  1 
ATOM   5818  C C   . ARG B 1 222 ? -7.984  5.264   96.202  1.00 16.57  ? 242  ARG B C   1 
ATOM   5819  O O   . ARG B 1 222 ? -7.047  5.192   95.408  1.00 18.90  ? 242  ARG B O   1 
ATOM   5820  C CB  . ARG B 1 222 ? -8.495  3.136   97.420  1.00 15.85  ? 242  ARG B CB  1 
ATOM   5821  C CG  . ARG B 1 222 ? -9.214  1.809   97.323  1.00 14.93  ? 242  ARG B CG  1 
ATOM   5822  C CD  . ARG B 1 222 ? -8.484  0.694   98.002  1.00 13.24  ? 242  ARG B CD  1 
ATOM   5823  N NE  . ARG B 1 222 ? -9.004  -0.616  97.605  1.00 14.33  ? 242  ARG B NE  1 
ATOM   5824  C CZ  . ARG B 1 222 ? -10.290 -0.970  97.640  1.00 13.97  ? 242  ARG B CZ  1 
ATOM   5825  N NH1 . ARG B 1 222 ? -11.216 -0.115  98.041  1.00 14.86  ? 242  ARG B NH1 1 
ATOM   5826  N NH2 . ARG B 1 222 ? -10.650 -2.201  97.307  1.00 14.07  ? 242  ARG B NH2 1 
ATOM   5827  N N   . ALA B 1 223 ? -8.193  6.333   96.961  1.00 14.67  ? 243  ALA B N   1 
ATOM   5828  C CA  . ALA B 1 223 ? -7.308  7.490   96.863  1.00 13.68  ? 243  ALA B CA  1 
ATOM   5829  C C   . ALA B 1 223 ? -6.978  8.139   98.207  1.00 13.72  ? 243  ALA B C   1 
ATOM   5830  O O   . ALA B 1 223 ? -7.815  8.199   99.103  1.00 14.61  ? 243  ALA B O   1 
ATOM   5831  C CB  . ALA B 1 223 ? -7.926  8.527   95.928  1.00 11.03  ? 243  ALA B CB  1 
ATOM   5832  N N   . ILE B 1 224 ? -5.753  8.627   98.343  1.00 11.68  ? 244  ILE B N   1 
ATOM   5833  C CA  . ILE B 1 224 ? -5.352  9.278   99.570  1.00 11.97  ? 244  ILE B CA  1 
ATOM   5834  C C   . ILE B 1 224 ? -4.722  10.622  99.244  1.00 13.01  ? 244  ILE B C   1 
ATOM   5835  O O   . ILE B 1 224 ? -3.770  10.695  98.467  1.00 13.92  ? 244  ILE B O   1 
ATOM   5836  C CB  . ILE B 1 224 ? -4.326  8.418   100.360 1.00 13.67  ? 244  ILE B CB  1 
ATOM   5837  C CG1 . ILE B 1 224 ? -4.915  7.035   100.650 1.00 13.46  ? 244  ILE B CG1 1 
ATOM   5838  C CG2 . ILE B 1 224 ? -3.942  9.117   101.681 1.00 11.33  ? 244  ILE B CG2 1 
ATOM   5839  C CD1 . ILE B 1 224 ? -3.981  6.121   101.425 1.00 12.02  ? 244  ILE B CD1 1 
ATOM   5840  N N   . SER B 1 225 ? -5.266  11.687  99.823  1.00 12.99  ? 245  SER B N   1 
ATOM   5841  C CA  . SER B 1 225 ? -4.731  13.025  99.614  1.00 13.49  ? 245  SER B CA  1 
ATOM   5842  C C   . SER B 1 225 ? -4.117  13.510  100.910 1.00 14.82  ? 245  SER B C   1 
ATOM   5843  O O   . SER B 1 225 ? -4.826  13.776  101.880 1.00 16.54  ? 245  SER B O   1 
ATOM   5844  C CB  . SER B 1 225 ? -5.828  13.995  99.188  1.00 13.54  ? 245  SER B CB  1 
ATOM   5845  O OG  . SER B 1 225 ? -5.979  14.008  97.780  1.00 16.31  ? 245  SER B OG  1 
ATOM   5846  N N   . GLU B 1 226 ? -2.797  13.626  100.927 1.00 14.68  ? 246  GLU B N   1 
ATOM   5847  C CA  . GLU B 1 226 ? -2.096  14.078  102.117 1.00 14.71  ? 246  GLU B CA  1 
ATOM   5848  C C   . GLU B 1 226 ? -1.730  15.550  102.033 1.00 15.06  ? 246  GLU B C   1 
ATOM   5849  O O   . GLU B 1 226 ? -0.861  15.932  101.252 1.00 15.32  ? 246  GLU B O   1 
ATOM   5850  C CB  . GLU B 1 226 ? -0.822  13.257  102.320 1.00 14.60  ? 246  GLU B CB  1 
ATOM   5851  C CG  . GLU B 1 226 ? -1.065  11.799  102.668 1.00 14.83  ? 246  GLU B CG  1 
ATOM   5852  C CD  . GLU B 1 226 ? 0.216   10.995  102.653 1.00 14.88  ? 246  GLU B CD  1 
ATOM   5853  O OE1 . GLU B 1 226 ? 1.272   11.600  102.942 1.00 15.28  ? 246  GLU B OE1 1 
ATOM   5854  O OE2 . GLU B 1 226 ? 0.166   9.774   102.367 1.00 11.08  ? 246  GLU B OE2 1 
ATOM   5855  N N   . SER B 1 227 ? -2.389  16.374  102.840 1.00 14.72  ? 247  SER B N   1 
ATOM   5856  C CA  . SER B 1 227 ? -2.096  17.801  102.856 1.00 15.60  ? 247  SER B CA  1 
ATOM   5857  C C   . SER B 1 227 ? -2.132  18.398  101.454 1.00 16.24  ? 247  SER B C   1 
ATOM   5858  O O   . SER B 1 227 ? -1.115  18.894  100.959 1.00 16.94  ? 247  SER B O   1 
ATOM   5859  C CB  . SER B 1 227 ? -0.710  18.051  103.467 1.00 15.00  ? 247  SER B CB  1 
ATOM   5860  O OG  . SER B 1 227 ? -0.562  17.398  104.716 1.00 13.56  ? 247  SER B OG  1 
ATOM   5861  N N   . GLY B 1 228 ? -3.299  18.344  100.818 1.00 16.75  ? 248  GLY B N   1 
ATOM   5862  C CA  . GLY B 1 228 ? -3.449  18.900  99.485  1.00 17.82  ? 248  GLY B CA  1 
ATOM   5863  C C   . GLY B 1 228 ? -4.679  18.415  98.732  1.00 19.48  ? 248  GLY B C   1 
ATOM   5864  O O   . GLY B 1 228 ? -4.887  17.210  98.586  1.00 18.61  ? 248  GLY B O   1 
ATOM   5865  N N   . VAL B 1 229 ? -5.502  19.349  98.258  1.00 21.06  ? 249  VAL B N   1 
ATOM   5866  C CA  . VAL B 1 229 ? -6.697  18.988  97.496  1.00 24.17  ? 249  VAL B CA  1 
ATOM   5867  C C   . VAL B 1 229 ? -6.871  19.917  96.294  1.00 26.32  ? 249  VAL B C   1 
ATOM   5868  O O   . VAL B 1 229 ? -6.019  20.772  96.048  1.00 27.21  ? 249  VAL B O   1 
ATOM   5869  C CB  . VAL B 1 229 ? -7.973  19.023  98.376  1.00 22.82  ? 249  VAL B CB  1 
ATOM   5870  C CG1 . VAL B 1 229 ? -7.870  17.982  99.454  1.00 22.99  ? 249  VAL B CG1 1 
ATOM   5871  C CG2 . VAL B 1 229 ? -8.165  20.393  98.987  1.00 22.25  ? 249  VAL B CG2 1 
ATOM   5872  N N   . ALA B 1 230 ? -7.966  19.749  95.552  1.00 28.39  ? 250  ALA B N   1 
ATOM   5873  C CA  . ALA B 1 230 ? -8.230  20.563  94.366  1.00 30.40  ? 250  ALA B CA  1 
ATOM   5874  C C   . ALA B 1 230 ? -8.882  21.917  94.637  1.00 33.22  ? 250  ALA B C   1 
ATOM   5875  O O   . ALA B 1 230 ? -8.698  22.851  93.857  1.00 33.60  ? 250  ALA B O   1 
ATOM   5876  C CB  . ALA B 1 230 ? -9.069  19.773  93.372  1.00 30.90  ? 250  ALA B CB  1 
ATOM   5877  N N   . LEU B 1 231 ? -9.655  22.032  95.717  1.00 36.16  ? 251  LEU B N   1 
ATOM   5878  C CA  . LEU B 1 231 ? -10.280 23.314  96.047  1.00 39.39  ? 251  LEU B CA  1 
ATOM   5879  C C   . LEU B 1 231 ? -9.193  24.325  96.440  1.00 43.20  ? 251  LEU B C   1 
ATOM   5880  O O   . LEU B 1 231 ? -9.464  25.525  96.604  1.00 42.04  ? 251  LEU B O   1 
ATOM   5881  C CB  . LEU B 1 231 ? -11.278 23.157  97.198  1.00 37.31  ? 251  LEU B CB  1 
ATOM   5882  C CG  . LEU B 1 231 ? -12.600 22.436  96.916  1.00 36.37  ? 251  LEU B CG  1 
ATOM   5883  C CD1 . LEU B 1 231 ? -13.471 22.451  98.155  1.00 35.35  ? 251  LEU B CD1 1 
ATOM   5884  C CD2 . LEU B 1 231 ? -13.329 23.119  95.785  1.00 36.64  ? 251  LEU B CD2 1 
ATOM   5885  N N   . THR B 1 232 ? -7.965  23.812  96.585  1.00 47.89  ? 252  THR B N   1 
ATOM   5886  C CA  . THR B 1 232 ? -6.779  24.605  96.941  1.00 51.96  ? 252  THR B CA  1 
ATOM   5887  C C   . THR B 1 232 ? -6.388  25.452  95.731  1.00 52.24  ? 252  THR B C   1 
ATOM   5888  O O   . THR B 1 232 ? -5.417  25.165  95.023  1.00 51.20  ? 252  THR B O   1 
ATOM   5889  C CB  . THR B 1 232 ? -5.568  23.692  97.330  1.00 54.28  ? 252  THR B CB  1 
ATOM   5890  O OG1 . THR B 1 232 ? -5.945  22.808  98.398  1.00 55.99  ? 252  THR B OG1 1 
ATOM   5891  C CG2 . THR B 1 232 ? -4.383  24.537  97.792  1.00 54.75  ? 252  THR B CG2 1 
ATOM   5892  N N   . SER B 1 233 ? -7.172  26.498  95.514  1.00 53.86  ? 253  SER B N   1 
ATOM   5893  C CA  . SER B 1 233 ? -6.999  27.420  94.402  1.00 56.07  ? 253  SER B CA  1 
ATOM   5894  C C   . SER B 1 233 ? -5.565  27.724  93.953  1.00 55.07  ? 253  SER B C   1 
ATOM   5895  O O   . SER B 1 233 ? -5.317  27.902  92.759  1.00 56.78  ? 253  SER B O   1 
ATOM   5896  C CB  . SER B 1 233 ? -7.725  28.735  94.721  1.00 58.13  ? 253  SER B CB  1 
ATOM   5897  O OG  . SER B 1 233 ? -9.115  28.520  94.925  1.00 60.23  ? 253  SER B OG  1 
ATOM   5898  N N   . VAL B 1 234 ? -4.623  27.785  94.887  1.00 52.68  ? 254  VAL B N   1 
ATOM   5899  C CA  . VAL B 1 234 ? -3.247  28.104  94.524  1.00 50.74  ? 254  VAL B CA  1 
ATOM   5900  C C   . VAL B 1 234 ? -2.723  27.302  93.335  1.00 48.21  ? 254  VAL B C   1 
ATOM   5901  O O   . VAL B 1 234 ? -2.086  27.859  92.439  1.00 48.02  ? 254  VAL B O   1 
ATOM   5902  C CB  . VAL B 1 234 ? -2.289  27.921  95.731  1.00 52.81  ? 254  VAL B CB  1 
ATOM   5903  C CG1 . VAL B 1 234 ? -2.400  26.514  96.280  1.00 54.36  ? 254  VAL B CG1 1 
ATOM   5904  C CG2 . VAL B 1 234 ? -0.850  28.226  95.313  1.00 52.94  ? 254  VAL B CG2 1 
ATOM   5905  N N   . LEU B 1 235 ? -3.003  26.003  93.318  1.00 45.62  ? 255  LEU B N   1 
ATOM   5906  C CA  . LEU B 1 235 ? -2.539  25.144  92.236  1.00 43.25  ? 255  LEU B CA  1 
ATOM   5907  C C   . LEU B 1 235 ? -3.471  25.081  91.025  1.00 42.09  ? 255  LEU B C   1 
ATOM   5908  O O   . LEU B 1 235 ? -3.094  24.551  89.973  1.00 40.67  ? 255  LEU B O   1 
ATOM   5909  C CB  . LEU B 1 235 ? -2.297  23.731  92.761  1.00 43.14  ? 255  LEU B CB  1 
ATOM   5910  C CG  . LEU B 1 235 ? -1.058  23.529  93.631  1.00 42.84  ? 255  LEU B CG  1 
ATOM   5911  C CD1 . LEU B 1 235 ? -0.913  22.053  93.984  1.00 42.06  ? 255  LEU B CD1 1 
ATOM   5912  C CD2 . LEU B 1 235 ? 0.171   24.013  92.881  1.00 43.53  ? 255  LEU B CD2 1 
ATOM   5913  N N   . VAL B 1 236 ? -4.682  25.613  91.171  1.00 40.87  ? 256  VAL B N   1 
ATOM   5914  C CA  . VAL B 1 236 ? -5.649  25.606  90.078  1.00 39.06  ? 256  VAL B CA  1 
ATOM   5915  C C   . VAL B 1 236 ? -5.891  27.004  89.509  1.00 38.95  ? 256  VAL B C   1 
ATOM   5916  O O   . VAL B 1 236 ? -6.448  27.889  90.164  1.00 37.48  ? 256  VAL B O   1 
ATOM   5917  C CB  . VAL B 1 236 ? -6.985  24.962  90.519  1.00 37.44  ? 256  VAL B CB  1 
ATOM   5918  C CG1 . VAL B 1 236 ? -8.028  25.104  89.423  1.00 35.78  ? 256  VAL B CG1 1 
ATOM   5919  C CG2 . VAL B 1 236 ? -6.761  23.486  90.826  1.00 35.53  ? 256  VAL B CG2 1 
ATOM   5920  N N   . LYS B 1 237 ? -5.450  27.175  88.267  1.00 40.53  ? 257  LYS B N   1 
ATOM   5921  C CA  . LYS B 1 237 ? -5.556  28.427  87.536  1.00 41.47  ? 257  LYS B CA  1 
ATOM   5922  C C   . LYS B 1 237 ? -6.891  28.616  86.827  1.00 41.76  ? 257  LYS B C   1 
ATOM   5923  O O   . LYS B 1 237 ? -7.054  28.228  85.670  1.00 41.83  ? 257  LYS B O   1 
ATOM   5924  C CB  . LYS B 1 237 ? -4.423  28.509  86.512  1.00 41.78  ? 257  LYS B CB  1 
ATOM   5925  C CG  . LYS B 1 237 ? -3.043  28.567  87.126  1.00 42.90  ? 257  LYS B CG  1 
ATOM   5926  C CD  . LYS B 1 237 ? -2.893  29.816  87.976  1.00 46.26  ? 257  LYS B CD  1 
ATOM   5927  C CE  . LYS B 1 237 ? -1.488  29.927  88.538  1.00 49.30  ? 257  LYS B CE  1 
ATOM   5928  N NZ  . LYS B 1 237 ? -1.317  31.156  89.357  1.00 50.72  ? 257  LYS B NZ  1 
ATOM   5929  N N   . LYS B 1 238 ? -7.847  29.215  87.525  1.00 43.10  ? 258  LYS B N   1 
ATOM   5930  C CA  . LYS B 1 238 ? -9.158  29.472  86.944  1.00 43.87  ? 258  LYS B CA  1 
ATOM   5931  C C   . LYS B 1 238 ? -9.074  30.815  86.218  1.00 43.34  ? 258  LYS B C   1 
ATOM   5932  O O   . LYS B 1 238 ? -8.141  31.595  86.439  1.00 42.84  ? 258  LYS B O   1 
ATOM   5933  C CB  . LYS B 1 238 ? -10.226 29.500  88.044  1.00 44.71  ? 258  LYS B CB  1 
ATOM   5934  C CG  . LYS B 1 238 ? -10.237 28.224  88.878  1.00 45.33  ? 258  LYS B CG  1 
ATOM   5935  C CD  . LYS B 1 238 ? -11.230 28.276  90.017  1.00 45.78  ? 258  LYS B CD  1 
ATOM   5936  C CE  . LYS B 1 238 ? -11.072 27.060  90.932  1.00 46.39  ? 258  LYS B CE  1 
ATOM   5937  N NZ  . LYS B 1 238 ? -9.846  27.094  91.791  1.00 45.79  ? 258  LYS B NZ  1 
ATOM   5938  N N   . GLY B 1 239 ? -10.034 31.078  85.341  1.00 42.17  ? 259  GLY B N   1 
ATOM   5939  C CA  . GLY B 1 239 ? -10.007 32.320  84.594  1.00 40.63  ? 259  GLY B CA  1 
ATOM   5940  C C   . GLY B 1 239 ? -9.182  32.168  83.330  1.00 39.60  ? 259  GLY B C   1 
ATOM   5941  O O   . GLY B 1 239 ? -8.660  31.089  83.042  1.00 40.26  ? 259  GLY B O   1 
ATOM   5942  N N   . ASP B 1 240 ? -9.066  33.253  82.575  1.00 38.31  ? 260  ASP B N   1 
ATOM   5943  C CA  . ASP B 1 240 ? -8.309  33.272  81.327  1.00 36.63  ? 260  ASP B CA  1 
ATOM   5944  C C   . ASP B 1 240 ? -6.797  33.148  81.578  1.00 34.85  ? 260  ASP B C   1 
ATOM   5945  O O   . ASP B 1 240 ? -6.182  34.034  82.172  1.00 34.52  ? 260  ASP B O   1 
ATOM   5946  C CB  . ASP B 1 240 ? -8.647  34.565  80.579  1.00 37.87  ? 260  ASP B CB  1 
ATOM   5947  C CG  . ASP B 1 240 ? -7.859  34.735  79.304  1.00 39.49  ? 260  ASP B CG  1 
ATOM   5948  O OD1 . ASP B 1 240 ? -7.620  33.728  78.603  1.00 40.63  ? 260  ASP B OD1 1 
ATOM   5949  O OD2 . ASP B 1 240 ? -7.495  35.892  78.996  1.00 40.87  ? 260  ASP B OD2 1 
ATOM   5950  N N   . VAL B 1 241 ? -6.207  32.043  81.123  1.00 32.14  ? 261  VAL B N   1 
ATOM   5951  C CA  . VAL B 1 241 ? -4.780  31.789  81.318  1.00 30.53  ? 261  VAL B CA  1 
ATOM   5952  C C   . VAL B 1 241 ? -3.891  32.399  80.240  1.00 30.41  ? 261  VAL B C   1 
ATOM   5953  O O   . VAL B 1 241 ? -2.673  32.508  80.411  1.00 29.94  ? 261  VAL B O   1 
ATOM   5954  C CB  . VAL B 1 241 ? -4.477  30.266  81.368  1.00 29.92  ? 261  VAL B CB  1 
ATOM   5955  C CG1 . VAL B 1 241 ? -5.354  29.604  82.410  1.00 30.38  ? 261  VAL B CG1 1 
ATOM   5956  C CG2 . VAL B 1 241 ? -4.690  29.626  80.000  1.00 26.93  ? 261  VAL B CG2 1 
ATOM   5957  N N   . LYS B 1 242 ? -4.510  32.794  79.135  1.00 29.30  ? 262  LYS B N   1 
ATOM   5958  C CA  . LYS B 1 242 ? -3.792  33.364  78.006  1.00 29.10  ? 262  LYS B CA  1 
ATOM   5959  C C   . LYS B 1 242 ? -2.741  34.417  78.398  1.00 29.14  ? 262  LYS B C   1 
ATOM   5960  O O   . LYS B 1 242 ? -1.597  34.369  77.937  1.00 28.51  ? 262  LYS B O   1 
ATOM   5961  C CB  . LYS B 1 242 ? -4.807  33.943  77.019  1.00 29.42  ? 262  LYS B CB  1 
ATOM   5962  C CG  . LYS B 1 242 ? -4.247  34.302  75.657  1.00 30.15  ? 262  LYS B CG  1 
ATOM   5963  C CD  . LYS B 1 242 ? -3.729  33.088  74.919  1.00 30.22  ? 262  LYS B CD  1 
ATOM   5964  C CE  . LYS B 1 242 ? -3.276  33.477  73.520  1.00 32.68  ? 262  LYS B CE  1 
ATOM   5965  N NZ  . LYS B 1 242 ? -4.389  34.026  72.678  1.00 32.78  ? 262  LYS B NZ  1 
ATOM   5966  N N   . PRO B 1 243 ? -3.112  35.379  79.258  1.00 29.31  ? 263  PRO B N   1 
ATOM   5967  C CA  . PRO B 1 243 ? -2.160  36.415  79.675  1.00 29.05  ? 263  PRO B CA  1 
ATOM   5968  C C   . PRO B 1 243 ? -0.876  35.859  80.285  1.00 28.92  ? 263  PRO B C   1 
ATOM   5969  O O   . PRO B 1 243 ? 0.224   36.309  79.952  1.00 29.53  ? 263  PRO B O   1 
ATOM   5970  C CB  . PRO B 1 243 ? -2.965  37.233  80.673  1.00 28.82  ? 263  PRO B CB  1 
ATOM   5971  C CG  . PRO B 1 243 ? -4.359  37.131  80.122  1.00 29.26  ? 263  PRO B CG  1 
ATOM   5972  C CD  . PRO B 1 243 ? -4.453  35.661  79.796  1.00 29.09  ? 263  PRO B CD  1 
ATOM   5973  N N   . LEU B 1 244 ? -1.004  34.882  81.177  1.00 27.97  ? 264  LEU B N   1 
ATOM   5974  C CA  . LEU B 1 244 ? 0.185   34.307  81.788  1.00 27.55  ? 264  LEU B CA  1 
ATOM   5975  C C   . LEU B 1 244 ? 1.058   33.617  80.732  1.00 26.08  ? 264  LEU B C   1 
ATOM   5976  O O   . LEU B 1 244 ? 2.285   33.646  80.815  1.00 24.71  ? 264  LEU B O   1 
ATOM   5977  C CB  . LEU B 1 244 ? -0.212  33.329  82.900  1.00 28.14  ? 264  LEU B CB  1 
ATOM   5978  C CG  . LEU B 1 244 ? 0.889   32.563  83.662  1.00 29.80  ? 264  LEU B CG  1 
ATOM   5979  C CD1 . LEU B 1 244 ? 1.289   31.337  82.854  1.00 31.30  ? 264  LEU B CD1 1 
ATOM   5980  C CD2 . LEU B 1 244 ? 2.103   33.460  83.952  1.00 28.67  ? 264  LEU B CD2 1 
ATOM   5981  N N   . ALA B 1 245 ? 0.416   33.017  79.731  1.00 25.62  ? 265  ALA B N   1 
ATOM   5982  C CA  . ALA B 1 245 ? 1.124   32.325  78.656  1.00 24.66  ? 265  ALA B CA  1 
ATOM   5983  C C   . ALA B 1 245 ? 1.994   33.296  77.865  1.00 24.48  ? 265  ALA B C   1 
ATOM   5984  O O   . ALA B 1 245 ? 3.177   33.038  77.610  1.00 22.66  ? 265  ALA B O   1 
ATOM   5985  C CB  . ALA B 1 245 ? 0.125   31.645  77.720  1.00 22.37  ? 265  ALA B CB  1 
ATOM   5986  N N   . GLU B 1 246 ? 1.399   34.416  77.478  1.00 24.28  ? 266  GLU B N   1 
ATOM   5987  C CA  . GLU B 1 246 ? 2.122   35.414  76.719  1.00 24.85  ? 266  GLU B CA  1 
ATOM   5988  C C   . GLU B 1 246 ? 3.296   35.943  77.533  1.00 23.75  ? 266  GLU B C   1 
ATOM   5989  O O   . GLU B 1 246 ? 4.386   36.183  77.005  1.00 22.02  ? 266  GLU B O   1 
ATOM   5990  C CB  . GLU B 1 246 ? 1.173   36.546  76.327  1.00 27.72  ? 266  GLU B CB  1 
ATOM   5991  C CG  . GLU B 1 246 ? 0.019   36.074  75.449  1.00 33.75  ? 266  GLU B CG  1 
ATOM   5992  C CD  . GLU B 1 246 ? -0.838  37.212  74.920  1.00 37.03  ? 266  GLU B CD  1 
ATOM   5993  O OE1 . GLU B 1 246 ? -0.308  38.061  74.168  1.00 39.49  ? 266  GLU B OE1 1 
ATOM   5994  O OE2 . GLU B 1 246 ? -2.042  37.255  75.254  1.00 38.34  ? 266  GLU B OE2 1 
ATOM   5995  N N   . GLN B 1 247 ? 3.081   36.114  78.828  1.00 23.54  ? 267  GLN B N   1 
ATOM   5996  C CA  . GLN B 1 247 ? 4.141   36.615  79.680  1.00 24.16  ? 267  GLN B CA  1 
ATOM   5997  C C   . GLN B 1 247 ? 5.364   35.693  79.574  1.00 22.95  ? 267  GLN B C   1 
ATOM   5998  O O   . GLN B 1 247 ? 6.492   36.152  79.378  1.00 23.41  ? 267  GLN B O   1 
ATOM   5999  C CB  . GLN B 1 247 ? 3.649   36.698  81.124  1.00 26.40  ? 267  GLN B CB  1 
ATOM   6000  C CG  . GLN B 1 247 ? 4.470   37.632  81.998  1.00 30.33  ? 267  GLN B CG  1 
ATOM   6001  C CD  . GLN B 1 247 ? 3.917   37.740  83.408  1.00 33.52  ? 267  GLN B CD  1 
ATOM   6002  O OE1 . GLN B 1 247 ? 2.769   38.154  83.611  1.00 34.33  ? 267  GLN B OE1 1 
ATOM   6003  N NE2 . GLN B 1 247 ? 4.731   37.363  84.395  1.00 33.95  ? 267  GLN B NE2 1 
ATOM   6004  N N   . ILE B 1 248 ? 5.131   34.389  79.687  1.00 20.78  ? 268  ILE B N   1 
ATOM   6005  C CA  . ILE B 1 248 ? 6.204   33.403  79.600  1.00 17.29  ? 268  ILE B CA  1 
ATOM   6006  C C   . ILE B 1 248 ? 6.897   33.443  78.239  1.00 15.96  ? 268  ILE B C   1 
ATOM   6007  O O   . ILE B 1 248 ? 8.121   33.399  78.149  1.00 11.73  ? 268  ILE B O   1 
ATOM   6008  C CB  . ILE B 1 248 ? 5.661   31.987  79.823  1.00 16.15  ? 268  ILE B CB  1 
ATOM   6009  C CG1 . ILE B 1 248 ? 4.877   31.938  81.137  1.00 14.75  ? 268  ILE B CG1 1 
ATOM   6010  C CG2 . ILE B 1 248 ? 6.808   30.997  79.834  1.00 15.36  ? 268  ILE B CG2 1 
ATOM   6011  C CD1 . ILE B 1 248 ? 4.352   30.572  81.499  1.00 12.47  ? 268  ILE B CD1 1 
ATOM   6012  N N   . ALA B 1 249 ? 6.095   33.520  77.182  1.00 17.06  ? 269  ALA B N   1 
ATOM   6013  C CA  . ALA B 1 249 ? 6.621   33.571  75.826  1.00 17.94  ? 269  ALA B CA  1 
ATOM   6014  C C   . ALA B 1 249 ? 7.601   34.732  75.673  1.00 19.03  ? 269  ALA B C   1 
ATOM   6015  O O   . ALA B 1 249 ? 8.726   34.546  75.193  1.00 20.58  ? 269  ALA B O   1 
ATOM   6016  C CB  . ALA B 1 249 ? 5.478   33.711  74.825  1.00 16.92  ? 269  ALA B CB  1 
ATOM   6017  N N   . ILE B 1 250 ? 7.182   35.927  76.085  1.00 18.10  ? 270  ILE B N   1 
ATOM   6018  C CA  . ILE B 1 250 ? 8.046   37.097  75.977  1.00 17.68  ? 270  ILE B CA  1 
ATOM   6019  C C   . ILE B 1 250 ? 9.348   36.949  76.763  1.00 18.46  ? 270  ILE B C   1 
ATOM   6020  O O   . ILE B 1 250 ? 10.415  37.310  76.277  1.00 18.85  ? 270  ILE B O   1 
ATOM   6021  C CB  . ILE B 1 250 ? 7.330   38.358  76.453  1.00 16.51  ? 270  ILE B CB  1 
ATOM   6022  C CG1 . ILE B 1 250 ? 6.091   38.589  75.594  1.00 17.58  ? 270  ILE B CG1 1 
ATOM   6023  C CG2 . ILE B 1 250 ? 8.259   39.544  76.353  1.00 13.48  ? 270  ILE B CG2 1 
ATOM   6024  C CD1 . ILE B 1 250 ? 5.227   39.725  76.065  1.00 18.86  ? 270  ILE B CD1 1 
ATOM   6025  N N   . THR B 1 251 ? 9.261   36.421  77.978  1.00 18.46  ? 271  THR B N   1 
ATOM   6026  C CA  . THR B 1 251 ? 10.446  36.238  78.797  1.00 18.27  ? 271  THR B CA  1 
ATOM   6027  C C   . THR B 1 251 ? 11.418  35.318  78.082  1.00 18.94  ? 271  THR B C   1 
ATOM   6028  O O   . THR B 1 251 ? 12.636  35.491  78.166  1.00 19.03  ? 271  THR B O   1 
ATOM   6029  C CB  . THR B 1 251 ? 10.081  35.630  80.155  1.00 19.01  ? 271  THR B CB  1 
ATOM   6030  O OG1 . THR B 1 251 ? 9.233   36.538  80.870  1.00 20.43  ? 271  THR B OG1 1 
ATOM   6031  C CG2 . THR B 1 251 ? 11.328  35.362  80.974  1.00 19.71  ? 271  THR B CG2 1 
ATOM   6032  N N   . ALA B 1 252 ? 10.874  34.335  77.374  1.00 19.75  ? 272  ALA B N   1 
ATOM   6033  C CA  . ALA B 1 252 ? 11.702  33.388  76.640  1.00 20.54  ? 272  ALA B CA  1 
ATOM   6034  C C   . ALA B 1 252 ? 12.125  33.972  75.293  1.00 20.48  ? 272  ALA B C   1 
ATOM   6035  O O   . ALA B 1 252 ? 12.969  33.407  74.594  1.00 19.47  ? 272  ALA B O   1 
ATOM   6036  C CB  . ALA B 1 252 ? 10.952  32.084  76.442  1.00 21.74  ? 272  ALA B CB  1 
ATOM   6037  N N   . GLY B 1 253 ? 11.526  35.101  74.931  1.00 20.24  ? 273  GLY B N   1 
ATOM   6038  C CA  . GLY B 1 253 ? 11.878  35.753  73.682  1.00 21.32  ? 273  GLY B CA  1 
ATOM   6039  C C   . GLY B 1 253 ? 11.102  35.293  72.468  1.00 21.64  ? 273  GLY B C   1 
ATOM   6040  O O   . GLY B 1 253 ? 11.691  34.985  71.433  1.00 22.79  ? 273  GLY B O   1 
ATOM   6041  N N   . CYS B 1 254 ? 9.780   35.267  72.582  1.00 20.94  ? 274  CYS B N   1 
ATOM   6042  C CA  . CYS B 1 254 ? 8.934   34.830  71.485  1.00 20.16  ? 274  CYS B CA  1 
ATOM   6043  C C   . CYS B 1 254 ? 7.818   35.812  71.182  1.00 20.70  ? 274  CYS B C   1 
ATOM   6044  O O   . CYS B 1 254 ? 7.324   36.494  72.081  1.00 20.18  ? 274  CYS B O   1 
ATOM   6045  C CB  . CYS B 1 254 ? 8.298   33.498  71.831  1.00 20.43  ? 274  CYS B CB  1 
ATOM   6046  S SG  . CYS B 1 254 ? 9.405   32.066  71.955  1.00 21.31  ? 274  CYS B SG  1 
ATOM   6047  N N   . LYS B 1 255 ? 7.412   35.868  69.916  1.00 21.85  ? 275  LYS B N   1 
ATOM   6048  C CA  . LYS B 1 255 ? 6.318   36.743  69.499  1.00 22.63  ? 275  LYS B CA  1 
ATOM   6049  C C   . LYS B 1 255 ? 5.028   36.189  70.109  1.00 21.47  ? 275  LYS B C   1 
ATOM   6050  O O   . LYS B 1 255 ? 4.946   35.001  70.412  1.00 22.44  ? 275  LYS B O   1 
ATOM   6051  C CB  . LYS B 1 255 ? 6.197   36.741  67.975  1.00 25.03  ? 275  LYS B CB  1 
ATOM   6052  C CG  . LYS B 1 255 ? 7.422   37.262  67.252  1.00 28.86  ? 275  LYS B CG  1 
ATOM   6053  C CD  . LYS B 1 255 ? 7.973   36.244  66.251  1.00 33.69  ? 275  LYS B CD  1 
ATOM   6054  C CE  . LYS B 1 255 ? 7.034   35.994  65.066  1.00 34.29  ? 275  LYS B CE  1 
ATOM   6055  N NZ  . LYS B 1 255 ? 7.705   35.149  64.017  1.00 33.79  ? 275  LYS B NZ  1 
ATOM   6056  N N   . THR B 1 256 ? 4.022   37.032  70.303  1.00 20.23  ? 276  THR B N   1 
ATOM   6057  C CA  . THR B 1 256 ? 2.760   36.548  70.861  1.00 18.95  ? 276  THR B CA  1 
ATOM   6058  C C   . THR B 1 256 ? 1.636   36.777  69.856  1.00 18.33  ? 276  THR B C   1 
ATOM   6059  O O   . THR B 1 256 ? 0.468   36.912  70.231  1.00 17.81  ? 276  THR B O   1 
ATOM   6060  C CB  . THR B 1 256 ? 2.406   37.261  72.180  1.00 18.58  ? 276  THR B CB  1 
ATOM   6061  O OG1 . THR B 1 256 ? 2.235   38.663  71.939  1.00 17.69  ? 276  THR B OG1 1 
ATOM   6062  C CG2 . THR B 1 256 ? 3.506   37.051  73.204  1.00 16.58  ? 276  THR B CG2 1 
ATOM   6063  N N   . THR B 1 257 ? 2.011   36.808  68.575  1.00 17.10  ? 277  THR B N   1 
ATOM   6064  C CA  . THR B 1 257 ? 1.077   37.035  67.478  1.00 15.66  ? 277  THR B CA  1 
ATOM   6065  C C   . THR B 1 257 ? -0.191  36.221  67.626  1.00 15.00  ? 277  THR B C   1 
ATOM   6066  O O   . THR B 1 257 ? -1.292  36.764  67.584  1.00 15.44  ? 277  THR B O   1 
ATOM   6067  C CB  . THR B 1 257 ? 1.701   36.680  66.128  1.00 16.37  ? 277  THR B CB  1 
ATOM   6068  O OG1 . THR B 1 257 ? 3.005   37.272  66.021  1.00 17.61  ? 277  THR B OG1 1 
ATOM   6069  C CG2 . THR B 1 257 ? 0.816   37.187  65.005  1.00 13.82  ? 277  THR B CG2 1 
ATOM   6070  N N   . THR B 1 258 ? -0.027  34.912  67.782  1.00 14.30  ? 278  THR B N   1 
ATOM   6071  C CA  . THR B 1 258 ? -1.156  34.001  67.949  1.00 13.90  ? 278  THR B CA  1 
ATOM   6072  C C   . THR B 1 258 ? -0.705  32.883  68.872  1.00 14.47  ? 278  THR B C   1 
ATOM   6073  O O   . THR B 1 258 ? 0.494   32.676  69.046  1.00 16.36  ? 278  THR B O   1 
ATOM   6074  C CB  . THR B 1 258 ? -1.580  33.358  66.618  1.00 12.73  ? 278  THR B CB  1 
ATOM   6075  O OG1 . THR B 1 258 ? -0.572  32.436  66.195  1.00 10.25  ? 278  THR B OG1 1 
ATOM   6076  C CG2 . THR B 1 258 ? -1.783  34.415  65.546  1.00 11.49  ? 278  THR B CG2 1 
ATOM   6077  N N   . SER B 1 259 ? -1.649  32.163  69.467  1.00 14.31  ? 279  SER B N   1 
ATOM   6078  C CA  . SER B 1 259 ? -1.275  31.070  70.354  1.00 14.93  ? 279  SER B CA  1 
ATOM   6079  C C   . SER B 1 259 ? -0.322  30.123  69.628  1.00 16.40  ? 279  SER B C   1 
ATOM   6080  O O   . SER B 1 259 ? 0.806   29.889  70.076  1.00 16.77  ? 279  SER B O   1 
ATOM   6081  C CB  . SER B 1 259 ? -2.507  30.285  70.796  1.00 13.55  ? 279  SER B CB  1 
ATOM   6082  O OG  . SER B 1 259 ? -3.354  31.064  71.614  1.00 13.03  ? 279  SER B OG  1 
ATOM   6083  N N   . ALA B 1 260 ? -0.788  29.597  68.498  1.00 16.39  ? 280  ALA B N   1 
ATOM   6084  C CA  . ALA B 1 260 ? -0.015  28.657  67.701  1.00 15.44  ? 280  ALA B CA  1 
ATOM   6085  C C   . ALA B 1 260 ? 1.417   29.109  67.452  1.00 15.78  ? 280  ALA B C   1 
ATOM   6086  O O   . ALA B 1 260 ? 2.319   28.284  67.299  1.00 16.97  ? 280  ALA B O   1 
ATOM   6087  C CB  . ALA B 1 260 ? -0.718  28.404  66.378  1.00 14.84  ? 280  ALA B CB  1 
ATOM   6088  N N   . VAL B 1 261 ? 1.634   30.416  67.410  1.00 15.00  ? 281  VAL B N   1 
ATOM   6089  C CA  . VAL B 1 261 ? 2.971   30.929  67.161  1.00 14.80  ? 281  VAL B CA  1 
ATOM   6090  C C   . VAL B 1 261 ? 3.797   30.832  68.434  1.00 15.66  ? 281  VAL B C   1 
ATOM   6091  O O   . VAL B 1 261 ? 4.983   30.498  68.393  1.00 16.45  ? 281  VAL B O   1 
ATOM   6092  C CB  . VAL B 1 261 ? 2.908   32.386  66.658  1.00 14.34  ? 281  VAL B CB  1 
ATOM   6093  C CG1 . VAL B 1 261 ? 4.288   32.977  66.579  1.00 13.82  ? 281  VAL B CG1 1 
ATOM   6094  C CG2 . VAL B 1 261 ? 2.255   32.422  65.287  1.00 14.53  ? 281  VAL B CG2 1 
ATOM   6095  N N   . MET B 1 262 ? 3.166   31.110  69.570  1.00 15.89  ? 282  MET B N   1 
ATOM   6096  C CA  . MET B 1 262 ? 3.857   31.027  70.845  1.00 16.23  ? 282  MET B CA  1 
ATOM   6097  C C   . MET B 1 262 ? 4.327   29.596  71.068  1.00 16.45  ? 282  MET B C   1 
ATOM   6098  O O   . MET B 1 262 ? 5.504   29.344  71.330  1.00 16.79  ? 282  MET B O   1 
ATOM   6099  C CB  . MET B 1 262 ? 2.927   31.430  71.989  1.00 17.16  ? 282  MET B CB  1 
ATOM   6100  C CG  . MET B 1 262 ? 2.487   32.877  71.946  1.00 20.18  ? 282  MET B CG  1 
ATOM   6101  S SD  . MET B 1 262 ? 1.804   33.428  73.523  1.00 23.34  ? 282  MET B SD  1 
ATOM   6102  C CE  . MET B 1 262 ? 0.092   32.944  73.358  1.00 19.42  ? 282  MET B CE  1 
ATOM   6103  N N   . VAL B 1 263 ? 3.399   28.655  70.953  1.00 15.66  ? 283  VAL B N   1 
ATOM   6104  C CA  . VAL B 1 263 ? 3.732   27.261  71.161  1.00 15.97  ? 283  VAL B CA  1 
ATOM   6105  C C   . VAL B 1 263 ? 4.866   26.823  70.251  1.00 16.00  ? 283  VAL B C   1 
ATOM   6106  O O   . VAL B 1 263 ? 5.836   26.225  70.710  1.00 15.92  ? 283  VAL B O   1 
ATOM   6107  C CB  . VAL B 1 263 ? 2.515   26.347  70.913  1.00 16.09  ? 283  VAL B CB  1 
ATOM   6108  C CG1 . VAL B 1 263 ? 2.862   24.908  71.288  1.00 15.90  ? 283  VAL B CG1 1 
ATOM   6109  C CG2 . VAL B 1 263 ? 1.329   26.825  71.729  1.00 16.76  ? 283  VAL B CG2 1 
ATOM   6110  N N   . HIS B 1 264 ? 4.745   27.120  68.961  1.00 16.01  ? 284  HIS B N   1 
ATOM   6111  C CA  . HIS B 1 264 ? 5.770   26.733  67.995  1.00 14.54  ? 284  HIS B CA  1 
ATOM   6112  C C   . HIS B 1 264 ? 7.126   27.258  68.429  1.00 14.06  ? 284  HIS B C   1 
ATOM   6113  O O   . HIS B 1 264 ? 8.128   26.550  68.340  1.00 14.08  ? 284  HIS B O   1 
ATOM   6114  C CB  . HIS B 1 264 ? 5.430   27.275  66.602  1.00 15.39  ? 284  HIS B CB  1 
ATOM   6115  C CG  . HIS B 1 264 ? 6.426   26.899  65.548  1.00 16.92  ? 284  HIS B CG  1 
ATOM   6116  N ND1 . HIS B 1 264 ? 6.655   25.594  65.168  1.00 19.33  ? 284  HIS B ND1 1 
ATOM   6117  C CD2 . HIS B 1 264 ? 7.268   27.657  64.804  1.00 17.61  ? 284  HIS B CD2 1 
ATOM   6118  C CE1 . HIS B 1 264 ? 7.595   25.563  64.240  1.00 18.70  ? 284  HIS B CE1 1 
ATOM   6119  N NE2 . HIS B 1 264 ? 7.984   26.803  64.001  1.00 18.02  ? 284  HIS B NE2 1 
ATOM   6120  N N   . CYS B 1 265 ? 7.147   28.498  68.910  1.00 13.69  ? 285  CYS B N   1 
ATOM   6121  C CA  . CYS B 1 265 ? 8.382   29.135  69.354  1.00 13.34  ? 285  CYS B CA  1 
ATOM   6122  C C   . CYS B 1 265 ? 8.972   28.518  70.611  1.00 10.71  ? 285  CYS B C   1 
ATOM   6123  O O   . CYS B 1 265 ? 10.178  28.359  70.718  1.00 6.50   ? 285  CYS B O   1 
ATOM   6124  C CB  . CYS B 1 265 ? 8.142   30.612  69.598  1.00 15.30  ? 285  CYS B CB  1 
ATOM   6125  S SG  . CYS B 1 265 ? 9.652   31.549  70.007  1.00 23.14  ? 285  CYS B SG  1 
ATOM   6126  N N   . LEU B 1 266 ? 8.115   28.195  71.570  1.00 11.88  ? 286  LEU B N   1 
ATOM   6127  C CA  . LEU B 1 266 ? 8.574   27.585  72.802  1.00 13.73  ? 286  LEU B CA  1 
ATOM   6128  C C   . LEU B 1 266 ? 9.098   26.178  72.521  1.00 16.63  ? 286  LEU B C   1 
ATOM   6129  O O   . LEU B 1 266 ? 9.981   25.691  73.231  1.00 18.59  ? 286  LEU B O   1 
ATOM   6130  C CB  . LEU B 1 266 ? 7.441   27.547  73.825  1.00 12.69  ? 286  LEU B CB  1 
ATOM   6131  C CG  . LEU B 1 266 ? 7.007   28.916  74.356  1.00 12.93  ? 286  LEU B CG  1 
ATOM   6132  C CD1 . LEU B 1 266 ? 5.901   28.743  75.374  1.00 12.19  ? 286  LEU B CD1 1 
ATOM   6133  C CD2 . LEU B 1 266 ? 8.194   29.619  74.998  1.00 12.26  ? 286  LEU B CD2 1 
ATOM   6134  N N   . ARG B 1 267 ? 8.565   25.524  71.487  1.00 17.44  ? 287  ARG B N   1 
ATOM   6135  C CA  . ARG B 1 267 ? 9.029   24.184  71.133  1.00 18.90  ? 287  ARG B CA  1 
ATOM   6136  C C   . ARG B 1 267 ? 10.433  24.284  70.553  1.00 19.45  ? 287  ARG B C   1 
ATOM   6137  O O   . ARG B 1 267 ? 11.171  23.301  70.538  1.00 20.74  ? 287  ARG B O   1 
ATOM   6138  C CB  . ARG B 1 267 ? 8.114   23.516  70.092  1.00 20.58  ? 287  ARG B CB  1 
ATOM   6139  C CG  . ARG B 1 267 ? 6.774   23.022  70.628  1.00 22.24  ? 287  ARG B CG  1 
ATOM   6140  C CD  . ARG B 1 267 ? 6.317   21.719  69.959  1.00 20.75  ? 287  ARG B CD  1 
ATOM   6141  N NE  . ARG B 1 267 ? 5.101   21.214  70.595  1.00 21.47  ? 287  ARG B NE  1 
ATOM   6142  C CZ  . ARG B 1 267 ? 3.881   21.699  70.374  1.00 21.12  ? 287  ARG B CZ  1 
ATOM   6143  N NH1 . ARG B 1 267 ? 3.703   22.694  69.518  1.00 19.49  ? 287  ARG B NH1 1 
ATOM   6144  N NH2 . ARG B 1 267 ? 2.842   21.218  71.043  1.00 20.40  ? 287  ARG B NH2 1 
ATOM   6145  N N   . GLN B 1 268 ? 10.787  25.480  70.084  1.00 18.97  ? 288  GLN B N   1 
ATOM   6146  C CA  . GLN B 1 268 ? 12.086  25.748  69.478  1.00 17.86  ? 288  GLN B CA  1 
ATOM   6147  C C   . GLN B 1 268 ? 13.204  25.938  70.487  1.00 16.78  ? 288  GLN B C   1 
ATOM   6148  O O   . GLN B 1 268 ? 14.364  25.668  70.195  1.00 16.98  ? 288  GLN B O   1 
ATOM   6149  C CB  . GLN B 1 268 ? 12.010  27.010  68.627  1.00 22.16  ? 288  GLN B CB  1 
ATOM   6150  C CG  . GLN B 1 268 ? 10.908  27.010  67.613  1.00 27.74  ? 288  GLN B CG  1 
ATOM   6151  C CD  . GLN B 1 268 ? 11.012  25.829  66.689  1.00 32.50  ? 288  GLN B CD  1 
ATOM   6152  O OE1 . GLN B 1 268 ? 11.990  25.694  65.950  1.00 34.29  ? 288  GLN B OE1 1 
ATOM   6153  N NE2 . GLN B 1 268 ? 10.007  24.953  66.726  1.00 35.33  ? 288  GLN B NE2 1 
ATOM   6154  N N   . LYS B 1 269 ? 12.859  26.423  71.670  1.00 15.87  ? 289  LYS B N   1 
ATOM   6155  C CA  . LYS B 1 269 ? 13.854  26.676  72.699  1.00 15.82  ? 289  LYS B CA  1 
ATOM   6156  C C   . LYS B 1 269 ? 14.478  25.411  73.266  1.00 15.79  ? 289  LYS B C   1 
ATOM   6157  O O   . LYS B 1 269 ? 13.910  24.323  73.182  1.00 16.75  ? 289  LYS B O   1 
ATOM   6158  C CB  . LYS B 1 269 ? 13.223  27.477  73.832  1.00 17.27  ? 289  LYS B CB  1 
ATOM   6159  C CG  . LYS B 1 269 ? 12.609  28.791  73.400  1.00 16.08  ? 289  LYS B CG  1 
ATOM   6160  C CD  . LYS B 1 269 ? 13.660  29.698  72.833  1.00 17.11  ? 289  LYS B CD  1 
ATOM   6161  C CE  . LYS B 1 269 ? 13.076  31.032  72.447  1.00 19.37  ? 289  LYS B CE  1 
ATOM   6162  N NZ  . LYS B 1 269 ? 14.126  31.868  71.806  1.00 23.00  ? 289  LYS B NZ  1 
ATOM   6163  N N   . THR B 1 270 ? 15.656  25.559  73.851  1.00 15.65  ? 290  THR B N   1 
ATOM   6164  C CA  . THR B 1 270 ? 16.336  24.419  74.442  1.00 16.25  ? 290  THR B CA  1 
ATOM   6165  C C   . THR B 1 270 ? 15.963  24.303  75.909  1.00 16.61  ? 290  THR B C   1 
ATOM   6166  O O   . THR B 1 270 ? 15.471  25.261  76.511  1.00 15.83  ? 290  THR B O   1 
ATOM   6167  C CB  . THR B 1 270 ? 17.866  24.559  74.365  1.00 16.02  ? 290  THR B CB  1 
ATOM   6168  O OG1 . THR B 1 270 ? 18.296  25.630  75.218  1.00 14.91  ? 290  THR B OG1 1 
ATOM   6169  C CG2 . THR B 1 270 ? 18.299  24.830  72.948  1.00 13.25  ? 290  THR B CG2 1 
ATOM   6170  N N   . GLU B 1 271 ? 16.204  23.124  76.475  1.00 18.17  ? 291  GLU B N   1 
ATOM   6171  C CA  . GLU B 1 271 ? 15.914  22.874  77.880  1.00 19.35  ? 291  GLU B CA  1 
ATOM   6172  C C   . GLU B 1 271 ? 16.523  24.010  78.688  1.00 21.38  ? 291  GLU B C   1 
ATOM   6173  O O   . GLU B 1 271 ? 15.841  24.658  79.482  1.00 21.85  ? 291  GLU B O   1 
ATOM   6174  C CB  . GLU B 1 271 ? 16.517  21.535  78.317  1.00 16.96  ? 291  GLU B CB  1 
ATOM   6175  C CG  . GLU B 1 271 ? 16.486  21.293  79.809  1.00 17.68  ? 291  GLU B CG  1 
ATOM   6176  C CD  . GLU B 1 271 ? 17.116  19.969  80.215  1.00 19.04  ? 291  GLU B CD  1 
ATOM   6177  O OE1 . GLU B 1 271 ? 16.384  18.965  80.331  1.00 19.09  ? 291  GLU B OE1 1 
ATOM   6178  O OE2 . GLU B 1 271 ? 18.351  19.930  80.412  1.00 20.80  ? 291  GLU B OE2 1 
ATOM   6179  N N   . GLU B 1 272 ? 17.801  24.278  78.453  1.00 23.37  ? 292  GLU B N   1 
ATOM   6180  C CA  . GLU B 1 272 ? 18.489  25.332  79.178  1.00 24.78  ? 292  GLU B CA  1 
ATOM   6181  C C   . GLU B 1 272 ? 17.799  26.692  79.089  1.00 23.89  ? 292  GLU B C   1 
ATOM   6182  O O   . GLU B 1 272 ? 17.761  27.440  80.067  1.00 21.61  ? 292  GLU B O   1 
ATOM   6183  C CB  . GLU B 1 272 ? 19.929  25.452  78.686  1.00 28.31  ? 292  GLU B CB  1 
ATOM   6184  C CG  . GLU B 1 272 ? 20.791  26.271  79.622  1.00 35.74  ? 292  GLU B CG  1 
ATOM   6185  C CD  . GLU B 1 272 ? 20.555  25.898  81.085  1.00 40.17  ? 292  GLU B CD  1 
ATOM   6186  O OE1 . GLU B 1 272 ? 20.751  24.713  81.449  1.00 41.08  ? 292  GLU B OE1 1 
ATOM   6187  O OE2 . GLU B 1 272 ? 20.164  26.795  81.868  1.00 42.21  ? 292  GLU B OE2 1 
ATOM   6188  N N   . GLU B 1 273 ? 17.248  27.008  77.920  1.00 24.32  ? 293  GLU B N   1 
ATOM   6189  C CA  . GLU B 1 273 ? 16.573  28.288  77.728  1.00 24.32  ? 293  GLU B CA  1 
ATOM   6190  C C   . GLU B 1 273 ? 15.280  28.363  78.535  1.00 23.98  ? 293  GLU B C   1 
ATOM   6191  O O   . GLU B 1 273 ? 14.971  29.394  79.144  1.00 23.25  ? 293  GLU B O   1 
ATOM   6192  C CB  . GLU B 1 273 ? 16.295  28.517  76.242  1.00 24.64  ? 293  GLU B CB  1 
ATOM   6193  C CG  . GLU B 1 273 ? 17.555  28.423  75.400  1.00 28.80  ? 293  GLU B CG  1 
ATOM   6194  C CD  . GLU B 1 273 ? 17.351  28.799  73.944  1.00 31.01  ? 293  GLU B CD  1 
ATOM   6195  O OE1 . GLU B 1 273 ? 17.200  30.007  73.650  1.00 32.60  ? 293  GLU B OE1 1 
ATOM   6196  O OE2 . GLU B 1 273 ? 17.344  27.882  73.094  1.00 32.21  ? 293  GLU B OE2 1 
ATOM   6197  N N   . LEU B 1 274 ? 14.528  27.268  78.551  1.00 22.83  ? 294  LEU B N   1 
ATOM   6198  C CA  . LEU B 1 274 ? 13.292  27.248  79.306  1.00 21.58  ? 294  LEU B CA  1 
ATOM   6199  C C   . LEU B 1 274 ? 13.569  27.225  80.809  1.00 21.95  ? 294  LEU B C   1 
ATOM   6200  O O   . LEU B 1 274 ? 12.769  27.716  81.605  1.00 22.72  ? 294  LEU B O   1 
ATOM   6201  C CB  . LEU B 1 274 ? 12.438  26.049  78.898  1.00 21.11  ? 294  LEU B CB  1 
ATOM   6202  C CG  . LEU B 1 274 ? 11.819  26.118  77.496  1.00 21.35  ? 294  LEU B CG  1 
ATOM   6203  C CD1 . LEU B 1 274 ? 10.718  25.085  77.382  1.00 21.42  ? 294  LEU B CD1 1 
ATOM   6204  C CD2 . LEU B 1 274 ? 11.230  27.491  77.250  1.00 21.52  ? 294  LEU B CD2 1 
ATOM   6205  N N   . LEU B 1 275 ? 14.707  26.670  81.208  1.00 21.54  ? 295  LEU B N   1 
ATOM   6206  C CA  . LEU B 1 275 ? 15.035  26.621  82.627  1.00 20.26  ? 295  LEU B CA  1 
ATOM   6207  C C   . LEU B 1 275 ? 15.395  28.024  83.103  1.00 21.05  ? 295  LEU B C   1 
ATOM   6208  O O   . LEU B 1 275 ? 14.972  28.452  84.175  1.00 19.68  ? 295  LEU B O   1 
ATOM   6209  C CB  . LEU B 1 275 ? 16.190  25.648  82.877  1.00 17.39  ? 295  LEU B CB  1 
ATOM   6210  C CG  . LEU B 1 275 ? 16.664  25.419  84.313  1.00 14.96  ? 295  LEU B CG  1 
ATOM   6211  C CD1 . LEU B 1 275 ? 15.484  25.220  85.244  1.00 13.93  ? 295  LEU B CD1 1 
ATOM   6212  C CD2 . LEU B 1 275 ? 17.583  24.215  84.344  1.00 12.02  ? 295  LEU B CD2 1 
ATOM   6213  N N   . GLU B 1 276 ? 16.166  28.745  82.294  1.00 23.33  ? 296  GLU B N   1 
ATOM   6214  C CA  . GLU B 1 276 ? 16.549  30.105  82.647  1.00 25.40  ? 296  GLU B CA  1 
ATOM   6215  C C   . GLU B 1 276 ? 15.293  30.941  82.765  1.00 24.69  ? 296  GLU B C   1 
ATOM   6216  O O   . GLU B 1 276 ? 15.144  31.725  83.697  1.00 23.17  ? 296  GLU B O   1 
ATOM   6217  C CB  . GLU B 1 276 ? 17.462  30.692  81.586  1.00 27.48  ? 296  GLU B CB  1 
ATOM   6218  C CG  . GLU B 1 276 ? 18.649  29.810  81.315  1.00 35.18  ? 296  GLU B CG  1 
ATOM   6219  C CD  . GLU B 1 276 ? 19.758  30.542  80.606  1.00 39.01  ? 296  GLU B CD  1 
ATOM   6220  O OE1 . GLU B 1 276 ? 20.772  29.889  80.261  1.00 40.12  ? 296  GLU B OE1 1 
ATOM   6221  O OE2 . GLU B 1 276 ? 19.609  31.769  80.403  1.00 40.63  ? 296  GLU B OE2 1 
ATOM   6222  N N   . THR B 1 277 ? 14.391  30.771  81.807  1.00 25.24  ? 297  THR B N   1 
ATOM   6223  C CA  . THR B 1 277 ? 13.137  31.492  81.837  1.00 26.72  ? 297  THR B CA  1 
ATOM   6224  C C   . THR B 1 277 ? 12.411  31.047  83.102  1.00 28.95  ? 297  THR B C   1 
ATOM   6225  O O   . THR B 1 277 ? 11.867  31.866  83.843  1.00 29.42  ? 297  THR B O   1 
ATOM   6226  C CB  . THR B 1 277 ? 12.277  31.160  80.607  1.00 25.99  ? 297  THR B CB  1 
ATOM   6227  O OG1 . THR B 1 277 ? 12.930  31.645  79.432  1.00 26.74  ? 297  THR B OG1 1 
ATOM   6228  C CG2 . THR B 1 277 ? 10.908  31.801  80.714  1.00 24.64  ? 297  THR B CG2 1 
ATOM   6229  N N   . THR B 1 278 ? 12.424  29.743  83.358  1.00 30.58  ? 298  THR B N   1 
ATOM   6230  C CA  . THR B 1 278 ? 11.766  29.205  84.540  1.00 32.86  ? 298  THR B CA  1 
ATOM   6231  C C   . THR B 1 278 ? 12.259  29.897  85.797  1.00 34.35  ? 298  THR B C   1 
ATOM   6232  O O   . THR B 1 278 ? 11.498  30.092  86.741  1.00 35.39  ? 298  THR B O   1 
ATOM   6233  C CB  . THR B 1 278 ? 12.030  27.700  84.699  1.00 33.11  ? 298  THR B CB  1 
ATOM   6234  O OG1 . THR B 1 278 ? 11.392  26.989  83.633  1.00 34.58  ? 298  THR B OG1 1 
ATOM   6235  C CG2 . THR B 1 278 ? 11.493  27.201  86.037  1.00 32.49  ? 298  THR B CG2 1 
ATOM   6236  N N   . LEU B 1 279 ? 13.536  30.267  85.801  1.00 35.77  ? 299  LEU B N   1 
ATOM   6237  C CA  . LEU B 1 279 ? 14.138  30.915  86.955  1.00 36.40  ? 299  LEU B CA  1 
ATOM   6238  C C   . LEU B 1 279 ? 13.958  32.424  87.012  1.00 39.62  ? 299  LEU B C   1 
ATOM   6239  O O   . LEU B 1 279 ? 13.870  32.991  88.100  1.00 41.65  ? 299  LEU B O   1 
ATOM   6240  C CB  . LEU B 1 279 ? 15.621  30.558  87.036  1.00 31.86  ? 299  LEU B CB  1 
ATOM   6241  C CG  . LEU B 1 279 ? 15.837  29.065  87.288  1.00 28.62  ? 299  LEU B CG  1 
ATOM   6242  C CD1 . LEU B 1 279 ? 17.315  28.759  87.335  1.00 26.70  ? 299  LEU B CD1 1 
ATOM   6243  C CD2 . LEU B 1 279 ? 15.166  28.667  88.593  1.00 26.91  ? 299  LEU B CD2 1 
ATOM   6244  N N   . LYS B 1 280 ? 13.912  33.086  85.862  1.00 42.21  ? 300  LYS B N   1 
ATOM   6245  C CA  . LYS B 1 280 ? 13.715  34.531  85.866  1.00 44.72  ? 300  LYS B CA  1 
ATOM   6246  C C   . LYS B 1 280 ? 12.344  34.781  86.474  1.00 47.85  ? 300  LYS B C   1 
ATOM   6247  O O   . LYS B 1 280 ? 12.143  35.741  87.220  1.00 48.73  ? 300  LYS B O   1 
ATOM   6248  C CB  . LYS B 1 280 ? 13.737  35.090  84.446  1.00 43.24  ? 300  LYS B CB  1 
ATOM   6249  C CG  . LYS B 1 280 ? 15.050  34.933  83.732  1.00 43.19  ? 300  LYS B CG  1 
ATOM   6250  C CD  . LYS B 1 280 ? 14.892  35.246  82.258  1.00 42.99  ? 300  LYS B CD  1 
ATOM   6251  C CE  . LYS B 1 280 ? 16.184  35.004  81.511  1.00 42.65  ? 300  LYS B CE  1 
ATOM   6252  N NZ  . LYS B 1 280 ? 15.980  35.100  80.048  1.00 43.51  ? 300  LYS B NZ  1 
ATOM   6253  N N   . MET B 1 281 ? 11.411  33.890  86.153  1.00 50.50  ? 301  MET B N   1 
ATOM   6254  C CA  . MET B 1 281 ? 10.041  33.989  86.632  1.00 53.82  ? 301  MET B CA  1 
ATOM   6255  C C   . MET B 1 281 ? 9.914   33.886  88.154  1.00 56.49  ? 301  MET B C   1 
ATOM   6256  O O   . MET B 1 281 ? 8.917   34.326  88.717  1.00 57.21  ? 301  MET B O   1 
ATOM   6257  C CB  . MET B 1 281 ? 9.176   32.904  85.976  1.00 53.69  ? 301  MET B CB  1 
ATOM   6258  C CG  . MET B 1 281 ? 9.254   32.817  84.440  1.00 52.44  ? 301  MET B CG  1 
ATOM   6259  S SD  . MET B 1 281 ? 8.641   34.247  83.512  1.00 49.94  ? 301  MET B SD  1 
ATOM   6260  C CE  . MET B 1 281 ? 6.868   33.952  83.531  1.00 48.31  ? 301  MET B CE  1 
ATOM   6261  N N   . LYS B 1 282 ? 10.916  33.307  88.815  1.00 60.09  ? 302  LYS B N   1 
ATOM   6262  C CA  . LYS B 1 282 ? 10.904  33.146  90.276  1.00 64.17  ? 302  LYS B CA  1 
ATOM   6263  C C   . LYS B 1 282 ? 9.529   32.703  90.789  1.00 67.04  ? 302  LYS B C   1 
ATOM   6264  O O   . LYS B 1 282 ? 8.931   33.351  91.655  1.00 67.12  ? 302  LYS B O   1 
ATOM   6265  C CB  . LYS B 1 282 ? 11.322  34.458  90.953  1.00 64.58  ? 302  LYS B CB  1 
ATOM   6266  C CG  . LYS B 1 282 ? 12.694  34.952  90.510  1.00 66.01  ? 302  LYS B CG  1 
ATOM   6267  C CD  . LYS B 1 282 ? 13.071  36.287  91.135  1.00 66.70  ? 302  LYS B CD  1 
ATOM   6268  C CE  . LYS B 1 282 ? 14.433  36.752  90.624  1.00 66.84  ? 302  LYS B CE  1 
ATOM   6269  N NZ  . LYS B 1 282 ? 14.883  38.046  91.216  1.00 66.52  ? 302  LYS B NZ  1 
ATOM   6270  N N   . PHE B 1 283 ? 9.050   31.584  90.247  1.00 70.31  ? 303  PHE B N   1 
ATOM   6271  C CA  . PHE B 1 283 ? 7.746   31.005  90.584  1.00 73.58  ? 303  PHE B CA  1 
ATOM   6272  C C   . PHE B 1 283 ? 7.582   30.492  92.016  1.00 75.54  ? 303  PHE B C   1 
ATOM   6273  O O   . PHE B 1 283 ? 6.495   30.583  92.591  1.00 75.54  ? 303  PHE B O   1 
ATOM   6274  C CB  . PHE B 1 283 ? 7.434   29.852  89.620  1.00 73.57  ? 303  PHE B CB  1 
ATOM   6275  C CG  . PHE B 1 283 ? 7.066   30.295  88.231  1.00 74.02  ? 303  PHE B CG  1 
ATOM   6276  C CD1 . PHE B 1 283 ? 7.315   29.467  87.139  1.00 74.07  ? 303  PHE B CD1 1 
ATOM   6277  C CD2 . PHE B 1 283 ? 6.446   31.523  88.012  1.00 74.14  ? 303  PHE B CD2 1 
ATOM   6278  C CE1 . PHE B 1 283 ? 6.952   29.853  85.848  1.00 73.50  ? 303  PHE B CE1 1 
ATOM   6279  C CE2 . PHE B 1 283 ? 6.079   31.918  86.726  1.00 74.11  ? 303  PHE B CE2 1 
ATOM   6280  C CZ  . PHE B 1 283 ? 6.333   31.079  85.642  1.00 73.54  ? 303  PHE B CZ  1 
ATOM   6281  N N   . LEU B 1 284 ? 8.658   29.950  92.580  1.00 77.98  ? 304  LEU B N   1 
ATOM   6282  C CA  . LEU B 1 284 ? 8.632   29.380  93.927  1.00 80.47  ? 304  LEU B CA  1 
ATOM   6283  C C   . LEU B 1 284 ? 8.763   30.390  95.077  1.00 81.66  ? 304  LEU B C   1 
ATOM   6284  O O   . LEU B 1 284 ? 8.339   30.113  96.205  1.00 81.34  ? 304  LEU B O   1 
ATOM   6285  C CB  . LEU B 1 284 ? 9.730   28.312  94.043  1.00 80.77  ? 304  LEU B CB  1 
ATOM   6286  C CG  . LEU B 1 284 ? 9.672   27.189  92.997  1.00 80.78  ? 304  LEU B CG  1 
ATOM   6287  C CD1 . LEU B 1 284 ? 10.955  26.377  93.028  1.00 80.12  ? 304  LEU B CD1 1 
ATOM   6288  C CD2 . LEU B 1 284 ? 8.459   26.309  93.261  1.00 80.92  ? 304  LEU B CD2 1 
ATOM   6289  N N   . SER B 1 285 ? 9.342   31.554  94.794  1.00 82.68  ? 305  SER B N   1 
ATOM   6290  C CA  . SER B 1 285 ? 9.515   32.578  95.817  1.00 83.73  ? 305  SER B CA  1 
ATOM   6291  C C   . SER B 1 285 ? 8.367   33.588  95.792  1.00 84.99  ? 305  SER B C   1 
ATOM   6292  O O   . SER B 1 285 ? 7.794   33.869  94.737  1.00 84.73  ? 305  SER B O   1 
ATOM   6293  C CB  . SER B 1 285 ? 10.851  33.298  95.616  1.00 83.43  ? 305  SER B CB  1 
ATOM   6294  O OG  . SER B 1 285 ? 11.161  34.118  96.728  1.00 83.35  ? 305  SER B OG  1 
ATOM   6295  N N   . LEU B 1 286 ? 8.038   34.129  96.962  1.00 86.49  ? 306  LEU B N   1 
ATOM   6296  C CA  . LEU B 1 286 ? 6.956   35.103  97.100  1.00 87.57  ? 306  LEU B CA  1 
ATOM   6297  C C   . LEU B 1 286 ? 7.463   36.538  96.956  1.00 88.24  ? 306  LEU B C   1 
ATOM   6298  O O   . LEU B 1 286 ? 8.420   36.935  97.623  1.00 87.85  ? 306  LEU B O   1 
ATOM   6299  C CB  . LEU B 1 286 ? 6.282   34.935  98.467  1.00 87.55  ? 306  LEU B CB  1 
ATOM   6300  C CG  . LEU B 1 286 ? 5.072   35.815  98.793  1.00 87.39  ? 306  LEU B CG  1 
ATOM   6301  C CD1 . LEU B 1 286 ? 3.921   35.485  97.858  1.00 86.97  ? 306  LEU B CD1 1 
ATOM   6302  C CD2 . LEU B 1 286 ? 4.655   35.585  100.235 1.00 87.78  ? 306  LEU B CD2 1 
ATOM   6303  N N   . ASP B 1 287 ? 6.814   37.311  96.089  1.00 89.14  ? 307  ASP B N   1 
ATOM   6304  C CA  . ASP B 1 287 ? 7.203   38.700  95.867  1.00 90.55  ? 307  ASP B CA  1 
ATOM   6305  C C   . ASP B 1 287 ? 6.592   39.619  96.920  1.00 91.04  ? 307  ASP B C   1 
ATOM   6306  O O   . ASP B 1 287 ? 5.380   39.834  96.936  1.00 90.62  ? 307  ASP B O   1 
ATOM   6307  C CB  . ASP B 1 287 ? 6.756   39.169  94.482  1.00 91.59  ? 307  ASP B CB  1 
ATOM   6308  C CG  . ASP B 1 287 ? 7.248   40.573  94.155  1.00 93.00  ? 307  ASP B CG  1 
ATOM   6309  O OD1 . ASP B 1 287 ? 6.737   41.177  93.185  1.00 93.69  ? 307  ASP B OD1 1 
ATOM   6310  O OD2 . ASP B 1 287 ? 8.152   41.071  94.861  1.00 93.16  ? 307  ASP B OD2 1 
ATOM   6311  N N   . LEU B 1 288 ? 7.440   40.163  97.790  1.00 92.02  ? 308  LEU B N   1 
ATOM   6312  C CA  . LEU B 1 288 ? 7.003   41.066  98.855  1.00 92.94  ? 308  LEU B CA  1 
ATOM   6313  C C   . LEU B 1 288 ? 6.418   42.384  98.341  1.00 93.79  ? 308  LEU B C   1 
ATOM   6314  O O   . LEU B 1 288 ? 5.260   42.711  98.625  1.00 93.56  ? 308  LEU B O   1 
ATOM   6315  C CB  . LEU B 1 288 ? 8.172   41.371  99.801  1.00 92.13  ? 308  LEU B CB  1 
ATOM   6316  C CG  . LEU B 1 288 ? 8.397   40.423  100.980 1.00 91.59  ? 308  LEU B CG  1 
ATOM   6317  C CD1 . LEU B 1 288 ? 9.686   40.789  101.703 1.00 91.18  ? 308  LEU B CD1 1 
ATOM   6318  C CD2 . LEU B 1 288 ? 7.206   40.513  101.923 1.00 90.79  ? 308  LEU B CD2 1 
ATOM   6319  N N   . GLN B 1 289 ? 7.223   43.139  97.595  1.00 94.52  ? 309  GLN B N   1 
ATOM   6320  C CA  . GLN B 1 289 ? 6.790   44.426  97.056  1.00 94.74  ? 309  GLN B CA  1 
ATOM   6321  C C   . GLN B 1 289 ? 5.869   44.257  95.855  1.00 94.98  ? 309  GLN B C   1 
ATOM   6322  O O   . GLN B 1 289 ? 5.619   43.139  95.397  1.00 95.09  ? 309  GLN B O   1 
ATOM   6323  C CB  . GLN B 1 289 ? 8.002   45.279  96.656  1.00 94.55  ? 309  GLN B CB  1 
ATOM   6324  C CG  . GLN B 1 289 ? 8.689   44.843  95.367  1.00 94.24  ? 309  GLN B CG  1 
ATOM   6325  C CD  . GLN B 1 289 ? 9.909   45.688  95.043  1.00 93.75  ? 309  GLN B CD  1 
ATOM   6326  O OE1 . GLN B 1 289 ? 10.917  45.637  95.751  1.00 93.26  ? 309  GLN B OE1 1 
ATOM   6327  N NE2 . GLN B 1 289 ? 9.820   46.475  93.974  1.00 92.62  ? 309  GLN B NE2 1 
ATOM   6328  N N   . GLY B 1 290 ? 5.371   45.377  95.344  1.00 95.19  ? 310  GLY B N   1 
ATOM   6329  C CA  . GLY B 1 290 ? 4.475   45.330  94.207  1.00 95.19  ? 310  GLY B CA  1 
ATOM   6330  C C   . GLY B 1 290 ? 3.038   45.186  94.664  1.00 95.16  ? 310  GLY B C   1 
ATOM   6331  O O   . GLY B 1 290 ? 2.741   45.311  95.854  1.00 94.97  ? 310  GLY B O   1 
ATOM   6332  N N   . ASP B 1 291 ? 2.144   44.921  93.718  1.00 95.31  ? 311  ASP B N   1 
ATOM   6333  C CA  . ASP B 1 291 ? 0.730   44.763  94.029  1.00 95.43  ? 311  ASP B CA  1 
ATOM   6334  C C   . ASP B 1 291 ? 0.404   43.291  94.253  1.00 95.70  ? 311  ASP B C   1 
ATOM   6335  O O   . ASP B 1 291 ? 0.788   42.433  93.459  1.00 95.58  ? 311  ASP B O   1 
ATOM   6336  C CB  . ASP B 1 291 ? -0.127  45.317  92.887  1.00 94.77  ? 311  ASP B CB  1 
ATOM   6337  C CG  . ASP B 1 291 ? -1.603  45.386  93.240  1.00 94.56  ? 311  ASP B CG  1 
ATOM   6338  O OD1 . ASP B 1 291 ? -2.227  44.322  93.450  1.00 93.78  ? 311  ASP B OD1 1 
ATOM   6339  O OD2 . ASP B 1 291 ? -2.138  46.513  93.310  1.00 94.50  ? 311  ASP B OD2 1 
ATOM   6340  N N   . PRO B 1 292 ? -0.302  42.980  95.351  1.00 96.06  ? 312  PRO B N   1 
ATOM   6341  C CA  . PRO B 1 292 ? -0.684  41.605  95.683  1.00 96.42  ? 312  PRO B CA  1 
ATOM   6342  C C   . PRO B 1 292 ? -1.357  40.879  94.515  1.00 96.67  ? 312  PRO B C   1 
ATOM   6343  O O   . PRO B 1 292 ? -1.065  39.710  94.244  1.00 96.86  ? 312  PRO B O   1 
ATOM   6344  C CB  . PRO B 1 292 ? -1.623  41.796  96.871  1.00 96.41  ? 312  PRO B CB  1 
ATOM   6345  C CG  . PRO B 1 292 ? -1.014  42.968  97.571  1.00 96.17  ? 312  PRO B CG  1 
ATOM   6346  C CD  . PRO B 1 292 ? -0.720  43.908  96.419  1.00 96.23  ? 312  PRO B CD  1 
ATOM   6347  N N   . ARG B 1 293 ? -2.253  41.582  93.826  1.00 96.54  ? 313  ARG B N   1 
ATOM   6348  C CA  . ARG B 1 293 ? -2.976  41.018  92.692  1.00 96.22  ? 313  ARG B CA  1 
ATOM   6349  C C   . ARG B 1 293 ? -2.139  40.951  91.414  1.00 95.70  ? 313  ARG B C   1 
ATOM   6350  O O   . ARG B 1 293 ? -2.412  40.134  90.532  1.00 95.82  ? 313  ARG B O   1 
ATOM   6351  C CB  . ARG B 1 293 ? -4.248  41.824  92.440  1.00 96.66  ? 313  ARG B CB  1 
ATOM   6352  C CG  . ARG B 1 293 ? -5.302  41.630  93.510  1.00 97.93  ? 313  ARG B CG  1 
ATOM   6353  C CD  . ARG B 1 293 ? -6.322  42.747  93.478  1.00 99.54  ? 313  ARG B CD  1 
ATOM   6354  N NE  . ARG B 1 293 ? -5.719  44.026  93.845  1.00 100.86 ? 313  ARG B NE  1 
ATOM   6355  C CZ  . ARG B 1 293 ? -6.371  45.184  93.871  1.00 101.02 ? 313  ARG B CZ  1 
ATOM   6356  N NH1 . ARG B 1 293 ? -7.658  45.234  93.548  1.00 100.73 ? 313  ARG B NH1 1 
ATOM   6357  N NH2 . ARG B 1 293 ? -5.736  46.295  94.223  1.00 100.86 ? 313  ARG B NH2 1 
ATOM   6358  N N   . GLU B 1 294 ? -1.125  41.808  91.312  1.00 94.67  ? 314  GLU B N   1 
ATOM   6359  C CA  . GLU B 1 294 ? -0.262  41.809  90.135  1.00 93.44  ? 314  GLU B CA  1 
ATOM   6360  C C   . GLU B 1 294 ? 0.843   40.766  90.223  1.00 92.78  ? 314  GLU B C   1 
ATOM   6361  O O   . GLU B 1 294 ? 0.999   39.957  89.309  1.00 93.05  ? 314  GLU B O   1 
ATOM   6362  C CB  . GLU B 1 294 ? 0.366   43.187  89.909  1.00 93.12  ? 314  GLU B CB  1 
ATOM   6363  C CG  . GLU B 1 294 ? -0.533  44.171  89.180  1.00 92.73  ? 314  GLU B CG  1 
ATOM   6364  C CD  . GLU B 1 294 ? 0.258   45.191  88.382  1.00 92.37  ? 314  GLU B CD  1 
ATOM   6365  O OE1 . GLU B 1 294 ? 1.112   45.875  88.979  1.00 92.36  ? 314  GLU B OE1 1 
ATOM   6366  O OE2 . GLU B 1 294 ? 0.028   45.308  87.158  1.00 91.85  ? 314  GLU B OE2 1 
ATOM   6367  N N   . SER B 1 295 ? 1.606   40.793  91.316  1.00 92.15  ? 315  SER B N   1 
ATOM   6368  C CA  . SER B 1 295 ? 2.705   39.846  91.532  1.00 90.92  ? 315  SER B CA  1 
ATOM   6369  C C   . SER B 1 295 ? 2.442   38.546  90.791  1.00 89.59  ? 315  SER B C   1 
ATOM   6370  O O   . SER B 1 295 ? 1.671   37.704  91.257  1.00 89.25  ? 315  SER B O   1 
ATOM   6371  C CB  . SER B 1 295 ? 2.880   39.551  93.025  1.00 91.43  ? 315  SER B CB  1 
ATOM   6372  O OG  . SER B 1 295 ? 3.924   38.614  93.240  1.00 90.90  ? 315  SER B OG  1 
ATOM   6373  N N   . GLN B 1 296 ? 3.086   38.400  89.636  1.00 87.83  ? 316  GLN B N   1 
ATOM   6374  C CA  . GLN B 1 296 ? 2.921   37.222  88.800  1.00 85.57  ? 316  GLN B CA  1 
ATOM   6375  C C   . GLN B 1 296 ? 2.668   35.961  89.621  1.00 83.35  ? 316  GLN B C   1 
ATOM   6376  O O   . GLN B 1 296 ? 3.420   35.643  90.553  1.00 83.18  ? 316  GLN B O   1 
ATOM   6377  C CB  . GLN B 1 296 ? 4.154   37.017  87.913  1.00 86.06  ? 316  GLN B CB  1 
ATOM   6378  C CG  . GLN B 1 296 ? 5.374   36.498  88.638  1.00 86.85  ? 316  GLN B CG  1 
ATOM   6379  C CD  . GLN B 1 296 ? 6.395   35.933  87.680  1.00 87.55  ? 316  GLN B CD  1 
ATOM   6380  O OE1 . GLN B 1 296 ? 6.091   35.034  86.896  1.00 87.97  ? 316  GLN B OE1 1 
ATOM   6381  N NE2 . GLN B 1 296 ? 7.614   36.457  87.733  1.00 88.32  ? 316  GLN B NE2 1 
ATOM   6382  N N   . PRO B 1 297 ? 1.579   35.247  89.296  1.00 80.58  ? 317  PRO B N   1 
ATOM   6383  C CA  . PRO B 1 297 ? 1.180   34.011  89.970  1.00 77.31  ? 317  PRO B CA  1 
ATOM   6384  C C   . PRO B 1 297 ? 2.137   32.870  89.636  1.00 73.06  ? 317  PRO B C   1 
ATOM   6385  O O   . PRO B 1 297 ? 3.247   32.787  90.170  1.00 73.82  ? 317  PRO B O   1 
ATOM   6386  C CB  . PRO B 1 297 ? -0.221  33.749  89.416  1.00 78.84  ? 317  PRO B CB  1 
ATOM   6387  C CG  . PRO B 1 297 ? -0.712  35.115  89.031  1.00 80.23  ? 317  PRO B CG  1 
ATOM   6388  C CD  . PRO B 1 297 ? 0.513   35.704  88.389  1.00 80.07  ? 317  PRO B CD  1 
ATOM   6389  N N   . LEU B 1 298 ? 1.685   31.982  88.752  1.00 67.23  ? 318  LEU B N   1 
ATOM   6390  C CA  . LEU B 1 298 ? 2.465   30.821  88.315  1.00 61.31  ? 318  LEU B CA  1 
ATOM   6391  C C   . LEU B 1 298 ? 1.635   30.056  87.307  1.00 55.88  ? 318  LEU B C   1 
ATOM   6392  O O   . LEU B 1 298 ? 0.751   30.624  86.685  1.00 55.42  ? 318  LEU B O   1 
ATOM   6393  C CB  . LEU B 1 298 ? 2.816   29.884  89.490  1.00 62.70  ? 318  LEU B CB  1 
ATOM   6394  C CG  . LEU B 1 298 ? 2.300   30.137  90.902  1.00 63.49  ? 318  LEU B CG  1 
ATOM   6395  C CD1 . LEU B 1 298 ? 0.801   29.933  90.969  1.00 62.84  ? 318  LEU B CD1 1 
ATOM   6396  C CD2 . LEU B 1 298 ? 3.023   29.183  91.836  1.00 63.91  ? 318  LEU B CD2 1 
ATOM   6397  N N   . LEU B 1 299 ? 1.905   28.764  87.165  1.00 49.49  ? 319  LEU B N   1 
ATOM   6398  C CA  . LEU B 1 299 ? 1.182   27.958  86.201  1.00 43.47  ? 319  LEU B CA  1 
ATOM   6399  C C   . LEU B 1 299 ? 0.962   26.590  86.798  1.00 38.86  ? 319  LEU B C   1 
ATOM   6400  O O   . LEU B 1 299 ? 1.854   26.022  87.414  1.00 38.07  ? 319  LEU B O   1 
ATOM   6401  C CB  . LEU B 1 299 ? 1.983   27.855  84.901  1.00 42.64  ? 319  LEU B CB  1 
ATOM   6402  C CG  . LEU B 1 299 ? 3.339   27.155  84.918  1.00 42.00  ? 319  LEU B CG  1 
ATOM   6403  C CD1 . LEU B 1 299 ? 4.040   27.428  83.606  1.00 42.75  ? 319  LEU B CD1 1 
ATOM   6404  C CD2 . LEU B 1 299 ? 4.188   27.648  86.074  1.00 42.68  ? 319  LEU B CD2 1 
ATOM   6405  N N   . GLY B 1 300 ? -0.244  26.075  86.628  1.00 34.80  ? 320  GLY B N   1 
ATOM   6406  C CA  . GLY B 1 300 ? -0.566  24.779  87.176  1.00 30.45  ? 320  GLY B CA  1 
ATOM   6407  C C   . GLY B 1 300 ? -1.776  24.206  86.481  1.00 27.54  ? 320  GLY B C   1 
ATOM   6408  O O   . GLY B 1 300 ? -1.972  24.440  85.289  1.00 26.51  ? 320  GLY B O   1 
ATOM   6409  N N   . THR B 1 301 ? -2.586  23.460  87.226  1.00 24.53  ? 321  THR B N   1 
ATOM   6410  C CA  . THR B 1 301 ? -3.783  22.847  86.671  1.00 20.74  ? 321  THR B CA  1 
ATOM   6411  C C   . THR B 1 301 ? -4.686  23.904  86.064  1.00 19.25  ? 321  THR B C   1 
ATOM   6412  O O   . THR B 1 301 ? -4.803  25.006  86.587  1.00 18.85  ? 321  THR B O   1 
ATOM   6413  C CB  . THR B 1 301 ? -4.583  22.113  87.743  1.00 19.47  ? 321  THR B CB  1 
ATOM   6414  O OG1 . THR B 1 301 ? -3.705  21.288  88.512  1.00 17.69  ? 321  THR B OG1 1 
ATOM   6415  C CG2 . THR B 1 301 ? -5.648  21.246  87.099  1.00 18.68  ? 321  THR B CG2 1 
ATOM   6416  N N   . VAL B 1 302 ? -5.316  23.563  84.949  1.00 18.44  ? 322  VAL B N   1 
ATOM   6417  C CA  . VAL B 1 302 ? -6.230  24.477  84.265  1.00 17.30  ? 322  VAL B CA  1 
ATOM   6418  C C   . VAL B 1 302 ? -7.462  23.666  83.926  1.00 16.61  ? 322  VAL B C   1 
ATOM   6419  O O   . VAL B 1 302 ? -7.468  22.452  84.130  1.00 18.35  ? 322  VAL B O   1 
ATOM   6420  C CB  . VAL B 1 302 ? -5.624  25.014  82.949  1.00 15.82  ? 322  VAL B CB  1 
ATOM   6421  C CG1 . VAL B 1 302 ? -4.450  25.929  83.248  1.00 14.44  ? 322  VAL B CG1 1 
ATOM   6422  C CG2 . VAL B 1 302 ? -5.189  23.852  82.064  1.00 13.77  ? 322  VAL B CG2 1 
ATOM   6423  N N   . ILE B 1 303 ? -8.508  24.312  83.429  1.00 14.62  ? 323  ILE B N   1 
ATOM   6424  C CA  . ILE B 1 303 ? -9.690  23.552  83.064  1.00 14.92  ? 323  ILE B CA  1 
ATOM   6425  C C   . ILE B 1 303 ? -9.630  23.366  81.548  1.00 15.88  ? 323  ILE B C   1 
ATOM   6426  O O   . ILE B 1 303 ? -10.173 24.159  80.792  1.00 16.15  ? 323  ILE B O   1 
ATOM   6427  C CB  . ILE B 1 303 ? -10.970 24.285  83.472  1.00 13.93  ? 323  ILE B CB  1 
ATOM   6428  C CG1 . ILE B 1 303 ? -10.878 24.740  84.934  1.00 13.54  ? 323  ILE B CG1 1 
ATOM   6429  C CG2 . ILE B 1 303 ? -12.164 23.354  83.307  1.00 14.14  ? 323  ILE B CG2 1 
ATOM   6430  C CD1 . ILE B 1 303 ? -10.922 23.615  85.958  1.00 11.92  ? 323  ILE B CD1 1 
ATOM   6431  N N   . ASP B 1 304 ? -8.953  22.306  81.117  1.00 17.63  ? 324  ASP B N   1 
ATOM   6432  C CA  . ASP B 1 304 ? -8.758  22.011  79.699  1.00 19.23  ? 324  ASP B CA  1 
ATOM   6433  C C   . ASP B 1 304 ? -9.950  21.428  78.949  1.00 20.82  ? 324  ASP B C   1 
ATOM   6434  O O   . ASP B 1 304 ? -9.993  21.468  77.717  1.00 21.76  ? 324  ASP B O   1 
ATOM   6435  C CB  . ASP B 1 304 ? -7.581  21.061  79.536  1.00 19.15  ? 324  ASP B CB  1 
ATOM   6436  C CG  . ASP B 1 304 ? -7.824  19.731  80.204  1.00 21.62  ? 324  ASP B CG  1 
ATOM   6437  O OD1 . ASP B 1 304 ? -7.061  18.782  79.937  1.00 24.81  ? 324  ASP B OD1 1 
ATOM   6438  O OD2 . ASP B 1 304 ? -8.778  19.634  81.004  1.00 22.60  ? 324  ASP B OD2 1 
ATOM   6439  N N   . GLY B 1 305 ? -10.912 20.873  79.673  1.00 21.51  ? 325  GLY B N   1 
ATOM   6440  C CA  . GLY B 1 305 ? -12.056 20.293  79.005  1.00 21.62  ? 325  GLY B CA  1 
ATOM   6441  C C   . GLY B 1 305 ? -11.713 18.910  78.501  1.00 22.14  ? 325  GLY B C   1 
ATOM   6442  O O   . GLY B 1 305 ? -12.361 18.382  77.605  1.00 22.76  ? 325  GLY B O   1 
ATOM   6443  N N   . MET B 1 306 ? -10.667 18.330  79.074  1.00 23.36  ? 326  MET B N   1 
ATOM   6444  C CA  . MET B 1 306 ? -10.230 16.986  78.717  1.00 24.00  ? 326  MET B CA  1 
ATOM   6445  C C   . MET B 1 306 ? -10.059 16.236  80.042  1.00 23.71  ? 326  MET B C   1 
ATOM   6446  O O   . MET B 1 306 ? -10.769 15.267  80.322  1.00 23.68  ? 326  MET B O   1 
ATOM   6447  C CB  . MET B 1 306 ? -8.901  17.038  77.954  1.00 25.13  ? 326  MET B CB  1 
ATOM   6448  C CG  . MET B 1 306 ? -8.962  17.679  76.553  1.00 28.67  ? 326  MET B CG  1 
ATOM   6449  S SD  . MET B 1 306 ? -9.521  16.593  75.176  1.00 31.65  ? 326  MET B SD  1 
ATOM   6450  C CE  . MET B 1 306 ? -8.164  15.394  75.109  1.00 29.24  ? 326  MET B CE  1 
ATOM   6451  N N   . LEU B 1 307 ? -9.124  16.709  80.862  1.00 22.65  ? 327  LEU B N   1 
ATOM   6452  C CA  . LEU B 1 307 ? -8.861  16.112  82.167  1.00 20.97  ? 327  LEU B CA  1 
ATOM   6453  C C   . LEU B 1 307 ? -9.891  16.636  83.157  1.00 20.69  ? 327  LEU B C   1 
ATOM   6454  O O   . LEU B 1 307 ? -10.318 15.931  84.061  1.00 20.12  ? 327  LEU B O   1 
ATOM   6455  C CB  . LEU B 1 307 ? -7.465  16.502  82.648  1.00 19.89  ? 327  LEU B CB  1 
ATOM   6456  C CG  . LEU B 1 307 ? -7.102  16.085  84.071  1.00 17.97  ? 327  LEU B CG  1 
ATOM   6457  C CD1 . LEU B 1 307 ? -6.789  14.610  84.091  1.00 18.74  ? 327  LEU B CD1 1 
ATOM   6458  C CD2 . LEU B 1 307 ? -5.906  16.873  84.544  1.00 17.39  ? 327  LEU B CD2 1 
ATOM   6459  N N   . LEU B 1 308 ? -10.270 17.894  82.975  1.00 21.03  ? 328  LEU B N   1 
ATOM   6460  C CA  . LEU B 1 308 ? -11.246 18.554  83.832  1.00 21.94  ? 328  LEU B CA  1 
ATOM   6461  C C   . LEU B 1 308 ? -12.234 19.291  82.956  1.00 23.13  ? 328  LEU B C   1 
ATOM   6462  O O   . LEU B 1 308 ? -11.846 20.178  82.199  1.00 23.08  ? 328  LEU B O   1 
ATOM   6463  C CB  . LEU B 1 308 ? -10.557 19.563  84.755  1.00 20.17  ? 328  LEU B CB  1 
ATOM   6464  C CG  . LEU B 1 308 ? -9.860  19.016  85.994  1.00 18.83  ? 328  LEU B CG  1 
ATOM   6465  C CD1 . LEU B 1 308 ? -8.936  20.060  86.563  1.00 17.61  ? 328  LEU B CD1 1 
ATOM   6466  C CD2 . LEU B 1 308 ? -10.910 18.608  87.012  1.00 19.66  ? 328  LEU B CD2 1 
ATOM   6467  N N   . LEU B 1 309 ? -13.508 18.928  83.053  1.00 25.10  ? 329  LEU B N   1 
ATOM   6468  C CA  . LEU B 1 309 ? -14.523 19.591  82.249  1.00 27.09  ? 329  LEU B CA  1 
ATOM   6469  C C   . LEU B 1 309 ? -14.983 20.897  82.882  1.00 29.35  ? 329  LEU B C   1 
ATOM   6470  O O   . LEU B 1 309 ? -15.737 21.655  82.278  1.00 29.78  ? 329  LEU B O   1 
ATOM   6471  C CB  . LEU B 1 309 ? -15.712 18.663  82.014  1.00 25.21  ? 329  LEU B CB  1 
ATOM   6472  C CG  . LEU B 1 309 ? -15.402 17.424  81.168  1.00 23.16  ? 329  LEU B CG  1 
ATOM   6473  C CD1 . LEU B 1 309 ? -16.715 16.764  80.756  1.00 22.64  ? 329  LEU B CD1 1 
ATOM   6474  C CD2 . LEU B 1 309 ? -14.600 17.807  79.938  1.00 19.92  ? 329  LEU B CD2 1 
ATOM   6475  N N   . LYS B 1 310 ? -14.515 21.156  84.100  1.00 32.36  ? 330  LYS B N   1 
ATOM   6476  C CA  . LYS B 1 310 ? -14.845 22.387  84.810  1.00 35.05  ? 330  LYS B CA  1 
ATOM   6477  C C   . LYS B 1 310 ? -14.188 22.472  86.177  1.00 35.88  ? 330  LYS B C   1 
ATOM   6478  O O   . LYS B 1 310 ? -13.753 21.467  86.728  1.00 37.10  ? 330  LYS B O   1 
ATOM   6479  C CB  . LYS B 1 310 ? -16.357 22.536  84.956  1.00 35.69  ? 330  LYS B CB  1 
ATOM   6480  C CG  . LYS B 1 310 ? -17.052 21.358  85.578  1.00 36.31  ? 330  LYS B CG  1 
ATOM   6481  C CD  . LYS B 1 310 ? -18.555 21.559  85.499  1.00 38.74  ? 330  LYS B CD  1 
ATOM   6482  C CE  . LYS B 1 310 ? -18.998 21.765  84.052  1.00 40.45  ? 330  LYS B CE  1 
ATOM   6483  N NZ  . LYS B 1 310 ? -20.461 21.985  83.925  1.00 41.35  ? 330  LYS B NZ  1 
ATOM   6484  N N   . THR B 1 311 ? -14.111 23.683  86.715  1.00 36.79  ? 331  THR B N   1 
ATOM   6485  C CA  . THR B 1 311 ? -13.506 23.900  88.019  1.00 37.74  ? 331  THR B CA  1 
ATOM   6486  C C   . THR B 1 311 ? -13.959 22.855  89.035  1.00 38.53  ? 331  THR B C   1 
ATOM   6487  O O   . THR B 1 311 ? -15.086 22.362  88.974  1.00 35.97  ? 331  THR B O   1 
ATOM   6488  C CB  . THR B 1 311 ? -13.856 25.295  88.568  1.00 37.65  ? 331  THR B CB  1 
ATOM   6489  O OG1 . THR B 1 311 ? -15.265 25.504  88.449  1.00 38.21  ? 331  THR B OG1 1 
ATOM   6490  C CG2 . THR B 1 311 ? -13.109 26.384  87.806  1.00 37.09  ? 331  THR B CG2 1 
ATOM   6491  N N   . PRO B 1 312 ? -13.067 22.502  89.980  1.00 40.92  ? 332  PRO B N   1 
ATOM   6492  C CA  . PRO B 1 312 ? -13.285 21.522  91.055  1.00 42.97  ? 332  PRO B CA  1 
ATOM   6493  C C   . PRO B 1 312 ? -14.445 21.901  91.983  1.00 44.43  ? 332  PRO B C   1 
ATOM   6494  O O   . PRO B 1 312 ? -15.218 21.041  92.420  1.00 43.09  ? 332  PRO B O   1 
ATOM   6495  C CB  . PRO B 1 312 ? -11.945 21.519  91.792  1.00 42.66  ? 332  PRO B CB  1 
ATOM   6496  C CG  . PRO B 1 312 ? -10.963 21.881  90.721  1.00 41.07  ? 332  PRO B CG  1 
ATOM   6497  C CD  . PRO B 1 312 ? -11.674 22.987  90.000  1.00 40.78  ? 332  PRO B CD  1 
ATOM   6498  N N   . GLU B 1 313 ? -14.544 23.192  92.289  1.00 46.66  ? 333  GLU B N   1 
ATOM   6499  C CA  . GLU B 1 313 ? -15.601 23.698  93.151  1.00 49.76  ? 333  GLU B CA  1 
ATOM   6500  C C   . GLU B 1 313 ? -16.928 23.250  92.550  1.00 51.80  ? 333  GLU B C   1 
ATOM   6501  O O   . GLU B 1 313 ? -17.821 22.783  93.260  1.00 53.29  ? 333  GLU B O   1 
ATOM   6502  C CB  . GLU B 1 313 ? -15.544 25.230  93.229  1.00 49.68  ? 333  GLU B CB  1 
ATOM   6503  C CG  . GLU B 1 313 ? -14.240 25.813  93.805  1.00 51.04  ? 333  GLU B CG  1 
ATOM   6504  C CD  . GLU B 1 313 ? -12.994 25.441  92.998  1.00 51.92  ? 333  GLU B CD  1 
ATOM   6505  O OE1 . GLU B 1 313 ? -13.083 25.398  91.753  1.00 52.74  ? 333  GLU B OE1 1 
ATOM   6506  O OE2 . GLU B 1 313 ? -11.920 25.207  93.602  1.00 51.67  ? 333  GLU B OE2 1 
ATOM   6507  N N   . GLU B 1 314 ? -17.045 23.378  91.231  1.00 53.51  ? 334  GLU B N   1 
ATOM   6508  C CA  . GLU B 1 314 ? -18.258 22.976  90.534  1.00 55.37  ? 334  GLU B CA  1 
ATOM   6509  C C   . GLU B 1 314 ? -18.405 21.462  90.524  1.00 57.24  ? 334  GLU B C   1 
ATOM   6510  O O   . GLU B 1 314 ? -19.353 20.921  91.083  1.00 58.12  ? 334  GLU B O   1 
ATOM   6511  C CB  . GLU B 1 314 ? -18.240 23.486  89.096  1.00 54.99  ? 334  GLU B CB  1 
ATOM   6512  C CG  . GLU B 1 314 ? -18.251 24.993  88.967  1.00 55.56  ? 334  GLU B CG  1 
ATOM   6513  C CD  . GLU B 1 314 ? -18.377 25.446  87.526  1.00 56.26  ? 334  GLU B CD  1 
ATOM   6514  O OE1 . GLU B 1 314 ? -19.370 25.065  86.873  1.00 57.21  ? 334  GLU B OE1 1 
ATOM   6515  O OE2 . GLU B 1 314 ? -17.488 26.180  87.044  1.00 57.48  ? 334  GLU B OE2 1 
ATOM   6516  N N   . LEU B 1 315 ? -17.456 20.786  89.887  1.00 59.94  ? 335  LEU B N   1 
ATOM   6517  C CA  . LEU B 1 315 ? -17.469 19.330  89.780  1.00 62.53  ? 335  LEU B CA  1 
ATOM   6518  C C   . LEU B 1 315 ? -17.890 18.574  91.036  1.00 65.19  ? 335  LEU B C   1 
ATOM   6519  O O   . LEU B 1 315 ? -18.710 17.659  90.960  1.00 65.35  ? 335  LEU B O   1 
ATOM   6520  C CB  . LEU B 1 315 ? -16.095 18.817  89.342  1.00 61.51  ? 335  LEU B CB  1 
ATOM   6521  C CG  . LEU B 1 315 ? -15.689 19.011  87.883  1.00 60.75  ? 335  LEU B CG  1 
ATOM   6522  C CD1 . LEU B 1 315 ? -14.286 18.462  87.673  1.00 60.41  ? 335  LEU B CD1 1 
ATOM   6523  C CD2 . LEU B 1 315 ? -16.677 18.296  86.978  1.00 60.54  ? 335  LEU B CD2 1 
ATOM   6524  N N   . GLN B 1 316 ? -17.332 18.944  92.184  1.00 68.53  ? 336  GLN B N   1 
ATOM   6525  C CA  . GLN B 1 316 ? -17.661 18.249  93.425  1.00 72.30  ? 336  GLN B CA  1 
ATOM   6526  C C   . GLN B 1 316 ? -19.123 18.377  93.844  1.00 73.96  ? 336  GLN B C   1 
ATOM   6527  O O   . GLN B 1 316 ? -19.585 17.667  94.741  1.00 74.05  ? 336  GLN B O   1 
ATOM   6528  C CB  . GLN B 1 316 ? -16.758 18.728  94.560  1.00 74.07  ? 336  GLN B CB  1 
ATOM   6529  C CG  . GLN B 1 316 ? -16.922 20.184  94.932  1.00 76.44  ? 336  GLN B CG  1 
ATOM   6530  C CD  . GLN B 1 316 ? -16.227 20.510  96.239  1.00 77.96  ? 336  GLN B CD  1 
ATOM   6531  O OE1 . GLN B 1 316 ? -15.031 20.262  96.400  1.00 78.45  ? 336  GLN B OE1 1 
ATOM   6532  N NE2 . GLN B 1 316 ? -16.978 21.066  97.186  1.00 79.40  ? 336  GLN B NE2 1 
ATOM   6533  N N   . ALA B 1 317 ? -19.848 19.284  93.199  1.00 75.89  ? 337  ALA B N   1 
ATOM   6534  C CA  . ALA B 1 317 ? -21.262 19.482  93.492  1.00 77.73  ? 337  ALA B CA  1 
ATOM   6535  C C   . ALA B 1 317 ? -22.076 18.685  92.473  1.00 79.30  ? 337  ALA B C   1 
ATOM   6536  O O   . ALA B 1 317 ? -23.200 19.051  92.129  1.00 79.57  ? 337  ALA B O   1 
ATOM   6537  C CB  . ALA B 1 317 ? -21.607 20.963  93.407  1.00 76.85  ? 337  ALA B CB  1 
ATOM   6538  N N   . GLU B 1 318 ? -21.494 17.588  91.998  1.00 81.57  ? 338  GLU B N   1 
ATOM   6539  C CA  . GLU B 1 318 ? -22.133 16.734  91.004  1.00 83.93  ? 338  GLU B CA  1 
ATOM   6540  C C   . GLU B 1 318 ? -21.938 15.246  91.300  1.00 85.14  ? 338  GLU B C   1 
ATOM   6541  O O   . GLU B 1 318 ? -20.929 14.648  90.918  1.00 84.97  ? 338  GLU B O   1 
ATOM   6542  C CB  . GLU B 1 318 ? -21.567 17.049  89.624  1.00 84.78  ? 338  GLU B CB  1 
ATOM   6543  C CG  . GLU B 1 318 ? -22.073 16.139  88.533  1.00 86.30  ? 338  GLU B CG  1 
ATOM   6544  C CD  . GLU B 1 318 ? -21.226 16.226  87.289  1.00 87.16  ? 338  GLU B CD  1 
ATOM   6545  O OE1 . GLU B 1 318 ? -21.094 17.342  86.737  1.00 86.78  ? 338  GLU B OE1 1 
ATOM   6546  O OE2 . GLU B 1 318 ? -20.690 15.176  86.871  1.00 87.89  ? 338  GLU B OE2 1 
ATOM   6547  N N   . ARG B 1 319 ? -22.923 14.654  91.966  1.00 86.65  ? 339  ARG B N   1 
ATOM   6548  C CA  . ARG B 1 319 ? -22.873 13.244  92.329  1.00 87.90  ? 339  ARG B CA  1 
ATOM   6549  C C   . ARG B 1 319 ? -23.335 12.329  91.190  1.00 87.96  ? 339  ARG B C   1 
ATOM   6550  O O   . ARG B 1 319 ? -24.320 11.599  91.327  1.00 88.54  ? 339  ARG B O   1 
ATOM   6551  C CB  . ARG B 1 319 ? -23.741 12.983  93.570  1.00 89.24  ? 339  ARG B CB  1 
ATOM   6552  C CG  . ARG B 1 319 ? -23.424 13.839  94.800  1.00 90.24  ? 339  ARG B CG  1 
ATOM   6553  C CD  . ARG B 1 319 ? -23.872 15.289  94.628  1.00 91.03  ? 339  ARG B CD  1 
ATOM   6554  N NE  . ARG B 1 319 ? -23.927 16.011  95.899  1.00 91.34  ? 339  ARG B NE  1 
ATOM   6555  C CZ  . ARG B 1 319 ? -22.878 16.234  96.685  1.00 91.32  ? 339  ARG B CZ  1 
ATOM   6556  N NH1 . ARG B 1 319 ? -21.675 15.794  96.339  1.00 91.33  ? 339  ARG B NH1 1 
ATOM   6557  N NH2 . ARG B 1 319 ? -23.035 16.898  97.823  1.00 90.81  ? 339  ARG B NH2 1 
ATOM   6558  N N   . ASN B 1 320 ? -22.628 12.371  90.066  1.00 87.32  ? 340  ASN B N   1 
ATOM   6559  C CA  . ASN B 1 320 ? -22.968 11.523  88.927  1.00 86.27  ? 340  ASN B CA  1 
ATOM   6560  C C   . ASN B 1 320 ? -21.686 10.963  88.323  1.00 84.66  ? 340  ASN B C   1 
ATOM   6561  O O   . ASN B 1 320 ? -21.682 10.414  87.220  1.00 84.64  ? 340  ASN B O   1 
ATOM   6562  C CB  . ASN B 1 320 ? -23.741 12.319  87.874  1.00 87.76  ? 340  ASN B CB  1 
ATOM   6563  C CG  . ASN B 1 320 ? -25.039 12.892  88.414  1.00 89.00  ? 340  ASN B CG  1 
ATOM   6564  O OD1 . ASN B 1 320 ? -25.030 13.737  89.311  1.00 89.16  ? 340  ASN B OD1 1 
ATOM   6565  N ND2 . ASN B 1 320 ? -26.164 12.432  87.869  1.00 89.50  ? 340  ASN B ND2 1 
ATOM   6566  N N   . PHE B 1 321 ? -20.596 11.110  89.066  1.00 82.49  ? 341  PHE B N   1 
ATOM   6567  C CA  . PHE B 1 321 ? -19.300 10.624  88.625  1.00 79.97  ? 341  PHE B CA  1 
ATOM   6568  C C   . PHE B 1 321 ? -18.963 9.356   89.403  1.00 77.67  ? 341  PHE B C   1 
ATOM   6569  O O   . PHE B 1 321 ? -19.477 9.154   90.504  1.00 78.44  ? 341  PHE B O   1 
ATOM   6570  C CB  . PHE B 1 321 ? -18.234 11.689  88.880  1.00 80.54  ? 341  PHE B CB  1 
ATOM   6571  C CG  . PHE B 1 321 ? -16.961 11.453  88.129  1.00 80.69  ? 341  PHE B CG  1 
ATOM   6572  C CD1 . PHE B 1 321 ? -16.945 11.505  86.738  1.00 80.65  ? 341  PHE B CD1 1 
ATOM   6573  C CD2 . PHE B 1 321 ? -15.782 11.164  88.805  1.00 80.37  ? 341  PHE B CD2 1 
ATOM   6574  C CE1 . PHE B 1 321 ? -15.775 11.273  86.030  1.00 80.59  ? 341  PHE B CE1 1 
ATOM   6575  C CE2 . PHE B 1 321 ? -14.603 10.930  88.106  1.00 80.76  ? 341  PHE B CE2 1 
ATOM   6576  C CZ  . PHE B 1 321 ? -14.600 10.985  86.715  1.00 80.99  ? 341  PHE B CZ  1 
ATOM   6577  N N   . HIS B 1 322 ? -18.105 8.511   88.830  1.00 73.78  ? 342  HIS B N   1 
ATOM   6578  C CA  . HIS B 1 322 ? -17.691 7.257   89.467  1.00 69.53  ? 342  HIS B CA  1 
ATOM   6579  C C   . HIS B 1 322 ? -16.941 7.522   90.789  1.00 65.20  ? 342  HIS B C   1 
ATOM   6580  O O   . HIS B 1 322 ? -15.943 8.251   90.814  1.00 64.50  ? 342  HIS B O   1 
ATOM   6581  C CB  . HIS B 1 322 ? -16.803 6.468   88.499  1.00 71.25  ? 342  HIS B CB  1 
ATOM   6582  C CG  . HIS B 1 322 ? -16.366 5.135   89.022  1.00 73.28  ? 342  HIS B CG  1 
ATOM   6583  N ND1 . HIS B 1 322 ? -15.296 4.445   88.492  1.00 74.07  ? 342  HIS B ND1 1 
ATOM   6584  C CD2 . HIS B 1 322 ? -16.850 4.367   90.026  1.00 74.01  ? 342  HIS B CD2 1 
ATOM   6585  C CE1 . HIS B 1 322 ? -15.137 3.311   89.151  1.00 74.68  ? 342  HIS B CE1 1 
ATOM   6586  N NE2 . HIS B 1 322 ? -16.066 3.239   90.086  1.00 75.19  ? 342  HIS B NE2 1 
ATOM   6587  N N   . THR B 1 323 ? -17.416 6.921   91.880  1.00 59.55  ? 343  THR B N   1 
ATOM   6588  C CA  . THR B 1 323 ? -16.802 7.134   93.192  1.00 54.24  ? 343  THR B CA  1 
ATOM   6589  C C   . THR B 1 323 ? -16.010 5.973   93.767  1.00 49.32  ? 343  THR B C   1 
ATOM   6590  O O   . THR B 1 323 ? -16.242 4.814   93.429  1.00 49.05  ? 343  THR B O   1 
ATOM   6591  C CB  . THR B 1 323 ? -17.850 7.504   94.238  1.00 55.18  ? 343  THR B CB  1 
ATOM   6592  O OG1 . THR B 1 323 ? -18.809 6.446   94.334  1.00 55.35  ? 343  THR B OG1 1 
ATOM   6593  C CG2 . THR B 1 323 ? -18.544 8.805   93.860  1.00 56.25  ? 343  THR B CG2 1 
ATOM   6594  N N   . VAL B 1 324 ? -15.091 6.306   94.668  1.00 43.49  ? 344  VAL B N   1 
ATOM   6595  C CA  . VAL B 1 324 ? -14.238 5.323   95.318  1.00 36.99  ? 344  VAL B CA  1 
ATOM   6596  C C   . VAL B 1 324 ? -13.842 5.789   96.713  1.00 33.52  ? 344  VAL B C   1 
ATOM   6597  O O   . VAL B 1 324 ? -13.865 6.981   97.005  1.00 32.20  ? 344  VAL B O   1 
ATOM   6598  C CB  . VAL B 1 324 ? -12.955 5.104   94.508  1.00 35.89  ? 344  VAL B CB  1 
ATOM   6599  C CG1 . VAL B 1 324 ? -13.279 4.430   93.199  1.00 35.90  ? 344  VAL B CG1 1 
ATOM   6600  C CG2 . VAL B 1 324 ? -12.279 6.431   94.250  1.00 33.53  ? 344  VAL B CG2 1 
ATOM   6601  N N   . PRO B 1 325 ? -13.483 4.848   97.597  1.00 31.13  ? 345  PRO B N   1 
ATOM   6602  C CA  . PRO B 1 325 ? -13.072 5.175   98.969  1.00 29.58  ? 345  PRO B CA  1 
ATOM   6603  C C   . PRO B 1 325 ? -12.031 6.275   98.880  1.00 28.02  ? 345  PRO B C   1 
ATOM   6604  O O   . PRO B 1 325 ? -11.119 6.195   98.059  1.00 28.43  ? 345  PRO B O   1 
ATOM   6605  C CB  . PRO B 1 325 ? -12.479 3.866   99.467  1.00 29.83  ? 345  PRO B CB  1 
ATOM   6606  C CG  . PRO B 1 325 ? -13.328 2.845   98.770  1.00 31.21  ? 345  PRO B CG  1 
ATOM   6607  C CD  . PRO B 1 325 ? -13.420 3.396   97.361  1.00 31.17  ? 345  PRO B CD  1 
ATOM   6608  N N   . TYR B 1 326 ? -12.149 7.288   99.728  1.00 25.73  ? 346  TYR B N   1 
ATOM   6609  C CA  . TYR B 1 326 ? -11.230 8.417   99.667  1.00 24.14  ? 346  TYR B CA  1 
ATOM   6610  C C   . TYR B 1 326 ? -10.784 8.899   101.045 1.00 23.34  ? 346  TYR B C   1 
ATOM   6611  O O   . TYR B 1 326 ? -11.606 9.271   101.873 1.00 25.23  ? 346  TYR B O   1 
ATOM   6612  C CB  . TYR B 1 326 ? -11.931 9.553   98.911  1.00 23.33  ? 346  TYR B CB  1 
ATOM   6613  C CG  . TYR B 1 326 ? -11.083 10.734  98.495  1.00 22.95  ? 346  TYR B CG  1 
ATOM   6614  C CD1 . TYR B 1 326 ? -11.685 11.892  98.018  1.00 22.44  ? 346  TYR B CD1 1 
ATOM   6615  C CD2 . TYR B 1 326 ? -9.688  10.693  98.552  1.00 23.37  ? 346  TYR B CD2 1 
ATOM   6616  C CE1 . TYR B 1 326 ? -10.931 12.983  97.606  1.00 23.61  ? 346  TYR B CE1 1 
ATOM   6617  C CE2 . TYR B 1 326 ? -8.919  11.783  98.139  1.00 22.90  ? 346  TYR B CE2 1 
ATOM   6618  C CZ  . TYR B 1 326 ? -9.552  12.927  97.667  1.00 23.03  ? 346  TYR B CZ  1 
ATOM   6619  O OH  . TYR B 1 326 ? -8.817  14.019  97.255  1.00 21.55  ? 346  TYR B OH  1 
ATOM   6620  N N   . MET B 1 327 ? -9.480  8.898   101.286 1.00 22.37  ? 347  MET B N   1 
ATOM   6621  C CA  . MET B 1 327 ? -8.940  9.357   102.560 1.00 20.57  ? 347  MET B CA  1 
ATOM   6622  C C   . MET B 1 327 ? -8.317  10.748  102.377 1.00 20.45  ? 347  MET B C   1 
ATOM   6623  O O   . MET B 1 327 ? -7.453  10.944  101.520 1.00 20.66  ? 347  MET B O   1 
ATOM   6624  C CB  . MET B 1 327 ? -7.876  8.374   103.069 1.00 19.48  ? 347  MET B CB  1 
ATOM   6625  C CG  . MET B 1 327 ? -7.318  8.718   104.446 1.00 18.97  ? 347  MET B CG  1 
ATOM   6626  S SD  . MET B 1 327 ? -5.818  7.801   104.883 1.00 19.07  ? 347  MET B SD  1 
ATOM   6627  C CE  . MET B 1 327 ? -6.468  6.106   104.936 1.00 16.69  ? 347  MET B CE  1 
ATOM   6628  N N   . VAL B 1 328 ? -8.766  11.715  103.170 1.00 20.25  ? 348  VAL B N   1 
ATOM   6629  C CA  . VAL B 1 328 ? -8.233  13.074  103.100 1.00 19.62  ? 348  VAL B CA  1 
ATOM   6630  C C   . VAL B 1 328 ? -7.735  13.473  104.484 1.00 20.27  ? 348  VAL B C   1 
ATOM   6631  O O   . VAL B 1 328 ? -8.441  13.277  105.472 1.00 21.98  ? 348  VAL B O   1 
ATOM   6632  C CB  . VAL B 1 328 ? -9.310  14.075  102.648 1.00 17.51  ? 348  VAL B CB  1 
ATOM   6633  C CG1 . VAL B 1 328 ? -8.705  15.462  102.497 1.00 15.51  ? 348  VAL B CG1 1 
ATOM   6634  C CG2 . VAL B 1 328 ? -9.919  13.609  101.338 1.00 17.12  ? 348  VAL B CG2 1 
ATOM   6635  N N   . GLY B 1 329 ? -6.527  14.027  104.564 1.00 19.29  ? 349  GLY B N   1 
ATOM   6636  C CA  . GLY B 1 329 ? -6.002  14.409  105.862 1.00 19.31  ? 349  GLY B CA  1 
ATOM   6637  C C   . GLY B 1 329 ? -4.992  15.537  105.864 1.00 19.85  ? 349  GLY B C   1 
ATOM   6638  O O   . GLY B 1 329 ? -4.353  15.813  104.847 1.00 20.95  ? 349  GLY B O   1 
ATOM   6639  N N   . ILE B 1 330 ? -4.839  16.189  107.014 1.00 19.89  ? 350  ILE B N   1 
ATOM   6640  C CA  . ILE B 1 330 ? -3.894  17.291  107.135 1.00 20.99  ? 350  ILE B CA  1 
ATOM   6641  C C   . ILE B 1 330 ? -3.009  17.158  108.372 1.00 22.08  ? 350  ILE B C   1 
ATOM   6642  O O   . ILE B 1 330 ? -3.240  16.311  109.229 1.00 21.54  ? 350  ILE B O   1 
ATOM   6643  C CB  . ILE B 1 330 ? -4.613  18.671  107.193 1.00 19.95  ? 350  ILE B CB  1 
ATOM   6644  C CG1 . ILE B 1 330 ? -5.326  18.846  108.536 1.00 19.93  ? 350  ILE B CG1 1 
ATOM   6645  C CG2 . ILE B 1 330 ? -5.624  18.783  106.060 1.00 18.89  ? 350  ILE B CG2 1 
ATOM   6646  C CD1 . ILE B 1 330 ? -5.814  20.261  108.780 1.00 18.10  ? 350  ILE B CD1 1 
ATOM   6647  N N   . ASN B 1 331 ? -1.991  18.006  108.446 1.00 23.69  ? 351  ASN B N   1 
ATOM   6648  C CA  . ASN B 1 331 ? -1.064  18.016  109.561 1.00 26.26  ? 351  ASN B CA  1 
ATOM   6649  C C   . ASN B 1 331 ? -1.420  19.170  110.482 1.00 28.64  ? 351  ASN B C   1 
ATOM   6650  O O   . ASN B 1 331 ? -2.113  20.104  110.074 1.00 29.22  ? 351  ASN B O   1 
ATOM   6651  C CB  . ASN B 1 331 ? 0.358   18.186  109.050 1.00 27.38  ? 351  ASN B CB  1 
ATOM   6652  C CG  . ASN B 1 331 ? 0.796   17.040  108.169 1.00 27.15  ? 351  ASN B CG  1 
ATOM   6653  O OD1 . ASN B 1 331 ? 1.850   17.102  107.533 1.00 28.64  ? 351  ASN B OD1 1 
ATOM   6654  N ND2 . ASN B 1 331 ? -0.004  15.980  108.135 1.00 25.21  ? 351  ASN B ND2 1 
ATOM   6655  N N   . LYS B 1 332 ? -0.929  19.110  111.717 1.00 31.22  ? 352  LYS B N   1 
ATOM   6656  C CA  . LYS B 1 332 ? -1.215  20.132  112.728 1.00 32.82  ? 352  LYS B CA  1 
ATOM   6657  C C   . LYS B 1 332 ? -0.798  21.543  112.327 1.00 32.26  ? 352  LYS B C   1 
ATOM   6658  O O   . LYS B 1 332 ? -1.592  22.479  112.392 1.00 32.14  ? 352  LYS B O   1 
ATOM   6659  C CB  . LYS B 1 332 ? -0.533  19.761  114.041 1.00 34.84  ? 352  LYS B CB  1 
ATOM   6660  C CG  . LYS B 1 332 ? -1.101  20.476  115.248 1.00 37.97  ? 352  LYS B CG  1 
ATOM   6661  C CD  . LYS B 1 332 ? -2.457  19.907  115.655 1.00 39.41  ? 352  LYS B CD  1 
ATOM   6662  C CE  . LYS B 1 332 ? -3.013  20.675  116.847 1.00 40.63  ? 352  LYS B CE  1 
ATOM   6663  N NZ  . LYS B 1 332 ? -1.960  20.901  117.887 1.00 40.83  ? 352  LYS B NZ  1 
ATOM   6664  N N   . GLN B 1 333 ? 0.455   21.693  111.925 1.00 32.23  ? 353  GLN B N   1 
ATOM   6665  C CA  . GLN B 1 333 ? 0.969   22.987  111.511 1.00 32.30  ? 353  GLN B CA  1 
ATOM   6666  C C   . GLN B 1 333 ? 1.472   22.887  110.077 1.00 31.72  ? 353  GLN B C   1 
ATOM   6667  O O   . GLN B 1 333 ? 2.669   22.724  109.844 1.00 31.79  ? 353  GLN B O   1 
ATOM   6668  C CB  . GLN B 1 333 ? 2.121   23.404  112.419 1.00 34.27  ? 353  GLN B CB  1 
ATOM   6669  C CG  . GLN B 1 333 ? 1.766   23.535  113.889 1.00 36.19  ? 353  GLN B CG  1 
ATOM   6670  C CD  . GLN B 1 333 ? 2.993   23.451  114.776 1.00 36.87  ? 353  GLN B CD  1 
ATOM   6671  O OE1 . GLN B 1 333 ? 4.009   24.084  114.504 1.00 39.60  ? 353  GLN B OE1 1 
ATOM   6672  N NE2 . GLN B 1 333 ? 2.906   22.666  115.842 1.00 37.02  ? 353  GLN B NE2 1 
ATOM   6673  N N   . GLU B 1 334 ? 0.557   22.972  109.118 1.00 30.76  ? 354  GLU B N   1 
ATOM   6674  C CA  . GLU B 1 334 ? 0.926   22.893  107.712 1.00 30.22  ? 354  GLU B CA  1 
ATOM   6675  C C   . GLU B 1 334 ? 1.893   24.004  107.317 1.00 31.28  ? 354  GLU B C   1 
ATOM   6676  O O   . GLU B 1 334 ? 2.802   23.797  106.507 1.00 28.95  ? 354  GLU B O   1 
ATOM   6677  C CB  . GLU B 1 334 ? -0.320  22.982  106.842 1.00 28.73  ? 354  GLU B CB  1 
ATOM   6678  C CG  . GLU B 1 334 ? -1.168  21.742  106.852 1.00 28.48  ? 354  GLU B CG  1 
ATOM   6679  C CD  . GLU B 1 334 ? -0.447  20.554  106.263 1.00 29.66  ? 354  GLU B CD  1 
ATOM   6680  O OE1 . GLU B 1 334 ? 0.665   20.741  105.719 1.00 30.05  ? 354  GLU B OE1 1 
ATOM   6681  O OE2 . GLU B 1 334 ? -0.993  19.434  106.337 1.00 30.06  ? 354  GLU B OE2 1 
ATOM   6682  N N   . PHE B 1 335 ? 1.691   25.185  107.896 1.00 33.31  ? 355  PHE B N   1 
ATOM   6683  C CA  . PHE B 1 335 ? 2.532   26.335  107.598 1.00 34.85  ? 355  PHE B CA  1 
ATOM   6684  C C   . PHE B 1 335 ? 3.545   26.596  108.713 1.00 34.77  ? 355  PHE B C   1 
ATOM   6685  O O   . PHE B 1 335 ? 4.036   27.708  108.877 1.00 34.03  ? 355  PHE B O   1 
ATOM   6686  C CB  . PHE B 1 335 ? 1.652   27.566  107.380 1.00 36.60  ? 355  PHE B CB  1 
ATOM   6687  C CG  . PHE B 1 335 ? 2.268   28.589  106.475 1.00 40.63  ? 355  PHE B CG  1 
ATOM   6688  C CD1 . PHE B 1 335 ? 2.753   29.791  106.982 1.00 42.26  ? 355  PHE B CD1 1 
ATOM   6689  C CD2 . PHE B 1 335 ? 2.386   28.340  105.111 1.00 41.36  ? 355  PHE B CD2 1 
ATOM   6690  C CE1 . PHE B 1 335 ? 3.351   30.735  106.139 1.00 43.23  ? 355  PHE B CE1 1 
ATOM   6691  C CE2 . PHE B 1 335 ? 2.980   29.273  104.261 1.00 42.96  ? 355  PHE B CE2 1 
ATOM   6692  C CZ  . PHE B 1 335 ? 3.465   30.474  104.777 1.00 43.35  ? 355  PHE B CZ  1 
ATOM   6693  N N   . GLY B 1 336 ? 3.856   25.552  109.472 1.00 35.26  ? 356  GLY B N   1 
ATOM   6694  C CA  . GLY B 1 336 ? 4.803   25.676  110.562 1.00 35.70  ? 356  GLY B CA  1 
ATOM   6695  C C   . GLY B 1 336 ? 6.179   26.171  110.159 1.00 36.76  ? 356  GLY B C   1 
ATOM   6696  O O   . GLY B 1 336 ? 6.485   27.347  110.322 1.00 37.02  ? 356  GLY B O   1 
ATOM   6697  N N   . TRP B 1 337 ? 7.016   25.286  109.627 1.00 37.73  ? 357  TRP B N   1 
ATOM   6698  C CA  . TRP B 1 337 ? 8.364   25.678  109.239 1.00 38.07  ? 357  TRP B CA  1 
ATOM   6699  C C   . TRP B 1 337 ? 8.706   25.533  107.752 1.00 38.01  ? 357  TRP B C   1 
ATOM   6700  O O   . TRP B 1 337 ? 8.975   26.525  107.063 1.00 37.55  ? 357  TRP B O   1 
ATOM   6701  C CB  . TRP B 1 337 ? 9.385   24.883  110.057 1.00 39.97  ? 357  TRP B CB  1 
ATOM   6702  C CG  . TRP B 1 337 ? 10.805  25.213  109.706 1.00 42.24  ? 357  TRP B CG  1 
ATOM   6703  C CD1 . TRP B 1 337 ? 11.446  26.398  109.923 1.00 43.08  ? 357  TRP B CD1 1 
ATOM   6704  C CD2 . TRP B 1 337 ? 11.742  24.369  109.019 1.00 43.55  ? 357  TRP B CD2 1 
ATOM   6705  N NE1 . TRP B 1 337 ? 12.723  26.350  109.411 1.00 44.51  ? 357  TRP B NE1 1 
ATOM   6706  C CE2 . TRP B 1 337 ? 12.932  25.118  108.850 1.00 44.18  ? 357  TRP B CE2 1 
ATOM   6707  C CE3 . TRP B 1 337 ? 11.692  23.056  108.527 1.00 43.25  ? 357  TRP B CE3 1 
ATOM   6708  C CZ2 . TRP B 1 337 ? 14.064  24.596  108.208 1.00 43.73  ? 357  TRP B CZ2 1 
ATOM   6709  C CZ3 . TRP B 1 337 ? 12.820  22.538  107.889 1.00 44.01  ? 357  TRP B CZ3 1 
ATOM   6710  C CH2 . TRP B 1 337 ? 13.989  23.311  107.736 1.00 43.79  ? 357  TRP B CH2 1 
ATOM   6711  N N   . LEU B 1 338 ? 8.699   24.293  107.268 1.00 36.49  ? 358  LEU B N   1 
ATOM   6712  C CA  . LEU B 1 338 ? 9.056   23.987  105.884 1.00 34.34  ? 358  LEU B CA  1 
ATOM   6713  C C   . LEU B 1 338 ? 8.653   24.993  104.817 1.00 32.98  ? 358  LEU B C   1 
ATOM   6714  O O   . LEU B 1 338 ? 9.514   25.658  104.239 1.00 32.51  ? 358  LEU B O   1 
ATOM   6715  C CB  . LEU B 1 338 ? 8.519   22.613  105.480 1.00 33.98  ? 358  LEU B CB  1 
ATOM   6716  C CG  . LEU B 1 338 ? 8.986   22.179  104.089 1.00 33.36  ? 358  LEU B CG  1 
ATOM   6717  C CD1 . LEU B 1 338 ? 10.472  21.903  104.127 1.00 33.03  ? 358  LEU B CD1 1 
ATOM   6718  C CD2 . LEU B 1 338 ? 8.235   20.951  103.640 1.00 33.57  ? 358  LEU B CD2 1 
ATOM   6719  N N   . ILE B 1 339 ? 7.354   25.093  104.548 1.00 31.76  ? 359  ILE B N   1 
ATOM   6720  C CA  . ILE B 1 339 ? 6.856   25.998  103.516 1.00 31.67  ? 359  ILE B CA  1 
ATOM   6721  C C   . ILE B 1 339 ? 7.338   27.448  103.639 1.00 33.80  ? 359  ILE B C   1 
ATOM   6722  O O   . ILE B 1 339 ? 7.953   27.976  102.715 1.00 35.49  ? 359  ILE B O   1 
ATOM   6723  C CB  . ILE B 1 339 ? 5.314   25.983  103.454 1.00 29.57  ? 359  ILE B CB  1 
ATOM   6724  C CG1 . ILE B 1 339 ? 4.815   24.546  103.301 1.00 28.29  ? 359  ILE B CG1 1 
ATOM   6725  C CG2 . ILE B 1 339 ? 4.831   26.828  102.282 1.00 26.86  ? 359  ILE B CG2 1 
ATOM   6726  C CD1 . ILE B 1 339 ? 3.303   24.419  103.231 1.00 27.56  ? 359  ILE B CD1 1 
ATOM   6727  N N   . PRO B 1 340 ? 7.071   28.111  104.778 1.00 34.57  ? 360  PRO B N   1 
ATOM   6728  C CA  . PRO B 1 340 ? 7.509   29.499  104.943 1.00 34.74  ? 360  PRO B CA  1 
ATOM   6729  C C   . PRO B 1 340 ? 8.984   29.655  104.612 1.00 35.64  ? 360  PRO B C   1 
ATOM   6730  O O   . PRO B 1 340 ? 9.375   30.542  103.862 1.00 34.87  ? 360  PRO B O   1 
ATOM   6731  C CB  . PRO B 1 340 ? 7.232   29.769  106.415 1.00 34.97  ? 360  PRO B CB  1 
ATOM   6732  C CG  . PRO B 1 340 ? 6.053   28.905  106.691 1.00 35.28  ? 360  PRO B CG  1 
ATOM   6733  C CD  . PRO B 1 340 ? 6.433   27.622  106.010 1.00 35.36  ? 360  PRO B CD  1 
ATOM   6734  N N   . MET B 1 341 ? 9.791   28.771  105.186 1.00 37.89  ? 361  MET B N   1 
ATOM   6735  C CA  . MET B 1 341 ? 11.233  28.774  104.985 1.00 40.31  ? 361  MET B CA  1 
ATOM   6736  C C   . MET B 1 341 ? 11.604  28.689  103.504 1.00 41.17  ? 361  MET B C   1 
ATOM   6737  O O   . MET B 1 341 ? 12.383  29.504  103.012 1.00 40.64  ? 361  MET B O   1 
ATOM   6738  C CB  . MET B 1 341 ? 11.851  27.611  105.775 1.00 41.45  ? 361  MET B CB  1 
ATOM   6739  C CG  . MET B 1 341 ? 13.364  27.481  105.682 1.00 42.82  ? 361  MET B CG  1 
ATOM   6740  S SD  . MET B 1 341 ? 13.909  26.565  104.229 1.00 44.58  ? 361  MET B SD  1 
ATOM   6741  C CE  . MET B 1 341 ? 13.512  24.894  104.751 1.00 43.46  ? 361  MET B CE  1 
ATOM   6742  N N   . LEU B 1 342 ? 11.040  27.712  102.797 1.00 42.82  ? 363  LEU B N   1 
ATOM   6743  C CA  . LEU B 1 342 ? 11.317  27.538  101.373 1.00 45.68  ? 363  LEU B CA  1 
ATOM   6744  C C   . LEU B 1 342 ? 10.842  28.714  100.522 1.00 48.62  ? 363  LEU B C   1 
ATOM   6745  O O   . LEU B 1 342 ? 11.343  28.924  99.418  1.00 50.05  ? 363  LEU B O   1 
ATOM   6746  C CB  . LEU B 1 342 ? 10.664  26.260  100.842 1.00 44.96  ? 363  LEU B CB  1 
ATOM   6747  C CG  . LEU B 1 342 ? 11.239  24.897  101.216 1.00 44.17  ? 363  LEU B CG  1 
ATOM   6748  C CD1 . LEU B 1 342 ? 10.461  23.821  100.494 1.00 43.31  ? 363  LEU B CD1 1 
ATOM   6749  C CD2 . LEU B 1 342 ? 12.697  24.822  100.829 1.00 44.78  ? 363  LEU B CD2 1 
ATOM   6750  N N   . MET B 1 343 ? 9.865   29.467  101.021 1.00 50.83  ? 364  MET B N   1 
ATOM   6751  C CA  . MET B 1 343 ? 9.348   30.620  100.291 1.00 52.37  ? 364  MET B CA  1 
ATOM   6752  C C   . MET B 1 343 ? 10.039  31.893  100.741 1.00 53.73  ? 364  MET B C   1 
ATOM   6753  O O   . MET B 1 343 ? 9.835   32.959  100.160 1.00 53.30  ? 364  MET B O   1 
ATOM   6754  C CB  . MET B 1 343 ? 7.846   30.770  100.507 1.00 52.39  ? 364  MET B CB  1 
ATOM   6755  C CG  . MET B 1 343 ? 7.002   29.822  99.693  1.00 52.88  ? 364  MET B CG  1 
ATOM   6756  S SD  . MET B 1 343 ? 5.266   30.216  99.909  1.00 54.20  ? 364  MET B SD  1 
ATOM   6757  C CE  . MET B 1 343 ? 5.171   31.791  99.061  1.00 54.07  ? 364  MET B CE  1 
ATOM   6758  N N   . SER B 1 344 ? 10.848  31.774  101.787 1.00 56.40  ? 365  SER B N   1 
ATOM   6759  C CA  . SER B 1 344 ? 11.577  32.910  102.325 1.00 59.67  ? 365  SER B CA  1 
ATOM   6760  C C   . SER B 1 344 ? 10.607  33.894  102.982 1.00 62.46  ? 365  SER B C   1 
ATOM   6761  O O   . SER B 1 344 ? 10.826  35.103  102.966 1.00 62.59  ? 365  SER B O   1 
ATOM   6762  C CB  . SER B 1 344 ? 12.339  33.597  101.196 1.00 58.73  ? 365  SER B CB  1 
ATOM   6763  O OG  . SER B 1 344 ? 12.822  32.629  100.280 1.00 58.29  ? 365  SER B OG  1 
ATOM   6764  N N   . TYR B 1 345 ? 9.537   33.362  103.565 1.00 65.89  ? 366  TYR B N   1 
ATOM   6765  C CA  . TYR B 1 345 ? 8.520   34.175  104.224 1.00 69.07  ? 366  TYR B CA  1 
ATOM   6766  C C   . TYR B 1 345 ? 9.137   35.169  105.210 1.00 71.70  ? 366  TYR B C   1 
ATOM   6767  O O   . TYR B 1 345 ? 10.064  34.829  105.945 1.00 71.48  ? 366  TYR B O   1 
ATOM   6768  C CB  . TYR B 1 345 ? 7.532   33.269  104.960 1.00 68.79  ? 366  TYR B CB  1 
ATOM   6769  C CG  . TYR B 1 345 ? 6.126   33.812  104.989 1.00 69.51  ? 366  TYR B CG  1 
ATOM   6770  C CD1 . TYR B 1 345 ? 5.390   33.958  103.811 1.00 69.33  ? 366  TYR B CD1 1 
ATOM   6771  C CD2 . TYR B 1 345 ? 5.534   34.201  106.189 1.00 70.63  ? 366  TYR B CD2 1 
ATOM   6772  C CE1 . TYR B 1 345 ? 4.099   34.478  103.826 1.00 69.85  ? 366  TYR B CE1 1 
ATOM   6773  C CE2 . TYR B 1 345 ? 4.242   34.725  106.219 1.00 70.81  ? 366  TYR B CE2 1 
ATOM   6774  C CZ  . TYR B 1 345 ? 3.532   34.861  105.035 1.00 70.76  ? 366  TYR B CZ  1 
ATOM   6775  O OH  . TYR B 1 345 ? 2.261   35.389  105.069 1.00 70.85  ? 366  TYR B OH  1 
ATOM   6776  N N   . PRO B 1 346 ? 8.633   36.417  105.227 1.00 74.62  ? 367  PRO B N   1 
ATOM   6777  C CA  . PRO B 1 346 ? 9.106   37.494  106.108 1.00 76.99  ? 367  PRO B CA  1 
ATOM   6778  C C   . PRO B 1 346 ? 8.794   37.290  107.588 1.00 79.15  ? 367  PRO B C   1 
ATOM   6779  O O   . PRO B 1 346 ? 7.899   37.934  108.139 1.00 79.26  ? 367  PRO B O   1 
ATOM   6780  C CB  . PRO B 1 346 ? 8.408   38.734  105.550 1.00 76.62  ? 367  PRO B CB  1 
ATOM   6781  C CG  . PRO B 1 346 ? 8.248   38.405  104.108 1.00 76.31  ? 367  PRO B CG  1 
ATOM   6782  C CD  . PRO B 1 346 ? 7.775   36.972  104.167 1.00 75.58  ? 367  PRO B CD  1 
ATOM   6783  N N   . LEU B 1 347 ? 9.538   36.393  108.225 1.00 81.46  ? 368  LEU B N   1 
ATOM   6784  C CA  . LEU B 1 347 ? 9.353   36.114  109.640 1.00 83.84  ? 368  LEU B CA  1 
ATOM   6785  C C   . LEU B 1 347 ? 10.706  36.061  110.343 1.00 85.57  ? 368  LEU B C   1 
ATOM   6786  O O   . LEU B 1 347 ? 11.072  35.052  110.951 1.00 86.35  ? 368  LEU B O   1 
ATOM   6787  C CB  . LEU B 1 347 ? 8.605   34.791  109.832 1.00 84.21  ? 368  LEU B CB  1 
ATOM   6788  C CG  . LEU B 1 347 ? 7.184   34.729  109.262 1.00 84.83  ? 368  LEU B CG  1 
ATOM   6789  C CD1 . LEU B 1 347 ? 6.573   33.367  109.569 1.00 84.46  ? 368  LEU B CD1 1 
ATOM   6790  C CD2 . LEU B 1 347 ? 6.335   35.847  109.859 1.00 84.45  ? 368  LEU B CD2 1 
ATOM   6791  N N   . SER B 1 348 ? 11.444  37.164  110.251 1.00 87.19  ? 369  SER B N   1 
ATOM   6792  C CA  . SER B 1 348 ? 12.762  37.272  110.868 1.00 88.19  ? 369  SER B CA  1 
ATOM   6793  C C   . SER B 1 348 ? 12.624  37.578  112.355 1.00 88.93  ? 369  SER B C   1 
ATOM   6794  O O   . SER B 1 348 ? 13.384  37.068  113.176 1.00 88.86  ? 369  SER B O   1 
ATOM   6795  C CB  . SER B 1 348 ? 13.568  38.389  110.198 1.00 87.89  ? 369  SER B CB  1 
ATOM   6796  O OG  . SER B 1 348 ? 13.648  38.198  108.796 1.00 87.34  ? 369  SER B OG  1 
ATOM   6797  N N   . GLU B 1 349 ? 11.639  38.409  112.685 1.00 89.68  ? 370  GLU B N   1 
ATOM   6798  C CA  . GLU B 1 349 ? 11.383  38.819  114.061 1.00 90.05  ? 370  GLU B CA  1 
ATOM   6799  C C   . GLU B 1 349 ? 10.853  37.724  114.981 1.00 90.07  ? 370  GLU B C   1 
ATOM   6800  O O   . GLU B 1 349 ? 11.236  37.654  116.149 1.00 90.16  ? 370  GLU B O   1 
ATOM   6801  C CB  . GLU B 1 349 ? 10.410  40.000  114.073 1.00 90.40  ? 370  GLU B CB  1 
ATOM   6802  C CG  . GLU B 1 349 ? 10.959  41.230  113.393 1.00 91.52  ? 370  GLU B CG  1 
ATOM   6803  C CD  . GLU B 1 349 ? 12.343  41.578  113.897 1.00 92.56  ? 370  GLU B CD  1 
ATOM   6804  O OE1 . GLU B 1 349 ? 12.490  41.805  115.118 1.00 92.81  ? 370  GLU B OE1 1 
ATOM   6805  O OE2 . GLU B 1 349 ? 13.283  41.617  113.075 1.00 93.28  ? 370  GLU B OE2 1 
ATOM   6806  N N   . GLY B 1 350 ? 9.972   36.875  114.462 1.00 90.07  ? 371  GLY B N   1 
ATOM   6807  C CA  . GLY B 1 350 ? 9.405   35.817  115.281 1.00 89.65  ? 371  GLY B CA  1 
ATOM   6808  C C   . GLY B 1 350 ? 8.285   36.370  116.144 1.00 89.26  ? 371  GLY B C   1 
ATOM   6809  O O   . GLY B 1 350 ? 7.873   35.758  117.133 1.00 88.68  ? 371  GLY B O   1 
ATOM   6810  N N   . GLN B 1 351 ? 7.793   37.541  115.750 1.00 89.10  ? 372  GLN B N   1 
ATOM   6811  C CA  . GLN B 1 351 ? 6.721   38.232  116.458 1.00 88.73  ? 372  GLN B CA  1 
ATOM   6812  C C   . GLN B 1 351 ? 5.871   38.991  115.442 1.00 88.08  ? 372  GLN B C   1 
ATOM   6813  O O   . GLN B 1 351 ? 6.230   39.069  114.266 1.00 87.53  ? 372  GLN B O   1 
ATOM   6814  C CB  . GLN B 1 351 ? 7.323   39.204  117.472 1.00 88.94  ? 372  GLN B CB  1 
ATOM   6815  C CG  . GLN B 1 351 ? 8.315   40.182  116.857 1.00 89.40  ? 372  GLN B CG  1 
ATOM   6816  C CD  . GLN B 1 351 ? 9.170   40.880  117.894 1.00 89.60  ? 372  GLN B CD  1 
ATOM   6817  O OE1 . GLN B 1 351 ? 10.020  41.708  117.560 1.00 89.10  ? 372  GLN B OE1 1 
ATOM   6818  N NE2 . GLN B 1 351 ? 8.954   40.547  119.162 1.00 90.34  ? 372  GLN B NE2 1 
ATOM   6819  N N   . LEU B 1 352 ? 4.754   39.558  115.889 1.00 87.55  ? 373  LEU B N   1 
ATOM   6820  C CA  . LEU B 1 352 ? 3.886   40.286  114.973 1.00 87.06  ? 373  LEU B CA  1 
ATOM   6821  C C   . LEU B 1 352 ? 2.910   41.235  115.671 1.00 86.65  ? 373  LEU B C   1 
ATOM   6822  O O   . LEU B 1 352 ? 2.798   41.245  116.898 1.00 85.75  ? 373  LEU B O   1 
ATOM   6823  C CB  . LEU B 1 352 ? 3.113   39.283  114.112 1.00 86.99  ? 373  LEU B CB  1 
ATOM   6824  C CG  . LEU B 1 352 ? 2.822   39.671  112.662 1.00 86.96  ? 373  LEU B CG  1 
ATOM   6825  C CD1 . LEU B 1 352 ? 4.128   39.973  111.935 1.00 86.28  ? 373  LEU B CD1 1 
ATOM   6826  C CD2 . LEU B 1 352 ? 2.074   38.531  111.979 1.00 86.41  ? 373  LEU B CD2 1 
ATOM   6827  N N   . ASP B 1 353 ? 2.206   42.030  114.871 1.00 86.71  ? 374  ASP B N   1 
ATOM   6828  C CA  . ASP B 1 353 ? 1.239   42.994  115.385 1.00 87.35  ? 374  ASP B CA  1 
ATOM   6829  C C   . ASP B 1 353 ? 0.063   43.101  114.422 1.00 87.16  ? 374  ASP B C   1 
ATOM   6830  O O   . ASP B 1 353 ? 0.220   42.897  113.219 1.00 87.69  ? 374  ASP B O   1 
ATOM   6831  C CB  . ASP B 1 353 ? 1.884   44.369  115.506 1.00 89.06  ? 374  ASP B CB  1 
ATOM   6832  C CG  . ASP B 1 353 ? 1.964   45.084  114.169 1.00 90.07  ? 374  ASP B CG  1 
ATOM   6833  O OD1 . ASP B 1 353 ? 2.470   44.475  113.201 1.00 89.40  ? 374  ASP B OD1 1 
ATOM   6834  O OD2 . ASP B 1 353 ? 1.519   46.250  114.088 1.00 90.38  ? 374  ASP B OD2 1 
ATOM   6835  N N   . GLN B 1 354 ? -1.105  43.449  114.955 1.00 86.33  ? 375  GLN B N   1 
ATOM   6836  C CA  . GLN B 1 354 ? -2.321  43.586  114.157 1.00 85.55  ? 375  GLN B CA  1 
ATOM   6837  C C   . GLN B 1 354 ? -2.137  44.328  112.836 1.00 85.19  ? 375  GLN B C   1 
ATOM   6838  O O   . GLN B 1 354 ? -2.897  44.119  111.888 1.00 84.69  ? 375  GLN B O   1 
ATOM   6839  C CB  . GLN B 1 354 ? -3.405  44.275  114.987 1.00 85.69  ? 375  GLN B CB  1 
ATOM   6840  C CG  . GLN B 1 354 ? -3.969  43.393  116.081 1.00 85.56  ? 375  GLN B CG  1 
ATOM   6841  C CD  . GLN B 1 354 ? -4.791  42.247  115.526 1.00 85.79  ? 375  GLN B CD  1 
ATOM   6842  O OE1 . GLN B 1 354 ? -5.096  41.287  116.233 1.00 85.87  ? 375  GLN B OE1 1 
ATOM   6843  N NE2 . GLN B 1 354 ? -5.166  42.348  114.254 1.00 85.82  ? 375  GLN B NE2 1 
ATOM   6844  N N   . LYS B 1 355 ? -1.131  45.194  112.774 1.00 84.74  ? 376  LYS B N   1 
ATOM   6845  C CA  . LYS B 1 355 ? -0.869  45.946  111.555 1.00 84.84  ? 376  LYS B CA  1 
ATOM   6846  C C   . LYS B 1 355 ? -0.168  45.069  110.528 1.00 84.80  ? 376  LYS B C   1 
ATOM   6847  O O   . LYS B 1 355 ? -0.761  44.688  109.515 1.00 84.53  ? 376  LYS B O   1 
ATOM   6848  C CB  . LYS B 1 355 ? -0.008  47.173  111.858 1.00 84.84  ? 376  LYS B CB  1 
ATOM   6849  C CG  . LYS B 1 355 ? -0.705  48.206  112.720 1.00 84.86  ? 376  LYS B CG  1 
ATOM   6850  C CD  . LYS B 1 355 ? -0.669  49.573  112.063 1.00 84.43  ? 376  LYS B CD  1 
ATOM   6851  C CE  . LYS B 1 355 ? -1.527  50.567  112.824 1.00 84.31  ? 376  LYS B CE  1 
ATOM   6852  N NZ  . LYS B 1 355 ? -1.550  51.891  112.146 1.00 84.53  ? 376  LYS B NZ  1 
ATOM   6853  N N   . THR B 1 356 ? 1.096   44.758  110.799 1.00 84.65  ? 377  THR B N   1 
ATOM   6854  C CA  . THR B 1 356 ? 1.895   43.920  109.913 1.00 84.38  ? 377  THR B CA  1 
ATOM   6855  C C   . THR B 1 356 ? 1.064   42.724  109.474 1.00 84.06  ? 377  THR B C   1 
ATOM   6856  O O   . THR B 1 356 ? 1.091   42.329  108.309 1.00 83.61  ? 377  THR B O   1 
ATOM   6857  C CB  . THR B 1 356 ? 3.154   43.400  110.628 1.00 84.48  ? 377  THR B CB  1 
ATOM   6858  O OG1 . THR B 1 356 ? 3.920   44.510  111.112 1.00 84.58  ? 377  THR B OG1 1 
ATOM   6859  C CG2 . THR B 1 356 ? 4.004   42.571  109.674 1.00 84.34  ? 377  THR B CG2 1 
ATOM   6860  N N   . ALA B 1 357 ? 0.327   42.155  110.424 1.00 83.81  ? 378  ALA B N   1 
ATOM   6861  C CA  . ALA B 1 357 ? -0.527  41.005  110.160 1.00 83.81  ? 378  ALA B CA  1 
ATOM   6862  C C   . ALA B 1 357 ? -1.410  41.303  108.959 1.00 83.80  ? 378  ALA B C   1 
ATOM   6863  O O   . ALA B 1 357 ? -1.425  40.553  107.978 1.00 83.53  ? 378  ALA B O   1 
ATOM   6864  C CB  . ALA B 1 357 ? -1.387  40.707  111.377 1.00 83.12  ? 378  ALA B CB  1 
ATOM   6865  N N   . MET B 1 358 ? -2.144  42.408  109.043 1.00 83.65  ? 379  MET B N   1 
ATOM   6866  C CA  . MET B 1 358 ? -3.029  42.815  107.964 1.00 83.32  ? 379  MET B CA  1 
ATOM   6867  C C   . MET B 1 358 ? -2.243  43.151  106.701 1.00 82.40  ? 379  MET B C   1 
ATOM   6868  O O   . MET B 1 358 ? -2.810  43.199  105.608 1.00 82.67  ? 379  MET B O   1 
ATOM   6869  C CB  . MET B 1 358 ? -3.861  44.024  108.392 1.00 84.07  ? 379  MET B CB  1 
ATOM   6870  C CG  . MET B 1 358 ? -4.852  43.725  109.501 1.00 85.56  ? 379  MET B CG  1 
ATOM   6871  S SD  . MET B 1 358 ? -5.997  45.087  109.779 1.00 86.94  ? 379  MET B SD  1 
ATOM   6872  C CE  . MET B 1 358 ? -5.209  45.908  111.173 1.00 86.74  ? 379  MET B CE  1 
ATOM   6873  N N   . SER B 1 359 ? -0.938  43.372  106.856 1.00 80.79  ? 380  SER B N   1 
ATOM   6874  C CA  . SER B 1 359 ? -0.072  43.708  105.727 1.00 79.05  ? 380  SER B CA  1 
ATOM   6875  C C   . SER B 1 359 ? 0.545   42.459  105.093 1.00 78.09  ? 380  SER B C   1 
ATOM   6876  O O   . SER B 1 359 ? 0.615   42.340  103.868 1.00 77.48  ? 380  SER B O   1 
ATOM   6877  C CB  . SER B 1 359 ? 1.037   44.660  106.185 1.00 78.58  ? 380  SER B CB  1 
ATOM   6878  O OG  . SER B 1 359 ? 1.785   45.147  105.082 1.00 77.73  ? 380  SER B OG  1 
ATOM   6879  N N   . LEU B 1 360 ? 0.992   41.531  105.930 1.00 77.29  ? 381  LEU B N   1 
ATOM   6880  C CA  . LEU B 1 360 ? 1.591   40.296  105.445 1.00 76.18  ? 381  LEU B CA  1 
ATOM   6881  C C   . LEU B 1 360 ? 0.539   39.440  104.758 1.00 75.93  ? 381  LEU B C   1 
ATOM   6882  O O   . LEU B 1 360 ? 0.797   38.842  103.717 1.00 75.70  ? 381  LEU B O   1 
ATOM   6883  C CB  . LEU B 1 360 ? 2.207   39.514  106.604 1.00 75.36  ? 381  LEU B CB  1 
ATOM   6884  C CG  . LEU B 1 360 ? 3.709   39.272  106.488 1.00 74.64  ? 381  LEU B CG  1 
ATOM   6885  C CD1 . LEU B 1 360 ? 4.212   38.540  107.721 1.00 75.41  ? 381  LEU B CD1 1 
ATOM   6886  C CD2 . LEU B 1 360 ? 3.991   38.472  105.234 1.00 73.91  ? 381  LEU B CD2 1 
ATOM   6887  N N   . LEU B 1 361 ? -0.652  39.387  105.345 1.00 76.20  ? 382  LEU B N   1 
ATOM   6888  C CA  . LEU B 1 361 ? -1.740  38.600  104.778 1.00 76.69  ? 382  LEU B CA  1 
ATOM   6889  C C   . LEU B 1 361 ? -2.155  39.147  103.414 1.00 77.32  ? 382  LEU B C   1 
ATOM   6890  O O   . LEU B 1 361 ? -2.448  38.380  102.495 1.00 76.93  ? 382  LEU B O   1 
ATOM   6891  C CB  . LEU B 1 361 ? -2.943  38.596  105.726 1.00 75.71  ? 382  LEU B CB  1 
ATOM   6892  C CG  . LEU B 1 361 ? -4.115  37.713  105.287 1.00 75.18  ? 382  LEU B CG  1 
ATOM   6893  C CD1 . LEU B 1 361 ? -3.653  36.270  105.153 1.00 74.48  ? 382  LEU B CD1 1 
ATOM   6894  C CD2 . LEU B 1 361 ? -5.241  37.820  106.298 1.00 75.11  ? 382  LEU B CD2 1 
ATOM   6895  N N   . TRP B 1 362 ? -2.184  40.472  103.286 1.00 78.38  ? 383  TRP B N   1 
ATOM   6896  C CA  . TRP B 1 362 ? -2.553  41.104  102.024 1.00 78.87  ? 383  TRP B CA  1 
ATOM   6897  C C   . TRP B 1 362 ? -1.533  40.741  100.958 1.00 78.63  ? 383  TRP B C   1 
ATOM   6898  O O   . TRP B 1 362 ? -1.895  40.324  99.860  1.00 78.73  ? 383  TRP B O   1 
ATOM   6899  C CB  . TRP B 1 362 ? -2.598  42.626  102.162 1.00 80.30  ? 383  TRP B CB  1 
ATOM   6900  C CG  . TRP B 1 362 ? -3.006  43.327  100.886 1.00 81.71  ? 383  TRP B CG  1 
ATOM   6901  C CD1 . TRP B 1 362 ? -2.481  44.484  100.380 1.00 81.56  ? 383  TRP B CD1 1 
ATOM   6902  C CD2 . TRP B 1 362 ? -4.032  42.918  99.968  1.00 81.82  ? 383  TRP B CD2 1 
ATOM   6903  N NE1 . TRP B 1 362 ? -3.113  44.819  99.206  1.00 81.27  ? 383  TRP B NE1 1 
ATOM   6904  C CE2 . TRP B 1 362 ? -4.069  43.876  98.930  1.00 81.77  ? 383  TRP B CE2 1 
ATOM   6905  C CE3 . TRP B 1 362 ? -4.923  41.835  99.923  1.00 81.80  ? 383  TRP B CE3 1 
ATOM   6906  C CZ2 . TRP B 1 362 ? -4.962  43.785  97.855  1.00 82.07  ? 383  TRP B CZ2 1 
ATOM   6907  C CZ3 . TRP B 1 362 ? -5.812  41.745  98.856  1.00 82.30  ? 383  TRP B CZ3 1 
ATOM   6908  C CH2 . TRP B 1 362 ? -5.823  42.717  97.835  1.00 82.48  ? 383  TRP B CH2 1 
ATOM   6909  N N   . LYS B 1 363 ? -0.256  40.915  101.284 1.00 78.11  ? 384  LYS B N   1 
ATOM   6910  C CA  . LYS B 1 363 ? 0.817   40.591  100.354 1.00 77.98  ? 384  LYS B CA  1 
ATOM   6911  C C   . LYS B 1 363 ? 0.813   39.089  100.086 1.00 77.74  ? 384  LYS B C   1 
ATOM   6912  O O   . LYS B 1 363 ? 1.275   38.634  99.039  1.00 77.45  ? 384  LYS B O   1 
ATOM   6913  C CB  . LYS B 1 363 ? 2.160   41.032  100.934 1.00 78.17  ? 384  LYS B CB  1 
ATOM   6914  C CG  . LYS B 1 363 ? 2.227   42.528  101.169 1.00 79.53  ? 384  LYS B CG  1 
ATOM   6915  C CD  . LYS B 1 363 ? 3.471   42.949  101.934 1.00 80.28  ? 384  LYS B CD  1 
ATOM   6916  C CE  . LYS B 1 363 ? 3.440   44.451  102.210 1.00 80.74  ? 384  LYS B CE  1 
ATOM   6917  N NZ  . LYS B 1 363 ? 4.604   44.928  103.006 1.00 81.21  ? 384  LYS B NZ  1 
ATOM   6918  N N   . SER B 1 364 ? 0.282   38.324  101.037 1.00 77.79  ? 385  SER B N   1 
ATOM   6919  C CA  . SER B 1 364 ? 0.192   36.873  100.897 1.00 77.57  ? 385  SER B CA  1 
ATOM   6920  C C   . SER B 1 364 ? -1.037  36.521  100.069 1.00 77.70  ? 385  SER B C   1 
ATOM   6921  O O   . SER B 1 364 ? -1.489  35.376  100.068 1.00 77.98  ? 385  SER B O   1 
ATOM   6922  C CB  . SER B 1 364 ? 0.085   36.200  102.269 1.00 76.41  ? 385  SER B CB  1 
ATOM   6923  O OG  . SER B 1 364 ? 1.314   36.257  102.964 1.00 75.00  ? 385  SER B OG  1 
ATOM   6924  N N   . TYR B 1 365 ? -1.572  37.519  99.371  1.00 77.67  ? 386  TYR B N   1 
ATOM   6925  C CA  . TYR B 1 365 ? -2.751  37.340  98.532  1.00 77.99  ? 386  TYR B CA  1 
ATOM   6926  C C   . TYR B 1 365 ? -2.564  36.226  97.499  1.00 78.29  ? 386  TYR B C   1 
ATOM   6927  O O   . TYR B 1 365 ? -3.496  35.464  97.224  1.00 78.51  ? 386  TYR B O   1 
ATOM   6928  C CB  . TYR B 1 365 ? -3.086  38.649  97.817  1.00 77.93  ? 386  TYR B CB  1 
ATOM   6929  C CG  . TYR B 1 365 ? -4.314  38.577  96.942  1.00 77.55  ? 386  TYR B CG  1 
ATOM   6930  C CD1 . TYR B 1 365 ? -5.593  38.577  97.498  1.00 77.05  ? 386  TYR B CD1 1 
ATOM   6931  C CD2 . TYR B 1 365 ? -4.196  38.503  95.554  1.00 77.61  ? 386  TYR B CD2 1 
ATOM   6932  C CE1 . TYR B 1 365 ? -6.723  38.507  96.693  1.00 77.05  ? 386  TYR B CE1 1 
ATOM   6933  C CE2 . TYR B 1 365 ? -5.317  38.431  94.741  1.00 77.47  ? 386  TYR B CE2 1 
ATOM   6934  C CZ  . TYR B 1 365 ? -6.576  38.434  95.315  1.00 77.62  ? 386  TYR B CZ  1 
ATOM   6935  O OH  . TYR B 1 365 ? -7.689  38.372  94.509  1.00 78.59  ? 386  TYR B OH  1 
ATOM   6936  N N   . PRO B 1 366 ? -1.361  36.120  96.904  1.00 77.98  ? 387  PRO B N   1 
ATOM   6937  C CA  . PRO B 1 366 ? -1.160  35.059  95.914  1.00 77.69  ? 387  PRO B CA  1 
ATOM   6938  C C   . PRO B 1 366 ? -1.161  33.657  96.525  1.00 77.72  ? 387  PRO B C   1 
ATOM   6939  O O   . PRO B 1 366 ? -1.001  32.669  95.809  1.00 78.30  ? 387  PRO B O   1 
ATOM   6940  C CB  . PRO B 1 366 ? 0.183   35.429  95.283  1.00 77.25  ? 387  PRO B CB  1 
ATOM   6941  C CG  . PRO B 1 366 ? 0.903   36.108  96.398  1.00 77.19  ? 387  PRO B CG  1 
ATOM   6942  C CD  . PRO B 1 366 ? -0.170  36.985  96.991  1.00 77.47  ? 387  PRO B CD  1 
ATOM   6943  N N   . LEU B 1 367 ? -1.351  33.577  97.843  1.00 77.33  ? 388  LEU B N   1 
ATOM   6944  C CA  . LEU B 1 367 ? -1.371  32.296  98.554  1.00 76.64  ? 388  LEU B CA  1 
ATOM   6945  C C   . LEU B 1 367 ? -2.705  31.991  99.240  1.00 76.20  ? 388  LEU B C   1 
ATOM   6946  O O   . LEU B 1 367 ? -3.218  30.873  99.154  1.00 75.69  ? 388  LEU B O   1 
ATOM   6947  C CB  . LEU B 1 367 ? -0.262  32.250  99.616  1.00 76.38  ? 388  LEU B CB  1 
ATOM   6948  C CG  . LEU B 1 367 ? 1.215   32.260  99.210  1.00 76.32  ? 388  LEU B CG  1 
ATOM   6949  C CD1 . LEU B 1 367 ? 2.082   32.100  100.459 1.00 75.87  ? 388  LEU B CD1 1 
ATOM   6950  C CD2 . LEU B 1 367 ? 1.492   31.132  98.230  1.00 76.51  ? 388  LEU B CD2 1 
ATOM   6951  N N   . VAL B 1 368 ? -3.255  32.984  99.929  1.00 76.25  ? 389  VAL B N   1 
ATOM   6952  C CA  . VAL B 1 368 ? -4.510  32.809  100.651 1.00 75.90  ? 389  VAL B CA  1 
ATOM   6953  C C   . VAL B 1 368 ? -5.693  33.519  100.006 1.00 76.46  ? 389  VAL B C   1 
ATOM   6954  O O   . VAL B 1 368 ? -6.818  33.431  100.502 1.00 76.51  ? 389  VAL B O   1 
ATOM   6955  C CB  . VAL B 1 368 ? -4.376  33.306  102.102 1.00 75.00  ? 389  VAL B CB  1 
ATOM   6956  C CG1 . VAL B 1 368 ? -3.428  32.402  102.874 1.00 74.34  ? 389  VAL B CG1 1 
ATOM   6957  C CG2 . VAL B 1 368 ? -3.864  34.736  102.110 1.00 73.82  ? 389  VAL B CG2 1 
ATOM   6958  N N   . CYS B 1 369 ? -5.434  34.216  98.904  1.00 76.96  ? 390  CYS B N   1 
ATOM   6959  C CA  . CYS B 1 369 ? -6.473  34.947  98.179  1.00 77.62  ? 390  CYS B CA  1 
ATOM   6960  C C   . CYS B 1 369 ? -7.527  35.559  99.097  1.00 78.00  ? 390  CYS B C   1 
ATOM   6961  O O   . CYS B 1 369 ? -8.647  35.056  99.207  1.00 78.07  ? 390  CYS B O   1 
ATOM   6962  C CB  . CYS B 1 369 ? -7.152  34.028  97.159  1.00 76.73  ? 390  CYS B CB  1 
ATOM   6963  S SG  . CYS B 1 369 ? -6.058  33.485  95.842  1.00 75.58  ? 390  CYS B SG  1 
ATOM   6964  N N   . ILE B 1 370 ? -7.162  36.650  99.755  1.00 78.10  ? 391  ILE B N   1 
ATOM   6965  C CA  . ILE B 1 370 ? -8.081  37.321  100.653 1.00 78.24  ? 391  ILE B CA  1 
ATOM   6966  C C   . ILE B 1 370 ? -8.176  38.794  100.282 1.00 78.84  ? 391  ILE B C   1 
ATOM   6967  O O   . ILE B 1 370 ? -7.170  39.504  100.248 1.00 78.64  ? 391  ILE B O   1 
ATOM   6968  C CB  . ILE B 1 370 ? -7.620  37.178  102.116 1.00 77.83  ? 391  ILE B CB  1 
ATOM   6969  C CG1 . ILE B 1 370 ? -7.587  35.695  102.500 1.00 77.45  ? 391  ILE B CG1 1 
ATOM   6970  C CG2 . ILE B 1 370 ? -8.558  37.942  103.038 1.00 78.08  ? 391  ILE B CG2 1 
ATOM   6971  C CD1 . ILE B 1 370 ? -7.111  35.428  103.917 1.00 77.71  ? 391  ILE B CD1 1 
ATOM   6972  N N   . ALA B 1 371 ? -9.394  39.239  99.990  1.00 79.68  ? 392  ALA B N   1 
ATOM   6973  C CA  . ALA B 1 371 ? -9.648  40.626  99.619  1.00 80.44  ? 392  ALA B CA  1 
ATOM   6974  C C   . ALA B 1 371 ? -9.225  41.551  100.749 1.00 81.10  ? 392  ALA B C   1 
ATOM   6975  O O   . ALA B 1 371 ? -9.442  41.250  101.921 1.00 81.00  ? 392  ALA B O   1 
ATOM   6976  C CB  . ALA B 1 371 ? -11.122 40.818  99.315  1.00 80.53  ? 392  ALA B CB  1 
ATOM   6977  N N   . LYS B 1 372 ? -8.627  42.681  100.393 1.00 81.92  ? 393  LYS B N   1 
ATOM   6978  C CA  . LYS B 1 372 ? -8.166  43.633  101.391 1.00 83.51  ? 393  LYS B CA  1 
ATOM   6979  C C   . LYS B 1 372 ? -9.292  44.069  102.328 1.00 84.18  ? 393  LYS B C   1 
ATOM   6980  O O   . LYS B 1 372 ? -9.087  44.193  103.537 1.00 84.79  ? 393  LYS B O   1 
ATOM   6981  C CB  . LYS B 1 372 ? -7.543  44.851  100.705 1.00 84.14  ? 393  LYS B CB  1 
ATOM   6982  C CG  . LYS B 1 372 ? -6.616  45.660  101.604 1.00 84.76  ? 393  LYS B CG  1 
ATOM   6983  C CD  . LYS B 1 372 ? -5.782  46.642  100.791 1.00 85.05  ? 393  LYS B CD  1 
ATOM   6984  C CE  . LYS B 1 372 ? -4.753  47.344  101.659 1.00 85.26  ? 393  LYS B CE  1 
ATOM   6985  N NZ  . LYS B 1 372 ? -3.837  46.379  102.331 1.00 85.35  ? 393  LYS B NZ  1 
ATOM   6986  N N   . GLU B 1 373 ? -10.480 44.294  101.775 1.00 84.70  ? 394  GLU B N   1 
ATOM   6987  C CA  . GLU B 1 373 ? -11.624 44.708  102.584 1.00 84.88  ? 394  GLU B CA  1 
ATOM   6988  C C   . GLU B 1 373 ? -12.027 43.589  103.546 1.00 84.40  ? 394  GLU B C   1 
ATOM   6989  O O   . GLU B 1 373 ? -12.887 43.775  104.409 1.00 84.81  ? 394  GLU B O   1 
ATOM   6990  C CB  . GLU B 1 373 ? -12.816 45.074  101.692 1.00 85.53  ? 394  GLU B CB  1 
ATOM   6991  C CG  . GLU B 1 373 ? -13.364 43.919  100.860 1.00 87.02  ? 394  GLU B CG  1 
ATOM   6992  C CD  . GLU B 1 373 ? -12.678 43.775  99.511  1.00 88.16  ? 394  GLU B CD  1 
ATOM   6993  O OE1 . GLU B 1 373 ? -11.428 43.768  99.465  1.00 88.94  ? 394  GLU B OE1 1 
ATOM   6994  O OE2 . GLU B 1 373 ? -13.397 43.660  98.493  1.00 88.51  ? 394  GLU B OE2 1 
ATOM   6995  N N   . LEU B 1 374 ? -11.402 42.426  103.387 1.00 83.21  ? 395  LEU B N   1 
ATOM   6996  C CA  . LEU B 1 374 ? -11.682 41.279  104.243 1.00 82.00  ? 395  LEU B CA  1 
ATOM   6997  C C   . LEU B 1 374 ? -10.544 41.079  105.244 1.00 81.43  ? 395  LEU B C   1 
ATOM   6998  O O   . LEU B 1 374 ? -10.762 40.583  106.352 1.00 81.28  ? 395  LEU B O   1 
ATOM   6999  C CB  . LEU B 1 374 ? -11.847 40.006  103.400 1.00 81.36  ? 395  LEU B CB  1 
ATOM   7000  C CG  . LEU B 1 374 ? -13.010 39.906  102.407 1.00 80.60  ? 395  LEU B CG  1 
ATOM   7001  C CD1 . LEU B 1 374 ? -12.930 38.582  101.660 1.00 79.84  ? 395  LEU B CD1 1 
ATOM   7002  C CD2 . LEU B 1 374 ? -14.333 40.015  103.144 1.00 80.26  ? 395  LEU B CD2 1 
ATOM   7003  N N   . ILE B 1 375 ? -9.335  41.471  104.840 1.00 80.55  ? 396  ILE B N   1 
ATOM   7004  C CA  . ILE B 1 375 ? -8.135  41.337  105.669 1.00 79.44  ? 396  ILE B CA  1 
ATOM   7005  C C   . ILE B 1 375 ? -8.400  41.487  107.170 1.00 79.25  ? 396  ILE B C   1 
ATOM   7006  O O   . ILE B 1 375 ? -8.123  40.573  107.948 1.00 78.96  ? 396  ILE B O   1 
ATOM   7007  C CB  . ILE B 1 375 ? -7.039  42.368  105.252 1.00 78.50  ? 396  ILE B CB  1 
ATOM   7008  C CG1 . ILE B 1 375 ? -6.569  42.101  103.819 1.00 77.47  ? 396  ILE B CG1 1 
ATOM   7009  C CG2 . ILE B 1 375 ? -5.854  42.289  106.208 1.00 78.06  ? 396  ILE B CG2 1 
ATOM   7010  C CD1 . ILE B 1 375 ? -5.717  40.857  103.657 1.00 76.70  ? 396  ILE B CD1 1 
ATOM   7011  N N   . PRO B 1 376 ? -8.951  42.637  107.593 1.00 79.36  ? 397  PRO B N   1 
ATOM   7012  C CA  . PRO B 1 376 ? -9.240  42.881  109.012 1.00 79.06  ? 397  PRO B CA  1 
ATOM   7013  C C   . PRO B 1 376 ? -10.029 41.764  109.696 1.00 78.65  ? 397  PRO B C   1 
ATOM   7014  O O   . PRO B 1 376 ? -9.507  41.074  110.572 1.00 78.09  ? 397  PRO B O   1 
ATOM   7015  C CB  . PRO B 1 376 ? -10.015 44.196  108.981 1.00 79.17  ? 397  PRO B CB  1 
ATOM   7016  C CG  . PRO B 1 376 ? -9.425  44.897  107.797 1.00 79.53  ? 397  PRO B CG  1 
ATOM   7017  C CD  . PRO B 1 376 ? -9.375  43.789  106.776 1.00 79.50  ? 397  PRO B CD  1 
ATOM   7018  N N   . GLU B 1 377 ? -11.286 41.601  109.291 1.00 78.52  ? 398  GLU B N   1 
ATOM   7019  C CA  . GLU B 1 377 ? -12.161 40.581  109.857 1.00 78.26  ? 398  GLU B CA  1 
ATOM   7020  C C   . GLU B 1 377 ? -11.416 39.275  110.081 1.00 77.57  ? 398  GLU B C   1 
ATOM   7021  O O   . GLU B 1 377 ? -11.554 38.644  111.130 1.00 77.66  ? 398  GLU B O   1 
ATOM   7022  C CB  . GLU B 1 377 ? -13.347 40.336  108.929 1.00 79.56  ? 398  GLU B CB  1 
ATOM   7023  C CG  . GLU B 1 377 ? -14.163 41.576  108.641 1.00 82.45  ? 398  GLU B CG  1 
ATOM   7024  C CD  . GLU B 1 377 ? -15.410 41.273  107.835 1.00 84.70  ? 398  GLU B CD  1 
ATOM   7025  O OE1 . GLU B 1 377 ? -15.281 40.682  106.741 1.00 85.94  ? 398  GLU B OE1 1 
ATOM   7026  O OE2 . GLU B 1 377 ? -16.520 41.626  108.295 1.00 86.09  ? 398  GLU B OE2 1 
ATOM   7027  N N   . ALA B 1 378 ? -10.627 38.876  109.088 1.00 76.54  ? 399  ALA B N   1 
ATOM   7028  C CA  . ALA B 1 378 ? -9.848  37.648  109.174 1.00 75.04  ? 399  ALA B CA  1 
ATOM   7029  C C   . ALA B 1 378 ? -8.738  37.798  110.215 1.00 74.27  ? 399  ALA B C   1 
ATOM   7030  O O   . ALA B 1 378 ? -8.611  36.976  111.125 1.00 74.61  ? 399  ALA B O   1 
ATOM   7031  C CB  . ALA B 1 378 ? -9.250  37.314  107.816 1.00 74.53  ? 399  ALA B CB  1 
ATOM   7032  N N   . THR B 1 379 ? -7.941  38.854  110.087 1.00 72.47  ? 400  THR B N   1 
ATOM   7033  C CA  . THR B 1 379 ? -6.849  39.092  111.022 1.00 71.02  ? 400  THR B CA  1 
ATOM   7034  C C   . THR B 1 379 ? -7.343  39.092  112.462 1.00 70.09  ? 400  THR B C   1 
ATOM   7035  O O   . THR B 1 379 ? -6.682  38.571  113.357 1.00 69.58  ? 400  THR B O   1 
ATOM   7036  C CB  . THR B 1 379 ? -6.175  40.447  110.769 1.00 71.24  ? 400  THR B CB  1 
ATOM   7037  O OG1 . THR B 1 379 ? -5.940  40.614  109.368 1.00 72.31  ? 400  THR B OG1 1 
ATOM   7038  C CG2 . THR B 1 379 ? -4.846  40.517  111.508 1.00 70.90  ? 400  THR B CG2 1 
ATOM   7039  N N   . GLU B 1 380 ? -8.514  39.679  112.679 1.00 69.43  ? 401  GLU B N   1 
ATOM   7040  C CA  . GLU B 1 380 ? -9.077  39.766  114.015 1.00 68.86  ? 401  GLU B CA  1 
ATOM   7041  C C   . GLU B 1 380 ? -9.485  38.425  114.597 1.00 67.08  ? 401  GLU B C   1 
ATOM   7042  O O   . GLU B 1 380 ? -9.014  38.039  115.664 1.00 67.03  ? 401  GLU B O   1 
ATOM   7043  C CB  . GLU B 1 380 ? -10.280 40.712  114.022 1.00 71.10  ? 401  GLU B CB  1 
ATOM   7044  C CG  . GLU B 1 380 ? -10.836 40.962  115.419 1.00 74.06  ? 401  GLU B CG  1 
ATOM   7045  C CD  . GLU B 1 380 ? -9.745  41.324  116.424 1.00 75.65  ? 401  GLU B CD  1 
ATOM   7046  O OE1 . GLU B 1 380 ? -9.075  42.368  116.242 1.00 75.45  ? 401  GLU B OE1 1 
ATOM   7047  O OE2 . GLU B 1 380 ? -9.554  40.556  117.393 1.00 76.27  ? 401  GLU B OE2 1 
ATOM   7048  N N   . LYS B 1 381 ? -10.369 37.724  113.899 1.00 65.44  ? 402  LYS B N   1 
ATOM   7049  C CA  . LYS B 1 381 ? -10.847 36.424  114.352 1.00 64.24  ? 402  LYS B CA  1 
ATOM   7050  C C   . LYS B 1 381 ? -9.728  35.512  114.860 1.00 64.85  ? 402  LYS B C   1 
ATOM   7051  O O   . LYS B 1 381 ? -9.948  34.720  115.776 1.00 65.17  ? 402  LYS B O   1 
ATOM   7052  C CB  . LYS B 1 381 ? -11.594 35.725  113.214 1.00 62.64  ? 402  LYS B CB  1 
ATOM   7053  C CG  . LYS B 1 381 ? -12.135 34.352  113.562 1.00 60.34  ? 402  LYS B CG  1 
ATOM   7054  C CD  . LYS B 1 381 ? -13.086 34.430  114.734 1.00 60.09  ? 402  LYS B CD  1 
ATOM   7055  C CE  . LYS B 1 381 ? -13.773 33.103  114.973 1.00 59.49  ? 402  LYS B CE  1 
ATOM   7056  N NZ  . LYS B 1 381 ? -14.660 33.172  116.161 1.00 58.81  ? 402  LYS B NZ  1 
ATOM   7057  N N   . TYR B 1 382 ? -8.535  35.631  114.271 1.00 65.08  ? 403  TYR B N   1 
ATOM   7058  C CA  . TYR B 1 382 ? -7.382  34.804  114.653 1.00 64.54  ? 403  TYR B CA  1 
ATOM   7059  C C   . TYR B 1 382 ? -6.415  35.443  115.647 1.00 65.74  ? 403  TYR B C   1 
ATOM   7060  O O   . TYR B 1 382 ? -6.229  34.940  116.753 1.00 64.93  ? 403  TYR B O   1 
ATOM   7061  C CB  . TYR B 1 382 ? -6.591  34.381  113.404 1.00 61.51  ? 403  TYR B CB  1 
ATOM   7062  C CG  . TYR B 1 382 ? -7.169  33.186  112.673 1.00 58.52  ? 403  TYR B CG  1 
ATOM   7063  C CD1 . TYR B 1 382 ? -8.422  33.250  112.063 1.00 56.89  ? 403  TYR B CD1 1 
ATOM   7064  C CD2 . TYR B 1 382 ? -6.471  31.979  112.610 1.00 56.98  ? 403  TYR B CD2 1 
ATOM   7065  C CE1 . TYR B 1 382 ? -8.965  32.141  111.411 1.00 54.01  ? 403  TYR B CE1 1 
ATOM   7066  C CE2 . TYR B 1 382 ? -7.009  30.864  111.961 1.00 53.45  ? 403  TYR B CE2 1 
ATOM   7067  C CZ  . TYR B 1 382 ? -8.254  30.955  111.368 1.00 52.40  ? 403  TYR B CZ  1 
ATOM   7068  O OH  . TYR B 1 382 ? -8.800  29.859  110.749 1.00 49.82  ? 403  TYR B OH  1 
ATOM   7069  N N   . LEU B 1 383 ? -5.796  36.548  115.240 1.00 68.23  ? 404  LEU B N   1 
ATOM   7070  C CA  . LEU B 1 383 ? -4.826  37.252  116.077 1.00 70.69  ? 404  LEU B CA  1 
ATOM   7071  C C   . LEU B 1 383 ? -5.446  38.145  117.155 1.00 72.60  ? 404  LEU B C   1 
ATOM   7072  O O   . LEU B 1 383 ? -4.758  38.984  117.741 1.00 73.03  ? 404  LEU B O   1 
ATOM   7073  C CB  . LEU B 1 383 ? -3.901  38.102  115.197 1.00 70.11  ? 404  LEU B CB  1 
ATOM   7074  C CG  . LEU B 1 383 ? -3.157  37.398  114.060 1.00 69.67  ? 404  LEU B CG  1 
ATOM   7075  C CD1 . LEU B 1 383 ? -2.267  38.394  113.347 1.00 69.19  ? 404  LEU B CD1 1 
ATOM   7076  C CD2 . LEU B 1 383 ? -2.327  36.257  114.613 1.00 70.08  ? 404  LEU B CD2 1 
ATOM   7077  N N   . GLY B 1 384 ? -6.735  37.965  117.420 1.00 74.50  ? 405  GLY B N   1 
ATOM   7078  C CA  . GLY B 1 384 ? -7.395  38.779  118.426 1.00 76.56  ? 405  GLY B CA  1 
ATOM   7079  C C   . GLY B 1 384 ? -7.339  38.201  119.829 1.00 78.22  ? 405  GLY B C   1 
ATOM   7080  O O   . GLY B 1 384 ? -7.774  38.845  120.784 1.00 77.80  ? 405  GLY B O   1 
ATOM   7081  N N   . GLY B 1 385 ? -6.805  36.988  119.951 1.00 80.24  ? 406  GLY B N   1 
ATOM   7082  C CA  . GLY B 1 385 ? -6.704  36.332  121.247 1.00 81.88  ? 406  GLY B CA  1 
ATOM   7083  C C   . GLY B 1 385 ? -6.031  37.183  122.306 1.00 82.57  ? 406  GLY B C   1 
ATOM   7084  O O   . GLY B 1 385 ? -6.710  37.870  123.069 1.00 82.89  ? 406  GLY B O   1 
ATOM   7085  N N   . THR B 1 386 ? -4.701  37.130  122.369 1.00 83.14  ? 407  THR B N   1 
ATOM   7086  C CA  . THR B 1 386 ? -3.953  37.926  123.339 1.00 84.15  ? 407  THR B CA  1 
ATOM   7087  C C   . THR B 1 386 ? -3.189  39.016  122.604 1.00 84.73  ? 407  THR B C   1 
ATOM   7088  O O   . THR B 1 386 ? -3.326  39.175  121.390 1.00 84.61  ? 407  THR B O   1 
ATOM   7089  C CB  . THR B 1 386 ? -2.928  37.086  124.137 1.00 84.16  ? 407  THR B CB  1 
ATOM   7090  O OG1 . THR B 1 386 ? -1.872  36.663  123.264 1.00 83.84  ? 407  THR B OG1 1 
ATOM   7091  C CG2 . THR B 1 386 ? -3.602  35.873  124.771 1.00 83.68  ? 407  THR B CG2 1 
ATOM   7092  N N   . ASP B 1 387 ? -2.376  39.759  123.345 1.00 85.46  ? 408  ASP B N   1 
ATOM   7093  C CA  . ASP B 1 387 ? -1.597  40.841  122.764 1.00 86.82  ? 408  ASP B CA  1 
ATOM   7094  C C   . ASP B 1 387 ? -0.171  40.388  122.463 1.00 87.47  ? 408  ASP B C   1 
ATOM   7095  O O   . ASP B 1 387 ? 0.596   41.099  121.806 1.00 87.44  ? 408  ASP B O   1 
ATOM   7096  C CB  . ASP B 1 387 ? -1.586  42.030  123.722 1.00 87.49  ? 408  ASP B CB  1 
ATOM   7097  C CG  . ASP B 1 387 ? -2.983  42.440  124.152 1.00 88.64  ? 408  ASP B CG  1 
ATOM   7098  O OD1 . ASP B 1 387 ? -3.805  42.779  123.273 1.00 88.89  ? 408  ASP B OD1 1 
ATOM   7099  O OD2 . ASP B 1 387 ? -3.262  42.419  125.369 1.00 89.55  ? 408  ASP B OD2 1 
ATOM   7100  N N   . ASP B 1 388 ? 0.166   39.193  122.942 1.00 87.66  ? 409  ASP B N   1 
ATOM   7101  C CA  . ASP B 1 388 ? 1.490   38.603  122.750 1.00 87.32  ? 409  ASP B CA  1 
ATOM   7102  C C   . ASP B 1 388 ? 1.934   38.651  121.285 1.00 86.70  ? 409  ASP B C   1 
ATOM   7103  O O   . ASP B 1 388 ? 1.341   37.988  120.432 1.00 86.87  ? 409  ASP B O   1 
ATOM   7104  C CB  . ASP B 1 388 ? 1.468   37.147  123.220 1.00 87.62  ? 409  ASP B CB  1 
ATOM   7105  C CG  . ASP B 1 388 ? 2.852   36.536  123.299 1.00 88.02  ? 409  ASP B CG  1 
ATOM   7106  O OD1 . ASP B 1 388 ? 3.716   36.896  122.473 1.00 88.57  ? 409  ASP B OD1 1 
ATOM   7107  O OD2 . ASP B 1 388 ? 3.071   35.681  124.183 1.00 88.22  ? 409  ASP B OD2 1 
ATOM   7108  N N   . THR B 1 389 ? 2.979   39.423  120.994 1.00 85.40  ? 410  THR B N   1 
ATOM   7109  C CA  . THR B 1 389 ? 3.476   39.523  119.625 1.00 84.10  ? 410  THR B CA  1 
ATOM   7110  C C   . THR B 1 389 ? 3.921   38.156  119.102 1.00 83.34  ? 410  THR B C   1 
ATOM   7111  O O   . THR B 1 389 ? 3.869   37.900  117.896 1.00 83.78  ? 410  THR B O   1 
ATOM   7112  C CB  . THR B 1 389 ? 4.664   40.512  119.515 1.00 83.77  ? 410  THR B CB  1 
ATOM   7113  O OG1 . THR B 1 389 ? 5.659   40.185  120.493 1.00 83.91  ? 410  THR B OG1 1 
ATOM   7114  C CG2 . THR B 1 389 ? 4.193   41.937  119.729 1.00 83.65  ? 410  THR B CG2 1 
ATOM   7115  N N   . VAL B 1 390 ? 4.355   37.283  120.010 1.00 81.71  ? 411  VAL B N   1 
ATOM   7116  C CA  . VAL B 1 390 ? 4.800   35.941  119.639 1.00 79.41  ? 411  VAL B CA  1 
ATOM   7117  C C   . VAL B 1 390 ? 3.596   35.027  119.416 1.00 78.65  ? 411  VAL B C   1 
ATOM   7118  O O   . VAL B 1 390 ? 3.529   34.313  118.417 1.00 79.12  ? 411  VAL B O   1 
ATOM   7119  C CB  . VAL B 1 390 ? 5.705   35.324  120.723 1.00 78.43  ? 411  VAL B CB  1 
ATOM   7120  C CG1 . VAL B 1 390 ? 6.173   33.951  120.283 1.00 77.82  ? 411  VAL B CG1 1 
ATOM   7121  C CG2 . VAL B 1 390 ? 6.894   36.230  120.985 1.00 77.50  ? 411  VAL B CG2 1 
ATOM   7122  N N   . LYS B 1 391 ? 2.647   35.046  120.348 1.00 77.01  ? 412  LYS B N   1 
ATOM   7123  C CA  . LYS B 1 391 ? 1.450   34.227  120.205 1.00 75.60  ? 412  LYS B CA  1 
ATOM   7124  C C   . LYS B 1 391 ? 0.789   34.577  118.881 1.00 74.53  ? 412  LYS B C   1 
ATOM   7125  O O   . LYS B 1 391 ? 0.111   33.749  118.280 1.00 75.12  ? 412  LYS B O   1 
ATOM   7126  C CB  . LYS B 1 391 ? 0.450   34.510  121.326 1.00 76.51  ? 412  LYS B CB  1 
ATOM   7127  C CG  . LYS B 1 391 ? 0.773   33.917  122.683 1.00 77.34  ? 412  LYS B CG  1 
ATOM   7128  C CD  . LYS B 1 391 ? -0.381  34.212  123.632 1.00 78.55  ? 412  LYS B CD  1 
ATOM   7129  C CE  . LYS B 1 391 ? -0.161  33.654  125.026 1.00 79.71  ? 412  LYS B CE  1 
ATOM   7130  N NZ  . LYS B 1 391 ? -1.314  33.974  125.923 1.00 79.84  ? 412  LYS B NZ  1 
ATOM   7131  N N   . LYS B 1 392 ? 0.984   35.815  118.438 1.00 73.24  ? 413  LYS B N   1 
ATOM   7132  C CA  . LYS B 1 392 ? 0.397   36.286  117.189 1.00 71.93  ? 413  LYS B CA  1 
ATOM   7133  C C   . LYS B 1 392 ? 0.990   35.592  115.969 1.00 70.92  ? 413  LYS B C   1 
ATOM   7134  O O   . LYS B 1 392 ? 0.261   34.991  115.179 1.00 71.29  ? 413  LYS B O   1 
ATOM   7135  C CB  . LYS B 1 392 ? 0.568   37.802  117.061 1.00 72.53  ? 413  LYS B CB  1 
ATOM   7136  C CG  . LYS B 1 392 ? -0.248  38.601  118.071 1.00 73.09  ? 413  LYS B CG  1 
ATOM   7137  C CD  . LYS B 1 392 ? -0.057  40.102  117.895 1.00 73.84  ? 413  LYS B CD  1 
ATOM   7138  C CE  . LYS B 1 392 ? -0.896  40.885  118.897 1.00 73.68  ? 413  LYS B CE  1 
ATOM   7139  N NZ  . LYS B 1 392 ? -2.349  40.575  118.773 1.00 72.79  ? 413  LYS B NZ  1 
ATOM   7140  N N   . LYS B 1 393 ? 2.309   35.676  115.810 1.00 69.32  ? 414  LYS B N   1 
ATOM   7141  C CA  . LYS B 1 393 ? 2.973   35.035  114.679 1.00 67.55  ? 414  LYS B CA  1 
ATOM   7142  C C   . LYS B 1 393 ? 2.380   33.646  114.472 1.00 65.58  ? 414  LYS B C   1 
ATOM   7143  O O   . LYS B 1 393 ? 1.951   33.292  113.376 1.00 65.15  ? 414  LYS B O   1 
ATOM   7144  C CB  . LYS B 1 393 ? 4.481   34.910  114.941 1.00 68.07  ? 414  LYS B CB  1 
ATOM   7145  C CG  . LYS B 1 393 ? 5.226   34.038  113.926 1.00 68.72  ? 414  LYS B CG  1 
ATOM   7146  C CD  . LYS B 1 393 ? 6.689   33.820  114.319 1.00 69.56  ? 414  LYS B CD  1 
ATOM   7147  C CE  . LYS B 1 393 ? 7.372   32.768  113.436 1.00 69.68  ? 414  LYS B CE  1 
ATOM   7148  N NZ  . LYS B 1 393 ? 8.784   32.484  113.844 1.00 68.19  ? 414  LYS B NZ  1 
ATOM   7149  N N   . ASP B 1 394 ? 2.346   32.880  115.555 1.00 63.71  ? 415  ASP B N   1 
ATOM   7150  C CA  . ASP B 1 394 ? 1.834   31.517  115.548 1.00 61.60  ? 415  ASP B CA  1 
ATOM   7151  C C   . ASP B 1 394 ? 0.396   31.385  115.060 1.00 59.27  ? 415  ASP B C   1 
ATOM   7152  O O   . ASP B 1 394 ? 0.091   30.510  114.251 1.00 59.90  ? 415  ASP B O   1 
ATOM   7153  C CB  . ASP B 1 394 ? 1.967   30.928  116.949 1.00 62.55  ? 415  ASP B CB  1 
ATOM   7154  C CG  . ASP B 1 394 ? 3.349   31.148  117.533 1.00 63.11  ? 415  ASP B CG  1 
ATOM   7155  O OD1 . ASP B 1 394 ? 4.334   30.733  116.887 1.00 63.35  ? 415  ASP B OD1 1 
ATOM   7156  O OD2 . ASP B 1 394 ? 3.452   31.739  118.629 1.00 64.26  ? 415  ASP B OD2 1 
ATOM   7157  N N   . LEU B 1 395 ? -0.491  32.239  115.554 1.00 56.61  ? 416  LEU B N   1 
ATOM   7158  C CA  . LEU B 1 395 ? -1.882  32.183  115.127 1.00 54.33  ? 416  LEU B CA  1 
ATOM   7159  C C   . LEU B 1 395 ? -1.974  32.568  113.664 1.00 52.66  ? 416  LEU B C   1 
ATOM   7160  O O   . LEU B 1 395 ? -2.837  32.080  112.942 1.00 53.18  ? 416  LEU B O   1 
ATOM   7161  C CB  . LEU B 1 395 ? -2.747  33.119  115.972 1.00 54.18  ? 416  LEU B CB  1 
ATOM   7162  C CG  . LEU B 1 395 ? -3.231  32.544  117.304 1.00 52.74  ? 416  LEU B CG  1 
ATOM   7163  C CD1 . LEU B 1 395 ? -3.730  33.660  118.195 1.00 53.74  ? 416  LEU B CD1 1 
ATOM   7164  C CD2 . LEU B 1 395 ? -4.327  31.525  117.046 1.00 51.03  ? 416  LEU B CD2 1 
ATOM   7165  N N   . PHE B 1 396 ? -1.075  33.444  113.231 1.00 51.00  ? 417  PHE B N   1 
ATOM   7166  C CA  . PHE B 1 396 ? -1.051  33.885  111.844 1.00 49.96  ? 417  PHE B CA  1 
ATOM   7167  C C   . PHE B 1 396 ? -0.737  32.686  110.945 1.00 48.80  ? 417  PHE B C   1 
ATOM   7168  O O   . PHE B 1 396 ? -1.350  32.501  109.890 1.00 47.70  ? 417  PHE B O   1 
ATOM   7169  C CB  . PHE B 1 396 ? 0.007   34.976  111.665 1.00 51.31  ? 417  PHE B CB  1 
ATOM   7170  C CG  . PHE B 1 396 ? 0.030   35.580  110.289 1.00 52.58  ? 417  PHE B CG  1 
ATOM   7171  C CD1 . PHE B 1 396 ? -1.109  36.174  109.755 1.00 52.49  ? 417  PHE B CD1 1 
ATOM   7172  C CD2 . PHE B 1 396 ? 1.196   35.565  109.529 1.00 53.20  ? 417  PHE B CD2 1 
ATOM   7173  C CE1 . PHE B 1 396 ? -1.090  36.745  108.485 1.00 53.02  ? 417  PHE B CE1 1 
ATOM   7174  C CE2 . PHE B 1 396 ? 1.230   36.134  108.256 1.00 53.82  ? 417  PHE B CE2 1 
ATOM   7175  C CZ  . PHE B 1 396 ? 0.084   36.725  107.733 1.00 54.09  ? 417  PHE B CZ  1 
ATOM   7176  N N   . LEU B 1 397 ? 0.224   31.873  111.377 1.00 47.31  ? 418  LEU B N   1 
ATOM   7177  C CA  . LEU B 1 397 ? 0.613   30.685  110.634 1.00 45.58  ? 418  LEU B CA  1 
ATOM   7178  C C   . LEU B 1 397 ? -0.569  29.726  110.594 1.00 45.85  ? 418  LEU B C   1 
ATOM   7179  O O   . LEU B 1 397 ? -0.747  28.983  109.629 1.00 46.84  ? 418  LEU B O   1 
ATOM   7180  C CB  . LEU B 1 397 ? 1.816   30.018  111.298 1.00 44.73  ? 418  LEU B CB  1 
ATOM   7181  C CG  . LEU B 1 397 ? 3.093   30.861  111.358 1.00 44.62  ? 418  LEU B CG  1 
ATOM   7182  C CD1 . LEU B 1 397 ? 4.189   30.071  112.061 1.00 43.95  ? 418  LEU B CD1 1 
ATOM   7183  C CD2 . LEU B 1 397 ? 3.530   31.253  109.949 1.00 42.92  ? 418  LEU B CD2 1 
ATOM   7184  N N   . ASP B 1 398 ? -1.374  29.738  111.650 1.00 45.14  ? 419  ASP B N   1 
ATOM   7185  C CA  . ASP B 1 398 ? -2.553  28.890  111.691 1.00 45.40  ? 419  ASP B CA  1 
ATOM   7186  C C   . ASP B 1 398 ? -3.534  29.466  110.677 1.00 44.68  ? 419  ASP B C   1 
ATOM   7187  O O   . ASP B 1 398 ? -4.140  28.740  109.884 1.00 45.46  ? 419  ASP B O   1 
ATOM   7188  C CB  . ASP B 1 398 ? -3.186  28.918  113.081 1.00 48.24  ? 419  ASP B CB  1 
ATOM   7189  C CG  . ASP B 1 398 ? -2.314  28.276  114.129 1.00 50.34  ? 419  ASP B CG  1 
ATOM   7190  O OD1 . ASP B 1 398 ? -2.024  27.069  114.005 1.00 52.59  ? 419  ASP B OD1 1 
ATOM   7191  O OD2 . ASP B 1 398 ? -1.916  28.976  115.080 1.00 52.63  ? 419  ASP B OD2 1 
ATOM   7192  N N   . LEU B 1 399 ? -3.679  30.785  110.719 1.00 42.76  ? 420  LEU B N   1 
ATOM   7193  C CA  . LEU B 1 399 ? -4.565  31.498  109.814 1.00 40.91  ? 420  LEU B CA  1 
ATOM   7194  C C   . LEU B 1 399 ? -4.357  30.934  108.413 1.00 40.52  ? 420  LEU B C   1 
ATOM   7195  O O   . LEU B 1 399 ? -5.277  30.381  107.806 1.00 39.43  ? 420  LEU B O   1 
ATOM   7196  C CB  . LEU B 1 399 ? -4.227  32.994  109.847 1.00 39.06  ? 420  LEU B CB  1 
ATOM   7197  C CG  . LEU B 1 399 ? -5.091  34.014  109.101 1.00 37.59  ? 420  LEU B CG  1 
ATOM   7198  C CD1 . LEU B 1 399 ? -5.005  33.820  107.594 1.00 37.61  ? 420  LEU B CD1 1 
ATOM   7199  C CD2 . LEU B 1 399 ? -6.511  33.873  109.569 1.00 38.16  ? 420  LEU B CD2 1 
ATOM   7200  N N   . ILE B 1 400 ? -3.128  31.061  107.921 1.00 39.90  ? 421  ILE B N   1 
ATOM   7201  C CA  . ILE B 1 400 ? -2.765  30.584  106.594 1.00 39.80  ? 421  ILE B CA  1 
ATOM   7202  C C   . ILE B 1 400 ? -2.914  29.078  106.452 1.00 39.34  ? 421  ILE B C   1 
ATOM   7203  O O   . ILE B 1 400 ? -3.443  28.589  105.454 1.00 39.43  ? 421  ILE B O   1 
ATOM   7204  C CB  . ILE B 1 400 ? -1.317  30.969  106.259 1.00 40.80  ? 421  ILE B CB  1 
ATOM   7205  C CG1 . ILE B 1 400 ? -1.193  32.490  106.209 1.00 41.77  ? 421  ILE B CG1 1 
ATOM   7206  C CG2 . ILE B 1 400 ? -0.898  30.352  104.933 1.00 40.26  ? 421  ILE B CG2 1 
ATOM   7207  C CD1 . ILE B 1 400 ? 0.201   32.969  105.895 1.00 44.01  ? 421  ILE B CD1 1 
ATOM   7208  N N   . ALA B 1 401 ? -2.442  28.345  107.451 1.00 38.50  ? 422  ALA B N   1 
ATOM   7209  C CA  . ALA B 1 401 ? -2.519  26.893  107.427 1.00 38.77  ? 422  ALA B CA  1 
ATOM   7210  C C   . ALA B 1 401 ? -3.957  26.379  107.275 1.00 38.71  ? 422  ALA B C   1 
ATOM   7211  O O   . ALA B 1 401 ? -4.184  25.252  106.819 1.00 39.15  ? 422  ALA B O   1 
ATOM   7212  C CB  . ALA B 1 401 ? -1.890  26.329  108.691 1.00 39.94  ? 422  ALA B CB  1 
ATOM   7213  N N   . ASP B 1 402 ? -4.930  27.200  107.657 1.00 37.38  ? 423  ASP B N   1 
ATOM   7214  C CA  . ASP B 1 402 ? -6.324  26.797  107.546 1.00 36.19  ? 423  ASP B CA  1 
ATOM   7215  C C   . ASP B 1 402 ? -6.886  27.114  106.174 1.00 34.74  ? 423  ASP B C   1 
ATOM   7216  O O   . ASP B 1 402 ? -7.752  26.407  105.664 1.00 34.11  ? 423  ASP B O   1 
ATOM   7217  C CB  . ASP B 1 402 ? -7.156  27.493  108.616 1.00 37.60  ? 423  ASP B CB  1 
ATOM   7218  C CG  . ASP B 1 402 ? -6.917  26.921  109.994 1.00 38.31  ? 423  ASP B CG  1 
ATOM   7219  O OD1 . ASP B 1 402 ? -7.325  25.768  110.250 1.00 38.72  ? 423  ASP B OD1 1 
ATOM   7220  O OD2 . ASP B 1 402 ? -6.312  27.626  110.820 1.00 40.99  ? 423  ASP B OD2 1 
ATOM   7221  N N   . VAL B 1 403 ? -6.382  28.183  105.576 1.00 34.37  ? 424  VAL B N   1 
ATOM   7222  C CA  . VAL B 1 403 ? -6.833  28.598  104.260 1.00 33.81  ? 424  VAL B CA  1 
ATOM   7223  C C   . VAL B 1 403 ? -6.332  27.680  103.150 1.00 33.01  ? 424  VAL B C   1 
ATOM   7224  O O   . VAL B 1 403 ? -7.106  27.262  102.295 1.00 32.01  ? 424  VAL B O   1 
ATOM   7225  C CB  . VAL B 1 403 ? -6.386  30.036  103.969 1.00 34.20  ? 424  VAL B CB  1 
ATOM   7226  C CG1 . VAL B 1 403 ? -6.651  30.386  102.509 1.00 35.42  ? 424  VAL B CG1 1 
ATOM   7227  C CG2 . VAL B 1 403 ? -7.135  30.989  104.885 1.00 34.56  ? 424  VAL B CG2 1 
ATOM   7228  N N   . MET B 1 404 ? -5.043  27.357  103.169 1.00 32.49  ? 425  MET B N   1 
ATOM   7229  C CA  . MET B 1 404 ? -4.471  26.500  102.138 1.00 31.55  ? 425  MET B CA  1 
ATOM   7230  C C   . MET B 1 404 ? -4.786  25.027  102.283 1.00 30.34  ? 425  MET B C   1 
ATOM   7231  O O   . MET B 1 404 ? -5.040  24.346  101.292 1.00 31.19  ? 425  MET B O   1 
ATOM   7232  C CB  . MET B 1 404 ? -2.954  26.656  102.084 1.00 31.23  ? 425  MET B CB  1 
ATOM   7233  C CG  . MET B 1 404 ? -2.493  28.049  101.753 1.00 33.14  ? 425  MET B CG  1 
ATOM   7234  S SD  . MET B 1 404 ? -0.734  28.078  101.420 1.00 35.94  ? 425  MET B SD  1 
ATOM   7235  C CE  . MET B 1 404 ? -0.080  27.712  103.025 1.00 36.36  ? 425  MET B CE  1 
ATOM   7236  N N   . PHE B 1 405 ? -4.779  24.524  103.509 1.00 29.38  ? 426  PHE B N   1 
ATOM   7237  C CA  . PHE B 1 405 ? -5.025  23.104  103.693 1.00 30.12  ? 426  PHE B CA  1 
ATOM   7238  C C   . PHE B 1 405 ? -6.235  22.729  104.543 1.00 30.52  ? 426  PHE B C   1 
ATOM   7239  O O   . PHE B 1 405 ? -7.039  21.875  104.148 1.00 29.42  ? 426  PHE B O   1 
ATOM   7240  C CB  . PHE B 1 405 ? -3.765  22.442  104.267 1.00 28.47  ? 426  PHE B CB  1 
ATOM   7241  C CG  . PHE B 1 405 ? -2.481  22.893  103.604 1.00 27.11  ? 426  PHE B CG  1 
ATOM   7242  C CD1 . PHE B 1 405 ? -1.791  24.008  104.075 1.00 25.55  ? 426  PHE B CD1 1 
ATOM   7243  C CD2 . PHE B 1 405 ? -1.953  22.193  102.522 1.00 25.85  ? 426  PHE B CD2 1 
ATOM   7244  C CE1 . PHE B 1 405 ? -0.598  24.414  103.484 1.00 23.51  ? 426  PHE B CE1 1 
ATOM   7245  C CE2 . PHE B 1 405 ? -0.758  22.597  101.923 1.00 23.87  ? 426  PHE B CE2 1 
ATOM   7246  C CZ  . PHE B 1 405 ? -0.082  23.708  102.409 1.00 23.37  ? 426  PHE B CZ  1 
ATOM   7247  N N   . GLY B 1 406 ? -6.362  23.365  105.705 1.00 31.49  ? 427  GLY B N   1 
ATOM   7248  C CA  . GLY B 1 406 ? -7.465  23.062  106.604 1.00 31.24  ? 427  GLY B CA  1 
ATOM   7249  C C   . GLY B 1 406 ? -8.867  23.037  106.009 1.00 30.06  ? 427  GLY B C   1 
ATOM   7250  O O   . GLY B 1 406 ? -9.436  21.972  105.751 1.00 30.25  ? 427  GLY B O   1 
ATOM   7251  N N   . VAL B 1 407 ? -9.425  24.220  105.794 1.00 28.88  ? 428  VAL B N   1 
ATOM   7252  C CA  . VAL B 1 407 ? -10.768 24.349  105.263 1.00 27.84  ? 428  VAL B CA  1 
ATOM   7253  C C   . VAL B 1 407 ? -11.013 23.538  103.980 1.00 26.91  ? 428  VAL B C   1 
ATOM   7254  O O   . VAL B 1 407 ? -11.929 22.711  103.931 1.00 26.63  ? 428  VAL B O   1 
ATOM   7255  C CB  . VAL B 1 407 ? -11.107 25.848  105.052 1.00 28.62  ? 428  VAL B CB  1 
ATOM   7256  C CG1 . VAL B 1 407 ? -12.598 26.016  104.754 1.00 29.90  ? 428  VAL B CG1 1 
ATOM   7257  C CG2 . VAL B 1 407 ? -10.719 26.642  106.299 1.00 25.41  ? 428  VAL B CG2 1 
ATOM   7258  N N   . PRO B 1 408 ? -10.192 23.749  102.933 1.00 26.03  ? 429  PRO B N   1 
ATOM   7259  C CA  . PRO B 1 408 ? -10.355 23.015  101.672 1.00 25.06  ? 429  PRO B CA  1 
ATOM   7260  C C   . PRO B 1 408 ? -10.536 21.520  101.900 1.00 25.33  ? 429  PRO B C   1 
ATOM   7261  O O   . PRO B 1 408 ? -11.523 20.927  101.451 1.00 24.81  ? 429  PRO B O   1 
ATOM   7262  C CB  . PRO B 1 408 ? -9.054  23.306  100.933 1.00 24.60  ? 429  PRO B CB  1 
ATOM   7263  C CG  . PRO B 1 408 ? -8.718  24.669  101.386 1.00 26.33  ? 429  PRO B CG  1 
ATOM   7264  C CD  . PRO B 1 408 ? -8.997  24.607  102.878 1.00 26.59  ? 429  PRO B CD  1 
ATOM   7265  N N   . SER B 1 409 ? -9.570  20.929  102.608 1.00 24.39  ? 430  SER B N   1 
ATOM   7266  C CA  . SER B 1 409 ? -9.569  19.503  102.913 1.00 23.85  ? 430  SER B CA  1 
ATOM   7267  C C   . SER B 1 409 ? -10.860 18.995  103.527 1.00 23.67  ? 430  SER B C   1 
ATOM   7268  O O   . SER B 1 409 ? -11.466 18.061  103.001 1.00 24.37  ? 430  SER B O   1 
ATOM   7269  C CB  . SER B 1 409 ? -8.408  19.155  103.846 1.00 25.40  ? 430  SER B CB  1 
ATOM   7270  O OG  . SER B 1 409 ? -7.177  19.075  103.149 1.00 26.28  ? 430  SER B OG  1 
ATOM   7271  N N   . VAL B 1 410 ? -11.276 19.593  104.640 1.00 22.08  ? 431  VAL B N   1 
ATOM   7272  C CA  . VAL B 1 410 ? -12.501 19.162  105.301 1.00 22.62  ? 431  VAL B CA  1 
ATOM   7273  C C   . VAL B 1 410 ? -13.697 19.292  104.363 1.00 22.29  ? 431  VAL B C   1 
ATOM   7274  O O   . VAL B 1 410 ? -14.562 18.411  104.314 1.00 18.94  ? 431  VAL B O   1 
ATOM   7275  C CB  . VAL B 1 410 ? -12.762 19.982  106.589 1.00 24.51  ? 431  VAL B CB  1 
ATOM   7276  C CG1 . VAL B 1 410 ? -14.184 19.736  107.101 1.00 22.90  ? 431  VAL B CG1 1 
ATOM   7277  C CG2 . VAL B 1 410 ? -11.749 19.590  107.660 1.00 24.48  ? 431  VAL B CG2 1 
ATOM   7278  N N   . ILE B 1 411 ? -13.741 20.396  103.620 1.00 23.50  ? 432  ILE B N   1 
ATOM   7279  C CA  . ILE B 1 411 ? -14.827 20.631  102.676 1.00 23.98  ? 432  ILE B CA  1 
ATOM   7280  C C   . ILE B 1 411 ? -14.880 19.476  101.687 1.00 26.10  ? 432  ILE B C   1 
ATOM   7281  O O   . ILE B 1 411 ? -15.917 18.822  101.540 1.00 26.91  ? 432  ILE B O   1 
ATOM   7282  C CB  . ILE B 1 411 ? -14.636 21.959  101.904 1.00 21.65  ? 432  ILE B CB  1 
ATOM   7283  C CG1 . ILE B 1 411 ? -14.818 23.140  102.866 1.00 21.00  ? 432  ILE B CG1 1 
ATOM   7284  C CG2 . ILE B 1 411 ? -15.616 22.033  100.740 1.00 19.33  ? 432  ILE B CG2 1 
ATOM   7285  C CD1 . ILE B 1 411 ? -14.638 24.511  102.254 1.00 17.51  ? 432  ILE B CD1 1 
ATOM   7286  N N   . VAL B 1 412 ? -13.755 19.218  101.022 1.00 27.09  ? 433  VAL B N   1 
ATOM   7287  C CA  . VAL B 1 412 ? -13.677 18.129  100.053 1.00 27.26  ? 433  VAL B CA  1 
ATOM   7288  C C   . VAL B 1 412 ? -14.219 16.831  100.640 1.00 27.16  ? 433  VAL B C   1 
ATOM   7289  O O   . VAL B 1 412 ? -15.037 16.152  100.020 1.00 26.22  ? 433  VAL B O   1 
ATOM   7290  C CB  . VAL B 1 412 ? -12.233 17.890  99.603  1.00 27.00  ? 433  VAL B CB  1 
ATOM   7291  C CG1 . VAL B 1 412 ? -12.172 16.679  98.674  1.00 26.56  ? 433  VAL B CG1 1 
ATOM   7292  C CG2 . VAL B 1 412 ? -11.699 19.137  98.914  1.00 25.69  ? 433  VAL B CG2 1 
ATOM   7293  N N   . ALA B 1 413 ? -13.755 16.497  101.840 1.00 28.51  ? 434  ALA B N   1 
ATOM   7294  C CA  . ALA B 1 413 ? -14.189 15.280  102.519 1.00 29.15  ? 434  ALA B CA  1 
ATOM   7295  C C   . ALA B 1 413 ? -15.697 15.280  102.716 1.00 29.25  ? 434  ALA B C   1 
ATOM   7296  O O   . ALA B 1 413 ? -16.359 14.262  102.498 1.00 29.83  ? 434  ALA B O   1 
ATOM   7297  C CB  . ALA B 1 413 ? -13.488 15.149  103.862 1.00 29.03  ? 434  ALA B CB  1 
ATOM   7298  N N   . ARG B 1 414 ? -16.239 16.421  103.134 1.00 29.33  ? 435  ARG B N   1 
ATOM   7299  C CA  . ARG B 1 414 ? -17.677 16.536  103.340 1.00 28.82  ? 435  ARG B CA  1 
ATOM   7300  C C   . ARG B 1 414 ? -18.427 16.216  102.057 1.00 29.37  ? 435  ARG B C   1 
ATOM   7301  O O   . ARG B 1 414 ? -19.269 15.316  102.035 1.00 28.86  ? 435  ARG B O   1 
ATOM   7302  C CB  . ARG B 1 414 ? -18.036 17.940  103.818 1.00 27.54  ? 435  ARG B CB  1 
ATOM   7303  C CG  . ARG B 1 414 ? -17.722 18.161  105.282 1.00 27.37  ? 435  ARG B CG  1 
ATOM   7304  C CD  . ARG B 1 414 ? -18.132 19.545  105.740 1.00 26.06  ? 435  ARG B CD  1 
ATOM   7305  N NE  . ARG B 1 414 ? -18.110 19.658  107.193 1.00 23.90  ? 435  ARG B NE  1 
ATOM   7306  C CZ  . ARG B 1 414 ? -18.041 20.811  107.843 1.00 23.77  ? 435  ARG B CZ  1 
ATOM   7307  N NH1 . ARG B 1 414 ? -17.985 21.946  107.165 1.00 23.83  ? 435  ARG B NH1 1 
ATOM   7308  N NH2 . ARG B 1 414 ? -18.021 20.827  109.167 1.00 23.93  ? 435  ARG B NH2 1 
ATOM   7309  N N   . ASN B 1 415 ? -18.110 16.944  100.988 1.00 30.09  ? 436  ASN B N   1 
ATOM   7310  C CA  . ASN B 1 415 ? -18.758 16.722  99.697  1.00 30.89  ? 436  ASN B CA  1 
ATOM   7311  C C   . ASN B 1 415 ? -18.653 15.260  99.266  1.00 30.68  ? 436  ASN B C   1 
ATOM   7312  O O   . ASN B 1 415 ? -19.641 14.655  98.849  1.00 31.09  ? 436  ASN B O   1 
ATOM   7313  C CB  . ASN B 1 415 ? -18.137 17.615  98.618  1.00 31.40  ? 436  ASN B CB  1 
ATOM   7314  C CG  . ASN B 1 415 ? -18.183 19.086  98.982  1.00 32.70  ? 436  ASN B CG  1 
ATOM   7315  O OD1 . ASN B 1 415 ? -17.371 19.568  99.770  1.00 32.68  ? 436  ASN B OD1 1 
ATOM   7316  N ND2 . ASN B 1 415 ? -19.147 19.807  98.416  1.00 33.17  ? 436  ASN B ND2 1 
ATOM   7317  N N   . HIS B 1 416 ? -17.455 14.695  99.366  1.00 29.50  ? 437  HIS B N   1 
ATOM   7318  C CA  . HIS B 1 416 ? -17.259 13.311  98.983  1.00 29.01  ? 437  HIS B CA  1 
ATOM   7319  C C   . HIS B 1 416 ? -18.178 12.429  99.808  1.00 30.13  ? 437  HIS B C   1 
ATOM   7320  O O   . HIS B 1 416 ? -18.739 11.451  99.311  1.00 30.89  ? 437  HIS B O   1 
ATOM   7321  C CB  . HIS B 1 416 ? -15.819 12.889  99.216  1.00 28.18  ? 437  HIS B CB  1 
ATOM   7322  C CG  . HIS B 1 416 ? -15.491 11.562  98.617  1.00 28.59  ? 437  HIS B CG  1 
ATOM   7323  N ND1 . HIS B 1 416 ? -15.507 11.338  97.258  1.00 29.69  ? 437  HIS B ND1 1 
ATOM   7324  C CD2 . HIS B 1 416 ? -15.170 10.378  99.190  1.00 29.09  ? 437  HIS B CD2 1 
ATOM   7325  C CE1 . HIS B 1 416 ? -15.210 10.074  97.017  1.00 30.54  ? 437  HIS B CE1 1 
ATOM   7326  N NE2 . HIS B 1 416 ? -15.001 9.470   98.174  1.00 30.76  ? 437  HIS B NE2 1 
ATOM   7327  N N   . ARG B 1 417 ? -18.309 12.777  101.082 1.00 30.94  ? 438  ARG B N   1 
ATOM   7328  C CA  . ARG B 1 417 ? -19.171 12.049  101.996 1.00 31.49  ? 438  ARG B CA  1 
ATOM   7329  C C   . ARG B 1 417 ? -20.594 12.150  101.465 1.00 31.25  ? 438  ARG B C   1 
ATOM   7330  O O   . ARG B 1 417 ? -21.243 11.141  101.183 1.00 29.53  ? 438  ARG B O   1 
ATOM   7331  C CB  . ARG B 1 417 ? -19.098 12.682  103.389 1.00 33.00  ? 438  ARG B CB  1 
ATOM   7332  C CG  . ARG B 1 417 ? -20.135 12.153  104.384 1.00 34.96  ? 438  ARG B CG  1 
ATOM   7333  C CD  . ARG B 1 417 ? -20.229 13.049  105.615 1.00 34.43  ? 438  ARG B CD  1 
ATOM   7334  N NE  . ARG B 1 417 ? -20.706 14.384  105.277 1.00 34.49  ? 438  ARG B NE  1 
ATOM   7335  C CZ  . ARG B 1 417 ? -20.526 15.460  106.039 1.00 36.33  ? 438  ARG B CZ  1 
ATOM   7336  N NH1 . ARG B 1 417 ? -19.875 15.370  107.195 1.00 35.84  ? 438  ARG B NH1 1 
ATOM   7337  N NH2 . ARG B 1 417 ? -20.997 16.634  105.641 1.00 38.10  ? 438  ARG B NH2 1 
ATOM   7338  N N   . ASP B 1 418 ? -21.063 13.387  101.325 1.00 31.65  ? 439  ASP B N   1 
ATOM   7339  C CA  . ASP B 1 418 ? -22.404 13.653  100.838 1.00 33.38  ? 439  ASP B CA  1 
ATOM   7340  C C   . ASP B 1 418 ? -22.652 12.996  99.487  1.00 33.50  ? 439  ASP B C   1 
ATOM   7341  O O   . ASP B 1 418 ? -23.781 12.632  99.163  1.00 34.09  ? 439  ASP B O   1 
ATOM   7342  C CB  . ASP B 1 418 ? -22.639 15.161  100.744 1.00 35.75  ? 439  ASP B CB  1 
ATOM   7343  C CG  . ASP B 1 418 ? -22.541 15.857  102.099 1.00 39.34  ? 439  ASP B CG  1 
ATOM   7344  O OD1 . ASP B 1 418 ? -22.809 15.202  103.133 1.00 40.02  ? 439  ASP B OD1 1 
ATOM   7345  O OD2 . ASP B 1 418 ? -22.212 17.067  102.131 1.00 41.12  ? 439  ASP B OD2 1 
ATOM   7346  N N   . ALA B 1 419 ? -21.593 12.840  98.702  1.00 33.59  ? 440  ALA B N   1 
ATOM   7347  C CA  . ALA B 1 419 ? -21.699 12.204  97.395  1.00 32.72  ? 440  ALA B CA  1 
ATOM   7348  C C   . ALA B 1 419 ? -22.066 10.726  97.564  1.00 32.53  ? 440  ALA B C   1 
ATOM   7349  O O   . ALA B 1 419 ? -22.369 10.037  96.588  1.00 33.10  ? 440  ALA B O   1 
ATOM   7350  C CB  . ALA B 1 419 ? -20.379 12.335  96.644  1.00 32.34  ? 440  ALA B CB  1 
ATOM   7351  N N   . GLY B 1 420 ? -22.027 10.243  98.805  1.00 31.16  ? 441  GLY B N   1 
ATOM   7352  C CA  . GLY B 1 420 ? -22.367 8.858   99.076  1.00 30.09  ? 441  GLY B CA  1 
ATOM   7353  C C   . GLY B 1 420 ? -21.184 7.908   99.087  1.00 29.97  ? 441  GLY B C   1 
ATOM   7354  O O   . GLY B 1 420 ? -21.347 6.699   99.285  1.00 29.28  ? 441  GLY B O   1 
ATOM   7355  N N   . ALA B 1 421 ? -19.984 8.449   98.893  1.00 29.42  ? 442  ALA B N   1 
ATOM   7356  C CA  . ALA B 1 421 ? -18.779 7.626   98.868  1.00 26.81  ? 442  ALA B CA  1 
ATOM   7357  C C   . ALA B 1 421 ? -18.037 7.535   100.201 1.00 24.45  ? 442  ALA B C   1 
ATOM   7358  O O   . ALA B 1 421 ? -17.998 8.489   100.987 1.00 23.74  ? 442  ALA B O   1 
ATOM   7359  C CB  . ALA B 1 421 ? -17.841 8.135   97.788  1.00 27.95  ? 442  ALA B CB  1 
ATOM   7360  N N   . PRO B 1 422 ? -17.437 6.370   100.470 1.00 22.37  ? 443  PRO B N   1 
ATOM   7361  C CA  . PRO B 1 422 ? -16.679 6.108   101.697 1.00 22.68  ? 443  PRO B CA  1 
ATOM   7362  C C   . PRO B 1 422 ? -15.601 7.169   101.924 1.00 22.41  ? 443  PRO B C   1 
ATOM   7363  O O   . PRO B 1 422 ? -14.695 7.330   101.098 1.00 21.75  ? 443  PRO B O   1 
ATOM   7364  C CB  . PRO B 1 422 ? -16.088 4.723   101.439 1.00 22.79  ? 443  PRO B CB  1 
ATOM   7365  C CG  . PRO B 1 422 ? -17.137 4.066   100.606 1.00 21.42  ? 443  PRO B CG  1 
ATOM   7366  C CD  . PRO B 1 422 ? -17.504 5.164   99.630  1.00 22.15  ? 443  PRO B CD  1 
ATOM   7367  N N   . THR B 1 423 ? -15.688 7.878   103.045 1.00 21.42  ? 444  THR B N   1 
ATOM   7368  C CA  . THR B 1 423 ? -14.721 8.927   103.334 1.00 20.41  ? 444  THR B CA  1 
ATOM   7369  C C   . THR B 1 423 ? -14.068 8.821   104.710 1.00 20.33  ? 444  THR B C   1 
ATOM   7370  O O   . THR B 1 423 ? -14.721 8.489   105.694 1.00 19.94  ? 444  THR B O   1 
ATOM   7371  C CB  . THR B 1 423 ? -15.391 10.305  103.205 1.00 20.28  ? 444  THR B CB  1 
ATOM   7372  O OG1 . THR B 1 423 ? -16.017 10.402  101.921 1.00 20.57  ? 444  THR B OG1 1 
ATOM   7373  C CG2 . THR B 1 423 ? -14.370 11.418  103.350 1.00 17.49  ? 444  THR B CG2 1 
ATOM   7374  N N   . TYR B 1 424 ? -12.771 9.116   104.762 1.00 20.39  ? 445  TYR B N   1 
ATOM   7375  C CA  . TYR B 1 424 ? -11.995 9.082   106.000 1.00 19.92  ? 445  TYR B CA  1 
ATOM   7376  C C   . TYR B 1 424 ? -11.104 10.314  106.096 1.00 19.10  ? 445  TYR B C   1 
ATOM   7377  O O   . TYR B 1 424 ? -10.552 10.754  105.095 1.00 19.80  ? 445  TYR B O   1 
ATOM   7378  C CB  . TYR B 1 424 ? -11.107 7.832   106.038 1.00 19.31  ? 445  TYR B CB  1 
ATOM   7379  C CG  . TYR B 1 424 ? -11.869 6.538   106.191 1.00 19.58  ? 445  TYR B CG  1 
ATOM   7380  C CD1 . TYR B 1 424 ? -12.414 6.166   107.420 1.00 18.54  ? 445  TYR B CD1 1 
ATOM   7381  C CD2 . TYR B 1 424 ? -12.083 5.706   105.100 1.00 19.78  ? 445  TYR B CD2 1 
ATOM   7382  C CE1 . TYR B 1 424 ? -13.158 4.998   107.557 1.00 19.38  ? 445  TYR B CE1 1 
ATOM   7383  C CE2 . TYR B 1 424 ? -12.825 4.536   105.224 1.00 21.39  ? 445  TYR B CE2 1 
ATOM   7384  C CZ  . TYR B 1 424 ? -13.361 4.186   106.454 1.00 20.76  ? 445  TYR B CZ  1 
ATOM   7385  O OH  . TYR B 1 424 ? -14.109 3.032   106.565 1.00 19.09  ? 445  TYR B OH  1 
ATOM   7386  N N   . MET B 1 425 ? -10.970 10.873  107.294 1.00 19.18  ? 446  MET B N   1 
ATOM   7387  C CA  . MET B 1 425 ? -10.098 12.029  107.504 1.00 20.00  ? 446  MET B CA  1 
ATOM   7388  C C   . MET B 1 425 ? -9.144  11.783  108.673 1.00 20.45  ? 446  MET B C   1 
ATOM   7389  O O   . MET B 1 425 ? -9.356  10.862  109.467 1.00 21.44  ? 446  MET B O   1 
ATOM   7390  C CB  . MET B 1 425 ? -10.908 13.294  107.772 1.00 18.86  ? 446  MET B CB  1 
ATOM   7391  C CG  . MET B 1 425 ? -11.374 14.000  106.523 1.00 19.23  ? 446  MET B CG  1 
ATOM   7392  S SD  . MET B 1 425 ? -11.871 15.700  106.862 1.00 21.63  ? 446  MET B SD  1 
ATOM   7393  C CE  . MET B 1 425 ? -10.544 16.607  106.118 1.00 21.40  ? 446  MET B CE  1 
ATOM   7394  N N   . TYR B 1 426 ? -8.090  12.594  108.771 1.00 19.74  ? 447  TYR B N   1 
ATOM   7395  C CA  . TYR B 1 426 ? -7.116  12.451  109.855 1.00 19.77  ? 447  TYR B CA  1 
ATOM   7396  C C   . TYR B 1 426 ? -6.297  13.712  110.034 1.00 20.58  ? 447  TYR B C   1 
ATOM   7397  O O   . TYR B 1 426 ? -6.143  14.502  109.109 1.00 22.46  ? 447  TYR B O   1 
ATOM   7398  C CB  . TYR B 1 426 ? -6.137  11.299  109.585 1.00 17.51  ? 447  TYR B CB  1 
ATOM   7399  C CG  . TYR B 1 426 ? -5.074  11.618  108.541 1.00 17.66  ? 447  TYR B CG  1 
ATOM   7400  C CD1 . TYR B 1 426 ? -5.096  11.007  107.284 1.00 18.42  ? 447  TYR B CD1 1 
ATOM   7401  C CD2 . TYR B 1 426 ? -4.064  12.556  108.796 1.00 16.01  ? 447  TYR B CD2 1 
ATOM   7402  C CE1 . TYR B 1 426 ? -4.147  11.320  106.315 1.00 15.64  ? 447  TYR B CE1 1 
ATOM   7403  C CE2 . TYR B 1 426 ? -3.116  12.877  107.829 1.00 13.55  ? 447  TYR B CE2 1 
ATOM   7404  C CZ  . TYR B 1 426 ? -3.164  12.254  106.595 1.00 14.68  ? 447  TYR B CZ  1 
ATOM   7405  O OH  . TYR B 1 426 ? -2.223  12.549  105.638 1.00 14.49  ? 447  TYR B OH  1 
ATOM   7406  N N   . GLU B 1 427 ? -5.755  13.896  111.225 1.00 21.93  ? 448  GLU B N   1 
ATOM   7407  C CA  . GLU B 1 427 ? -4.908  15.042  111.461 1.00 24.64  ? 448  GLU B CA  1 
ATOM   7408  C C   . GLU B 1 427 ? -3.635  14.539  112.113 1.00 25.67  ? 448  GLU B C   1 
ATOM   7409  O O   . GLU B 1 427 ? -3.646  14.126  113.276 1.00 27.76  ? 448  GLU B O   1 
ATOM   7410  C CB  . GLU B 1 427 ? -5.580  16.065  112.366 1.00 26.31  ? 448  GLU B CB  1 
ATOM   7411  C CG  . GLU B 1 427 ? -4.714  17.301  112.562 1.00 28.90  ? 448  GLU B CG  1 
ATOM   7412  C CD  . GLU B 1 427 ? -5.390  18.359  113.394 1.00 32.21  ? 448  GLU B CD  1 
ATOM   7413  O OE1 . GLU B 1 427 ? -4.791  19.448  113.572 1.00 32.99  ? 448  GLU B OE1 1 
ATOM   7414  O OE2 . GLU B 1 427 ? -6.521  18.099  113.870 1.00 34.51  ? 448  GLU B OE2 1 
ATOM   7415  N N   . PHE B 1 428 ? -2.545  14.562  111.351 1.00 25.60  ? 449  PHE B N   1 
ATOM   7416  C CA  . PHE B 1 428 ? -1.250  14.102  111.838 1.00 24.34  ? 449  PHE B CA  1 
ATOM   7417  C C   . PHE B 1 428 ? -0.595  15.180  112.685 1.00 25.28  ? 449  PHE B C   1 
ATOM   7418  O O   . PHE B 1 428 ? -0.427  16.315  112.235 1.00 24.56  ? 449  PHE B O   1 
ATOM   7419  C CB  . PHE B 1 428 ? -0.338  13.765  110.668 1.00 20.97  ? 449  PHE B CB  1 
ATOM   7420  C CG  . PHE B 1 428 ? 0.925   13.076  111.069 1.00 17.27  ? 449  PHE B CG  1 
ATOM   7421  C CD1 . PHE B 1 428 ? 0.960   11.696  111.209 1.00 14.83  ? 449  PHE B CD1 1 
ATOM   7422  C CD2 . PHE B 1 428 ? 2.089   13.808  111.293 1.00 15.73  ? 449  PHE B CD2 1 
ATOM   7423  C CE1 . PHE B 1 428 ? 2.140   11.049  111.563 1.00 15.25  ? 449  PHE B CE1 1 
ATOM   7424  C CE2 . PHE B 1 428 ? 3.275   13.175  111.648 1.00 14.44  ? 449  PHE B CE2 1 
ATOM   7425  C CZ  . PHE B 1 428 ? 3.302   11.790  111.782 1.00 15.18  ? 449  PHE B CZ  1 
ATOM   7426  N N   . GLN B 1 429 ? -0.217  14.810  113.906 1.00 26.74  ? 450  GLN B N   1 
ATOM   7427  C CA  . GLN B 1 429 ? 0.415   15.738  114.837 1.00 28.57  ? 450  GLN B CA  1 
ATOM   7428  C C   . GLN B 1 429 ? 1.584   15.082  115.562 1.00 27.25  ? 450  GLN B C   1 
ATOM   7429  O O   . GLN B 1 429 ? 1.456   14.648  116.699 1.00 26.85  ? 450  GLN B O   1 
ATOM   7430  C CB  . GLN B 1 429 ? -0.625  16.231  115.841 1.00 31.09  ? 450  GLN B CB  1 
ATOM   7431  C CG  . GLN B 1 429 ? -1.874  15.356  115.864 1.00 37.38  ? 450  GLN B CG  1 
ATOM   7432  C CD  . GLN B 1 429 ? -2.987  15.927  116.719 1.00 41.06  ? 450  GLN B CD  1 
ATOM   7433  O OE1 . GLN B 1 429 ? -2.840  16.055  117.937 1.00 43.88  ? 450  GLN B OE1 1 
ATOM   7434  N NE2 . GLN B 1 429 ? -4.110  16.276  116.086 1.00 40.59  ? 450  GLN B NE2 1 
ATOM   7435  N N   . TYR B 1 430 ? 2.724   15.011  114.887 1.00 26.75  ? 451  TYR B N   1 
ATOM   7436  C CA  . TYR B 1 430 ? 3.917   14.408  115.454 1.00 26.94  ? 451  TYR B CA  1 
ATOM   7437  C C   . TYR B 1 430 ? 5.138   15.153  114.931 1.00 28.52  ? 451  TYR B C   1 
ATOM   7438  O O   . TYR B 1 430 ? 5.059   15.834  113.907 1.00 29.18  ? 451  TYR B O   1 
ATOM   7439  C CB  . TYR B 1 430 ? 4.005   12.945  115.036 1.00 25.74  ? 451  TYR B CB  1 
ATOM   7440  C CG  . TYR B 1 430 ? 5.063   12.156  115.772 1.00 26.67  ? 451  TYR B CG  1 
ATOM   7441  C CD1 . TYR B 1 430 ? 4.835   11.688  117.069 1.00 27.04  ? 451  TYR B CD1 1 
ATOM   7442  C CD2 . TYR B 1 430 ? 6.291   11.868  115.173 1.00 25.60  ? 451  TYR B CD2 1 
ATOM   7443  C CE1 . TYR B 1 430 ? 5.795   10.949  117.750 1.00 25.81  ? 451  TYR B CE1 1 
ATOM   7444  C CE2 . TYR B 1 430 ? 7.260   11.133  115.845 1.00 25.86  ? 451  TYR B CE2 1 
ATOM   7445  C CZ  . TYR B 1 430 ? 7.003   10.673  117.134 1.00 26.45  ? 451  TYR B CZ  1 
ATOM   7446  O OH  . TYR B 1 430 ? 7.944   9.919   117.797 1.00 26.12  ? 451  TYR B OH  1 
ATOM   7447  N N   . ARG B 1 431 ? 6.261   15.038  115.636 1.00 30.05  ? 452  ARG B N   1 
ATOM   7448  C CA  . ARG B 1 431 ? 7.497   15.688  115.199 1.00 30.96  ? 452  ARG B CA  1 
ATOM   7449  C C   . ARG B 1 431 ? 8.587   14.639  115.027 1.00 30.65  ? 452  ARG B C   1 
ATOM   7450  O O   . ARG B 1 431 ? 9.203   14.199  115.998 1.00 31.67  ? 452  ARG B O   1 
ATOM   7451  C CB  . ARG B 1 431 ? 7.957   16.746  116.202 1.00 31.14  ? 452  ARG B CB  1 
ATOM   7452  C CG  . ARG B 1 431 ? 9.119   17.578  115.691 1.00 32.61  ? 452  ARG B CG  1 
ATOM   7453  C CD  . ARG B 1 431 ? 9.334   18.799  116.574 1.00 37.09  ? 452  ARG B CD  1 
ATOM   7454  N NE  . ARG B 1 431 ? 10.316  19.742  116.033 1.00 37.76  ? 452  ARG B NE  1 
ATOM   7455  C CZ  . ARG B 1 431 ? 11.579  19.434  115.759 1.00 38.99  ? 452  ARG B CZ  1 
ATOM   7456  N NH1 . ARG B 1 431 ? 12.028  18.201  115.970 1.00 39.44  ? 452  ARG B NH1 1 
ATOM   7457  N NH2 . ARG B 1 431 ? 12.399  20.363  115.284 1.00 39.26  ? 452  ARG B NH2 1 
ATOM   7458  N N   . PRO B 1 432 ? 8.834   14.218  113.778 1.00 29.59  ? 453  PRO B N   1 
ATOM   7459  C CA  . PRO B 1 432 ? 9.856   13.211  113.506 1.00 28.23  ? 453  PRO B CA  1 
ATOM   7460  C C   . PRO B 1 432 ? 11.257  13.682  113.858 1.00 27.97  ? 453  PRO B C   1 
ATOM   7461  O O   . PRO B 1 432 ? 11.575  14.868  113.751 1.00 27.54  ? 453  PRO B O   1 
ATOM   7462  C CB  . PRO B 1 432 ? 9.680   12.946  112.016 1.00 28.25  ? 453  PRO B CB  1 
ATOM   7463  C CG  . PRO B 1 432 ? 9.242   14.271  111.499 1.00 27.98  ? 453  PRO B CG  1 
ATOM   7464  C CD  . PRO B 1 432 ? 8.220   14.685  112.523 1.00 29.21  ? 453  PRO B CD  1 
ATOM   7465  N N   . SER B 1 433 ? 12.086  12.738  114.286 1.00 28.03  ? 454  SER B N   1 
ATOM   7466  C CA  . SER B 1 433 ? 13.465  13.015  114.655 1.00 28.59  ? 454  SER B CA  1 
ATOM   7467  C C   . SER B 1 433 ? 14.279  13.330  113.413 1.00 29.31  ? 454  SER B C   1 
ATOM   7468  O O   . SER B 1 433 ? 15.403  13.819  113.501 1.00 28.92  ? 454  SER B O   1 
ATOM   7469  C CB  . SER B 1 433 ? 14.066  11.798  115.343 1.00 28.72  ? 454  SER B CB  1 
ATOM   7470  O OG  . SER B 1 433 ? 14.039  10.679  114.473 1.00 29.49  ? 454  SER B OG  1 
ATOM   7471  N N   . PHE B 1 434 ? 13.704  13.029  112.255 1.00 31.40  ? 455  PHE B N   1 
ATOM   7472  C CA  . PHE B 1 434 ? 14.363  13.264  110.981 1.00 33.40  ? 455  PHE B CA  1 
ATOM   7473  C C   . PHE B 1 434 ? 14.089  14.680  110.471 1.00 35.57  ? 455  PHE B C   1 
ATOM   7474  O O   . PHE B 1 434 ? 14.152  14.932  109.270 1.00 36.75  ? 455  PHE B O   1 
ATOM   7475  C CB  . PHE B 1 434 ? 13.871  12.253  109.948 1.00 31.62  ? 455  PHE B CB  1 
ATOM   7476  C CG  . PHE B 1 434 ? 13.758  10.854  110.473 1.00 31.41  ? 455  PHE B CG  1 
ATOM   7477  C CD1 . PHE B 1 434 ? 12.513  10.297  110.738 1.00 31.28  ? 455  PHE B CD1 1 
ATOM   7478  C CD2 . PHE B 1 434 ? 14.892  10.075  110.671 1.00 31.85  ? 455  PHE B CD2 1 
ATOM   7479  C CE1 . PHE B 1 434 ? 12.400  8.976   111.190 1.00 30.89  ? 455  PHE B CE1 1 
ATOM   7480  C CE2 . PHE B 1 434 ? 14.789  8.756   111.122 1.00 30.60  ? 455  PHE B CE2 1 
ATOM   7481  C CZ  . PHE B 1 434 ? 13.540  8.208   111.380 1.00 29.86  ? 455  PHE B CZ  1 
ATOM   7482  N N   . SER B 1 435 ? 13.778  15.599  111.379 1.00 37.59  ? 456  SER B N   1 
ATOM   7483  C CA  . SER B 1 435 ? 13.499  16.977  110.996 1.00 39.56  ? 456  SER B CA  1 
ATOM   7484  C C   . SER B 1 435 ? 14.816  17.718  110.794 1.00 41.46  ? 456  SER B C   1 
ATOM   7485  O O   . SER B 1 435 ? 15.866  17.252  111.236 1.00 40.84  ? 456  SER B O   1 
ATOM   7486  C CB  . SER B 1 435 ? 12.675  17.682  112.084 1.00 40.65  ? 456  SER B CB  1 
ATOM   7487  O OG  . SER B 1 435 ? 11.409  17.069  112.287 1.00 40.32  ? 456  SER B OG  1 
ATOM   7488  N N   . SER B 1 436 ? 14.757  18.863  110.119 1.00 43.99  ? 457  SER B N   1 
ATOM   7489  C CA  . SER B 1 436 ? 15.950  19.671  109.873 1.00 46.48  ? 457  SER B CA  1 
ATOM   7490  C C   . SER B 1 436 ? 16.372  20.346  111.173 1.00 47.73  ? 457  SER B C   1 
ATOM   7491  O O   . SER B 1 436 ? 15.530  20.694  112.000 1.00 48.65  ? 457  SER B O   1 
ATOM   7492  C CB  . SER B 1 436 ? 15.667  20.736  108.804 1.00 47.14  ? 457  SER B CB  1 
ATOM   7493  O OG  . SER B 1 436 ? 16.792  21.581  108.593 1.00 46.38  ? 457  SER B OG  1 
ATOM   7494  N N   . ASP B 1 437 ? 17.673  20.534  111.352 1.00 48.92  ? 458  ASP B N   1 
ATOM   7495  C CA  . ASP B 1 437 ? 18.187  21.162  112.562 1.00 50.47  ? 458  ASP B CA  1 
ATOM   7496  C C   . ASP B 1 437 ? 17.704  22.596  112.719 1.00 50.75  ? 458  ASP B C   1 
ATOM   7497  O O   . ASP B 1 437 ? 17.516  23.079  113.835 1.00 50.69  ? 458  ASP B O   1 
ATOM   7498  C CB  . ASP B 1 437 ? 19.716  21.159  112.558 1.00 52.90  ? 458  ASP B CB  1 
ATOM   7499  C CG  . ASP B 1 437 ? 20.296  19.770  112.403 1.00 55.29  ? 458  ASP B CG  1 
ATOM   7500  O OD1 . ASP B 1 437 ? 19.725  18.821  112.983 1.00 57.50  ? 458  ASP B OD1 1 
ATOM   7501  O OD2 . ASP B 1 437 ? 21.330  19.627  111.713 1.00 56.44  ? 458  ASP B OD2 1 
ATOM   7502  N N   . MET B 1 438 ? 17.508  23.274  111.597 1.00 50.85  ? 459  MET B N   1 
ATOM   7503  C CA  . MET B 1 438 ? 17.072  24.660  111.616 1.00 51.24  ? 459  MET B CA  1 
ATOM   7504  C C   . MET B 1 438 ? 15.580  24.802  111.890 1.00 50.66  ? 459  MET B C   1 
ATOM   7505  O O   . MET B 1 438 ? 15.016  25.893  111.772 1.00 50.47  ? 459  MET B O   1 
ATOM   7506  C CB  . MET B 1 438 ? 17.445  25.322  110.290 1.00 53.02  ? 459  MET B CB  1 
ATOM   7507  C CG  . MET B 1 438 ? 18.954  25.355  110.050 1.00 54.84  ? 459  MET B CG  1 
ATOM   7508  S SD  . MET B 1 438 ? 19.432  25.859  108.387 1.00 56.31  ? 459  MET B SD  1 
ATOM   7509  C CE  . MET B 1 438 ? 19.717  24.246  107.608 1.00 56.51  ? 459  MET B CE  1 
ATOM   7510  N N   . LYS B 1 439 ? 14.953  23.695  112.275 1.00 49.75  ? 460  LYS B N   1 
ATOM   7511  C CA  . LYS B 1 439 ? 13.522  23.669  112.567 1.00 49.63  ? 460  LYS B CA  1 
ATOM   7512  C C   . LYS B 1 439 ? 13.245  23.811  114.067 1.00 50.11  ? 460  LYS B C   1 
ATOM   7513  O O   . LYS B 1 439 ? 13.649  22.964  114.865 1.00 51.49  ? 460  LYS B O   1 
ATOM   7514  C CB  . LYS B 1 439 ? 12.920  22.355  112.045 1.00 48.00  ? 460  LYS B CB  1 
ATOM   7515  C CG  . LYS B 1 439 ? 11.437  22.140  112.336 1.00 44.76  ? 460  LYS B CG  1 
ATOM   7516  C CD  . LYS B 1 439 ? 10.999  20.767  111.838 1.00 42.52  ? 460  LYS B CD  1 
ATOM   7517  C CE  . LYS B 1 439 ? 9.542   20.478  112.149 1.00 41.43  ? 460  LYS B CE  1 
ATOM   7518  N NZ  . LYS B 1 439 ? 9.163   19.110  111.703 1.00 39.50  ? 460  LYS B NZ  1 
ATOM   7519  N N   . PRO B 1 440 ? 12.551  24.888  114.468 1.00 49.63  ? 461  PRO B N   1 
ATOM   7520  C CA  . PRO B 1 440 ? 12.238  25.102  115.884 1.00 49.70  ? 461  PRO B CA  1 
ATOM   7521  C C   . PRO B 1 440 ? 11.540  23.886  116.459 1.00 50.25  ? 461  PRO B C   1 
ATOM   7522  O O   . PRO B 1 440 ? 10.532  23.428  115.930 1.00 50.77  ? 461  PRO B O   1 
ATOM   7523  C CB  . PRO B 1 440 ? 11.342  26.333  115.860 1.00 49.75  ? 461  PRO B CB  1 
ATOM   7524  C CG  . PRO B 1 440 ? 10.702  26.263  114.514 1.00 50.22  ? 461  PRO B CG  1 
ATOM   7525  C CD  . PRO B 1 440 ? 11.854  25.872  113.629 1.00 49.69  ? 461  PRO B CD  1 
ATOM   7526  N N   . LYS B 1 441 ? 12.089  23.371  117.548 1.00 51.32  ? 462  LYS B N   1 
ATOM   7527  C CA  . LYS B 1 441 ? 11.558  22.182  118.198 1.00 52.51  ? 462  LYS B CA  1 
ATOM   7528  C C   . LYS B 1 441 ? 10.086  22.257  118.626 1.00 51.77  ? 462  LYS B C   1 
ATOM   7529  O O   . LYS B 1 441 ? 9.472   21.230  118.937 1.00 51.39  ? 462  LYS B O   1 
ATOM   7530  C CB  . LYS B 1 441 ? 12.450  21.831  119.394 1.00 54.67  ? 462  LYS B CB  1 
ATOM   7531  C CG  . LYS B 1 441 ? 13.925  21.669  119.015 1.00 56.83  ? 462  LYS B CG  1 
ATOM   7532  C CD  . LYS B 1 441 ? 14.793  21.274  120.207 1.00 58.43  ? 462  LYS B CD  1 
ATOM   7533  C CE  . LYS B 1 441 ? 16.247  21.050  119.792 1.00 58.79  ? 462  LYS B CE  1 
ATOM   7534  N NZ  . LYS B 1 441 ? 17.098  20.579  120.926 1.00 58.78  ? 462  LYS B NZ  1 
ATOM   7535  N N   . THR B 1 442 ? 9.512   23.457  118.630 1.00 50.28  ? 463  THR B N   1 
ATOM   7536  C CA  . THR B 1 442 ? 8.116   23.606  119.028 1.00 49.21  ? 463  THR B CA  1 
ATOM   7537  C C   . THR B 1 442 ? 7.173   23.262  117.883 1.00 48.16  ? 463  THR B C   1 
ATOM   7538  O O   . THR B 1 442 ? 6.007   22.940  118.107 1.00 47.99  ? 463  THR B O   1 
ATOM   7539  C CB  . THR B 1 442 ? 7.804   25.034  119.467 1.00 49.39  ? 463  THR B CB  1 
ATOM   7540  O OG1 . THR B 1 442 ? 7.573   25.846  118.309 1.00 50.91  ? 463  THR B OG1 1 
ATOM   7541  C CG2 . THR B 1 442 ? 8.967   25.605  120.255 1.00 50.66  ? 463  THR B CG2 1 
ATOM   7542  N N   . VAL B 1 443 ? 7.674   23.341  116.655 1.00 47.05  ? 464  VAL B N   1 
ATOM   7543  C CA  . VAL B 1 443 ? 6.855   23.030  115.491 1.00 45.44  ? 464  VAL B CA  1 
ATOM   7544  C C   . VAL B 1 443 ? 6.609   21.527  115.412 1.00 44.44  ? 464  VAL B C   1 
ATOM   7545  O O   . VAL B 1 443 ? 7.542   20.740  115.252 1.00 44.52  ? 464  VAL B O   1 
ATOM   7546  C CB  . VAL B 1 443 ? 7.528   23.508  114.188 1.00 45.19  ? 464  VAL B CB  1 
ATOM   7547  C CG1 . VAL B 1 443 ? 6.669   23.137  112.996 1.00 45.41  ? 464  VAL B CG1 1 
ATOM   7548  C CG2 . VAL B 1 443 ? 7.732   25.005  114.232 1.00 43.73  ? 464  VAL B CG2 1 
ATOM   7549  N N   . ILE B 1 444 ? 5.344   21.144  115.530 1.00 42.39  ? 465  ILE B N   1 
ATOM   7550  C CA  . ILE B 1 444 ? 4.943   19.744  115.490 1.00 40.93  ? 465  ILE B CA  1 
ATOM   7551  C C   . ILE B 1 444 ? 3.895   19.547  114.407 1.00 39.07  ? 465  ILE B C   1 
ATOM   7552  O O   . ILE B 1 444 ? 2.985   20.360  114.268 1.00 39.85  ? 465  ILE B O   1 
ATOM   7553  C CB  . ILE B 1 444 ? 4.354   19.317  116.849 1.00 42.28  ? 465  ILE B CB  1 
ATOM   7554  C CG1 . ILE B 1 444 ? 5.471   19.257  117.890 1.00 43.80  ? 465  ILE B CG1 1 
ATOM   7555  C CG2 . ILE B 1 444 ? 3.639   17.981  116.725 1.00 43.06  ? 465  ILE B CG2 1 
ATOM   7556  C CD1 . ILE B 1 444 ? 4.977   19.055  119.304 1.00 44.74  ? 465  ILE B CD1 1 
ATOM   7557  N N   . GLY B 1 445 ? 4.018   18.470  113.641 1.00 36.01  ? 466  GLY B N   1 
ATOM   7558  C CA  . GLY B 1 445 ? 3.050   18.229  112.587 1.00 33.76  ? 466  GLY B CA  1 
ATOM   7559  C C   . GLY B 1 445 ? 3.158   19.251  111.468 1.00 32.06  ? 466  GLY B C   1 
ATOM   7560  O O   . GLY B 1 445 ? 2.157   19.782  110.978 1.00 31.18  ? 466  GLY B O   1 
ATOM   7561  N N   . ASP B 1 446 ? 4.396   19.525  111.076 1.00 30.70  ? 467  ASP B N   1 
ATOM   7562  C CA  . ASP B 1 446 ? 4.715   20.461  110.009 1.00 28.29  ? 467  ASP B CA  1 
ATOM   7563  C C   . ASP B 1 446 ? 4.432   19.796  108.650 1.00 28.24  ? 467  ASP B C   1 
ATOM   7564  O O   . ASP B 1 446 ? 4.221   18.580  108.565 1.00 27.24  ? 467  ASP B O   1 
ATOM   7565  C CB  . ASP B 1 446 ? 6.190   20.856  110.141 1.00 26.73  ? 467  ASP B CB  1 
ATOM   7566  C CG  . ASP B 1 446 ? 6.604   21.947  109.177 1.00 27.63  ? 467  ASP B CG  1 
ATOM   7567  O OD1 . ASP B 1 446 ? 5.761   22.801  108.829 1.00 27.79  ? 467  ASP B OD1 1 
ATOM   7568  O OD2 . ASP B 1 446 ? 7.792   21.965  108.784 1.00 26.72  ? 467  ASP B OD2 1 
ATOM   7569  N N   . HIS B 1 447 ? 4.419   20.602  107.594 1.00 28.16  ? 468  HIS B N   1 
ATOM   7570  C CA  . HIS B 1 447 ? 4.163   20.124  106.235 1.00 27.68  ? 468  HIS B CA  1 
ATOM   7571  C C   . HIS B 1 447 ? 5.095   18.978  105.813 1.00 27.62  ? 468  HIS B C   1 
ATOM   7572  O O   . HIS B 1 447 ? 6.317   19.152  105.744 1.00 26.74  ? 468  HIS B O   1 
ATOM   7573  C CB  . HIS B 1 447 ? 4.315   21.288  105.251 1.00 26.96  ? 468  HIS B CB  1 
ATOM   7574  C CG  . HIS B 1 447 ? 3.825   20.987  103.868 1.00 26.87  ? 468  HIS B CG  1 
ATOM   7575  N ND1 . HIS B 1 447 ? 2.499   20.741  103.585 1.00 25.88  ? 468  HIS B ND1 1 
ATOM   7576  C CD2 . HIS B 1 447 ? 4.481   20.922  102.685 1.00 26.95  ? 468  HIS B CD2 1 
ATOM   7577  C CE1 . HIS B 1 447 ? 2.360   20.540  102.286 1.00 26.82  ? 468  HIS B CE1 1 
ATOM   7578  N NE2 . HIS B 1 447 ? 3.547   20.645  101.716 1.00 25.55  ? 468  HIS B NE2 1 
ATOM   7579  N N   . GLY B 1 448 ? 4.509   17.813  105.536 1.00 26.30  ? 469  GLY B N   1 
ATOM   7580  C CA  . GLY B 1 448 ? 5.285   16.661  105.106 1.00 24.51  ? 469  GLY B CA  1 
ATOM   7581  C C   . GLY B 1 448 ? 5.760   15.723  106.204 1.00 23.79  ? 469  GLY B C   1 
ATOM   7582  O O   . GLY B 1 448 ? 6.258   14.631  105.917 1.00 22.39  ? 469  GLY B O   1 
ATOM   7583  N N   . ASP B 1 449 ? 5.606   16.133  107.460 1.00 23.17  ? 470  ASP B N   1 
ATOM   7584  C CA  . ASP B 1 449 ? 6.047   15.310  108.579 1.00 22.14  ? 470  ASP B CA  1 
ATOM   7585  C C   . ASP B 1 449 ? 5.534   13.873  108.583 1.00 21.18  ? 470  ASP B C   1 
ATOM   7586  O O   . ASP B 1 449 ? 6.249   12.957  108.991 1.00 22.43  ? 470  ASP B O   1 
ATOM   7587  C CB  . ASP B 1 449 ? 5.685   15.974  109.904 1.00 22.21  ? 470  ASP B CB  1 
ATOM   7588  C CG  . ASP B 1 449 ? 6.684   17.032  110.314 1.00 22.61  ? 470  ASP B CG  1 
ATOM   7589  O OD1 . ASP B 1 449 ? 7.905   16.803  110.173 1.00 22.79  ? 470  ASP B OD1 1 
ATOM   7590  O OD2 . ASP B 1 449 ? 6.254   18.092  110.796 1.00 24.56  ? 470  ASP B OD2 1 
ATOM   7591  N N   . GLU B 1 450 ? 4.304   13.668  108.132 1.00 19.34  ? 471  GLU B N   1 
ATOM   7592  C CA  . GLU B 1 450 ? 3.742   12.326  108.109 1.00 18.68  ? 471  GLU B CA  1 
ATOM   7593  C C   . GLU B 1 450 ? 4.423   11.426  107.080 1.00 18.91  ? 471  GLU B C   1 
ATOM   7594  O O   . GLU B 1 450 ? 4.252   10.209  107.108 1.00 20.00  ? 471  GLU B O   1 
ATOM   7595  C CB  . GLU B 1 450 ? 2.239   12.385  107.818 1.00 18.75  ? 471  GLU B CB  1 
ATOM   7596  C CG  . GLU B 1 450 ? 1.838   12.360  106.335 1.00 19.12  ? 471  GLU B CG  1 
ATOM   7597  C CD  . GLU B 1 450 ? 2.336   13.561  105.537 1.00 18.68  ? 471  GLU B CD  1 
ATOM   7598  O OE1 . GLU B 1 450 ? 2.689   14.595  106.145 1.00 16.69  ? 471  GLU B OE1 1 
ATOM   7599  O OE2 . GLU B 1 450 ? 2.358   13.466  104.291 1.00 17.74  ? 471  GLU B OE2 1 
ATOM   7600  N N   . LEU B 1 451 ? 5.195   12.022  106.174 1.00 18.60  ? 472  LEU B N   1 
ATOM   7601  C CA  . LEU B 1 451 ? 5.872   11.260  105.132 1.00 17.50  ? 472  LEU B CA  1 
ATOM   7602  C C   . LEU B 1 451 ? 6.796   10.188  105.688 1.00 17.67  ? 472  LEU B C   1 
ATOM   7603  O O   . LEU B 1 451 ? 6.837   9.062   105.178 1.00 16.36  ? 472  LEU B O   1 
ATOM   7604  C CB  . LEU B 1 451 ? 6.663   12.199  104.218 1.00 18.16  ? 472  LEU B CB  1 
ATOM   7605  C CG  . LEU B 1 451 ? 5.841   13.173  103.361 1.00 20.54  ? 472  LEU B CG  1 
ATOM   7606  C CD1 . LEU B 1 451 ? 6.795   14.042  102.524 1.00 20.90  ? 472  LEU B CD1 1 
ATOM   7607  C CD2 . LEU B 1 451 ? 4.876   12.401  102.460 1.00 17.41  ? 472  LEU B CD2 1 
ATOM   7608  N N   . PHE B 1 452 ? 7.529   10.539  106.741 1.00 17.66  ? 473  PHE B N   1 
ATOM   7609  C CA  . PHE B 1 452 ? 8.466   9.611   107.364 1.00 17.52  ? 473  PHE B CA  1 
ATOM   7610  C C   . PHE B 1 452 ? 7.777   8.389   107.982 1.00 18.35  ? 473  PHE B C   1 
ATOM   7611  O O   . PHE B 1 452 ? 8.329   7.290   107.979 1.00 18.52  ? 473  PHE B O   1 
ATOM   7612  C CB  . PHE B 1 452 ? 9.295   10.349  108.414 1.00 15.03  ? 473  PHE B CB  1 
ATOM   7613  C CG  . PHE B 1 452 ? 9.979   11.570  107.882 1.00 13.27  ? 473  PHE B CG  1 
ATOM   7614  C CD1 . PHE B 1 452 ? 9.306   12.783  107.811 1.00 12.91  ? 473  PHE B CD1 1 
ATOM   7615  C CD2 . PHE B 1 452 ? 11.287  11.503  107.415 1.00 12.75  ? 473  PHE B CD2 1 
ATOM   7616  C CE1 . PHE B 1 452 ? 9.927   13.915  107.280 1.00 10.06  ? 473  PHE B CE1 1 
ATOM   7617  C CE2 . PHE B 1 452 ? 11.913  12.626  106.884 1.00 10.67  ? 473  PHE B CE2 1 
ATOM   7618  C CZ  . PHE B 1 452 ? 11.229  13.835  106.817 1.00 9.44   ? 473  PHE B CZ  1 
ATOM   7619  N N   . SER B 1 453 ? 6.572   8.583   108.505 1.00 18.81  ? 474  SER B N   1 
ATOM   7620  C CA  . SER B 1 453 ? 5.818   7.492   109.100 1.00 19.28  ? 474  SER B CA  1 
ATOM   7621  C C   . SER B 1 453 ? 5.137   6.650   108.012 1.00 19.77  ? 474  SER B C   1 
ATOM   7622  O O   . SER B 1 453 ? 5.018   5.431   108.141 1.00 19.51  ? 474  SER B O   1 
ATOM   7623  C CB  . SER B 1 453 ? 4.765   8.045   110.066 1.00 20.10  ? 474  SER B CB  1 
ATOM   7624  O OG  . SER B 1 453 ? 5.365   8.712   111.163 1.00 19.70  ? 474  SER B OG  1 
ATOM   7625  N N   . VAL B 1 454 ? 4.694   7.302   106.942 1.00 19.89  ? 475  VAL B N   1 
ATOM   7626  C CA  . VAL B 1 454 ? 4.031   6.593   105.852 1.00 20.23  ? 475  VAL B CA  1 
ATOM   7627  C C   . VAL B 1 454 ? 5.026   5.753   105.050 1.00 20.38  ? 475  VAL B C   1 
ATOM   7628  O O   . VAL B 1 454 ? 4.729   4.620   104.662 1.00 19.39  ? 475  VAL B O   1 
ATOM   7629  C CB  . VAL B 1 454 ? 3.298   7.578   104.889 1.00 19.67  ? 475  VAL B CB  1 
ATOM   7630  C CG1 . VAL B 1 454 ? 2.715   6.824   103.701 1.00 19.36  ? 475  VAL B CG1 1 
ATOM   7631  C CG2 . VAL B 1 454 ? 2.184   8.300   105.627 1.00 19.16  ? 475  VAL B CG2 1 
ATOM   7632  N N   . PHE B 1 455 ? 6.209   6.301   104.803 1.00 20.91  ? 476  PHE B N   1 
ATOM   7633  C CA  . PHE B 1 455 ? 7.198   5.564   104.037 1.00 21.09  ? 476  PHE B CA  1 
ATOM   7634  C C   . PHE B 1 455 ? 8.208   4.866   104.913 1.00 20.33  ? 476  PHE B C   1 
ATOM   7635  O O   . PHE B 1 455 ? 9.248   4.424   104.434 1.00 21.52  ? 476  PHE B O   1 
ATOM   7636  C CB  . PHE B 1 455 ? 7.915   6.475   103.042 1.00 22.12  ? 476  PHE B CB  1 
ATOM   7637  C CG  . PHE B 1 455 ? 7.121   6.751   101.803 1.00 22.01  ? 476  PHE B CG  1 
ATOM   7638  C CD1 . PHE B 1 455 ? 6.458   7.962   101.638 1.00 22.20  ? 476  PHE B CD1 1 
ATOM   7639  C CD2 . PHE B 1 455 ? 7.011   5.785   100.813 1.00 21.89  ? 476  PHE B CD2 1 
ATOM   7640  C CE1 . PHE B 1 455 ? 5.695   8.210   100.504 1.00 20.84  ? 476  PHE B CE1 1 
ATOM   7641  C CE2 . PHE B 1 455 ? 6.250   6.022   99.676  1.00 22.88  ? 476  PHE B CE2 1 
ATOM   7642  C CZ  . PHE B 1 455 ? 5.590   7.239   99.523  1.00 22.47  ? 476  PHE B CZ  1 
ATOM   7643  N N   . GLY B 1 456 ? 7.898   4.778   106.199 1.00 19.28  ? 477  GLY B N   1 
ATOM   7644  C CA  . GLY B 1 456 ? 8.777   4.090   107.131 1.00 19.39  ? 477  GLY B CA  1 
ATOM   7645  C C   . GLY B 1 456 ? 10.244  4.480   107.189 1.00 17.57  ? 477  GLY B C   1 
ATOM   7646  O O   . GLY B 1 456 ? 11.125  3.618   107.106 1.00 16.42  ? 477  GLY B O   1 
ATOM   7647  N N   . ALA B 1 457 ? 10.505  5.775   107.342 1.00 16.45  ? 478  ALA B N   1 
ATOM   7648  C CA  . ALA B 1 457 ? 11.863  6.276   107.446 1.00 16.25  ? 478  ALA B CA  1 
ATOM   7649  C C   . ALA B 1 457 ? 12.570  5.583   108.619 1.00 17.23  ? 478  ALA B C   1 
ATOM   7650  O O   . ALA B 1 457 ? 13.785  5.391   108.597 1.00 15.96  ? 478  ALA B O   1 
ATOM   7651  C CB  . ALA B 1 457 ? 11.846  7.787   107.650 1.00 13.95  ? 478  ALA B CB  1 
ATOM   7652  N N   . PRO B 1 458 ? 11.815  5.206   109.668 1.00 19.53  ? 479  PRO B N   1 
ATOM   7653  C CA  . PRO B 1 458 ? 12.432  4.535   110.816 1.00 20.36  ? 479  PRO B CA  1 
ATOM   7654  C C   . PRO B 1 458 ? 13.177  3.241   110.485 1.00 20.57  ? 479  PRO B C   1 
ATOM   7655  O O   . PRO B 1 458 ? 14.121  2.883   111.181 1.00 20.56  ? 479  PRO B O   1 
ATOM   7656  C CB  . PRO B 1 458 ? 11.243  4.297   111.745 1.00 20.16  ? 479  PRO B CB  1 
ATOM   7657  C CG  . PRO B 1 458 ? 10.415  5.503   111.511 1.00 19.97  ? 479  PRO B CG  1 
ATOM   7658  C CD  . PRO B 1 458 ? 10.434  5.608   110.000 1.00 20.43  ? 479  PRO B CD  1 
ATOM   7659  N N   . PHE B 1 459 ? 12.761  2.541   109.432 1.00 21.70  ? 480  PHE B N   1 
ATOM   7660  C CA  . PHE B 1 459 ? 13.419  1.292   109.064 1.00 23.36  ? 480  PHE B CA  1 
ATOM   7661  C C   . PHE B 1 459 ? 14.487  1.431   107.980 1.00 25.52  ? 480  PHE B C   1 
ATOM   7662  O O   . PHE B 1 459 ? 14.946  0.430   107.434 1.00 26.85  ? 480  PHE B O   1 
ATOM   7663  C CB  . PHE B 1 459 ? 12.388  0.259   108.622 1.00 22.16  ? 480  PHE B CB  1 
ATOM   7664  C CG  . PHE B 1 459 ? 11.235  0.137   109.553 1.00 22.02  ? 480  PHE B CG  1 
ATOM   7665  C CD1 . PHE B 1 459 ? 10.163  1.010   109.462 1.00 22.64  ? 480  PHE B CD1 1 
ATOM   7666  C CD2 . PHE B 1 459 ? 11.246  -0.805  110.569 1.00 22.86  ? 480  PHE B CD2 1 
ATOM   7667  C CE1 . PHE B 1 459 ? 9.122   0.952   110.374 1.00 24.05  ? 480  PHE B CE1 1 
ATOM   7668  C CE2 . PHE B 1 459 ? 10.206  -0.873  111.492 1.00 23.79  ? 480  PHE B CE2 1 
ATOM   7669  C CZ  . PHE B 1 459 ? 9.143   0.009   111.395 1.00 24.03  ? 480  PHE B CZ  1 
ATOM   7670  N N   . LEU B 1 460 ? 14.881  2.666   107.676 1.00 26.86  ? 481  LEU B N   1 
ATOM   7671  C CA  . LEU B 1 460 ? 15.904  2.928   106.668 1.00 28.20  ? 481  LEU B CA  1 
ATOM   7672  C C   . LEU B 1 460 ? 16.897  3.945   107.215 1.00 30.38  ? 481  LEU B C   1 
ATOM   7673  O O   . LEU B 1 460 ? 18.054  3.986   106.800 1.00 30.69  ? 481  LEU B O   1 
ATOM   7674  C CB  . LEU B 1 460 ? 15.273  3.470   105.383 1.00 27.29  ? 481  LEU B CB  1 
ATOM   7675  C CG  . LEU B 1 460 ? 14.178  2.634   104.715 1.00 26.51  ? 481  LEU B CG  1 
ATOM   7676  C CD1 . LEU B 1 460 ? 13.684  3.379   103.501 1.00 28.45  ? 481  LEU B CD1 1 
ATOM   7677  C CD2 . LEU B 1 460 ? 14.695  1.275   104.311 1.00 24.51  ? 481  LEU B CD2 1 
ATOM   7678  N N   . LYS B 1 461 ? 16.437  4.769   108.150 1.00 33.35  ? 482  LYS B N   1 
ATOM   7679  C CA  . LYS B 1 461 ? 17.294  5.774   108.763 1.00 36.33  ? 482  LYS B CA  1 
ATOM   7680  C C   . LYS B 1 461 ? 17.714  5.337   110.167 1.00 38.75  ? 482  LYS B C   1 
ATOM   7681  O O   . LYS B 1 461 ? 17.405  4.219   110.591 1.00 39.45  ? 482  LYS B O   1 
ATOM   7682  C CB  . LYS B 1 461 ? 16.577  7.126   108.803 1.00 35.14  ? 482  LYS B CB  1 
ATOM   7683  C CG  . LYS B 1 461 ? 16.405  7.732   107.424 1.00 34.90  ? 482  LYS B CG  1 
ATOM   7684  C CD  . LYS B 1 461 ? 16.007  9.191   107.489 1.00 35.15  ? 482  LYS B CD  1 
ATOM   7685  C CE  . LYS B 1 461 ? 16.229  9.866   106.144 1.00 34.56  ? 482  LYS B CE  1 
ATOM   7686  N NZ  . LYS B 1 461 ? 15.874  11.305  106.187 1.00 34.13  ? 482  LYS B NZ  1 
ATOM   7687  N N   . GLU B 1 462 ? 18.412  6.215   110.888 1.00 41.14  ? 483  GLU B N   1 
ATOM   7688  C CA  . GLU B 1 462 ? 18.892  5.890   112.232 1.00 42.48  ? 483  GLU B CA  1 
ATOM   7689  C C   . GLU B 1 462 ? 18.465  6.870   113.309 1.00 41.47  ? 483  GLU B C   1 
ATOM   7690  O O   . GLU B 1 462 ? 18.270  8.051   113.039 1.00 41.94  ? 483  GLU B O   1 
ATOM   7691  C CB  . GLU B 1 462 ? 20.419  5.805   112.219 1.00 45.54  ? 483  GLU B CB  1 
ATOM   7692  C CG  . GLU B 1 462 ? 20.960  4.738   111.284 1.00 48.95  ? 483  GLU B CG  1 
ATOM   7693  C CD  . GLU B 1 462 ? 22.414  4.961   110.915 1.00 50.79  ? 483  GLU B CD  1 
ATOM   7694  O OE1 . GLU B 1 462 ? 22.976  4.096   110.206 1.00 51.40  ? 483  GLU B OE1 1 
ATOM   7695  O OE2 . GLU B 1 462 ? 22.989  6.000   111.324 1.00 51.67  ? 483  GLU B OE2 1 
ATOM   7696  N N   . GLY B 1 463 ? 18.324  6.370   114.534 1.00 41.35  ? 484  GLY B N   1 
ATOM   7697  C CA  . GLY B 1 463 ? 17.943  7.222   115.650 1.00 41.22  ? 484  GLY B CA  1 
ATOM   7698  C C   . GLY B 1 463 ? 16.467  7.240   116.011 1.00 40.35  ? 484  GLY B C   1 
ATOM   7699  O O   . GLY B 1 463 ? 16.063  7.915   116.963 1.00 40.69  ? 484  GLY B O   1 
ATOM   7700  N N   . ALA B 1 464 ? 15.656  6.506   115.257 1.00 39.02  ? 485  ALA B N   1 
ATOM   7701  C CA  . ALA B 1 464 ? 14.227  6.460   115.521 1.00 37.04  ? 485  ALA B CA  1 
ATOM   7702  C C   . ALA B 1 464 ? 13.960  5.724   116.827 1.00 36.38  ? 485  ALA B C   1 
ATOM   7703  O O   . ALA B 1 464 ? 14.331  4.554   116.981 1.00 35.23  ? 485  ALA B O   1 
ATOM   7704  C CB  . ALA B 1 464 ? 13.507  5.770   114.374 1.00 37.05  ? 485  ALA B CB  1 
ATOM   7705  N N   . SER B 1 465 ? 13.324  6.422   117.767 1.00 35.56  ? 486  SER B N   1 
ATOM   7706  C CA  . SER B 1 465 ? 12.981  5.855   119.069 1.00 33.88  ? 486  SER B CA  1 
ATOM   7707  C C   . SER B 1 465 ? 11.916  4.778   118.890 1.00 33.03  ? 486  SER B C   1 
ATOM   7708  O O   . SER B 1 465 ? 11.270  4.710   117.849 1.00 33.46  ? 486  SER B O   1 
ATOM   7709  C CB  . SER B 1 465 ? 12.459  6.952   119.999 1.00 33.66  ? 486  SER B CB  1 
ATOM   7710  O OG  . SER B 1 465 ? 11.254  7.516   119.512 1.00 33.29  ? 486  SER B OG  1 
ATOM   7711  N N   . GLU B 1 466 ? 11.732  3.930   119.893 1.00 32.54  ? 487  GLU B N   1 
ATOM   7712  C CA  . GLU B 1 466 ? 10.736  2.879   119.777 1.00 32.84  ? 487  GLU B CA  1 
ATOM   7713  C C   . GLU B 1 466 ? 9.369   3.478   119.481 1.00 33.62  ? 487  GLU B C   1 
ATOM   7714  O O   . GLU B 1 466 ? 8.581   2.899   118.731 1.00 34.53  ? 487  GLU B O   1 
ATOM   7715  C CB  . GLU B 1 466 ? 10.658  2.063   121.057 1.00 33.46  ? 487  GLU B CB  1 
ATOM   7716  C CG  . GLU B 1 466 ? 9.900   0.758   120.888 1.00 34.49  ? 487  GLU B CG  1 
ATOM   7717  C CD  . GLU B 1 466 ? 10.547  -0.152  119.859 1.00 36.06  ? 487  GLU B CD  1 
ATOM   7718  O OE1 . GLU B 1 466 ? 11.776  -0.030  119.659 1.00 37.86  ? 487  GLU B OE1 1 
ATOM   7719  O OE2 . GLU B 1 466 ? 9.839   -0.997  119.263 1.00 36.43  ? 487  GLU B OE2 1 
ATOM   7720  N N   . GLU B 1 467 ? 9.090   4.636   120.080 1.00 32.77  ? 488  GLU B N   1 
ATOM   7721  C CA  . GLU B 1 467 ? 7.819   5.339   119.879 1.00 30.92  ? 488  GLU B CA  1 
ATOM   7722  C C   . GLU B 1 467 ? 7.605   5.589   118.383 1.00 30.53  ? 488  GLU B C   1 
ATOM   7723  O O   . GLU B 1 467 ? 6.605   5.174   117.793 1.00 29.74  ? 488  GLU B O   1 
ATOM   7724  C CB  . GLU B 1 467 ? 7.860   6.680   120.610 1.00 30.79  ? 488  GLU B CB  1 
ATOM   7725  C CG  . GLU B 1 467 ? 6.544   7.442   120.653 1.00 29.96  ? 488  GLU B CG  1 
ATOM   7726  C CD  . GLU B 1 467 ? 6.720   8.873   121.140 1.00 29.38  ? 488  GLU B CD  1 
ATOM   7727  O OE1 . GLU B 1 467 ? 5.736   9.473   121.615 1.00 29.68  ? 488  GLU B OE1 1 
ATOM   7728  O OE2 . GLU B 1 467 ? 7.844   9.406   121.036 1.00 29.06  ? 488  GLU B OE2 1 
ATOM   7729  N N   . GLU B 1 468 ? 8.574   6.270   117.784 1.00 29.93  ? 489  GLU B N   1 
ATOM   7730  C CA  . GLU B 1 468 ? 8.546   6.603   116.371 1.00 28.61  ? 489  GLU B CA  1 
ATOM   7731  C C   . GLU B 1 468 ? 8.464   5.347   115.517 1.00 27.79  ? 489  GLU B C   1 
ATOM   7732  O O   . GLU B 1 468 ? 7.656   5.261   114.599 1.00 29.61  ? 489  GLU B O   1 
ATOM   7733  C CB  . GLU B 1 468 ? 9.802   7.387   116.014 1.00 27.94  ? 489  GLU B CB  1 
ATOM   7734  C CG  . GLU B 1 468 ? 9.708   8.163   114.726 1.00 28.94  ? 489  GLU B CG  1 
ATOM   7735  C CD  . GLU B 1 468 ? 10.939  9.009   114.492 1.00 30.40  ? 489  GLU B CD  1 
ATOM   7736  O OE1 . GLU B 1 468 ? 10.887  9.916   113.632 1.00 29.49  ? 489  GLU B OE1 1 
ATOM   7737  O OE2 . GLU B 1 468 ? 11.961  8.761   115.172 1.00 30.86  ? 489  GLU B OE2 1 
ATOM   7738  N N   . ILE B 1 469 ? 9.305   4.372   115.820 1.00 26.79  ? 490  ILE B N   1 
ATOM   7739  C CA  . ILE B 1 469 ? 9.312   3.129   115.063 1.00 26.85  ? 490  ILE B CA  1 
ATOM   7740  C C   . ILE B 1 469 ? 7.932   2.487   115.010 1.00 26.67  ? 490  ILE B C   1 
ATOM   7741  O O   . ILE B 1 469 ? 7.521   1.968   113.972 1.00 25.71  ? 490  ILE B O   1 
ATOM   7742  C CB  . ILE B 1 469 ? 10.320  2.119   115.666 1.00 26.45  ? 490  ILE B CB  1 
ATOM   7743  C CG1 . ILE B 1 469 ? 11.739  2.669   115.508 1.00 25.39  ? 490  ILE B CG1 1 
ATOM   7744  C CG2 . ILE B 1 469 ? 10.174  0.754   114.992 1.00 24.08  ? 490  ILE B CG2 1 
ATOM   7745  C CD1 . ILE B 1 469 ? 12.794  1.805   116.110 1.00 26.38  ? 490  ILE B CD1 1 
ATOM   7746  N N   . ARG B 1 470 ? 7.216   2.530   116.128 1.00 27.62  ? 491  ARG B N   1 
ATOM   7747  C CA  . ARG B 1 470 ? 5.890   1.933   116.186 1.00 28.43  ? 491  ARG B CA  1 
ATOM   7748  C C   . ARG B 1 470 ? 4.813   2.846   115.596 1.00 27.58  ? 491  ARG B C   1 
ATOM   7749  O O   . ARG B 1 470 ? 3.786   2.369   115.096 1.00 27.15  ? 491  ARG B O   1 
ATOM   7750  C CB  . ARG B 1 470 ? 5.575   1.526   117.628 1.00 30.88  ? 491  ARG B CB  1 
ATOM   7751  C CG  . ARG B 1 470 ? 6.633   0.568   118.180 1.00 35.72  ? 491  ARG B CG  1 
ATOM   7752  C CD  . ARG B 1 470 ? 6.064   -0.621  118.952 1.00 40.05  ? 491  ARG B CD  1 
ATOM   7753  N NE  . ARG B 1 470 ? 5.641   -0.253  120.299 1.00 44.90  ? 491  ARG B NE  1 
ATOM   7754  C CZ  . ARG B 1 470 ? 4.381   -0.026  120.661 1.00 47.30  ? 491  ARG B CZ  1 
ATOM   7755  N NH1 . ARG B 1 470 ? 3.397   -0.134  119.773 1.00 48.68  ? 491  ARG B NH1 1 
ATOM   7756  N NH2 . ARG B 1 470 ? 4.108   0.326   121.912 1.00 47.67  ? 491  ARG B NH2 1 
ATOM   7757  N N   . LEU B 1 471 ? 5.048   4.154   115.636 1.00 25.59  ? 492  LEU B N   1 
ATOM   7758  C CA  . LEU B 1 471 ? 4.101   5.089   115.047 1.00 23.18  ? 492  LEU B CA  1 
ATOM   7759  C C   . LEU B 1 471 ? 4.077   4.803   113.552 1.00 22.69  ? 492  LEU B C   1 
ATOM   7760  O O   . LEU B 1 471 ? 3.018   4.793   112.932 1.00 23.92  ? 492  LEU B O   1 
ATOM   7761  C CB  . LEU B 1 471 ? 4.541   6.534   115.285 1.00 22.55  ? 492  LEU B CB  1 
ATOM   7762  C CG  . LEU B 1 471 ? 3.846   7.601   114.433 1.00 22.43  ? 492  LEU B CG  1 
ATOM   7763  C CD1 . LEU B 1 471 ? 2.343   7.389   114.465 1.00 22.04  ? 492  LEU B CD1 1 
ATOM   7764  C CD2 . LEU B 1 471 ? 4.209   8.986   114.945 1.00 21.51  ? 492  LEU B CD2 1 
ATOM   7765  N N   . SER B 1 472 ? 5.254   4.561   112.981 1.00 21.16  ? 493  SER B N   1 
ATOM   7766  C CA  . SER B 1 472 ? 5.366   4.267   111.558 1.00 20.79  ? 493  SER B CA  1 
ATOM   7767  C C   . SER B 1 472 ? 4.663   2.964   111.206 1.00 21.93  ? 493  SER B C   1 
ATOM   7768  O O   . SER B 1 472 ? 3.846   2.920   110.285 1.00 21.95  ? 493  SER B O   1 
ATOM   7769  C CB  . SER B 1 472 ? 6.832   4.174   111.147 1.00 19.43  ? 493  SER B CB  1 
ATOM   7770  O OG  . SER B 1 472 ? 6.952   3.715   109.812 1.00 14.61  ? 493  SER B OG  1 
ATOM   7771  N N   . LYS B 1 473 ? 4.991   1.899   111.930 1.00 23.10  ? 494  LYS B N   1 
ATOM   7772  C CA  . LYS B 1 473 ? 4.363   0.607   111.683 1.00 24.62  ? 494  LYS B CA  1 
ATOM   7773  C C   . LYS B 1 473 ? 2.858   0.794   111.642 1.00 24.89  ? 494  LYS B C   1 
ATOM   7774  O O   . LYS B 1 473 ? 2.178   0.343   110.713 1.00 23.57  ? 494  LYS B O   1 
ATOM   7775  C CB  . LYS B 1 473 ? 4.695   -0.387  112.798 1.00 25.86  ? 494  LYS B CB  1 
ATOM   7776  C CG  . LYS B 1 473 ? 6.083   -0.997  112.748 1.00 28.23  ? 494  LYS B CG  1 
ATOM   7777  C CD  . LYS B 1 473 ? 6.155   -2.189  113.695 1.00 29.74  ? 494  LYS B CD  1 
ATOM   7778  C CE  . LYS B 1 473 ? 7.478   -2.925  113.582 1.00 31.07  ? 494  LYS B CE  1 
ATOM   7779  N NZ  . LYS B 1 473 ? 7.516   -4.105  114.489 1.00 31.65  ? 494  LYS B NZ  1 
ATOM   7780  N N   . MET B 1 474 ? 2.360   1.469   112.675 1.00 25.65  ? 495  MET B N   1 
ATOM   7781  C CA  . MET B 1 474 ? 0.940   1.750   112.841 1.00 24.80  ? 495  MET B CA  1 
ATOM   7782  C C   . MET B 1 474 ? 0.362   2.398   111.583 1.00 22.74  ? 495  MET B C   1 
ATOM   7783  O O   . MET B 1 474 ? -0.617  1.907   111.019 1.00 22.22  ? 495  MET B O   1 
ATOM   7784  C CB  . MET B 1 474 ? 0.742   2.670   114.057 1.00 27.07  ? 495  MET B CB  1 
ATOM   7785  C CG  . MET B 1 474 ? -0.628  2.578   114.729 1.00 30.65  ? 495  MET B CG  1 
ATOM   7786  S SD  . MET B 1 474 ? -0.843  3.760   116.100 1.00 37.20  ? 495  MET B SD  1 
ATOM   7787  C CE  . MET B 1 474 ? 0.471   3.229   117.261 1.00 32.10  ? 495  MET B CE  1 
ATOM   7788  N N   . VAL B 1 475 ? 0.979   3.489   111.139 1.00 20.66  ? 496  VAL B N   1 
ATOM   7789  C CA  . VAL B 1 475 ? 0.504   4.204   109.959 1.00 20.24  ? 496  VAL B CA  1 
ATOM   7790  C C   . VAL B 1 475 ? 0.477   3.358   108.686 1.00 19.99  ? 496  VAL B C   1 
ATOM   7791  O O   . VAL B 1 475 ? -0.516  3.366   107.955 1.00 19.99  ? 496  VAL B O   1 
ATOM   7792  C CB  . VAL B 1 475 ? 1.352   5.459   109.687 1.00 20.10  ? 496  VAL B CB  1 
ATOM   7793  C CG1 . VAL B 1 475 ? 0.857   6.156   108.437 1.00 19.16  ? 496  VAL B CG1 1 
ATOM   7794  C CG2 . VAL B 1 475 ? 1.275   6.399   110.868 1.00 20.34  ? 496  VAL B CG2 1 
ATOM   7795  N N   . MET B 1 476 ? 1.560   2.636   108.413 1.00 19.31  ? 497  MET B N   1 
ATOM   7796  C CA  . MET B 1 476 ? 1.616   1.808   107.216 1.00 18.77  ? 497  MET B CA  1 
ATOM   7797  C C   . MET B 1 476 ? 0.460   0.805   107.212 1.00 17.54  ? 497  MET B C   1 
ATOM   7798  O O   . MET B 1 476 ? -0.130  0.550   106.170 1.00 15.76  ? 497  MET B O   1 
ATOM   7799  C CB  . MET B 1 476 ? 2.979   1.105   107.118 1.00 20.56  ? 497  MET B CB  1 
ATOM   7800  C CG  . MET B 1 476 ? 4.151   2.073   106.911 1.00 21.38  ? 497  MET B CG  1 
ATOM   7801  S SD  . MET B 1 476 ? 5.787   1.293   106.746 1.00 23.66  ? 497  MET B SD  1 
ATOM   7802  C CE  . MET B 1 476 ? 6.203   1.055   108.451 1.00 24.68  ? 497  MET B CE  1 
ATOM   7803  N N   . LYS B 1 477 ? 0.137   0.249   108.378 1.00 18.11  ? 498  LYS B N   1 
ATOM   7804  C CA  . LYS B 1 477 ? -0.983  -0.687  108.512 1.00 19.06  ? 498  LYS B CA  1 
ATOM   7805  C C   . LYS B 1 477 ? -2.215  0.020   107.959 1.00 18.71  ? 498  LYS B C   1 
ATOM   7806  O O   . LYS B 1 477 ? -2.845  -0.435  107.001 1.00 17.06  ? 498  LYS B O   1 
ATOM   7807  C CB  . LYS B 1 477 ? -1.254  -1.006  109.990 1.00 21.67  ? 498  LYS B CB  1 
ATOM   7808  C CG  . LYS B 1 477 ? -0.627  -2.278  110.539 1.00 24.13  ? 498  LYS B CG  1 
ATOM   7809  C CD  . LYS B 1 477 ? -1.469  -3.503  110.236 1.00 25.35  ? 498  LYS B CD  1 
ATOM   7810  C CE  . LYS B 1 477 ? -0.923  -4.729  110.964 1.00 28.30  ? 498  LYS B CE  1 
ATOM   7811  N NZ  . LYS B 1 477 ? 0.514   -5.005  110.644 1.00 29.15  ? 498  LYS B NZ  1 
ATOM   7812  N N   . PHE B 1 478 ? -2.555  1.135   108.597 1.00 18.28  ? 499  PHE B N   1 
ATOM   7813  C CA  . PHE B 1 478 ? -3.694  1.936   108.196 1.00 19.13  ? 499  PHE B CA  1 
ATOM   7814  C C   . PHE B 1 478 ? -3.709  2.134   106.685 1.00 19.50  ? 499  PHE B C   1 
ATOM   7815  O O   . PHE B 1 478 ? -4.650  1.698   106.009 1.00 20.35  ? 499  PHE B O   1 
ATOM   7816  C CB  . PHE B 1 478 ? -3.654  3.290   108.906 1.00 20.76  ? 499  PHE B CB  1 
ATOM   7817  C CG  . PHE B 1 478 ? -4.232  3.269   110.301 1.00 21.85  ? 499  PHE B CG  1 
ATOM   7818  C CD1 . PHE B 1 478 ? -3.693  4.072   111.302 1.00 20.67  ? 499  PHE B CD1 1 
ATOM   7819  C CD2 . PHE B 1 478 ? -5.343  2.483   110.601 1.00 22.45  ? 499  PHE B CD2 1 
ATOM   7820  C CE1 . PHE B 1 478 ? -4.248  4.098   112.575 1.00 21.19  ? 499  PHE B CE1 1 
ATOM   7821  C CE2 . PHE B 1 478 ? -5.906  2.501   111.875 1.00 23.01  ? 499  PHE B CE2 1 
ATOM   7822  C CZ  . PHE B 1 478 ? -5.357  3.311   112.863 1.00 22.65  ? 499  PHE B CZ  1 
ATOM   7823  N N   . TRP B 1 479 ? -2.671  2.781   106.154 1.00 18.35  ? 500  TRP B N   1 
ATOM   7824  C CA  . TRP B 1 479 ? -2.595  3.019   104.715 1.00 16.14  ? 500  TRP B CA  1 
ATOM   7825  C C   . TRP B 1 479 ? -2.771  1.717   103.924 1.00 15.64  ? 500  TRP B C   1 
ATOM   7826  O O   . TRP B 1 479 ? -3.657  1.621   103.076 1.00 15.19  ? 500  TRP B O   1 
ATOM   7827  C CB  . TRP B 1 479 ? -1.266  3.681   104.346 1.00 15.62  ? 500  TRP B CB  1 
ATOM   7828  C CG  . TRP B 1 479 ? -1.270  5.208   104.317 1.00 15.91  ? 500  TRP B CG  1 
ATOM   7829  C CD1 . TRP B 1 479 ? -0.740  5.999   103.337 1.00 16.60  ? 500  TRP B CD1 1 
ATOM   7830  C CD2 . TRP B 1 479 ? -1.735  6.108   105.341 1.00 15.92  ? 500  TRP B CD2 1 
ATOM   7831  N NE1 . TRP B 1 479 ? -0.838  7.326   103.683 1.00 16.63  ? 500  TRP B NE1 1 
ATOM   7832  C CE2 . TRP B 1 479 ? -1.443  7.423   104.907 1.00 15.55  ? 500  TRP B CE2 1 
ATOM   7833  C CE3 . TRP B 1 479 ? -2.365  5.931   106.582 1.00 15.83  ? 500  TRP B CE3 1 
ATOM   7834  C CZ2 . TRP B 1 479 ? -1.758  8.557   105.669 1.00 14.61  ? 500  TRP B CZ2 1 
ATOM   7835  C CZ3 . TRP B 1 479 ? -2.678  7.063   107.340 1.00 15.80  ? 500  TRP B CZ3 1 
ATOM   7836  C CH2 . TRP B 1 479 ? -2.372  8.357   106.877 1.00 14.60  ? 500  TRP B CH2 1 
ATOM   7837  N N   . ALA B 1 480 ? -1.942  0.713   104.206 1.00 15.58  ? 501  ALA B N   1 
ATOM   7838  C CA  . ALA B 1 480 ? -2.036  -0.572  103.507 1.00 15.64  ? 501  ALA B CA  1 
ATOM   7839  C C   . ALA B 1 480 ? -3.426  -1.189  103.641 1.00 16.86  ? 501  ALA B C   1 
ATOM   7840  O O   . ALA B 1 480 ? -3.961  -1.748  102.677 1.00 16.05  ? 501  ALA B O   1 
ATOM   7841  C CB  . ALA B 1 480 ? -0.984  -1.542  104.029 1.00 13.76  ? 501  ALA B CB  1 
ATOM   7842  N N   . ASN B 1 481 ? -4.007  -1.104  104.837 1.00 18.78  ? 502  ASN B N   1 
ATOM   7843  C CA  . ASN B 1 481 ? -5.346  -1.643  105.048 1.00 20.24  ? 502  ASN B CA  1 
ATOM   7844  C C   . ASN B 1 481 ? -6.312  -0.942  104.101 1.00 20.52  ? 502  ASN B C   1 
ATOM   7845  O O   . ASN B 1 481 ? -7.068  -1.597  103.377 1.00 21.27  ? 502  ASN B O   1 
ATOM   7846  C CB  . ASN B 1 481 ? -5.810  -1.440  106.497 1.00 19.91  ? 502  ASN B CB  1 
ATOM   7847  C CG  . ASN B 1 481 ? -5.176  -2.427  107.449 1.00 19.27  ? 502  ASN B CG  1 
ATOM   7848  O OD1 . ASN B 1 481 ? -4.716  -3.491  107.032 1.00 17.25  ? 502  ASN B OD1 1 
ATOM   7849  N ND2 . ASN B 1 481 ? -5.161  -2.090  108.738 1.00 18.44  ? 502  ASN B ND2 1 
ATOM   7850  N N   . PHE B 1 482 ? -6.281  0.389   104.108 1.00 19.70  ? 503  PHE B N   1 
ATOM   7851  C CA  . PHE B 1 482 ? -7.149  1.170   103.236 1.00 20.60  ? 503  PHE B CA  1 
ATOM   7852  C C   . PHE B 1 482 ? -6.952  0.693   101.805 1.00 20.05  ? 503  PHE B C   1 
ATOM   7853  O O   . PHE B 1 482 ? -7.916  0.459   101.082 1.00 19.84  ? 503  PHE B O   1 
ATOM   7854  C CB  . PHE B 1 482 ? -6.803  2.659   103.337 1.00 22.16  ? 503  PHE B CB  1 
ATOM   7855  C CG  . PHE B 1 482 ? -7.674  3.555   102.493 1.00 21.65  ? 503  PHE B CG  1 
ATOM   7856  C CD1 . PHE B 1 482 ? -9.029  3.681   102.756 1.00 21.83  ? 503  PHE B CD1 1 
ATOM   7857  C CD2 . PHE B 1 482 ? -7.121  4.309   101.461 1.00 22.88  ? 503  PHE B CD2 1 
ATOM   7858  C CE1 . PHE B 1 482 ? -9.823  4.550   102.007 1.00 23.97  ? 503  PHE B CE1 1 
ATOM   7859  C CE2 . PHE B 1 482 ? -7.904  5.182   100.706 1.00 23.41  ? 503  PHE B CE2 1 
ATOM   7860  C CZ  . PHE B 1 482 ? -9.258  5.304   100.979 1.00 23.96  ? 503  PHE B CZ  1 
ATOM   7861  N N   . ALA B 1 483 ? -5.692  0.545   101.412 1.00 19.51  ? 504  ALA B N   1 
ATOM   7862  C CA  . ALA B 1 483 ? -5.355  0.094   100.072 1.00 19.53  ? 504  ALA B CA  1 
ATOM   7863  C C   . ALA B 1 483 ? -6.029  -1.240  99.803  1.00 19.84  ? 504  ALA B C   1 
ATOM   7864  O O   . ALA B 1 483 ? -6.549  -1.477  98.715  1.00 20.42  ? 504  ALA B O   1 
ATOM   7865  C CB  . ALA B 1 483 ? -3.844  -0.039  99.930  1.00 19.50  ? 504  ALA B CB  1 
ATOM   7866  N N   . ARG B 1 484 ? -6.023  -2.112  100.802 1.00 20.87  ? 505  ARG B N   1 
ATOM   7867  C CA  . ARG B 1 484 ? -6.644  -3.416  100.654 1.00 21.78  ? 505  ARG B CA  1 
ATOM   7868  C C   . ARG B 1 484 ? -8.171  -3.394  100.615 1.00 22.41  ? 505  ARG B C   1 
ATOM   7869  O O   . ARG B 1 484 ? -8.761  -3.969  99.707  1.00 22.40  ? 505  ARG B O   1 
ATOM   7870  C CB  . ARG B 1 484 ? -6.185  -4.356  101.772 1.00 21.83  ? 505  ARG B CB  1 
ATOM   7871  C CG  . ARG B 1 484 ? -4.803  -4.956  101.560 1.00 23.06  ? 505  ARG B CG  1 
ATOM   7872  C CD  . ARG B 1 484 ? -4.437  -5.946  102.671 1.00 21.90  ? 505  ARG B CD  1 
ATOM   7873  N NE  . ARG B 1 484 ? -4.101  -5.275  103.923 1.00 21.75  ? 505  ARG B NE  1 
ATOM   7874  C CZ  . ARG B 1 484 ? -2.904  -4.769  104.204 1.00 21.27  ? 505  ARG B CZ  1 
ATOM   7875  N NH1 . ARG B 1 484 ? -1.916  -4.863  103.325 1.00 20.81  ? 505  ARG B NH1 1 
ATOM   7876  N NH2 . ARG B 1 484 ? -2.701  -4.147  105.357 1.00 21.83  ? 505  ARG B NH2 1 
ATOM   7877  N N   . ASN B 1 485 ? -8.815  -2.719  101.569 1.00 22.73  ? 506  ASN B N   1 
ATOM   7878  C CA  . ASN B 1 485 ? -10.277 -2.723  101.615 1.00 24.98  ? 506  ASN B CA  1 
ATOM   7879  C C   . ASN B 1 485 ? -11.015 -1.395  101.575 1.00 25.98  ? 506  ASN B C   1 
ATOM   7880  O O   . ASN B 1 485 ? -12.225 -1.362  101.799 1.00 26.47  ? 506  ASN B O   1 
ATOM   7881  C CB  . ASN B 1 485 ? -10.745 -3.457  102.867 1.00 26.72  ? 506  ASN B CB  1 
ATOM   7882  C CG  . ASN B 1 485 ? -9.930  -4.694  103.154 1.00 30.01  ? 506  ASN B CG  1 
ATOM   7883  O OD1 . ASN B 1 485 ? -9.968  -5.671  102.405 1.00 32.30  ? 506  ASN B OD1 1 
ATOM   7884  N ND2 . ASN B 1 485 ? -9.176  -4.658  104.246 1.00 32.42  ? 506  ASN B ND2 1 
ATOM   7885  N N   . GLY B 1 486 ? -10.325 -0.300  101.298 1.00 25.58  ? 507  GLY B N   1 
ATOM   7886  C CA  . GLY B 1 486 ? -11.025 0.965   101.286 1.00 25.21  ? 507  GLY B CA  1 
ATOM   7887  C C   . GLY B 1 486 ? -11.498 1.255   102.698 1.00 26.38  ? 507  GLY B C   1 
ATOM   7888  O O   . GLY B 1 486 ? -12.488 1.952   102.915 1.00 26.32  ? 507  GLY B O   1 
ATOM   7889  N N   . ASN B 1 487 ? -10.791 0.686   103.669 1.00 27.99  ? 508  ASN B N   1 
ATOM   7890  C CA  . ASN B 1 487 ? -11.098 0.893   105.082 1.00 28.61  ? 508  ASN B CA  1 
ATOM   7891  C C   . ASN B 1 487 ? -9.822  0.700   105.888 1.00 28.24  ? 508  ASN B C   1 
ATOM   7892  O O   . ASN B 1 487 ? -9.306  -0.409  105.986 1.00 28.98  ? 508  ASN B O   1 
ATOM   7893  C CB  . ASN B 1 487 ? -12.141 -0.095  105.569 1.00 29.85  ? 508  ASN B CB  1 
ATOM   7894  C CG  . ASN B 1 487 ? -12.696 0.290   106.914 1.00 30.95  ? 508  ASN B CG  1 
ATOM   7895  O OD1 . ASN B 1 487 ? -11.953 0.696   107.807 1.00 30.84  ? 508  ASN B OD1 1 
ATOM   7896  N ND2 . ASN B 1 487 ? -14.008 0.166   107.071 1.00 32.14  ? 508  ASN B ND2 1 
ATOM   7897  N N   . PRO B 1 488 ? -9.311  1.778   106.496 1.00 27.99  ? 509  PRO B N   1 
ATOM   7898  C CA  . PRO B 1 488 ? -8.080  1.755   107.297 1.00 28.64  ? 509  PRO B CA  1 
ATOM   7899  C C   . PRO B 1 488 ? -8.023  0.826   108.510 1.00 28.66  ? 509  PRO B C   1 
ATOM   7900  O O   . PRO B 1 488 ? -6.953  0.574   109.054 1.00 27.90  ? 509  PRO B O   1 
ATOM   7901  C CB  . PRO B 1 488 ? -7.904  3.222   107.688 1.00 28.32  ? 509  PRO B CB  1 
ATOM   7902  C CG  . PRO B 1 488 ? -9.308  3.710   107.779 1.00 27.79  ? 509  PRO B CG  1 
ATOM   7903  C CD  . PRO B 1 488 ? -9.953  3.102   106.560 1.00 26.80  ? 509  PRO B CD  1 
ATOM   7904  N N   . ASN B 1 489 ? -9.164  0.302   108.927 1.00 30.27  ? 510  ASN B N   1 
ATOM   7905  C CA  . ASN B 1 489 ? -9.188  -0.555  110.097 1.00 32.00  ? 510  ASN B CA  1 
ATOM   7906  C C   . ASN B 1 489 ? -8.566  -1.935  109.925 1.00 33.88  ? 510  ASN B C   1 
ATOM   7907  O O   . ASN B 1 489 ? -8.460  -2.466  108.814 1.00 33.77  ? 510  ASN B O   1 
ATOM   7908  C CB  . ASN B 1 489 ? -10.620 -0.666  110.621 1.00 31.65  ? 510  ASN B CB  1 
ATOM   7909  C CG  . ASN B 1 489 ? -11.106 0.633   111.251 1.00 31.62  ? 510  ASN B CG  1 
ATOM   7910  O OD1 . ASN B 1 489 ? -10.538 1.107   112.235 1.00 31.32  ? 510  ASN B OD1 1 
ATOM   7911  N ND2 . ASN B 1 489 ? -12.151 1.218   110.679 1.00 32.07  ? 510  ASN B ND2 1 
ATOM   7912  N N   . GLY B 1 490 ? -8.132  -2.490  111.053 1.00 35.86  ? 511  GLY B N   1 
ATOM   7913  C CA  . GLY B 1 490 ? -7.510  -3.801  111.081 1.00 37.86  ? 511  GLY B CA  1 
ATOM   7914  C C   . GLY B 1 490 ? -7.249  -4.206  112.522 1.00 39.54  ? 511  GLY B C   1 
ATOM   7915  O O   . GLY B 1 490 ? -7.086  -3.341  113.393 1.00 40.78  ? 511  GLY B O   1 
ATOM   7916  N N   . GLU B 1 491 ? -7.216  -5.510  112.787 1.00 39.86  ? 512  GLU B N   1 
ATOM   7917  C CA  . GLU B 1 491 ? -6.973  -5.995  114.138 1.00 40.65  ? 512  GLU B CA  1 
ATOM   7918  C C   . GLU B 1 491 ? -5.628  -5.545  114.669 1.00 38.55  ? 512  GLU B C   1 
ATOM   7919  O O   . GLU B 1 491 ? -4.611  -5.652  113.984 1.00 38.87  ? 512  GLU B O   1 
ATOM   7920  C CB  . GLU B 1 491 ? -7.070  -7.520  114.190 1.00 45.11  ? 512  GLU B CB  1 
ATOM   7921  C CG  . GLU B 1 491 ? -8.466  -8.012  114.588 1.00 53.03  ? 512  GLU B CG  1 
ATOM   7922  C CD  . GLU B 1 491 ? -8.612  -9.529  114.552 1.00 56.35  ? 512  GLU B CD  1 
ATOM   7923  O OE1 . GLU B 1 491 ? -7.827  -10.224 115.240 1.00 57.95  ? 512  GLU B OE1 1 
ATOM   7924  O OE2 . GLU B 1 491 ? -9.520  -10.021 113.840 1.00 57.92  ? 512  GLU B OE2 1 
ATOM   7925  N N   . GLY B 1 492 ? -5.638  -5.030  115.893 1.00 36.20  ? 513  GLY B N   1 
ATOM   7926  C CA  . GLY B 1 492 ? -4.419  -4.565  116.523 1.00 32.93  ? 513  GLY B CA  1 
ATOM   7927  C C   . GLY B 1 492 ? -4.199  -3.079  116.332 1.00 31.86  ? 513  GLY B C   1 
ATOM   7928  O O   . GLY B 1 492 ? -3.169  -2.545  116.745 1.00 32.72  ? 513  GLY B O   1 
ATOM   7929  N N   . LEU B 1 493 ? -5.171  -2.405  115.720 1.00 30.40  ? 514  LEU B N   1 
ATOM   7930  C CA  . LEU B 1 493 ? -5.071  -0.968  115.455 1.00 28.34  ? 514  LEU B CA  1 
ATOM   7931  C C   . LEU B 1 493 ? -6.202  -0.166  116.081 1.00 26.84  ? 514  LEU B C   1 
ATOM   7932  O O   . LEU B 1 493 ? -7.325  -0.658  116.203 1.00 27.98  ? 514  LEU B O   1 
ATOM   7933  C CB  . LEU B 1 493 ? -5.085  -0.717  113.943 1.00 28.03  ? 514  LEU B CB  1 
ATOM   7934  C CG  . LEU B 1 493 ? -3.867  -1.114  113.119 1.00 26.49  ? 514  LEU B CG  1 
ATOM   7935  C CD1 . LEU B 1 493 ? -4.249  -1.209  111.648 1.00 27.77  ? 514  LEU B CD1 1 
ATOM   7936  C CD2 . LEU B 1 493 ? -2.767  -0.092  113.346 1.00 25.79  ? 514  LEU B CD2 1 
ATOM   7937  N N   . PRO B 1 494 ? -5.925  1.090   116.479 1.00 25.76  ? 515  PRO B N   1 
ATOM   7938  C CA  . PRO B 1 494 ? -6.994  1.895   117.077 1.00 25.61  ? 515  PRO B CA  1 
ATOM   7939  C C   . PRO B 1 494 ? -8.131  1.966   116.065 1.00 26.15  ? 515  PRO B C   1 
ATOM   7940  O O   . PRO B 1 494 ? -7.901  1.810   114.864 1.00 26.46  ? 515  PRO B O   1 
ATOM   7941  C CB  . PRO B 1 494 ? -6.326  3.252   117.293 1.00 24.28  ? 515  PRO B CB  1 
ATOM   7942  C CG  . PRO B 1 494 ? -4.892  2.891   117.528 1.00 23.35  ? 515  PRO B CG  1 
ATOM   7943  C CD  . PRO B 1 494 ? -4.650  1.830   116.472 1.00 24.90  ? 515  PRO B CD  1 
ATOM   7944  N N   . HIS B 1 495 ? -9.353  2.190   116.528 1.00 26.89  ? 516  HIS B N   1 
ATOM   7945  C CA  . HIS B 1 495 ? -10.465 2.259   115.594 1.00 26.63  ? 516  HIS B CA  1 
ATOM   7946  C C   . HIS B 1 495 ? -10.577 3.620   114.925 1.00 26.63  ? 516  HIS B C   1 
ATOM   7947  O O   . HIS B 1 495 ? -10.608 4.658   115.590 1.00 24.12  ? 516  HIS B O   1 
ATOM   7948  C CB  . HIS B 1 495 ? -11.785 1.940   116.274 1.00 26.56  ? 516  HIS B CB  1 
ATOM   7949  C CG  . HIS B 1 495 ? -12.944 1.930   115.331 1.00 27.16  ? 516  HIS B CG  1 
ATOM   7950  N ND1 . HIS B 1 495 ? -13.179 0.890   114.456 1.00 27.56  ? 516  HIS B ND1 1 
ATOM   7951  C CD2 . HIS B 1 495 ? -13.903 2.854   115.089 1.00 27.65  ? 516  HIS B CD2 1 
ATOM   7952  C CE1 . HIS B 1 495 ? -14.235 1.175   113.715 1.00 28.04  ? 516  HIS B CE1 1 
ATOM   7953  N NE2 . HIS B 1 495 ? -14.693 2.361   114.077 1.00 27.97  ? 516  HIS B NE2 1 
ATOM   7954  N N   . TRP B 1 496 ? -10.647 3.588   113.596 1.00 27.77  ? 517  TRP B N   1 
ATOM   7955  C CA  . TRP B 1 496 ? -10.751 4.787   112.780 1.00 27.77  ? 517  TRP B CA  1 
ATOM   7956  C C   . TRP B 1 496 ? -12.189 4.948   112.309 1.00 26.36  ? 517  TRP B C   1 
ATOM   7957  O O   . TRP B 1 496 ? -12.656 4.219   111.435 1.00 24.92  ? 517  TRP B O   1 
ATOM   7958  C CB  . TRP B 1 496 ? -9.825  4.677   111.566 1.00 29.87  ? 517  TRP B CB  1 
ATOM   7959  C CG  . TRP B 1 496 ? -9.507  5.991   110.908 1.00 31.49  ? 517  TRP B CG  1 
ATOM   7960  C CD1 . TRP B 1 496 ? -10.307 7.098   110.845 1.00 31.56  ? 517  TRP B CD1 1 
ATOM   7961  C CD2 . TRP B 1 496 ? -8.318  6.312   110.174 1.00 32.87  ? 517  TRP B CD2 1 
ATOM   7962  N NE1 . TRP B 1 496 ? -9.691  8.087   110.116 1.00 32.87  ? 517  TRP B NE1 1 
ATOM   7963  C CE2 . TRP B 1 496 ? -8.472  7.633   109.691 1.00 33.47  ? 517  TRP B CE2 1 
ATOM   7964  C CE3 . TRP B 1 496 ? -7.140  5.612   109.876 1.00 33.26  ? 517  TRP B CE3 1 
ATOM   7965  C CZ2 . TRP B 1 496 ? -7.487  8.269   108.924 1.00 33.68  ? 517  TRP B CZ2 1 
ATOM   7966  C CZ3 . TRP B 1 496 ? -6.161  6.244   109.114 1.00 33.82  ? 517  TRP B CZ3 1 
ATOM   7967  C CH2 . TRP B 1 496 ? -6.343  7.563   108.647 1.00 34.23  ? 517  TRP B CH2 1 
ATOM   7968  N N   . PRO B 1 497 ? -12.905 5.917   112.886 1.00 26.39  ? 518  PRO B N   1 
ATOM   7969  C CA  . PRO B 1 497 ? -14.298 6.203   112.550 1.00 27.39  ? 518  PRO B CA  1 
ATOM   7970  C C   . PRO B 1 497 ? -14.425 6.649   111.113 1.00 28.88  ? 518  PRO B C   1 
ATOM   7971  O O   . PRO B 1 497 ? -13.534 7.306   110.585 1.00 28.90  ? 518  PRO B O   1 
ATOM   7972  C CB  . PRO B 1 497 ? -14.654 7.324   113.508 1.00 26.54  ? 518  PRO B CB  1 
ATOM   7973  C CG  . PRO B 1 497 ? -13.369 8.080   113.593 1.00 26.98  ? 518  PRO B CG  1 
ATOM   7974  C CD  . PRO B 1 497 ? -12.369 6.959   113.778 1.00 26.98  ? 518  PRO B CD  1 
ATOM   7975  N N   . GLU B 1 498 ? -15.531 6.287   110.476 1.00 31.57  ? 519  GLU B N   1 
ATOM   7976  C CA  . GLU B 1 498 ? -15.747 6.701   109.104 1.00 33.96  ? 519  GLU B CA  1 
ATOM   7977  C C   . GLU B 1 498 ? -16.213 8.153   109.163 1.00 35.11  ? 519  GLU B C   1 
ATOM   7978  O O   . GLU B 1 498 ? -16.920 8.549   110.091 1.00 35.75  ? 519  GLU B O   1 
ATOM   7979  C CB  . GLU B 1 498 ? -16.817 5.849   108.430 1.00 33.38  ? 519  GLU B CB  1 
ATOM   7980  C CG  . GLU B 1 498 ? -16.774 5.976   106.926 1.00 37.92  ? 519  GLU B CG  1 
ATOM   7981  C CD  . GLU B 1 498 ? -18.133 5.838   106.275 1.00 39.99  ? 519  GLU B CD  1 
ATOM   7982  O OE1 . GLU B 1 498 ? -18.771 4.776   106.434 1.00 42.16  ? 519  GLU B OE1 1 
ATOM   7983  O OE2 . GLU B 1 498 ? -18.562 6.799   105.597 1.00 41.24  ? 519  GLU B OE2 1 
ATOM   7984  N N   . TYR B 1 499 ? -15.797 8.955   108.191 1.00 35.82  ? 520  TYR B N   1 
ATOM   7985  C CA  . TYR B 1 499 ? -16.204 10.345  108.177 1.00 36.75  ? 520  TYR B CA  1 
ATOM   7986  C C   . TYR B 1 499 ? -17.595 10.423  107.565 1.00 40.25  ? 520  TYR B C   1 
ATOM   7987  O O   . TYR B 1 499 ? -17.772 10.274  106.343 1.00 41.84  ? 520  TYR B O   1 
ATOM   7988  C CB  . TYR B 1 499 ? -15.237 11.191  107.359 1.00 32.95  ? 520  TYR B CB  1 
ATOM   7989  C CG  . TYR B 1 499 ? -15.462 12.675  107.504 1.00 27.65  ? 520  TYR B CG  1 
ATOM   7990  C CD1 . TYR B 1 499 ? -14.873 13.388  108.545 1.00 25.97  ? 520  TYR B CD1 1 
ATOM   7991  C CD2 . TYR B 1 499 ? -16.237 13.371  106.582 1.00 25.63  ? 520  TYR B CD2 1 
ATOM   7992  C CE1 . TYR B 1 499 ? -15.043 14.766  108.658 1.00 25.46  ? 520  TYR B CE1 1 
ATOM   7993  C CE2 . TYR B 1 499 ? -16.419 14.746  106.685 1.00 24.71  ? 520  TYR B CE2 1 
ATOM   7994  C CZ  . TYR B 1 499 ? -15.819 15.440  107.724 1.00 25.10  ? 520  TYR B CZ  1 
ATOM   7995  O OH  . TYR B 1 499 ? -15.994 16.803  107.830 1.00 22.89  ? 520  TYR B OH  1 
ATOM   7996  N N   . ASN B 1 500 ? -18.581 10.635  108.431 1.00 41.45  ? 521  ASN B N   1 
ATOM   7997  C CA  . ASN B 1 500 ? -19.973 10.751  108.015 1.00 41.55  ? 521  ASN B CA  1 
ATOM   7998  C C   . ASN B 1 500 ? -20.543 12.016  108.640 1.00 41.97  ? 521  ASN B C   1 
ATOM   7999  O O   . ASN B 1 500 ? -19.846 13.025  108.741 1.00 41.65  ? 521  ASN B O   1 
ATOM   8000  C CB  . ASN B 1 500 ? -20.758 9.522   108.489 1.00 40.67  ? 521  ASN B CB  1 
ATOM   8001  C CG  . ASN B 1 500 ? -20.551 9.235   109.958 1.00 41.01  ? 521  ASN B CG  1 
ATOM   8002  O OD1 . ASN B 1 500 ? -20.483 10.148  110.787 1.00 41.86  ? 521  ASN B OD1 1 
ATOM   8003  N ND2 . ASN B 1 500 ? -20.462 7.957   110.295 1.00 39.90  ? 521  ASN B ND2 1 
ATOM   8004  N N   . GLN B 1 501 ? -21.800 11.962  109.073 1.00 42.71  ? 522  GLN B N   1 
ATOM   8005  C CA  . GLN B 1 501 ? -22.428 13.112  109.708 1.00 42.63  ? 522  GLN B CA  1 
ATOM   8006  C C   . GLN B 1 501 ? -21.756 13.479  111.024 1.00 42.51  ? 522  GLN B C   1 
ATOM   8007  O O   . GLN B 1 501 ? -21.587 14.657  111.311 1.00 42.27  ? 522  GLN B O   1 
ATOM   8008  C CB  . GLN B 1 501 ? -23.920 12.861  109.936 1.00 43.98  ? 522  GLN B CB  1 
ATOM   8009  C CG  . GLN B 1 501 ? -24.712 12.613  108.657 1.00 46.61  ? 522  GLN B CG  1 
ATOM   8010  C CD  . GLN B 1 501 ? -24.486 13.678  107.571 1.00 47.86  ? 522  GLN B CD  1 
ATOM   8011  O OE1 . GLN B 1 501 ? -24.499 14.884  107.837 1.00 47.99  ? 522  GLN B OE1 1 
ATOM   8012  N NE2 . GLN B 1 501 ? -24.294 13.223  106.336 1.00 48.38  ? 522  GLN B NE2 1 
ATOM   8013  N N   . LYS B 1 502 ? -21.372 12.478  111.816 1.00 43.01  ? 523  LYS B N   1 
ATOM   8014  C CA  . LYS B 1 502 ? -20.703 12.750  113.089 1.00 43.38  ? 523  LYS B CA  1 
ATOM   8015  C C   . LYS B 1 502 ? -19.357 13.406  112.845 1.00 42.51  ? 523  LYS B C   1 
ATOM   8016  O O   . LYS B 1 502 ? -18.768 13.996  113.752 1.00 42.55  ? 523  LYS B O   1 
ATOM   8017  C CB  . LYS B 1 502 ? -20.470 11.463  113.887 1.00 45.14  ? 523  LYS B CB  1 
ATOM   8018  C CG  . LYS B 1 502 ? -21.701 10.890  114.565 1.00 45.92  ? 523  LYS B CG  1 
ATOM   8019  C CD  . LYS B 1 502 ? -22.397 9.859   113.699 1.00 47.49  ? 523  LYS B CD  1 
ATOM   8020  C CE  . LYS B 1 502 ? -23.328 9.015   114.547 1.00 48.89  ? 523  LYS B CE  1 
ATOM   8021  N NZ  . LYS B 1 502 ? -22.598 8.477   115.732 1.00 49.31  ? 523  LYS B NZ  1 
ATOM   8022  N N   . GLU B 1 503 ? -18.878 13.288  111.612 1.00 41.31  ? 524  GLU B N   1 
ATOM   8023  C CA  . GLU B 1 503 ? -17.596 13.850  111.223 1.00 39.54  ? 524  GLU B CA  1 
ATOM   8024  C C   . GLU B 1 503 ? -16.457 13.322  112.092 1.00 38.46  ? 524  GLU B C   1 
ATOM   8025  O O   . GLU B 1 503 ? -15.603 14.083  112.550 1.00 38.19  ? 524  GLU B O   1 
ATOM   8026  C CB  . GLU B 1 503 ? -17.640 15.381  111.283 1.00 38.82  ? 524  GLU B CB  1 
ATOM   8027  C CG  . GLU B 1 503 ? -18.506 16.002  110.203 1.00 38.60  ? 524  GLU B CG  1 
ATOM   8028  C CD  . GLU B 1 503 ? -18.370 17.507  110.143 1.00 39.60  ? 524  GLU B CD  1 
ATOM   8029  O OE1 . GLU B 1 503 ? -18.960 18.115  109.228 1.00 39.73  ? 524  GLU B OE1 1 
ATOM   8030  O OE2 . GLU B 1 503 ? -17.673 18.082  111.006 1.00 39.28  ? 524  GLU B OE2 1 
ATOM   8031  N N   . GLY B 1 504 ? -16.454 12.013  112.319 1.00 36.80  ? 525  GLY B N   1 
ATOM   8032  C CA  . GLY B 1 504 ? -15.401 11.419  113.114 1.00 34.90  ? 525  GLY B CA  1 
ATOM   8033  C C   . GLY B 1 504 ? -14.141 11.281  112.283 1.00 33.65  ? 525  GLY B C   1 
ATOM   8034  O O   . GLY B 1 504 ? -14.188 10.805  111.151 1.00 33.28  ? 525  GLY B O   1 
ATOM   8035  N N   . TYR B 1 505 ? -13.013 11.708  112.841 1.00 33.03  ? 526  TYR B N   1 
ATOM   8036  C CA  . TYR B 1 505 ? -11.729 11.623  112.152 1.00 32.02  ? 526  TYR B CA  1 
ATOM   8037  C C   . TYR B 1 505 ? -10.694 11.077  113.122 1.00 31.97  ? 526  TYR B C   1 
ATOM   8038  O O   . TYR B 1 505 ? -10.953 10.986  114.318 1.00 32.62  ? 526  TYR B O   1 
ATOM   8039  C CB  . TYR B 1 505 ? -11.292 13.001  111.668 1.00 31.31  ? 526  TYR B CB  1 
ATOM   8040  C CG  . TYR B 1 505 ? -10.868 13.945  112.773 1.00 29.94  ? 526  TYR B CG  1 
ATOM   8041  C CD1 . TYR B 1 505 ? -9.529  14.074  113.127 1.00 30.31  ? 526  TYR B CD1 1 
ATOM   8042  C CD2 . TYR B 1 505 ? -11.804 14.734  113.443 1.00 29.12  ? 526  TYR B CD2 1 
ATOM   8043  C CE1 . TYR B 1 505 ? -9.129  14.974  114.116 1.00 29.93  ? 526  TYR B CE1 1 
ATOM   8044  C CE2 . TYR B 1 505 ? -11.416 15.633  114.434 1.00 28.20  ? 526  TYR B CE2 1 
ATOM   8045  C CZ  . TYR B 1 505 ? -10.077 15.750  114.762 1.00 28.13  ? 526  TYR B CZ  1 
ATOM   8046  O OH  . TYR B 1 505 ? -9.679  16.656  115.715 1.00 26.94  ? 526  TYR B OH  1 
ATOM   8047  N N   . LEU B 1 506 ? -9.517  10.732  112.616 1.00 31.29  ? 527  LEU B N   1 
ATOM   8048  C CA  . LEU B 1 506 ? -8.482  10.180  113.471 1.00 30.38  ? 527  LEU B CA  1 
ATOM   8049  C C   . LEU B 1 506 ? -7.279  11.078  113.673 1.00 30.75  ? 527  LEU B C   1 
ATOM   8050  O O   . LEU B 1 506 ? -6.684  11.560  112.718 1.00 29.91  ? 527  LEU B O   1 
ATOM   8051  C CB  . LEU B 1 506 ? -8.013  8.835   112.918 1.00 28.89  ? 527  LEU B CB  1 
ATOM   8052  C CG  . LEU B 1 506 ? -6.865  8.176   113.680 1.00 28.66  ? 527  LEU B CG  1 
ATOM   8053  C CD1 . LEU B 1 506 ? -7.276  7.922   115.117 1.00 27.67  ? 527  LEU B CD1 1 
ATOM   8054  C CD2 . LEU B 1 506 ? -6.482  6.881   112.994 1.00 29.78  ? 527  LEU B CD2 1 
ATOM   8055  N N   . GLN B 1 507 ? -6.932  11.301  114.935 1.00 33.18  ? 528  GLN B N   1 
ATOM   8056  C CA  . GLN B 1 507 ? -5.768  12.108  115.279 1.00 34.74  ? 528  GLN B CA  1 
ATOM   8057  C C   . GLN B 1 507 ? -4.640  11.109  115.434 1.00 34.11  ? 528  GLN B C   1 
ATOM   8058  O O   . GLN B 1 507 ? -4.759  10.150  116.201 1.00 33.01  ? 528  GLN B O   1 
ATOM   8059  C CB  . GLN B 1 507 ? -5.976  12.842  116.605 1.00 37.02  ? 528  GLN B CB  1 
ATOM   8060  C CG  . GLN B 1 507 ? -7.085  13.873  116.582 1.00 39.86  ? 528  GLN B CG  1 
ATOM   8061  C CD  . GLN B 1 507 ? -7.420  14.388  117.967 1.00 41.26  ? 528  GLN B CD  1 
ATOM   8062  O OE1 . GLN B 1 507 ? -7.691  13.604  118.880 1.00 42.48  ? 528  GLN B OE1 1 
ATOM   8063  N NE2 . GLN B 1 507 ? -7.409  15.708  118.132 1.00 41.33  ? 528  GLN B NE2 1 
ATOM   8064  N N   . ILE B 1 508 ? -3.554  11.332  114.701 1.00 33.98  ? 529  ILE B N   1 
ATOM   8065  C CA  . ILE B 1 508 ? -2.405  10.434  114.738 1.00 33.15  ? 529  ILE B CA  1 
ATOM   8066  C C   . ILE B 1 508 ? -1.179  11.096  115.354 1.00 33.12  ? 529  ILE B C   1 
ATOM   8067  O O   . ILE B 1 508 ? -0.847  12.240  115.028 1.00 32.83  ? 529  ILE B O   1 
ATOM   8068  C CB  . ILE B 1 508 ? -2.040  9.955   113.319 1.00 32.73  ? 529  ILE B CB  1 
ATOM   8069  C CG1 . ILE B 1 508 ? -3.252  9.273   112.672 1.00 30.94  ? 529  ILE B CG1 1 
ATOM   8070  C CG2 . ILE B 1 508 ? -0.842  9.019   113.385 1.00 33.37  ? 529  ILE B CG2 1 
ATOM   8071  C CD1 . ILE B 1 508 ? -3.014  8.803   111.258 1.00 29.09  ? 529  ILE B CD1 1 
ATOM   8072  N N   . GLY B 1 509 ? -0.505  10.364  116.239 1.00 33.19  ? 530  GLY B N   1 
ATOM   8073  C CA  . GLY B 1 509 ? 0.682   10.891  116.890 1.00 32.69  ? 530  GLY B CA  1 
ATOM   8074  C C   . GLY B 1 509 ? 1.136   10.018  118.041 1.00 32.15  ? 530  GLY B C   1 
ATOM   8075  O O   . GLY B 1 509 ? 0.972   8.794   117.994 1.00 32.82  ? 530  GLY B O   1 
ATOM   8076  N N   . ALA B 1 510 ? 1.709   10.643  119.070 1.00 31.73  ? 531  ALA B N   1 
ATOM   8077  C CA  . ALA B 1 510 ? 2.179   9.925   120.254 1.00 31.04  ? 531  ALA B CA  1 
ATOM   8078  C C   . ALA B 1 510 ? 1.040   9.054   120.747 1.00 31.40  ? 531  ALA B C   1 
ATOM   8079  O O   . ALA B 1 510 ? 1.211   7.871   121.025 1.00 31.08  ? 531  ALA B O   1 
ATOM   8080  C CB  . ALA B 1 510 ? 2.579   10.906  121.328 1.00 30.74  ? 531  ALA B CB  1 
ATOM   8081  N N   . ASN B 1 511 ? -0.131  9.668   120.844 1.00 32.12  ? 532  ASN B N   1 
ATOM   8082  C CA  . ASN B 1 511 ? -1.340  8.989   121.265 1.00 33.15  ? 532  ASN B CA  1 
ATOM   8083  C C   . ASN B 1 511 ? -2.306  9.109   120.094 1.00 34.42  ? 532  ASN B C   1 
ATOM   8084  O O   . ASN B 1 511 ? -2.800  10.193  119.795 1.00 35.17  ? 532  ASN B O   1 
ATOM   8085  C CB  . ASN B 1 511 ? -1.909  9.662   122.521 1.00 33.49  ? 532  ASN B CB  1 
ATOM   8086  C CG  . ASN B 1 511 ? -3.281  9.129   122.910 1.00 33.92  ? 532  ASN B CG  1 
ATOM   8087  O OD1 . ASN B 1 511 ? -3.621  7.976   122.636 1.00 34.16  ? 532  ASN B OD1 1 
ATOM   8088  N ND2 . ASN B 1 511 ? -4.072  9.970   123.570 1.00 33.98  ? 532  ASN B ND2 1 
ATOM   8089  N N   . THR B 1 512 ? -2.545  7.994   119.415 1.00 35.90  ? 533  THR B N   1 
ATOM   8090  C CA  . THR B 1 512 ? -3.446  7.961   118.269 1.00 37.57  ? 533  THR B CA  1 
ATOM   8091  C C   . THR B 1 512 ? -4.858  7.638   118.739 1.00 38.10  ? 533  THR B C   1 
ATOM   8092  O O   . THR B 1 512 ? -5.146  6.501   119.105 1.00 38.33  ? 533  THR B O   1 
ATOM   8093  C CB  . THR B 1 512 ? -2.996  6.890   117.255 1.00 38.19  ? 533  THR B CB  1 
ATOM   8094  O OG1 . THR B 1 512 ? -1.640  7.146   116.863 1.00 39.24  ? 533  THR B OG1 1 
ATOM   8095  C CG2 . THR B 1 512 ? -3.898  6.905   116.028 1.00 37.55  ? 533  THR B CG2 1 
ATOM   8096  N N   . GLN B 1 513 ? -5.737  8.637   118.721 1.00 39.33  ? 534  GLN B N   1 
ATOM   8097  C CA  . GLN B 1 513 ? -7.118  8.455   119.174 1.00 39.60  ? 534  GLN B CA  1 
ATOM   8098  C C   . GLN B 1 513 ? -8.125  9.142   118.251 1.00 38.69  ? 534  GLN B C   1 
ATOM   8099  O O   . GLN B 1 513 ? -7.823  10.167  117.634 1.00 38.95  ? 534  GLN B O   1 
ATOM   8100  C CB  . GLN B 1 513 ? -7.266  9.027   120.581 1.00 41.29  ? 534  GLN B CB  1 
ATOM   8101  C CG  . GLN B 1 513 ? -7.199  10.544  120.602 1.00 44.77  ? 534  GLN B CG  1 
ATOM   8102  C CD  . GLN B 1 513 ? -6.937  11.101  121.979 1.00 47.18  ? 534  GLN B CD  1 
ATOM   8103  O OE1 . GLN B 1 513 ? -7.580  10.703  122.952 1.00 49.49  ? 534  GLN B OE1 1 
ATOM   8104  N NE2 . GLN B 1 513 ? -5.992  12.037  122.073 1.00 48.90  ? 534  GLN B NE2 1 
ATOM   8105  N N   . ALA B 1 514 ? -9.330  8.584   118.178 1.00 37.43  ? 535  ALA B N   1 
ATOM   8106  C CA  . ALA B 1 514 ? -10.384 9.139   117.333 1.00 36.38  ? 535  ALA B CA  1 
ATOM   8107  C C   . ALA B 1 514 ? -11.024 10.390  117.928 1.00 35.79  ? 535  ALA B C   1 
ATOM   8108  O O   . ALA B 1 514 ? -11.102 10.544  119.143 1.00 35.87  ? 535  ALA B O   1 
ATOM   8109  C CB  . ALA B 1 514 ? -11.448 8.088   117.081 1.00 34.36  ? 535  ALA B CB  1 
ATOM   8110  N N   . ALA B 1 515 ? -11.475 11.282  117.053 1.00 36.73  ? 536  ALA B N   1 
ATOM   8111  C CA  . ALA B 1 515 ? -12.127 12.523  117.456 1.00 37.74  ? 536  ALA B CA  1 
ATOM   8112  C C   . ALA B 1 515 ? -13.231 12.856  116.454 1.00 39.61  ? 536  ALA B C   1 
ATOM   8113  O O   . ALA B 1 515 ? -13.603 12.019  115.621 1.00 39.52  ? 536  ALA B O   1 
ATOM   8114  C CB  . ALA B 1 515 ? -11.121 13.654  117.517 1.00 36.65  ? 536  ALA B CB  1 
ATOM   8115  N N   . GLN B 1 516 ? -13.757 14.075  116.531 1.00 41.07  ? 537  GLN B N   1 
ATOM   8116  C CA  . GLN B 1 516 ? -14.825 14.486  115.625 1.00 41.89  ? 537  GLN B CA  1 
ATOM   8117  C C   . GLN B 1 516 ? -14.820 15.983  115.328 1.00 41.77  ? 537  GLN B C   1 
ATOM   8118  O O   . GLN B 1 516 ? -14.213 16.770  116.052 1.00 42.29  ? 537  GLN B O   1 
ATOM   8119  C CB  . GLN B 1 516 ? -16.182 14.089  116.207 1.00 42.26  ? 537  GLN B CB  1 
ATOM   8120  C CG  . GLN B 1 516 ? -16.374 12.597  116.381 1.00 43.85  ? 537  GLN B CG  1 
ATOM   8121  C CD  . GLN B 1 516 ? -17.710 12.261  117.015 1.00 46.83  ? 537  GLN B CD  1 
ATOM   8122  O OE1 . GLN B 1 516 ? -18.107 11.094  117.070 1.00 48.72  ? 537  GLN B OE1 1 
ATOM   8123  N NE2 . GLN B 1 516 ? -18.411 13.283  117.504 1.00 45.90  ? 537  GLN B NE2 1 
ATOM   8124  N N   . LYS B 1 517 ? -15.505 16.356  114.250 1.00 41.88  ? 538  LYS B N   1 
ATOM   8125  C CA  . LYS B 1 517 ? -15.619 17.747  113.820 1.00 41.79  ? 538  LYS B CA  1 
ATOM   8126  C C   . LYS B 1 517 ? -14.272 18.447  113.641 1.00 39.37  ? 538  LYS B C   1 
ATOM   8127  O O   . LYS B 1 517 ? -13.872 19.287  114.449 1.00 38.89  ? 538  LYS B O   1 
ATOM   8128  C CB  . LYS B 1 517 ? -16.504 18.528  114.802 1.00 43.98  ? 538  LYS B CB  1 
ATOM   8129  C CG  . LYS B 1 517 ? -17.959 18.040  114.850 1.00 46.80  ? 538  LYS B CG  1 
ATOM   8130  C CD  . LYS B 1 517 ? -18.814 18.881  115.801 1.00 49.27  ? 538  LYS B CD  1 
ATOM   8131  C CE  . LYS B 1 517 ? -20.273 18.409  115.833 1.00 50.38  ? 538  LYS B CE  1 
ATOM   8132  N NZ  . LYS B 1 517 ? -21.119 19.190  116.797 1.00 49.38  ? 538  LYS B NZ  1 
ATOM   8133  N N   . LEU B 1 518 ? -13.592 18.097  112.555 1.00 36.81  ? 539  LEU B N   1 
ATOM   8134  C CA  . LEU B 1 518 ? -12.289 18.656  112.221 1.00 34.74  ? 539  LEU B CA  1 
ATOM   8135  C C   . LEU B 1 518 ? -12.409 20.035  111.568 1.00 33.61  ? 539  LEU B C   1 
ATOM   8136  O O   . LEU B 1 518 ? -13.120 20.192  110.581 1.00 33.33  ? 539  LEU B O   1 
ATOM   8137  C CB  . LEU B 1 518 ? -11.565 17.690  111.284 1.00 33.17  ? 539  LEU B CB  1 
ATOM   8138  C CG  . LEU B 1 518 ? -10.162 18.016  110.789 1.00 31.66  ? 539  LEU B CG  1 
ATOM   8139  C CD1 . LEU B 1 518 ? -9.203  18.206  111.949 1.00 30.23  ? 539  LEU B CD1 1 
ATOM   8140  C CD2 . LEU B 1 518 ? -9.709  16.874  109.912 1.00 32.39  ? 539  LEU B CD2 1 
ATOM   8141  N N   . LYS B 1 519 ? -11.707 21.021  112.126 1.00 33.27  ? 540  LYS B N   1 
ATOM   8142  C CA  . LYS B 1 519 ? -11.718 22.399  111.622 1.00 33.71  ? 540  LYS B CA  1 
ATOM   8143  C C   . LYS B 1 519 ? -13.125 22.904  111.326 1.00 34.83  ? 540  LYS B C   1 
ATOM   8144  O O   . LYS B 1 519 ? -13.313 23.763  110.462 1.00 33.82  ? 540  LYS B O   1 
ATOM   8145  C CB  . LYS B 1 519 ? -10.871 22.529  110.348 1.00 33.29  ? 540  LYS B CB  1 
ATOM   8146  C CG  . LYS B 1 519 ? -9.380  22.267  110.519 1.00 30.81  ? 540  LYS B CG  1 
ATOM   8147  C CD  . LYS B 1 519 ? -8.689  23.362  111.300 1.00 28.93  ? 540  LYS B CD  1 
ATOM   8148  C CE  . LYS B 1 519 ? -7.215  23.035  111.483 1.00 29.32  ? 540  LYS B CE  1 
ATOM   8149  N NZ  . LYS B 1 519 ? -6.507  24.015  112.353 1.00 29.77  ? 540  LYS B NZ  1 
ATOM   8150  N N   . ASP B 1 520 ? -14.105 22.373  112.052 1.00 37.02  ? 541  ASP B N   1 
ATOM   8151  C CA  . ASP B 1 520 ? -15.504 22.750  111.883 1.00 37.96  ? 541  ASP B CA  1 
ATOM   8152  C C   . ASP B 1 520 ? -15.721 24.249  112.066 1.00 38.24  ? 541  ASP B C   1 
ATOM   8153  O O   . ASP B 1 520 ? -16.348 24.900  111.233 1.00 37.64  ? 541  ASP B O   1 
ATOM   8154  C CB  . ASP B 1 520 ? -16.368 21.989  112.879 1.00 40.00  ? 541  ASP B CB  1 
ATOM   8155  C CG  . ASP B 1 520 ? -17.787 21.810  112.393 1.00 42.97  ? 541  ASP B CG  1 
ATOM   8156  O OD1 . ASP B 1 520 ? -18.419 22.821  112.014 1.00 44.27  ? 541  ASP B OD1 1 
ATOM   8157  O OD2 . ASP B 1 520 ? -18.271 20.655  112.389 1.00 44.50  ? 541  ASP B OD2 1 
ATOM   8158  N N   . LYS B 1 521 ? -15.216 24.797  113.165 1.00 39.62  ? 542  LYS B N   1 
ATOM   8159  C CA  . LYS B 1 521 ? -15.356 26.225  113.409 1.00 40.90  ? 542  LYS B CA  1 
ATOM   8160  C C   . LYS B 1 521 ? -14.707 26.947  112.241 1.00 40.72  ? 542  LYS B C   1 
ATOM   8161  O O   . LYS B 1 521 ? -15.323 27.787  111.585 1.00 40.90  ? 542  LYS B O   1 
ATOM   8162  C CB  . LYS B 1 521 ? -14.652 26.629  114.707 1.00 42.48  ? 542  LYS B CB  1 
ATOM   8163  C CG  . LYS B 1 521 ? -14.615 28.138  114.928 1.00 46.62  ? 542  LYS B CG  1 
ATOM   8164  C CD  . LYS B 1 521 ? -13.930 28.526  116.242 1.00 50.98  ? 542  LYS B CD  1 
ATOM   8165  C CE  . LYS B 1 521 ? -13.981 30.052  116.465 1.00 53.57  ? 542  LYS B CE  1 
ATOM   8166  N NZ  . LYS B 1 521 ? -13.296 30.531  117.717 1.00 52.74  ? 542  LYS B NZ  1 
ATOM   8167  N N   . GLU B 1 522 ? -13.454 26.586  111.987 1.00 40.77  ? 543  GLU B N   1 
ATOM   8168  C CA  . GLU B 1 522 ? -12.656 27.165  110.917 1.00 40.47  ? 543  GLU B CA  1 
ATOM   8169  C C   . GLU B 1 522 ? -13.372 27.210  109.569 1.00 40.97  ? 543  GLU B C   1 
ATOM   8170  O O   . GLU B 1 522 ? -13.431 28.258  108.926 1.00 41.37  ? 543  GLU B O   1 
ATOM   8171  C CB  . GLU B 1 522 ? -11.340 26.395  110.787 1.00 39.79  ? 543  GLU B CB  1 
ATOM   8172  C CG  . GLU B 1 522 ? -10.359 26.638  111.936 1.00 37.54  ? 543  GLU B CG  1 
ATOM   8173  C CD  . GLU B 1 522 ? -10.832 26.081  113.269 1.00 35.26  ? 543  GLU B CD  1 
ATOM   8174  O OE1 . GLU B 1 522 ? -10.201 26.402  114.297 1.00 33.28  ? 543  GLU B OE1 1 
ATOM   8175  O OE2 . GLU B 1 522 ? -11.822 25.321  113.293 1.00 34.20  ? 543  GLU B OE2 1 
ATOM   8176  N N   . VAL B 1 523 ? -13.909 26.074  109.138 1.00 41.43  ? 544  VAL B N   1 
ATOM   8177  C CA  . VAL B 1 523 ? -14.622 26.013  107.868 1.00 40.52  ? 544  VAL B CA  1 
ATOM   8178  C C   . VAL B 1 523 ? -15.765 27.021  107.881 1.00 41.11  ? 544  VAL B C   1 
ATOM   8179  O O   . VAL B 1 523 ? -15.996 27.731  106.900 1.00 40.61  ? 544  VAL B O   1 
ATOM   8180  C CB  . VAL B 1 523 ? -15.186 24.604  107.623 1.00 39.53  ? 544  VAL B CB  1 
ATOM   8181  C CG1 . VAL B 1 523 ? -15.979 24.572  106.331 1.00 39.53  ? 544  VAL B CG1 1 
ATOM   8182  C CG2 . VAL B 1 523 ? -14.048 23.604  107.571 1.00 39.30  ? 544  VAL B CG2 1 
ATOM   8183  N N   . ALA B 1 524 ? -16.465 27.088  109.011 1.00 42.01  ? 545  ALA B N   1 
ATOM   8184  C CA  . ALA B 1 524 ? -17.590 28.003  109.182 1.00 42.19  ? 545  ALA B CA  1 
ATOM   8185  C C   . ALA B 1 524 ? -17.178 29.457  109.000 1.00 42.14  ? 545  ALA B C   1 
ATOM   8186  O O   . ALA B 1 524 ? -17.670 30.147  108.104 1.00 42.02  ? 545  ALA B O   1 
ATOM   8187  C CB  . ALA B 1 524 ? -18.203 27.816  110.556 1.00 42.66  ? 545  ALA B CB  1 
ATOM   8188  N N   . PHE B 1 525 ? -16.278 29.924  109.856 1.00 41.95  ? 546  PHE B N   1 
ATOM   8189  C CA  . PHE B 1 525 ? -15.820 31.301  109.773 1.00 42.99  ? 546  PHE B CA  1 
ATOM   8190  C C   . PHE B 1 525 ? -15.444 31.720  108.352 1.00 43.97  ? 546  PHE B C   1 
ATOM   8191  O O   . PHE B 1 525 ? -15.874 32.774  107.878 1.00 44.76  ? 546  PHE B O   1 
ATOM   8192  C CB  . PHE B 1 525 ? -14.618 31.526  110.684 1.00 42.13  ? 546  PHE B CB  1 
ATOM   8193  C CG  . PHE B 1 525 ? -13.970 32.856  110.485 1.00 41.98  ? 546  PHE B CG  1 
ATOM   8194  C CD1 . PHE B 1 525 ? -14.639 34.020  110.828 1.00 41.40  ? 546  PHE B CD1 1 
ATOM   8195  C CD2 . PHE B 1 525 ? -12.723 32.951  109.875 1.00 43.01  ? 546  PHE B CD2 1 
ATOM   8196  C CE1 . PHE B 1 525 ? -14.080 35.267  110.560 1.00 43.34  ? 546  PHE B CE1 1 
ATOM   8197  C CE2 . PHE B 1 525 ? -12.152 34.192  109.601 1.00 43.47  ? 546  PHE B CE2 1 
ATOM   8198  C CZ  . PHE B 1 525 ? -12.833 35.355  109.943 1.00 43.42  ? 546  PHE B CZ  1 
ATOM   8199  N N   . TRP B 1 526 ? -14.648 30.896  107.675 1.00 44.21  ? 547  TRP B N   1 
ATOM   8200  C CA  . TRP B 1 526 ? -14.205 31.208  106.321 1.00 44.57  ? 547  TRP B CA  1 
ATOM   8201  C C   . TRP B 1 526 ? -15.252 31.085  105.220 1.00 46.22  ? 547  TRP B C   1 
ATOM   8202  O O   . TRP B 1 526 ? -15.228 31.849  104.252 1.00 46.16  ? 547  TRP B O   1 
ATOM   8203  C CB  . TRP B 1 526 ? -12.987 30.363  105.962 1.00 41.74  ? 547  TRP B CB  1 
ATOM   8204  C CG  . TRP B 1 526 ? -11.811 30.679  106.810 1.00 39.73  ? 547  TRP B CG  1 
ATOM   8205  C CD1 . TRP B 1 526 ? -11.368 29.979  107.893 1.00 39.44  ? 547  TRP B CD1 1 
ATOM   8206  C CD2 . TRP B 1 526 ? -10.947 31.808  106.678 1.00 39.35  ? 547  TRP B CD2 1 
ATOM   8207  N NE1 . TRP B 1 526 ? -10.279 30.603  108.445 1.00 39.18  ? 547  TRP B NE1 1 
ATOM   8208  C CE2 . TRP B 1 526 ? -9.999  31.729  107.719 1.00 39.49  ? 547  TRP B CE2 1 
ATOM   8209  C CE3 . TRP B 1 526 ? -10.880 32.881  105.782 1.00 39.69  ? 547  TRP B CE3 1 
ATOM   8210  C CZ2 . TRP B 1 526 ? -8.995  32.685  107.889 1.00 39.74  ? 547  TRP B CZ2 1 
ATOM   8211  C CZ3 . TRP B 1 526 ? -9.879  33.833  105.951 1.00 39.78  ? 547  TRP B CZ3 1 
ATOM   8212  C CH2 . TRP B 1 526 ? -8.951  33.727  106.998 1.00 39.80  ? 547  TRP B CH2 1 
ATOM   8213  N N   . THR B 1 527 ? -16.165 30.131  105.348 1.00 47.87  ? 548  THR B N   1 
ATOM   8214  C CA  . THR B 1 527 ? -17.193 29.979  104.331 1.00 51.64  ? 548  THR B CA  1 
ATOM   8215  C C   . THR B 1 527 ? -17.940 31.302  104.199 1.00 53.91  ? 548  THR B C   1 
ATOM   8216  O O   . THR B 1 527 ? -18.374 31.679  103.109 1.00 54.79  ? 548  THR B O   1 
ATOM   8217  C CB  . THR B 1 527 ? -18.200 28.878  104.703 1.00 52.25  ? 548  THR B CB  1 
ATOM   8218  O OG1 . THR B 1 527 ? -17.513 27.629  104.846 1.00 52.93  ? 548  THR B OG1 1 
ATOM   8219  C CG2 . THR B 1 527 ? -19.263 28.743  103.623 1.00 52.16  ? 548  THR B CG2 1 
ATOM   8220  N N   . ASN B 1 528 ? -18.064 32.006  105.321 1.00 56.54  ? 549  ASN B N   1 
ATOM   8221  C CA  . ASN B 1 528 ? -18.760 33.290  105.381 1.00 58.88  ? 549  ASN B CA  1 
ATOM   8222  C C   . ASN B 1 528 ? -17.916 34.465  104.896 1.00 59.60  ? 549  ASN B C   1 
ATOM   8223  O O   . ASN B 1 528 ? -18.277 35.137  103.929 1.00 59.75  ? 549  ASN B O   1 
ATOM   8224  C CB  . ASN B 1 528 ? -19.225 33.553  106.814 1.00 60.14  ? 549  ASN B CB  1 
ATOM   8225  C CG  . ASN B 1 528 ? -20.178 32.486  107.314 1.00 61.91  ? 549  ASN B CG  1 
ATOM   8226  O OD1 . ASN B 1 528 ? -20.337 31.437  106.685 1.00 62.36  ? 549  ASN B OD1 1 
ATOM   8227  N ND2 . ASN B 1 528 ? -20.813 32.743  108.453 1.00 62.82  ? 549  ASN B ND2 1 
ATOM   8228  N N   . LEU B 1 529 ? -16.801 34.717  105.572 1.00 60.45  ? 550  LEU B N   1 
ATOM   8229  C CA  . LEU B 1 529 ? -15.923 35.815  105.196 1.00 61.93  ? 550  LEU B CA  1 
ATOM   8230  C C   . LEU B 1 529 ? -15.746 35.895  103.681 1.00 63.45  ? 550  LEU B C   1 
ATOM   8231  O O   . LEU B 1 529 ? -15.819 36.979  103.099 1.00 64.09  ? 550  LEU B O   1 
ATOM   8232  C CB  . LEU B 1 529 ? -14.555 35.655  105.867 1.00 62.27  ? 550  LEU B CB  1 
ATOM   8233  C CG  . LEU B 1 529 ? -13.501 36.729  105.561 1.00 62.83  ? 550  LEU B CG  1 
ATOM   8234  C CD1 . LEU B 1 529 ? -14.013 38.095  105.983 1.00 63.74  ? 550  LEU B CD1 1 
ATOM   8235  C CD2 . LEU B 1 529 ? -12.208 36.408  106.292 1.00 63.39  ? 550  LEU B CD2 1 
ATOM   8236  N N   . PHE B 1 530 ? -15.523 34.746  103.048 1.00 64.48  ? 551  PHE B N   1 
ATOM   8237  C CA  . PHE B 1 530 ? -15.328 34.692  101.602 1.00 65.12  ? 551  PHE B CA  1 
ATOM   8238  C C   . PHE B 1 530 ? -16.576 35.023  100.797 1.00 66.04  ? 551  PHE B C   1 
ATOM   8239  O O   . PHE B 1 530 ? -16.482 35.515  99.670  1.00 65.63  ? 551  PHE B O   1 
ATOM   8240  C CB  . PHE B 1 530 ? -14.798 33.319  101.201 1.00 65.00  ? 551  PHE B CB  1 
ATOM   8241  C CG  . PHE B 1 530 ? -13.315 33.173  101.376 1.00 65.54  ? 551  PHE B CG  1 
ATOM   8242  C CD1 . PHE B 1 530 ? -12.709 31.923  101.280 1.00 65.28  ? 551  PHE B CD1 1 
ATOM   8243  C CD2 . PHE B 1 530 ? -12.517 34.290  101.619 1.00 65.37  ? 551  PHE B CD2 1 
ATOM   8244  C CE1 . PHE B 1 530 ? -11.333 31.787  101.423 1.00 65.12  ? 551  PHE B CE1 1 
ATOM   8245  C CE2 . PHE B 1 530 ? -11.139 34.163  101.762 1.00 66.19  ? 551  PHE B CE2 1 
ATOM   8246  C CZ  . PHE B 1 530 ? -10.546 32.908  101.664 1.00 65.83  ? 551  PHE B CZ  1 
ATOM   8247  N N   . ALA B 1 531 ? -17.742 34.749  101.371 1.00 67.16  ? 552  ALA B N   1 
ATOM   8248  C CA  . ALA B 1 531 ? -19.002 35.051  100.704 1.00 68.19  ? 552  ALA B CA  1 
ATOM   8249  C C   . ALA B 1 531 ? -19.192 36.563  100.769 1.00 68.98  ? 552  ALA B C   1 
ATOM   8250  O O   . ALA B 1 531 ? -20.213 37.101  100.337 1.00 68.87  ? 552  ALA B O   1 
ATOM   8251  C CB  . ALA B 1 531 ? -20.148 34.345  101.406 1.00 67.99  ? 552  ALA B CB  1 
ATOM   8252  N N   . LYS B 1 532 ? -18.181 37.235  101.315 1.00 70.26  ? 553  LYS B N   1 
ATOM   8253  C CA  . LYS B 1 532 ? -18.174 38.685  101.467 1.00 70.49  ? 553  LYS B CA  1 
ATOM   8254  C C   . LYS B 1 532 ? -19.274 39.131  102.420 1.00 70.11  ? 553  LYS B C   1 
ATOM   8255  O O   . LYS B 1 532 ? -19.257 38.780  103.601 1.00 69.51  ? 553  LYS B O   1 
ATOM   8256  C CB  . LYS B 1 532 ? -18.341 39.367  100.104 1.00 70.63  ? 553  LYS B CB  1 
ATOM   8257  C CG  . LYS B 1 532 ? -17.318 38.924  99.068  1.00 70.43  ? 553  LYS B CG  1 
ATOM   8258  C CD  . LYS B 1 532 ? -17.075 40.008  98.039  1.00 71.36  ? 553  LYS B CD  1 
ATOM   8259  C CE  . LYS B 1 532 ? -16.453 41.231  98.701  1.00 72.51  ? 553  LYS B CE  1 
ATOM   8260  N NZ  . LYS B 1 532 ? -16.204 42.343  97.743  1.00 72.98  ? 553  LYS B NZ  1 
ATOM   8261  N N   . SER C 1 1   ? 17.102  4.429   20.200  1.00 55.33  ? 21   SER C N   1 
ATOM   8262  C CA  . SER C 1 1   ? 17.488  5.783   19.808  1.00 55.63  ? 21   SER C CA  1 
ATOM   8263  C C   . SER C 1 1   ? 16.831  6.831   20.703  1.00 54.72  ? 21   SER C C   1 
ATOM   8264  O O   . SER C 1 1   ? 17.400  7.899   20.950  1.00 54.72  ? 21   SER C O   1 
ATOM   8265  C CB  . SER C 1 1   ? 17.108  6.043   18.344  1.00 56.23  ? 21   SER C CB  1 
ATOM   8266  O OG  . SER C 1 1   ? 15.709  5.922   18.139  1.00 56.29  ? 21   SER C OG  1 
ATOM   8267  N N   . SER C 1 2   ? 15.628  6.524   21.182  1.00 52.96  ? 22   SER C N   1 
ATOM   8268  C CA  . SER C 1 2   ? 14.901  7.439   22.055  1.00 50.52  ? 22   SER C CA  1 
ATOM   8269  C C   . SER C 1 2   ? 15.143  7.023   23.505  1.00 47.21  ? 22   SER C C   1 
ATOM   8270  O O   . SER C 1 2   ? 15.268  5.834   23.800  1.00 47.54  ? 22   SER C O   1 
ATOM   8271  C CB  . SER C 1 2   ? 13.403  7.397   21.737  1.00 51.20  ? 22   SER C CB  1 
ATOM   8272  O OG  . SER C 1 2   ? 12.711  8.420   22.433  1.00 52.80  ? 22   SER C OG  1 
ATOM   8273  N N   . PRO C 1 3   ? 15.220  7.999   24.427  1.00 43.29  ? 23   PRO C N   1 
ATOM   8274  C CA  . PRO C 1 3   ? 15.453  7.707   25.843  1.00 40.53  ? 23   PRO C CA  1 
ATOM   8275  C C   . PRO C 1 3   ? 14.542  6.612   26.397  1.00 37.25  ? 23   PRO C C   1 
ATOM   8276  O O   . PRO C 1 3   ? 13.326  6.642   26.194  1.00 37.90  ? 23   PRO C O   1 
ATOM   8277  C CB  . PRO C 1 3   ? 15.212  9.056   26.511  1.00 40.36  ? 23   PRO C CB  1 
ATOM   8278  C CG  . PRO C 1 3   ? 15.682  10.011  25.488  1.00 40.93  ? 23   PRO C CG  1 
ATOM   8279  C CD  . PRO C 1 3   ? 15.087  9.450   24.217  1.00 42.08  ? 23   PRO C CD  1 
ATOM   8280  N N   . PRO C 1 4   ? 15.125  5.623   27.098  1.00 33.78  ? 24   PRO C N   1 
ATOM   8281  C CA  . PRO C 1 4   ? 14.348  4.523   27.680  1.00 30.68  ? 24   PRO C CA  1 
ATOM   8282  C C   . PRO C 1 4   ? 13.406  5.091   28.727  1.00 28.46  ? 24   PRO C C   1 
ATOM   8283  O O   . PRO C 1 4   ? 13.720  6.107   29.350  1.00 29.09  ? 24   PRO C O   1 
ATOM   8284  C CB  . PRO C 1 4   ? 15.413  3.645   28.334  1.00 30.12  ? 24   PRO C CB  1 
ATOM   8285  C CG  . PRO C 1 4   ? 16.669  3.989   27.604  1.00 31.91  ? 24   PRO C CG  1 
ATOM   8286  C CD  . PRO C 1 4   ? 16.558  5.465   27.394  1.00 32.49  ? 24   PRO C CD  1 
ATOM   8287  N N   . VAL C 1 5   ? 12.254  4.458   28.919  1.00 25.53  ? 25   VAL C N   1 
ATOM   8288  C CA  . VAL C 1 5   ? 11.315  4.918   29.936  1.00 22.57  ? 25   VAL C CA  1 
ATOM   8289  C C   . VAL C 1 5   ? 10.608  3.738   30.566  1.00 21.15  ? 25   VAL C C   1 
ATOM   8290  O O   . VAL C 1 5   ? 9.762   3.121   29.945  1.00 21.73  ? 25   VAL C O   1 
ATOM   8291  C CB  . VAL C 1 5   ? 10.264  5.893   29.366  1.00 21.23  ? 25   VAL C CB  1 
ATOM   8292  C CG1 . VAL C 1 5   ? 9.193   6.161   30.405  1.00 21.88  ? 25   VAL C CG1 1 
ATOM   8293  C CG2 . VAL C 1 5   ? 10.921  7.207   28.995  1.00 19.49  ? 25   VAL C CG2 1 
ATOM   8294  N N   . VAL C 1 6   ? 10.966  3.427   31.806  1.00 20.74  ? 26   VAL C N   1 
ATOM   8295  C CA  . VAL C 1 6   ? 10.363  2.307   32.515  1.00 20.80  ? 26   VAL C CA  1 
ATOM   8296  C C   . VAL C 1 6   ? 9.442   2.797   33.625  1.00 21.69  ? 26   VAL C C   1 
ATOM   8297  O O   . VAL C 1 6   ? 9.752   3.775   34.304  1.00 21.55  ? 26   VAL C O   1 
ATOM   8298  C CB  . VAL C 1 6   ? 11.453  1.411   33.144  1.00 20.07  ? 26   VAL C CB  1 
ATOM   8299  C CG1 . VAL C 1 6   ? 10.811  0.266   33.919  1.00 18.71  ? 26   VAL C CG1 1 
ATOM   8300  C CG2 . VAL C 1 6   ? 12.377  0.881   32.062  1.00 18.71  ? 26   VAL C CG2 1 
ATOM   8301  N N   . ASP C 1 7   ? 8.309   2.124   33.807  1.00 23.04  ? 27   ASP C N   1 
ATOM   8302  C CA  . ASP C 1 7   ? 7.378   2.506   34.863  1.00 25.87  ? 27   ASP C CA  1 
ATOM   8303  C C   . ASP C 1 7   ? 7.670   1.712   36.123  1.00 24.46  ? 27   ASP C C   1 
ATOM   8304  O O   . ASP C 1 7   ? 7.666   0.486   36.094  1.00 25.99  ? 27   ASP C O   1 
ATOM   8305  C CB  . ASP C 1 7   ? 5.933   2.240   34.447  1.00 31.10  ? 27   ASP C CB  1 
ATOM   8306  C CG  . ASP C 1 7   ? 5.568   2.926   33.152  1.00 37.84  ? 27   ASP C CG  1 
ATOM   8307  O OD1 . ASP C 1 7   ? 5.957   4.100   32.971  1.00 42.57  ? 27   ASP C OD1 1 
ATOM   8308  O OD2 . ASP C 1 7   ? 4.883   2.299   32.315  1.00 41.47  ? 27   ASP C OD2 1 
ATOM   8309  N N   . THR C 1 8   ? 7.939   2.400   37.227  1.00 22.58  ? 28   THR C N   1 
ATOM   8310  C CA  . THR C 1 8   ? 8.199   1.697   38.477  1.00 20.08  ? 28   THR C CA  1 
ATOM   8311  C C   . THR C 1 8   ? 6.963   1.859   39.346  1.00 17.30  ? 28   THR C C   1 
ATOM   8312  O O   . THR C 1 8   ? 5.954   2.401   38.899  1.00 15.19  ? 28   THR C O   1 
ATOM   8313  C CB  . THR C 1 8   ? 9.455   2.240   39.224  1.00 21.26  ? 28   THR C CB  1 
ATOM   8314  O OG1 . THR C 1 8   ? 9.104   3.365   40.042  1.00 22.63  ? 28   THR C OG1 1 
ATOM   8315  C CG2 . THR C 1 8   ? 10.528  2.647   38.221  1.00 20.57  ? 28   THR C CG2 1 
ATOM   8316  N N   . VAL C 1 9   ? 7.035   1.388   40.581  1.00 15.57  ? 29   VAL C N   1 
ATOM   8317  C CA  . VAL C 1 9   ? 5.893   1.474   41.467  1.00 14.54  ? 29   VAL C CA  1 
ATOM   8318  C C   . VAL C 1 9   ? 5.587   2.899   41.869  1.00 15.43  ? 29   VAL C C   1 
ATOM   8319  O O   . VAL C 1 9   ? 4.428   3.267   42.010  1.00 16.17  ? 29   VAL C O   1 
ATOM   8320  C CB  . VAL C 1 9   ? 6.111   0.627   42.724  1.00 14.17  ? 29   VAL C CB  1 
ATOM   8321  C CG1 . VAL C 1 9   ? 4.879   0.676   43.608  1.00 12.87  ? 29   VAL C CG1 1 
ATOM   8322  C CG2 . VAL C 1 9   ? 6.421   -0.808  42.320  1.00 13.81  ? 29   VAL C CG2 1 
ATOM   8323  N N   . HIS C 1 10  ? 6.615   3.714   42.039  1.00 16.74  ? 30   HIS C N   1 
ATOM   8324  C CA  . HIS C 1 10  ? 6.382   5.093   42.441  1.00 18.26  ? 30   HIS C CA  1 
ATOM   8325  C C   . HIS C 1 10  ? 6.459   6.106   41.298  1.00 18.45  ? 30   HIS C C   1 
ATOM   8326  O O   . HIS C 1 10  ? 6.495   7.313   41.535  1.00 18.75  ? 30   HIS C O   1 
ATOM   8327  C CB  . HIS C 1 10  ? 7.362   5.484   43.553  1.00 20.07  ? 30   HIS C CB  1 
ATOM   8328  C CG  . HIS C 1 10  ? 7.373   4.533   44.710  1.00 21.34  ? 30   HIS C CG  1 
ATOM   8329  N ND1 . HIS C 1 10  ? 6.220   4.053   45.293  1.00 22.18  ? 30   HIS C ND1 1 
ATOM   8330  C CD2 . HIS C 1 10  ? 8.399   3.999   45.415  1.00 22.03  ? 30   HIS C CD2 1 
ATOM   8331  C CE1 . HIS C 1 10  ? 6.533   3.266   46.306  1.00 21.69  ? 30   HIS C CE1 1 
ATOM   8332  N NE2 . HIS C 1 10  ? 7.849   3.217   46.401  1.00 22.97  ? 30   HIS C NE2 1 
ATOM   8333  N N   . GLY C 1 11  ? 6.485   5.623   40.060  1.00 19.66  ? 31   GLY C N   1 
ATOM   8334  C CA  . GLY C 1 11  ? 6.543   6.537   38.931  1.00 20.94  ? 31   GLY C CA  1 
ATOM   8335  C C   . GLY C 1 11  ? 7.410   6.118   37.757  1.00 21.45  ? 31   GLY C C   1 
ATOM   8336  O O   . GLY C 1 11  ? 8.020   5.050   37.757  1.00 21.51  ? 31   GLY C O   1 
ATOM   8337  N N   . LYS C 1 12  ? 7.466   6.977   36.748  1.00 21.86  ? 32   LYS C N   1 
ATOM   8338  C CA  . LYS C 1 12  ? 8.257   6.702   35.559  1.00 23.13  ? 32   LYS C CA  1 
ATOM   8339  C C   . LYS C 1 12  ? 9.684   7.262   35.652  1.00 22.33  ? 32   LYS C C   1 
ATOM   8340  O O   . LYS C 1 12  ? 9.909   8.359   36.174  1.00 21.96  ? 32   LYS C O   1 
ATOM   8341  C CB  . LYS C 1 12  ? 7.561   7.287   34.325  1.00 24.74  ? 32   LYS C CB  1 
ATOM   8342  C CG  . LYS C 1 12  ? 6.143   6.784   34.092  1.00 26.13  ? 32   LYS C CG  1 
ATOM   8343  C CD  . LYS C 1 12  ? 5.588   7.360   32.793  1.00 28.16  ? 32   LYS C CD  1 
ATOM   8344  C CE  . LYS C 1 12  ? 4.151   6.929   32.519  1.00 30.07  ? 32   LYS C CE  1 
ATOM   8345  N NZ  . LYS C 1 12  ? 3.999   5.469   32.239  1.00 30.66  ? 32   LYS C NZ  1 
ATOM   8346  N N   . VAL C 1 13  ? 10.644  6.492   35.147  1.00 21.67  ? 33   VAL C N   1 
ATOM   8347  C CA  . VAL C 1 13  ? 12.042  6.902   35.144  1.00 20.59  ? 33   VAL C CA  1 
ATOM   8348  C C   . VAL C 1 13  ? 12.543  6.936   33.712  1.00 20.62  ? 33   VAL C C   1 
ATOM   8349  O O   . VAL C 1 13  ? 12.253  6.044   32.912  1.00 19.37  ? 33   VAL C O   1 
ATOM   8350  C CB  . VAL C 1 13  ? 12.931  5.936   35.940  1.00 19.54  ? 33   VAL C CB  1 
ATOM   8351  C CG1 . VAL C 1 13  ? 12.564  5.983   37.399  1.00 18.97  ? 33   VAL C CG1 1 
ATOM   8352  C CG2 . VAL C 1 13  ? 12.779  4.528   35.400  1.00 20.21  ? 33   VAL C CG2 1 
ATOM   8353  N N   . LEU C 1 14  ? 13.304  7.977   33.405  1.00 21.30  ? 34   LEU C N   1 
ATOM   8354  C CA  . LEU C 1 14  ? 13.857  8.186   32.075  1.00 22.25  ? 34   LEU C CA  1 
ATOM   8355  C C   . LEU C 1 14  ? 15.360  7.980   32.164  1.00 22.66  ? 34   LEU C C   1 
ATOM   8356  O O   . LEU C 1 14  ? 16.044  8.677   32.915  1.00 23.51  ? 34   LEU C O   1 
ATOM   8357  C CB  . LEU C 1 14  ? 13.538  9.620   31.622  1.00 23.05  ? 34   LEU C CB  1 
ATOM   8358  C CG  . LEU C 1 14  ? 13.883  10.231  30.258  1.00 22.05  ? 34   LEU C CG  1 
ATOM   8359  C CD1 . LEU C 1 14  ? 15.374  10.268  30.065  1.00 22.18  ? 34   LEU C CD1 1 
ATOM   8360  C CD2 . LEU C 1 14  ? 13.212  9.445   29.159  1.00 23.44  ? 34   LEU C CD2 1 
ATOM   8361  N N   . GLY C 1 15  ? 15.869  7.012   31.411  1.00 22.61  ? 35   GLY C N   1 
ATOM   8362  C CA  . GLY C 1 15  ? 17.295  6.750   31.420  1.00 22.65  ? 35   GLY C CA  1 
ATOM   8363  C C   . GLY C 1 15  ? 17.919  7.045   30.069  1.00 22.91  ? 35   GLY C C   1 
ATOM   8364  O O   . GLY C 1 15  ? 17.322  7.717   29.228  1.00 22.88  ? 35   GLY C O   1 
ATOM   8365  N N   . LYS C 1 16  ? 19.132  6.551   29.858  1.00 23.39  ? 36   LYS C N   1 
ATOM   8366  C CA  . LYS C 1 16  ? 19.815  6.751   28.591  1.00 22.08  ? 36   LYS C CA  1 
ATOM   8367  C C   . LYS C 1 16  ? 20.378  5.415   28.101  1.00 19.86  ? 36   LYS C C   1 
ATOM   8368  O O   . LYS C 1 16  ? 20.591  4.499   28.893  1.00 19.48  ? 36   LYS C O   1 
ATOM   8369  C CB  . LYS C 1 16  ? 20.945  7.768   28.754  1.00 22.77  ? 36   LYS C CB  1 
ATOM   8370  C CG  . LYS C 1 16  ? 22.000  7.336   29.740  1.00 27.51  ? 36   LYS C CG  1 
ATOM   8371  C CD  . LYS C 1 16  ? 23.254  8.187   29.625  1.00 31.44  ? 36   LYS C CD  1 
ATOM   8372  C CE  . LYS C 1 16  ? 24.359  7.627   30.518  1.00 34.09  ? 36   LYS C CE  1 
ATOM   8373  N NZ  . LYS C 1 16  ? 25.651  8.364   30.391  1.00 35.90  ? 36   LYS C NZ  1 
ATOM   8374  N N   . PHE C 1 17  ? 20.590  5.308   26.791  1.00 17.90  ? 37   PHE C N   1 
ATOM   8375  C CA  . PHE C 1 17  ? 21.154  4.108   26.174  1.00 15.57  ? 37   PHE C CA  1 
ATOM   8376  C C   . PHE C 1 17  ? 22.659  4.301   25.992  1.00 15.60  ? 37   PHE C C   1 
ATOM   8377  O O   . PHE C 1 17  ? 23.123  5.407   25.721  1.00 16.35  ? 37   PHE C O   1 
ATOM   8378  C CB  . PHE C 1 17  ? 20.526  3.865   24.799  1.00 13.00  ? 37   PHE C CB  1 
ATOM   8379  C CG  . PHE C 1 17  ? 19.201  3.162   24.840  1.00 11.68  ? 37   PHE C CG  1 
ATOM   8380  C CD1 . PHE C 1 17  ? 18.052  3.794   24.388  1.00 9.80   ? 37   PHE C CD1 1 
ATOM   8381  C CD2 . PHE C 1 17  ? 19.107  1.854   25.313  1.00 12.81  ? 37   PHE C CD2 1 
ATOM   8382  C CE1 . PHE C 1 17  ? 16.830  3.140   24.402  1.00 8.12   ? 37   PHE C CE1 1 
ATOM   8383  C CE2 . PHE C 1 17  ? 17.889  1.192   25.332  1.00 11.52  ? 37   PHE C CE2 1 
ATOM   8384  C CZ  . PHE C 1 17  ? 16.747  1.838   24.874  1.00 9.91   ? 37   PHE C CZ  1 
ATOM   8385  N N   . VAL C 1 18  ? 23.429  3.235   26.134  1.00 15.95  ? 38   VAL C N   1 
ATOM   8386  C CA  . VAL C 1 18  ? 24.868  3.353   25.951  1.00 18.47  ? 38   VAL C CA  1 
ATOM   8387  C C   . VAL C 1 18  ? 25.387  2.095   25.272  1.00 21.68  ? 38   VAL C C   1 
ATOM   8388  O O   . VAL C 1 18  ? 25.003  0.994   25.655  1.00 23.20  ? 38   VAL C O   1 
ATOM   8389  C CB  . VAL C 1 18  ? 25.582  3.531   27.300  1.00 16.99  ? 38   VAL C CB  1 
ATOM   8390  C CG1 . VAL C 1 18  ? 27.074  3.714   27.076  1.00 12.74  ? 38   VAL C CG1 1 
ATOM   8391  C CG2 . VAL C 1 18  ? 24.981  4.715   28.050  1.00 14.02  ? 38   VAL C CG2 1 
ATOM   8392  N N   . SER C 1 19  ? 26.248  2.252   24.267  1.00 24.84  ? 39   SER C N   1 
ATOM   8393  C CA  . SER C 1 19  ? 26.793  1.095   23.548  1.00 28.50  ? 39   SER C CA  1 
ATOM   8394  C C   . SER C 1 19  ? 28.242  0.780   23.867  1.00 30.53  ? 39   SER C C   1 
ATOM   8395  O O   . SER C 1 19  ? 29.091  1.671   23.873  1.00 31.84  ? 39   SER C O   1 
ATOM   8396  C CB  . SER C 1 19  ? 26.675  1.286   22.037  1.00 29.12  ? 39   SER C CB  1 
ATOM   8397  O OG  . SER C 1 19  ? 25.355  1.034   21.596  1.00 32.70  ? 39   SER C OG  1 
ATOM   8398  N N   . LEU C 1 20  ? 28.518  -0.498  24.116  1.00 32.17  ? 40   LEU C N   1 
ATOM   8399  C CA  . LEU C 1 20  ? 29.871  -0.948  24.417  1.00 32.14  ? 40   LEU C CA  1 
ATOM   8400  C C   . LEU C 1 20  ? 30.499  -1.474  23.133  1.00 33.54  ? 40   LEU C C   1 
ATOM   8401  O O   . LEU C 1 20  ? 29.819  -2.057  22.295  1.00 34.37  ? 40   LEU C O   1 
ATOM   8402  C CB  . LEU C 1 20  ? 29.851  -2.055  25.475  1.00 30.09  ? 40   LEU C CB  1 
ATOM   8403  C CG  . LEU C 1 20  ? 31.183  -2.326  26.176  1.00 27.59  ? 40   LEU C CG  1 
ATOM   8404  C CD1 . LEU C 1 20  ? 31.647  -1.059  26.865  1.00 25.86  ? 40   LEU C CD1 1 
ATOM   8405  C CD2 . LEU C 1 20  ? 31.025  -3.441  27.190  1.00 26.56  ? 40   LEU C CD2 1 
ATOM   8406  N N   . GLU C 1 21  ? 31.800  -1.251  22.997  1.00 35.45  ? 41   GLU C N   1 
ATOM   8407  C CA  . GLU C 1 21  ? 32.583  -1.663  21.838  1.00 37.19  ? 41   GLU C CA  1 
ATOM   8408  C C   . GLU C 1 21  ? 31.887  -2.412  20.694  1.00 35.76  ? 41   GLU C C   1 
ATOM   8409  O O   . GLU C 1 21  ? 31.468  -1.797  19.716  1.00 35.95  ? 41   GLU C O   1 
ATOM   8410  C CB  . GLU C 1 21  ? 33.797  -2.469  22.303  1.00 41.58  ? 41   GLU C CB  1 
ATOM   8411  C CG  . GLU C 1 21  ? 34.825  -2.704  21.199  1.00 47.56  ? 41   GLU C CG  1 
ATOM   8412  C CD  . GLU C 1 21  ? 35.059  -1.461  20.341  1.00 50.07  ? 41   GLU C CD  1 
ATOM   8413  O OE1 . GLU C 1 21  ? 35.300  -0.373  20.912  1.00 52.27  ? 41   GLU C OE1 1 
ATOM   8414  O OE2 . GLU C 1 21  ? 35.002  -1.577  19.095  1.00 50.20  ? 41   GLU C OE2 1 
ATOM   8415  N N   . GLY C 1 22  ? 31.765  -3.730  20.794  1.00 33.85  ? 42   GLY C N   1 
ATOM   8416  C CA  . GLY C 1 22  ? 31.142  -4.457  19.700  1.00 32.84  ? 42   GLY C CA  1 
ATOM   8417  C C   . GLY C 1 22  ? 29.749  -5.018  19.911  1.00 31.85  ? 42   GLY C C   1 
ATOM   8418  O O   . GLY C 1 22  ? 29.307  -5.887  19.159  1.00 32.87  ? 42   GLY C O   1 
ATOM   8419  N N   . PHE C 1 23  ? 29.039  -4.526  20.915  1.00 30.32  ? 43   PHE C N   1 
ATOM   8420  C CA  . PHE C 1 23  ? 27.708  -5.035  21.184  1.00 28.70  ? 43   PHE C CA  1 
ATOM   8421  C C   . PHE C 1 23  ? 26.605  -4.293  20.444  1.00 28.68  ? 43   PHE C C   1 
ATOM   8422  O O   . PHE C 1 23  ? 26.509  -3.076  20.506  1.00 29.23  ? 43   PHE C O   1 
ATOM   8423  C CB  . PHE C 1 23  ? 27.446  -5.018  22.690  1.00 27.55  ? 43   PHE C CB  1 
ATOM   8424  C CG  . PHE C 1 23  ? 28.348  -5.932  23.465  1.00 25.20  ? 43   PHE C CG  1 
ATOM   8425  C CD1 . PHE C 1 23  ? 29.648  -5.554  23.766  1.00 24.84  ? 43   PHE C CD1 1 
ATOM   8426  C CD2 . PHE C 1 23  ? 27.908  -7.193  23.857  1.00 23.67  ? 43   PHE C CD2 1 
ATOM   8427  C CE1 . PHE C 1 23  ? 30.501  -6.423  24.446  1.00 25.34  ? 43   PHE C CE1 1 
ATOM   8428  C CE2 . PHE C 1 23  ? 28.748  -8.066  24.533  1.00 23.48  ? 43   PHE C CE2 1 
ATOM   8429  C CZ  . PHE C 1 23  ? 30.050  -7.683  24.831  1.00 24.24  ? 43   PHE C CZ  1 
ATOM   8430  N N   . ALA C 1 24  ? 25.768  -5.046  19.743  1.00 29.85  ? 44   ALA C N   1 
ATOM   8431  C CA  . ALA C 1 24  ? 24.668  -4.469  18.984  1.00 30.79  ? 44   ALA C CA  1 
ATOM   8432  C C   . ALA C 1 24  ? 23.510  -4.031  19.883  1.00 30.45  ? 44   ALA C C   1 
ATOM   8433  O O   . ALA C 1 24  ? 22.844  -3.033  19.605  1.00 30.28  ? 44   ALA C O   1 
ATOM   8434  C CB  . ALA C 1 24  ? 24.177  -5.472  17.941  1.00 31.20  ? 44   ALA C CB  1 
ATOM   8435  N N   . GLN C 1 25  ? 23.261  -4.779  20.953  1.00 30.15  ? 45   GLN C N   1 
ATOM   8436  C CA  . GLN C 1 25  ? 22.179  -4.433  21.872  1.00 30.21  ? 45   GLN C CA  1 
ATOM   8437  C C   . GLN C 1 25  ? 22.694  -3.388  22.850  1.00 29.05  ? 45   GLN C C   1 
ATOM   8438  O O   . GLN C 1 25  ? 23.599  -3.655  23.639  1.00 30.91  ? 45   GLN C O   1 
ATOM   8439  C CB  . GLN C 1 25  ? 21.697  -5.677  22.633  1.00 30.25  ? 45   GLN C CB  1 
ATOM   8440  C CG  . GLN C 1 25  ? 20.588  -5.424  23.653  1.00 33.88  ? 45   GLN C CG  1 
ATOM   8441  C CD  . GLN C 1 25  ? 19.293  -4.905  23.031  1.00 38.03  ? 45   GLN C CD  1 
ATOM   8442  O OE1 . GLN C 1 25  ? 18.705  -5.545  22.147  1.00 40.13  ? 45   GLN C OE1 1 
ATOM   8443  N NE2 . GLN C 1 25  ? 18.836  -3.744  23.498  1.00 38.59  ? 45   GLN C NE2 1 
ATOM   8444  N N   . PRO C 1 26  ? 22.148  -2.167  22.796  1.00 27.36  ? 46   PRO C N   1 
ATOM   8445  C CA  . PRO C 1 26  ? 22.650  -1.172  23.744  1.00 25.78  ? 46   PRO C CA  1 
ATOM   8446  C C   . PRO C 1 26  ? 22.176  -1.498  25.152  1.00 24.20  ? 46   PRO C C   1 
ATOM   8447  O O   . PRO C 1 26  ? 21.295  -2.343  25.349  1.00 22.62  ? 46   PRO C O   1 
ATOM   8448  C CB  . PRO C 1 26  ? 22.067  0.133   23.218  1.00 25.43  ? 46   PRO C CB  1 
ATOM   8449  C CG  . PRO C 1 26  ? 20.750  -0.309  22.658  1.00 27.97  ? 46   PRO C CG  1 
ATOM   8450  C CD  . PRO C 1 26  ? 21.116  -1.590  21.919  1.00 27.45  ? 46   PRO C CD  1 
ATOM   8451  N N   . VAL C 1 27  ? 22.772  -0.828  26.129  1.00 22.39  ? 47   VAL C N   1 
ATOM   8452  C CA  . VAL C 1 27  ? 22.412  -1.039  27.520  1.00 19.72  ? 47   VAL C CA  1 
ATOM   8453  C C   . VAL C 1 27  ? 21.754  0.230   28.039  1.00 17.17  ? 47   VAL C C   1 
ATOM   8454  O O   . VAL C 1 27  ? 22.247  1.334   27.815  1.00 15.27  ? 47   VAL C O   1 
ATOM   8455  C CB  . VAL C 1 27  ? 23.661  -1.369  28.375  1.00 19.36  ? 47   VAL C CB  1 
ATOM   8456  C CG1 . VAL C 1 27  ? 23.243  -1.807  29.762  1.00 19.48  ? 47   VAL C CG1 1 
ATOM   8457  C CG2 . VAL C 1 27  ? 24.476  -2.460  27.704  1.00 18.56  ? 47   VAL C CG2 1 
ATOM   8458  N N   . ALA C 1 28  ? 20.624  0.065   28.709  1.00 16.55  ? 48   ALA C N   1 
ATOM   8459  C CA  . ALA C 1 28  ? 19.905  1.196   29.270  1.00 18.03  ? 48   ALA C CA  1 
ATOM   8460  C C   . ALA C 1 28  ? 20.485  1.496   30.650  1.00 18.91  ? 48   ALA C C   1 
ATOM   8461  O O   . ALA C 1 28  ? 20.667  0.588   31.465  1.00 19.54  ? 48   ALA C O   1 
ATOM   8462  C CB  . ALA C 1 28  ? 18.433  0.870   29.380  1.00 18.14  ? 48   ALA C CB  1 
ATOM   8463  N N   . ILE C 1 29  ? 20.773  2.767   30.911  1.00 19.08  ? 49   ILE C N   1 
ATOM   8464  C CA  . ILE C 1 29  ? 21.347  3.150   32.190  1.00 20.38  ? 49   ILE C CA  1 
ATOM   8465  C C   . ILE C 1 29  ? 20.531  4.182   32.951  1.00 20.76  ? 49   ILE C C   1 
ATOM   8466  O O   . ILE C 1 29  ? 20.213  5.251   32.430  1.00 21.20  ? 49   ILE C O   1 
ATOM   8467  C CB  . ILE C 1 29  ? 22.765  3.698   32.008  1.00 20.54  ? 49   ILE C CB  1 
ATOM   8468  C CG1 . ILE C 1 29  ? 23.658  2.624   31.392  1.00 20.96  ? 49   ILE C CG1 1 
ATOM   8469  C CG2 . ILE C 1 29  ? 23.328  4.131   33.346  1.00 21.75  ? 49   ILE C CG2 1 
ATOM   8470  C CD1 . ILE C 1 29  ? 25.035  3.125   31.017  1.00 20.86  ? 49   ILE C CD1 1 
ATOM   8471  N N   . PHE C 1 30  ? 20.203  3.848   34.195  1.00 20.84  ? 50   PHE C N   1 
ATOM   8472  C CA  . PHE C 1 30  ? 19.440  4.737   35.059  1.00 21.51  ? 50   PHE C CA  1 
ATOM   8473  C C   . PHE C 1 30  ? 20.297  5.094   36.262  1.00 21.06  ? 50   PHE C C   1 
ATOM   8474  O O   . PHE C 1 30  ? 20.834  4.218   36.946  1.00 22.43  ? 50   PHE C O   1 
ATOM   8475  C CB  . PHE C 1 30  ? 18.154  4.056   35.526  1.00 24.29  ? 50   PHE C CB  1 
ATOM   8476  C CG  . PHE C 1 30  ? 17.263  3.612   34.402  1.00 25.30  ? 50   PHE C CG  1 
ATOM   8477  C CD1 . PHE C 1 30  ? 17.516  2.423   33.728  1.00 23.59  ? 50   PHE C CD1 1 
ATOM   8478  C CD2 . PHE C 1 30  ? 16.195  4.413   33.989  1.00 25.29  ? 50   PHE C CD2 1 
ATOM   8479  C CE1 . PHE C 1 30  ? 16.724  2.039   32.659  1.00 24.83  ? 50   PHE C CE1 1 
ATOM   8480  C CE2 . PHE C 1 30  ? 15.395  4.038   32.919  1.00 25.67  ? 50   PHE C CE2 1 
ATOM   8481  C CZ  . PHE C 1 30  ? 15.658  2.849   32.250  1.00 25.87  ? 50   PHE C CZ  1 
ATOM   8482  N N   . LEU C 1 31  ? 20.422  6.386   36.527  1.00 19.44  ? 51   LEU C N   1 
ATOM   8483  C CA  . LEU C 1 31  ? 21.244  6.841   37.635  1.00 16.80  ? 51   LEU C CA  1 
ATOM   8484  C C   . LEU C 1 31  ? 20.462  7.620   38.677  1.00 15.89  ? 51   LEU C C   1 
ATOM   8485  O O   . LEU C 1 31  ? 19.753  8.567   38.349  1.00 15.86  ? 51   LEU C O   1 
ATOM   8486  C CB  . LEU C 1 31  ? 22.381  7.715   37.104  1.00 15.30  ? 51   LEU C CB  1 
ATOM   8487  C CG  . LEU C 1 31  ? 23.270  7.107   36.018  1.00 12.93  ? 51   LEU C CG  1 
ATOM   8488  C CD1 . LEU C 1 31  ? 24.249  8.160   35.544  1.00 9.62   ? 51   LEU C CD1 1 
ATOM   8489  C CD2 . LEU C 1 31  ? 23.996  5.881   36.552  1.00 11.58  ? 51   LEU C CD2 1 
ATOM   8490  N N   . GLY C 1 32  ? 20.595  7.213   39.934  1.00 16.10  ? 52   GLY C N   1 
ATOM   8491  C CA  . GLY C 1 32  ? 19.915  7.913   41.007  1.00 15.45  ? 52   GLY C CA  1 
ATOM   8492  C C   . GLY C 1 32  ? 18.444  7.610   41.216  1.00 15.39  ? 52   GLY C C   1 
ATOM   8493  O O   . GLY C 1 32  ? 17.660  8.515   41.530  1.00 15.91  ? 52   GLY C O   1 
ATOM   8494  N N   . ILE C 1 33  ? 18.049  6.355   41.030  1.00 13.58  ? 53   ILE C N   1 
ATOM   8495  C CA  . ILE C 1 33  ? 16.663  5.998   41.263  1.00 11.21  ? 53   ILE C CA  1 
ATOM   8496  C C   . ILE C 1 33  ? 16.562  5.873   42.768  1.00 11.83  ? 53   ILE C C   1 
ATOM   8497  O O   . ILE C 1 33  ? 17.308  5.106   43.375  1.00 13.24  ? 53   ILE C O   1 
ATOM   8498  C CB  . ILE C 1 33  ? 16.309  4.646   40.661  1.00 10.31  ? 53   ILE C CB  1 
ATOM   8499  C CG1 . ILE C 1 33  ? 16.289  4.743   39.134  1.00 8.99   ? 53   ILE C CG1 1 
ATOM   8500  C CG2 . ILE C 1 33  ? 14.975  4.174   41.228  1.00 8.29   ? 53   ILE C CG2 1 
ATOM   8501  C CD1 . ILE C 1 33  ? 16.034  3.417   38.443  1.00 7.32   ? 53   ILE C CD1 1 
ATOM   8502  N N   . PRO C 1 34  ? 15.665  6.646   43.398  1.00 11.33  ? 54   PRO C N   1 
ATOM   8503  C CA  . PRO C 1 34  ? 15.502  6.583   44.853  1.00 9.39   ? 54   PRO C CA  1 
ATOM   8504  C C   . PRO C 1 34  ? 14.772  5.305   45.254  1.00 7.57   ? 54   PRO C C   1 
ATOM   8505  O O   . PRO C 1 34  ? 13.829  4.894   44.580  1.00 7.00   ? 54   PRO C O   1 
ATOM   8506  C CB  . PRO C 1 34  ? 14.678  7.829   45.152  1.00 9.11   ? 54   PRO C CB  1 
ATOM   8507  C CG  . PRO C 1 34  ? 13.799  7.922   43.956  1.00 9.35   ? 54   PRO C CG  1 
ATOM   8508  C CD  . PRO C 1 34  ? 14.773  7.665   42.818  1.00 10.89  ? 54   PRO C CD  1 
ATOM   8509  N N   . PHE C 1 35  ? 15.221  4.665   46.329  1.00 6.14   ? 55   PHE C N   1 
ATOM   8510  C CA  . PHE C 1 35  ? 14.567  3.449   46.797  1.00 6.38   ? 55   PHE C CA  1 
ATOM   8511  C C   . PHE C 1 35  ? 14.041  3.677   48.210  1.00 7.34   ? 55   PHE C C   1 
ATOM   8512  O O   . PHE C 1 35  ? 13.582  2.750   48.885  1.00 8.96   ? 55   PHE C O   1 
ATOM   8513  C CB  . PHE C 1 35  ? 15.521  2.237   46.736  1.00 4.16   ? 55   PHE C CB  1 
ATOM   8514  C CG  . PHE C 1 35  ? 16.685  2.310   47.685  1.00 3.99   ? 55   PHE C CG  1 
ATOM   8515  C CD1 . PHE C 1 35  ? 16.568  1.842   48.993  1.00 4.01   ? 55   PHE C CD1 1 
ATOM   8516  C CD2 . PHE C 1 35  ? 17.899  2.845   47.272  1.00 1.44   ? 55   PHE C CD2 1 
ATOM   8517  C CE1 . PHE C 1 35  ? 17.646  1.910   49.871  1.00 4.91   ? 55   PHE C CE1 1 
ATOM   8518  C CE2 . PHE C 1 35  ? 18.980  2.918   48.138  1.00 1.44   ? 55   PHE C CE2 1 
ATOM   8519  C CZ  . PHE C 1 35  ? 18.858  2.452   49.439  1.00 4.16   ? 55   PHE C CZ  1 
ATOM   8520  N N   . ALA C 1 36  ? 14.088  4.933   48.642  1.00 7.58   ? 56   ALA C N   1 
ATOM   8521  C CA  . ALA C 1 36  ? 13.605  5.304   49.967  1.00 8.51   ? 56   ALA C CA  1 
ATOM   8522  C C   . ALA C 1 36  ? 13.420  6.812   50.093  1.00 8.34   ? 56   ALA C C   1 
ATOM   8523  O O   . ALA C 1 36  ? 13.826  7.583   49.226  1.00 9.57   ? 56   ALA C O   1 
ATOM   8524  C CB  . ALA C 1 36  ? 14.565  4.803   51.034  1.00 6.11   ? 56   ALA C CB  1 
ATOM   8525  N N   . LYS C 1 37  ? 12.797  7.226   51.183  1.00 7.58   ? 57   LYS C N   1 
ATOM   8526  C CA  . LYS C 1 37  ? 12.562  8.635   51.442  1.00 7.66   ? 57   LYS C CA  1 
ATOM   8527  C C   . LYS C 1 37  ? 13.853  9.229   52.013  1.00 7.93   ? 57   LYS C C   1 
ATOM   8528  O O   . LYS C 1 37  ? 14.509  8.613   52.852  1.00 9.09   ? 57   LYS C O   1 
ATOM   8529  C CB  . LYS C 1 37  ? 11.414  8.757   52.447  1.00 6.32   ? 57   LYS C CB  1 
ATOM   8530  C CG  . LYS C 1 37  ? 10.995  10.151  52.810  1.00 9.21   ? 57   LYS C CG  1 
ATOM   8531  C CD  . LYS C 1 37  ? 9.963   10.091  53.932  1.00 13.25  ? 57   LYS C CD  1 
ATOM   8532  C CE  . LYS C 1 37  ? 9.423   11.460  54.301  1.00 14.20  ? 57   LYS C CE  1 
ATOM   8533  N NZ  . LYS C 1 37  ? 8.690   12.077  53.152  1.00 18.37  ? 57   LYS C NZ  1 
ATOM   8534  N N   . PRO C 1 38  ? 14.254  10.419  51.547  1.00 7.50   ? 58   PRO C N   1 
ATOM   8535  C CA  . PRO C 1 38  ? 15.481  11.027  52.073  1.00 8.31   ? 58   PRO C CA  1 
ATOM   8536  C C   . PRO C 1 38  ? 15.496  10.996  53.608  1.00 9.32   ? 58   PRO C C   1 
ATOM   8537  O O   . PRO C 1 38  ? 14.642  11.614  54.249  1.00 10.72  ? 58   PRO C O   1 
ATOM   8538  C CB  . PRO C 1 38  ? 15.410  12.450  51.524  1.00 7.38   ? 58   PRO C CB  1 
ATOM   8539  C CG  . PRO C 1 38  ? 14.790  12.240  50.180  1.00 5.48   ? 58   PRO C CG  1 
ATOM   8540  C CD  . PRO C 1 38  ? 13.680  11.236  50.463  1.00 6.96   ? 58   PRO C CD  1 
ATOM   8541  N N   . PRO C 1 39  ? 16.461  10.273  54.214  1.00 9.29   ? 59   PRO C N   1 
ATOM   8542  C CA  . PRO C 1 39  ? 16.609  10.141  55.670  1.00 8.98   ? 59   PRO C CA  1 
ATOM   8543  C C   . PRO C 1 39  ? 17.067  11.415  56.372  1.00 10.07  ? 59   PRO C C   1 
ATOM   8544  O O   . PRO C 1 39  ? 18.117  11.432  57.017  1.00 10.70  ? 59   PRO C O   1 
ATOM   8545  C CB  . PRO C 1 39  ? 17.632  9.019   55.804  1.00 7.80   ? 59   PRO C CB  1 
ATOM   8546  C CG  . PRO C 1 39  ? 18.498  9.225   54.622  1.00 7.77   ? 59   PRO C CG  1 
ATOM   8547  C CD  . PRO C 1 39  ? 17.484  9.469   53.524  1.00 9.76   ? 59   PRO C CD  1 
ATOM   8548  N N   . LEU C 1 40  ? 16.262  12.472  56.258  1.00 11.59  ? 60   LEU C N   1 
ATOM   8549  C CA  . LEU C 1 40  ? 16.580  13.768  56.854  1.00 10.51  ? 60   LEU C CA  1 
ATOM   8550  C C   . LEU C 1 40  ? 15.745  14.100  58.081  1.00 10.67  ? 60   LEU C C   1 
ATOM   8551  O O   . LEU C 1 40  ? 14.774  13.407  58.403  1.00 10.82  ? 60   LEU C O   1 
ATOM   8552  C CB  . LEU C 1 40  ? 16.394  14.873  55.815  1.00 8.85   ? 60   LEU C CB  1 
ATOM   8553  C CG  . LEU C 1 40  ? 17.018  14.536  54.463  1.00 9.30   ? 60   LEU C CG  1 
ATOM   8554  C CD1 . LEU C 1 40  ? 16.723  15.634  53.448  1.00 7.91   ? 60   LEU C CD1 1 
ATOM   8555  C CD2 . LEU C 1 40  ? 18.508  14.330  54.655  1.00 5.76   ? 60   LEU C CD2 1 
ATOM   8556  N N   . GLY C 1 41  ? 16.142  15.176  58.756  1.00 10.68  ? 61   GLY C N   1 
ATOM   8557  C CA  . GLY C 1 41  ? 15.448  15.627  59.943  1.00 9.84   ? 61   GLY C CA  1 
ATOM   8558  C C   . GLY C 1 41  ? 15.244  14.502  60.924  1.00 9.63   ? 61   GLY C C   1 
ATOM   8559  O O   . GLY C 1 41  ? 16.190  13.799  61.266  1.00 10.01  ? 61   GLY C O   1 
ATOM   8560  N N   . PRO C 1 42  ? 14.008  14.296  61.391  1.00 9.57   ? 62   PRO C N   1 
ATOM   8561  C CA  . PRO C 1 42  ? 13.717  13.227  62.346  1.00 10.12  ? 62   PRO C CA  1 
ATOM   8562  C C   . PRO C 1 42  ? 13.977  11.820  61.807  1.00 10.46  ? 62   PRO C C   1 
ATOM   8563  O O   . PRO C 1 42  ? 14.162  10.891  62.583  1.00 10.84  ? 62   PRO C O   1 
ATOM   8564  C CB  . PRO C 1 42  ? 12.249  13.465  62.682  1.00 8.47   ? 62   PRO C CB  1 
ATOM   8565  C CG  . PRO C 1 42  ? 11.717  14.019  61.404  1.00 8.22   ? 62   PRO C CG  1 
ATOM   8566  C CD  . PRO C 1 42  ? 12.776  15.008  61.017  1.00 8.22   ? 62   PRO C CD  1 
ATOM   8567  N N   . LEU C 1 43  ? 13.991  11.659  60.486  1.00 11.09  ? 63   LEU C N   1 
ATOM   8568  C CA  . LEU C 1 43  ? 14.225  10.343  59.901  1.00 11.16  ? 63   LEU C CA  1 
ATOM   8569  C C   . LEU C 1 43  ? 15.655  9.830   60.113  1.00 12.11  ? 63   LEU C C   1 
ATOM   8570  O O   . LEU C 1 43  ? 15.952  8.662   59.842  1.00 11.83  ? 63   LEU C O   1 
ATOM   8571  C CB  . LEU C 1 43  ? 13.875  10.349  58.407  1.00 8.79   ? 63   LEU C CB  1 
ATOM   8572  C CG  . LEU C 1 43  ? 12.375  10.406  58.092  1.00 6.73   ? 63   LEU C CG  1 
ATOM   8573  C CD1 . LEU C 1 43  ? 12.130  10.186  56.610  1.00 2.88   ? 63   LEU C CD1 1 
ATOM   8574  C CD2 . LEU C 1 43  ? 11.654  9.338   58.892  1.00 6.48   ? 63   LEU C CD2 1 
ATOM   8575  N N   . ARG C 1 44  ? 16.533  10.697  60.611  1.00 11.33  ? 64   ARG C N   1 
ATOM   8576  C CA  . ARG C 1 44  ? 17.914  10.307  60.873  1.00 10.72  ? 64   ARG C CA  1 
ATOM   8577  C C   . ARG C 1 44  ? 17.971  9.319   62.043  1.00 9.57   ? 64   ARG C C   1 
ATOM   8578  O O   . ARG C 1 44  ? 17.309  9.515   63.060  1.00 9.78   ? 64   ARG C O   1 
ATOM   8579  C CB  . ARG C 1 44  ? 18.753  11.539  61.197  1.00 11.67  ? 64   ARG C CB  1 
ATOM   8580  C CG  . ARG C 1 44  ? 20.215  11.232  61.418  1.00 13.44  ? 64   ARG C CG  1 
ATOM   8581  C CD  . ARG C 1 44  ? 20.941  12.439  61.962  1.00 13.74  ? 64   ARG C CD  1 
ATOM   8582  N NE  . ARG C 1 44  ? 21.072  13.502  60.975  1.00 14.10  ? 64   ARG C NE  1 
ATOM   8583  C CZ  . ARG C 1 44  ? 21.421  14.747  61.281  1.00 13.64  ? 64   ARG C CZ  1 
ATOM   8584  N NH1 . ARG C 1 44  ? 21.662  15.072  62.545  1.00 11.45  ? 64   ARG C NH1 1 
ATOM   8585  N NH2 . ARG C 1 44  ? 21.539  15.660  60.328  1.00 10.84  ? 64   ARG C NH2 1 
ATOM   8586  N N   . PHE C 1 45  ? 18.774  8.270   61.897  1.00 7.98   ? 65   PHE C N   1 
ATOM   8587  C CA  . PHE C 1 45  ? 18.905  7.227   62.916  1.00 6.79   ? 65   PHE C CA  1 
ATOM   8588  C C   . PHE C 1 45  ? 17.612  6.432   63.042  1.00 6.54   ? 65   PHE C C   1 
ATOM   8589  O O   . PHE C 1 45  ? 17.282  5.940   64.118  1.00 5.99   ? 65   PHE C O   1 
ATOM   8590  C CB  . PHE C 1 45  ? 19.254  7.811   64.291  1.00 7.19   ? 65   PHE C CB  1 
ATOM   8591  C CG  . PHE C 1 45  ? 20.460  8.696   64.287  1.00 6.60   ? 65   PHE C CG  1 
ATOM   8592  C CD1 . PHE C 1 45  ? 21.635  8.295   63.649  1.00 6.27   ? 65   PHE C CD1 1 
ATOM   8593  C CD2 . PHE C 1 45  ? 20.429  9.929   64.933  1.00 3.63   ? 65   PHE C CD2 1 
ATOM   8594  C CE1 . PHE C 1 45  ? 22.761  9.109   63.655  1.00 4.35   ? 65   PHE C CE1 1 
ATOM   8595  C CE2 . PHE C 1 45  ? 21.543  10.750  64.949  1.00 1.91   ? 65   PHE C CE2 1 
ATOM   8596  C CZ  . PHE C 1 45  ? 22.714  10.342  64.310  1.00 4.30   ? 65   PHE C CZ  1 
ATOM   8597  N N   . THR C 1 46  ? 16.867  6.330   61.947  1.00 6.71   ? 66   THR C N   1 
ATOM   8598  C CA  . THR C 1 46  ? 15.622  5.564   61.947  1.00 6.18   ? 66   THR C CA  1 
ATOM   8599  C C   . THR C 1 46  ? 15.637  4.704   60.685  1.00 5.85   ? 66   THR C C   1 
ATOM   8600  O O   . THR C 1 46  ? 16.290  5.052   59.700  1.00 5.12   ? 66   THR C O   1 
ATOM   8601  C CB  . THR C 1 46  ? 14.357  6.481   61.926  1.00 4.33   ? 66   THR C CB  1 
ATOM   8602  O OG1 . THR C 1 46  ? 13.985  6.778   60.572  1.00 7.28   ? 66   THR C OG1 1 
ATOM   8603  C CG2 . THR C 1 46  ? 14.629  7.777   62.648  1.00 1.44   ? 66   THR C CG2 1 
ATOM   8604  N N   . PRO C 1 47  ? 14.928  3.566   60.701  1.00 5.30   ? 67   PRO C N   1 
ATOM   8605  C CA  . PRO C 1 47  ? 14.893  2.691   59.527  1.00 5.12   ? 67   PRO C CA  1 
ATOM   8606  C C   . PRO C 1 47  ? 14.490  3.497   58.309  1.00 5.24   ? 67   PRO C C   1 
ATOM   8607  O O   . PRO C 1 47  ? 13.800  4.504   58.439  1.00 5.56   ? 67   PRO C O   1 
ATOM   8608  C CB  . PRO C 1 47  ? 13.840  1.661   59.898  1.00 3.52   ? 67   PRO C CB  1 
ATOM   8609  C CG  . PRO C 1 47  ? 13.988  1.569   61.382  1.00 5.28   ? 67   PRO C CG  1 
ATOM   8610  C CD  . PRO C 1 47  ? 14.114  3.012   61.793  1.00 3.98   ? 67   PRO C CD  1 
ATOM   8611  N N   . PRO C 1 48  ? 14.924  3.075   57.112  1.00 6.05   ? 68   PRO C N   1 
ATOM   8612  C CA  . PRO C 1 48  ? 14.577  3.797   55.888  1.00 7.61   ? 68   PRO C CA  1 
ATOM   8613  C C   . PRO C 1 48  ? 13.100  3.629   55.608  1.00 9.44   ? 68   PRO C C   1 
ATOM   8614  O O   . PRO C 1 48  ? 12.515  2.599   55.929  1.00 10.68  ? 68   PRO C O   1 
ATOM   8615  C CB  . PRO C 1 48  ? 15.420  3.104   54.833  1.00 6.44   ? 68   PRO C CB  1 
ATOM   8616  C CG  . PRO C 1 48  ? 15.386  1.696   55.289  1.00 5.74   ? 68   PRO C CG  1 
ATOM   8617  C CD  . PRO C 1 48  ? 15.650  1.837   56.784  1.00 5.89   ? 68   PRO C CD  1 
ATOM   8618  N N   . GLN C 1 49  ? 12.488  4.638   55.011  1.00 11.62  ? 69   GLN C N   1 
ATOM   8619  C CA  . GLN C 1 49  ? 11.081  4.539   54.694  1.00 12.88  ? 69   GLN C CA  1 
ATOM   8620  C C   . GLN C 1 49  ? 10.854  4.588   53.200  1.00 12.10  ? 69   GLN C C   1 
ATOM   8621  O O   . GLN C 1 49  ? 11.715  5.033   52.437  1.00 9.75   ? 69   GLN C O   1 
ATOM   8622  C CB  . GLN C 1 49  ? 10.308  5.641   55.404  1.00 16.35  ? 69   GLN C CB  1 
ATOM   8623  C CG  . GLN C 1 49  ? 9.926   5.245   56.810  1.00 22.12  ? 69   GLN C CG  1 
ATOM   8624  C CD  . GLN C 1 49  ? 9.758   6.436   57.716  1.00 26.52  ? 69   GLN C CD  1 
ATOM   8625  O OE1 . GLN C 1 49  ? 8.987   7.355   57.422  1.00 28.89  ? 69   GLN C OE1 1 
ATOM   8626  N NE2 . GLN C 1 49  ? 10.484  6.433   58.834  1.00 28.57  ? 69   GLN C NE2 1 
ATOM   8627  N N   . PRO C 1 50  ? 9.694   4.097   52.757  1.00 13.20  ? 70   PRO C N   1 
ATOM   8628  C CA  . PRO C 1 50  ? 9.356   4.087   51.335  1.00 15.37  ? 70   PRO C CA  1 
ATOM   8629  C C   . PRO C 1 50  ? 9.512   5.474   50.730  1.00 17.77  ? 70   PRO C C   1 
ATOM   8630  O O   . PRO C 1 50  ? 9.453   6.474   51.442  1.00 21.29  ? 70   PRO C O   1 
ATOM   8631  C CB  . PRO C 1 50  ? 7.917   3.603   51.340  1.00 13.78  ? 70   PRO C CB  1 
ATOM   8632  C CG  . PRO C 1 50  ? 7.913   2.652   52.506  1.00 13.07  ? 70   PRO C CG  1 
ATOM   8633  C CD  . PRO C 1 50  ? 8.644   3.438   53.551  1.00 12.58  ? 70   PRO C CD  1 
ATOM   8634  N N   . ALA C 1 51  ? 9.724   5.535   49.422  1.00 18.36  ? 71   ALA C N   1 
ATOM   8635  C CA  . ALA C 1 51  ? 9.889   6.808   48.740  1.00 18.74  ? 71   ALA C CA  1 
ATOM   8636  C C   . ALA C 1 51  ? 8.537   7.359   48.308  1.00 20.36  ? 71   ALA C C   1 
ATOM   8637  O O   . ALA C 1 51  ? 7.608   6.596   48.009  1.00 21.10  ? 71   ALA C O   1 
ATOM   8638  C CB  . ALA C 1 51  ? 10.788  6.630   47.533  1.00 18.90  ? 71   ALA C CB  1 
ATOM   8639  N N   . GLU C 1 52  ? 8.430   8.685   48.279  1.00 20.58  ? 72   GLU C N   1 
ATOM   8640  C CA  . GLU C 1 52  ? 7.195   9.343   47.873  1.00 21.58  ? 72   GLU C CA  1 
ATOM   8641  C C   . GLU C 1 52  ? 7.036   9.268   46.358  1.00 19.62  ? 72   GLU C C   1 
ATOM   8642  O O   . GLU C 1 52  ? 7.937   9.648   45.601  1.00 19.73  ? 72   GLU C O   1 
ATOM   8643  C CB  . GLU C 1 52  ? 7.208   10.799  48.329  1.00 26.54  ? 72   GLU C CB  1 
ATOM   8644  C CG  . GLU C 1 52  ? 7.359   10.957  49.832  1.00 34.20  ? 72   GLU C CG  1 
ATOM   8645  C CD  . GLU C 1 52  ? 6.049   10.761  50.581  1.00 39.59  ? 72   GLU C CD  1 
ATOM   8646  O OE1 . GLU C 1 52  ? 5.281   9.831   50.233  1.00 40.81  ? 72   GLU C OE1 1 
ATOM   8647  O OE2 . GLU C 1 52  ? 5.796   11.540  51.530  1.00 43.57  ? 72   GLU C OE2 1 
ATOM   8648  N N   . PRO C 1 53  ? 5.878   8.774   45.897  1.00 17.53  ? 73   PRO C N   1 
ATOM   8649  C CA  . PRO C 1 53  ? 5.564   8.629   44.472  1.00 16.01  ? 73   PRO C CA  1 
ATOM   8650  C C   . PRO C 1 53  ? 5.571   9.949   43.721  1.00 14.54  ? 73   PRO C C   1 
ATOM   8651  O O   . PRO C 1 53  ? 5.025   10.941  44.195  1.00 13.16  ? 73   PRO C O   1 
ATOM   8652  C CB  . PRO C 1 53  ? 4.186   7.983   44.493  1.00 14.79  ? 73   PRO C CB  1 
ATOM   8653  C CG  . PRO C 1 53  ? 3.581   8.556   45.740  1.00 15.35  ? 73   PRO C CG  1 
ATOM   8654  C CD  . PRO C 1 53  ? 4.707   8.440   46.726  1.00 16.29  ? 73   PRO C CD  1 
ATOM   8655  N N   . TRP C 1 54  ? 6.199   9.955   42.550  1.00 14.83  ? 74   TRP C N   1 
ATOM   8656  C CA  . TRP C 1 54  ? 6.262   11.160  41.738  1.00 14.93  ? 74   TRP C CA  1 
ATOM   8657  C C   . TRP C 1 54  ? 5.195   11.139  40.649  1.00 15.39  ? 74   TRP C C   1 
ATOM   8658  O O   . TRP C 1 54  ? 4.719   10.077  40.249  1.00 13.86  ? 74   TRP C O   1 
ATOM   8659  C CB  . TRP C 1 54  ? 7.666   11.337  41.152  1.00 13.19  ? 74   TRP C CB  1 
ATOM   8660  C CG  . TRP C 1 54  ? 8.198   10.143  40.452  1.00 12.12  ? 74   TRP C CG  1 
ATOM   8661  C CD1 . TRP C 1 54  ? 8.101   9.860   39.120  1.00 12.19  ? 74   TRP C CD1 1 
ATOM   8662  C CD2 . TRP C 1 54  ? 8.916   9.060   41.042  1.00 11.47  ? 74   TRP C CD2 1 
ATOM   8663  N NE1 . TRP C 1 54  ? 8.718   8.666   38.843  1.00 12.00  ? 74   TRP C NE1 1 
ATOM   8664  C CE2 . TRP C 1 54  ? 9.227   8.151   40.007  1.00 12.25  ? 74   TRP C CE2 1 
ATOM   8665  C CE3 . TRP C 1 54  ? 9.331   8.767   42.346  1.00 10.78  ? 74   TRP C CE3 1 
ATOM   8666  C CZ2 . TRP C 1 54  ? 9.934   6.965   40.236  1.00 11.45  ? 74   TRP C CZ2 1 
ATOM   8667  C CZ3 . TRP C 1 54  ? 10.037  7.587   42.572  1.00 11.82  ? 74   TRP C CZ3 1 
ATOM   8668  C CH2 . TRP C 1 54  ? 10.331  6.702   41.520  1.00 9.95   ? 74   TRP C CH2 1 
ATOM   8669  N N   . SER C 1 55  ? 4.833   12.326  40.173  1.00 17.94  ? 75   SER C N   1 
ATOM   8670  C CA  . SER C 1 55  ? 3.773   12.478  39.186  1.00 20.39  ? 75   SER C CA  1 
ATOM   8671  C C   . SER C 1 55  ? 4.040   12.337  37.696  1.00 20.96  ? 75   SER C C   1 
ATOM   8672  O O   . SER C 1 55  ? 3.199   11.782  36.978  1.00 23.95  ? 75   SER C O   1 
ATOM   8673  C CB  . SER C 1 55  ? 3.045   13.803  39.426  1.00 21.08  ? 75   SER C CB  1 
ATOM   8674  O OG  . SER C 1 55  ? 2.300   13.746  40.633  1.00 26.04  ? 75   SER C OG  1 
ATOM   8675  N N   . PHE C 1 56  ? 5.162   12.836  37.197  1.00 18.72  ? 76   PHE C N   1 
ATOM   8676  C CA  . PHE C 1 56  ? 5.387   12.708  35.766  1.00 18.08  ? 76   PHE C CA  1 
ATOM   8677  C C   . PHE C 1 56  ? 6.519   11.737  35.470  1.00 18.88  ? 76   PHE C C   1 
ATOM   8678  O O   . PHE C 1 56  ? 6.512   10.616  35.981  1.00 19.78  ? 76   PHE C O   1 
ATOM   8679  C CB  . PHE C 1 56  ? 5.624   14.091  35.149  1.00 16.53  ? 76   PHE C CB  1 
ATOM   8680  C CG  . PHE C 1 56  ? 4.450   15.030  35.319  1.00 17.17  ? 76   PHE C CG  1 
ATOM   8681  C CD1 . PHE C 1 56  ? 4.499   16.081  36.234  1.00 18.44  ? 76   PHE C CD1 1 
ATOM   8682  C CD2 . PHE C 1 56  ? 3.263   14.812  34.627  1.00 15.73  ? 76   PHE C CD2 1 
ATOM   8683  C CE1 . PHE C 1 56  ? 3.380   16.892  36.459  1.00 16.34  ? 76   PHE C CE1 1 
ATOM   8684  C CE2 . PHE C 1 56  ? 2.148   15.616  34.847  1.00 15.62  ? 76   PHE C CE2 1 
ATOM   8685  C CZ  . PHE C 1 56  ? 2.209   16.656  35.767  1.00 15.66  ? 76   PHE C CZ  1 
ATOM   8686  N N   . VAL C 1 57  ? 7.473   12.131  34.635  1.00 18.86  ? 77   VAL C N   1 
ATOM   8687  C CA  . VAL C 1 57  ? 8.594   11.249  34.341  1.00 18.91  ? 77   VAL C CA  1 
ATOM   8688  C C   . VAL C 1 57  ? 9.814   11.784  35.076  1.00 18.92  ? 77   VAL C C   1 
ATOM   8689  O O   . VAL C 1 57  ? 10.166  12.950  34.922  1.00 18.36  ? 77   VAL C O   1 
ATOM   8690  C CB  . VAL C 1 57  ? 8.893   11.186  32.816  1.00 19.57  ? 77   VAL C CB  1 
ATOM   8691  C CG1 . VAL C 1 57  ? 10.227  10.486  32.567  1.00 17.55  ? 77   VAL C CG1 1 
ATOM   8692  C CG2 . VAL C 1 57  ? 7.783   10.439  32.096  1.00 17.34  ? 77   VAL C CG2 1 
ATOM   8693  N N   . LYS C 1 58  ? 10.443  10.935  35.884  1.00 19.60  ? 78   LYS C N   1 
ATOM   8694  C CA  . LYS C 1 58  ? 11.628  11.337  36.634  1.00 21.07  ? 78   LYS C CA  1 
ATOM   8695  C C   . LYS C 1 58  ? 12.906  11.001  35.864  1.00 22.44  ? 78   LYS C C   1 
ATOM   8696  O O   . LYS C 1 58  ? 13.133  9.855   35.477  1.00 22.17  ? 78   LYS C O   1 
ATOM   8697  C CB  . LYS C 1 58  ? 11.646  10.649  38.002  1.00 20.61  ? 78   LYS C CB  1 
ATOM   8698  C CG  . LYS C 1 58  ? 12.850  11.025  38.863  1.00 19.04  ? 78   LYS C CG  1 
ATOM   8699  C CD  . LYS C 1 58  ? 12.907  10.221  40.153  1.00 17.41  ? 78   LYS C CD  1 
ATOM   8700  C CE  . LYS C 1 58  ? 11.792  10.580  41.117  1.00 16.53  ? 78   LYS C CE  1 
ATOM   8701  N NZ  . LYS C 1 58  ? 11.922  11.960  41.644  1.00 18.58  ? 78   LYS C NZ  1 
ATOM   8702  N N   . ASN C 1 59  ? 13.742  12.007  35.651  1.00 24.82  ? 79   ASN C N   1 
ATOM   8703  C CA  . ASN C 1 59  ? 14.995  11.829  34.921  1.00 27.65  ? 79   ASN C CA  1 
ATOM   8704  C C   . ASN C 1 59  ? 16.136  11.229  35.728  1.00 25.94  ? 79   ASN C C   1 
ATOM   8705  O O   . ASN C 1 59  ? 16.818  11.929  36.476  1.00 25.68  ? 79   ASN C O   1 
ATOM   8706  C CB  . ASN C 1 59  ? 15.450  13.165  34.354  1.00 33.25  ? 79   ASN C CB  1 
ATOM   8707  C CG  . ASN C 1 59  ? 14.741  13.516  33.084  1.00 39.16  ? 79   ASN C CG  1 
ATOM   8708  O OD1 . ASN C 1 59  ? 13.655  13.009  32.803  1.00 37.61  ? 79   ASN C OD1 1 
ATOM   8709  N ND2 . ASN C 1 59  ? 15.362  14.398  32.312  1.00 46.89  ? 79   ASN C ND2 1 
ATOM   8710  N N   . ALA C 1 60  ? 16.352  9.932   35.550  1.00 24.13  ? 80   ALA C N   1 
ATOM   8711  C CA  . ALA C 1 60  ? 17.410  9.222   36.249  1.00 21.68  ? 80   ALA C CA  1 
ATOM   8712  C C   . ALA C 1 60  ? 18.684  9.312   35.425  1.00 20.85  ? 80   ALA C C   1 
ATOM   8713  O O   . ALA C 1 60  ? 19.172  8.295   34.930  1.00 20.75  ? 80   ALA C O   1 
ATOM   8714  C CB  . ALA C 1 60  ? 17.009  7.771   36.429  1.00 21.71  ? 80   ALA C CB  1 
ATOM   8715  N N   . THR C 1 61  ? 19.233  10.517  35.287  1.00 19.53  ? 81   THR C N   1 
ATOM   8716  C CA  . THR C 1 61  ? 20.432  10.695  34.473  1.00 19.42  ? 81   THR C CA  1 
ATOM   8717  C C   . THR C 1 61  ? 21.604  11.453  35.066  1.00 18.97  ? 81   THR C C   1 
ATOM   8718  O O   . THR C 1 61  ? 22.411  12.016  34.327  1.00 17.58  ? 81   THR C O   1 
ATOM   8719  C CB  . THR C 1 61  ? 20.093  11.366  33.139  1.00 20.77  ? 81   THR C CB  1 
ATOM   8720  O OG1 . THR C 1 61  ? 18.888  12.125  33.285  1.00 22.59  ? 81   THR C OG1 1 
ATOM   8721  C CG2 . THR C 1 61  ? 19.925  10.329  32.044  1.00 21.55  ? 81   THR C CG2 1 
ATOM   8722  N N   . SER C 1 62  ? 21.702  11.474  36.389  1.00 19.64  ? 82   SER C N   1 
ATOM   8723  C CA  . SER C 1 62  ? 22.814  12.140  37.064  1.00 18.59  ? 82   SER C CA  1 
ATOM   8724  C C   . SER C 1 62  ? 23.263  11.300  38.239  1.00 17.87  ? 82   SER C C   1 
ATOM   8725  O O   . SER C 1 62  ? 22.445  10.838  39.042  1.00 17.51  ? 82   SER C O   1 
ATOM   8726  C CB  . SER C 1 62  ? 22.408  13.518  37.577  1.00 18.54  ? 82   SER C CB  1 
ATOM   8727  O OG  . SER C 1 62  ? 22.218  14.417  36.509  1.00 23.98  ? 82   SER C OG  1 
ATOM   8728  N N   . TYR C 1 63  ? 24.566  11.093  38.343  1.00 17.23  ? 83   TYR C N   1 
ATOM   8729  C CA  . TYR C 1 63  ? 25.077  10.319  39.453  1.00 16.02  ? 83   TYR C CA  1 
ATOM   8730  C C   . TYR C 1 63  ? 24.510  10.926  40.726  1.00 14.34  ? 83   TYR C C   1 
ATOM   8731  O O   . TYR C 1 63  ? 24.541  12.142  40.922  1.00 12.64  ? 83   TYR C O   1 
ATOM   8732  C CB  . TYR C 1 63  ? 26.601  10.361  39.458  1.00 17.00  ? 83   TYR C CB  1 
ATOM   8733  C CG  . TYR C 1 63  ? 27.192  9.542   38.346  1.00 19.75  ? 83   TYR C CG  1 
ATOM   8734  C CD1 . TYR C 1 63  ? 27.099  8.155   38.366  1.00 22.39  ? 83   TYR C CD1 1 
ATOM   8735  C CD2 . TYR C 1 63  ? 27.814  10.145  37.253  1.00 21.07  ? 83   TYR C CD2 1 
ATOM   8736  C CE1 . TYR C 1 63  ? 27.612  7.379   37.324  1.00 25.03  ? 83   TYR C CE1 1 
ATOM   8737  C CE2 . TYR C 1 63  ? 28.332  9.379   36.202  1.00 22.37  ? 83   TYR C CE2 1 
ATOM   8738  C CZ  . TYR C 1 63  ? 28.226  7.996   36.248  1.00 24.41  ? 83   TYR C CZ  1 
ATOM   8739  O OH  . TYR C 1 63  ? 28.736  7.216   35.235  1.00 26.43  ? 83   TYR C OH  1 
ATOM   8740  N N   . PRO C 1 64  ? 23.942  10.087  41.596  1.00 12.70  ? 84   PRO C N   1 
ATOM   8741  C CA  . PRO C 1 64  ? 23.395  10.651  42.826  1.00 11.90  ? 84   PRO C CA  1 
ATOM   8742  C C   . PRO C 1 64  ? 24.560  11.057  43.715  1.00 11.73  ? 84   PRO C C   1 
ATOM   8743  O O   . PRO C 1 64  ? 25.729  10.855  43.364  1.00 10.39  ? 84   PRO C O   1 
ATOM   8744  C CB  . PRO C 1 64  ? 22.607  9.486   43.406  1.00 11.02  ? 84   PRO C CB  1 
ATOM   8745  C CG  . PRO C 1 64  ? 23.473  8.319   43.038  1.00 10.04  ? 84   PRO C CG  1 
ATOM   8746  C CD  . PRO C 1 64  ? 23.847  8.616   41.598  1.00 10.79  ? 84   PRO C CD  1 
ATOM   8747  N N   . PRO C 1 65  ? 24.259  11.660  44.866  1.00 11.42  ? 85   PRO C N   1 
ATOM   8748  C CA  . PRO C 1 65  ? 25.323  12.073  45.782  1.00 11.45  ? 85   PRO C CA  1 
ATOM   8749  C C   . PRO C 1 65  ? 25.731  10.856  46.597  1.00 12.59  ? 85   PRO C C   1 
ATOM   8750  O O   . PRO C 1 65  ? 24.918  9.956   46.812  1.00 10.62  ? 85   PRO C O   1 
ATOM   8751  C CB  . PRO C 1 65  ? 24.641  13.118  46.662  1.00 10.14  ? 85   PRO C CB  1 
ATOM   8752  C CG  . PRO C 1 65  ? 23.483  13.594  45.824  1.00 10.49  ? 85   PRO C CG  1 
ATOM   8753  C CD  . PRO C 1 65  ? 22.993  12.330  45.195  1.00 10.02  ? 85   PRO C CD  1 
ATOM   8754  N N   . MET C 1 66  ? 26.985  10.799  47.028  1.00 14.73  ? 86   MET C N   1 
ATOM   8755  C CA  . MET C 1 66  ? 27.393  9.685   47.869  1.00 16.53  ? 86   MET C CA  1 
ATOM   8756  C C   . MET C 1 66  ? 27.090  10.164  49.277  1.00 15.70  ? 86   MET C C   1 
ATOM   8757  O O   . MET C 1 66  ? 27.189  11.360  49.555  1.00 15.12  ? 86   MET C O   1 
ATOM   8758  C CB  . MET C 1 66  ? 28.885  9.364   47.707  1.00 19.44  ? 86   MET C CB  1 
ATOM   8759  C CG  . MET C 1 66  ? 29.804  10.566  47.552  1.00 25.92  ? 86   MET C CG  1 
ATOM   8760  S SD  . MET C 1 66  ? 31.562  10.107  47.357  1.00 29.31  ? 86   MET C SD  1 
ATOM   8761  C CE  . MET C 1 66  ? 32.287  10.986  48.751  1.00 28.81  ? 86   MET C CE  1 
ATOM   8762  N N   . CYS C 1 67  ? 26.686  9.240   50.146  1.00 15.75  ? 87   CYS C N   1 
ATOM   8763  C CA  . CYS C 1 67  ? 26.350  9.558   51.532  1.00 14.43  ? 87   CYS C CA  1 
ATOM   8764  C C   . CYS C 1 67  ? 27.497  10.279  52.228  1.00 13.81  ? 87   CYS C C   1 
ATOM   8765  O O   . CYS C 1 67  ? 28.656  10.033  51.919  1.00 16.07  ? 87   CYS C O   1 
ATOM   8766  C CB  . CYS C 1 67  ? 26.009  8.278   52.279  1.00 13.97  ? 87   CYS C CB  1 
ATOM   8767  S SG  . CYS C 1 67  ? 24.550  7.391   51.622  1.00 19.08  ? 87   CYS C SG  1 
ATOM   8768  N N   . THR C 1 68  ? 27.176  11.165  53.167  1.00 13.38  ? 88   THR C N   1 
ATOM   8769  C CA  . THR C 1 68  ? 28.200  11.935  53.875  1.00 12.52  ? 88   THR C CA  1 
ATOM   8770  C C   . THR C 1 68  ? 29.344  11.066  54.384  1.00 12.65  ? 88   THR C C   1 
ATOM   8771  O O   . THR C 1 68  ? 29.133  10.021  55.012  1.00 10.72  ? 88   THR C O   1 
ATOM   8772  C CB  . THR C 1 68  ? 27.618  12.717  55.080  1.00 13.55  ? 88   THR C CB  1 
ATOM   8773  O OG1 . THR C 1 68  ? 26.411  13.389  54.690  1.00 14.00  ? 88   THR C OG1 1 
ATOM   8774  C CG2 . THR C 1 68  ? 28.625  13.752  55.563  1.00 9.40   ? 88   THR C CG2 1 
ATOM   8775  N N   . GLN C 1 69  ? 30.561  11.527  54.109  1.00 13.35  ? 89   GLN C N   1 
ATOM   8776  C CA  . GLN C 1 69  ? 31.776  10.828  54.492  1.00 12.95  ? 89   GLN C CA  1 
ATOM   8777  C C   . GLN C 1 69  ? 32.936  11.801  54.369  1.00 13.42  ? 89   GLN C C   1 
ATOM   8778  O O   . GLN C 1 69  ? 32.738  12.960  54.010  1.00 12.89  ? 89   GLN C O   1 
ATOM   8779  C CB  . GLN C 1 69  ? 32.001  9.648   53.547  1.00 11.68  ? 89   GLN C CB  1 
ATOM   8780  C CG  . GLN C 1 69  ? 31.928  10.044  52.088  1.00 10.82  ? 89   GLN C CG  1 
ATOM   8781  C CD  . GLN C 1 69  ? 31.965  8.854   51.146  1.00 13.37  ? 89   GLN C CD  1 
ATOM   8782  O OE1 . GLN C 1 69  ? 32.990  8.189   51.005  1.00 14.04  ? 89   GLN C OE1 1 
ATOM   8783  N NE2 . GLN C 1 69  ? 30.839  8.581   50.492  1.00 13.26  ? 89   GLN C NE2 1 
ATOM   8784  N N   . ASP C 1 70  ? 34.139  11.329  54.690  1.00 14.61  ? 90   ASP C N   1 
ATOM   8785  C CA  . ASP C 1 70  ? 35.346  12.147  54.576  1.00 14.87  ? 90   ASP C CA  1 
ATOM   8786  C C   . ASP C 1 70  ? 35.528  12.363  53.084  1.00 14.57  ? 90   ASP C C   1 
ATOM   8787  O O   . ASP C 1 70  ? 35.804  11.420  52.347  1.00 13.66  ? 90   ASP C O   1 
ATOM   8788  C CB  . ASP C 1 70  ? 36.568  11.395  55.112  1.00 15.21  ? 90   ASP C CB  1 
ATOM   8789  C CG  . ASP C 1 70  ? 37.861  12.175  54.935  1.00 14.71  ? 90   ASP C CG  1 
ATOM   8790  O OD1 . ASP C 1 70  ? 37.919  13.046  54.045  1.00 14.49  ? 90   ASP C OD1 1 
ATOM   8791  O OD2 . ASP C 1 70  ? 38.824  11.909  55.683  1.00 15.20  ? 90   ASP C OD2 1 
ATOM   8792  N N   . PRO C 1 71  ? 35.383  13.607  52.616  1.00 14.72  ? 91   PRO C N   1 
ATOM   8793  C CA  . PRO C 1 71  ? 35.549  13.834  51.178  1.00 14.94  ? 91   PRO C CA  1 
ATOM   8794  C C   . PRO C 1 71  ? 36.942  13.484  50.626  1.00 14.27  ? 91   PRO C C   1 
ATOM   8795  O O   . PRO C 1 71  ? 37.066  13.021  49.495  1.00 14.89  ? 91   PRO C O   1 
ATOM   8796  C CB  . PRO C 1 71  ? 35.169  15.307  51.021  1.00 13.33  ? 91   PRO C CB  1 
ATOM   8797  C CG  . PRO C 1 71  ? 35.582  15.896  52.331  1.00 15.32  ? 91   PRO C CG  1 
ATOM   8798  C CD  . PRO C 1 71  ? 35.132  14.867  53.335  1.00 14.01  ? 91   PRO C CD  1 
ATOM   8799  N N   . LYS C 1 72  ? 37.985  13.686  51.418  1.00 15.02  ? 92   LYS C N   1 
ATOM   8800  C CA  . LYS C 1 72  ? 39.331  13.369  50.961  1.00 16.39  ? 92   LYS C CA  1 
ATOM   8801  C C   . LYS C 1 72  ? 39.420  11.864  50.759  1.00 15.44  ? 92   LYS C C   1 
ATOM   8802  O O   . LYS C 1 72  ? 39.627  11.381  49.642  1.00 15.87  ? 92   LYS C O   1 
ATOM   8803  C CB  . LYS C 1 72  ? 40.361  13.810  51.999  1.00 19.24  ? 92   LYS C CB  1 
ATOM   8804  C CG  . LYS C 1 72  ? 41.612  14.443  51.415  1.00 24.92  ? 92   LYS C CG  1 
ATOM   8805  C CD  . LYS C 1 72  ? 41.907  15.803  52.084  1.00 30.30  ? 92   LYS C CD  1 
ATOM   8806  C CE  . LYS C 1 72  ? 40.770  16.828  51.846  1.00 32.61  ? 92   LYS C CE  1 
ATOM   8807  N NZ  . LYS C 1 72  ? 40.962  18.121  52.579  1.00 30.42  ? 92   LYS C NZ  1 
ATOM   8808  N N   . ALA C 1 73  ? 39.249  11.129  51.855  1.00 14.24  ? 93   ALA C N   1 
ATOM   8809  C CA  . ALA C 1 73  ? 39.302  9.673   51.842  1.00 12.62  ? 93   ALA C CA  1 
ATOM   8810  C C   . ALA C 1 73  ? 38.330  9.081   50.829  1.00 12.65  ? 93   ALA C C   1 
ATOM   8811  O O   . ALA C 1 73  ? 38.648  8.130   50.128  1.00 12.68  ? 93   ALA C O   1 
ATOM   8812  C CB  . ALA C 1 73  ? 38.985  9.149   53.225  1.00 11.35  ? 93   ALA C CB  1 
ATOM   8813  N N   . GLY C 1 74  ? 37.136  9.654   50.768  1.00 14.70  ? 94   GLY C N   1 
ATOM   8814  C CA  . GLY C 1 74  ? 36.122  9.175   49.854  1.00 15.12  ? 94   GLY C CA  1 
ATOM   8815  C C   . GLY C 1 74  ? 36.550  9.289   48.412  1.00 16.53  ? 94   GLY C C   1 
ATOM   8816  O O   . GLY C 1 74  ? 36.402  8.342   47.643  1.00 17.32  ? 94   GLY C O   1 
ATOM   8817  N N   . GLN C 1 75  ? 37.076  10.446  48.027  1.00 18.61  ? 95   GLN C N   1 
ATOM   8818  C CA  . GLN C 1 75  ? 37.516  10.618  46.648  1.00 19.61  ? 95   GLN C CA  1 
ATOM   8819  C C   . GLN C 1 75  ? 38.629  9.632   46.359  1.00 17.08  ? 95   GLN C C   1 
ATOM   8820  O O   . GLN C 1 75  ? 38.621  8.956   45.334  1.00 15.78  ? 95   GLN C O   1 
ATOM   8821  C CB  . GLN C 1 75  ? 38.009  12.044  46.405  1.00 23.13  ? 95   GLN C CB  1 
ATOM   8822  C CG  . GLN C 1 75  ? 36.906  13.047  46.079  1.00 31.50  ? 95   GLN C CG  1 
ATOM   8823  C CD  . GLN C 1 75  ? 36.285  12.832  44.692  1.00 36.92  ? 95   GLN C CD  1 
ATOM   8824  O OE1 . GLN C 1 75  ? 35.392  11.990  44.509  1.00 39.51  ? 95   GLN C OE1 1 
ATOM   8825  N NE2 . GLN C 1 75  ? 36.768  13.592  43.706  1.00 37.84  ? 95   GLN C NE2 1 
ATOM   8826  N N   . LEU C 1 76  ? 39.567  9.530   47.292  1.00 14.84  ? 96   LEU C N   1 
ATOM   8827  C CA  . LEU C 1 76  ? 40.702  8.637   47.130  1.00 15.41  ? 96   LEU C CA  1 
ATOM   8828  C C   . LEU C 1 76  ? 40.325  7.187   46.862  1.00 17.59  ? 96   LEU C C   1 
ATOM   8829  O O   . LEU C 1 76  ? 40.847  6.571   45.925  1.00 19.87  ? 96   LEU C O   1 
ATOM   8830  C CB  . LEU C 1 76  ? 41.608  8.703   48.357  1.00 13.02  ? 96   LEU C CB  1 
ATOM   8831  C CG  . LEU C 1 76  ? 42.870  7.848   48.248  1.00 10.72  ? 96   LEU C CG  1 
ATOM   8832  C CD1 . LEU C 1 76  ? 43.609  8.176   46.961  1.00 8.28   ? 96   LEU C CD1 1 
ATOM   8833  C CD2 . LEU C 1 76  ? 43.740  8.076   49.459  1.00 8.66   ? 96   LEU C CD2 1 
ATOM   8834  N N   . LEU C 1 77  ? 39.434  6.634   47.683  1.00 17.04  ? 97   LEU C N   1 
ATOM   8835  C CA  . LEU C 1 77  ? 39.014  5.251   47.504  1.00 16.47  ? 97   LEU C CA  1 
ATOM   8836  C C   . LEU C 1 77  ? 38.332  5.072   46.151  1.00 16.42  ? 97   LEU C C   1 
ATOM   8837  O O   . LEU C 1 77  ? 38.600  4.106   45.435  1.00 16.83  ? 97   LEU C O   1 
ATOM   8838  C CB  . LEU C 1 77  ? 38.063  4.827   48.621  1.00 14.38  ? 97   LEU C CB  1 
ATOM   8839  C CG  . LEU C 1 77  ? 37.845  3.316   48.724  1.00 13.78  ? 97   LEU C CG  1 
ATOM   8840  C CD1 . LEU C 1 77  ? 39.140  2.624   49.125  1.00 10.35  ? 97   LEU C CD1 1 
ATOM   8841  C CD2 . LEU C 1 77  ? 36.760  3.036   49.744  1.00 16.46  ? 97   LEU C CD2 1 
ATOM   8842  N N   . SER C 1 78  ? 37.459  6.010   45.799  1.00 17.63  ? 98   SER C N   1 
ATOM   8843  C CA  . SER C 1 78  ? 36.748  5.948   44.526  1.00 18.60  ? 98   SER C CA  1 
ATOM   8844  C C   . SER C 1 78  ? 37.731  5.967   43.357  1.00 20.71  ? 98   SER C C   1 
ATOM   8845  O O   . SER C 1 78  ? 37.506  5.312   42.339  1.00 21.16  ? 98   SER C O   1 
ATOM   8846  C CB  . SER C 1 78  ? 35.776  7.127   44.399  1.00 17.44  ? 98   SER C CB  1 
ATOM   8847  O OG  . SER C 1 78  ? 35.034  7.055   43.192  1.00 13.78  ? 98   SER C OG  1 
ATOM   8848  N N   . GLU C 1 79  ? 38.825  6.711   43.498  1.00 22.28  ? 99   GLU C N   1 
ATOM   8849  C CA  . GLU C 1 79  ? 39.802  6.792   42.423  1.00 23.36  ? 99   GLU C CA  1 
ATOM   8850  C C   . GLU C 1 79  ? 40.600  5.507   42.301  1.00 22.57  ? 99   GLU C C   1 
ATOM   8851  O O   . GLU C 1 79  ? 40.935  5.093   41.194  1.00 24.08  ? 99   GLU C O   1 
ATOM   8852  C CB  . GLU C 1 79  ? 40.741  7.979   42.640  1.00 26.85  ? 99   GLU C CB  1 
ATOM   8853  C CG  . GLU C 1 79  ? 40.005  9.304   42.770  1.00 34.74  ? 99   GLU C CG  1 
ATOM   8854  C CD  . GLU C 1 79  ? 40.928  10.512  42.866  1.00 38.17  ? 99   GLU C CD  1 
ATOM   8855  O OE1 . GLU C 1 79  ? 41.951  10.429  43.583  1.00 40.34  ? 99   GLU C OE1 1 
ATOM   8856  O OE2 . GLU C 1 79  ? 40.613  11.549  42.234  1.00 40.01  ? 99   GLU C OE2 1 
ATOM   8857  N N   . LEU C 1 80  ? 40.883  4.873   43.438  1.00 20.87  ? 100  LEU C N   1 
ATOM   8858  C CA  . LEU C 1 80  ? 41.652  3.629   43.481  1.00 17.83  ? 100  LEU C CA  1 
ATOM   8859  C C   . LEU C 1 80  ? 40.875  2.400   43.008  1.00 17.94  ? 100  LEU C C   1 
ATOM   8860  O O   . LEU C 1 80  ? 41.460  1.485   42.422  1.00 19.06  ? 100  LEU C O   1 
ATOM   8861  C CB  . LEU C 1 80  ? 42.138  3.370   44.905  1.00 17.59  ? 100  LEU C CB  1 
ATOM   8862  C CG  . LEU C 1 80  ? 43.252  4.220   45.509  1.00 16.15  ? 100  LEU C CG  1 
ATOM   8863  C CD1 . LEU C 1 80  ? 43.268  4.079   47.030  1.00 15.56  ? 100  LEU C CD1 1 
ATOM   8864  C CD2 . LEU C 1 80  ? 44.565  3.774   44.924  1.00 15.57  ? 100  LEU C CD2 1 
ATOM   8865  N N   . PHE C 1 81  ? 39.566  2.381   43.265  1.00 16.41  ? 101  PHE C N   1 
ATOM   8866  C CA  . PHE C 1 81  ? 38.712  1.252   42.894  1.00 14.28  ? 101  PHE C CA  1 
ATOM   8867  C C   . PHE C 1 81  ? 37.904  1.361   41.609  1.00 13.59  ? 101  PHE C C   1 
ATOM   8868  O O   . PHE C 1 81  ? 37.488  0.351   41.059  1.00 13.83  ? 101  PHE C O   1 
ATOM   8869  C CB  . PHE C 1 81  ? 37.734  0.949   44.026  1.00 14.88  ? 101  PHE C CB  1 
ATOM   8870  C CG  . PHE C 1 81  ? 38.332  0.178   45.156  1.00 16.20  ? 101  PHE C CG  1 
ATOM   8871  C CD1 . PHE C 1 81  ? 39.658  -0.239  45.110  1.00 16.84  ? 101  PHE C CD1 1 
ATOM   8872  C CD2 . PHE C 1 81  ? 37.561  -0.153  46.265  1.00 15.60  ? 101  PHE C CD2 1 
ATOM   8873  C CE1 . PHE C 1 81  ? 40.209  -0.977  46.155  1.00 18.05  ? 101  PHE C CE1 1 
ATOM   8874  C CE2 . PHE C 1 81  ? 38.100  -0.892  47.316  1.00 16.92  ? 101  PHE C CE2 1 
ATOM   8875  C CZ  . PHE C 1 81  ? 39.430  -1.306  47.263  1.00 16.84  ? 101  PHE C CZ  1 
ATOM   8876  N N   . THR C 1 82  ? 37.667  2.570   41.126  1.00 13.90  ? 102  THR C N   1 
ATOM   8877  C CA  . THR C 1 82  ? 36.866  2.728   39.923  1.00 14.13  ? 102  THR C CA  1 
ATOM   8878  C C   . THR C 1 82  ? 37.392  1.933   38.736  1.00 16.04  ? 102  THR C C   1 
ATOM   8879  O O   . THR C 1 82  ? 38.593  1.764   38.563  1.00 16.83  ? 102  THR C O   1 
ATOM   8880  C CB  . THR C 1 82  ? 36.741  4.203   39.530  1.00 12.63  ? 102  THR C CB  1 
ATOM   8881  O OG1 . THR C 1 82  ? 35.848  4.313   38.420  1.00 11.22  ? 102  THR C OG1 1 
ATOM   8882  C CG2 . THR C 1 82  ? 38.092  4.777   39.161  1.00 11.38  ? 102  THR C CG2 1 
ATOM   8883  N N   . ASN C 1 83  ? 36.477  1.445   37.914  1.00 18.22  ? 103  ASN C N   1 
ATOM   8884  C CA  . ASN C 1 83  ? 36.850  0.655   36.757  1.00 20.39  ? 103  ASN C CA  1 
ATOM   8885  C C   . ASN C 1 83  ? 36.586  1.414   35.476  1.00 22.05  ? 103  ASN C C   1 
ATOM   8886  O O   . ASN C 1 83  ? 36.759  0.875   34.389  1.00 21.96  ? 103  ASN C O   1 
ATOM   8887  C CB  . ASN C 1 83  ? 36.056  -0.648  36.746  1.00 21.02  ? 103  ASN C CB  1 
ATOM   8888  C CG  . ASN C 1 83  ? 34.560  -0.413  36.671  1.00 21.01  ? 103  ASN C CG  1 
ATOM   8889  O OD1 . ASN C 1 83  ? 34.010  0.410   37.404  1.00 20.93  ? 103  ASN C OD1 1 
ATOM   8890  N ND2 . ASN C 1 83  ? 33.892  -1.143  35.789  1.00 21.67  ? 103  ASN C ND2 1 
ATOM   8891  N N   . ARG C 1 84  ? 36.154  2.662   35.605  1.00 25.57  ? 104  ARG C N   1 
ATOM   8892  C CA  . ARG C 1 84  ? 35.873  3.494   34.441  1.00 30.09  ? 104  ARG C CA  1 
ATOM   8893  C C   . ARG C 1 84  ? 37.129  4.295   34.091  1.00 33.37  ? 104  ARG C C   1 
ATOM   8894  O O   . ARG C 1 84  ? 37.989  4.499   34.942  1.00 34.27  ? 104  ARG C O   1 
ATOM   8895  C CB  . ARG C 1 84  ? 34.689  4.429   34.735  1.00 29.38  ? 104  ARG C CB  1 
ATOM   8896  C CG  . ARG C 1 84  ? 34.750  5.061   36.115  1.00 29.57  ? 104  ARG C CG  1 
ATOM   8897  C CD  . ARG C 1 84  ? 33.729  6.179   36.346  1.00 29.50  ? 104  ARG C CD  1 
ATOM   8898  N NE  . ARG C 1 84  ? 32.396  5.722   36.745  1.00 26.38  ? 104  ARG C NE  1 
ATOM   8899  C CZ  . ARG C 1 84  ? 31.496  5.218   35.911  1.00 25.69  ? 104  ARG C CZ  1 
ATOM   8900  N NH1 . ARG C 1 84  ? 31.783  5.098   34.621  1.00 25.28  ? 104  ARG C NH1 1 
ATOM   8901  N NH2 . ARG C 1 84  ? 30.306  4.853   36.366  1.00 22.58  ? 104  ARG C NH2 1 
ATOM   8902  N N   . LYS C 1 85  ? 37.240  4.729   32.838  1.00 37.90  ? 105  LYS C N   1 
ATOM   8903  C CA  . LYS C 1 85  ? 38.402  5.495   32.382  1.00 43.22  ? 105  LYS C CA  1 
ATOM   8904  C C   . LYS C 1 85  ? 38.718  6.700   33.265  1.00 44.87  ? 105  LYS C C   1 
ATOM   8905  O O   . LYS C 1 85  ? 39.792  6.786   33.860  1.00 45.02  ? 105  LYS C O   1 
ATOM   8906  C CB  . LYS C 1 85  ? 38.188  5.965   30.937  1.00 45.78  ? 105  LYS C CB  1 
ATOM   8907  C CG  . LYS C 1 85  ? 36.719  6.199   30.590  1.00 51.08  ? 105  LYS C CG  1 
ATOM   8908  C CD  . LYS C 1 85  ? 36.528  7.051   29.329  1.00 54.38  ? 105  LYS C CD  1 
ATOM   8909  C CE  . LYS C 1 85  ? 36.595  8.551   29.634  1.00 55.15  ? 105  LYS C CE  1 
ATOM   8910  N NZ  . LYS C 1 85  ? 36.287  9.404   28.444  1.00 55.18  ? 105  LYS C NZ  1 
ATOM   8911  N N   . GLU C 1 86  ? 37.777  7.631   33.336  1.00 46.90  ? 106  GLU C N   1 
ATOM   8912  C CA  . GLU C 1 86  ? 37.933  8.840   34.133  1.00 49.89  ? 106  GLU C CA  1 
ATOM   8913  C C   . GLU C 1 86  ? 37.135  8.712   35.428  1.00 49.59  ? 106  GLU C C   1 
ATOM   8914  O O   . GLU C 1 86  ? 36.032  8.167   35.427  1.00 49.48  ? 106  GLU C O   1 
ATOM   8915  C CB  . GLU C 1 86  ? 37.408  10.037  33.344  1.00 54.00  ? 106  GLU C CB  1 
ATOM   8916  C CG  . GLU C 1 86  ? 36.050  9.750   32.711  1.00 61.82  ? 106  GLU C CG  1 
ATOM   8917  C CD  . GLU C 1 86  ? 35.237  10.998  32.387  1.00 66.88  ? 106  GLU C CD  1 
ATOM   8918  O OE1 . GLU C 1 86  ? 34.841  11.723  33.335  1.00 68.35  ? 106  GLU C OE1 1 
ATOM   8919  O OE2 . GLU C 1 86  ? 34.986  11.246  31.181  1.00 69.21  ? 106  GLU C OE2 1 
ATOM   8920  N N   . ASN C 1 87  ? 37.679  9.216   36.531  1.00 48.69  ? 107  ASN C N   1 
ATOM   8921  C CA  . ASN C 1 87  ? 36.957  9.138   37.789  1.00 47.50  ? 107  ASN C CA  1 
ATOM   8922  C C   . ASN C 1 87  ? 35.913  10.243  37.833  1.00 46.09  ? 107  ASN C C   1 
ATOM   8923  O O   . ASN C 1 87  ? 36.157  11.360  37.371  1.00 44.84  ? 107  ASN C O   1 
ATOM   8924  C CB  . ASN C 1 87  ? 37.902  9.263   38.983  1.00 48.83  ? 107  ASN C CB  1 
ATOM   8925  C CG  . ASN C 1 87  ? 37.279  8.730   40.270  1.00 50.43  ? 107  ASN C CG  1 
ATOM   8926  O OD1 . ASN C 1 87  ? 36.368  9.337   40.846  1.00 49.41  ? 107  ASN C OD1 1 
ATOM   8927  N ND2 . ASN C 1 87  ? 37.756  7.574   40.713  1.00 51.37  ? 107  ASN C ND2 1 
ATOM   8928  N N   . ILE C 1 88  ? 34.751  9.917   38.392  1.00 44.58  ? 108  ILE C N   1 
ATOM   8929  C CA  . ILE C 1 88  ? 33.644  10.859  38.488  1.00 42.76  ? 108  ILE C CA  1 
ATOM   8930  C C   . ILE C 1 88  ? 33.580  11.591  39.821  1.00 41.33  ? 108  ILE C C   1 
ATOM   8931  O O   . ILE C 1 88  ? 33.382  10.974  40.869  1.00 42.45  ? 108  ILE C O   1 
ATOM   8932  C CB  . ILE C 1 88  ? 32.298  10.143  38.282  1.00 43.76  ? 108  ILE C CB  1 
ATOM   8933  C CG1 . ILE C 1 88  ? 32.312  9.368   36.959  1.00 44.13  ? 108  ILE C CG1 1 
ATOM   8934  C CG2 . ILE C 1 88  ? 31.163  11.152  38.332  1.00 44.27  ? 108  ILE C CG2 1 
ATOM   8935  C CD1 . ILE C 1 88  ? 32.760  10.179  35.757  1.00 44.57  ? 108  ILE C CD1 1 
ATOM   8936  N N   . PRO C 1 89  ? 33.731  12.924  39.798  1.00 39.46  ? 109  PRO C N   1 
ATOM   8937  C CA  . PRO C 1 89  ? 33.678  13.703  41.035  1.00 37.69  ? 109  PRO C CA  1 
ATOM   8938  C C   . PRO C 1 89  ? 32.279  13.578  41.625  1.00 36.16  ? 109  PRO C C   1 
ATOM   8939  O O   . PRO C 1 89  ? 31.287  13.618  40.898  1.00 35.67  ? 109  PRO C O   1 
ATOM   8940  C CB  . PRO C 1 89  ? 33.972  15.118  40.556  1.00 37.60  ? 109  PRO C CB  1 
ATOM   8941  C CG  . PRO C 1 89  ? 33.318  15.137  39.212  1.00 37.67  ? 109  PRO C CG  1 
ATOM   8942  C CD  . PRO C 1 89  ? 33.772  13.815  38.625  1.00 38.47  ? 109  PRO C CD  1 
ATOM   8943  N N   . LEU C 1 90  ? 32.196  13.420  42.937  1.00 34.91  ? 110  LEU C N   1 
ATOM   8944  C CA  . LEU C 1 90  ? 30.895  13.284  43.574  1.00 32.97  ? 110  LEU C CA  1 
ATOM   8945  C C   . LEU C 1 90  ? 30.629  14.392  44.579  1.00 30.27  ? 110  LEU C C   1 
ATOM   8946  O O   . LEU C 1 90  ? 31.526  15.151  44.940  1.00 28.57  ? 110  LEU C O   1 
ATOM   8947  C CB  . LEU C 1 90  ? 30.783  11.916  44.260  1.00 34.17  ? 110  LEU C CB  1 
ATOM   8948  C CG  . LEU C 1 90  ? 30.644  10.719  43.315  1.00 34.53  ? 110  LEU C CG  1 
ATOM   8949  C CD1 . LEU C 1 90  ? 31.103  9.451   44.014  1.00 36.18  ? 110  LEU C CD1 1 
ATOM   8950  C CD2 . LEU C 1 90  ? 29.203  10.601  42.846  1.00 34.41  ? 110  LEU C CD2 1 
ATOM   8951  N N   . LYS C 1 91  ? 29.377  14.468  45.011  1.00 27.78  ? 111  LYS C N   1 
ATOM   8952  C CA  . LYS C 1 91  ? 28.929  15.457  45.971  1.00 25.60  ? 111  LYS C CA  1 
ATOM   8953  C C   . LYS C 1 91  ? 28.467  14.689  47.209  1.00 22.43  ? 111  LYS C C   1 
ATOM   8954  O O   . LYS C 1 91  ? 28.059  13.526  47.112  1.00 21.57  ? 111  LYS C O   1 
ATOM   8955  C CB  . LYS C 1 91  ? 27.762  16.259  45.380  1.00 28.96  ? 111  LYS C CB  1 
ATOM   8956  C CG  . LYS C 1 91  ? 27.467  17.603  46.063  1.00 33.65  ? 111  LYS C CG  1 
ATOM   8957  C CD  . LYS C 1 91  ? 28.511  18.657  45.690  1.00 36.19  ? 111  LYS C CD  1 
ATOM   8958  C CE  . LYS C 1 91  ? 28.046  20.086  45.986  1.00 36.20  ? 111  LYS C CE  1 
ATOM   8959  N NZ  . LYS C 1 91  ? 29.026  21.085  45.432  1.00 34.66  ? 111  LYS C NZ  1 
ATOM   8960  N N   . LEU C 1 92  ? 28.536  15.340  48.366  1.00 17.83  ? 112  LEU C N   1 
ATOM   8961  C CA  . LEU C 1 92  ? 28.130  14.720  49.619  1.00 14.58  ? 112  LEU C CA  1 
ATOM   8962  C C   . LEU C 1 92  ? 26.730  15.155  50.023  1.00 13.73  ? 112  LEU C C   1 
ATOM   8963  O O   . LEU C 1 92  ? 26.362  16.326  49.880  1.00 14.53  ? 112  LEU C O   1 
ATOM   8964  C CB  . LEU C 1 92  ? 29.090  15.113  50.738  1.00 13.74  ? 112  LEU C CB  1 
ATOM   8965  C CG  . LEU C 1 92  ? 30.570  14.785  50.626  1.00 13.67  ? 112  LEU C CG  1 
ATOM   8966  C CD1 . LEU C 1 92  ? 31.295  15.458  51.764  1.00 13.63  ? 112  LEU C CD1 1 
ATOM   8967  C CD2 . LEU C 1 92  ? 30.787  13.280  50.667  1.00 16.40  ? 112  LEU C CD2 1 
ATOM   8968  N N   . SER C 1 93  ? 25.950  14.220  50.543  1.00 11.19  ? 113  SER C N   1 
ATOM   8969  C CA  . SER C 1 93  ? 24.613  14.555  50.986  1.00 11.53  ? 113  SER C CA  1 
ATOM   8970  C C   . SER C 1 93  ? 24.019  13.476  51.843  1.00 12.37  ? 113  SER C C   1 
ATOM   8971  O O   . SER C 1 93  ? 24.342  12.300  51.691  1.00 15.30  ? 113  SER C O   1 
ATOM   8972  C CB  . SER C 1 93  ? 23.680  14.782  49.805  1.00 11.50  ? 113  SER C CB  1 
ATOM   8973  O OG  . SER C 1 93  ? 22.388  15.146  50.266  1.00 8.74   ? 113  SER C OG  1 
ATOM   8974  N N   . GLU C 1 94  ? 23.147  13.882  52.754  1.00 11.06  ? 114  GLU C N   1 
ATOM   8975  C CA  . GLU C 1 94  ? 22.476  12.933  53.611  1.00 8.98   ? 114  GLU C CA  1 
ATOM   8976  C C   . GLU C 1 94  ? 21.448  12.319  52.687  1.00 7.33   ? 114  GLU C C   1 
ATOM   8977  O O   . GLU C 1 94  ? 20.980  11.202  52.897  1.00 7.69   ? 114  GLU C O   1 
ATOM   8978  C CB  . GLU C 1 94  ? 21.823  13.654  54.791  1.00 9.97   ? 114  GLU C CB  1 
ATOM   8979  C CG  . GLU C 1 94  ? 22.576  13.445  56.087  1.00 13.22  ? 114  GLU C CG  1 
ATOM   8980  C CD  . GLU C 1 94  ? 22.164  14.394  57.177  1.00 15.21  ? 114  GLU C CD  1 
ATOM   8981  O OE1 . GLU C 1 94  ? 20.950  14.525  57.440  1.00 19.16  ? 114  GLU C OE1 1 
ATOM   8982  O OE2 . GLU C 1 94  ? 23.064  15.005  57.785  1.00 17.40  ? 114  GLU C OE2 1 
ATOM   8983  N N   . ASP C 1 95  ? 21.121  13.065  51.640  1.00 6.82   ? 115  ASP C N   1 
ATOM   8984  C CA  . ASP C 1 95  ? 20.170  12.609  50.636  1.00 8.74   ? 115  ASP C CA  1 
ATOM   8985  C C   . ASP C 1 95  ? 20.966  11.714  49.691  1.00 9.01   ? 115  ASP C C   1 
ATOM   8986  O O   . ASP C 1 95  ? 21.542  12.191  48.712  1.00 8.14   ? 115  ASP C O   1 
ATOM   8987  C CB  . ASP C 1 95  ? 19.603  13.797  49.866  1.00 8.01   ? 115  ASP C CB  1 
ATOM   8988  C CG  . ASP C 1 95  ? 18.540  13.392  48.884  1.00 8.22   ? 115  ASP C CG  1 
ATOM   8989  O OD1 . ASP C 1 95  ? 18.339  12.176  48.690  1.00 8.04   ? 115  ASP C OD1 1 
ATOM   8990  O OD2 . ASP C 1 95  ? 17.905  14.291  48.302  1.00 10.83  ? 115  ASP C OD2 1 
ATOM   8991  N N   . CYS C 1 96  ? 20.987  10.415  49.980  1.00 8.74   ? 116  CYS C N   1 
ATOM   8992  C CA  . CYS C 1 96  ? 21.764  9.498   49.169  1.00 8.55   ? 116  CYS C CA  1 
ATOM   8993  C C   . CYS C 1 96  ? 21.191  8.097   48.994  1.00 7.25   ? 116  CYS C C   1 
ATOM   8994  O O   . CYS C 1 96  ? 21.854  7.241   48.417  1.00 6.96   ? 116  CYS C O   1 
ATOM   8995  C CB  . CYS C 1 96  ? 23.163  9.388   49.776  1.00 11.42  ? 116  CYS C CB  1 
ATOM   8996  S SG  . CYS C 1 96  ? 23.098  8.802   51.495  1.00 12.46  ? 116  CYS C SG  1 
ATOM   8997  N N   . LEU C 1 97  ? 19.985  7.835   49.486  1.00 5.80   ? 117  LEU C N   1 
ATOM   8998  C CA  . LEU C 1 97  ? 19.445  6.490   49.326  1.00 5.77   ? 117  LEU C CA  1 
ATOM   8999  C C   . LEU C 1 97  ? 18.930  6.224   47.899  1.00 5.69   ? 117  LEU C C   1 
ATOM   9000  O O   . LEU C 1 97  ? 17.722  6.142   47.641  1.00 4.11   ? 117  LEU C O   1 
ATOM   9001  C CB  . LEU C 1 97  ? 18.363  6.229   50.378  1.00 4.56   ? 117  LEU C CB  1 
ATOM   9002  C CG  . LEU C 1 97  ? 18.863  6.408   51.816  1.00 1.44   ? 117  LEU C CG  1 
ATOM   9003  C CD1 . LEU C 1 97  ? 17.847  5.860   52.791  1.00 1.44   ? 117  LEU C CD1 1 
ATOM   9004  C CD2 . LEU C 1 97  ? 20.166  5.683   51.994  1.00 1.87   ? 117  LEU C CD2 1 
ATOM   9005  N N   . TYR C 1 98  ? 19.890  6.093   46.985  1.00 5.56   ? 118  TYR C N   1 
ATOM   9006  C CA  . TYR C 1 98  ? 19.640  5.838   45.569  1.00 5.48   ? 118  TYR C CA  1 
ATOM   9007  C C   . TYR C 1 98  ? 20.386  4.587   45.092  1.00 6.35   ? 118  TYR C C   1 
ATOM   9008  O O   . TYR C 1 98  ? 21.230  4.042   45.808  1.00 6.41   ? 118  TYR C O   1 
ATOM   9009  C CB  . TYR C 1 98  ? 20.124  7.020   44.732  1.00 3.03   ? 118  TYR C CB  1 
ATOM   9010  C CG  . TYR C 1 98  ? 19.449  8.316   45.053  1.00 2.52   ? 118  TYR C CG  1 
ATOM   9011  C CD1 . TYR C 1 98  ? 19.942  9.158   46.042  1.00 1.44   ? 118  TYR C CD1 1 
ATOM   9012  C CD2 . TYR C 1 98  ? 18.283  8.685   44.388  1.00 3.62   ? 118  TYR C CD2 1 
ATOM   9013  C CE1 . TYR C 1 98  ? 19.282  10.340  46.363  1.00 2.33   ? 118  TYR C CE1 1 
ATOM   9014  C CE2 . TYR C 1 98  ? 17.618  9.854   44.699  1.00 2.58   ? 118  TYR C CE2 1 
ATOM   9015  C CZ  . TYR C 1 98  ? 18.114  10.676  45.687  1.00 2.53   ? 118  TYR C CZ  1 
ATOM   9016  O OH  . TYR C 1 98  ? 17.404  11.803  46.027  1.00 3.44   ? 118  TYR C OH  1 
ATOM   9017  N N   . LEU C 1 99  ? 20.066  4.141   43.879  1.00 7.65   ? 119  LEU C N   1 
ATOM   9018  C CA  . LEU C 1 99  ? 20.727  2.988   43.264  1.00 9.10   ? 119  LEU C CA  1 
ATOM   9019  C C   . LEU C 1 99  ? 20.826  3.244   41.755  1.00 9.79   ? 119  LEU C C   1 
ATOM   9020  O O   . LEU C 1 99  ? 20.053  4.042   41.206  1.00 10.26  ? 119  LEU C O   1 
ATOM   9021  C CB  . LEU C 1 99  ? 19.936  1.707   43.544  1.00 8.87   ? 119  LEU C CB  1 
ATOM   9022  C CG  . LEU C 1 99  ? 18.456  1.656   43.145  1.00 10.24  ? 119  LEU C CG  1 
ATOM   9023  C CD1 . LEU C 1 99  ? 18.333  1.561   41.621  1.00 9.62   ? 119  LEU C CD1 1 
ATOM   9024  C CD2 . LEU C 1 99  ? 17.784  0.451   43.801  1.00 7.35   ? 119  LEU C CD2 1 
ATOM   9025  N N   . ASN C 1 100 ? 21.785  2.599   41.093  1.00 9.51   ? 120  ASN C N   1 
ATOM   9026  C CA  . ASN C 1 100 ? 21.949  2.758   39.643  1.00 9.07   ? 120  ASN C CA  1 
ATOM   9027  C C   . ASN C 1 100 ? 21.629  1.449   38.955  1.00 9.02   ? 120  ASN C C   1 
ATOM   9028  O O   . ASN C 1 100 ? 21.977  0.391   39.473  1.00 11.65  ? 120  ASN C O   1 
ATOM   9029  C CB  . ASN C 1 100 ? 23.379  3.146   39.290  1.00 7.49   ? 120  ASN C CB  1 
ATOM   9030  C CG  . ASN C 1 100 ? 23.771  4.491   39.847  1.00 9.29   ? 120  ASN C CG  1 
ATOM   9031  O OD1 . ASN C 1 100 ? 22.954  5.417   39.895  1.00 8.55   ? 120  ASN C OD1 1 
ATOM   9032  N ND2 . ASN C 1 100 ? 25.034  4.619   40.259  1.00 7.04   ? 120  ASN C ND2 1 
ATOM   9033  N N   . ILE C 1 101 ? 20.967  1.500   37.803  1.00 9.01   ? 121  ILE C N   1 
ATOM   9034  C CA  . ILE C 1 101 ? 20.651  0.266   37.077  1.00 9.90   ? 121  ILE C CA  1 
ATOM   9035  C C   . ILE C 1 101 ? 21.324  0.188   35.695  1.00 9.77   ? 121  ILE C C   1 
ATOM   9036  O O   . ILE C 1 101 ? 21.379  1.177   34.959  1.00 9.91   ? 121  ILE C O   1 
ATOM   9037  C CB  . ILE C 1 101 ? 19.113  0.070   36.906  1.00 9.60   ? 121  ILE C CB  1 
ATOM   9038  C CG1 . ILE C 1 101 ? 18.453  -0.184  38.271  1.00 10.88  ? 121  ILE C CG1 1 
ATOM   9039  C CG2 . ILE C 1 101 ? 18.841  -1.118  35.989  1.00 8.50   ? 121  ILE C CG2 1 
ATOM   9040  C CD1 . ILE C 1 101 ? 16.922  -0.417  38.227  1.00 8.34   ? 121  ILE C CD1 1 
ATOM   9041  N N   . TYR C 1 102 ? 21.857  -0.991  35.377  1.00 10.14  ? 122  TYR C N   1 
ATOM   9042  C CA  . TYR C 1 102 ? 22.512  -1.268  34.094  1.00 12.02  ? 122  TYR C CA  1 
ATOM   9043  C C   . TYR C 1 102 ? 21.864  -2.526  33.511  1.00 13.23  ? 122  TYR C C   1 
ATOM   9044  O O   . TYR C 1 102 ? 22.249  -3.654  33.840  1.00 14.07  ? 122  TYR C O   1 
ATOM   9045  C CB  . TYR C 1 102 ? 24.010  -1.522  34.282  1.00 11.10  ? 122  TYR C CB  1 
ATOM   9046  C CG  . TYR C 1 102 ? 24.760  -0.346  34.842  1.00 13.57  ? 122  TYR C CG  1 
ATOM   9047  C CD1 . TYR C 1 102 ? 24.768  -0.081  36.209  1.00 14.51  ? 122  TYR C CD1 1 
ATOM   9048  C CD2 . TYR C 1 102 ? 25.439  0.528   34.003  1.00 14.39  ? 122  TYR C CD2 1 
ATOM   9049  C CE1 . TYR C 1 102 ? 25.440  1.034   36.727  1.00 13.79  ? 122  TYR C CE1 1 
ATOM   9050  C CE2 . TYR C 1 102 ? 26.109  1.643   34.506  1.00 15.18  ? 122  TYR C CE2 1 
ATOM   9051  C CZ  . TYR C 1 102 ? 26.106  1.890   35.867  1.00 14.24  ? 122  TYR C CZ  1 
ATOM   9052  O OH  . TYR C 1 102 ? 26.761  2.994   36.356  1.00 13.45  ? 122  TYR C OH  1 
ATOM   9053  N N   . THR C 1 103 ? 20.873  -2.345  32.650  1.00 13.34  ? 123  THR C N   1 
ATOM   9054  C CA  . THR C 1 103 ? 20.197  -3.498  32.088  1.00 14.19  ? 123  THR C CA  1 
ATOM   9055  C C   . THR C 1 103 ? 20.443  -3.686  30.603  1.00 15.49  ? 123  THR C C   1 
ATOM   9056  O O   . THR C 1 103 ? 20.256  -2.766  29.802  1.00 15.01  ? 123  THR C O   1 
ATOM   9057  C CB  . THR C 1 103 ? 18.690  -3.416  32.328  1.00 14.31  ? 123  THR C CB  1 
ATOM   9058  O OG1 . THR C 1 103 ? 18.094  -4.669  31.983  1.00 16.02  ? 123  THR C OG1 1 
ATOM   9059  C CG2 . THR C 1 103 ? 18.072  -2.306  31.490  1.00 12.76  ? 123  THR C CG2 1 
ATOM   9060  N N   . PRO C 1 104 ? 20.877  -4.893  30.216  1.00 16.92  ? 124  PRO C N   1 
ATOM   9061  C CA  . PRO C 1 104 ? 21.158  -5.226  28.817  1.00 17.21  ? 124  PRO C CA  1 
ATOM   9062  C C   . PRO C 1 104 ? 19.932  -5.781  28.088  1.00 17.42  ? 124  PRO C C   1 
ATOM   9063  O O   . PRO C 1 104 ? 19.972  -6.024  26.880  1.00 18.36  ? 124  PRO C O   1 
ATOM   9064  C CB  . PRO C 1 104 ? 22.274  -6.254  28.940  1.00 16.78  ? 124  PRO C CB  1 
ATOM   9065  C CG  . PRO C 1 104 ? 21.850  -7.034  30.153  1.00 17.20  ? 124  PRO C CG  1 
ATOM   9066  C CD  . PRO C 1 104 ? 21.395  -5.939  31.121  1.00 17.71  ? 124  PRO C CD  1 
ATOM   9067  N N   . ALA C 1 105 ? 18.843  -5.971  28.823  1.00 17.64  ? 125  ALA C N   1 
ATOM   9068  C CA  . ALA C 1 105 ? 17.620  -6.515  28.246  1.00 20.53  ? 125  ALA C CA  1 
ATOM   9069  C C   . ALA C 1 105 ? 16.931  -5.565  27.269  1.00 22.83  ? 125  ALA C C   1 
ATOM   9070  O O   . ALA C 1 105 ? 17.096  -4.344  27.350  1.00 23.17  ? 125  ALA C O   1 
ATOM   9071  C CB  . ALA C 1 105 ? 16.646  -6.892  29.366  1.00 19.17  ? 125  ALA C CB  1 
ATOM   9072  N N   . ASP C 1 106 ? 16.169  -6.131  26.334  1.00 25.38  ? 126  ASP C N   1 
ATOM   9073  C CA  . ASP C 1 106 ? 15.412  -5.312  25.392  1.00 28.24  ? 126  ASP C CA  1 
ATOM   9074  C C   . ASP C 1 106 ? 14.138  -4.962  26.167  1.00 28.41  ? 126  ASP C C   1 
ATOM   9075  O O   . ASP C 1 106 ? 13.291  -5.816  26.418  1.00 27.63  ? 126  ASP C O   1 
ATOM   9076  C CB  . ASP C 1 106 ? 15.069  -6.098  24.122  1.00 29.55  ? 126  ASP C CB  1 
ATOM   9077  C CG  . ASP C 1 106 ? 14.294  -5.262  23.107  1.00 31.34  ? 126  ASP C CG  1 
ATOM   9078  O OD1 . ASP C 1 106 ? 14.770  -4.159  22.747  1.00 32.21  ? 126  ASP C OD1 1 
ATOM   9079  O OD2 . ASP C 1 106 ? 13.210  -5.711  22.669  1.00 30.53  ? 126  ASP C OD2 1 
ATOM   9080  N N   . LEU C 1 107 ? 14.013  -3.703  26.558  1.00 28.23  ? 127  LEU C N   1 
ATOM   9081  C CA  . LEU C 1 107 ? 12.874  -3.286  27.342  1.00 28.91  ? 127  LEU C CA  1 
ATOM   9082  C C   . LEU C 1 107 ? 11.542  -3.403  26.625  1.00 31.00  ? 127  LEU C C   1 
ATOM   9083  O O   . LEU C 1 107 ? 10.503  -3.547  27.271  1.00 31.74  ? 127  LEU C O   1 
ATOM   9084  C CB  . LEU C 1 107 ? 13.106  -1.864  27.850  1.00 28.24  ? 127  LEU C CB  1 
ATOM   9085  C CG  . LEU C 1 107 ? 14.367  -1.752  28.728  1.00 27.94  ? 127  LEU C CG  1 
ATOM   9086  C CD1 . LEU C 1 107 ? 14.628  -0.298  29.063  1.00 25.92  ? 127  LEU C CD1 1 
ATOM   9087  C CD2 . LEU C 1 107 ? 14.218  -2.592  30.007  1.00 25.43  ? 127  LEU C CD2 1 
ATOM   9088  N N   . THR C 1 108 ? 11.564  -3.372  25.296  1.00 33.47  ? 128  THR C N   1 
ATOM   9089  C CA  . THR C 1 108 ? 10.326  -3.467  24.516  1.00 34.09  ? 128  THR C CA  1 
ATOM   9090  C C   . THR C 1 108 ? 9.629   -4.821  24.672  1.00 35.41  ? 128  THR C C   1 
ATOM   9091  O O   . THR C 1 108 ? 8.408   -4.901  24.608  1.00 36.75  ? 128  THR C O   1 
ATOM   9092  C CB  . THR C 1 108 ? 10.582  -3.248  23.021  1.00 32.82  ? 128  THR C CB  1 
ATOM   9093  O OG1 . THR C 1 108 ? 10.919  -4.499  22.408  1.00 32.45  ? 128  THR C OG1 1 
ATOM   9094  C CG2 . THR C 1 108 ? 11.726  -2.266  22.821  1.00 31.89  ? 128  THR C CG2 1 
ATOM   9095  N N   . LYS C 1 109 ? 10.406  -5.881  24.866  1.00 36.74  ? 129  LYS C N   1 
ATOM   9096  C CA  . LYS C 1 109 ? 9.854   -7.222  25.028  1.00 38.78  ? 129  LYS C CA  1 
ATOM   9097  C C   . LYS C 1 109 ? 10.075  -7.687  26.457  1.00 39.98  ? 129  LYS C C   1 
ATOM   9098  O O   . LYS C 1 109 ? 10.965  -7.185  27.139  1.00 41.59  ? 129  LYS C O   1 
ATOM   9099  C CB  . LYS C 1 109 ? 10.531  -8.183  24.046  1.00 39.44  ? 129  LYS C CB  1 
ATOM   9100  C CG  . LYS C 1 109 ? 10.259  -7.814  22.595  1.00 43.95  ? 129  LYS C CG  1 
ATOM   9101  C CD  . LYS C 1 109 ? 11.222  -8.459  21.618  1.00 46.06  ? 129  LYS C CD  1 
ATOM   9102  C CE  . LYS C 1 109 ? 10.984  -7.913  20.208  1.00 48.85  ? 129  LYS C CE  1 
ATOM   9103  N NZ  . LYS C 1 109 ? 12.017  -8.347  19.216  1.00 49.01  ? 129  LYS C NZ  1 
ATOM   9104  N N   . LYS C 1 110 ? 9.258   -8.629  26.924  1.00 40.81  ? 130  LYS C N   1 
ATOM   9105  C CA  . LYS C 1 110 ? 9.410   -9.143  28.282  1.00 40.11  ? 130  LYS C CA  1 
ATOM   9106  C C   . LYS C 1 110 ? 10.814  -9.702  28.404  1.00 40.04  ? 130  LYS C C   1 
ATOM   9107  O O   . LYS C 1 110 ? 11.394  -10.176 27.426  1.00 39.93  ? 130  LYS C O   1 
ATOM   9108  C CB  . LYS C 1 110 ? 8.391   -10.244 28.563  1.00 40.86  ? 130  LYS C CB  1 
ATOM   9109  C CG  . LYS C 1 110 ? 8.592   -10.982 29.879  1.00 41.99  ? 130  LYS C CG  1 
ATOM   9110  C CD  . LYS C 1 110 ? 9.766   -11.965 29.828  1.00 45.19  ? 130  LYS C CD  1 
ATOM   9111  C CE  . LYS C 1 110 ? 9.619   -12.998 28.706  1.00 47.07  ? 130  LYS C CE  1 
ATOM   9112  N NZ  . LYS C 1 110 ? 10.792  -13.929 28.614  1.00 46.75  ? 130  LYS C NZ  1 
ATOM   9113  N N   . ASN C 1 111 ? 11.361  -9.653  29.609  1.00 39.02  ? 131  ASN C N   1 
ATOM   9114  C CA  . ASN C 1 111 ? 12.708  -10.149 29.828  1.00 37.89  ? 131  ASN C CA  1 
ATOM   9115  C C   . ASN C 1 111 ? 12.960  -10.364 31.305  1.00 36.52  ? 131  ASN C C   1 
ATOM   9116  O O   . ASN C 1 111 ? 12.733  -9.464  32.106  1.00 37.83  ? 131  ASN C O   1 
ATOM   9117  C CB  . ASN C 1 111 ? 13.728  -9.145  29.288  1.00 38.32  ? 131  ASN C CB  1 
ATOM   9118  C CG  . ASN C 1 111 ? 14.398  -9.617  28.024  1.00 37.58  ? 131  ASN C CG  1 
ATOM   9119  O OD1 . ASN C 1 111 ? 14.854  -10.752 27.945  1.00 38.75  ? 131  ASN C OD1 1 
ATOM   9120  N ND2 . ASN C 1 111 ? 14.479  -8.741  27.033  1.00 38.32  ? 131  ASN C ND2 1 
ATOM   9121  N N   . ARG C 1 112 ? 13.423  -11.553 31.670  1.00 34.19  ? 132  ARG C N   1 
ATOM   9122  C CA  . ARG C 1 112 ? 13.705  -11.835 33.066  1.00 32.81  ? 132  ARG C CA  1 
ATOM   9123  C C   . ARG C 1 112 ? 15.114  -12.369 33.252  1.00 30.35  ? 132  ARG C C   1 
ATOM   9124  O O   . ARG C 1 112 ? 15.313  -13.518 33.649  1.00 30.59  ? 132  ARG C O   1 
ATOM   9125  C CB  . ARG C 1 112 ? 12.662  -12.805 33.649  1.00 35.01  ? 132  ARG C CB  1 
ATOM   9126  C CG  . ARG C 1 112 ? 11.418  -12.098 34.222  1.00 37.44  ? 132  ARG C CG  1 
ATOM   9127  C CD  . ARG C 1 112 ? 10.741  -11.259 33.149  1.00 41.59  ? 132  ARG C CD  1 
ATOM   9128  N NE  . ARG C 1 112 ? 9.870   -10.194 33.648  1.00 44.57  ? 132  ARG C NE  1 
ATOM   9129  C CZ  . ARG C 1 112 ? 8.675   -10.387 34.200  1.00 46.60  ? 132  ARG C CZ  1 
ATOM   9130  N NH1 . ARG C 1 112 ? 8.195   -11.614 34.340  1.00 47.67  ? 132  ARG C NH1 1 
ATOM   9131  N NH2 . ARG C 1 112 ? 7.944   -9.345  34.583  1.00 47.61  ? 132  ARG C NH2 1 
ATOM   9132  N N   . LEU C 1 113 ? 16.085  -11.506 32.959  1.00 27.29  ? 133  LEU C N   1 
ATOM   9133  C CA  . LEU C 1 113 ? 17.507  -11.823 33.083  1.00 23.71  ? 133  LEU C CA  1 
ATOM   9134  C C   . LEU C 1 113 ? 17.882  -11.871 34.557  1.00 22.43  ? 133  LEU C C   1 
ATOM   9135  O O   . LEU C 1 113 ? 17.201  -11.267 35.390  1.00 22.46  ? 133  LEU C O   1 
ATOM   9136  C CB  . LEU C 1 113 ? 18.344  -10.743 32.399  1.00 22.38  ? 133  LEU C CB  1 
ATOM   9137  C CG  . LEU C 1 113 ? 18.223  -10.539 30.891  1.00 19.25  ? 133  LEU C CG  1 
ATOM   9138  C CD1 . LEU C 1 113 ? 18.858  -9.225  30.488  1.00 19.32  ? 133  LEU C CD1 1 
ATOM   9139  C CD2 . LEU C 1 113 ? 18.900  -11.678 30.189  1.00 19.81  ? 133  LEU C CD2 1 
ATOM   9140  N N   . PRO C 1 114 ? 18.973  -12.583 34.903  1.00 20.81  ? 134  PRO C N   1 
ATOM   9141  C CA  . PRO C 1 114 ? 19.382  -12.662 36.311  1.00 20.30  ? 134  PRO C CA  1 
ATOM   9142  C C   . PRO C 1 114 ? 19.844  -11.291 36.826  1.00 19.81  ? 134  PRO C C   1 
ATOM   9143  O O   . PRO C 1 114 ? 20.403  -10.491 36.077  1.00 19.90  ? 134  PRO C O   1 
ATOM   9144  C CB  . PRO C 1 114 ? 20.489  -13.718 36.288  1.00 18.60  ? 134  PRO C CB  1 
ATOM   9145  C CG  . PRO C 1 114 ? 21.086  -13.548 34.942  1.00 17.56  ? 134  PRO C CG  1 
ATOM   9146  C CD  . PRO C 1 114 ? 19.890  -13.353 34.045  1.00 18.51  ? 134  PRO C CD  1 
ATOM   9147  N N   . VAL C 1 115 ? 19.601  -11.018 38.100  1.00 19.21  ? 135  VAL C N   1 
ATOM   9148  C CA  . VAL C 1 115 ? 19.969  -9.726  38.672  1.00 19.03  ? 135  VAL C CA  1 
ATOM   9149  C C   . VAL C 1 115 ? 21.147  -9.821  39.635  1.00 18.23  ? 135  VAL C C   1 
ATOM   9150  O O   . VAL C 1 115 ? 21.163  -10.680 40.511  1.00 19.42  ? 135  VAL C O   1 
ATOM   9151  C CB  . VAL C 1 115 ? 18.767  -9.109  39.430  1.00 18.92  ? 135  VAL C CB  1 
ATOM   9152  C CG1 . VAL C 1 115 ? 19.075  -7.678  39.824  1.00 18.33  ? 135  VAL C CG1 1 
ATOM   9153  C CG2 . VAL C 1 115 ? 17.516  -9.183  38.570  1.00 17.82  ? 135  VAL C CG2 1 
ATOM   9154  N N   . MET C 1 116 ? 22.126  -8.935  39.471  1.00 17.28  ? 136  MET C N   1 
ATOM   9155  C CA  . MET C 1 116 ? 23.300  -8.905  40.339  1.00 17.07  ? 136  MET C CA  1 
ATOM   9156  C C   . MET C 1 116 ? 23.417  -7.571  41.074  1.00 16.90  ? 136  MET C C   1 
ATOM   9157  O O   . MET C 1 116 ? 23.839  -6.568  40.502  1.00 18.19  ? 136  MET C O   1 
ATOM   9158  C CB  . MET C 1 116 ? 24.568  -9.152  39.524  1.00 17.55  ? 136  MET C CB  1 
ATOM   9159  C CG  . MET C 1 116 ? 24.688  -10.561 38.978  1.00 17.67  ? 136  MET C CG  1 
ATOM   9160  S SD  . MET C 1 116 ? 26.332  -10.875 38.297  1.00 21.06  ? 136  MET C SD  1 
ATOM   9161  C CE  . MET C 1 116 ? 27.269  -11.275 39.809  1.00 15.80  ? 136  MET C CE  1 
ATOM   9162  N N   . VAL C 1 117 ? 23.043  -7.566  42.348  1.00 17.02  ? 137  VAL C N   1 
ATOM   9163  C CA  . VAL C 1 117 ? 23.091  -6.355  43.164  1.00 16.59  ? 137  VAL C CA  1 
ATOM   9164  C C   . VAL C 1 117 ? 24.446  -6.213  43.860  1.00 16.65  ? 137  VAL C C   1 
ATOM   9165  O O   . VAL C 1 117 ? 24.874  -7.118  44.580  1.00 17.97  ? 137  VAL C O   1 
ATOM   9166  C CB  . VAL C 1 117 ? 21.979  -6.388  44.215  1.00 16.60  ? 137  VAL C CB  1 
ATOM   9167  C CG1 . VAL C 1 117 ? 21.945  -5.074  44.972  1.00 15.57  ? 137  VAL C CG1 1 
ATOM   9168  C CG2 . VAL C 1 117 ? 20.639  -6.680  43.530  1.00 15.04  ? 137  VAL C CG2 1 
ATOM   9169  N N   . TRP C 1 118 ? 25.109  -5.074  43.653  1.00 15.32  ? 138  TRP C N   1 
ATOM   9170  C CA  . TRP C 1 118 ? 26.438  -4.824  44.225  1.00 13.65  ? 138  TRP C CA  1 
ATOM   9171  C C   . TRP C 1 118 ? 26.506  -3.877  45.416  1.00 13.74  ? 138  TRP C C   1 
ATOM   9172  O O   . TRP C 1 118 ? 26.025  -2.746  45.356  1.00 15.76  ? 138  TRP C O   1 
ATOM   9173  C CB  . TRP C 1 118 ? 27.373  -4.304  43.134  1.00 11.28  ? 138  TRP C CB  1 
ATOM   9174  C CG  . TRP C 1 118 ? 28.690  -3.788  43.632  1.00 10.26  ? 138  TRP C CG  1 
ATOM   9175  C CD1 . TRP C 1 118 ? 29.028  -2.486  43.866  1.00 10.00  ? 138  TRP C CD1 1 
ATOM   9176  C CD2 . TRP C 1 118 ? 29.856  -4.561  43.924  1.00 11.99  ? 138  TRP C CD2 1 
ATOM   9177  N NE1 . TRP C 1 118 ? 30.335  -2.396  44.280  1.00 8.92   ? 138  TRP C NE1 1 
ATOM   9178  C CE2 . TRP C 1 118 ? 30.869  -3.656  44.325  1.00 11.68  ? 138  TRP C CE2 1 
ATOM   9179  C CE3 . TRP C 1 118 ? 30.149  -5.934  43.886  1.00 12.34  ? 138  TRP C CE3 1 
ATOM   9180  C CZ2 . TRP C 1 118 ? 32.160  -4.081  44.686  1.00 13.30  ? 138  TRP C CZ2 1 
ATOM   9181  C CZ3 . TRP C 1 118 ? 31.433  -6.358  44.245  1.00 13.54  ? 138  TRP C CZ3 1 
ATOM   9182  C CH2 . TRP C 1 118 ? 32.422  -5.431  44.640  1.00 13.49  ? 138  TRP C CH2 1 
ATOM   9183  N N   . ILE C 1 119 ? 27.125  -4.345  46.494  1.00 13.40  ? 139  ILE C N   1 
ATOM   9184  C CA  . ILE C 1 119 ? 27.284  -3.543  47.706  1.00 12.86  ? 139  ILE C CA  1 
ATOM   9185  C C   . ILE C 1 119 ? 28.748  -3.107  47.846  1.00 11.70  ? 139  ILE C C   1 
ATOM   9186  O O   . ILE C 1 119 ? 29.620  -3.916  48.175  1.00 12.41  ? 139  ILE C O   1 
ATOM   9187  C CB  . ILE C 1 119 ? 26.879  -4.342  48.969  1.00 11.37  ? 139  ILE C CB  1 
ATOM   9188  C CG1 . ILE C 1 119 ? 25.415  -4.767  48.872  1.00 9.43   ? 139  ILE C CG1 1 
ATOM   9189  C CG2 . ILE C 1 119 ? 27.093  -3.495  50.201  1.00 9.67   ? 139  ILE C CG2 1 
ATOM   9190  C CD1 . ILE C 1 119 ? 24.944  -5.595  50.051  1.00 9.93   ? 139  ILE C CD1 1 
ATOM   9191  N N   . HIS C 1 120 ? 29.009  -1.828  47.601  1.00 9.64   ? 140  HIS C N   1 
ATOM   9192  C CA  . HIS C 1 120 ? 30.363  -1.302  47.675  1.00 8.24   ? 140  HIS C CA  1 
ATOM   9193  C C   . HIS C 1 120 ? 30.985  -1.428  49.060  1.00 6.40   ? 140  HIS C C   1 
ATOM   9194  O O   . HIS C 1 120 ? 30.281  -1.551  50.053  1.00 5.96   ? 140  HIS C O   1 
ATOM   9195  C CB  . HIS C 1 120 ? 30.385  0.172   47.247  1.00 9.65   ? 140  HIS C CB  1 
ATOM   9196  C CG  . HIS C 1 120 ? 29.881  1.116   48.293  1.00 10.12  ? 140  HIS C CG  1 
ATOM   9197  N ND1 . HIS C 1 120 ? 28.650  1.732   48.212  1.00 10.57  ? 140  HIS C ND1 1 
ATOM   9198  C CD2 . HIS C 1 120 ? 30.435  1.536   49.456  1.00 9.22   ? 140  HIS C CD2 1 
ATOM   9199  C CE1 . HIS C 1 120 ? 28.468  2.489   49.278  1.00 10.85  ? 140  HIS C CE1 1 
ATOM   9200  N NE2 . HIS C 1 120 ? 29.538  2.386   50.049  1.00 10.19  ? 140  HIS C NE2 1 
ATOM   9201  N N   . GLY C 1 121 ? 32.315  -1.394  49.104  1.00 5.52   ? 141  GLY C N   1 
ATOM   9202  C CA  . GLY C 1 121 ? 33.031  -1.476  50.360  1.00 5.78   ? 141  GLY C CA  1 
ATOM   9203  C C   . GLY C 1 121 ? 33.513  -0.091  50.773  1.00 6.44   ? 141  GLY C C   1 
ATOM   9204  O O   . GLY C 1 121 ? 33.185  0.908   50.133  1.00 7.93   ? 141  GLY C O   1 
ATOM   9205  N N   . GLY C 1 122 ? 34.308  -0.028  51.835  1.00 6.06   ? 142  GLY C N   1 
ATOM   9206  C CA  . GLY C 1 122 ? 34.805  1.245   52.325  1.00 3.65   ? 142  GLY C CA  1 
ATOM   9207  C C   . GLY C 1 122 ? 34.677  1.310   53.841  1.00 2.26   ? 142  GLY C C   1 
ATOM   9208  O O   . GLY C 1 122 ? 34.323  2.340   54.397  1.00 1.44   ? 142  GLY C O   1 
ATOM   9209  N N   . GLY C 1 123 ? 34.961  0.191   54.499  1.00 2.58   ? 143  GLY C N   1 
ATOM   9210  C CA  . GLY C 1 123 ? 34.892  0.097   55.952  1.00 4.36   ? 143  GLY C CA  1 
ATOM   9211  C C   . GLY C 1 123 ? 33.628  0.620   56.615  1.00 4.63   ? 143  GLY C C   1 
ATOM   9212  O O   . GLY C 1 123 ? 33.619  0.892   57.820  1.00 2.35   ? 143  GLY C O   1 
ATOM   9213  N N   . LEU C 1 124 ? 32.564  0.750   55.827  1.00 5.47   ? 144  LEU C N   1 
ATOM   9214  C CA  . LEU C 1 124 ? 31.291  1.269   56.310  1.00 6.01   ? 144  LEU C CA  1 
ATOM   9215  C C   . LEU C 1 124 ? 31.395  2.751   56.637  1.00 7.68   ? 144  LEU C C   1 
ATOM   9216  O O   . LEU C 1 124 ? 30.418  3.355   57.079  1.00 9.88   ? 144  LEU C O   1 
ATOM   9217  C CB  . LEU C 1 124 ? 30.833  0.517   57.551  1.00 3.81   ? 144  LEU C CB  1 
ATOM   9218  C CG  . LEU C 1 124 ? 30.475  -0.939  57.333  1.00 1.99   ? 144  LEU C CG  1 
ATOM   9219  C CD1 . LEU C 1 124 ? 30.082  -1.564  58.658  1.00 1.44   ? 144  LEU C CD1 1 
ATOM   9220  C CD2 . LEU C 1 124 ? 29.350  -1.019  56.319  1.00 1.44   ? 144  LEU C CD2 1 
ATOM   9221  N N   . MET C 1 125 ? 32.579  3.325   56.424  1.00 9.32   ? 145  MET C N   1 
ATOM   9222  C CA  . MET C 1 125 ? 32.827  4.739   56.690  1.00 9.60   ? 145  MET C CA  1 
ATOM   9223  C C   . MET C 1 125 ? 32.765  5.573   55.400  1.00 8.47   ? 145  MET C C   1 
ATOM   9224  O O   . MET C 1 125 ? 32.262  6.697   55.406  1.00 7.66   ? 145  MET C O   1 
ATOM   9225  C CB  . MET C 1 125 ? 34.208  4.936   57.341  1.00 14.20  ? 145  MET C CB  1 
ATOM   9226  C CG  . MET C 1 125 ? 34.513  4.117   58.602  1.00 21.07  ? 145  MET C CG  1 
ATOM   9227  S SD  . MET C 1 125 ? 33.390  4.382   60.005  1.00 31.59  ? 145  MET C SD  1 
ATOM   9228  C CE  . MET C 1 125 ? 33.542  6.164   60.258  1.00 29.91  ? 145  MET C CE  1 
ATOM   9229  N N   . VAL C 1 126 ? 33.285  5.021   54.302  1.00 8.02   ? 146  VAL C N   1 
ATOM   9230  C CA  . VAL C 1 126 ? 33.313  5.712   53.005  1.00 5.70   ? 146  VAL C CA  1 
ATOM   9231  C C   . VAL C 1 126 ? 32.851  4.829   51.849  1.00 4.89   ? 146  VAL C C   1 
ATOM   9232  O O   . VAL C 1 126 ? 32.512  3.663   52.041  1.00 6.42   ? 146  VAL C O   1 
ATOM   9233  C CB  . VAL C 1 126 ? 34.739  6.212   52.654  1.00 4.32   ? 146  VAL C CB  1 
ATOM   9234  C CG1 . VAL C 1 126 ? 35.184  7.268   53.639  1.00 3.93   ? 146  VAL C CG1 1 
ATOM   9235  C CG2 . VAL C 1 126 ? 35.706  5.053   52.656  1.00 1.85   ? 146  VAL C CG2 1 
ATOM   9236  N N   . GLY C 1 127 ? 32.851  5.395   50.647  1.00 4.36   ? 147  GLY C N   1 
ATOM   9237  C CA  . GLY C 1 127 ? 32.432  4.651   49.473  1.00 3.91   ? 147  GLY C CA  1 
ATOM   9238  C C   . GLY C 1 127 ? 31.144  5.164   48.856  1.00 4.14   ? 147  GLY C C   1 
ATOM   9239  O O   . GLY C 1 127 ? 30.365  5.861   49.497  1.00 5.00   ? 147  GLY C O   1 
ATOM   9240  N N   . ALA C 1 128 ? 30.922  4.817   47.596  1.00 5.27   ? 148  ALA C N   1 
ATOM   9241  C CA  . ALA C 1 128 ? 29.727  5.226   46.872  1.00 6.44   ? 148  ALA C CA  1 
ATOM   9242  C C   . ALA C 1 128 ? 29.461  4.205   45.783  1.00 7.93   ? 148  ALA C C   1 
ATOM   9243  O O   . ALA C 1 128 ? 30.372  3.499   45.348  1.00 8.96   ? 148  ALA C O   1 
ATOM   9244  C CB  . ALA C 1 128 ? 29.929  6.588   46.253  1.00 7.67   ? 148  ALA C CB  1 
ATOM   9245  N N   . ALA C 1 129 ? 28.216  4.140   45.328  1.00 8.15   ? 149  ALA C N   1 
ATOM   9246  C CA  . ALA C 1 129 ? 27.838  3.182   44.299  1.00 7.84   ? 149  ALA C CA  1 
ATOM   9247  C C   . ALA C 1 129 ? 28.301  3.536   42.891  1.00 7.82   ? 149  ALA C C   1 
ATOM   9248  O O   . ALA C 1 129 ? 28.654  2.651   42.119  1.00 7.23   ? 149  ALA C O   1 
ATOM   9249  C CB  . ALA C 1 129 ? 26.337  2.993   44.311  1.00 7.81   ? 149  ALA C CB  1 
ATOM   9250  N N   . SER C 1 130 ? 28.303  4.824   42.565  1.00 8.85   ? 150  SER C N   1 
ATOM   9251  C CA  . SER C 1 130 ? 28.694  5.288   41.238  1.00 9.47   ? 150  SER C CA  1 
ATOM   9252  C C   . SER C 1 130 ? 30.119  4.947   40.824  1.00 10.09  ? 150  SER C C   1 
ATOM   9253  O O   . SER C 1 130 ? 30.454  4.991   39.639  1.00 10.42  ? 150  SER C O   1 
ATOM   9254  C CB  . SER C 1 130 ? 28.489  6.784   41.156  1.00 9.44   ? 150  SER C CB  1 
ATOM   9255  O OG  . SER C 1 130 ? 27.192  7.098   41.611  1.00 14.28  ? 150  SER C OG  1 
ATOM   9256  N N   . THR C 1 131 ? 30.960  4.611   41.793  1.00 10.78  ? 151  THR C N   1 
ATOM   9257  C CA  . THR C 1 131 ? 32.337  4.253   41.498  1.00 11.79  ? 151  THR C CA  1 
ATOM   9258  C C   . THR C 1 131 ? 32.358  3.087   40.515  1.00 13.93  ? 151  THR C C   1 
ATOM   9259  O O   . THR C 1 131 ? 33.147  3.072   39.567  1.00 16.28  ? 151  THR C O   1 
ATOM   9260  C CB  . THR C 1 131 ? 33.074  3.815   42.764  1.00 11.86  ? 151  THR C CB  1 
ATOM   9261  O OG1 . THR C 1 131 ? 33.117  4.900   43.695  1.00 15.23  ? 151  THR C OG1 1 
ATOM   9262  C CG2 . THR C 1 131 ? 34.477  3.392   42.440  1.00 10.69  ? 151  THR C CG2 1 
ATOM   9263  N N   . TYR C 1 132 ? 31.470  2.122   40.744  1.00 14.21  ? 152  TYR C N   1 
ATOM   9264  C CA  . TYR C 1 132 ? 31.373  0.918   39.924  1.00 14.30  ? 152  TYR C CA  1 
ATOM   9265  C C   . TYR C 1 132 ? 30.421  1.035   38.739  1.00 15.69  ? 152  TYR C C   1 
ATOM   9266  O O   . TYR C 1 132 ? 29.208  1.148   38.918  1.00 16.43  ? 152  TYR C O   1 
ATOM   9267  C CB  . TYR C 1 132 ? 30.958  -0.255  40.815  1.00 12.82  ? 152  TYR C CB  1 
ATOM   9268  C CG  . TYR C 1 132 ? 31.746  -0.276  42.106  1.00 13.91  ? 152  TYR C CG  1 
ATOM   9269  C CD1 . TYR C 1 132 ? 31.482  0.641   43.119  1.00 12.80  ? 152  TYR C CD1 1 
ATOM   9270  C CD2 . TYR C 1 132 ? 32.820  -1.145  42.277  1.00 14.59  ? 152  TYR C CD2 1 
ATOM   9271  C CE1 . TYR C 1 132 ? 32.262  0.696   44.255  1.00 11.68  ? 152  TYR C CE1 1 
ATOM   9272  C CE2 . TYR C 1 132 ? 33.613  -1.090  43.415  1.00 13.01  ? 152  TYR C CE2 1 
ATOM   9273  C CZ  . TYR C 1 132 ? 33.324  -0.169  44.394  1.00 12.46  ? 152  TYR C CZ  1 
ATOM   9274  O OH  . TYR C 1 132 ? 34.099  -0.117  45.521  1.00 16.79  ? 152  TYR C OH  1 
ATOM   9275  N N   . ASP C 1 133 ? 30.982  1.014   37.529  1.00 16.62  ? 153  ASP C N   1 
ATOM   9276  C CA  . ASP C 1 133 ? 30.194  1.099   36.304  1.00 16.19  ? 153  ASP C CA  1 
ATOM   9277  C C   . ASP C 1 133 ? 29.818  -0.319  35.885  1.00 14.70  ? 153  ASP C C   1 
ATOM   9278  O O   . ASP C 1 133 ? 30.688  -1.180  35.747  1.00 13.77  ? 153  ASP C O   1 
ATOM   9279  C CB  . ASP C 1 133 ? 31.002  1.772   35.192  1.00 19.36  ? 153  ASP C CB  1 
ATOM   9280  C CG  . ASP C 1 133 ? 30.209  1.907   33.892  1.00 23.36  ? 153  ASP C CG  1 
ATOM   9281  O OD1 . ASP C 1 133 ? 30.747  2.449   32.900  1.00 25.00  ? 153  ASP C OD1 1 
ATOM   9282  O OD2 . ASP C 1 133 ? 29.040  1.472   33.863  1.00 25.18  ? 153  ASP C OD2 1 
ATOM   9283  N N   . GLY C 1 134 ? 28.526  -0.552  35.671  1.00 13.18  ? 154  GLY C N   1 
ATOM   9284  C CA  . GLY C 1 134 ? 28.067  -1.878  35.301  1.00 13.34  ? 154  GLY C CA  1 
ATOM   9285  C C   . GLY C 1 134 ? 27.931  -2.200  33.823  1.00 13.06  ? 154  GLY C C   1 
ATOM   9286  O O   . GLY C 1 134 ? 27.459  -3.281  33.470  1.00 13.62  ? 154  GLY C O   1 
ATOM   9287  N N   . LEU C 1 135 ? 28.364  -1.291  32.956  1.00 12.21  ? 155  LEU C N   1 
ATOM   9288  C CA  . LEU C 1 135 ? 28.254  -1.489  31.513  1.00 10.97  ? 155  LEU C CA  1 
ATOM   9289  C C   . LEU C 1 135 ? 28.901  -2.758  30.947  1.00 10.97  ? 155  LEU C C   1 
ATOM   9290  O O   . LEU C 1 135 ? 28.250  -3.528  30.235  1.00 11.27  ? 155  LEU C O   1 
ATOM   9291  C CB  . LEU C 1 135 ? 28.803  -0.259  30.787  1.00 9.80   ? 155  LEU C CB  1 
ATOM   9292  C CG  . LEU C 1 135 ? 28.875  -0.312  29.261  1.00 9.64   ? 155  LEU C CG  1 
ATOM   9293  C CD1 . LEU C 1 135 ? 27.546  -0.766  28.676  1.00 10.80  ? 155  LEU C CD1 1 
ATOM   9294  C CD2 . LEU C 1 135 ? 29.260  1.054   28.743  1.00 6.72   ? 155  LEU C CD2 1 
ATOM   9295  N N   . ALA C 1 136 ? 30.172  -2.983  31.252  1.00 10.12  ? 156  ALA C N   1 
ATOM   9296  C CA  . ALA C 1 136 ? 30.853  -4.158  30.733  1.00 10.57  ? 156  ALA C CA  1 
ATOM   9297  C C   . ALA C 1 136 ? 30.203  -5.451  31.199  1.00 12.19  ? 156  ALA C C   1 
ATOM   9298  O O   . ALA C 1 136 ? 29.808  -6.277  30.382  1.00 12.93  ? 156  ALA C O   1 
ATOM   9299  C CB  . ALA C 1 136 ? 32.318  -4.141  31.137  1.00 10.20  ? 156  ALA C CB  1 
ATOM   9300  N N   . LEU C 1 137 ? 30.097  -5.628  32.513  1.00 13.64  ? 157  LEU C N   1 
ATOM   9301  C CA  . LEU C 1 137 ? 29.501  -6.839  33.075  1.00 13.29  ? 157  LEU C CA  1 
ATOM   9302  C C   . LEU C 1 137 ? 28.098  -7.080  32.544  1.00 13.03  ? 157  LEU C C   1 
ATOM   9303  O O   . LEU C 1 137 ? 27.726  -8.214  32.254  1.00 12.18  ? 157  LEU C O   1 
ATOM   9304  C CB  . LEU C 1 137 ? 29.461  -6.754  34.605  1.00 14.86  ? 157  LEU C CB  1 
ATOM   9305  C CG  . LEU C 1 137 ? 28.712  -7.834  35.402  1.00 14.75  ? 157  LEU C CG  1 
ATOM   9306  C CD1 . LEU C 1 137 ? 29.258  -9.204  35.078  1.00 15.71  ? 157  LEU C CD1 1 
ATOM   9307  C CD2 . LEU C 1 137 ? 28.849  -7.556  36.893  1.00 15.01  ? 157  LEU C CD2 1 
ATOM   9308  N N   . ALA C 1 138 ? 27.320  -6.011  32.415  1.00 13.21  ? 158  ALA C N   1 
ATOM   9309  C CA  . ALA C 1 138 ? 25.951  -6.126  31.919  1.00 13.69  ? 158  ALA C CA  1 
ATOM   9310  C C   . ALA C 1 138 ? 25.912  -6.643  30.486  1.00 14.44  ? 158  ALA C C   1 
ATOM   9311  O O   . ALA C 1 138 ? 25.151  -7.565  30.166  1.00 13.28  ? 158  ALA C O   1 
ATOM   9312  C CB  . ALA C 1 138 ? 25.258  -4.784  31.997  1.00 13.52  ? 158  ALA C CB  1 
ATOM   9313  N N   . ALA C 1 139 ? 26.730  -6.042  29.625  1.00 14.35  ? 159  ALA C N   1 
ATOM   9314  C CA  . ALA C 1 139 ? 26.782  -6.446  28.230  1.00 15.56  ? 159  ALA C CA  1 
ATOM   9315  C C   . ALA C 1 139 ? 27.467  -7.806  28.053  1.00 17.12  ? 159  ALA C C   1 
ATOM   9316  O O   . ALA C 1 139 ? 26.924  -8.705  27.412  1.00 17.45  ? 159  ALA C O   1 
ATOM   9317  C CB  . ALA C 1 139 ? 27.499  -5.387  27.415  1.00 13.41  ? 159  ALA C CB  1 
ATOM   9318  N N   . HIS C 1 140 ? 28.650  -7.952  28.638  1.00 18.44  ? 160  HIS C N   1 
ATOM   9319  C CA  . HIS C 1 140 ? 29.428  -9.175  28.530  1.00 20.12  ? 160  HIS C CA  1 
ATOM   9320  C C   . HIS C 1 140 ? 28.816  -10.473 29.076  1.00 20.69  ? 160  HIS C C   1 
ATOM   9321  O O   . HIS C 1 140 ? 29.172  -11.547 28.608  1.00 22.55  ? 160  HIS C O   1 
ATOM   9322  C CB  . HIS C 1 140 ? 30.804  -8.957  29.168  1.00 23.54  ? 160  HIS C CB  1 
ATOM   9323  C CG  . HIS C 1 140 ? 31.775  -8.221  28.293  1.00 28.45  ? 160  HIS C CG  1 
ATOM   9324  N ND1 . HIS C 1 140 ? 32.370  -8.797  27.189  1.00 30.47  ? 160  HIS C ND1 1 
ATOM   9325  C CD2 . HIS C 1 140 ? 32.280  -6.966  28.376  1.00 30.28  ? 160  HIS C CD2 1 
ATOM   9326  C CE1 . HIS C 1 140 ? 33.199  -7.929  26.633  1.00 30.96  ? 160  HIS C CE1 1 
ATOM   9327  N NE2 . HIS C 1 140 ? 33.163  -6.810  27.334  1.00 29.72  ? 160  HIS C NE2 1 
ATOM   9328  N N   . GLU C 1 141 ? 27.918  -10.411 30.054  1.00 20.62  ? 161  GLU C N   1 
ATOM   9329  C CA  . GLU C 1 141 ? 27.338  -11.654 30.589  1.00 20.90  ? 161  GLU C CA  1 
ATOM   9330  C C   . GLU C 1 141 ? 25.808  -11.691 30.606  1.00 20.59  ? 161  GLU C C   1 
ATOM   9331  O O   . GLU C 1 141 ? 25.201  -12.605 31.178  1.00 19.74  ? 161  GLU C O   1 
ATOM   9332  C CB  . GLU C 1 141 ? 27.860  -11.940 32.002  1.00 21.70  ? 161  GLU C CB  1 
ATOM   9333  C CG  . GLU C 1 141 ? 29.322  -12.347 32.082  1.00 22.94  ? 161  GLU C CG  1 
ATOM   9334  C CD  . GLU C 1 141 ? 29.645  -13.597 31.277  1.00 23.63  ? 161  GLU C CD  1 
ATOM   9335  O OE1 . GLU C 1 141 ? 28.735  -14.426 31.059  1.00 22.98  ? 161  GLU C OE1 1 
ATOM   9336  O OE2 . GLU C 1 141 ? 30.822  -13.752 30.879  1.00 23.80  ? 161  GLU C OE2 1 
ATOM   9337  N N   . ASN C 1 142 ? 25.199  -10.683 29.990  1.00 20.41  ? 162  ASN C N   1 
ATOM   9338  C CA  . ASN C 1 142 ? 23.750  -10.572 29.877  1.00 19.41  ? 162  ASN C CA  1 
ATOM   9339  C C   . ASN C 1 142 ? 22.975  -10.706 31.180  1.00 17.66  ? 162  ASN C C   1 
ATOM   9340  O O   . ASN C 1 142 ? 22.089  -11.546 31.313  1.00 17.14  ? 162  ASN C O   1 
ATOM   9341  C CB  . ASN C 1 142 ? 23.245  -11.591 28.862  1.00 21.34  ? 162  ASN C CB  1 
ATOM   9342  C CG  . ASN C 1 142 ? 22.198  -11.013 27.956  1.00 23.65  ? 162  ASN C CG  1 
ATOM   9343  O OD1 . ASN C 1 142 ? 21.011  -11.021 28.275  1.00 26.29  ? 162  ASN C OD1 1 
ATOM   9344  N ND2 . ASN C 1 142 ? 22.634  -10.475 26.826  1.00 23.82  ? 162  ASN C ND2 1 
ATOM   9345  N N   . VAL C 1 143 ? 23.320  -9.845  32.129  1.00 16.79  ? 163  VAL C N   1 
ATOM   9346  C CA  . VAL C 1 143 ? 22.695  -9.805  33.437  1.00 14.45  ? 163  VAL C CA  1 
ATOM   9347  C C   . VAL C 1 143 ? 22.418  -8.347  33.747  1.00 14.57  ? 163  VAL C C   1 
ATOM   9348  O O   . VAL C 1 143 ? 22.972  -7.453  33.113  1.00 14.84  ? 163  VAL C O   1 
ATOM   9349  C CB  . VAL C 1 143 ? 23.637  -10.346 34.521  1.00 13.79  ? 163  VAL C CB  1 
ATOM   9350  C CG1 . VAL C 1 143 ? 23.901  -11.830 34.303  1.00 12.07  ? 163  VAL C CG1 1 
ATOM   9351  C CG2 . VAL C 1 143 ? 24.940  -9.557  34.497  1.00 12.53  ? 163  VAL C CG2 1 
ATOM   9352  N N   . VAL C 1 144 ? 21.557  -8.105  34.720  1.00 15.57  ? 164  VAL C N   1 
ATOM   9353  C CA  . VAL C 1 144 ? 21.239  -6.743  35.113  1.00 16.93  ? 164  VAL C CA  1 
ATOM   9354  C C   . VAL C 1 144 ? 22.111  -6.396  36.315  1.00 17.06  ? 164  VAL C C   1 
ATOM   9355  O O   . VAL C 1 144 ? 22.083  -7.096  37.326  1.00 17.85  ? 164  VAL C O   1 
ATOM   9356  C CB  . VAL C 1 144 ? 19.756  -6.614  35.505  1.00 16.76  ? 164  VAL C CB  1 
ATOM   9357  C CG1 . VAL C 1 144 ? 19.452  -5.185  35.917  1.00 15.84  ? 164  VAL C CG1 1 
ATOM   9358  C CG2 . VAL C 1 144 ? 18.874  -7.041  34.333  1.00 16.90  ? 164  VAL C CG2 1 
ATOM   9359  N N   . VAL C 1 145 ? 22.897  -5.330  36.205  1.00 16.43  ? 165  VAL C N   1 
ATOM   9360  C CA  . VAL C 1 145 ? 23.763  -4.936  37.312  1.00 15.35  ? 165  VAL C CA  1 
ATOM   9361  C C   . VAL C 1 145 ? 23.147  -3.811  38.135  1.00 14.22  ? 165  VAL C C   1 
ATOM   9362  O O   . VAL C 1 145 ? 22.763  -2.776  37.591  1.00 14.02  ? 165  VAL C O   1 
ATOM   9363  C CB  . VAL C 1 145 ? 25.155  -4.485  36.812  1.00 14.10  ? 165  VAL C CB  1 
ATOM   9364  C CG1 . VAL C 1 145 ? 25.994  -4.022  37.976  1.00 13.97  ? 165  VAL C CG1 1 
ATOM   9365  C CG2 . VAL C 1 145 ? 25.850  -5.630  36.110  1.00 13.93  ? 165  VAL C CG2 1 
ATOM   9366  N N   . VAL C 1 146 ? 23.055  -4.024  39.447  1.00 13.30  ? 166  VAL C N   1 
ATOM   9367  C CA  . VAL C 1 146 ? 22.497  -3.022  40.353  1.00 11.97  ? 166  VAL C CA  1 
ATOM   9368  C C   . VAL C 1 146 ? 23.488  -2.616  41.442  1.00 12.19  ? 166  VAL C C   1 
ATOM   9369  O O   . VAL C 1 146 ? 23.877  -3.440  42.279  1.00 14.12  ? 166  VAL C O   1 
ATOM   9370  C CB  . VAL C 1 146 ? 21.225  -3.528  41.050  1.00 9.45   ? 166  VAL C CB  1 
ATOM   9371  C CG1 . VAL C 1 146 ? 20.688  -2.454  41.974  1.00 8.37   ? 166  VAL C CG1 1 
ATOM   9372  C CG2 . VAL C 1 146 ? 20.185  -3.902  40.022  1.00 9.91   ? 166  VAL C CG2 1 
ATOM   9373  N N   . THR C 1 147 ? 23.892  -1.347  41.424  1.00 10.32  ? 167  THR C N   1 
ATOM   9374  C CA  . THR C 1 147 ? 24.816  -0.806  42.419  1.00 7.46   ? 167  THR C CA  1 
ATOM   9375  C C   . THR C 1 147 ? 23.999  0.068   43.363  1.00 7.70   ? 167  THR C C   1 
ATOM   9376  O O   . THR C 1 147 ? 23.339  1.025   42.927  1.00 8.22   ? 167  THR C O   1 
ATOM   9377  C CB  . THR C 1 147 ? 25.904  0.053   41.763  1.00 5.63   ? 167  THR C CB  1 
ATOM   9378  O OG1 . THR C 1 147 ? 25.291  1.103   41.008  1.00 4.47   ? 167  THR C OG1 1 
ATOM   9379  C CG2 . THR C 1 147 ? 26.765  -0.795  40.841  1.00 4.73   ? 167  THR C CG2 1 
ATOM   9380  N N   . ILE C 1 148 ? 24.025  -0.266  44.651  1.00 7.02   ? 168  ILE C N   1 
ATOM   9381  C CA  . ILE C 1 148 ? 23.256  0.486   45.643  1.00 6.27   ? 168  ILE C CA  1 
ATOM   9382  C C   . ILE C 1 148 ? 24.115  1.193   46.678  1.00 6.66   ? 168  ILE C C   1 
ATOM   9383  O O   . ILE C 1 148 ? 25.281  0.860   46.878  1.00 9.01   ? 168  ILE C O   1 
ATOM   9384  C CB  . ILE C 1 148 ? 22.293  -0.422  46.418  1.00 5.67   ? 168  ILE C CB  1 
ATOM   9385  C CG1 . ILE C 1 148 ? 23.090  -1.367  47.326  1.00 4.43   ? 168  ILE C CG1 1 
ATOM   9386  C CG2 . ILE C 1 148 ? 21.415  -1.197  45.447  1.00 4.92   ? 168  ILE C CG2 1 
ATOM   9387  C CD1 . ILE C 1 148 ? 22.242  -2.089  48.349  1.00 4.16   ? 168  ILE C CD1 1 
ATOM   9388  N N   . GLN C 1 149 ? 23.522  2.171   47.345  1.00 6.45   ? 169  GLN C N   1 
ATOM   9389  C CA  . GLN C 1 149 ? 24.221  2.914   48.380  1.00 5.73   ? 169  GLN C CA  1 
ATOM   9390  C C   . GLN C 1 149 ? 23.511  2.721   49.721  1.00 4.54   ? 169  GLN C C   1 
ATOM   9391  O O   . GLN C 1 149 ? 22.391  2.219   49.784  1.00 4.61   ? 169  GLN C O   1 
ATOM   9392  C CB  . GLN C 1 149 ? 24.298  4.398   48.003  1.00 4.59   ? 169  GLN C CB  1 
ATOM   9393  C CG  . GLN C 1 149 ? 25.303  4.678   46.890  1.00 4.45   ? 169  GLN C CG  1 
ATOM   9394  C CD  . GLN C 1 149 ? 25.482  6.161   46.567  1.00 4.78   ? 169  GLN C CD  1 
ATOM   9395  O OE1 . GLN C 1 149 ? 26.377  6.538   45.803  1.00 3.41   ? 169  GLN C OE1 1 
ATOM   9396  N NE2 . GLN C 1 149 ? 24.630  7.004   47.143  1.00 5.05   ? 169  GLN C NE2 1 
ATOM   9397  N N   . TYR C 1 150 ? 24.170  3.110   50.797  1.00 3.56   ? 170  TYR C N   1 
ATOM   9398  C CA  . TYR C 1 150 ? 23.587  2.963   52.115  1.00 4.72   ? 170  TYR C CA  1 
ATOM   9399  C C   . TYR C 1 150 ? 24.331  3.895   53.052  1.00 5.23   ? 170  TYR C C   1 
ATOM   9400  O O   . TYR C 1 150 ? 25.512  4.164   52.853  1.00 6.38   ? 170  TYR C O   1 
ATOM   9401  C CB  . TYR C 1 150 ? 23.733  1.520   52.587  1.00 4.57   ? 170  TYR C CB  1 
ATOM   9402  C CG  . TYR C 1 150 ? 25.150  1.004   52.493  1.00 2.83   ? 170  TYR C CG  1 
ATOM   9403  C CD1 . TYR C 1 150 ? 25.705  0.656   51.271  1.00 3.04   ? 170  TYR C CD1 1 
ATOM   9404  C CD2 . TYR C 1 150 ? 25.952  0.919   53.623  1.00 3.47   ? 170  TYR C CD2 1 
ATOM   9405  C CE1 . TYR C 1 150 ? 27.026  0.238   51.180  1.00 2.65   ? 170  TYR C CE1 1 
ATOM   9406  C CE2 . TYR C 1 150 ? 27.270  0.508   53.539  1.00 1.98   ? 170  TYR C CE2 1 
ATOM   9407  C CZ  . TYR C 1 150 ? 27.798  0.169   52.319  1.00 1.44   ? 170  TYR C CZ  1 
ATOM   9408  O OH  . TYR C 1 150 ? 29.103  -0.241  52.239  1.00 4.25   ? 170  TYR C OH  1 
ATOM   9409  N N   . ARG C 1 151 ? 23.635  4.386   54.069  1.00 6.32   ? 171  ARG C N   1 
ATOM   9410  C CA  . ARG C 1 151 ? 24.218  5.310   55.037  1.00 6.35   ? 171  ARG C CA  1 
ATOM   9411  C C   . ARG C 1 151 ? 25.537  4.827   55.630  1.00 7.13   ? 171  ARG C C   1 
ATOM   9412  O O   . ARG C 1 151 ? 25.725  3.641   55.890  1.00 6.41   ? 171  ARG C O   1 
ATOM   9413  C CB  . ARG C 1 151 ? 23.199  5.602   56.140  1.00 3.22   ? 171  ARG C CB  1 
ATOM   9414  C CG  . ARG C 1 151 ? 22.077  6.468   55.640  1.00 2.19   ? 171  ARG C CG  1 
ATOM   9415  C CD  . ARG C 1 151 ? 20.998  6.641   56.657  1.00 2.68   ? 171  ARG C CD  1 
ATOM   9416  N NE  . ARG C 1 151 ? 19.954  5.638   56.514  1.00 4.64   ? 171  ARG C NE  1 
ATOM   9417  C CZ  . ARG C 1 151 ? 18.923  5.524   57.347  1.00 5.83   ? 171  ARG C CZ  1 
ATOM   9418  N NH1 . ARG C 1 151 ? 18.814  6.353   58.375  1.00 4.02   ? 171  ARG C NH1 1 
ATOM   9419  N NH2 . ARG C 1 151 ? 18.001  4.585   57.151  1.00 6.00   ? 171  ARG C NH2 1 
ATOM   9420  N N   . LEU C 1 152 ? 26.452  5.763   55.840  1.00 8.66   ? 172  LEU C N   1 
ATOM   9421  C CA  . LEU C 1 152 ? 27.757  5.426   56.369  1.00 10.42  ? 172  LEU C CA  1 
ATOM   9422  C C   . LEU C 1 152 ? 28.043  6.098   57.699  1.00 12.70  ? 172  LEU C C   1 
ATOM   9423  O O   . LEU C 1 152 ? 27.340  7.028   58.118  1.00 14.46  ? 172  LEU C O   1 
ATOM   9424  C CB  . LEU C 1 152 ? 28.828  5.825   55.358  1.00 9.15   ? 172  LEU C CB  1 
ATOM   9425  C CG  . LEU C 1 152 ? 28.611  5.208   53.979  1.00 9.00   ? 172  LEU C CG  1 
ATOM   9426  C CD1 . LEU C 1 152 ? 29.444  5.939   52.947  1.00 9.63   ? 172  LEU C CD1 1 
ATOM   9427  C CD2 . LEU C 1 152 ? 28.953  3.730   54.027  1.00 9.02   ? 172  LEU C CD2 1 
ATOM   9428  N N   . GLY C 1 153 ? 29.086  5.609   58.361  1.00 13.04  ? 173  GLY C N   1 
ATOM   9429  C CA  . GLY C 1 153 ? 29.495  6.168   59.633  1.00 14.12  ? 173  GLY C CA  1 
ATOM   9430  C C   . GLY C 1 153 ? 28.402  6.467   60.639  1.00 13.73  ? 173  GLY C C   1 
ATOM   9431  O O   . GLY C 1 153 ? 27.517  5.648   60.895  1.00 15.18  ? 173  GLY C O   1 
ATOM   9432  N N   . ILE C 1 154 ? 28.465  7.655   61.218  1.00 12.77  ? 174  ILE C N   1 
ATOM   9433  C CA  . ILE C 1 154 ? 27.497  8.036   62.225  1.00 12.90  ? 174  ILE C CA  1 
ATOM   9434  C C   . ILE C 1 154 ? 26.063  7.893   61.765  1.00 11.43  ? 174  ILE C C   1 
ATOM   9435  O O   . ILE C 1 154 ? 25.240  7.313   62.469  1.00 10.55  ? 174  ILE C O   1 
ATOM   9436  C CB  . ILE C 1 154 ? 27.730  9.475   62.690  1.00 14.11  ? 174  ILE C CB  1 
ATOM   9437  C CG1 . ILE C 1 154 ? 29.137  9.596   63.274  1.00 14.63  ? 174  ILE C CG1 1 
ATOM   9438  C CG2 . ILE C 1 154 ? 26.696  9.859   63.737  1.00 15.59  ? 174  ILE C CG2 1 
ATOM   9439  C CD1 . ILE C 1 154 ? 29.439  10.950  63.845  1.00 15.87  ? 174  ILE C CD1 1 
ATOM   9440  N N   . TRP C 1 155 ? 25.773  8.413   60.577  1.00 11.16  ? 175  TRP C N   1 
ATOM   9441  C CA  . TRP C 1 155 ? 24.420  8.369   60.024  1.00 9.76   ? 175  TRP C CA  1 
ATOM   9442  C C   . TRP C 1 155 ? 23.873  6.962   59.844  1.00 9.45   ? 175  TRP C C   1 
ATOM   9443  O O   . TRP C 1 155 ? 22.689  6.727   60.058  1.00 10.70  ? 175  TRP C O   1 
ATOM   9444  C CB  . TRP C 1 155 ? 24.375  9.093   58.681  1.00 6.41   ? 175  TRP C CB  1 
ATOM   9445  C CG  . TRP C 1 155 ? 24.725  10.539  58.754  1.00 5.92   ? 175  TRP C CG  1 
ATOM   9446  C CD1 . TRP C 1 155 ? 23.864  11.583  58.895  1.00 5.94   ? 175  TRP C CD1 1 
ATOM   9447  C CD2 . TRP C 1 155 ? 26.037  11.111  58.650  1.00 7.37   ? 175  TRP C CD2 1 
ATOM   9448  N NE1 . TRP C 1 155 ? 24.552  12.775  58.879  1.00 6.39   ? 175  TRP C NE1 1 
ATOM   9449  C CE2 . TRP C 1 155 ? 25.889  12.515  58.730  1.00 7.96   ? 175  TRP C CE2 1 
ATOM   9450  C CE3 . TRP C 1 155 ? 27.324  10.574  58.492  1.00 6.27   ? 175  TRP C CE3 1 
ATOM   9451  C CZ2 . TRP C 1 155 ? 26.983  13.393  58.656  1.00 7.28   ? 175  TRP C CZ2 1 
ATOM   9452  C CZ3 . TRP C 1 155 ? 28.409  11.447  58.417  1.00 5.11   ? 175  TRP C CZ3 1 
ATOM   9453  C CH2 . TRP C 1 155 ? 28.229  12.840  58.499  1.00 5.26   ? 175  TRP C CH2 1 
ATOM   9454  N N   . GLY C 1 156 ? 24.729  6.026   59.457  1.00 9.36   ? 176  GLY C N   1 
ATOM   9455  C CA  . GLY C 1 156 ? 24.264  4.673   59.245  1.00 8.50   ? 176  GLY C CA  1 
ATOM   9456  C C   . GLY C 1 156 ? 24.591  3.646   60.308  1.00 9.72   ? 176  GLY C C   1 
ATOM   9457  O O   . GLY C 1 156 ? 24.102  2.521   60.219  1.00 10.88  ? 176  GLY C O   1 
ATOM   9458  N N   . PHE C 1 157 ? 25.384  3.996   61.322  1.00 9.61   ? 177  PHE C N   1 
ATOM   9459  C CA  . PHE C 1 157 ? 25.728  2.995   62.330  1.00 7.91   ? 177  PHE C CA  1 
ATOM   9460  C C   . PHE C 1 157 ? 25.754  3.398   63.795  1.00 7.32   ? 177  PHE C C   1 
ATOM   9461  O O   . PHE C 1 157 ? 26.169  2.613   64.656  1.00 4.74   ? 177  PHE C O   1 
ATOM   9462  C CB  . PHE C 1 157 ? 27.044  2.337   61.929  1.00 6.77   ? 177  PHE C CB  1 
ATOM   9463  C CG  . PHE C 1 157 ? 26.930  1.540   60.678  1.00 6.45   ? 177  PHE C CG  1 
ATOM   9464  C CD1 . PHE C 1 157 ? 26.329  0.285   60.701  1.00 6.57   ? 177  PHE C CD1 1 
ATOM   9465  C CD2 . PHE C 1 157 ? 27.319  2.079   59.458  1.00 6.77   ? 177  PHE C CD2 1 
ATOM   9466  C CE1 . PHE C 1 157 ? 26.108  -0.423  59.525  1.00 7.97   ? 177  PHE C CE1 1 
ATOM   9467  C CE2 . PHE C 1 157 ? 27.105  1.384   58.271  1.00 8.56   ? 177  PHE C CE2 1 
ATOM   9468  C CZ  . PHE C 1 157 ? 26.496  0.128   58.302  1.00 9.21   ? 177  PHE C CZ  1 
ATOM   9469  N N   . PHE C 1 158 ? 25.296  4.612   64.082  1.00 8.71   ? 178  PHE C N   1 
ATOM   9470  C CA  . PHE C 1 158 ? 25.245  5.091   65.461  1.00 10.13  ? 178  PHE C CA  1 
ATOM   9471  C C   . PHE C 1 158 ? 24.184  4.311   66.243  1.00 9.31   ? 178  PHE C C   1 
ATOM   9472  O O   . PHE C 1 158 ? 23.012  4.256   65.854  1.00 7.24   ? 178  PHE C O   1 
ATOM   9473  C CB  . PHE C 1 158 ? 24.932  6.594   65.494  1.00 10.36  ? 178  PHE C CB  1 
ATOM   9474  C CG  . PHE C 1 158 ? 24.805  7.154   66.880  1.00 10.24  ? 178  PHE C CG  1 
ATOM   9475  C CD1 . PHE C 1 158 ? 23.560  7.298   67.473  1.00 9.65   ? 178  PHE C CD1 1 
ATOM   9476  C CD2 . PHE C 1 158 ? 25.942  7.494   67.613  1.00 11.83  ? 178  PHE C CD2 1 
ATOM   9477  C CE1 . PHE C 1 158 ? 23.447  7.772   68.784  1.00 10.97  ? 178  PHE C CE1 1 
ATOM   9478  C CE2 . PHE C 1 158 ? 25.842  7.968   68.923  1.00 10.45  ? 178  PHE C CE2 1 
ATOM   9479  C CZ  . PHE C 1 158 ? 24.590  8.106   69.510  1.00 10.44  ? 178  PHE C CZ  1 
ATOM   9480  N N   . SER C 1 159 ? 24.608  3.711   67.350  1.00 10.50  ? 179  SER C N   1 
ATOM   9481  C CA  . SER C 1 159 ? 23.715  2.914   68.189  1.00 11.96  ? 179  SER C CA  1 
ATOM   9482  C C   . SER C 1 159 ? 23.873  3.187   69.686  1.00 11.04  ? 179  SER C C   1 
ATOM   9483  O O   . SER C 1 159 ? 24.990  3.284   70.188  1.00 12.17  ? 179  SER C O   1 
ATOM   9484  C CB  . SER C 1 159 ? 23.978  1.429   67.923  1.00 11.67  ? 179  SER C CB  1 
ATOM   9485  O OG  . SER C 1 159 ? 23.457  0.621   68.959  1.00 12.76  ? 179  SER C OG  1 
ATOM   9486  N N   . THR C 1 160 ? 22.767  3.305   70.407  1.00 9.66   ? 180  THR C N   1 
ATOM   9487  C CA  . THR C 1 160 ? 22.878  3.524   71.844  1.00 12.28  ? 180  THR C CA  1 
ATOM   9488  C C   . THR C 1 160 ? 22.660  2.216   72.587  1.00 12.32  ? 180  THR C C   1 
ATOM   9489  O O   . THR C 1 160 ? 22.535  2.201   73.805  1.00 13.05  ? 180  THR C O   1 
ATOM   9490  C CB  . THR C 1 160 ? 21.853  4.539   72.388  1.00 12.18  ? 180  THR C CB  1 
ATOM   9491  O OG1 . THR C 1 160 ? 20.535  4.106   72.044  1.00 13.81  ? 180  THR C OG1 1 
ATOM   9492  C CG2 . THR C 1 160 ? 22.113  5.932   71.835  1.00 11.67  ? 180  THR C CG2 1 
ATOM   9493  N N   . GLY C 1 161 ? 22.606  1.116   71.847  1.00 12.44  ? 181  GLY C N   1 
ATOM   9494  C CA  . GLY C 1 161 ? 22.417  -0.176  72.473  1.00 12.02  ? 181  GLY C CA  1 
ATOM   9495  C C   . GLY C 1 161 ? 20.985  -0.455  72.879  1.00 13.55  ? 181  GLY C C   1 
ATOM   9496  O O   . GLY C 1 161 ? 20.663  -1.582  73.270  1.00 14.14  ? 181  GLY C O   1 
ATOM   9497  N N   . ASP C 1 162 ? 20.123  0.559   72.798  1.00 14.20  ? 182  ASP C N   1 
ATOM   9498  C CA  . ASP C 1 162 ? 18.719  0.386   73.168  1.00 13.46  ? 182  ASP C CA  1 
ATOM   9499  C C   . ASP C 1 162 ? 17.748  0.796   72.063  1.00 12.58  ? 182  ASP C C   1 
ATOM   9500  O O   . ASP C 1 162 ? 18.154  1.081   70.936  1.00 11.79  ? 182  ASP C O   1 
ATOM   9501  C CB  . ASP C 1 162 ? 18.410  1.130   74.477  1.00 15.13  ? 182  ASP C CB  1 
ATOM   9502  C CG  . ASP C 1 162 ? 18.691  2.622   74.398  1.00 19.65  ? 182  ASP C CG  1 
ATOM   9503  O OD1 . ASP C 1 162 ? 18.963  3.234   75.451  1.00 19.64  ? 182  ASP C OD1 1 
ATOM   9504  O OD2 . ASP C 1 162 ? 18.622  3.194   73.292  1.00 24.30  ? 182  ASP C OD2 1 
ATOM   9505  N N   . GLU C 1 163 ? 16.463  0.823   72.394  1.00 12.17  ? 183  GLU C N   1 
ATOM   9506  C CA  . GLU C 1 163 ? 15.434  1.138   71.425  1.00 11.22  ? 183  GLU C CA  1 
ATOM   9507  C C   . GLU C 1 163 ? 15.464  2.547   70.870  1.00 11.97  ? 183  GLU C C   1 
ATOM   9508  O O   . GLU C 1 163 ? 14.892  2.810   69.811  1.00 13.10  ? 183  GLU C O   1 
ATOM   9509  C CB  . GLU C 1 163 ? 14.046  0.844   72.009  1.00 12.32  ? 183  GLU C CB  1 
ATOM   9510  C CG  . GLU C 1 163 ? 13.491  1.863   73.002  1.00 14.05  ? 183  GLU C CG  1 
ATOM   9511  C CD  . GLU C 1 163 ? 13.970  1.648   74.430  1.00 17.49  ? 183  GLU C CD  1 
ATOM   9512  O OE1 . GLU C 1 163 ? 13.389  2.280   75.346  1.00 18.11  ? 183  GLU C OE1 1 
ATOM   9513  O OE2 . GLU C 1 163 ? 14.921  0.859   74.643  1.00 17.68  ? 183  GLU C OE2 1 
ATOM   9514  N N   . HIS C 1 164 ? 16.131  3.458   71.565  1.00 12.32  ? 184  HIS C N   1 
ATOM   9515  C CA  . HIS C 1 164 ? 16.192  4.842   71.100  1.00 12.93  ? 184  HIS C CA  1 
ATOM   9516  C C   . HIS C 1 164 ? 17.075  5.024   69.857  1.00 12.92  ? 184  HIS C C   1 
ATOM   9517  O O   . HIS C 1 164 ? 16.986  6.035   69.160  1.00 12.59  ? 184  HIS C O   1 
ATOM   9518  C CB  . HIS C 1 164 ? 16.641  5.738   72.254  1.00 12.62  ? 184  HIS C CB  1 
ATOM   9519  C CG  . HIS C 1 164 ? 15.737  5.660   73.449  1.00 13.98  ? 184  HIS C CG  1 
ATOM   9520  N ND1 . HIS C 1 164 ? 14.375  5.870   73.366  1.00 12.84  ? 184  HIS C ND1 1 
ATOM   9521  C CD2 . HIS C 1 164 ? 15.994  5.392   74.750  1.00 13.06  ? 184  HIS C CD2 1 
ATOM   9522  C CE1 . HIS C 1 164 ? 13.836  5.735   74.564  1.00 10.42  ? 184  HIS C CE1 1 
ATOM   9523  N NE2 . HIS C 1 164 ? 14.795  5.446   75.422  1.00 10.69  ? 184  HIS C NE2 1 
ATOM   9524  N N   . SER C 1 165 ? 17.905  4.023   69.577  1.00 13.21  ? 185  SER C N   1 
ATOM   9525  C CA  . SER C 1 165 ? 18.784  4.026   68.414  1.00 12.77  ? 185  SER C CA  1 
ATOM   9526  C C   . SER C 1 165 ? 19.508  2.677   68.294  1.00 12.19  ? 185  SER C C   1 
ATOM   9527  O O   . SER C 1 165 ? 20.732  2.587   68.476  1.00 11.82  ? 185  SER C O   1 
ATOM   9528  C CB  . SER C 1 165 ? 19.805  5.168   68.505  1.00 13.47  ? 185  SER C CB  1 
ATOM   9529  O OG  . SER C 1 165 ? 20.517  5.311   67.281  1.00 13.88  ? 185  SER C OG  1 
ATOM   9530  N N   . ARG C 1 166 ? 18.734  1.637   67.985  1.00 11.17  ? 186  ARG C N   1 
ATOM   9531  C CA  . ARG C 1 166 ? 19.254  0.280   67.828  1.00 8.75   ? 186  ARG C CA  1 
ATOM   9532  C C   . ARG C 1 166 ? 20.516  0.205   66.980  1.00 6.50   ? 186  ARG C C   1 
ATOM   9533  O O   . ARG C 1 166 ? 21.512  -0.381  67.395  1.00 4.57   ? 186  ARG C O   1 
ATOM   9534  C CB  . ARG C 1 166 ? 18.194  -0.624  67.201  1.00 9.75   ? 186  ARG C CB  1 
ATOM   9535  C CG  . ARG C 1 166 ? 17.026  -0.970  68.102  1.00 11.05  ? 186  ARG C CG  1 
ATOM   9536  C CD  . ARG C 1 166 ? 16.225  -2.113  67.489  1.00 14.71  ? 186  ARG C CD  1 
ATOM   9537  N NE  . ARG C 1 166 ? 15.315  -2.724  68.451  1.00 17.40  ? 186  ARG C NE  1 
ATOM   9538  C CZ  . ARG C 1 166 ? 14.160  -2.190  68.829  1.00 19.95  ? 186  ARG C CZ  1 
ATOM   9539  N NH1 . ARG C 1 166 ? 13.768  -1.031  68.314  1.00 20.17  ? 186  ARG C NH1 1 
ATOM   9540  N NH2 . ARG C 1 166 ? 13.408  -2.802  69.739  1.00 20.76  ? 186  ARG C NH2 1 
ATOM   9541  N N   . GLY C 1 167 ? 20.463  0.783   65.786  1.00 5.99   ? 187  GLY C N   1 
ATOM   9542  C CA  . GLY C 1 167 ? 21.615  0.765   64.904  1.00 6.00   ? 187  GLY C CA  1 
ATOM   9543  C C   . GLY C 1 167 ? 21.388  0.033   63.592  1.00 6.20   ? 187  GLY C C   1 
ATOM   9544  O O   . GLY C 1 167 ? 20.248  -0.262  63.214  1.00 6.24   ? 187  GLY C O   1 
ATOM   9545  N N   . ASN C 1 168 ? 22.487  -0.265  62.904  1.00 6.05   ? 188  ASN C N   1 
ATOM   9546  C CA  . ASN C 1 168 ? 22.467  -0.962  61.618  1.00 7.22   ? 188  ASN C CA  1 
ATOM   9547  C C   . ASN C 1 168 ? 21.575  -0.302  60.581  1.00 7.92   ? 188  ASN C C   1 
ATOM   9548  O O   . ASN C 1 168 ? 21.006  -0.998  59.734  1.00 9.20   ? 188  ASN C O   1 
ATOM   9549  C CB  . ASN C 1 168 ? 21.992  -2.413  61.757  1.00 6.32   ? 188  ASN C CB  1 
ATOM   9550  C CG  . ASN C 1 168 ? 22.930  -3.273  62.560  1.00 6.86   ? 188  ASN C CG  1 
ATOM   9551  O OD1 . ASN C 1 168 ? 24.150  -3.084  62.541  1.00 5.23   ? 188  ASN C OD1 1 
ATOM   9552  N ND2 . ASN C 1 168 ? 22.365  -4.257  63.257  1.00 5.86   ? 188  ASN C ND2 1 
ATOM   9553  N N   . TRP C 1 169 ? 21.436  1.019   60.631  1.00 8.79   ? 189  TRP C N   1 
ATOM   9554  C CA  . TRP C 1 169 ? 20.586  1.697   59.650  1.00 9.53   ? 189  TRP C CA  1 
ATOM   9555  C C   . TRP C 1 169 ? 21.100  1.339   58.251  1.00 10.01  ? 189  TRP C C   1 
ATOM   9556  O O   . TRP C 1 169 ? 20.316  1.058   57.334  1.00 10.91  ? 189  TRP C O   1 
ATOM   9557  C CB  . TRP C 1 169 ? 20.619  3.219   59.860  1.00 9.50   ? 189  TRP C CB  1 
ATOM   9558  C CG  . TRP C 1 169 ? 20.568  3.628   61.314  1.00 9.45   ? 189  TRP C CG  1 
ATOM   9559  C CD1 . TRP C 1 169 ? 21.515  4.332   61.997  1.00 9.14   ? 189  TRP C CD1 1 
ATOM   9560  C CD2 . TRP C 1 169 ? 19.558  3.286   62.271  1.00 9.48   ? 189  TRP C CD2 1 
ATOM   9561  N NE1 . TRP C 1 169 ? 21.166  4.446   63.321  1.00 8.68   ? 189  TRP C NE1 1 
ATOM   9562  C CE2 . TRP C 1 169 ? 19.969  3.811   63.517  1.00 9.42   ? 189  TRP C CE2 1 
ATOM   9563  C CE3 . TRP C 1 169 ? 18.346  2.584   62.200  1.00 9.18   ? 189  TRP C CE3 1 
ATOM   9564  C CZ2 . TRP C 1 169 ? 19.214  3.654   64.683  1.00 8.82   ? 189  TRP C CZ2 1 
ATOM   9565  C CZ3 . TRP C 1 169 ? 17.596  2.430   63.360  1.00 7.95   ? 189  TRP C CZ3 1 
ATOM   9566  C CH2 . TRP C 1 169 ? 18.036  2.963   64.585  1.00 7.02   ? 189  TRP C CH2 1 
ATOM   9567  N N   . GLY C 1 170 ? 22.426  1.322   58.117  1.00 10.04  ? 190  GLY C N   1 
ATOM   9568  C CA  . GLY C 1 170 ? 23.069  1.001   56.855  1.00 8.41   ? 190  GLY C CA  1 
ATOM   9569  C C   . GLY C 1 170 ? 22.695  -0.364  56.323  1.00 7.62   ? 190  GLY C C   1 
ATOM   9570  O O   . GLY C 1 170 ? 22.529  -0.549  55.120  1.00 7.46   ? 190  GLY C O   1 
ATOM   9571  N N   . HIS C 1 171 ? 22.564  -1.334  57.215  1.00 7.80   ? 191  HIS C N   1 
ATOM   9572  C CA  . HIS C 1 171 ? 22.195  -2.667  56.783  1.00 8.00   ? 191  HIS C CA  1 
ATOM   9573  C C   . HIS C 1 171 ? 20.724  -2.678  56.436  1.00 8.73   ? 191  HIS C C   1 
ATOM   9574  O O   . HIS C 1 171 ? 20.302  -3.405  55.540  1.00 9.51   ? 191  HIS C O   1 
ATOM   9575  C CB  . HIS C 1 171 ? 22.506  -3.689  57.867  1.00 7.79   ? 191  HIS C CB  1 
ATOM   9576  C CG  . HIS C 1 171 ? 23.974  -3.878  58.103  1.00 9.56   ? 191  HIS C CG  1 
ATOM   9577  N ND1 . HIS C 1 171 ? 24.881  -3.996  57.069  1.00 9.69   ? 191  HIS C ND1 1 
ATOM   9578  C CD2 . HIS C 1 171 ? 24.694  -3.956  59.245  1.00 8.83   ? 191  HIS C CD2 1 
ATOM   9579  C CE1 . HIS C 1 171 ? 26.096  -4.134  57.567  1.00 9.56   ? 191  HIS C CE1 1 
ATOM   9580  N NE2 . HIS C 1 171 ? 26.012  -4.112  58.884  1.00 9.97   ? 191  HIS C NE2 1 
ATOM   9581  N N   . LEU C 1 172 ? 19.940  -1.854  57.127  1.00 8.58   ? 192  LEU C N   1 
ATOM   9582  C CA  . LEU C 1 172 ? 18.521  -1.786  56.830  1.00 8.64   ? 192  LEU C CA  1 
ATOM   9583  C C   . LEU C 1 172 ? 18.320  -1.098  55.474  1.00 10.85  ? 192  LEU C C   1 
ATOM   9584  O O   . LEU C 1 172 ? 17.353  -1.392  54.754  1.00 10.92  ? 192  LEU C O   1 
ATOM   9585  C CB  . LEU C 1 172 ? 17.778  -1.042  57.932  1.00 6.05   ? 192  LEU C CB  1 
ATOM   9586  C CG  . LEU C 1 172 ? 17.712  -1.726  59.300  1.00 5.43   ? 192  LEU C CG  1 
ATOM   9587  C CD1 . LEU C 1 172 ? 16.861  -0.877  60.228  1.00 3.71   ? 192  LEU C CD1 1 
ATOM   9588  C CD2 . LEU C 1 172 ? 17.121  -3.126  59.178  1.00 3.76   ? 192  LEU C CD2 1 
ATOM   9589  N N   . ASP C 1 173 ? 19.237  -0.192  55.125  1.00 11.63  ? 193  ASP C N   1 
ATOM   9590  C CA  . ASP C 1 173 ? 19.179  0.502   53.836  1.00 11.81  ? 193  ASP C CA  1 
ATOM   9591  C C   . ASP C 1 173 ? 19.432  -0.500  52.710  1.00 10.89  ? 193  ASP C C   1 
ATOM   9592  O O   . ASP C 1 173 ? 18.856  -0.410  51.625  1.00 9.10   ? 193  ASP C O   1 
ATOM   9593  C CB  . ASP C 1 173 ? 20.241  1.604   53.748  1.00 13.01  ? 193  ASP C CB  1 
ATOM   9594  C CG  . ASP C 1 173 ? 19.884  2.823   54.556  1.00 14.76  ? 193  ASP C CG  1 
ATOM   9595  O OD1 . ASP C 1 173 ? 18.678  3.062   54.742  1.00 16.75  ? 193  ASP C OD1 1 
ATOM   9596  O OD2 . ASP C 1 173 ? 20.802  3.553   54.988  1.00 15.33  ? 193  ASP C OD2 1 
ATOM   9597  N N   . GLN C 1 174 ? 20.319  -1.449  52.968  1.00 10.47  ? 194  GLN C N   1 
ATOM   9598  C CA  . GLN C 1 174 ? 20.621  -2.446  51.965  1.00 11.81  ? 194  GLN C CA  1 
ATOM   9599  C C   . GLN C 1 174 ? 19.382  -3.320  51.780  1.00 11.16  ? 194  GLN C C   1 
ATOM   9600  O O   . GLN C 1 174 ? 18.956  -3.580  50.655  1.00 10.60  ? 194  GLN C O   1 
ATOM   9601  C CB  . GLN C 1 174 ? 21.846  -3.262  52.398  1.00 11.02  ? 194  GLN C CB  1 
ATOM   9602  C CG  . GLN C 1 174 ? 23.089  -2.394  52.524  1.00 11.40  ? 194  GLN C CG  1 
ATOM   9603  C CD  . GLN C 1 174 ? 24.213  -3.037  53.321  1.00 13.13  ? 194  GLN C CD  1 
ATOM   9604  O OE1 . GLN C 1 174 ? 23.976  -3.773  54.289  1.00 11.21  ? 194  GLN C OE1 1 
ATOM   9605  N NE2 . GLN C 1 174 ? 25.449  -2.733  52.937  1.00 10.09  ? 194  GLN C NE2 1 
ATOM   9606  N N   . VAL C 1 175 ? 18.788  -3.746  52.888  1.00 10.96  ? 195  VAL C N   1 
ATOM   9607  C CA  . VAL C 1 175 ? 17.594  -4.582  52.833  1.00 9.96   ? 195  VAL C CA  1 
ATOM   9608  C C   . VAL C 1 175 ? 16.465  -3.878  52.089  1.00 10.09  ? 195  VAL C C   1 
ATOM   9609  O O   . VAL C 1 175 ? 15.686  -4.516  51.377  1.00 8.26   ? 195  VAL C O   1 
ATOM   9610  C CB  . VAL C 1 175 ? 17.088  -4.933  54.241  1.00 9.12   ? 195  VAL C CB  1 
ATOM   9611  C CG1 . VAL C 1 175 ? 15.733  -5.602  54.144  1.00 11.56  ? 195  VAL C CG1 1 
ATOM   9612  C CG2 . VAL C 1 175 ? 18.067  -5.838  54.932  1.00 6.77   ? 195  VAL C CG2 1 
ATOM   9613  N N   . ALA C 1 176 ? 16.377  -2.563  52.269  1.00 10.79  ? 196  ALA C N   1 
ATOM   9614  C CA  . ALA C 1 176 ? 15.341  -1.777  51.616  1.00 10.89  ? 196  ALA C CA  1 
ATOM   9615  C C   . ALA C 1 176 ? 15.535  -1.790  50.106  1.00 11.43  ? 196  ALA C C   1 
ATOM   9616  O O   . ALA C 1 176 ? 14.581  -2.027  49.360  1.00 13.28  ? 196  ALA C O   1 
ATOM   9617  C CB  . ALA C 1 176 ? 15.354  -0.351  52.135  1.00 11.09  ? 196  ALA C CB  1 
ATOM   9618  N N   . ALA C 1 177 ? 16.761  -1.542  49.653  1.00 10.55  ? 197  ALA C N   1 
ATOM   9619  C CA  . ALA C 1 177 ? 17.047  -1.551  48.222  1.00 10.47  ? 197  ALA C CA  1 
ATOM   9620  C C   . ALA C 1 177 ? 16.722  -2.924  47.625  1.00 10.91  ? 197  ALA C C   1 
ATOM   9621  O O   . ALA C 1 177 ? 16.195  -3.010  46.518  1.00 12.29  ? 197  ALA C O   1 
ATOM   9622  C CB  . ALA C 1 177 ? 18.507  -1.201  47.970  1.00 10.83  ? 197  ALA C CB  1 
ATOM   9623  N N   . LEU C 1 178 ? 17.035  -3.994  48.354  1.00 10.21  ? 198  LEU C N   1 
ATOM   9624  C CA  . LEU C 1 178 ? 16.745  -5.342  47.879  1.00 10.11  ? 198  LEU C CA  1 
ATOM   9625  C C   . LEU C 1 178 ? 15.245  -5.500  47.683  1.00 11.70  ? 198  LEU C C   1 
ATOM   9626  O O   . LEU C 1 178 ? 14.799  -6.119  46.716  1.00 12.66  ? 198  LEU C O   1 
ATOM   9627  C CB  . LEU C 1 178 ? 17.238  -6.390  48.874  1.00 8.97   ? 198  LEU C CB  1 
ATOM   9628  C CG  . LEU C 1 178 ? 18.749  -6.588  48.933  1.00 7.35   ? 198  LEU C CG  1 
ATOM   9629  C CD1 . LEU C 1 178 ? 19.066  -7.648  49.968  1.00 8.76   ? 198  LEU C CD1 1 
ATOM   9630  C CD2 . LEU C 1 178 ? 19.281  -6.992  47.563  1.00 7.39   ? 198  LEU C CD2 1 
ATOM   9631  N N   . ARG C 1 179 ? 14.467  -4.954  48.612  1.00 12.70  ? 199  ARG C N   1 
ATOM   9632  C CA  . ARG C 1 179 ? 13.020  -5.014  48.486  1.00 13.77  ? 199  ARG C CA  1 
ATOM   9633  C C   . ARG C 1 179 ? 12.623  -4.224  47.245  1.00 12.49  ? 199  ARG C C   1 
ATOM   9634  O O   . ARG C 1 179 ? 11.694  -4.604  46.535  1.00 11.22  ? 199  ARG C O   1 
ATOM   9635  C CB  . ARG C 1 179 ? 12.324  -4.403  49.702  1.00 15.91  ? 199  ARG C CB  1 
ATOM   9636  C CG  . ARG C 1 179 ? 12.295  -5.270  50.934  1.00 21.00  ? 199  ARG C CG  1 
ATOM   9637  C CD  . ARG C 1 179 ? 11.529  -4.564  52.046  1.00 25.46  ? 199  ARG C CD  1 
ATOM   9638  N NE  . ARG C 1 179 ? 11.766  -5.166  53.354  1.00 29.31  ? 199  ARG C NE  1 
ATOM   9639  C CZ  . ARG C 1 179 ? 11.430  -6.410  53.671  1.00 32.45  ? 199  ARG C CZ  1 
ATOM   9640  N NH1 . ARG C 1 179 ? 10.835  -7.187  52.774  1.00 33.30  ? 199  ARG C NH1 1 
ATOM   9641  N NH2 . ARG C 1 179 ? 11.696  -6.882  54.883  1.00 35.51  ? 199  ARG C NH2 1 
ATOM   9642  N N   . TRP C 1 180 ? 13.325  -3.125  46.980  1.00 12.62  ? 200  TRP C N   1 
ATOM   9643  C CA  . TRP C 1 180 ? 13.004  -2.320  45.808  1.00 14.74  ? 200  TRP C CA  1 
ATOM   9644  C C   . TRP C 1 180 ? 13.262  -3.104  44.532  1.00 15.78  ? 200  TRP C C   1 
ATOM   9645  O O   . TRP C 1 180 ? 12.544  -2.951  43.541  1.00 16.20  ? 200  TRP C O   1 
ATOM   9646  C CB  . TRP C 1 180 ? 13.820  -1.036  45.753  1.00 13.85  ? 200  TRP C CB  1 
ATOM   9647  C CG  . TRP C 1 180 ? 13.379  -0.159  44.617  1.00 13.80  ? 200  TRP C CG  1 
ATOM   9648  C CD1 . TRP C 1 180 ? 12.464  0.849   44.670  1.00 13.27  ? 200  TRP C CD1 1 
ATOM   9649  C CD2 . TRP C 1 180 ? 13.809  -0.239  43.249  1.00 14.99  ? 200  TRP C CD2 1 
ATOM   9650  N NE1 . TRP C 1 180 ? 12.296  1.406   43.423  1.00 15.16  ? 200  TRP C NE1 1 
ATOM   9651  C CE2 . TRP C 1 180 ? 13.110  0.756   42.532  1.00 15.12  ? 200  TRP C CE2 1 
ATOM   9652  C CE3 . TRP C 1 180 ? 14.720  -1.056  42.560  1.00 14.01  ? 200  TRP C CE3 1 
ATOM   9653  C CZ2 . TRP C 1 180 ? 13.292  0.959   41.160  1.00 14.91  ? 200  TRP C CZ2 1 
ATOM   9654  C CZ3 . TRP C 1 180 ? 14.901  -0.853  41.195  1.00 13.42  ? 200  TRP C CZ3 1 
ATOM   9655  C CH2 . TRP C 1 180 ? 14.190  0.147   40.512  1.00 14.45  ? 200  TRP C CH2 1 
ATOM   9656  N N   . VAL C 1 181 ? 14.300  -3.932  44.556  1.00 15.89  ? 201  VAL C N   1 
ATOM   9657  C CA  . VAL C 1 181 ? 14.624  -4.750  43.406  1.00 15.26  ? 201  VAL C CA  1 
ATOM   9658  C C   . VAL C 1 181 ? 13.487  -5.745  43.190  1.00 16.29  ? 201  VAL C C   1 
ATOM   9659  O O   . VAL C 1 181 ? 12.984  -5.889  42.077  1.00 17.83  ? 201  VAL C O   1 
ATOM   9660  C CB  . VAL C 1 181 ? 15.928  -5.495  43.635  1.00 14.87  ? 201  VAL C CB  1 
ATOM   9661  C CG1 . VAL C 1 181 ? 16.242  -6.384  42.443  1.00 15.14  ? 201  VAL C CG1 1 
ATOM   9662  C CG2 . VAL C 1 181 ? 17.039  -4.489  43.860  1.00 14.06  ? 201  VAL C CG2 1 
ATOM   9663  N N   . GLN C 1 182 ? 13.064  -6.412  44.258  1.00 16.04  ? 202  GLN C N   1 
ATOM   9664  C CA  . GLN C 1 182 ? 11.973  -7.381  44.171  1.00 16.64  ? 202  GLN C CA  1 
ATOM   9665  C C   . GLN C 1 182 ? 10.696  -6.816  43.534  1.00 16.55  ? 202  GLN C C   1 
ATOM   9666  O O   . GLN C 1 182 ? 10.043  -7.481  42.724  1.00 14.67  ? 202  GLN C O   1 
ATOM   9667  C CB  . GLN C 1 182 ? 11.626  -7.914  45.564  1.00 16.16  ? 202  GLN C CB  1 
ATOM   9668  C CG  . GLN C 1 182 ? 12.742  -8.698  46.229  1.00 21.13  ? 202  GLN C CG  1 
ATOM   9669  C CD  . GLN C 1 182 ? 13.002  -10.042 45.562  1.00 22.46  ? 202  GLN C CD  1 
ATOM   9670  O OE1 . GLN C 1 182 ? 12.094  -10.861 45.427  1.00 22.62  ? 202  GLN C OE1 1 
ATOM   9671  N NE2 . GLN C 1 182 ? 14.249  -10.276 45.152  1.00 21.35  ? 202  GLN C NE2 1 
ATOM   9672  N N   . ASP C 1 183 ? 10.338  -5.589  43.892  1.00 16.51  ? 203  ASP C N   1 
ATOM   9673  C CA  . ASP C 1 183 ? 9.117   -5.013  43.365  1.00 16.56  ? 203  ASP C CA  1 
ATOM   9674  C C   . ASP C 1 183 ? 9.240   -4.296  42.042  1.00 16.78  ? 203  ASP C C   1 
ATOM   9675  O O   . ASP C 1 183 ? 8.227   -3.936  41.452  1.00 19.28  ? 203  ASP C O   1 
ATOM   9676  C CB  . ASP C 1 183 ? 8.499   -4.043  44.371  1.00 17.00  ? 203  ASP C CB  1 
ATOM   9677  C CG  . ASP C 1 183 ? 8.419   -4.618  45.765  1.00 18.61  ? 203  ASP C CG  1 
ATOM   9678  O OD1 . ASP C 1 183 ? 8.387   -5.860  45.902  1.00 16.68  ? 203  ASP C OD1 1 
ATOM   9679  O OD2 . ASP C 1 183 ? 8.375   -3.819  46.730  1.00 21.81  ? 203  ASP C OD2 1 
ATOM   9680  N N   . ASN C 1 184 ? 10.451  -4.091  41.545  1.00 15.61  ? 204  ASN C N   1 
ATOM   9681  C CA  . ASN C 1 184 ? 10.570  -3.350  40.294  1.00 14.31  ? 204  ASN C CA  1 
ATOM   9682  C C   . ASN C 1 184 ? 11.411  -3.952  39.186  1.00 14.27  ? 204  ASN C C   1 
ATOM   9683  O O   . ASN C 1 184 ? 11.059  -3.839  38.017  1.00 16.15  ? 204  ASN C O   1 
ATOM   9684  C CB  . ASN C 1 184 ? 11.124  -1.947  40.576  1.00 11.58  ? 204  ASN C CB  1 
ATOM   9685  C CG  . ASN C 1 184 ? 10.304  -1.185  41.584  1.00 8.36   ? 204  ASN C CG  1 
ATOM   9686  O OD1 . ASN C 1 184 ? 9.455   -0.378  41.224  1.00 8.03   ? 204  ASN C OD1 1 
ATOM   9687  N ND2 . ASN C 1 184 ? 10.549  -1.443  42.858  1.00 8.37   ? 204  ASN C ND2 1 
ATOM   9688  N N   . ILE C 1 185 ? 12.523  -4.575  39.554  1.00 13.67  ? 205  ILE C N   1 
ATOM   9689  C CA  . ILE C 1 185 ? 13.461  -5.117  38.578  1.00 12.50  ? 205  ILE C CA  1 
ATOM   9690  C C   . ILE C 1 185 ? 12.845  -5.702  37.299  1.00 12.66  ? 205  ILE C C   1 
ATOM   9691  O O   . ILE C 1 185 ? 13.339  -5.440  36.207  1.00 13.67  ? 205  ILE C O   1 
ATOM   9692  C CB  . ILE C 1 185 ? 14.460  -6.122  39.267  1.00 9.76   ? 205  ILE C CB  1 
ATOM   9693  C CG1 . ILE C 1 185 ? 15.839  -5.995  38.617  1.00 8.06   ? 205  ILE C CG1 1 
ATOM   9694  C CG2 . ILE C 1 185 ? 13.966  -7.560  39.170  1.00 8.14   ? 205  ILE C CG2 1 
ATOM   9695  C CD1 . ILE C 1 185 ? 16.409  -4.589  38.622  1.00 1.44   ? 205  ILE C CD1 1 
ATOM   9696  N N   . ALA C 1 186 ? 11.756  -6.452  37.416  1.00 14.01  ? 206  ALA C N   1 
ATOM   9697  C CA  . ALA C 1 186 ? 11.120  -7.043  36.235  1.00 14.25  ? 206  ALA C CA  1 
ATOM   9698  C C   . ALA C 1 186 ? 10.831  -5.994  35.170  1.00 14.69  ? 206  ALA C C   1 
ATOM   9699  O O   . ALA C 1 186 ? 10.887  -6.281  33.973  1.00 15.07  ? 206  ALA C O   1 
ATOM   9700  C CB  . ALA C 1 186 ? 9.831   -7.753  36.628  1.00 12.75  ? 206  ALA C CB  1 
ATOM   9701  N N   . SER C 1 187 ? 10.516  -4.782  35.620  1.00 16.06  ? 207  SER C N   1 
ATOM   9702  C CA  . SER C 1 187 ? 10.217  -3.663  34.734  1.00 15.78  ? 207  SER C CA  1 
ATOM   9703  C C   . SER C 1 187 ? 11.483  -3.286  33.985  1.00 15.06  ? 207  SER C C   1 
ATOM   9704  O O   . SER C 1 187 ? 11.433  -2.609  32.961  1.00 16.01  ? 207  SER C O   1 
ATOM   9705  C CB  . SER C 1 187 ? 9.727   -2.457  35.545  1.00 17.07  ? 207  SER C CB  1 
ATOM   9706  O OG  . SER C 1 187 ? 8.600   -2.788  36.343  1.00 19.11  ? 207  SER C OG  1 
ATOM   9707  N N   . PHE C 1 188 ? 12.622  -3.725  34.506  1.00 14.48  ? 208  PHE C N   1 
ATOM   9708  C CA  . PHE C 1 188 ? 13.899  -3.430  33.879  1.00 14.56  ? 208  PHE C CA  1 
ATOM   9709  C C   . PHE C 1 188 ? 14.470  -4.645  33.166  1.00 14.19  ? 208  PHE C C   1 
ATOM   9710  O O   . PHE C 1 188 ? 15.617  -4.637  32.733  1.00 15.48  ? 208  PHE C O   1 
ATOM   9711  C CB  . PHE C 1 188 ? 14.904  -2.911  34.917  1.00 14.49  ? 208  PHE C CB  1 
ATOM   9712  C CG  . PHE C 1 188 ? 14.565  -1.551  35.464  1.00 11.99  ? 208  PHE C CG  1 
ATOM   9713  C CD1 . PHE C 1 188 ? 13.848  -1.419  36.642  1.00 12.28  ? 208  PHE C CD1 1 
ATOM   9714  C CD2 . PHE C 1 188 ? 14.936  -0.402  34.777  1.00 10.41  ? 208  PHE C CD2 1 
ATOM   9715  C CE1 . PHE C 1 188 ? 13.504  -0.157  37.127  1.00 12.51  ? 208  PHE C CE1 1 
ATOM   9716  C CE2 . PHE C 1 188 ? 14.595  0.856   35.255  1.00 10.14  ? 208  PHE C CE2 1 
ATOM   9717  C CZ  . PHE C 1 188 ? 13.879  0.979   36.430  1.00 10.04  ? 208  PHE C CZ  1 
ATOM   9718  N N   . GLY C 1 189 ? 13.665  -5.692  33.048  1.00 14.29  ? 209  GLY C N   1 
ATOM   9719  C CA  . GLY C 1 189 ? 14.121  -6.888  32.366  1.00 14.43  ? 209  GLY C CA  1 
ATOM   9720  C C   . GLY C 1 189 ? 14.887  -7.819  33.274  1.00 14.48  ? 209  GLY C C   1 
ATOM   9721  O O   . GLY C 1 189 ? 15.697  -8.624  32.814  1.00 14.25  ? 209  GLY C O   1 
ATOM   9722  N N   . GLY C 1 190 ? 14.622  -7.708  34.571  1.00 15.04  ? 210  GLY C N   1 
ATOM   9723  C CA  . GLY C 1 190 ? 15.298  -8.546  35.544  1.00 15.08  ? 210  GLY C CA  1 
ATOM   9724  C C   . GLY C 1 190 ? 14.339  -9.517  36.196  1.00 14.79  ? 210  GLY C C   1 
ATOM   9725  O O   . GLY C 1 190 ? 13.160  -9.219  36.349  1.00 15.70  ? 210  GLY C O   1 
ATOM   9726  N N   . ASN C 1 191 ? 14.840  -10.684 36.579  1.00 13.59  ? 211  ASN C N   1 
ATOM   9727  C CA  . ASN C 1 191 ? 14.004  -11.684 37.210  1.00 12.32  ? 211  ASN C CA  1 
ATOM   9728  C C   . ASN C 1 191 ? 14.123  -11.602 38.725  1.00 12.24  ? 211  ASN C C   1 
ATOM   9729  O O   . ASN C 1 191 ? 15.137  -11.993 39.304  1.00 11.77  ? 211  ASN C O   1 
ATOM   9730  C CB  . ASN C 1 191 ? 14.407  -13.064 36.705  1.00 14.09  ? 211  ASN C CB  1 
ATOM   9731  C CG  . ASN C 1 191 ? 13.787  -14.177 37.505  1.00 15.97  ? 211  ASN C CG  1 
ATOM   9732  O OD1 . ASN C 1 191 ? 12.701  -14.030 38.067  1.00 18.47  ? 211  ASN C OD1 1 
ATOM   9733  N ND2 . ASN C 1 191 ? 14.468  -15.312 37.551  1.00 16.27  ? 211  ASN C ND2 1 
ATOM   9734  N N   . PRO C 1 192 ? 13.078  -11.085 39.391  1.00 12.32  ? 212  PRO C N   1 
ATOM   9735  C CA  . PRO C 1 192 ? 13.063  -10.946 40.851  1.00 12.65  ? 212  PRO C CA  1 
ATOM   9736  C C   . PRO C 1 192 ? 13.252  -12.251 41.599  1.00 13.64  ? 212  PRO C C   1 
ATOM   9737  O O   . PRO C 1 192 ? 13.478  -12.247 42.809  1.00 16.04  ? 212  PRO C O   1 
ATOM   9738  C CB  . PRO C 1 192 ? 11.701  -10.322 41.127  1.00 10.37  ? 212  PRO C CB  1 
ATOM   9739  C CG  . PRO C 1 192 ? 10.873  -10.831 40.013  1.00 10.40  ? 212  PRO C CG  1 
ATOM   9740  C CD  . PRO C 1 192 ? 11.782  -10.683 38.824  1.00 10.57  ? 212  PRO C CD  1 
ATOM   9741  N N   . GLY C 1 193 ? 13.157  -13.364 40.881  1.00 13.43  ? 213  GLY C N   1 
ATOM   9742  C CA  . GLY C 1 193 ? 13.322  -14.661 41.511  1.00 12.00  ? 213  GLY C CA  1 
ATOM   9743  C C   . GLY C 1 193 ? 14.742  -15.184 41.436  1.00 11.84  ? 213  GLY C C   1 
ATOM   9744  O O   . GLY C 1 193 ? 15.022  -16.278 41.921  1.00 10.34  ? 213  GLY C O   1 
ATOM   9745  N N   . SER C 1 194 ? 15.638  -14.407 40.828  1.00 12.86  ? 214  SER C N   1 
ATOM   9746  C CA  . SER C 1 194 ? 17.035  -14.806 40.701  1.00 13.24  ? 214  SER C CA  1 
ATOM   9747  C C   . SER C 1 194 ? 17.973  -13.625 40.945  1.00 13.39  ? 214  SER C C   1 
ATOM   9748  O O   . SER C 1 194 ? 18.730  -13.215 40.058  1.00 14.96  ? 214  SER C O   1 
ATOM   9749  C CB  . SER C 1 194 ? 17.299  -15.401 39.313  1.00 14.72  ? 214  SER C CB  1 
ATOM   9750  O OG  . SER C 1 194 ? 18.511  -16.152 39.277  1.00 16.36  ? 214  SER C OG  1 
ATOM   9751  N N   . VAL C 1 195 ? 17.923  -13.080 42.154  1.00 12.46  ? 215  VAL C N   1 
ATOM   9752  C CA  . VAL C 1 195 ? 18.786  -11.965 42.514  1.00 12.45  ? 215  VAL C CA  1 
ATOM   9753  C C   . VAL C 1 195 ? 19.998  -12.452 43.306  1.00 11.71  ? 215  VAL C C   1 
ATOM   9754  O O   . VAL C 1 195 ? 19.867  -13.210 44.270  1.00 11.17  ? 215  VAL C O   1 
ATOM   9755  C CB  . VAL C 1 195 ? 18.018  -10.913 43.342  1.00 12.92  ? 215  VAL C CB  1 
ATOM   9756  C CG1 . VAL C 1 195 ? 18.983  -9.888  43.923  1.00 12.94  ? 215  VAL C CG1 1 
ATOM   9757  C CG2 . VAL C 1 195 ? 16.994  -10.221 42.460  1.00 12.67  ? 215  VAL C CG2 1 
ATOM   9758  N N   . THR C 1 196 ? 21.177  -12.010 42.879  1.00 11.44  ? 216  THR C N   1 
ATOM   9759  C CA  . THR C 1 196 ? 22.445  -12.369 43.513  1.00 10.93  ? 216  THR C CA  1 
ATOM   9760  C C   . THR C 1 196 ? 23.052  -11.117 44.148  1.00 9.84   ? 216  THR C C   1 
ATOM   9761  O O   . THR C 1 196 ? 23.097  -10.054 43.521  1.00 10.07  ? 216  THR C O   1 
ATOM   9762  C CB  . THR C 1 196 ? 23.464  -12.904 42.465  1.00 12.19  ? 216  THR C CB  1 
ATOM   9763  O OG1 . THR C 1 196 ? 22.849  -13.914 41.653  1.00 14.02  ? 216  THR C OG1 1 
ATOM   9764  C CG2 . THR C 1 196 ? 24.669  -13.499 43.151  1.00 13.21  ? 216  THR C CG2 1 
ATOM   9765  N N   . ILE C 1 197 ? 23.508  -11.225 45.391  1.00 8.34   ? 217  ILE C N   1 
ATOM   9766  C CA  . ILE C 1 197 ? 24.128  -10.075 46.031  1.00 6.38   ? 217  ILE C CA  1 
ATOM   9767  C C   . ILE C 1 197 ? 25.588  -10.372 46.249  1.00 5.72   ? 217  ILE C C   1 
ATOM   9768  O O   . ILE C 1 197 ? 25.937  -11.430 46.745  1.00 4.69   ? 217  ILE C O   1 
ATOM   9769  C CB  . ILE C 1 197 ? 23.518  -9.759  47.390  1.00 5.49   ? 217  ILE C CB  1 
ATOM   9770  C CG1 . ILE C 1 197 ? 23.506  -11.034 48.240  1.00 5.24   ? 217  ILE C CG1 1 
ATOM   9771  C CG2 . ILE C 1 197 ? 22.157  -9.097  47.200  1.00 2.67   ? 217  ILE C CG2 1 
ATOM   9772  C CD1 . ILE C 1 197 ? 23.254  -10.793 49.708  1.00 3.86   ? 217  ILE C CD1 1 
ATOM   9773  N N   . PHE C 1 198 ? 26.433  -9.427  45.863  1.00 7.45   ? 218  PHE C N   1 
ATOM   9774  C CA  . PHE C 1 198 ? 27.873  -9.559  46.023  1.00 9.13   ? 218  PHE C CA  1 
ATOM   9775  C C   . PHE C 1 198 ? 28.483  -8.200  46.380  1.00 10.67  ? 218  PHE C C   1 
ATOM   9776  O O   . PHE C 1 198 ? 28.049  -7.156  45.888  1.00 12.62  ? 218  PHE C O   1 
ATOM   9777  C CB  . PHE C 1 198 ? 28.503  -10.119 44.737  1.00 7.98   ? 218  PHE C CB  1 
ATOM   9778  C CG  . PHE C 1 198 ? 28.350  -9.226  43.519  1.00 7.10   ? 218  PHE C CG  1 
ATOM   9779  C CD1 . PHE C 1 198 ? 27.104  -8.697  43.163  1.00 5.61   ? 218  PHE C CD1 1 
ATOM   9780  C CD2 . PHE C 1 198 ? 29.452  -8.944  42.709  1.00 3.56   ? 218  PHE C CD2 1 
ATOM   9781  C CE1 . PHE C 1 198 ? 26.961  -7.906  42.020  1.00 3.43   ? 218  PHE C CE1 1 
ATOM   9782  C CE2 . PHE C 1 198 ? 29.319  -8.159  41.573  1.00 3.55   ? 218  PHE C CE2 1 
ATOM   9783  C CZ  . PHE C 1 198 ? 28.070  -7.637  41.225  1.00 3.55   ? 218  PHE C CZ  1 
ATOM   9784  N N   . GLY C 1 199 ? 29.479  -8.214  47.255  1.00 12.08  ? 219  GLY C N   1 
ATOM   9785  C CA  . GLY C 1 199 ? 30.118  -6.974  47.663  1.00 12.70  ? 219  GLY C CA  1 
ATOM   9786  C C   . GLY C 1 199 ? 31.569  -7.226  48.008  1.00 12.82  ? 219  GLY C C   1 
ATOM   9787  O O   . GLY C 1 199 ? 31.999  -8.378  48.092  1.00 13.29  ? 219  GLY C O   1 
ATOM   9788  N N   . GLU C 1 200 ? 32.327  -6.160  48.218  1.00 12.17  ? 220  GLU C N   1 
ATOM   9789  C CA  . GLU C 1 200 ? 33.736  -6.314  48.536  1.00 12.29  ? 220  GLU C CA  1 
ATOM   9790  C C   . GLU C 1 200 ? 34.091  -5.656  49.867  1.00 11.67  ? 220  GLU C C   1 
ATOM   9791  O O   . GLU C 1 200 ? 33.547  -4.605  50.226  1.00 10.69  ? 220  GLU C O   1 
ATOM   9792  C CB  . GLU C 1 200 ? 34.566  -5.740  47.388  1.00 13.20  ? 220  GLU C CB  1 
ATOM   9793  C CG  . GLU C 1 200 ? 36.033  -6.113  47.393  1.00 15.24  ? 220  GLU C CG  1 
ATOM   9794  C CD  . GLU C 1 200 ? 36.883  -5.118  48.155  1.00 16.69  ? 220  GLU C CD  1 
ATOM   9795  O OE1 . GLU C 1 200 ? 36.583  -3.901  48.086  1.00 17.10  ? 220  GLU C OE1 1 
ATOM   9796  O OE2 . GLU C 1 200 ? 37.859  -5.551  48.803  1.00 16.68  ? 220  GLU C OE2 1 
ATOM   9797  N N   . SER C 1 201 ? 34.996  -6.301  50.600  1.00 12.37  ? 221  SER C N   1 
ATOM   9798  C CA  . SER C 1 201 ? 35.445  -5.829  51.911  1.00 12.09  ? 221  SER C CA  1 
ATOM   9799  C C   . SER C 1 201 ? 34.241  -5.572  52.819  1.00 10.41  ? 221  SER C C   1 
ATOM   9800  O O   . SER C 1 201 ? 33.556  -6.512  53.229  1.00 10.84  ? 221  SER C O   1 
ATOM   9801  C CB  . SER C 1 201 ? 36.285  -4.556  51.757  1.00 14.46  ? 221  SER C CB  1 
ATOM   9802  O OG  . SER C 1 201 ? 36.968  -4.234  52.957  1.00 17.39  ? 221  SER C OG  1 
ATOM   9803  N N   . ALA C 1 202 ? 33.976  -4.311  53.140  1.00 8.84   ? 222  ALA C N   1 
ATOM   9804  C CA  . ALA C 1 202 ? 32.836  -3.995  53.986  1.00 8.25   ? 222  ALA C CA  1 
ATOM   9805  C C   . ALA C 1 202 ? 31.570  -4.467  53.258  1.00 8.81   ? 222  ALA C C   1 
ATOM   9806  O O   . ALA C 1 202 ? 30.614  -4.945  53.874  1.00 5.63   ? 222  ALA C O   1 
ATOM   9807  C CB  . ALA C 1 202 ? 32.778  -2.500  54.241  1.00 7.22   ? 222  ALA C CB  1 
ATOM   9808  N N   . GLY C 1 203 ? 31.582  -4.327  51.935  1.00 9.81   ? 223  GLY C N   1 
ATOM   9809  C CA  . GLY C 1 203 ? 30.448  -4.744  51.135  1.00 10.37  ? 223  GLY C CA  1 
ATOM   9810  C C   . GLY C 1 203 ? 30.367  -6.247  51.206  1.00 10.49  ? 223  GLY C C   1 
ATOM   9811  O O   . GLY C 1 203 ? 29.304  -6.847  51.041  1.00 10.82  ? 223  GLY C O   1 
ATOM   9812  N N   . GLY C 1 204 ? 31.521  -6.854  51.448  1.00 10.83  ? 224  GLY C N   1 
ATOM   9813  C CA  . GLY C 1 204 ? 31.582  -8.294  51.573  1.00 11.95  ? 224  GLY C CA  1 
ATOM   9814  C C   . GLY C 1 204 ? 31.003  -8.671  52.922  1.00 10.91  ? 224  GLY C C   1 
ATOM   9815  O O   . GLY C 1 204 ? 30.291  -9.664  53.043  1.00 9.51   ? 224  GLY C O   1 
ATOM   9816  N N   . GLU C 1 205 ? 31.307  -7.865  53.935  1.00 11.09  ? 225  GLU C N   1 
ATOM   9817  C CA  . GLU C 1 205 ? 30.798  -8.114  55.276  1.00 12.92  ? 225  GLU C CA  1 
ATOM   9818  C C   . GLU C 1 205 ? 29.274  -7.988  55.299  1.00 13.03  ? 225  GLU C C   1 
ATOM   9819  O O   . GLU C 1 205 ? 28.590  -8.724  56.011  1.00 13.24  ? 225  GLU C O   1 
ATOM   9820  C CB  . GLU C 1 205 ? 31.410  -7.128  56.281  1.00 12.73  ? 225  GLU C CB  1 
ATOM   9821  C CG  . GLU C 1 205 ? 31.010  -7.411  57.729  1.00 13.38  ? 225  GLU C CG  1 
ATOM   9822  C CD  . GLU C 1 205 ? 29.944  -6.465  58.271  1.00 14.18  ? 225  GLU C CD  1 
ATOM   9823  O OE1 . GLU C 1 205 ? 29.249  -5.788  57.482  1.00 13.89  ? 225  GLU C OE1 1 
ATOM   9824  O OE2 . GLU C 1 205 ? 29.794  -6.412  59.506  1.00 14.76  ? 225  GLU C OE2 1 
ATOM   9825  N N   . SER C 1 206 ? 28.754  -7.048  54.516  1.00 12.45  ? 226  SER C N   1 
ATOM   9826  C CA  . SER C 1 206 ? 27.322  -6.816  54.444  1.00 9.83   ? 226  SER C CA  1 
ATOM   9827  C C   . SER C 1 206 ? 26.638  -8.021  53.828  1.00 10.43  ? 226  SER C C   1 
ATOM   9828  O O   . SER C 1 206 ? 25.602  -8.478  54.318  1.00 10.30  ? 226  SER C O   1 
ATOM   9829  C CB  . SER C 1 206 ? 27.033  -5.572  53.609  1.00 9.05   ? 226  SER C CB  1 
ATOM   9830  O OG  . SER C 1 206 ? 27.572  -4.416  54.219  1.00 7.07   ? 226  SER C OG  1 
ATOM   9831  N N   . VAL C 1 207 ? 27.210  -8.531  52.744  1.00 9.76   ? 227  VAL C N   1 
ATOM   9832  C CA  . VAL C 1 207 ? 26.641  -9.700  52.093  1.00 9.49   ? 227  VAL C CA  1 
ATOM   9833  C C   . VAL C 1 207 ? 26.590  -10.835 53.121  1.00 8.01   ? 227  VAL C C   1 
ATOM   9834  O O   . VAL C 1 207 ? 25.582  -11.516 53.263  1.00 7.01   ? 227  VAL C O   1 
ATOM   9835  C CB  . VAL C 1 207 ? 27.489  -10.120 50.871  1.00 9.94   ? 227  VAL C CB  1 
ATOM   9836  C CG1 . VAL C 1 207 ? 27.002  -11.449 50.316  1.00 10.27  ? 227  VAL C CG1 1 
ATOM   9837  C CG2 . VAL C 1 207 ? 27.401  -9.055  49.802  1.00 8.83   ? 227  VAL C CG2 1 
ATOM   9838  N N   . SER C 1 208 ? 27.680  -11.009 53.856  1.00 8.02   ? 228  SER C N   1 
ATOM   9839  C CA  . SER C 1 208 ? 27.764  -12.044 54.878  1.00 8.08   ? 228  SER C CA  1 
ATOM   9840  C C   . SER C 1 208 ? 26.710  -11.862 55.976  1.00 9.00   ? 228  SER C C   1 
ATOM   9841  O O   . SER C 1 208 ? 26.204  -12.846 56.518  1.00 9.01   ? 228  SER C O   1 
ATOM   9842  C CB  . SER C 1 208 ? 29.163  -12.044 55.498  1.00 6.43   ? 228  SER C CB  1 
ATOM   9843  O OG  . SER C 1 208 ? 29.296  -13.070 56.458  1.00 7.28   ? 228  SER C OG  1 
ATOM   9844  N N   . VAL C 1 209 ? 26.382  -10.606 56.294  1.00 10.55  ? 229  VAL C N   1 
ATOM   9845  C CA  . VAL C 1 209 ? 25.388  -10.278 57.329  1.00 9.92   ? 229  VAL C CA  1 
ATOM   9846  C C   . VAL C 1 209 ? 23.967  -10.529 56.833  1.00 9.77   ? 229  VAL C C   1 
ATOM   9847  O O   . VAL C 1 209 ? 23.108  -10.980 57.581  1.00 9.60   ? 229  VAL C O   1 
ATOM   9848  C CB  . VAL C 1 209 ? 25.501  -8.793  57.789  1.00 8.47   ? 229  VAL C CB  1 
ATOM   9849  C CG1 . VAL C 1 209 ? 24.400  -8.460  58.780  1.00 6.60   ? 229  VAL C CG1 1 
ATOM   9850  C CG2 . VAL C 1 209 ? 26.850  -8.547  58.432  1.00 7.54   ? 229  VAL C CG2 1 
ATOM   9851  N N   . LEU C 1 210 ? 23.724  -10.222 55.568  1.00 11.18  ? 230  LEU C N   1 
ATOM   9852  C CA  . LEU C 1 210 ? 22.416  -10.444 54.984  1.00 11.96  ? 230  LEU C CA  1 
ATOM   9853  C C   . LEU C 1 210 ? 22.170  -11.953 54.954  1.00 13.97  ? 230  LEU C C   1 
ATOM   9854  O O   . LEU C 1 210 ? 21.039  -12.423 55.097  1.00 16.21  ? 230  LEU C O   1 
ATOM   9855  C CB  . LEU C 1 210 ? 22.380  -9.865  53.570  1.00 9.80   ? 230  LEU C CB  1 
ATOM   9856  C CG  . LEU C 1 210 ? 22.499  -8.339  53.507  1.00 10.55  ? 230  LEU C CG  1 
ATOM   9857  C CD1 . LEU C 1 210 ? 22.573  -7.864  52.058  1.00 10.71  ? 230  LEU C CD1 1 
ATOM   9858  C CD2 . LEU C 1 210 ? 21.298  -7.713  54.211  1.00 8.41   ? 230  LEU C CD2 1 
ATOM   9859  N N   . VAL C 1 211 ? 23.245  -12.712 54.782  1.00 14.75  ? 231  VAL C N   1 
ATOM   9860  C CA  . VAL C 1 211 ? 23.151  -14.158 54.731  1.00 14.90  ? 231  VAL C CA  1 
ATOM   9861  C C   . VAL C 1 211 ? 22.645  -14.743 56.044  1.00 17.17  ? 231  VAL C C   1 
ATOM   9862  O O   . VAL C 1 211 ? 22.048  -15.822 56.045  1.00 18.61  ? 231  VAL C O   1 
ATOM   9863  C CB  . VAL C 1 211 ? 24.520  -14.782 54.385  1.00 13.96  ? 231  VAL C CB  1 
ATOM   9864  C CG1 . VAL C 1 211 ? 24.517  -16.274 54.667  1.00 13.22  ? 231  VAL C CG1 1 
ATOM   9865  C CG2 . VAL C 1 211 ? 24.831  -14.538 52.923  1.00 12.41  ? 231  VAL C CG2 1 
ATOM   9866  N N   . LEU C 1 212 ? 22.872  -14.034 57.152  1.00 17.89  ? 232  LEU C N   1 
ATOM   9867  C CA  . LEU C 1 212 ? 22.450  -14.501 58.480  1.00 18.19  ? 232  LEU C CA  1 
ATOM   9868  C C   . LEU C 1 212 ? 21.244  -13.740 59.011  1.00 20.77  ? 232  LEU C C   1 
ATOM   9869  O O   . LEU C 1 212 ? 20.780  -14.006 60.118  1.00 22.25  ? 232  LEU C O   1 
ATOM   9870  C CB  . LEU C 1 212 ? 23.577  -14.322 59.498  1.00 14.66  ? 232  LEU C CB  1 
ATOM   9871  C CG  . LEU C 1 212 ? 24.991  -14.808 59.191  1.00 13.56  ? 232  LEU C CG  1 
ATOM   9872  C CD1 . LEU C 1 212 ? 25.933  -14.375 60.313  1.00 13.17  ? 232  LEU C CD1 1 
ATOM   9873  C CD2 . LEU C 1 212 ? 25.001  -16.302 59.043  1.00 9.72   ? 232  LEU C CD2 1 
ATOM   9874  N N   . SER C 1 213 ? 20.744  -12.785 58.237  1.00 23.37  ? 233  SER C N   1 
ATOM   9875  C CA  . SER C 1 213 ? 19.624  -11.968 58.683  1.00 25.02  ? 233  SER C CA  1 
ATOM   9876  C C   . SER C 1 213 ? 18.244  -12.481 58.280  1.00 26.55  ? 233  SER C C   1 
ATOM   9877  O O   . SER C 1 213 ? 17.947  -12.653 57.095  1.00 26.93  ? 233  SER C O   1 
ATOM   9878  C CB  . SER C 1 213 ? 19.812  -10.532 58.189  1.00 25.03  ? 233  SER C CB  1 
ATOM   9879  O OG  . SER C 1 213 ? 18.779  -9.691  58.667  1.00 27.57  ? 233  SER C OG  1 
ATOM   9880  N N   . PRO C 1 214 ? 17.380  -12.733 59.276  1.00 28.18  ? 234  PRO C N   1 
ATOM   9881  C CA  . PRO C 1 214 ? 16.014  -13.224 59.070  1.00 29.24  ? 234  PRO C CA  1 
ATOM   9882  C C   . PRO C 1 214 ? 15.187  -12.259 58.215  1.00 29.97  ? 234  PRO C C   1 
ATOM   9883  O O   . PRO C 1 214 ? 14.300  -12.666 57.461  1.00 31.23  ? 234  PRO C O   1 
ATOM   9884  C CB  . PRO C 1 214 ? 15.481  -13.339 60.495  1.00 28.64  ? 234  PRO C CB  1 
ATOM   9885  C CG  . PRO C 1 214 ? 16.705  -13.685 61.277  1.00 28.99  ? 234  PRO C CG  1 
ATOM   9886  C CD  . PRO C 1 214 ? 17.713  -12.720 60.711  1.00 28.81  ? 234  PRO C CD  1 
ATOM   9887  N N   . LEU C 1 215 ? 15.486  -10.975 58.345  1.00 29.50  ? 235  LEU C N   1 
ATOM   9888  C CA  . LEU C 1 215 ? 14.777  -9.959  57.602  1.00 29.75  ? 235  LEU C CA  1 
ATOM   9889  C C   . LEU C 1 215 ? 14.981  -10.123 56.107  1.00 31.64  ? 235  LEU C C   1 
ATOM   9890  O O   . LEU C 1 215 ? 14.022  -10.037 55.333  1.00 33.87  ? 235  LEU C O   1 
ATOM   9891  C CB  . LEU C 1 215 ? 15.265  -8.571  58.015  1.00 28.80  ? 235  LEU C CB  1 
ATOM   9892  C CG  . LEU C 1 215 ? 15.040  -8.111  59.454  1.00 28.03  ? 235  LEU C CG  1 
ATOM   9893  C CD1 . LEU C 1 215 ? 15.702  -6.760  59.650  1.00 27.02  ? 235  LEU C CD1 1 
ATOM   9894  C CD2 . LEU C 1 215 ? 13.545  -8.029  59.756  1.00 27.72  ? 235  LEU C CD2 1 
ATOM   9895  N N   . ALA C 1 216 ? 16.229  -10.367 55.711  1.00 31.71  ? 236  ALA C N   1 
ATOM   9896  C CA  . ALA C 1 216 ? 16.598  -10.493 54.304  1.00 32.38  ? 236  ALA C CA  1 
ATOM   9897  C C   . ALA C 1 216 ? 16.247  -11.804 53.612  1.00 33.09  ? 236  ALA C C   1 
ATOM   9898  O O   . ALA C 1 216 ? 16.396  -11.924 52.394  1.00 33.56  ? 236  ALA C O   1 
ATOM   9899  C CB  . ALA C 1 216 ? 18.085  -10.209 54.138  1.00 32.39  ? 236  ALA C CB  1 
ATOM   9900  N N   . LYS C 1 217 ? 15.796  -12.793 54.371  1.00 33.57  ? 237  LYS C N   1 
ATOM   9901  C CA  . LYS C 1 217 ? 15.416  -14.064 53.765  1.00 34.41  ? 237  LYS C CA  1 
ATOM   9902  C C   . LYS C 1 217 ? 14.396  -13.780 52.655  1.00 32.63  ? 237  LYS C C   1 
ATOM   9903  O O   . LYS C 1 217 ? 13.417  -13.060 52.881  1.00 33.75  ? 237  LYS C O   1 
ATOM   9904  C CB  . LYS C 1 217 ? 14.794  -14.973 54.828  1.00 37.57  ? 237  LYS C CB  1 
ATOM   9905  C CG  . LYS C 1 217 ? 14.283  -16.314 54.317  1.00 40.83  ? 237  LYS C CG  1 
ATOM   9906  C CD  . LYS C 1 217 ? 13.645  -17.123 55.449  1.00 42.96  ? 237  LYS C CD  1 
ATOM   9907  C CE  . LYS C 1 217 ? 14.628  -17.347 56.601  1.00 42.58  ? 237  LYS C CE  1 
ATOM   9908  N NZ  . LYS C 1 217 ? 14.018  -18.084 57.739  1.00 41.91  ? 237  LYS C NZ  1 
ATOM   9909  N N   . ASN C 1 218 ? 14.639  -14.321 51.464  1.00 28.92  ? 238  ASN C N   1 
ATOM   9910  C CA  . ASN C 1 218 ? 13.741  -14.148 50.317  1.00 26.72  ? 238  ASN C CA  1 
ATOM   9911  C C   . ASN C 1 218 ? 14.006  -12.903 49.480  1.00 23.48  ? 238  ASN C C   1 
ATOM   9912  O O   . ASN C 1 218 ? 13.247  -12.589 48.569  1.00 21.53  ? 238  ASN C O   1 
ATOM   9913  C CB  . ASN C 1 218 ? 12.267  -14.117 50.753  1.00 29.25  ? 238  ASN C CB  1 
ATOM   9914  C CG  . ASN C 1 218 ? 11.859  -15.334 51.568  1.00 32.41  ? 238  ASN C CG  1 
ATOM   9915  O OD1 . ASN C 1 218 ? 12.296  -16.457 51.300  1.00 34.29  ? 238  ASN C OD1 1 
ATOM   9916  N ND2 . ASN C 1 218 ? 10.994  -15.117 52.560  1.00 34.20  ? 238  ASN C ND2 1 
ATOM   9917  N N   . LEU C 1 219 ? 15.076  -12.190 49.785  1.00 22.06  ? 239  LEU C N   1 
ATOM   9918  C CA  . LEU C 1 219 ? 15.399  -10.986 49.035  1.00 21.12  ? 239  LEU C CA  1 
ATOM   9919  C C   . LEU C 1 219 ? 16.537  -11.254 48.065  1.00 19.76  ? 239  LEU C C   1 
ATOM   9920  O O   . LEU C 1 219 ? 16.906  -10.392 47.269  1.00 19.31  ? 239  LEU C O   1 
ATOM   9921  C CB  . LEU C 1 219 ? 15.769  -9.859  50.001  1.00 20.93  ? 239  LEU C CB  1 
ATOM   9922  C CG  . LEU C 1 219 ? 14.567  -9.445  50.850  1.00 20.02  ? 239  LEU C CG  1 
ATOM   9923  C CD1 . LEU C 1 219 ? 14.993  -8.543  52.002  1.00 19.08  ? 239  LEU C CD1 1 
ATOM   9924  C CD2 . LEU C 1 219 ? 13.559  -8.751  49.942  1.00 19.99  ? 239  LEU C CD2 1 
ATOM   9925  N N   . PHE C 1 220 ? 17.080  -12.462 48.144  1.00 18.77  ? 240  PHE C N   1 
ATOM   9926  C CA  . PHE C 1 220 ? 18.173  -12.889 47.282  1.00 19.12  ? 240  PHE C CA  1 
ATOM   9927  C C   . PHE C 1 220 ? 18.200  -14.412 47.196  1.00 19.46  ? 240  PHE C C   1 
ATOM   9928  O O   . PHE C 1 220 ? 17.590  -15.113 48.017  1.00 20.68  ? 240  PHE C O   1 
ATOM   9929  C CB  . PHE C 1 220 ? 19.524  -12.360 47.796  1.00 18.97  ? 240  PHE C CB  1 
ATOM   9930  C CG  . PHE C 1 220 ? 19.860  -12.789 49.191  1.00 17.51  ? 240  PHE C CG  1 
ATOM   9931  C CD1 . PHE C 1 220 ? 19.170  -12.268 50.278  1.00 17.58  ? 240  PHE C CD1 1 
ATOM   9932  C CD2 . PHE C 1 220 ? 20.869  -13.715 49.419  1.00 17.44  ? 240  PHE C CD2 1 
ATOM   9933  C CE1 . PHE C 1 220 ? 19.482  -12.665 51.575  1.00 18.34  ? 240  PHE C CE1 1 
ATOM   9934  C CE2 . PHE C 1 220 ? 21.190  -14.119 50.715  1.00 17.72  ? 240  PHE C CE2 1 
ATOM   9935  C CZ  . PHE C 1 220 ? 20.496  -13.592 51.794  1.00 18.10  ? 240  PHE C CZ  1 
ATOM   9936  N N   . HIS C 1 221 ? 18.931  -14.926 46.216  1.00 18.89  ? 241  HIS C N   1 
ATOM   9937  C CA  . HIS C 1 221 ? 18.988  -16.361 45.998  1.00 17.37  ? 241  HIS C CA  1 
ATOM   9938  C C   . HIS C 1 221 ? 20.404  -16.918 45.883  1.00 18.19  ? 241  HIS C C   1 
ATOM   9939  O O   . HIS C 1 221 ? 20.590  -18.133 45.804  1.00 19.36  ? 241  HIS C O   1 
ATOM   9940  C CB  . HIS C 1 221 ? 18.184  -16.666 44.737  1.00 15.81  ? 241  HIS C CB  1 
ATOM   9941  C CG  . HIS C 1 221 ? 16.882  -15.927 44.675  1.00 13.58  ? 241  HIS C CG  1 
ATOM   9942  N ND1 . HIS C 1 221 ? 15.772  -16.308 45.397  1.00 12.01  ? 241  HIS C ND1 1 
ATOM   9943  C CD2 . HIS C 1 221 ? 16.539  -14.779 44.041  1.00 13.39  ? 241  HIS C CD2 1 
ATOM   9944  C CE1 . HIS C 1 221 ? 14.804  -15.429 45.214  1.00 12.48  ? 241  HIS C CE1 1 
ATOM   9945  N NE2 . HIS C 1 221 ? 15.245  -14.490 44.394  1.00 12.94  ? 241  HIS C NE2 1 
ATOM   9946  N N   . ARG C 1 222 ? 21.392  -16.025 45.865  1.00 18.59  ? 242  ARG C N   1 
ATOM   9947  C CA  . ARG C 1 222 ? 22.806  -16.397 45.764  1.00 17.84  ? 242  ARG C CA  1 
ATOM   9948  C C   . ARG C 1 222 ? 23.622  -15.248 46.357  1.00 17.73  ? 242  ARG C C   1 
ATOM   9949  O O   . ARG C 1 222 ? 23.229  -14.083 46.247  1.00 18.52  ? 242  ARG C O   1 
ATOM   9950  C CB  . ARG C 1 222 ? 23.192  -16.607 44.300  1.00 17.96  ? 242  ARG C CB  1 
ATOM   9951  C CG  . ARG C 1 222 ? 22.135  -17.362 43.496  1.00 18.89  ? 242  ARG C CG  1 
ATOM   9952  C CD  . ARG C 1 222 ? 22.525  -17.505 42.035  1.00 18.36  ? 242  ARG C CD  1 
ATOM   9953  N NE  . ARG C 1 222 ? 21.462  -18.080 41.208  1.00 16.41  ? 242  ARG C NE  1 
ATOM   9954  C CZ  . ARG C 1 222 ? 20.817  -19.216 41.465  1.00 13.91  ? 242  ARG C CZ  1 
ATOM   9955  N NH1 . ARG C 1 222 ? 21.098  -19.936 42.539  1.00 10.69  ? 242  ARG C NH1 1 
ATOM   9956  N NH2 . ARG C 1 222 ? 19.897  -19.643 40.621  1.00 14.67  ? 242  ARG C NH2 1 
ATOM   9957  N N   . ALA C 1 223 ? 24.754  -15.565 46.980  1.00 16.19  ? 243  ALA C N   1 
ATOM   9958  C CA  . ALA C 1 223 ? 25.574  -14.529 47.596  1.00 14.21  ? 243  ALA C CA  1 
ATOM   9959  C C   . ALA C 1 223 ? 27.086  -14.687 47.399  1.00 13.47  ? 243  ALA C C   1 
ATOM   9960  O O   . ALA C 1 223 ? 27.627  -15.792 47.473  1.00 14.25  ? 243  ALA C O   1 
ATOM   9961  C CB  . ALA C 1 223 ? 25.247  -14.450 49.083  1.00 13.75  ? 243  ALA C CB  1 
ATOM   9962  N N   . ILE C 1 224 ? 27.762  -13.564 47.157  1.00 12.56  ? 244  ILE C N   1 
ATOM   9963  C CA  . ILE C 1 224 ? 29.210  -13.550 46.954  1.00 11.34  ? 244  ILE C CA  1 
ATOM   9964  C C   . ILE C 1 224 ? 29.903  -12.577 47.889  1.00 12.23  ? 244  ILE C C   1 
ATOM   9965  O O   . ILE C 1 224 ? 29.629  -11.378 47.852  1.00 13.64  ? 244  ILE C O   1 
ATOM   9966  C CB  . ILE C 1 224 ? 29.603  -13.125 45.511  1.00 8.95   ? 244  ILE C CB  1 
ATOM   9967  C CG1 . ILE C 1 224 ? 29.047  -14.120 44.491  1.00 6.71   ? 244  ILE C CG1 1 
ATOM   9968  C CG2 . ILE C 1 224 ? 31.124  -13.031 45.395  1.00 6.23   ? 244  ILE C CG2 1 
ATOM   9969  C CD1 . ILE C 1 224 ? 29.364  -13.759 43.072  1.00 3.20   ? 244  ILE C CD1 1 
ATOM   9970  N N   . SER C 1 225 ? 30.801  -13.095 48.719  1.00 13.31  ? 245  SER C N   1 
ATOM   9971  C CA  . SER C 1 225 ? 31.568  -12.265 49.637  1.00 14.04  ? 245  SER C CA  1 
ATOM   9972  C C   . SER C 1 225 ? 33.006  -12.249 49.149  1.00 15.01  ? 245  SER C C   1 
ATOM   9973  O O   . SER C 1 225 ? 33.655  -13.298 49.095  1.00 15.10  ? 245  SER C O   1 
ATOM   9974  C CB  . SER C 1 225 ? 31.518  -12.818 51.061  1.00 14.29  ? 245  SER C CB  1 
ATOM   9975  O OG  . SER C 1 225 ? 30.386  -12.331 51.755  1.00 14.95  ? 245  SER C OG  1 
ATOM   9976  N N   . GLU C 1 226 ? 33.484  -11.054 48.792  1.00 15.90  ? 246  GLU C N   1 
ATOM   9977  C CA  . GLU C 1 226 ? 34.845  -10.836 48.294  1.00 14.05  ? 246  GLU C CA  1 
ATOM   9978  C C   . GLU C 1 226 ? 35.713  -10.102 49.319  1.00 12.32  ? 246  GLU C C   1 
ATOM   9979  O O   . GLU C 1 226 ? 35.589  -8.893  49.489  1.00 12.25  ? 246  GLU C O   1 
ATOM   9980  C CB  . GLU C 1 226 ? 34.800  -10.013 47.002  1.00 14.61  ? 246  GLU C CB  1 
ATOM   9981  C CG  . GLU C 1 226 ? 34.035  -10.663 45.854  1.00 18.05  ? 246  GLU C CG  1 
ATOM   9982  C CD  . GLU C 1 226 ? 33.858  -9.721  44.663  1.00 20.38  ? 246  GLU C CD  1 
ATOM   9983  O OE1 . GLU C 1 226 ? 34.819  -9.001  44.314  1.00 21.63  ? 246  GLU C OE1 1 
ATOM   9984  O OE2 . GLU C 1 226 ? 32.763  -9.706  44.067  1.00 18.75  ? 246  GLU C OE2 1 
ATOM   9985  N N   . SER C 1 227 ? 36.593  -10.831 49.995  1.00 11.40  ? 247  SER C N   1 
ATOM   9986  C CA  . SER C 1 227 ? 37.477  -10.231 50.988  1.00 11.28  ? 247  SER C CA  1 
ATOM   9987  C C   . SER C 1 227 ? 36.694  -9.581  52.111  1.00 12.29  ? 247  SER C C   1 
ATOM   9988  O O   . SER C 1 227 ? 36.765  -8.367  52.282  1.00 13.27  ? 247  SER C O   1 
ATOM   9989  C CB  . SER C 1 227 ? 38.362  -9.169  50.337  1.00 10.20  ? 247  SER C CB  1 
ATOM   9990  O OG  . SER C 1 227 ? 39.130  -9.723  49.280  1.00 13.15  ? 247  SER C OG  1 
ATOM   9991  N N   . GLY C 1 228 ? 35.942  -10.378 52.869  1.00 12.07  ? 248  GLY C N   1 
ATOM   9992  C CA  . GLY C 1 228 ? 35.166  -9.829  53.969  1.00 10.12  ? 248  GLY C CA  1 
ATOM   9993  C C   . GLY C 1 228 ? 33.925  -10.623 54.340  1.00 10.20  ? 248  GLY C C   1 
ATOM   9994  O O   . GLY C 1 228 ? 33.059  -10.861 53.499  1.00 11.10  ? 248  GLY C O   1 
ATOM   9995  N N   . VAL C 1 229 ? 33.838  -11.032 55.603  1.00 9.20   ? 249  VAL C N   1 
ATOM   9996  C CA  . VAL C 1 229 ? 32.700  -11.798 56.089  1.00 10.16  ? 249  VAL C CA  1 
ATOM   9997  C C   . VAL C 1 229 ? 32.255  -11.253 57.438  1.00 13.10  ? 249  VAL C C   1 
ATOM   9998  O O   . VAL C 1 229 ? 32.890  -10.357 57.973  1.00 14.98  ? 249  VAL C O   1 
ATOM   9999  C CB  . VAL C 1 229 ? 33.052  -13.285 56.241  1.00 8.74   ? 249  VAL C CB  1 
ATOM   10000 C CG1 . VAL C 1 229 ? 33.459  -13.863 54.894  1.00 6.59   ? 249  VAL C CG1 1 
ATOM   10001 C CG2 . VAL C 1 229 ? 34.155  -13.459 57.266  1.00 6.30   ? 249  VAL C CG2 1 
ATOM   10002 N N   . ALA C 1 230 ? 31.173  -11.797 57.990  1.00 15.98  ? 250  ALA C N   1 
ATOM   10003 C CA  . ALA C 1 230 ? 30.639  -11.337 59.270  1.00 17.08  ? 250  ALA C CA  1 
ATOM   10004 C C   . ALA C 1 230 ? 31.524  -11.650 60.463  1.00 19.06  ? 250  ALA C C   1 
ATOM   10005 O O   . ALA C 1 230 ? 31.428  -10.993 61.487  1.00 18.47  ? 250  ALA C O   1 
ATOM   10006 C CB  . ALA C 1 230 ? 29.255  -11.918 59.488  1.00 20.26  ? 250  ALA C CB  1 
ATOM   10007 N N   . LEU C 1 231 ? 32.372  -12.664 60.347  1.00 24.47  ? 251  LEU C N   1 
ATOM   10008 C CA  . LEU C 1 231 ? 33.289  -13.006 61.436  1.00 29.16  ? 251  LEU C CA  1 
ATOM   10009 C C   . LEU C 1 231 ? 34.456  -12.010 61.464  1.00 33.15  ? 251  LEU C C   1 
ATOM   10010 O O   . LEU C 1 231 ? 35.187  -11.939 62.455  1.00 35.28  ? 251  LEU C O   1 
ATOM   10011 C CB  . LEU C 1 231 ? 33.837  -14.420 61.264  1.00 28.71  ? 251  LEU C CB  1 
ATOM   10012 C CG  . LEU C 1 231 ? 32.911  -15.597 61.560  1.00 28.99  ? 251  LEU C CG  1 
ATOM   10013 C CD1 . LEU C 1 231 ? 33.540  -16.875 61.029  1.00 30.72  ? 251  LEU C CD1 1 
ATOM   10014 C CD2 . LEU C 1 231 ? 32.679  -15.706 63.052  1.00 28.02  ? 251  LEU C CD2 1 
ATOM   10015 N N   . THR C 1 232 ? 34.639  -11.264 60.366  1.00 35.75  ? 252  THR C N   1 
ATOM   10016 C CA  . THR C 1 232 ? 35.691  -10.237 60.272  1.00 36.78  ? 252  THR C CA  1 
ATOM   10017 C C   . THR C 1 232 ? 35.371  -9.202  61.363  1.00 37.45  ? 252  THR C C   1 
ATOM   10018 O O   . THR C 1 232 ? 34.849  -8.111  61.097  1.00 36.37  ? 252  THR C O   1 
ATOM   10019 C CB  . THR C 1 232 ? 35.712  -9.527  58.862  1.00 37.12  ? 252  THR C CB  1 
ATOM   10020 O OG1 . THR C 1 232 ? 36.107  -10.459 57.844  1.00 34.24  ? 252  THR C OG1 1 
ATOM   10021 C CG2 . THR C 1 232 ? 36.696  -8.351  58.860  1.00 36.33  ? 252  THR C CG2 1 
ATOM   10022 N N   . SER C 1 233 ? 35.681  -9.593  62.594  1.00 37.95  ? 253  SER C N   1 
ATOM   10023 C CA  . SER C 1 233 ? 35.449  -8.803  63.792  1.00 39.33  ? 253  SER C CA  1 
ATOM   10024 C C   . SER C 1 233 ? 35.429  -7.288  63.603  1.00 38.49  ? 253  SER C C   1 
ATOM   10025 O O   . SER C 1 233 ? 34.387  -6.656  63.751  1.00 40.12  ? 253  SER C O   1 
ATOM   10026 C CB  . SER C 1 233 ? 36.504  -9.163  64.838  1.00 41.79  ? 253  SER C CB  1 
ATOM   10027 O OG  . SER C 1 233 ? 36.761  -10.555 64.819  1.00 44.51  ? 253  SER C OG  1 
ATOM   10028 N N   . VAL C 1 234 ? 36.587  -6.720  63.285  1.00 35.65  ? 254  VAL C N   1 
ATOM   10029 C CA  . VAL C 1 234 ? 36.748  -5.284  63.113  1.00 32.90  ? 254  VAL C CA  1 
ATOM   10030 C C   . VAL C 1 234 ? 35.497  -4.495  62.722  1.00 31.59  ? 254  VAL C C   1 
ATOM   10031 O O   . VAL C 1 234 ? 35.384  -3.317  63.055  1.00 32.90  ? 254  VAL C O   1 
ATOM   10032 C CB  . VAL C 1 234 ? 37.880  -4.983  62.101  1.00 33.12  ? 254  VAL C CB  1 
ATOM   10033 C CG1 . VAL C 1 234 ? 37.517  -5.536  60.734  1.00 34.55  ? 254  VAL C CG1 1 
ATOM   10034 C CG2 . VAL C 1 234 ? 38.142  -3.491  62.034  1.00 31.79  ? 254  VAL C CG2 1 
ATOM   10035 N N   . LEU C 1 235 ? 34.554  -5.124  62.032  1.00 29.78  ? 255  LEU C N   1 
ATOM   10036 C CA  . LEU C 1 235 ? 33.351  -4.410  61.625  1.00 28.46  ? 255  LEU C CA  1 
ATOM   10037 C C   . LEU C 1 235 ? 32.070  -4.664  62.421  1.00 28.39  ? 255  LEU C C   1 
ATOM   10038 O O   . LEU C 1 235 ? 31.060  -3.999  62.187  1.00 27.31  ? 255  LEU C O   1 
ATOM   10039 C CB  . LEU C 1 235 ? 33.089  -4.642  60.135  1.00 27.83  ? 255  LEU C CB  1 
ATOM   10040 C CG  . LEU C 1 235 ? 34.013  -3.841  59.214  1.00 27.23  ? 255  LEU C CG  1 
ATOM   10041 C CD1 . LEU C 1 235 ? 33.612  -4.040  57.760  1.00 26.45  ? 255  LEU C CD1 1 
ATOM   10042 C CD2 . LEU C 1 235 ? 33.934  -2.360  59.589  1.00 27.44  ? 255  LEU C CD2 1 
ATOM   10043 N N   . VAL C 1 236 ? 32.100  -5.608  63.359  1.00 29.15  ? 256  VAL C N   1 
ATOM   10044 C CA  . VAL C 1 236 ? 30.922  -5.908  64.183  1.00 30.12  ? 256  VAL C CA  1 
ATOM   10045 C C   . VAL C 1 236 ? 31.222  -5.674  65.671  1.00 31.07  ? 256  VAL C C   1 
ATOM   10046 O O   . VAL C 1 236 ? 31.817  -6.522  66.329  1.00 32.39  ? 256  VAL C O   1 
ATOM   10047 C CB  . VAL C 1 236 ? 30.451  -7.376  63.979  1.00 29.19  ? 256  VAL C CB  1 
ATOM   10048 C CG1 . VAL C 1 236 ? 29.244  -7.675  64.872  1.00 26.93  ? 256  VAL C CG1 1 
ATOM   10049 C CG2 . VAL C 1 236 ? 30.100  -7.608  62.516  1.00 27.21  ? 256  VAL C CG2 1 
ATOM   10050 N N   . LYS C 1 237 ? 30.803  -4.525  66.198  1.00 31.55  ? 257  LYS C N   1 
ATOM   10051 C CA  . LYS C 1 237 ? 31.060  -4.191  67.597  1.00 32.49  ? 257  LYS C CA  1 
ATOM   10052 C C   . LYS C 1 237 ? 30.152  -4.969  68.544  1.00 32.80  ? 257  LYS C C   1 
ATOM   10053 O O   . LYS C 1 237 ? 28.962  -4.684  68.660  1.00 32.95  ? 257  LYS C O   1 
ATOM   10054 C CB  . LYS C 1 237 ? 30.871  -2.685  67.848  1.00 31.97  ? 257  LYS C CB  1 
ATOM   10055 C CG  . LYS C 1 237 ? 31.284  -1.762  66.698  1.00 33.60  ? 257  LYS C CG  1 
ATOM   10056 C CD  . LYS C 1 237 ? 32.769  -1.817  66.341  1.00 34.79  ? 257  LYS C CD  1 
ATOM   10057 C CE  . LYS C 1 237 ? 33.636  -1.160  67.395  1.00 36.44  ? 257  LYS C CE  1 
ATOM   10058 N NZ  . LYS C 1 237 ? 33.558  -1.895  68.682  1.00 40.16  ? 257  LYS C NZ  1 
ATOM   10059 N N   . LYS C 1 238 ? 30.717  -5.955  69.225  1.00 33.61  ? 258  LYS C N   1 
ATOM   10060 C CA  . LYS C 1 238 ? 29.944  -6.745  70.171  1.00 34.61  ? 258  LYS C CA  1 
ATOM   10061 C C   . LYS C 1 238 ? 30.071  -6.069  71.539  1.00 34.51  ? 258  LYS C C   1 
ATOM   10062 O O   . LYS C 1 238 ? 30.699  -5.013  71.660  1.00 35.53  ? 258  LYS C O   1 
ATOM   10063 C CB  . LYS C 1 238 ? 30.487  -8.174  70.215  1.00 34.93  ? 258  LYS C CB  1 
ATOM   10064 C CG  . LYS C 1 238 ? 30.612  -8.815  68.841  1.00 35.88  ? 258  LYS C CG  1 
ATOM   10065 C CD  . LYS C 1 238 ? 31.425  -10.101 68.899  1.00 38.58  ? 258  LYS C CD  1 
ATOM   10066 C CE  . LYS C 1 238 ? 31.859  -10.569 67.510  1.00 39.90  ? 258  LYS C CE  1 
ATOM   10067 N NZ  . LYS C 1 238 ? 32.846  -9.639  66.863  1.00 40.66  ? 258  LYS C NZ  1 
ATOM   10068 N N   . GLY C 1 239 ? 29.475  -6.662  72.565  1.00 33.04  ? 259  GLY C N   1 
ATOM   10069 C CA  . GLY C 1 239 ? 29.556  -6.070  73.888  1.00 31.60  ? 259  GLY C CA  1 
ATOM   10070 C C   . GLY C 1 239 ? 28.686  -4.835  73.993  1.00 30.80  ? 259  GLY C C   1 
ATOM   10071 O O   . GLY C 1 239 ? 27.865  -4.586  73.112  1.00 31.70  ? 259  GLY C O   1 
ATOM   10072 N N   . ASP C 1 240 ? 28.863  -4.059  75.061  1.00 29.58  ? 260  ASP C N   1 
ATOM   10073 C CA  . ASP C 1 240 ? 28.075  -2.844  75.271  1.00 27.72  ? 260  ASP C CA  1 
ATOM   10074 C C   . ASP C 1 240 ? 28.592  -1.713  74.395  1.00 24.99  ? 260  ASP C C   1 
ATOM   10075 O O   . ASP C 1 240 ? 29.750  -1.313  74.500  1.00 23.09  ? 260  ASP C O   1 
ATOM   10076 C CB  . ASP C 1 240 ? 28.126  -2.430  76.744  1.00 30.60  ? 260  ASP C CB  1 
ATOM   10077 C CG  . ASP C 1 240 ? 27.168  -1.297  77.069  1.00 33.74  ? 260  ASP C CG  1 
ATOM   10078 O OD1 . ASP C 1 240 ? 26.003  -1.348  76.616  1.00 36.70  ? 260  ASP C OD1 1 
ATOM   10079 O OD2 . ASP C 1 240 ? 27.572  -0.362  77.793  1.00 35.72  ? 260  ASP C OD2 1 
ATOM   10080 N N   . VAL C 1 241 ? 27.729  -1.200  73.526  1.00 22.51  ? 261  VAL C N   1 
ATOM   10081 C CA  . VAL C 1 241 ? 28.128  -0.129  72.629  1.00 21.55  ? 261  VAL C CA  1 
ATOM   10082 C C   . VAL C 1 241 ? 27.901  1.245   73.233  1.00 22.17  ? 261  VAL C C   1 
ATOM   10083 O O   . VAL C 1 241 ? 28.435  2.244   72.736  1.00 22.68  ? 261  VAL C O   1 
ATOM   10084 C CB  . VAL C 1 241 ? 27.365  -0.203  71.306  1.00 19.93  ? 261  VAL C CB  1 
ATOM   10085 C CG1 . VAL C 1 241 ? 27.676  -1.507  70.613  1.00 19.15  ? 261  VAL C CG1 1 
ATOM   10086 C CG2 . VAL C 1 241 ? 25.877  -0.068  71.559  1.00 19.27  ? 261  VAL C CG2 1 
ATOM   10087 N N   . LYS C 1 242 ? 27.120  1.284   74.311  1.00 21.27  ? 262  LYS C N   1 
ATOM   10088 C CA  . LYS C 1 242 ? 26.793  2.532   74.995  1.00 20.49  ? 262  LYS C CA  1 
ATOM   10089 C C   . LYS C 1 242 ? 27.977  3.507   75.131  1.00 19.16  ? 262  LYS C C   1 
ATOM   10090 O O   . LYS C 1 242 ? 27.830  4.708   74.909  1.00 18.50  ? 262  LYS C O   1 
ATOM   10091 C CB  . LYS C 1 242 ? 26.185  2.215   76.366  1.00 20.72  ? 262  LYS C CB  1 
ATOM   10092 C CG  . LYS C 1 242 ? 25.558  3.413   77.095  1.00 20.56  ? 262  LYS C CG  1 
ATOM   10093 C CD  . LYS C 1 242 ? 24.517  4.120   76.249  1.00 18.37  ? 262  LYS C CD  1 
ATOM   10094 C CE  . LYS C 1 242 ? 23.637  5.018   77.094  1.00 17.68  ? 262  LYS C CE  1 
ATOM   10095 N NZ  . LYS C 1 242 ? 22.714  4.223   77.958  1.00 17.69  ? 262  LYS C NZ  1 
ATOM   10096 N N   . PRO C 1 243 ? 29.162  3.007   75.505  1.00 18.48  ? 263  PRO C N   1 
ATOM   10097 C CA  . PRO C 1 243 ? 30.313  3.904   75.638  1.00 19.09  ? 263  PRO C CA  1 
ATOM   10098 C C   . PRO C 1 243 ? 30.698  4.635   74.347  1.00 18.92  ? 263  PRO C C   1 
ATOM   10099 O O   . PRO C 1 243 ? 30.799  5.860   74.332  1.00 19.79  ? 263  PRO C O   1 
ATOM   10100 C CB  . PRO C 1 243 ? 31.415  2.971   76.120  1.00 17.50  ? 263  PRO C CB  1 
ATOM   10101 C CG  . PRO C 1 243 ? 30.671  2.042   76.982  1.00 18.06  ? 263  PRO C CG  1 
ATOM   10102 C CD  . PRO C 1 243 ? 29.446  1.716   76.151  1.00 18.30  ? 263  PRO C CD  1 
ATOM   10103 N N   . LEU C 1 244 ? 30.908  3.895   73.265  1.00 18.22  ? 264  LEU C N   1 
ATOM   10104 C CA  . LEU C 1 244 ? 31.295  4.532   72.010  1.00 17.86  ? 264  LEU C CA  1 
ATOM   10105 C C   . LEU C 1 244 ? 30.278  5.607   71.631  1.00 15.71  ? 264  LEU C C   1 
ATOM   10106 O O   . LEU C 1 244 ? 30.610  6.583   70.955  1.00 14.57  ? 264  LEU C O   1 
ATOM   10107 C CB  . LEU C 1 244 ? 31.431  3.475   70.894  1.00 19.64  ? 264  LEU C CB  1 
ATOM   10108 C CG  . LEU C 1 244 ? 32.166  3.802   69.573  1.00 19.73  ? 264  LEU C CG  1 
ATOM   10109 C CD1 . LEU C 1 244 ? 31.217  4.473   68.598  1.00 20.57  ? 264  LEU C CD1 1 
ATOM   10110 C CD2 . LEU C 1 244 ? 33.409  4.672   69.839  1.00 18.46  ? 264  LEU C CD2 1 
ATOM   10111 N N   . ALA C 1 245 ? 29.043  5.428   72.090  1.00 14.00  ? 265  ALA C N   1 
ATOM   10112 C CA  . ALA C 1 245 ? 27.976  6.376   71.811  1.00 13.43  ? 265  ALA C CA  1 
ATOM   10113 C C   . ALA C 1 245 ? 28.213  7.655   72.598  1.00 14.53  ? 265  ALA C C   1 
ATOM   10114 O O   . ALA C 1 245 ? 28.178  8.762   72.048  1.00 13.05  ? 265  ALA C O   1 
ATOM   10115 C CB  . ALA C 1 245 ? 26.648  5.775   72.196  1.00 14.02  ? 265  ALA C CB  1 
ATOM   10116 N N   . GLU C 1 246 ? 28.444  7.490   73.896  1.00 16.13  ? 266  GLU C N   1 
ATOM   10117 C CA  . GLU C 1 246 ? 28.703  8.614   74.778  1.00 17.18  ? 266  GLU C CA  1 
ATOM   10118 C C   . GLU C 1 246 ? 29.899  9.395   74.252  1.00 17.39  ? 266  GLU C C   1 
ATOM   10119 O O   . GLU C 1 246 ? 29.898  10.627  74.233  1.00 16.25  ? 266  GLU C O   1 
ATOM   10120 C CB  . GLU C 1 246 ? 28.956  8.100   76.189  1.00 18.29  ? 266  GLU C CB  1 
ATOM   10121 C CG  . GLU C 1 246 ? 27.672  7.859   76.965  1.00 25.05  ? 266  GLU C CG  1 
ATOM   10122 C CD  . GLU C 1 246 ? 27.831  6.868   78.111  1.00 28.77  ? 266  GLU C CD  1 
ATOM   10123 O OE1 . GLU C 1 246 ? 28.867  6.916   78.812  1.00 30.33  ? 266  GLU C OE1 1 
ATOM   10124 O OE2 . GLU C 1 246 ? 26.905  6.047   78.316  1.00 30.05  ? 266  GLU C OE2 1 
ATOM   10125 N N   . GLN C 1 247 ? 30.908  8.666   73.795  1.00 19.36  ? 267  GLN C N   1 
ATOM   10126 C CA  . GLN C 1 247 ? 32.108  9.282   73.258  1.00 20.51  ? 267  GLN C CA  1 
ATOM   10127 C C   . GLN C 1 247 ? 31.749  10.117  72.029  1.00 19.65  ? 267  GLN C C   1 
ATOM   10128 O O   . GLN C 1 247 ? 32.135  11.284  71.931  1.00 20.83  ? 267  GLN C O   1 
ATOM   10129 C CB  . GLN C 1 247 ? 33.132  8.210   72.893  1.00 22.60  ? 267  GLN C CB  1 
ATOM   10130 C CG  . GLN C 1 247 ? 34.559  8.717   72.907  1.00 28.73  ? 267  GLN C CG  1 
ATOM   10131 C CD  . GLN C 1 247 ? 35.574  7.609   72.684  1.00 32.88  ? 267  GLN C CD  1 
ATOM   10132 O OE1 . GLN C 1 247 ? 35.585  6.609   73.407  1.00 35.59  ? 267  GLN C OE1 1 
ATOM   10133 N NE2 . GLN C 1 247 ? 36.438  7.783   71.683  1.00 33.33  ? 267  GLN C NE2 1 
ATOM   10134 N N   . ILE C 1 248 ? 31.010  9.533   71.090  1.00 17.92  ? 268  ILE C N   1 
ATOM   10135 C CA  . ILE C 1 248 ? 30.608  10.283  69.906  1.00 15.30  ? 268  ILE C CA  1 
ATOM   10136 C C   . ILE C 1 248 ? 29.741  11.456  70.347  1.00 15.08  ? 268  ILE C C   1 
ATOM   10137 O O   . ILE C 1 248 ? 29.928  12.583  69.892  1.00 14.98  ? 268  ILE C O   1 
ATOM   10138 C CB  . ILE C 1 248 ? 29.807  9.417   68.928  1.00 14.51  ? 268  ILE C CB  1 
ATOM   10139 C CG1 . ILE C 1 248 ? 30.687  8.266   68.432  1.00 13.31  ? 268  ILE C CG1 1 
ATOM   10140 C CG2 . ILE C 1 248 ? 29.300  10.273  67.773  1.00 11.73  ? 268  ILE C CG2 1 
ATOM   10141 C CD1 . ILE C 1 248 ? 29.982  7.291   67.520  1.00 12.38  ? 268  ILE C CD1 1 
ATOM   10142 N N   . ALA C 1 249 ? 28.803  11.189  71.251  1.00 13.97  ? 269  ALA C N   1 
ATOM   10143 C CA  . ALA C 1 249 ? 27.917  12.231  71.759  1.00 13.72  ? 269  ALA C CA  1 
ATOM   10144 C C   . ALA C 1 249 ? 28.712  13.436  72.264  1.00 14.52  ? 269  ALA C C   1 
ATOM   10145 O O   . ALA C 1 249 ? 28.479  14.576  71.850  1.00 14.45  ? 269  ALA C O   1 
ATOM   10146 C CB  . ALA C 1 249 ? 27.058  11.673  72.878  1.00 12.19  ? 269  ALA C CB  1 
ATOM   10147 N N   . ILE C 1 250 ? 29.651  13.174  73.167  1.00 15.13  ? 270  ILE C N   1 
ATOM   10148 C CA  . ILE C 1 250 ? 30.482  14.224  73.740  1.00 13.22  ? 270  ILE C CA  1 
ATOM   10149 C C   . ILE C 1 250 ? 31.301  14.948  72.691  1.00 13.70  ? 270  ILE C C   1 
ATOM   10150 O O   . ILE C 1 250 ? 31.357  16.174  72.694  1.00 15.12  ? 270  ILE C O   1 
ATOM   10151 C CB  . ILE C 1 250 ? 31.446  13.658  74.773  1.00 11.19  ? 270  ILE C CB  1 
ATOM   10152 C CG1 . ILE C 1 250 ? 30.658  13.074  75.933  1.00 11.62  ? 270  ILE C CG1 1 
ATOM   10153 C CG2 . ILE C 1 250 ? 32.369  14.739  75.269  1.00 9.49   ? 270  ILE C CG2 1 
ATOM   10154 C CD1 . ILE C 1 250 ? 31.515  12.335  76.912  1.00 12.77  ? 270  ILE C CD1 1 
ATOM   10155 N N   . THR C 1 251 ? 31.947  14.196  71.805  1.00 12.81  ? 271  THR C N   1 
ATOM   10156 C CA  . THR C 1 251 ? 32.761  14.804  70.761  1.00 13.77  ? 271  THR C CA  1 
ATOM   10157 C C   . THR C 1 251 ? 31.931  15.730  69.889  1.00 13.67  ? 271  THR C C   1 
ATOM   10158 O O   . THR C 1 251 ? 32.420  16.755  69.420  1.00 14.25  ? 271  THR C O   1 
ATOM   10159 C CB  . THR C 1 251 ? 33.421  13.739  69.878  1.00 14.87  ? 271  THR C CB  1 
ATOM   10160 O OG1 . THR C 1 251 ? 34.313  12.961  70.680  1.00 19.34  ? 271  THR C OG1 1 
ATOM   10161 C CG2 . THR C 1 251 ? 34.209  14.381  68.749  1.00 12.00  ? 271  THR C CG2 1 
ATOM   10162 N N   . ALA C 1 252 ? 30.674  15.365  69.667  1.00 13.58  ? 272  ALA C N   1 
ATOM   10163 C CA  . ALA C 1 252 ? 29.779  16.182  68.864  1.00 12.72  ? 272  ALA C CA  1 
ATOM   10164 C C   . ALA C 1 252 ? 29.273  17.296  69.755  1.00 12.99  ? 272  ALA C C   1 
ATOM   10165 O O   . ALA C 1 252 ? 28.586  18.206  69.308  1.00 13.55  ? 272  ALA C O   1 
ATOM   10166 C CB  . ALA C 1 252 ? 28.620  15.354  68.371  1.00 13.06  ? 272  ALA C CB  1 
ATOM   10167 N N   . GLY C 1 253 ? 29.608  17.203  71.034  1.00 14.07  ? 273  GLY C N   1 
ATOM   10168 C CA  . GLY C 1 253 ? 29.182  18.210  71.982  1.00 15.41  ? 273  GLY C CA  1 
ATOM   10169 C C   . GLY C 1 253 ? 27.742  18.049  72.420  1.00 16.12  ? 273  GLY C C   1 
ATOM   10170 O O   . GLY C 1 253 ? 26.938  18.968  72.286  1.00 16.50  ? 273  GLY C O   1 
ATOM   10171 N N   . CYS C 1 254 ? 27.408  16.882  72.949  1.00 16.31  ? 274  CYS C N   1 
ATOM   10172 C CA  . CYS C 1 254 ? 26.051  16.639  73.403  1.00 16.71  ? 274  CYS C CA  1 
ATOM   10173 C C   . CYS C 1 254 ? 26.053  16.064  74.804  1.00 17.76  ? 274  CYS C C   1 
ATOM   10174 O O   . CYS C 1 254 ? 26.973  15.337  75.178  1.00 18.74  ? 274  CYS C O   1 
ATOM   10175 C CB  . CYS C 1 254 ? 25.360  15.655  72.479  1.00 16.25  ? 274  CYS C CB  1 
ATOM   10176 S SG  . CYS C 1 254 ? 24.834  16.296  70.864  1.00 18.62  ? 274  CYS C SG  1 
ATOM   10177 N N   . LYS C 1 255 ? 25.029  16.395  75.585  1.00 19.00  ? 275  LYS C N   1 
ATOM   10178 C CA  . LYS C 1 255 ? 24.912  15.863  76.938  1.00 19.36  ? 275  LYS C CA  1 
ATOM   10179 C C   . LYS C 1 255 ? 24.796  14.352  76.784  1.00 19.06  ? 275  LYS C C   1 
ATOM   10180 O O   . LYS C 1 255 ? 24.422  13.856  75.722  1.00 20.07  ? 275  LYS C O   1 
ATOM   10181 C CB  . LYS C 1 255 ? 23.652  16.404  77.618  1.00 21.99  ? 275  LYS C CB  1 
ATOM   10182 C CG  . LYS C 1 255 ? 23.746  17.858  78.068  1.00 26.31  ? 275  LYS C CG  1 
ATOM   10183 C CD  . LYS C 1 255 ? 22.456  18.656  77.778  1.00 30.50  ? 275  LYS C CD  1 
ATOM   10184 C CE  . LYS C 1 255 ? 21.223  18.142  78.529  1.00 31.12  ? 275  LYS C CE  1 
ATOM   10185 N NZ  . LYS C 1 255 ? 20.021  19.010  78.276  1.00 30.14  ? 275  LYS C NZ  1 
ATOM   10186 N N   . THR C 1 256 ? 25.117  13.607  77.829  1.00 18.41  ? 276  THR C N   1 
ATOM   10187 C CA  . THR C 1 256 ? 25.016  12.159  77.735  1.00 16.91  ? 276  THR C CA  1 
ATOM   10188 C C   . THR C 1 256 ? 24.097  11.648  78.825  1.00 15.19  ? 276  THR C C   1 
ATOM   10189 O O   . THR C 1 256 ? 24.190  10.498  79.226  1.00 16.08  ? 276  THR C O   1 
ATOM   10190 C CB  . THR C 1 256 ? 26.391  11.493  77.894  1.00 17.25  ? 276  THR C CB  1 
ATOM   10191 O OG1 . THR C 1 256 ? 26.908  11.776  79.196  1.00 16.07  ? 276  THR C OG1 1 
ATOM   10192 C CG2 . THR C 1 256 ? 27.360  12.024  76.854  1.00 17.95  ? 276  THR C CG2 1 
ATOM   10193 N N   . THR C 1 257 ? 23.200  12.507  79.290  1.00 13.45  ? 277  THR C N   1 
ATOM   10194 C CA  . THR C 1 257 ? 22.279  12.146  80.353  1.00 13.22  ? 277  THR C CA  1 
ATOM   10195 C C   . THR C 1 257 ? 21.574  10.810  80.117  1.00 13.08  ? 277  THR C C   1 
ATOM   10196 O O   . THR C 1 257 ? 21.573  9.956   81.001  1.00 11.63  ? 277  THR C O   1 
ATOM   10197 C CB  . THR C 1 257 ? 21.240  13.255  80.568  1.00 14.33  ? 277  THR C CB  1 
ATOM   10198 O OG1 . THR C 1 257 ? 21.904  14.528  80.575  1.00 13.81  ? 277  THR C OG1 1 
ATOM   10199 C CG2 . THR C 1 257 ? 20.533  13.064  81.904  1.00 12.78  ? 277  THR C CG2 1 
ATOM   10200 N N   . THR C 1 258 ? 20.977  10.629  78.938  1.00 13.90  ? 278  THR C N   1 
ATOM   10201 C CA  . THR C 1 258 ? 20.287  9.369   78.596  1.00 13.49  ? 278  THR C CA  1 
ATOM   10202 C C   . THR C 1 258 ? 20.370  9.128   77.093  1.00 12.78  ? 278  THR C C   1 
ATOM   10203 O O   . THR C 1 258 ? 20.604  10.058  76.333  1.00 13.86  ? 278  THR C O   1 
ATOM   10204 C CB  . THR C 1 258 ? 18.775  9.393   78.923  1.00 14.17  ? 278  THR C CB  1 
ATOM   10205 O OG1 . THR C 1 258 ? 18.075  10.046  77.850  1.00 11.85  ? 278  THR C OG1 1 
ATOM   10206 C CG2 . THR C 1 258 ? 18.499  10.118  80.250  1.00 12.20  ? 278  THR C CG2 1 
ATOM   10207 N N   . SER C 1 259 ? 20.159  7.887   76.669  1.00 12.55  ? 279  SER C N   1 
ATOM   10208 C CA  . SER C 1 259 ? 20.191  7.551   75.246  1.00 12.63  ? 279  SER C CA  1 
ATOM   10209 C C   . SER C 1 259 ? 19.293  8.484   74.430  1.00 12.34  ? 279  SER C C   1 
ATOM   10210 O O   . SER C 1 259 ? 19.736  9.098   73.457  1.00 12.59  ? 279  SER C O   1 
ATOM   10211 C CB  . SER C 1 259 ? 19.731  6.112   75.036  1.00 11.26  ? 279  SER C CB  1 
ATOM   10212 O OG  . SER C 1 259 ? 20.599  5.226   75.701  1.00 13.39  ? 279  SER C OG  1 
ATOM   10213 N N   . ALA C 1 260 ? 18.029  8.575   74.834  1.00 11.65  ? 280  ALA C N   1 
ATOM   10214 C CA  . ALA C 1 260 ? 17.057  9.424   74.168  1.00 10.14  ? 280  ALA C CA  1 
ATOM   10215 C C   . ALA C 1 260 ? 17.578  10.855  74.094  1.00 10.57  ? 280  ALA C C   1 
ATOM   10216 O O   . ALA C 1 260 ? 17.369  11.548  73.101  1.00 11.85  ? 280  ALA C O   1 
ATOM   10217 C CB  . ALA C 1 260 ? 15.740  9.385   74.916  1.00 9.04   ? 280  ALA C CB  1 
ATOM   10218 N N   . VAL C 1 261 ? 18.248  11.305  75.148  1.00 10.80  ? 281  VAL C N   1 
ATOM   10219 C CA  . VAL C 1 261 ? 18.814  12.652  75.159  1.00 10.89  ? 281  VAL C CA  1 
ATOM   10220 C C   . VAL C 1 261 ? 19.888  12.763  74.070  1.00 10.68  ? 281  VAL C C   1 
ATOM   10221 O O   . VAL C 1 261 ? 19.887  13.699  73.269  1.00 10.45  ? 281  VAL C O   1 
ATOM   10222 C CB  . VAL C 1 261 ? 19.447  12.982  76.533  1.00 10.41  ? 281  VAL C CB  1 
ATOM   10223 C CG1 . VAL C 1 261 ? 20.300  14.227  76.430  1.00 8.33   ? 281  VAL C CG1 1 
ATOM   10224 C CG2 . VAL C 1 261 ? 18.351  13.185  77.568  1.00 10.84  ? 281  VAL C CG2 1 
ATOM   10225 N N   . MET C 1 262 ? 20.800  11.796  74.045  1.00 10.37  ? 282  MET C N   1 
ATOM   10226 C CA  . MET C 1 262 ? 21.861  11.779  73.053  1.00 9.99   ? 282  MET C CA  1 
ATOM   10227 C C   . MET C 1 262 ? 21.283  11.784  71.640  1.00 9.85   ? 282  MET C C   1 
ATOM   10228 O O   . MET C 1 262 ? 21.569  12.682  70.841  1.00 10.78  ? 282  MET C O   1 
ATOM   10229 C CB  . MET C 1 262 ? 22.745  10.546  73.241  1.00 8.96   ? 282  MET C CB  1 
ATOM   10230 C CG  . MET C 1 262 ? 23.530  10.536  74.545  1.00 10.09  ? 282  MET C CG  1 
ATOM   10231 S SD  . MET C 1 262 ? 24.930  9.374   74.531  1.00 9.58   ? 282  MET C SD  1 
ATOM   10232 C CE  . MET C 1 262 ? 24.108  7.848   74.995  1.00 13.07  ? 282  MET C CE  1 
ATOM   10233 N N   . VAL C 1 263 ? 20.464  10.783  71.342  1.00 9.23   ? 283  VAL C N   1 
ATOM   10234 C CA  . VAL C 1 263 ? 19.855  10.657  70.022  1.00 8.24   ? 283  VAL C CA  1 
ATOM   10235 C C   . VAL C 1 263 ? 19.181  11.955  69.579  1.00 8.91   ? 283  VAL C C   1 
ATOM   10236 O O   . VAL C 1 263 ? 19.309  12.373  68.418  1.00 6.26   ? 283  VAL C O   1 
ATOM   10237 C CB  . VAL C 1 263 ? 18.820  9.495   70.000  1.00 5.50   ? 283  VAL C CB  1 
ATOM   10238 C CG1 . VAL C 1 263 ? 18.208  9.353   68.632  1.00 4.83   ? 283  VAL C CG1 1 
ATOM   10239 C CG2 . VAL C 1 263 ? 19.495  8.208   70.373  1.00 6.96   ? 283  VAL C CG2 1 
ATOM   10240 N N   . HIS C 1 264 ? 18.476  12.593  70.512  1.00 9.83   ? 284  HIS C N   1 
ATOM   10241 C CA  . HIS C 1 264 ? 17.767  13.830  70.221  1.00 10.86  ? 284  HIS C CA  1 
ATOM   10242 C C   . HIS C 1 264 ? 18.701  14.986  69.898  1.00 10.98  ? 284  HIS C C   1 
ATOM   10243 O O   . HIS C 1 264 ? 18.386  15.819  69.053  1.00 9.92   ? 284  HIS C O   1 
ATOM   10244 C CB  . HIS C 1 264 ? 16.872  14.224  71.394  1.00 13.63  ? 284  HIS C CB  1 
ATOM   10245 C CG  . HIS C 1 264 ? 16.270  15.587  71.253  1.00 16.52  ? 284  HIS C CG  1 
ATOM   10246 N ND1 . HIS C 1 264 ? 15.237  15.860  70.380  1.00 18.72  ? 284  HIS C ND1 1 
ATOM   10247 C CD2 . HIS C 1 264 ? 16.606  16.771  71.817  1.00 17.06  ? 284  HIS C CD2 1 
ATOM   10248 C CE1 . HIS C 1 264 ? 14.966  17.152  70.410  1.00 18.54  ? 284  HIS C CE1 1 
ATOM   10249 N NE2 . HIS C 1 264 ? 15.783  17.728  71.274  1.00 19.56  ? 284  HIS C NE2 1 
ATOM   10250 N N   . CYS C 1 265 ? 19.840  15.041  70.582  1.00 11.95  ? 285  CYS C N   1 
ATOM   10251 C CA  . CYS C 1 265 ? 20.810  16.101  70.350  1.00 13.88  ? 285  CYS C CA  1 
ATOM   10252 C C   . CYS C 1 265 ? 21.512  15.911  69.010  1.00 14.34  ? 285  CYS C C   1 
ATOM   10253 O O   . CYS C 1 265 ? 21.684  16.866  68.243  1.00 15.38  ? 285  CYS C O   1 
ATOM   10254 C CB  . CYS C 1 265 ? 21.842  16.116  71.467  1.00 15.08  ? 285  CYS C CB  1 
ATOM   10255 S SG  . CYS C 1 265 ? 23.167  17.375  71.334  1.00 22.56  ? 285  CYS C SG  1 
ATOM   10256 N N   . LEU C 1 266 ? 21.928  14.684  68.723  1.00 12.53  ? 286  LEU C N   1 
ATOM   10257 C CA  . LEU C 1 266 ? 22.593  14.429  67.461  1.00 11.43  ? 286  LEU C CA  1 
ATOM   10258 C C   . LEU C 1 266 ? 21.663  14.659  66.273  1.00 11.83  ? 286  LEU C C   1 
ATOM   10259 O O   . LEU C 1 266 ? 22.120  15.039  65.198  1.00 11.84  ? 286  LEU C O   1 
ATOM   10260 C CB  . LEU C 1 266 ? 23.165  13.011  67.439  1.00 8.71   ? 286  LEU C CB  1 
ATOM   10261 C CG  . LEU C 1 266 ? 24.429  12.889  68.292  1.00 7.10   ? 286  LEU C CG  1 
ATOM   10262 C CD1 . LEU C 1 266 ? 24.825  11.440  68.448  1.00 6.05   ? 286  LEU C CD1 1 
ATOM   10263 C CD2 . LEU C 1 266 ? 25.549  13.679  67.647  1.00 5.54   ? 286  LEU C CD2 1 
ATOM   10264 N N   . ARG C 1 267 ? 20.361  14.444  66.449  1.00 12.23  ? 287  ARG C N   1 
ATOM   10265 C CA  . ARG C 1 267 ? 19.440  14.664  65.333  1.00 13.06  ? 287  ARG C CA  1 
ATOM   10266 C C   . ARG C 1 267 ? 19.297  16.147  65.048  1.00 13.43  ? 287  ARG C C   1 
ATOM   10267 O O   . ARG C 1 267 ? 18.874  16.543  63.969  1.00 14.07  ? 287  ARG C O   1 
ATOM   10268 C CB  . ARG C 1 267 ? 18.050  14.095  65.617  1.00 12.49  ? 287  ARG C CB  1 
ATOM   10269 C CG  . ARG C 1 267 ? 17.945  12.589  65.567  1.00 11.48  ? 287  ARG C CG  1 
ATOM   10270 C CD  . ARG C 1 267 ? 16.503  12.167  65.271  1.00 11.20  ? 287  ARG C CD  1 
ATOM   10271 N NE  . ARG C 1 267 ? 16.323  10.719  65.339  1.00 10.42  ? 287  ARG C NE  1 
ATOM   10272 C CZ  . ARG C 1 267 ? 15.893  10.068  66.415  1.00 11.01  ? 287  ARG C CZ  1 
ATOM   10273 N NH1 . ARG C 1 267 ? 15.588  10.740  67.518  1.00 8.74   ? 287  ARG C NH1 1 
ATOM   10274 N NH2 . ARG C 1 267 ? 15.792  8.742   66.398  1.00 12.52  ? 287  ARG C NH2 1 
ATOM   10275 N N   . GLN C 1 268 ? 19.662  16.968  66.021  1.00 14.36  ? 288  GLN C N   1 
ATOM   10276 C CA  . GLN C 1 268 ? 19.557  18.408  65.878  1.00 14.13  ? 288  GLN C CA  1 
ATOM   10277 C C   . GLN C 1 268 ? 20.789  19.012  65.230  1.00 13.40  ? 288  GLN C C   1 
ATOM   10278 O O   . GLN C 1 268 ? 20.741  20.153  64.789  1.00 14.54  ? 288  GLN C O   1 
ATOM   10279 C CB  . GLN C 1 268 ? 19.333  19.048  67.246  1.00 16.92  ? 288  GLN C CB  1 
ATOM   10280 C CG  . GLN C 1 268 ? 18.134  18.497  68.005  1.00 22.05  ? 288  GLN C CG  1 
ATOM   10281 C CD  . GLN C 1 268 ? 16.798  19.019  67.492  1.00 25.49  ? 288  GLN C CD  1 
ATOM   10282 O OE1 . GLN C 1 268 ? 16.566  20.227  67.465  1.00 26.72  ? 288  GLN C OE1 1 
ATOM   10283 N NE2 . GLN C 1 268 ? 15.908  18.107  67.095  1.00 27.04  ? 288  GLN C NE2 1 
ATOM   10284 N N   . LYS C 1 269 ? 21.887  18.259  65.174  1.00 12.13  ? 289  LYS C N   1 
ATOM   10285 C CA  . LYS C 1 269 ? 23.126  18.755  64.561  1.00 11.79  ? 289  LYS C CA  1 
ATOM   10286 C C   . LYS C 1 269 ? 23.035  18.784  63.036  1.00 11.59  ? 289  LYS C C   1 
ATOM   10287 O O   . LYS C 1 269 ? 22.328  17.980  62.435  1.00 12.05  ? 289  LYS C O   1 
ATOM   10288 C CB  . LYS C 1 269 ? 24.324  17.884  64.957  1.00 13.00  ? 289  LYS C CB  1 
ATOM   10289 C CG  . LYS C 1 269 ? 24.686  17.882  66.438  1.00 14.66  ? 289  LYS C CG  1 
ATOM   10290 C CD  . LYS C 1 269 ? 25.188  19.238  66.899  1.00 17.03  ? 289  LYS C CD  1 
ATOM   10291 C CE  . LYS C 1 269 ? 25.527  19.234  68.384  1.00 17.00  ? 289  LYS C CE  1 
ATOM   10292 N NZ  . LYS C 1 269 ? 25.960  20.581  68.837  1.00 17.75  ? 289  LYS C NZ  1 
ATOM   10293 N N   . THR C 1 270 ? 23.759  19.709  62.411  1.00 11.22  ? 290  THR C N   1 
ATOM   10294 C CA  . THR C 1 270 ? 23.749  19.814  60.959  1.00 11.51  ? 290  THR C CA  1 
ATOM   10295 C C   . THR C 1 270 ? 24.624  18.717  60.376  1.00 12.19  ? 290  THR C C   1 
ATOM   10296 O O   . THR C 1 270 ? 25.501  18.195  61.057  1.00 11.19  ? 290  THR C O   1 
ATOM   10297 C CB  . THR C 1 270 ? 24.301  21.170  60.473  1.00 10.61  ? 290  THR C CB  1 
ATOM   10298 O OG1 . THR C 1 270 ? 25.728  21.161  60.536  1.00 12.64  ? 290  THR C OG1 1 
ATOM   10299 C CG2 . THR C 1 270 ? 23.794  22.281  61.335  1.00 10.23  ? 290  THR C CG2 1 
ATOM   10300 N N   . GLU C 1 271 ? 24.379  18.367  59.117  1.00 14.10  ? 291  GLU C N   1 
ATOM   10301 C CA  . GLU C 1 271 ? 25.170  17.343  58.448  1.00 17.58  ? 291  GLU C CA  1 
ATOM   10302 C C   . GLU C 1 271 ? 26.649  17.706  58.572  1.00 18.97  ? 291  GLU C C   1 
ATOM   10303 O O   . GLU C 1 271 ? 27.477  16.854  58.901  1.00 20.03  ? 291  GLU C O   1 
ATOM   10304 C CB  . GLU C 1 271 ? 24.785  17.247  56.964  1.00 19.49  ? 291  GLU C CB  1 
ATOM   10305 C CG  . GLU C 1 271 ? 25.702  16.351  56.118  1.00 22.57  ? 291  GLU C CG  1 
ATOM   10306 C CD  . GLU C 1 271 ? 25.381  16.389  54.620  1.00 24.79  ? 291  GLU C CD  1 
ATOM   10307 O OE1 . GLU C 1 271 ? 24.303  15.900  54.221  1.00 26.31  ? 291  GLU C OE1 1 
ATOM   10308 O OE2 . GLU C 1 271 ? 26.208  16.910  53.836  1.00 26.06  ? 291  GLU C OE2 1 
ATOM   10309 N N   . GLU C 1 272 ? 26.970  18.975  58.320  1.00 18.86  ? 292  GLU C N   1 
ATOM   10310 C CA  . GLU C 1 272 ? 28.344  19.451  58.391  1.00 18.72  ? 292  GLU C CA  1 
ATOM   10311 C C   . GLU C 1 272 ? 28.965  19.272  59.768  1.00 18.05  ? 292  GLU C C   1 
ATOM   10312 O O   . GLU C 1 272 ? 30.151  18.935  59.883  1.00 17.43  ? 292  GLU C O   1 
ATOM   10313 C CB  . GLU C 1 272 ? 28.417  20.924  57.999  1.00 22.37  ? 292  GLU C CB  1 
ATOM   10314 C CG  . GLU C 1 272 ? 28.430  21.207  56.503  1.00 26.62  ? 292  GLU C CG  1 
ATOM   10315 C CD  . GLU C 1 272 ? 27.133  20.831  55.812  1.00 31.43  ? 292  GLU C CD  1 
ATOM   10316 O OE1 . GLU C 1 272 ? 26.042  21.155  56.348  1.00 31.16  ? 292  GLU C OE1 1 
ATOM   10317 O OE2 . GLU C 1 272 ? 27.218  20.220  54.720  1.00 33.57  ? 292  GLU C OE2 1 
ATOM   10318 N N   . GLU C 1 273 ? 28.175  19.507  60.813  1.00 17.21  ? 293  GLU C N   1 
ATOM   10319 C CA  . GLU C 1 273 ? 28.679  19.361  62.175  1.00 16.79  ? 293  GLU C CA  1 
ATOM   10320 C C   . GLU C 1 273 ? 29.041  17.899  62.465  1.00 15.18  ? 293  GLU C C   1 
ATOM   10321 O O   . GLU C 1 273 ? 30.096  17.613  63.044  1.00 13.77  ? 293  GLU C O   1 
ATOM   10322 C CB  . GLU C 1 273 ? 27.643  19.844  63.188  1.00 17.65  ? 293  GLU C CB  1 
ATOM   10323 C CG  . GLU C 1 273 ? 27.178  21.263  62.993  1.00 20.92  ? 293  GLU C CG  1 
ATOM   10324 C CD  . GLU C 1 273 ? 26.279  21.734  64.124  1.00 24.07  ? 293  GLU C CD  1 
ATOM   10325 O OE1 . GLU C 1 273 ? 26.793  21.968  65.236  1.00 24.86  ? 293  GLU C OE1 1 
ATOM   10326 O OE2 . GLU C 1 273 ? 25.054  21.863  63.908  1.00 26.88  ? 293  GLU C OE2 1 
ATOM   10327 N N   . LEU C 1 274 ? 28.164  16.980  62.059  1.00 13.52  ? 294  LEU C N   1 
ATOM   10328 C CA  . LEU C 1 274 ? 28.404  15.559  62.271  1.00 12.90  ? 294  LEU C CA  1 
ATOM   10329 C C   . LEU C 1 274 ? 29.614  15.063  61.466  1.00 12.84  ? 294  LEU C C   1 
ATOM   10330 O O   . LEU C 1 274 ? 30.246  14.068  61.837  1.00 13.99  ? 294  LEU C O   1 
ATOM   10331 C CB  . LEU C 1 274 ? 27.156  14.746  61.915  1.00 11.83  ? 294  LEU C CB  1 
ATOM   10332 C CG  . LEU C 1 274 ? 25.944  14.911  62.845  1.00 12.24  ? 294  LEU C CG  1 
ATOM   10333 C CD1 . LEU C 1 274 ? 24.867  13.904  62.456  1.00 12.20  ? 294  LEU C CD1 1 
ATOM   10334 C CD2 . LEU C 1 274 ? 26.351  14.693  64.296  1.00 9.71   ? 294  LEU C CD2 1 
ATOM   10335 N N   . LEU C 1 275 ? 29.947  15.756  60.376  1.00 10.10  ? 295  LEU C N   1 
ATOM   10336 C CA  . LEU C 1 275 ? 31.095  15.371  59.570  1.00 6.67   ? 295  LEU C CA  1 
ATOM   10337 C C   . LEU C 1 275 ? 32.353  15.847  60.290  1.00 7.21   ? 295  LEU C C   1 
ATOM   10338 O O   . LEU C 1 275 ? 33.363  15.136  60.336  1.00 3.44   ? 295  LEU C O   1 
ATOM   10339 C CB  . LEU C 1 275 ? 30.994  15.977  58.163  1.00 4.54   ? 295  LEU C CB  1 
ATOM   10340 C CG  . LEU C 1 275 ? 32.089  15.673  57.122  1.00 3.42   ? 295  LEU C CG  1 
ATOM   10341 C CD1 . LEU C 1 275 ? 32.524  14.237  57.248  1.00 3.90   ? 295  LEU C CD1 1 
ATOM   10342 C CD2 . LEU C 1 275 ? 31.588  15.956  55.709  1.00 1.44   ? 295  LEU C CD2 1 
ATOM   10343 N N   . GLU C 1 276 ? 32.293  17.050  60.864  1.00 9.38   ? 296  GLU C N   1 
ATOM   10344 C CA  . GLU C 1 276 ? 33.444  17.569  61.601  1.00 11.07  ? 296  GLU C CA  1 
ATOM   10345 C C   . GLU C 1 276 ? 33.703  16.636  62.783  1.00 11.34  ? 296  GLU C C   1 
ATOM   10346 O O   . GLU C 1 276 ? 34.851  16.318  63.090  1.00 10.30  ? 296  GLU C O   1 
ATOM   10347 C CB  . GLU C 1 276 ? 33.196  18.992  62.105  1.00 10.83  ? 296  GLU C CB  1 
ATOM   10348 C CG  . GLU C 1 276 ? 33.218  20.048  61.024  1.00 13.09  ? 296  GLU C CG  1 
ATOM   10349 C CD  . GLU C 1 276 ? 33.572  21.434  61.560  1.00 15.58  ? 296  GLU C CD  1 
ATOM   10350 O OE1 . GLU C 1 276 ? 33.611  22.395  60.757  1.00 15.81  ? 296  GLU C OE1 1 
ATOM   10351 O OE2 . GLU C 1 276 ? 33.816  21.565  62.780  1.00 16.26  ? 296  GLU C OE2 1 
ATOM   10352 N N   . THR C 1 277 ? 32.628  16.202  63.442  1.00 10.71  ? 297  THR C N   1 
ATOM   10353 C CA  . THR C 1 277 ? 32.749  15.269  64.553  1.00 9.98   ? 297  THR C CA  1 
ATOM   10354 C C   . THR C 1 277 ? 33.425  14.017  63.993  1.00 9.04   ? 297  THR C C   1 
ATOM   10355 O O   . THR C 1 277 ? 34.296  13.430  64.634  1.00 7.20   ? 297  THR C O   1 
ATOM   10356 C CB  . THR C 1 277 ? 31.365  14.872  65.128  1.00 10.38  ? 297  THR C CB  1 
ATOM   10357 O OG1 . THR C 1 277 ? 30.750  16.005  65.746  1.00 12.12  ? 297  THR C OG1 1 
ATOM   10358 C CG2 . THR C 1 277 ? 31.515  13.797  66.172  1.00 11.33  ? 297  THR C CG2 1 
ATOM   10359 N N   . THR C 1 278 ? 33.031  13.622  62.783  1.00 9.09   ? 298  THR C N   1 
ATOM   10360 C CA  . THR C 1 278 ? 33.612  12.443  62.145  1.00 8.90   ? 298  THR C CA  1 
ATOM   10361 C C   . THR C 1 278 ? 35.101  12.597  61.871  1.00 10.84  ? 298  THR C C   1 
ATOM   10362 O O   . THR C 1 278 ? 35.835  11.613  61.897  1.00 12.69  ? 298  THR C O   1 
ATOM   10363 C CB  . THR C 1 278 ? 32.938  12.109  60.802  1.00 6.40   ? 298  THR C CB  1 
ATOM   10364 O OG1 . THR C 1 278 ? 31.542  11.877  61.006  1.00 6.80   ? 298  THR C OG1 1 
ATOM   10365 C CG2 . THR C 1 278 ? 33.551  10.858  60.201  1.00 4.31   ? 298  THR C CG2 1 
ATOM   10366 N N   . LEU C 1 279 ? 35.557  13.816  61.594  1.00 12.06  ? 299  LEU C N   1 
ATOM   10367 C CA  . LEU C 1 279 ? 36.979  14.015  61.317  1.00 11.89  ? 299  LEU C CA  1 
ATOM   10368 C C   . LEU C 1 279 ? 37.766  14.035  62.618  1.00 13.13  ? 299  LEU C C   1 
ATOM   10369 O O   . LEU C 1 279 ? 38.875  13.516  62.698  1.00 13.06  ? 299  LEU C O   1 
ATOM   10370 C CB  . LEU C 1 279 ? 37.211  15.314  60.534  1.00 8.92   ? 299  LEU C CB  1 
ATOM   10371 C CG  . LEU C 1 279 ? 36.633  15.419  59.112  1.00 7.39   ? 299  LEU C CG  1 
ATOM   10372 C CD1 . LEU C 1 279 ? 37.111  16.721  58.471  1.00 5.26   ? 299  LEU C CD1 1 
ATOM   10373 C CD2 . LEU C 1 279 ? 37.054  14.230  58.262  1.00 2.35   ? 299  LEU C CD2 1 
ATOM   10374 N N   . LYS C 1 280 ? 37.182  14.634  63.643  1.00 15.94  ? 300  LYS C N   1 
ATOM   10375 C CA  . LYS C 1 280 ? 37.831  14.696  64.935  1.00 17.57  ? 300  LYS C CA  1 
ATOM   10376 C C   . LYS C 1 280 ? 38.074  13.274  65.412  1.00 22.55  ? 300  LYS C C   1 
ATOM   10377 O O   . LYS C 1 280 ? 39.140  12.966  65.939  1.00 25.17  ? 300  LYS C O   1 
ATOM   10378 C CB  . LYS C 1 280 ? 36.943  15.424  65.933  1.00 13.13  ? 300  LYS C CB  1 
ATOM   10379 C CG  . LYS C 1 280 ? 36.648  16.852  65.580  1.00 8.86   ? 300  LYS C CG  1 
ATOM   10380 C CD  . LYS C 1 280 ? 35.721  17.444  66.613  1.00 9.30   ? 300  LYS C CD  1 
ATOM   10381 C CE  . LYS C 1 280 ? 35.661  18.958  66.526  1.00 8.84   ? 300  LYS C CE  1 
ATOM   10382 N NZ  . LYS C 1 280 ? 34.937  19.500  67.706  1.00 8.13   ? 300  LYS C NZ  1 
ATOM   10383 N N   . MET C 1 281 ? 37.084  12.404  65.221  1.00 27.46  ? 301  MET C N   1 
ATOM   10384 C CA  . MET C 1 281 ? 37.211  11.013  65.647  1.00 32.90  ? 301  MET C CA  1 
ATOM   10385 C C   . MET C 1 281 ? 38.512  10.394  65.139  1.00 36.08  ? 301  MET C C   1 
ATOM   10386 O O   . MET C 1 281 ? 39.264  9.825   65.920  1.00 36.54  ? 301  MET C O   1 
ATOM   10387 C CB  . MET C 1 281 ? 36.024  10.178  65.148  1.00 34.86  ? 301  MET C CB  1 
ATOM   10388 C CG  . MET C 1 281 ? 34.630  10.636  65.601  1.00 37.53  ? 301  MET C CG  1 
ATOM   10389 S SD  . MET C 1 281 ? 34.264  10.465  67.366  1.00 39.66  ? 301  MET C SD  1 
ATOM   10390 C CE  . MET C 1 281 ? 33.803  8.769   67.461  1.00 41.27  ? 301  MET C CE  1 
ATOM   10391 N N   . LYS C 1 282 ? 38.773  10.518  63.838  1.00 40.71  ? 302  LYS C N   1 
ATOM   10392 C CA  . LYS C 1 282 ? 39.977  9.963   63.214  1.00 46.74  ? 302  LYS C CA  1 
ATOM   10393 C C   . LYS C 1 282 ? 39.880  8.439   63.159  1.00 52.15  ? 302  LYS C C   1 
ATOM   10394 O O   . LYS C 1 282 ? 40.750  7.728   63.679  1.00 53.33  ? 302  LYS C O   1 
ATOM   10395 C CB  . LYS C 1 282 ? 41.226  10.346  64.005  1.00 46.11  ? 302  LYS C CB  1 
ATOM   10396 C CG  . LYS C 1 282 ? 41.521  11.818  64.080  1.00 46.86  ? 302  LYS C CG  1 
ATOM   10397 C CD  . LYS C 1 282 ? 42.748  12.053  64.948  1.00 48.50  ? 302  LYS C CD  1 
ATOM   10398 C CE  . LYS C 1 282 ? 43.187  13.508  64.904  1.00 51.64  ? 302  LYS C CE  1 
ATOM   10399 N NZ  . LYS C 1 282 ? 44.433  13.754  65.691  1.00 52.13  ? 302  LYS C NZ  1 
ATOM   10400 N N   . PHE C 1 283 ? 38.829  7.942   62.514  1.00 57.30  ? 303  PHE C N   1 
ATOM   10401 C CA  . PHE C 1 283 ? 38.590  6.504   62.407  1.00 62.21  ? 303  PHE C CA  1 
ATOM   10402 C C   . PHE C 1 283 ? 39.563  5.696   61.540  1.00 64.94  ? 303  PHE C C   1 
ATOM   10403 O O   . PHE C 1 283 ? 40.309  4.860   62.055  1.00 65.92  ? 303  PHE C O   1 
ATOM   10404 C CB  . PHE C 1 283 ? 37.162  6.244   61.905  1.00 63.88  ? 303  PHE C CB  1 
ATOM   10405 C CG  . PHE C 1 283 ? 36.080  6.759   62.823  1.00 65.28  ? 303  PHE C CG  1 
ATOM   10406 C CD1 . PHE C 1 283 ? 35.253  7.813   62.423  1.00 64.91  ? 303  PHE C CD1 1 
ATOM   10407 C CD2 . PHE C 1 283 ? 35.861  6.167   64.067  1.00 65.34  ? 303  PHE C CD2 1 
ATOM   10408 C CE1 . PHE C 1 283 ? 34.223  8.267   63.241  1.00 65.03  ? 303  PHE C CE1 1 
ATOM   10409 C CE2 . PHE C 1 283 ? 34.833  6.614   64.898  1.00 65.90  ? 303  PHE C CE2 1 
ATOM   10410 C CZ  . PHE C 1 283 ? 34.010  7.667   64.481  1.00 66.15  ? 303  PHE C CZ  1 
ATOM   10411 N N   . LEU C 1 284 ? 39.545  5.946   60.231  1.00 67.40  ? 304  LEU C N   1 
ATOM   10412 C CA  . LEU C 1 284 ? 40.377  5.216   59.266  1.00 70.18  ? 304  LEU C CA  1 
ATOM   10413 C C   . LEU C 1 284 ? 41.893  5.206   59.502  1.00 71.42  ? 304  LEU C C   1 
ATOM   10414 O O   . LEU C 1 284 ? 42.636  4.591   58.736  1.00 71.13  ? 304  LEU C O   1 
ATOM   10415 C CB  . LEU C 1 284 ? 40.092  5.728   57.844  1.00 71.23  ? 304  LEU C CB  1 
ATOM   10416 C CG  . LEU C 1 284 ? 40.557  4.866   56.659  1.00 72.69  ? 304  LEU C CG  1 
ATOM   10417 C CD1 . LEU C 1 284 ? 39.720  3.592   56.583  1.00 72.92  ? 304  LEU C CD1 1 
ATOM   10418 C CD2 . LEU C 1 284 ? 40.419  5.651   55.366  1.00 72.69  ? 304  LEU C CD2 1 
ATOM   10419 N N   . SER C 1 285 ? 42.358  5.871   60.554  1.00 73.11  ? 305  SER C N   1 
ATOM   10420 C CA  . SER C 1 285 ? 43.789  5.903   60.836  1.00 74.72  ? 305  SER C CA  1 
ATOM   10421 C C   . SER C 1 285 ? 44.143  5.140   62.111  1.00 76.64  ? 305  SER C C   1 
ATOM   10422 O O   . SER C 1 285 ? 43.566  5.395   63.173  1.00 77.26  ? 305  SER C O   1 
ATOM   10423 C CB  . SER C 1 285 ? 44.264  7.352   60.958  1.00 73.71  ? 305  SER C CB  1 
ATOM   10424 O OG  . SER C 1 285 ? 45.648  7.410   61.261  1.00 73.76  ? 305  SER C OG  1 
ATOM   10425 N N   . LEU C 1 286 ? 45.087  4.204   62.002  1.00 78.18  ? 306  LEU C N   1 
ATOM   10426 C CA  . LEU C 1 286 ? 45.530  3.418   63.156  1.00 79.75  ? 306  LEU C CA  1 
ATOM   10427 C C   . LEU C 1 286 ? 46.366  4.294   64.080  1.00 80.75  ? 306  LEU C C   1 
ATOM   10428 O O   . LEU C 1 286 ? 47.329  4.924   63.643  1.00 80.58  ? 306  LEU C O   1 
ATOM   10429 C CB  . LEU C 1 286 ? 46.374  2.215   62.717  1.00 79.73  ? 306  LEU C CB  1 
ATOM   10430 C CG  . LEU C 1 286 ? 46.993  1.393   63.861  1.00 79.50  ? 306  LEU C CG  1 
ATOM   10431 C CD1 . LEU C 1 286 ? 45.893  0.723   64.678  1.00 78.92  ? 306  LEU C CD1 1 
ATOM   10432 C CD2 . LEU C 1 286 ? 47.939  0.351   63.298  1.00 78.76  ? 306  LEU C CD2 1 
ATOM   10433 N N   . ASP C 1 287 ? 46.002  4.324   65.358  1.00 82.20  ? 307  ASP C N   1 
ATOM   10434 C CA  . ASP C 1 287 ? 46.727  5.136   66.324  1.00 84.21  ? 307  ASP C CA  1 
ATOM   10435 C C   . ASP C 1 287 ? 47.899  4.360   66.929  1.00 85.27  ? 307  ASP C C   1 
ATOM   10436 O O   . ASP C 1 287 ? 47.759  3.193   67.303  1.00 85.28  ? 307  ASP C O   1 
ATOM   10437 C CB  . ASP C 1 287 ? 45.780  5.606   67.432  1.00 84.40  ? 307  ASP C CB  1 
ATOM   10438 C CG  . ASP C 1 287 ? 46.185  6.950   68.014  1.00 84.76  ? 307  ASP C CG  1 
ATOM   10439 O OD1 . ASP C 1 287 ? 45.633  7.341   69.061  1.00 85.30  ? 307  ASP C OD1 1 
ATOM   10440 O OD2 . ASP C 1 287 ? 47.050  7.623   67.416  1.00 85.50  ? 307  ASP C OD2 1 
ATOM   10441 N N   . LEU C 1 288 ? 49.052  5.022   67.015  1.00 86.53  ? 308  LEU C N   1 
ATOM   10442 C CA  . LEU C 1 288 ? 50.267  4.428   67.567  1.00 87.28  ? 308  LEU C CA  1 
ATOM   10443 C C   . LEU C 1 288 ? 50.439  4.778   69.051  1.00 88.20  ? 308  LEU C C   1 
ATOM   10444 O O   . LEU C 1 288 ? 50.829  3.925   69.852  1.00 88.09  ? 308  LEU C O   1 
ATOM   10445 C CB  . LEU C 1 288 ? 51.496  4.918   66.790  1.00 86.94  ? 308  LEU C CB  1 
ATOM   10446 C CG  . LEU C 1 288 ? 51.507  4.773   65.265  1.00 86.73  ? 308  LEU C CG  1 
ATOM   10447 C CD1 . LEU C 1 288 ? 52.802  5.355   64.711  1.00 86.24  ? 308  LEU C CD1 1 
ATOM   10448 C CD2 . LEU C 1 288 ? 51.367  3.311   64.878  1.00 86.70  ? 308  LEU C CD2 1 
ATOM   10449 N N   . GLN C 1 289 ? 50.150  6.033   69.405  1.00 88.96  ? 309  GLN C N   1 
ATOM   10450 C CA  . GLN C 1 289 ? 50.277  6.508   70.788  1.00 89.01  ? 309  GLN C CA  1 
ATOM   10451 C C   . GLN C 1 289 ? 49.039  6.148   71.611  1.00 88.78  ? 309  GLN C C   1 
ATOM   10452 O O   . GLN C 1 289 ? 47.920  6.138   71.094  1.00 87.91  ? 309  GLN C O   1 
ATOM   10453 C CB  . GLN C 1 289 ? 50.470  8.036   70.834  1.00 89.11  ? 309  GLN C CB  1 
ATOM   10454 C CG  . GLN C 1 289 ? 50.777  8.720   69.496  1.00 89.60  ? 309  GLN C CG  1 
ATOM   10455 C CD  . GLN C 1 289 ? 52.256  8.734   69.137  1.00 89.81  ? 309  GLN C CD  1 
ATOM   10456 O OE1 . GLN C 1 289 ? 52.890  7.685   69.011  1.00 90.33  ? 309  GLN C OE1 1 
ATOM   10457 N NE2 . GLN C 1 289 ? 52.810  9.932   68.962  1.00 89.18  ? 309  GLN C NE2 1 
ATOM   10458 N N   . GLY C 1 290 ? 49.250  5.860   72.893  1.00 89.07  ? 310  GLY C N   1 
ATOM   10459 C CA  . GLY C 1 290 ? 48.146  5.505   73.768  1.00 89.40  ? 310  GLY C CA  1 
ATOM   10460 C C   . GLY C 1 290 ? 48.023  4.010   74.006  1.00 89.56  ? 310  GLY C C   1 
ATOM   10461 O O   . GLY C 1 290 ? 48.862  3.229   73.555  1.00 89.72  ? 310  GLY C O   1 
ATOM   10462 N N   . ASP C 1 291 ? 46.975  3.614   74.723  1.00 89.52  ? 311  ASP C N   1 
ATOM   10463 C CA  . ASP C 1 291 ? 46.722  2.205   75.026  1.00 89.02  ? 311  ASP C CA  1 
ATOM   10464 C C   . ASP C 1 291 ? 46.093  1.558   73.790  1.00 88.67  ? 311  ASP C C   1 
ATOM   10465 O O   . ASP C 1 291 ? 45.118  2.072   73.243  1.00 89.10  ? 311  ASP C O   1 
ATOM   10466 C CB  . ASP C 1 291 ? 45.769  2.089   76.225  1.00 88.20  ? 311  ASP C CB  1 
ATOM   10467 C CG  . ASP C 1 291 ? 45.664  0.671   76.763  1.00 87.69  ? 311  ASP C CG  1 
ATOM   10468 O OD1 . ASP C 1 291 ? 45.261  -0.236  76.005  1.00 87.09  ? 311  ASP C OD1 1 
ATOM   10469 O OD2 . ASP C 1 291 ? 45.982  0.464   77.952  1.00 87.39  ? 311  ASP C OD2 1 
ATOM   10470 N N   . PRO C 1 292 ? 46.652  0.424   73.332  1.00 87.87  ? 312  PRO C N   1 
ATOM   10471 C CA  . PRO C 1 292 ? 46.170  -0.316  72.158  1.00 87.03  ? 312  PRO C CA  1 
ATOM   10472 C C   . PRO C 1 292 ? 44.676  -0.642  72.198  1.00 86.61  ? 312  PRO C C   1 
ATOM   10473 O O   . PRO C 1 292 ? 43.964  -0.472  71.205  1.00 85.41  ? 312  PRO C O   1 
ATOM   10474 C CB  . PRO C 1 292 ? 47.031  -1.573  72.175  1.00 87.06  ? 312  PRO C CB  1 
ATOM   10475 C CG  . PRO C 1 292 ? 48.313  -1.077  72.749  1.00 87.53  ? 312  PRO C CG  1 
ATOM   10476 C CD  . PRO C 1 292 ? 47.840  -0.233  73.902  1.00 87.55  ? 312  PRO C CD  1 
ATOM   10477 N N   . ARG C 1 293 ? 44.214  -1.117  73.351  1.00 86.49  ? 313  ARG C N   1 
ATOM   10478 C CA  . ARG C 1 293 ? 42.814  -1.476  73.539  1.00 86.19  ? 313  ARG C CA  1 
ATOM   10479 C C   . ARG C 1 293 ? 41.912  -0.245  73.605  1.00 86.63  ? 313  ARG C C   1 
ATOM   10480 O O   . ARG C 1 293 ? 40.848  -0.214  72.984  1.00 86.63  ? 313  ARG C O   1 
ATOM   10481 C CB  . ARG C 1 293 ? 42.665  -2.320  74.809  1.00 85.18  ? 313  ARG C CB  1 
ATOM   10482 C CG  . ARG C 1 293 ? 43.252  -3.721  74.681  1.00 84.26  ? 313  ARG C CG  1 
ATOM   10483 C CD  . ARG C 1 293 ? 43.450  -4.382  76.036  1.00 84.33  ? 313  ARG C CD  1 
ATOM   10484 N NE  . ARG C 1 293 ? 44.444  -3.669  76.834  1.00 84.73  ? 313  ARG C NE  1 
ATOM   10485 C CZ  . ARG C 1 293 ? 44.890  -4.067  78.022  1.00 84.29  ? 313  ARG C CZ  1 
ATOM   10486 N NH1 . ARG C 1 293 ? 44.436  -5.185  78.573  1.00 83.54  ? 313  ARG C NH1 1 
ATOM   10487 N NH2 . ARG C 1 293 ? 45.797  -3.343  78.661  1.00 85.06  ? 313  ARG C NH2 1 
ATOM   10488 N N   . GLU C 1 294 ? 42.335  0.770   74.353  1.00 87.27  ? 314  GLU C N   1 
ATOM   10489 C CA  . GLU C 1 294 ? 41.548  1.993   74.473  1.00 87.96  ? 314  GLU C CA  1 
ATOM   10490 C C   . GLU C 1 294 ? 41.415  2.700   73.125  1.00 87.70  ? 314  GLU C C   1 
ATOM   10491 O O   . GLU C 1 294 ? 40.412  3.364   72.861  1.00 87.36  ? 314  GLU C O   1 
ATOM   10492 C CB  . GLU C 1 294 ? 42.174  2.947   75.502  1.00 88.80  ? 314  GLU C CB  1 
ATOM   10493 C CG  . GLU C 1 294 ? 42.021  2.493   76.953  1.00 89.68  ? 314  GLU C CG  1 
ATOM   10494 C CD  . GLU C 1 294 ? 42.407  3.572   77.955  1.00 90.20  ? 314  GLU C CD  1 
ATOM   10495 O OE1 . GLU C 1 294 ? 43.585  3.994   77.964  1.00 90.68  ? 314  GLU C OE1 1 
ATOM   10496 O OE2 . GLU C 1 294 ? 41.529  4.000   78.736  1.00 89.73  ? 314  GLU C OE2 1 
ATOM   10497 N N   . SER C 1 295 ? 42.431  2.555   72.276  1.00 87.44  ? 315  SER C N   1 
ATOM   10498 C CA  . SER C 1 295 ? 42.418  3.174   70.953  1.00 86.57  ? 315  SER C CA  1 
ATOM   10499 C C   . SER C 1 295 ? 41.199  2.697   70.179  1.00 85.60  ? 315  SER C C   1 
ATOM   10500 O O   . SER C 1 295 ? 41.270  1.748   69.401  1.00 85.48  ? 315  SER C O   1 
ATOM   10501 C CB  . SER C 1 295 ? 43.691  2.818   70.174  1.00 87.14  ? 315  SER C CB  1 
ATOM   10502 O OG  . SER C 1 295 ? 44.840  3.402   70.766  1.00 88.32  ? 315  SER C OG  1 
ATOM   10503 N N   . GLN C 1 296 ? 40.078  3.370   70.410  1.00 84.82  ? 316  GLN C N   1 
ATOM   10504 C CA  . GLN C 1 296 ? 38.817  3.058   69.763  1.00 84.07  ? 316  GLN C CA  1 
ATOM   10505 C C   . GLN C 1 296 ? 38.914  2.575   68.318  1.00 82.44  ? 316  GLN C C   1 
ATOM   10506 O O   . GLN C 1 296 ? 39.538  3.226   67.472  1.00 83.32  ? 316  GLN C O   1 
ATOM   10507 C CB  . GLN C 1 296 ? 37.897  4.282   69.788  1.00 85.22  ? 316  GLN C CB  1 
ATOM   10508 C CG  . GLN C 1 296 ? 37.430  4.721   71.167  1.00 86.21  ? 316  GLN C CG  1 
ATOM   10509 C CD  . GLN C 1 296 ? 36.447  3.747   71.797  1.00 86.62  ? 316  GLN C CD  1 
ATOM   10510 O OE1 . GLN C 1 296 ? 35.840  4.043   72.827  1.00 86.78  ? 316  GLN C OE1 1 
ATOM   10511 N NE2 . GLN C 1 296 ? 36.291  2.577   71.183  1.00 86.44  ? 316  GLN C NE2 1 
ATOM   10512 N N   . PRO C 1 297 ? 38.319  1.417   68.029  1.00 80.31  ? 317  PRO C N   1 
ATOM   10513 C CA  . PRO C 1 297 ? 38.293  0.801   66.696  1.00 77.84  ? 317  PRO C CA  1 
ATOM   10514 C C   . PRO C 1 297 ? 37.461  1.639   65.698  1.00 74.32  ? 317  PRO C C   1 
ATOM   10515 O O   . PRO C 1 297 ? 38.005  2.427   64.918  1.00 74.09  ? 317  PRO C O   1 
ATOM   10516 C CB  . PRO C 1 297 ? 37.669  -0.562  66.971  1.00 78.91  ? 317  PRO C CB  1 
ATOM   10517 C CG  . PRO C 1 297 ? 38.337  -0.919  68.225  1.00 79.71  ? 317  PRO C CG  1 
ATOM   10518 C CD  . PRO C 1 297 ? 38.153  0.359   69.063  1.00 80.25  ? 317  PRO C CD  1 
ATOM   10519 N N   . LEU C 1 298 ? 36.150  1.454   65.744  1.00 69.69  ? 318  LEU C N   1 
ATOM   10520 C CA  . LEU C 1 298 ? 35.209  2.174   64.883  1.00 64.35  ? 318  LEU C CA  1 
ATOM   10521 C C   . LEU C 1 298 ? 33.823  2.090   65.516  1.00 59.25  ? 318  LEU C C   1 
ATOM   10522 O O   . LEU C 1 298 ? 33.648  2.244   66.728  1.00 58.24  ? 318  LEU C O   1 
ATOM   10523 C CB  . LEU C 1 298 ? 35.129  1.529   63.484  1.00 65.70  ? 318  LEU C CB  1 
ATOM   10524 C CG  . LEU C 1 298 ? 36.336  1.286   62.565  1.00 65.65  ? 318  LEU C CG  1 
ATOM   10525 C CD1 . LEU C 1 298 ? 35.875  0.467   61.361  1.00 64.79  ? 318  LEU C CD1 1 
ATOM   10526 C CD2 . LEU C 1 298 ? 36.948  2.604   62.103  1.00 66.12  ? 318  LEU C CD2 1 
ATOM   10527 N N   . LEU C 1 299 ? 32.845  1.854   64.659  1.00 52.00  ? 319  LEU C N   1 
ATOM   10528 C CA  . LEU C 1 299 ? 31.458  1.680   65.054  1.00 44.37  ? 319  LEU C CA  1 
ATOM   10529 C C   . LEU C 1 299 ? 30.867  1.115   63.787  1.00 40.68  ? 319  LEU C C   1 
ATOM   10530 O O   . LEU C 1 299 ? 31.093  1.656   62.704  1.00 41.16  ? 319  LEU C O   1 
ATOM   10531 C CB  . LEU C 1 299 ? 30.784  3.010   65.414  1.00 41.73  ? 319  LEU C CB  1 
ATOM   10532 C CG  . LEU C 1 299 ? 30.374  3.955   64.286  1.00 38.32  ? 319  LEU C CG  1 
ATOM   10533 C CD1 . LEU C 1 299 ? 29.559  5.113   64.829  1.00 36.66  ? 319  LEU C CD1 1 
ATOM   10534 C CD2 . LEU C 1 299 ? 31.616  4.453   63.590  1.00 39.58  ? 319  LEU C CD2 1 
ATOM   10535 N N   . GLY C 1 300 ? 30.133  0.019   63.912  1.00 35.21  ? 320  GLY C N   1 
ATOM   10536 C CA  . GLY C 1 300 ? 29.553  -0.580  62.733  1.00 29.05  ? 320  GLY C CA  1 
ATOM   10537 C C   . GLY C 1 300 ? 28.360  -1.469  62.981  1.00 25.07  ? 320  GLY C C   1 
ATOM   10538 O O   . GLY C 1 300 ? 27.341  -1.029  63.507  1.00 23.79  ? 320  GLY C O   1 
ATOM   10539 N N   . THR C 1 301 ? 28.491  -2.729  62.584  1.00 22.15  ? 321  THR C N   1 
ATOM   10540 C CA  . THR C 1 301 ? 27.425  -3.703  62.746  1.00 18.64  ? 321  THR C CA  1 
ATOM   10541 C C   . THR C 1 301 ? 27.294  -4.045  64.216  1.00 17.29  ? 321  THR C C   1 
ATOM   10542 O O   . THR C 1 301 ? 28.288  -4.310  64.891  1.00 17.30  ? 321  THR C O   1 
ATOM   10543 C CB  . THR C 1 301 ? 27.730  -4.995  61.953  1.00 16.48  ? 321  THR C CB  1 
ATOM   10544 O OG1 . THR C 1 301 ? 28.020  -4.656  60.595  1.00 16.62  ? 321  THR C OG1 1 
ATOM   10545 C CG2 . THR C 1 301 ? 26.547  -5.938  61.974  1.00 13.95  ? 321  THR C CG2 1 
ATOM   10546 N N   . VAL C 1 302 ? 26.065  -4.013  64.715  1.00 14.94  ? 322  VAL C N   1 
ATOM   10547 C CA  . VAL C 1 302 ? 25.809  -4.358  66.102  1.00 12.18  ? 322  VAL C CA  1 
ATOM   10548 C C   . VAL C 1 302 ? 24.699  -5.381  66.064  1.00 11.75  ? 322  VAL C C   1 
ATOM   10549 O O   . VAL C 1 302 ? 24.129  -5.642  65.001  1.00 9.68   ? 322  VAL C O   1 
ATOM   10550 C CB  . VAL C 1 302 ? 25.361  -3.135  66.946  1.00 10.02  ? 322  VAL C CB  1 
ATOM   10551 C CG1 . VAL C 1 302 ? 26.474  -2.117  67.008  1.00 8.65   ? 322  VAL C CG1 1 
ATOM   10552 C CG2 . VAL C 1 302 ? 24.112  -2.515  66.352  1.00 10.40  ? 322  VAL C CG2 1 
ATOM   10553 N N   . ILE C 1 303 ? 24.408  -5.972  67.216  1.00 12.39  ? 323  ILE C N   1 
ATOM   10554 C CA  . ILE C 1 303 ? 23.348  -6.963  67.318  1.00 12.52  ? 323  ILE C CA  1 
ATOM   10555 C C   . ILE C 1 303 ? 22.132  -6.180  67.781  1.00 13.10  ? 323  ILE C C   1 
ATOM   10556 O O   . ILE C 1 303 ? 21.942  -5.970  68.968  1.00 14.62  ? 323  ILE C O   1 
ATOM   10557 C CB  . ILE C 1 303 ? 23.715  -8.028  68.355  1.00 10.32  ? 323  ILE C CB  1 
ATOM   10558 C CG1 . ILE C 1 303 ? 25.202  -8.376  68.227  1.00 8.33   ? 323  ILE C CG1 1 
ATOM   10559 C CG2 . ILE C 1 303 ? 22.841  -9.251  68.168  1.00 9.58   ? 323  ILE C CG2 1 
ATOM   10560 C CD1 . ILE C 1 303 ? 25.641  -8.796  66.825  1.00 7.06   ? 323  ILE C CD1 1 
ATOM   10561 N N   . ASP C 1 304 ? 21.307  -5.741  66.844  1.00 15.19  ? 324  ASP C N   1 
ATOM   10562 C CA  . ASP C 1 304 ? 20.158  -4.929  67.211  1.00 18.32  ? 324  ASP C CA  1 
ATOM   10563 C C   . ASP C 1 304 ? 18.916  -5.654  67.699  1.00 19.61  ? 324  ASP C C   1 
ATOM   10564 O O   . ASP C 1 304 ? 18.139  -5.089  68.467  1.00 20.68  ? 324  ASP C O   1 
ATOM   10565 C CB  . ASP C 1 304 ? 19.773  -3.994  66.052  1.00 18.90  ? 324  ASP C CB  1 
ATOM   10566 C CG  . ASP C 1 304 ? 19.427  -4.740  64.772  1.00 19.03  ? 324  ASP C CG  1 
ATOM   10567 O OD1 . ASP C 1 304 ? 18.723  -4.133  63.937  1.00 18.39  ? 324  ASP C OD1 1 
ATOM   10568 O OD2 . ASP C 1 304 ? 19.858  -5.907  64.595  1.00 16.92  ? 324  ASP C OD2 1 
ATOM   10569 N N   . GLY C 1 305 ? 18.723  -6.893  67.265  1.00 20.35  ? 325  GLY C N   1 
ATOM   10570 C CA  . GLY C 1 305 ? 17.540  -7.627  67.673  1.00 20.93  ? 325  GLY C CA  1 
ATOM   10571 C C   . GLY C 1 305 ? 16.459  -7.537  66.609  1.00 22.16  ? 325  GLY C C   1 
ATOM   10572 O O   . GLY C 1 305 ? 15.315  -7.928  66.838  1.00 22.79  ? 325  GLY C O   1 
ATOM   10573 N N   . MET C 1 306 ? 16.832  -7.018  65.439  1.00 22.98  ? 326  MET C N   1 
ATOM   10574 C CA  . MET C 1 306 ? 15.914  -6.869  64.309  1.00 21.77  ? 326  MET C CA  1 
ATOM   10575 C C   . MET C 1 306 ? 16.540  -7.378  63.014  1.00 20.28  ? 326  MET C C   1 
ATOM   10576 O O   . MET C 1 306 ? 15.880  -8.059  62.234  1.00 19.85  ? 326  MET C O   1 
ATOM   10577 C CB  . MET C 1 306 ? 15.515  -5.408  64.143  1.00 23.04  ? 326  MET C CB  1 
ATOM   10578 C CG  . MET C 1 306 ? 14.873  -4.819  65.380  1.00 26.24  ? 326  MET C CG  1 
ATOM   10579 S SD  . MET C 1 306 ? 13.258  -4.160  65.013  1.00 29.53  ? 326  MET C SD  1 
ATOM   10580 C CE  . MET C 1 306 ? 13.725  -2.697  63.945  1.00 27.96  ? 326  MET C CE  1 
ATOM   10581 N N   . LEU C 1 307 ? 17.805  -7.035  62.781  1.00 19.36  ? 327  LEU C N   1 
ATOM   10582 C CA  . LEU C 1 307 ? 18.510  -7.501  61.591  1.00 16.86  ? 327  LEU C CA  1 
ATOM   10583 C C   . LEU C 1 307 ? 19.336  -8.709  62.011  1.00 16.59  ? 327  LEU C C   1 
ATOM   10584 O O   . LEU C 1 307 ? 19.405  -9.697  61.290  1.00 16.56  ? 327  LEU C O   1 
ATOM   10585 C CB  . LEU C 1 307 ? 19.438  -6.424  61.033  1.00 16.18  ? 327  LEU C CB  1 
ATOM   10586 C CG  . LEU C 1 307 ? 20.131  -6.860  59.736  1.00 16.46  ? 327  LEU C CG  1 
ATOM   10587 C CD1 . LEU C 1 307 ? 19.200  -6.671  58.570  1.00 16.38  ? 327  LEU C CD1 1 
ATOM   10588 C CD2 . LEU C 1 307 ? 21.381  -6.058  59.516  1.00 18.24  ? 327  LEU C CD2 1 
ATOM   10589 N N   . LEU C 1 308 ? 19.968  -8.610  63.180  1.00 16.80  ? 328  LEU C N   1 
ATOM   10590 C CA  . LEU C 1 308 ? 20.773  -9.696  63.736  1.00 17.21  ? 328  LEU C CA  1 
ATOM   10591 C C   . LEU C 1 308 ? 20.287  -9.929  65.151  1.00 17.53  ? 328  LEU C C   1 
ATOM   10592 O O   . LEU C 1 308 ? 20.200  -8.987  65.932  1.00 17.24  ? 328  LEU C O   1 
ATOM   10593 C CB  . LEU C 1 308 ? 22.261  -9.337  63.784  1.00 17.27  ? 328  LEU C CB  1 
ATOM   10594 C CG  . LEU C 1 308 ? 23.056  -9.172  62.485  1.00 17.12  ? 328  LEU C CG  1 
ATOM   10595 C CD1 . LEU C 1 308 ? 24.498  -8.854  62.826  1.00 15.05  ? 328  LEU C CD1 1 
ATOM   10596 C CD2 . LEU C 1 308 ? 22.988  -10.436 61.656  1.00 17.00  ? 328  LEU C CD2 1 
ATOM   10597 N N   . LEU C 1 309 ? 19.979  -11.181 65.476  1.00 18.87  ? 329  LEU C N   1 
ATOM   10598 C CA  . LEU C 1 309 ? 19.488  -11.528 66.806  1.00 20.17  ? 329  LEU C CA  1 
ATOM   10599 C C   . LEU C 1 309 ? 20.552  -12.073 67.750  1.00 21.22  ? 329  LEU C C   1 
ATOM   10600 O O   . LEU C 1 309 ? 20.286  -12.301 68.925  1.00 22.44  ? 329  LEU C O   1 
ATOM   10601 C CB  . LEU C 1 309 ? 18.348  -12.535 66.695  1.00 18.88  ? 329  LEU C CB  1 
ATOM   10602 C CG  . LEU C 1 309 ? 17.156  -12.039 65.888  1.00 18.19  ? 329  LEU C CG  1 
ATOM   10603 C CD1 . LEU C 1 309 ? 16.037  -13.033 66.021  1.00 17.76  ? 329  LEU C CD1 1 
ATOM   10604 C CD2 . LEU C 1 309 ? 16.715  -10.678 66.390  1.00 17.04  ? 329  LEU C CD2 1 
ATOM   10605 N N   . LYS C 1 310 ? 21.751  -12.298 67.229  1.00 22.89  ? 330  LYS C N   1 
ATOM   10606 C CA  . LYS C 1 310 ? 22.867  -12.790 68.030  1.00 23.63  ? 330  LYS C CA  1 
ATOM   10607 C C   . LYS C 1 310 ? 24.134  -12.602 67.211  1.00 23.83  ? 330  LYS C C   1 
ATOM   10608 O O   . LYS C 1 310 ? 24.068  -12.408 65.999  1.00 24.91  ? 330  LYS C O   1 
ATOM   10609 C CB  . LYS C 1 310 ? 22.683  -14.268 68.387  1.00 24.38  ? 330  LYS C CB  1 
ATOM   10610 C CG  . LYS C 1 310 ? 21.368  -14.860 67.918  1.00 26.73  ? 330  LYS C CG  1 
ATOM   10611 C CD  . LYS C 1 310 ? 21.137  -16.259 68.464  1.00 28.12  ? 330  LYS C CD  1 
ATOM   10612 C CE  . LYS C 1 310 ? 20.938  -16.241 69.966  1.00 28.37  ? 330  LYS C CE  1 
ATOM   10613 N NZ  . LYS C 1 310 ? 20.629  -17.604 70.468  1.00 28.33  ? 330  LYS C NZ  1 
ATOM   10614 N N   . THR C 1 311 ? 25.285  -12.640 67.869  1.00 23.55  ? 331  THR C N   1 
ATOM   10615 C CA  . THR C 1 311 ? 26.550  -12.461 67.172  1.00 23.27  ? 331  THR C CA  1 
ATOM   10616 C C   . THR C 1 311 ? 26.670  -13.461 66.037  1.00 23.52  ? 331  THR C C   1 
ATOM   10617 O O   . THR C 1 311 ? 26.172  -14.581 66.134  1.00 21.34  ? 331  THR C O   1 
ATOM   10618 C CB  . THR C 1 311 ? 27.733  -12.699 68.099  1.00 22.47  ? 331  THR C CB  1 
ATOM   10619 O OG1 . THR C 1 311 ? 27.683  -14.049 68.573  1.00 22.73  ? 331  THR C OG1 1 
ATOM   10620 C CG2 . THR C 1 311 ? 27.695  -11.753 69.272  1.00 22.31  ? 331  THR C CG2 1 
ATOM   10621 N N   . PRO C 1 312 ? 27.333  -13.066 64.940  1.00 25.21  ? 332  PRO C N   1 
ATOM   10622 C CA  . PRO C 1 312 ? 27.522  -13.948 63.787  1.00 27.65  ? 332  PRO C CA  1 
ATOM   10623 C C   . PRO C 1 312 ? 28.048  -15.312 64.230  1.00 29.58  ? 332  PRO C C   1 
ATOM   10624 O O   . PRO C 1 312 ? 27.658  -16.353 63.700  1.00 28.59  ? 332  PRO C O   1 
ATOM   10625 C CB  . PRO C 1 312 ? 28.529  -13.178 62.945  1.00 25.49  ? 332  PRO C CB  1 
ATOM   10626 C CG  . PRO C 1 312 ? 28.075  -11.783 63.142  1.00 24.43  ? 332  PRO C CG  1 
ATOM   10627 C CD  . PRO C 1 312 ? 27.847  -11.719 64.643  1.00 24.91  ? 332  PRO C CD  1 
ATOM   10628 N N   . GLU C 1 313 ? 28.932  -15.287 65.219  1.00 32.11  ? 333  GLU C N   1 
ATOM   10629 C CA  . GLU C 1 313 ? 29.523  -16.497 65.752  1.00 34.35  ? 333  GLU C CA  1 
ATOM   10630 C C   . GLU C 1 313 ? 28.431  -17.488 66.188  1.00 36.36  ? 333  GLU C C   1 
ATOM   10631 O O   . GLU C 1 313 ? 28.445  -18.653 65.793  1.00 37.17  ? 333  GLU C O   1 
ATOM   10632 C CB  . GLU C 1 313 ? 30.438  -16.136 66.926  1.00 35.00  ? 333  GLU C CB  1 
ATOM   10633 C CG  . GLU C 1 313 ? 31.637  -15.196 66.593  1.00 38.97  ? 333  GLU C CG  1 
ATOM   10634 C CD  . GLU C 1 313 ? 31.248  -13.783 66.101  1.00 40.28  ? 333  GLU C CD  1 
ATOM   10635 O OE1 . GLU C 1 313 ? 30.190  -13.262 66.506  1.00 41.35  ? 333  GLU C OE1 1 
ATOM   10636 O OE2 . GLU C 1 313 ? 32.019  -13.177 65.320  1.00 40.78  ? 333  GLU C OE2 1 
ATOM   10637 N N   . GLU C 1 314 ? 27.473  -17.024 66.982  1.00 38.78  ? 334  GLU C N   1 
ATOM   10638 C CA  . GLU C 1 314 ? 26.392  -17.887 67.459  1.00 41.25  ? 334  GLU C CA  1 
ATOM   10639 C C   . GLU C 1 314 ? 25.435  -18.312 66.349  1.00 42.88  ? 334  GLU C C   1 
ATOM   10640 O O   . GLU C 1 314 ? 24.925  -19.428 66.360  1.00 43.85  ? 334  GLU C O   1 
ATOM   10641 C CB  . GLU C 1 314 ? 25.581  -17.177 68.541  1.00 42.66  ? 334  GLU C CB  1 
ATOM   10642 C CG  . GLU C 1 314 ? 26.388  -16.672 69.715  1.00 44.97  ? 334  GLU C CG  1 
ATOM   10643 C CD  . GLU C 1 314 ? 25.614  -15.670 70.550  1.00 47.99  ? 334  GLU C CD  1 
ATOM   10644 O OE1 . GLU C 1 314 ? 24.559  -16.043 71.101  1.00 50.20  ? 334  GLU C OE1 1 
ATOM   10645 O OE2 . GLU C 1 314 ? 26.051  -14.503 70.653  1.00 49.64  ? 334  GLU C OE2 1 
ATOM   10646 N N   . LEU C 1 315 ? 25.181  -17.414 65.402  1.00 44.90  ? 335  LEU C N   1 
ATOM   10647 C CA  . LEU C 1 315 ? 24.265  -17.695 64.301  1.00 45.66  ? 335  LEU C CA  1 
ATOM   10648 C C   . LEU C 1 315 ? 24.720  -18.808 63.372  1.00 48.53  ? 335  LEU C C   1 
ATOM   10649 O O   . LEU C 1 315 ? 23.918  -19.634 62.956  1.00 48.87  ? 335  LEU C O   1 
ATOM   10650 C CB  . LEU C 1 315 ? 24.022  -16.436 63.474  1.00 42.95  ? 335  LEU C CB  1 
ATOM   10651 C CG  . LEU C 1 315 ? 23.278  -15.276 64.127  1.00 41.32  ? 335  LEU C CG  1 
ATOM   10652 C CD1 . LEU C 1 315 ? 22.969  -14.215 63.077  1.00 40.38  ? 335  LEU C CD1 1 
ATOM   10653 C CD2 . LEU C 1 315 ? 21.998  -15.782 64.739  1.00 40.90  ? 335  LEU C CD2 1 
ATOM   10654 N N   . GLN C 1 316 ? 26.003  -18.827 63.036  1.00 53.09  ? 336  GLN C N   1 
ATOM   10655 C CA  . GLN C 1 316 ? 26.532  -19.845 62.136  1.00 58.16  ? 336  GLN C CA  1 
ATOM   10656 C C   . GLN C 1 316 ? 26.362  -21.259 62.656  1.00 61.50  ? 336  GLN C C   1 
ATOM   10657 O O   . GLN C 1 316 ? 26.193  -22.201 61.879  1.00 61.01  ? 336  GLN C O   1 
ATOM   10658 C CB  . GLN C 1 316 ? 28.009  -19.599 61.866  1.00 58.56  ? 336  GLN C CB  1 
ATOM   10659 C CG  . GLN C 1 316 ? 28.275  -18.413 60.986  1.00 60.26  ? 336  GLN C CG  1 
ATOM   10660 C CD  . GLN C 1 316 ? 29.515  -18.610 60.159  1.00 61.96  ? 336  GLN C CD  1 
ATOM   10661 O OE1 . GLN C 1 316 ? 30.626  -18.677 60.689  1.00 62.44  ? 336  GLN C OE1 1 
ATOM   10662 N NE2 . GLN C 1 316 ? 29.335  -18.724 58.845  1.00 62.95  ? 336  GLN C NE2 1 
ATOM   10663 N N   . ALA C 1 317 ? 26.424  -21.407 63.974  1.00 65.54  ? 337  ALA C N   1 
ATOM   10664 C CA  . ALA C 1 317 ? 26.278  -22.713 64.592  1.00 69.91  ? 337  ALA C CA  1 
ATOM   10665 C C   . ALA C 1 317 ? 24.805  -23.128 64.637  1.00 73.36  ? 337  ALA C C   1 
ATOM   10666 O O   . ALA C 1 317 ? 24.420  -23.973 65.445  1.00 74.78  ? 337  ALA C O   1 
ATOM   10667 C CB  . ALA C 1 317 ? 26.866  -22.685 65.998  1.00 68.86  ? 337  ALA C CB  1 
ATOM   10668 N N   . GLU C 1 318 ? 23.990  -22.541 63.761  1.00 76.75  ? 338  GLU C N   1 
ATOM   10669 C CA  . GLU C 1 318 ? 22.555  -22.837 63.711  1.00 79.45  ? 338  GLU C CA  1 
ATOM   10670 C C   . GLU C 1 318 ? 22.053  -23.134 62.298  1.00 81.06  ? 338  GLU C C   1 
ATOM   10671 O O   . GLU C 1 318 ? 21.692  -22.221 61.550  1.00 81.66  ? 338  GLU C O   1 
ATOM   10672 C CB  . GLU C 1 318 ? 21.754  -21.663 64.284  1.00 79.56  ? 338  GLU C CB  1 
ATOM   10673 C CG  . GLU C 1 318 ? 20.251  -21.767 64.071  1.00 80.70  ? 338  GLU C CG  1 
ATOM   10674 C CD  . GLU C 1 318 ? 19.567  -20.409 64.085  1.00 82.07  ? 338  GLU C CD  1 
ATOM   10675 O OE1 . GLU C 1 318 ? 19.641  -19.715 65.125  1.00 81.86  ? 338  GLU C OE1 1 
ATOM   10676 O OE2 . GLU C 1 318 ? 18.959  -20.035 63.054  1.00 82.07  ? 338  GLU C OE2 1 
ATOM   10677 N N   . ARG C 1 319 ? 22.019  -24.413 61.943  1.00 82.67  ? 339  ARG C N   1 
ATOM   10678 C CA  . ARG C 1 319 ? 21.547  -24.826 60.625  1.00 84.00  ? 339  ARG C CA  1 
ATOM   10679 C C   . ARG C 1 319 ? 20.017  -24.820 60.592  1.00 84.10  ? 339  ARG C C   1 
ATOM   10680 O O   . ARG C 1 319 ? 19.397  -25.800 60.178  1.00 84.37  ? 339  ARG C O   1 
ATOM   10681 C CB  . ARG C 1 319 ? 22.052  -26.237 60.289  1.00 84.82  ? 339  ARG C CB  1 
ATOM   10682 C CG  . ARG C 1 319 ? 23.568  -26.391 60.189  1.00 85.80  ? 339  ARG C CG  1 
ATOM   10683 C CD  . ARG C 1 319 ? 24.255  -26.202 61.536  1.00 86.80  ? 339  ARG C CD  1 
ATOM   10684 N NE  . ARG C 1 319 ? 25.657  -26.619 61.510  1.00 87.40  ? 339  ARG C NE  1 
ATOM   10685 C CZ  . ARG C 1 319 ? 26.600  -26.059 60.755  1.00 87.41  ? 339  ARG C CZ  1 
ATOM   10686 N NH1 . ARG C 1 319 ? 26.301  -25.047 59.952  1.00 86.86  ? 339  ARG C NH1 1 
ATOM   10687 N NH2 . ARG C 1 319 ? 27.848  -26.513 60.806  1.00 87.59  ? 339  ARG C NH2 1 
ATOM   10688 N N   . ASN C 1 320 ? 19.408  -23.723 61.031  1.00 84.18  ? 340  ASN C N   1 
ATOM   10689 C CA  . ASN C 1 320 ? 17.951  -23.634 61.039  1.00 84.32  ? 340  ASN C CA  1 
ATOM   10690 C C   . ASN C 1 320 ? 17.432  -22.373 60.366  1.00 83.13  ? 340  ASN C C   1 
ATOM   10691 O O   . ASN C 1 320 ? 16.321  -21.919 60.637  1.00 82.78  ? 340  ASN C O   1 
ATOM   10692 C CB  . ASN C 1 320 ? 17.424  -23.722 62.474  1.00 85.86  ? 340  ASN C CB  1 
ATOM   10693 C CG  . ASN C 1 320 ? 17.461  -25.144 63.023  1.00 87.38  ? 340  ASN C CG  1 
ATOM   10694 O OD1 . ASN C 1 320 ? 18.506  -25.802 63.015  1.00 88.05  ? 340  ASN C OD1 1 
ATOM   10695 N ND2 . ASN C 1 320 ? 16.317  -25.623 63.503  1.00 87.41  ? 340  ASN C ND2 1 
ATOM   10696 N N   . PHE C 1 321 ? 18.251  -21.812 59.485  1.00 81.71  ? 341  PHE C N   1 
ATOM   10697 C CA  . PHE C 1 321 ? 17.878  -20.616 58.748  1.00 79.73  ? 341  PHE C CA  1 
ATOM   10698 C C   . PHE C 1 321 ? 17.755  -21.024 57.281  1.00 76.59  ? 341  PHE C C   1 
ATOM   10699 O O   . PHE C 1 321 ? 17.798  -22.212 56.955  1.00 76.27  ? 341  PHE C O   1 
ATOM   10700 C CB  . PHE C 1 321 ? 18.956  -19.534 58.907  1.00 82.53  ? 341  PHE C CB  1 
ATOM   10701 C CG  . PHE C 1 321 ? 18.544  -18.177 58.381  1.00 85.62  ? 341  PHE C CG  1 
ATOM   10702 C CD1 . PHE C 1 321 ? 17.533  -17.448 59.007  1.00 86.50  ? 341  PHE C CD1 1 
ATOM   10703 C CD2 . PHE C 1 321 ? 19.156  -17.635 57.250  1.00 86.57  ? 341  PHE C CD2 1 
ATOM   10704 C CE1 . PHE C 1 321 ? 17.138  -16.203 58.514  1.00 86.66  ? 341  PHE C CE1 1 
ATOM   10705 C CE2 . PHE C 1 321 ? 18.765  -16.388 56.748  1.00 86.86  ? 341  PHE C CE2 1 
ATOM   10706 C CZ  . PHE C 1 321 ? 17.755  -15.674 57.382  1.00 86.87  ? 341  PHE C CZ  1 
ATOM   10707 N N   . HIS C 1 322 ? 17.595  -20.036 56.405  1.00 72.42  ? 342  HIS C N   1 
ATOM   10708 C CA  . HIS C 1 322 ? 17.486  -20.272 54.970  1.00 67.21  ? 342  HIS C CA  1 
ATOM   10709 C C   . HIS C 1 322 ? 18.907  -20.346 54.400  1.00 62.63  ? 342  HIS C C   1 
ATOM   10710 O O   . HIS C 1 322 ? 19.748  -19.499 54.708  1.00 62.79  ? 342  HIS C O   1 
ATOM   10711 C CB  . HIS C 1 322 ? 16.721  -19.123 54.317  1.00 68.94  ? 342  HIS C CB  1 
ATOM   10712 C CG  . HIS C 1 322 ? 16.390  -19.358 52.878  1.00 70.63  ? 342  HIS C CG  1 
ATOM   10713 N ND1 . HIS C 1 322 ? 16.020  -18.341 52.025  1.00 71.90  ? 342  HIS C ND1 1 
ATOM   10714 C CD2 . HIS C 1 322 ? 16.358  -20.496 52.146  1.00 71.54  ? 342  HIS C CD2 1 
ATOM   10715 C CE1 . HIS C 1 322 ? 15.774  -18.842 50.827  1.00 72.81  ? 342  HIS C CE1 1 
ATOM   10716 N NE2 . HIS C 1 322 ? 15.971  -20.148 50.874  1.00 72.99  ? 342  HIS C NE2 1 
ATOM   10717 N N   . THR C 1 323 ? 19.173  -21.355 53.573  1.00 55.85  ? 343  THR C N   1 
ATOM   10718 C CA  . THR C 1 323 ? 20.501  -21.535 52.990  1.00 48.16  ? 343  THR C CA  1 
ATOM   10719 C C   . THR C 1 323 ? 20.504  -21.348 51.480  1.00 42.40  ? 343  THR C C   1 
ATOM   10720 O O   . THR C 1 323 ? 19.609  -21.827 50.793  1.00 41.76  ? 343  THR C O   1 
ATOM   10721 C CB  . THR C 1 323 ? 21.035  -22.937 53.292  1.00 48.98  ? 343  THR C CB  1 
ATOM   10722 O OG1 . THR C 1 323 ? 20.120  -23.907 52.771  1.00 48.69  ? 343  THR C OG1 1 
ATOM   10723 C CG2 . THR C 1 323 ? 21.187  -23.141 54.794  1.00 48.67  ? 343  THR C CG2 1 
ATOM   10724 N N   . VAL C 1 324 ? 21.522  -20.663 50.965  1.00 35.89  ? 344  VAL C N   1 
ATOM   10725 C CA  . VAL C 1 324 ? 21.629  -20.421 49.528  1.00 29.63  ? 344  VAL C CA  1 
ATOM   10726 C C   . VAL C 1 324 ? 23.063  -20.590 49.018  1.00 26.17  ? 344  VAL C C   1 
ATOM   10727 O O   . VAL C 1 324 ? 24.010  -20.589 49.809  1.00 26.16  ? 344  VAL C O   1 
ATOM   10728 C CB  . VAL C 1 324 ? 21.146  -19.004 49.183  1.00 27.80  ? 344  VAL C CB  1 
ATOM   10729 C CG1 . VAL C 1 324 ? 19.729  -18.821 49.665  1.00 27.52  ? 344  VAL C CG1 1 
ATOM   10730 C CG2 . VAL C 1 324 ? 22.055  -17.976 49.812  1.00 25.48  ? 344  VAL C CG2 1 
ATOM   10731 N N   . PRO C 1 325 ? 23.245  -20.745 47.689  1.00 21.99  ? 345  PRO C N   1 
ATOM   10732 C CA  . PRO C 1 325 ? 24.596  -20.907 47.141  1.00 20.23  ? 345  PRO C CA  1 
ATOM   10733 C C   . PRO C 1 325 ? 25.421  -19.705 47.570  1.00 19.57  ? 345  PRO C C   1 
ATOM   10734 O O   . PRO C 1 325 ? 25.049  -18.560 47.300  1.00 18.99  ? 345  PRO C O   1 
ATOM   10735 C CB  . PRO C 1 325 ? 24.360  -20.929 45.637  1.00 19.24  ? 345  PRO C CB  1 
ATOM   10736 C CG  . PRO C 1 325 ? 22.996  -21.476 45.516  1.00 18.45  ? 345  PRO C CG  1 
ATOM   10737 C CD  . PRO C 1 325 ? 22.249  -20.759 46.609  1.00 19.36  ? 345  PRO C CD  1 
ATOM   10738 N N   . TYR C 1 326 ? 26.538  -19.966 48.237  1.00 18.17  ? 346  TYR C N   1 
ATOM   10739 C CA  . TYR C 1 326 ? 27.391  -18.897 48.737  1.00 17.07  ? 346  TYR C CA  1 
ATOM   10740 C C   . TYR C 1 326 ? 28.834  -19.033 48.276  1.00 16.62  ? 346  TYR C C   1 
ATOM   10741 O O   . TYR C 1 326 ? 29.475  -20.046 48.560  1.00 17.93  ? 346  TYR C O   1 
ATOM   10742 C CB  . TYR C 1 326 ? 27.352  -18.913 50.271  1.00 16.74  ? 346  TYR C CB  1 
ATOM   10743 C CG  . TYR C 1 326 ? 27.928  -17.692 50.959  1.00 14.79  ? 346  TYR C CG  1 
ATOM   10744 C CD1 . TYR C 1 326 ? 28.119  -17.685 52.338  1.00 13.18  ? 346  TYR C CD1 1 
ATOM   10745 C CD2 . TYR C 1 326 ? 28.252  -16.539 50.240  1.00 13.33  ? 346  TYR C CD2 1 
ATOM   10746 C CE1 . TYR C 1 326 ? 28.615  -16.566 52.988  1.00 14.94  ? 346  TYR C CE1 1 
ATOM   10747 C CE2 . TYR C 1 326 ? 28.746  -15.416 50.873  1.00 14.15  ? 346  TYR C CE2 1 
ATOM   10748 C CZ  . TYR C 1 326 ? 28.928  -15.430 52.251  1.00 16.24  ? 346  TYR C CZ  1 
ATOM   10749 O OH  . TYR C 1 326 ? 29.424  -14.312 52.897  1.00 17.38  ? 346  TYR C OH  1 
ATOM   10750 N N   . MET C 1 327 ? 29.344  -18.022 47.569  1.00 16.27  ? 347  MET C N   1 
ATOM   10751 C CA  . MET C 1 327 ? 30.745  -18.027 47.112  1.00 14.95  ? 347  MET C CA  1 
ATOM   10752 C C   . MET C 1 327 ? 31.531  -17.073 48.026  1.00 14.79  ? 347  MET C C   1 
ATOM   10753 O O   . MET C 1 327 ? 31.131  -15.924 48.209  1.00 16.95  ? 347  MET C O   1 
ATOM   10754 C CB  . MET C 1 327 ? 30.849  -17.541 45.665  1.00 12.59  ? 347  MET C CB  1 
ATOM   10755 C CG  . MET C 1 327 ? 32.259  -17.584 45.100  1.00 10.89  ? 347  MET C CG  1 
ATOM   10756 S SD  . MET C 1 327 ? 32.517  -16.543 43.620  1.00 9.53   ? 347  MET C SD  1 
ATOM   10757 C CE  . MET C 1 327 ? 31.425  -17.337 42.420  1.00 7.02   ? 347  MET C CE  1 
ATOM   10758 N N   . VAL C 1 328 ? 32.626  -17.553 48.615  1.00 13.93  ? 348  VAL C N   1 
ATOM   10759 C CA  . VAL C 1 328 ? 33.461  -16.738 49.510  1.00 13.51  ? 348  VAL C CA  1 
ATOM   10760 C C   . VAL C 1 328 ? 34.892  -16.755 48.990  1.00 14.16  ? 348  VAL C C   1 
ATOM   10761 O O   . VAL C 1 328 ? 35.354  -17.775 48.495  1.00 15.72  ? 348  VAL C O   1 
ATOM   10762 C CB  . VAL C 1 328 ? 33.475  -17.303 50.957  1.00 11.61  ? 348  VAL C CB  1 
ATOM   10763 C CG1 . VAL C 1 328 ? 34.391  -16.467 51.840  1.00 10.14  ? 348  VAL C CG1 1 
ATOM   10764 C CG2 . VAL C 1 328 ? 32.077  -17.323 51.521  1.00 8.81   ? 348  VAL C CG2 1 
ATOM   10765 N N   . GLY C 1 329 ? 35.608  -15.645 49.101  1.00 14.36  ? 349  GLY C N   1 
ATOM   10766 C CA  . GLY C 1 329 ? 36.967  -15.659 48.597  1.00 15.17  ? 349  GLY C CA  1 
ATOM   10767 C C   . GLY C 1 329 ? 37.885  -14.590 49.134  1.00 15.79  ? 349  GLY C C   1 
ATOM   10768 O O   . GLY C 1 329 ? 37.430  -13.592 49.685  1.00 16.88  ? 349  GLY C O   1 
ATOM   10769 N N   . ILE C 1 330 ? 39.186  -14.806 48.966  1.00 15.47  ? 350  ILE C N   1 
ATOM   10770 C CA  . ILE C 1 330 ? 40.189  -13.864 49.427  1.00 15.44  ? 350  ILE C CA  1 
ATOM   10771 C C   . ILE C 1 330 ? 41.204  -13.576 48.319  1.00 17.46  ? 350  ILE C C   1 
ATOM   10772 O O   . ILE C 1 330 ? 41.095  -14.097 47.215  1.00 16.97  ? 350  ILE C O   1 
ATOM   10773 C CB  . ILE C 1 330 ? 40.933  -14.412 50.667  1.00 13.69  ? 350  ILE C CB  1 
ATOM   10774 C CG1 . ILE C 1 330 ? 41.676  -15.705 50.310  1.00 13.79  ? 350  ILE C CG1 1 
ATOM   10775 C CG2 . ILE C 1 330 ? 39.946  -14.686 51.783  1.00 10.47  ? 350  ILE C CG2 1 
ATOM   10776 C CD1 . ILE C 1 330 ? 42.589  -16.218 51.419  1.00 12.06  ? 350  ILE C CD1 1 
ATOM   10777 N N   . ASN C 1 331 ? 42.178  -12.724 48.620  1.00 20.63  ? 351  ASN C N   1 
ATOM   10778 C CA  . ASN C 1 331 ? 43.233  -12.374 47.674  1.00 22.16  ? 351  ASN C CA  1 
ATOM   10779 C C   . ASN C 1 331 ? 44.563  -12.726 48.319  1.00 24.38  ? 351  ASN C C   1 
ATOM   10780 O O   . ASN C 1 331 ? 44.720  -12.616 49.536  1.00 25.20  ? 351  ASN C O   1 
ATOM   10781 C CB  . ASN C 1 331 ? 43.193  -10.885 47.342  1.00 19.86  ? 351  ASN C CB  1 
ATOM   10782 C CG  . ASN C 1 331 ? 41.973  -10.513 46.540  1.00 19.20  ? 351  ASN C CG  1 
ATOM   10783 O OD1 . ASN C 1 331 ? 41.733  -9.341  46.249  1.00 18.74  ? 351  ASN C OD1 1 
ATOM   10784 N ND2 . ASN C 1 331 ? 41.191  -11.516 46.171  1.00 18.48  ? 351  ASN C ND2 1 
ATOM   10785 N N   . LYS C 1 332 ? 45.511  -13.156 47.495  1.00 26.06  ? 352  LYS C N   1 
ATOM   10786 C CA  . LYS C 1 332 ? 46.830  -13.562 47.961  1.00 26.25  ? 352  LYS C CA  1 
ATOM   10787 C C   . LYS C 1 332 ? 47.460  -12.624 48.989  1.00 24.32  ? 352  LYS C C   1 
ATOM   10788 O O   . LYS C 1 332 ? 47.970  -13.080 50.007  1.00 23.38  ? 352  LYS C O   1 
ATOM   10789 C CB  . LYS C 1 332 ? 47.767  -13.709 46.759  1.00 29.62  ? 352  LYS C CB  1 
ATOM   10790 C CG  . LYS C 1 332 ? 49.109  -14.359 47.067  1.00 31.47  ? 352  LYS C CG  1 
ATOM   10791 C CD  . LYS C 1 332 ? 48.950  -15.831 47.406  1.00 34.08  ? 352  LYS C CD  1 
ATOM   10792 C CE  . LYS C 1 332 ? 50.300  -16.518 47.427  1.00 35.55  ? 352  LYS C CE  1 
ATOM   10793 N NZ  . LYS C 1 332 ? 51.015  -16.331 46.127  1.00 37.50  ? 352  LYS C NZ  1 
ATOM   10794 N N   . GLN C 1 333 ? 47.414  -11.320 48.717  1.00 24.14  ? 353  GLN C N   1 
ATOM   10795 C CA  . GLN C 1 333 ? 48.009  -10.309 49.596  1.00 24.11  ? 353  GLN C CA  1 
ATOM   10796 C C   . GLN C 1 333 ? 47.029  -9.225  50.067  1.00 24.71  ? 353  GLN C C   1 
ATOM   10797 O O   . GLN C 1 333 ? 47.160  -8.050  49.695  1.00 23.77  ? 353  GLN C O   1 
ATOM   10798 C CB  . GLN C 1 333 ? 49.187  -9.642  48.880  1.00 24.60  ? 353  GLN C CB  1 
ATOM   10799 C CG  . GLN C 1 333 ? 50.358  -10.578 48.586  1.00 24.81  ? 353  GLN C CG  1 
ATOM   10800 C CD  . GLN C 1 333 ? 51.476  -9.906  47.803  1.00 25.36  ? 353  GLN C CD  1 
ATOM   10801 O OE1 . GLN C 1 333 ? 52.031  -8.883  48.219  1.00 26.07  ? 353  GLN C OE1 1 
ATOM   10802 N NE2 . GLN C 1 333 ? 51.815  -10.484 46.663  1.00 25.58  ? 353  GLN C NE2 1 
ATOM   10803 N N   . GLU C 1 334 ? 46.066  -9.628  50.901  1.00 24.48  ? 354  GLU C N   1 
ATOM   10804 C CA  . GLU C 1 334 ? 45.035  -8.735  51.438  1.00 22.26  ? 354  GLU C CA  1 
ATOM   10805 C C   . GLU C 1 334 ? 45.562  -7.491  52.144  1.00 21.30  ? 354  GLU C C   1 
ATOM   10806 O O   . GLU C 1 334 ? 44.942  -6.430  52.094  1.00 19.58  ? 354  GLU C O   1 
ATOM   10807 C CB  . GLU C 1 334 ? 44.140  -9.495  52.417  1.00 20.91  ? 354  GLU C CB  1 
ATOM   10808 C CG  . GLU C 1 334 ? 43.269  -10.562 51.790  1.00 22.06  ? 354  GLU C CG  1 
ATOM   10809 C CD  . GLU C 1 334 ? 42.146  -9.996  50.943  1.00 22.14  ? 354  GLU C CD  1 
ATOM   10810 O OE1 . GLU C 1 334 ? 42.005  -8.757  50.871  1.00 22.67  ? 354  GLU C OE1 1 
ATOM   10811 O OE2 . GLU C 1 334 ? 41.397  -10.799 50.348  1.00 21.60  ? 354  GLU C OE2 1 
ATOM   10812 N N   . PHE C 1 335 ? 46.698  -7.623  52.811  1.00 21.10  ? 355  PHE C N   1 
ATOM   10813 C CA  . PHE C 1 335 ? 47.261  -6.499  53.538  1.00 22.05  ? 355  PHE C CA  1 
ATOM   10814 C C   . PHE C 1 335 ? 48.573  -6.079  52.894  1.00 21.99  ? 355  PHE C C   1 
ATOM   10815 O O   . PHE C 1 335 ? 49.454  -5.519  53.549  1.00 21.30  ? 355  PHE C O   1 
ATOM   10816 C CB  . PHE C 1 335 ? 47.487  -6.906  54.992  1.00 23.41  ? 355  PHE C CB  1 
ATOM   10817 C CG  . PHE C 1 335 ? 47.412  -5.773  55.957  1.00 22.86  ? 355  PHE C CG  1 
ATOM   10818 C CD1 . PHE C 1 335 ? 48.511  -5.433  56.730  1.00 24.37  ? 355  PHE C CD1 1 
ATOM   10819 C CD2 . PHE C 1 335 ? 46.234  -5.058  56.113  1.00 22.98  ? 355  PHE C CD2 1 
ATOM   10820 C CE1 . PHE C 1 335 ? 48.437  -4.391  57.655  1.00 25.29  ? 355  PHE C CE1 1 
ATOM   10821 C CE2 . PHE C 1 335 ? 46.150  -4.018  57.032  1.00 24.63  ? 355  PHE C CE2 1 
ATOM   10822 C CZ  . PHE C 1 335 ? 47.253  -3.683  57.806  1.00 24.42  ? 355  PHE C CZ  1 
ATOM   10823 N N   . GLY C 1 336 ? 48.680  -6.334  51.596  1.00 22.21  ? 356  GLY C N   1 
ATOM   10824 C CA  . GLY C 1 336 ? 49.893  -6.012  50.869  1.00 21.82  ? 356  GLY C CA  1 
ATOM   10825 C C   . GLY C 1 336 ? 50.238  -4.554  50.619  1.00 21.92  ? 356  GLY C C   1 
ATOM   10826 O O   . GLY C 1 336 ? 51.422  -4.236  50.500  1.00 23.32  ? 356  GLY C O   1 
ATOM   10827 N N   . TRP C 1 337 ? 49.245  -3.672  50.531  1.00 21.92  ? 357  TRP C N   1 
ATOM   10828 C CA  . TRP C 1 337 ? 49.528  -2.266  50.278  1.00 21.40  ? 357  TRP C CA  1 
ATOM   10829 C C   . TRP C 1 337 ? 48.370  -1.301  50.582  1.00 20.16  ? 357  TRP C C   1 
ATOM   10830 O O   . TRP C 1 337 ? 48.441  -0.509  51.525  1.00 19.22  ? 357  TRP C O   1 
ATOM   10831 C CB  . TRP C 1 337 ? 49.955  -2.095  48.810  1.00 22.75  ? 357  TRP C CB  1 
ATOM   10832 C CG  . TRP C 1 337 ? 50.329  -0.713  48.433  1.00 23.83  ? 357  TRP C CG  1 
ATOM   10833 C CD1 . TRP C 1 337 ? 51.486  -0.068  48.733  1.00 24.12  ? 357  TRP C CD1 1 
ATOM   10834 C CD2 . TRP C 1 337 ? 49.532  0.209   47.691  1.00 25.28  ? 357  TRP C CD2 1 
ATOM   10835 N NE1 . TRP C 1 337 ? 51.463  1.205   48.221  1.00 24.81  ? 357  TRP C NE1 1 
ATOM   10836 C CE2 . TRP C 1 337 ? 50.272  1.401   47.575  1.00 24.67  ? 357  TRP C CE2 1 
ATOM   10837 C CE3 . TRP C 1 337 ? 48.257  0.143   47.111  1.00 26.86  ? 357  TRP C CE3 1 
ATOM   10838 C CZ2 . TRP C 1 337 ? 49.788  2.521   46.901  1.00 25.64  ? 357  TRP C CZ2 1 
ATOM   10839 C CZ3 . TRP C 1 337 ? 47.773  1.256   46.440  1.00 25.97  ? 357  TRP C CZ3 1 
ATOM   10840 C CH2 . TRP C 1 337 ? 48.539  2.431   46.340  1.00 26.42  ? 357  TRP C CH2 1 
ATOM   10841 N N   . LEU C 1 338 ? 47.312  -1.387  49.774  1.00 19.61  ? 358  LEU C N   1 
ATOM   10842 C CA  . LEU C 1 338 ? 46.161  -0.498  49.871  1.00 18.42  ? 358  LEU C CA  1 
ATOM   10843 C C   . LEU C 1 338 ? 45.727  -0.212  51.294  1.00 17.48  ? 358  LEU C C   1 
ATOM   10844 O O   . LEU C 1 338 ? 45.594  0.942   51.690  1.00 18.05  ? 358  LEU C O   1 
ATOM   10845 C CB  . LEU C 1 338 ? 44.982  -1.071  49.091  1.00 17.28  ? 358  LEU C CB  1 
ATOM   10846 C CG  . LEU C 1 338 ? 43.667  -0.303  49.218  1.00 14.93  ? 358  LEU C CG  1 
ATOM   10847 C CD1 . LEU C 1 338 ? 43.857  1.102   48.736  1.00 17.22  ? 358  LEU C CD1 1 
ATOM   10848 C CD2 . LEU C 1 338 ? 42.596  -0.966  48.402  1.00 16.15  ? 358  LEU C CD2 1 
ATOM   10849 N N   . ILE C 1 339 ? 45.508  -1.258  52.073  1.00 17.37  ? 359  ILE C N   1 
ATOM   10850 C CA  . ILE C 1 339 ? 45.071  -1.059  53.441  1.00 18.65  ? 359  ILE C CA  1 
ATOM   10851 C C   . ILE C 1 339 ? 46.137  -0.450  54.341  1.00 20.33  ? 359  ILE C C   1 
ATOM   10852 O O   . ILE C 1 339 ? 45.865  0.507   55.056  1.00 20.28  ? 359  ILE C O   1 
ATOM   10853 C CB  . ILE C 1 339 ? 44.546  -2.370  54.071  1.00 18.09  ? 359  ILE C CB  1 
ATOM   10854 C CG1 . ILE C 1 339 ? 43.363  -2.895  53.242  1.00 17.87  ? 359  ILE C CG1 1 
ATOM   10855 C CG2 . ILE C 1 339 ? 44.065  -2.101  55.515  1.00 18.19  ? 359  ILE C CG2 1 
ATOM   10856 C CD1 . ILE C 1 339 ? 42.723  -4.127  53.788  1.00 17.52  ? 359  ILE C CD1 1 
ATOM   10857 N N   . PRO C 1 340 ? 47.357  -1.009  54.343  1.00 22.19  ? 360  PRO C N   1 
ATOM   10858 C CA  . PRO C 1 340 ? 48.389  -0.428  55.202  1.00 22.80  ? 360  PRO C CA  1 
ATOM   10859 C C   . PRO C 1 340 ? 48.694  1.009   54.810  1.00 24.17  ? 360  PRO C C   1 
ATOM   10860 O O   . PRO C 1 340 ? 49.151  1.804   55.633  1.00 26.25  ? 360  PRO C O   1 
ATOM   10861 C CB  . PRO C 1 340 ? 49.573  -1.364  54.993  1.00 21.47  ? 360  PRO C CB  1 
ATOM   10862 C CG  . PRO C 1 340 ? 48.915  -2.667  54.781  1.00 22.12  ? 360  PRO C CG  1 
ATOM   10863 C CD  . PRO C 1 340 ? 47.800  -2.312  53.823  1.00 22.99  ? 360  PRO C CD  1 
ATOM   10864 N N   . MET C 1 341 ? 48.435  1.340   53.550  1.00 23.67  ? 361  MET C N   1 
ATOM   10865 C CA  . MET C 1 341 ? 48.677  2.688   53.055  1.00 23.69  ? 361  MET C CA  1 
ATOM   10866 C C   . MET C 1 341 ? 47.603  3.648   53.569  1.00 23.95  ? 361  MET C C   1 
ATOM   10867 O O   . MET C 1 341 ? 47.903  4.593   54.299  1.00 23.26  ? 361  MET C O   1 
ATOM   10868 C CB  . MET C 1 341 ? 48.714  2.677   51.519  1.00 25.29  ? 361  MET C CB  1 
ATOM   10869 C CG  . MET C 1 341 ? 48.878  4.038   50.863  1.00 26.73  ? 361  MET C CG  1 
ATOM   10870 S SD  . MET C 1 341 ? 47.301  4.854   50.541  1.00 29.10  ? 361  MET C SD  1 
ATOM   10871 C CE  . MET C 1 341 ? 47.517  5.392   48.823  1.00 29.37  ? 361  MET C CE  1 
ATOM   10872 N N   . LEU C 1 342 ? 46.350  3.387   53.207  1.00 24.66  ? 363  LEU C N   1 
ATOM   10873 C CA  . LEU C 1 342 ? 45.231  4.228   53.625  1.00 25.04  ? 363  LEU C CA  1 
ATOM   10874 C C   . LEU C 1 342 ? 45.181  4.496   55.129  1.00 27.25  ? 363  LEU C C   1 
ATOM   10875 O O   . LEU C 1 342 ? 44.538  5.458   55.565  1.00 28.19  ? 363  LEU C O   1 
ATOM   10876 C CB  . LEU C 1 342 ? 43.906  3.595   53.206  1.00 22.53  ? 363  LEU C CB  1 
ATOM   10877 C CG  . LEU C 1 342 ? 43.728  3.235   51.735  1.00 21.84  ? 363  LEU C CG  1 
ATOM   10878 C CD1 . LEU C 1 342 ? 42.358  2.605   51.549  1.00 20.26  ? 363  LEU C CD1 1 
ATOM   10879 C CD2 . LEU C 1 342 ? 43.886  4.466   50.861  1.00 21.22  ? 363  LEU C CD2 1 
ATOM   10880 N N   . MET C 1 343 ? 45.843  3.650   55.918  1.00 27.84  ? 364  MET C N   1 
ATOM   10881 C CA  . MET C 1 343 ? 45.850  3.808   57.369  1.00 28.97  ? 364  MET C CA  1 
ATOM   10882 C C   . MET C 1 343 ? 47.165  4.346   57.899  1.00 29.74  ? 364  MET C C   1 
ATOM   10883 O O   . MET C 1 343 ? 47.339  4.493   59.106  1.00 29.34  ? 364  MET C O   1 
ATOM   10884 C CB  . MET C 1 343 ? 45.529  2.482   58.056  1.00 30.29  ? 364  MET C CB  1 
ATOM   10885 C CG  . MET C 1 343 ? 44.050  2.124   58.067  1.00 31.91  ? 364  MET C CG  1 
ATOM   10886 S SD  . MET C 1 343 ? 43.744  0.465   58.718  1.00 32.61  ? 364  MET C SD  1 
ATOM   10887 C CE  . MET C 1 343 ? 44.283  0.680   60.437  1.00 31.41  ? 364  MET C CE  1 
ATOM   10888 N N   . SER C 1 344 ? 48.093  4.630   56.997  1.00 30.88  ? 365  SER C N   1 
ATOM   10889 C CA  . SER C 1 344 ? 49.379  5.182   57.392  1.00 33.56  ? 365  SER C CA  1 
ATOM   10890 C C   . SER C 1 344 ? 50.163  4.251   58.311  1.00 36.09  ? 365  SER C C   1 
ATOM   10891 O O   . SER C 1 344 ? 50.786  4.692   59.279  1.00 36.33  ? 365  SER C O   1 
ATOM   10892 C CB  . SER C 1 344 ? 49.165  6.526   58.085  1.00 32.57  ? 365  SER C CB  1 
ATOM   10893 O OG  . SER C 1 344 ? 48.390  7.393   57.274  1.00 31.77  ? 365  SER C OG  1 
ATOM   10894 N N   . TYR C 1 345 ? 50.134  2.962   58.002  1.00 38.56  ? 366  TYR C N   1 
ATOM   10895 C CA  . TYR C 1 345 ? 50.856  1.980   58.796  1.00 41.15  ? 366  TYR C CA  1 
ATOM   10896 C C   . TYR C 1 345 ? 52.336  2.345   58.792  1.00 42.64  ? 366  TYR C C   1 
ATOM   10897 O O   . TYR C 1 345 ? 52.896  2.664   57.743  1.00 42.38  ? 366  TYR C O   1 
ATOM   10898 C CB  . TYR C 1 345 ? 50.672  0.590   58.193  1.00 41.72  ? 366  TYR C CB  1 
ATOM   10899 C CG  . TYR C 1 345 ? 50.390  -0.484  59.213  1.00 42.14  ? 366  TYR C CG  1 
ATOM   10900 C CD1 . TYR C 1 345 ? 49.171  -0.523  59.892  1.00 41.85  ? 366  TYR C CD1 1 
ATOM   10901 C CD2 . TYR C 1 345 ? 51.336  -1.469  59.489  1.00 42.65  ? 366  TYR C CD2 1 
ATOM   10902 C CE1 . TYR C 1 345 ? 48.899  -1.521  60.816  1.00 42.68  ? 366  TYR C CE1 1 
ATOM   10903 C CE2 . TYR C 1 345 ? 51.077  -2.472  60.413  1.00 43.35  ? 366  TYR C CE2 1 
ATOM   10904 C CZ  . TYR C 1 345 ? 49.856  -2.494  61.071  1.00 43.97  ? 366  TYR C CZ  1 
ATOM   10905 O OH  . TYR C 1 345 ? 49.590  -3.500  61.969  1.00 44.95  ? 366  TYR C OH  1 
ATOM   10906 N N   . PRO C 1 346 ? 52.991  2.297   59.966  1.00 45.07  ? 367  PRO C N   1 
ATOM   10907 C CA  . PRO C 1 346 ? 54.418  2.626   60.101  1.00 47.26  ? 367  PRO C CA  1 
ATOM   10908 C C   . PRO C 1 346 ? 55.345  1.559   59.510  1.00 49.71  ? 367  PRO C C   1 
ATOM   10909 O O   . PRO C 1 346 ? 55.892  0.727   60.238  1.00 50.62  ? 367  PRO C O   1 
ATOM   10910 C CB  . PRO C 1 346 ? 54.589  2.765   61.609  1.00 45.14  ? 367  PRO C CB  1 
ATOM   10911 C CG  . PRO C 1 346 ? 53.671  1.715   62.121  1.00 45.26  ? 367  PRO C CG  1 
ATOM   10912 C CD  . PRO C 1 346 ? 52.424  1.910   61.271  1.00 45.09  ? 367  PRO C CD  1 
ATOM   10913 N N   . LEU C 1 347 ? 55.519  1.591   58.190  1.00 51.81  ? 368  LEU C N   1 
ATOM   10914 C CA  . LEU C 1 347 ? 56.369  0.625   57.498  1.00 53.90  ? 368  LEU C CA  1 
ATOM   10915 C C   . LEU C 1 347 ? 57.049  1.273   56.302  1.00 54.87  ? 368  LEU C C   1 
ATOM   10916 O O   . LEU C 1 347 ? 56.933  0.809   55.167  1.00 54.57  ? 368  LEU C O   1 
ATOM   10917 C CB  . LEU C 1 347 ? 55.540  -0.579  57.039  1.00 54.04  ? 368  LEU C CB  1 
ATOM   10918 C CG  . LEU C 1 347 ? 55.008  -1.474  58.161  1.00 53.27  ? 368  LEU C CG  1 
ATOM   10919 C CD1 . LEU C 1 347 ? 54.057  -2.501  57.589  1.00 53.76  ? 368  LEU C CD1 1 
ATOM   10920 C CD2 . LEU C 1 347 ? 56.170  -2.148  58.869  1.00 52.78  ? 368  LEU C CD2 1 
ATOM   10921 N N   . SER C 1 348 ? 57.758  2.358   56.577  1.00 56.22  ? 369  SER C N   1 
ATOM   10922 C CA  . SER C 1 348 ? 58.472  3.099   55.553  1.00 56.81  ? 369  SER C CA  1 
ATOM   10923 C C   . SER C 1 348 ? 59.848  2.498   55.272  1.00 57.03  ? 369  SER C C   1 
ATOM   10924 O O   . SER C 1 348 ? 60.233  2.310   54.116  1.00 57.12  ? 369  SER C O   1 
ATOM   10925 C CB  . SER C 1 348 ? 58.602  4.561   55.989  1.00 57.17  ? 369  SER C CB  1 
ATOM   10926 O OG  . SER C 1 348 ? 58.622  4.664   57.406  1.00 58.84  ? 369  SER C OG  1 
ATOM   10927 N N   . GLU C 1 349 ? 60.578  2.189   56.340  1.00 57.72  ? 370  GLU C N   1 
ATOM   10928 C CA  . GLU C 1 349 ? 61.909  1.605   56.232  1.00 58.36  ? 370  GLU C CA  1 
ATOM   10929 C C   . GLU C 1 349 ? 61.869  0.227   55.574  1.00 56.67  ? 370  GLU C C   1 
ATOM   10930 O O   . GLU C 1 349 ? 62.877  -0.477  55.529  1.00 56.20  ? 370  GLU C O   1 
ATOM   10931 C CB  . GLU C 1 349 ? 62.560  1.514   57.617  1.00 61.14  ? 370  GLU C CB  1 
ATOM   10932 C CG  . GLU C 1 349 ? 61.755  0.743   58.664  1.00 66.87  ? 370  GLU C CG  1 
ATOM   10933 C CD  . GLU C 1 349 ? 60.427  1.411   59.022  1.00 70.04  ? 370  GLU C CD  1 
ATOM   10934 O OE1 . GLU C 1 349 ? 60.432  2.610   59.391  1.00 71.00  ? 370  GLU C OE1 1 
ATOM   10935 O OE2 . GLU C 1 349 ? 59.378  0.730   58.942  1.00 71.88  ? 370  GLU C OE2 1 
ATOM   10936 N N   . GLY C 1 350 ? 60.692  -0.144  55.076  1.00 55.14  ? 371  GLY C N   1 
ATOM   10937 C CA  . GLY C 1 350 ? 60.509  -1.415  54.397  1.00 53.07  ? 371  GLY C CA  1 
ATOM   10938 C C   . GLY C 1 350 ? 60.982  -2.685  55.082  1.00 51.84  ? 371  GLY C C   1 
ATOM   10939 O O   . GLY C 1 350 ? 61.201  -3.695  54.414  1.00 50.83  ? 371  GLY C O   1 
ATOM   10940 N N   . GLN C 1 351 ? 61.149  -2.658  56.398  1.00 51.74  ? 372  GLN C N   1 
ATOM   10941 C CA  . GLN C 1 351 ? 61.584  -3.856  57.105  1.00 52.07  ? 372  GLN C CA  1 
ATOM   10942 C C   . GLN C 1 351 ? 61.177  -3.857  58.569  1.00 51.45  ? 372  GLN C C   1 
ATOM   10943 O O   . GLN C 1 351 ? 60.828  -2.819  59.130  1.00 50.89  ? 372  GLN C O   1 
ATOM   10944 C CB  . GLN C 1 351 ? 63.100  -4.052  56.964  1.00 53.63  ? 372  GLN C CB  1 
ATOM   10945 C CG  . GLN C 1 351 ? 63.967  -2.910  57.472  1.00 55.65  ? 372  GLN C CG  1 
ATOM   10946 C CD  . GLN C 1 351 ? 65.422  -3.057  57.048  1.00 56.65  ? 372  GLN C CD  1 
ATOM   10947 O OE1 . GLN C 1 351 ? 66.291  -2.309  57.495  1.00 58.42  ? 372  GLN C OE1 1 
ATOM   10948 N NE2 . GLN C 1 351 ? 65.691  -4.021  56.175  1.00 56.55  ? 372  GLN C NE2 1 
ATOM   10949 N N   . LEU C 1 352 ? 61.216  -5.040  59.175  1.00 51.68  ? 373  LEU C N   1 
ATOM   10950 C CA  . LEU C 1 352 ? 60.824  -5.218  60.566  1.00 51.64  ? 373  LEU C CA  1 
ATOM   10951 C C   . LEU C 1 352 ? 61.644  -6.311  61.242  1.00 51.16  ? 373  LEU C C   1 
ATOM   10952 O O   . LEU C 1 352 ? 62.344  -7.077  60.586  1.00 50.13  ? 373  LEU C O   1 
ATOM   10953 C CB  . LEU C 1 352 ? 59.337  -5.590  60.631  1.00 52.84  ? 373  LEU C CB  1 
ATOM   10954 C CG  . LEU C 1 352 ? 58.401  -4.766  61.520  1.00 53.17  ? 373  LEU C CG  1 
ATOM   10955 C CD1 . LEU C 1 352 ? 58.369  -3.319  61.049  1.00 52.59  ? 373  LEU C CD1 1 
ATOM   10956 C CD2 . LEU C 1 352 ? 57.008  -5.373  61.472  1.00 53.40  ? 373  LEU C CD2 1 
ATOM   10957 N N   . ASP C 1 353 ? 61.544  -6.375  62.564  1.00 52.60  ? 374  ASP C N   1 
ATOM   10958 C CA  . ASP C 1 353 ? 62.255  -7.375  63.352  1.00 53.73  ? 374  ASP C CA  1 
ATOM   10959 C C   . ASP C 1 353 ? 61.344  -7.877  64.476  1.00 54.15  ? 374  ASP C C   1 
ATOM   10960 O O   . ASP C 1 353 ? 60.470  -7.146  64.950  1.00 54.18  ? 374  ASP C O   1 
ATOM   10961 C CB  . ASP C 1 353 ? 63.537  -6.779  63.946  1.00 53.95  ? 374  ASP C CB  1 
ATOM   10962 C CG  . ASP C 1 353 ? 63.265  -5.811  65.085  1.00 54.04  ? 374  ASP C CG  1 
ATOM   10963 O OD1 . ASP C 1 353 ? 62.639  -4.758  64.848  1.00 53.84  ? 374  ASP C OD1 1 
ATOM   10964 O OD2 . ASP C 1 353 ? 63.681  -6.108  66.225  1.00 55.00  ? 374  ASP C OD2 1 
ATOM   10965 N N   . GLN C 1 354 ? 61.556  -9.121  64.894  1.00 54.11  ? 375  GLN C N   1 
ATOM   10966 C CA  . GLN C 1 354 ? 60.764  -9.745  65.952  1.00 54.34  ? 375  GLN C CA  1 
ATOM   10967 C C   . GLN C 1 354 ? 60.220  -8.800  67.022  1.00 53.91  ? 375  GLN C C   1 
ATOM   10968 O O   . GLN C 1 354 ? 59.031  -8.850  67.347  1.00 55.00  ? 375  GLN C O   1 
ATOM   10969 C CB  . GLN C 1 354 ? 61.583  -10.847 66.615  1.00 55.78  ? 375  GLN C CB  1 
ATOM   10970 C CG  . GLN C 1 354 ? 61.883  -12.002 65.681  1.00 58.14  ? 375  GLN C CG  1 
ATOM   10971 C CD  . GLN C 1 354 ? 60.653  -12.829 65.370  1.00 58.62  ? 375  GLN C CD  1 
ATOM   10972 O OE1 . GLN C 1 354 ? 60.650  -13.624 64.433  1.00 59.31  ? 375  GLN C OE1 1 
ATOM   10973 N NE2 . GLN C 1 354 ? 59.605  -12.657 66.168  1.00 59.03  ? 375  GLN C NE2 1 
ATOM   10974 N N   . LYS C 1 355 ? 61.078  -7.944  67.573  1.00 52.22  ? 376  LYS C N   1 
ATOM   10975 C CA  . LYS C 1 355 ? 60.647  -7.006  68.606  1.00 49.99  ? 376  LYS C CA  1 
ATOM   10976 C C   . LYS C 1 355 ? 59.661  -5.957  68.100  1.00 49.26  ? 376  LYS C C   1 
ATOM   10977 O O   . LYS C 1 355 ? 58.559  -5.836  68.626  1.00 49.32  ? 376  LYS C O   1 
ATOM   10978 C CB  . LYS C 1 355 ? 61.851  -6.305  69.232  1.00 48.39  ? 376  LYS C CB  1 
ATOM   10979 C CG  . LYS C 1 355 ? 62.490  -7.055  70.385  1.00 46.12  ? 376  LYS C CG  1 
ATOM   10980 C CD  . LYS C 1 355 ? 63.622  -6.232  70.981  1.00 44.36  ? 376  LYS C CD  1 
ATOM   10981 C CE  . LYS C 1 355 ? 64.233  -6.884  72.200  1.00 41.82  ? 376  LYS C CE  1 
ATOM   10982 N NZ  . LYS C 1 355 ? 65.456  -6.152  72.603  1.00 40.68  ? 376  LYS C NZ  1 
ATOM   10983 N N   . THR C 1 356 ? 60.059  -5.196  67.085  1.00 48.83  ? 377  THR C N   1 
ATOM   10984 C CA  . THR C 1 356 ? 59.196  -4.155  66.526  1.00 48.15  ? 377  THR C CA  1 
ATOM   10985 C C   . THR C 1 35