data_1YEE
# 
_entry.id   1YEE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1YEE         
WWPDB D_1000177381 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1YEE 
_pdbx_database_status.recvd_initial_deposition_date   1997-04-15 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Golinelli-Pimpaneau, B.' 1 
'Knossow, M.'             2 
# 
_citation.id                        primary 
_citation.title                     'Structural convergence in the active sites of a family of catalytic antibodies.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            275 
_citation.page_first                1140 
_citation.page_last                 1142 
_citation.year                      1997 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9027317 
_citation.pdbx_database_id_DOI      10.1126/science.275.5303.1140 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Charbonnier, J.B.'       1  
primary 'Golinelli-Pimpaneau, B.' 2  
primary 'Gigant, B.'              3  
primary 'Tawfik, D.S.'            4  
primary 'Chap, R.'                5  
primary 'Schindler, D.G.'         6  
primary 'Kim, S.H.'               7  
primary 'Green, B.S.'             8  
primary 'Eshhar, Z.'              9  
primary 'Knossow, M.'             10 
# 
_cell.entry_id           1YEE 
_cell.length_a           67.930 
_cell.length_b           76.980 
_cell.length_c           45.800 
_cell.angle_alpha        90.00 
_cell.angle_beta         94.68 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1YEE 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'IGG2A FAB FRAGMENT (D2.5)'             24065.887 1  ? ? ? 'TRANSITION STATE ANALOGUE' 
2 polymer     nat 'IGG2A FAB FRAGMENT (D2.5)'             23964.035 1  ? ? ? 'TRANSITION STATE ANALOGUE' 
3 non-polymer syn 4-NITRO-BENZYLPHOSPHONOBUTANOYL-GLYCINE 360.256   1  ? ? ? ?                           
4 water       nat water                                   18.015    93 ? ? ? ?                           
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;DIVMTQSPLTLSVTIGQPASISCKSSQSLLYSNGKTYLSWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKI
SRVEAADLGLYYCVQGTHFPYTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSER
QNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
;DIVMTQSPLTLSVTIGQPASISCKSSQSLLYSNGKTYLSWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKI
SRVEAADLGLYYCVQGTHFPYTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSER
QNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
L ? 
2 'polypeptide(L)' no no 
;EVKLQESGAELVRPGASVKLSCKTSGYIFTSYWIHWVKQRAAAGLEWIARIYPGTGSSYYNVKFKGKATLTADKSSSTAY
MQLSSLKSDDSAVYFCVRWGFIPVREDYVLDYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPV
TLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
;
;EVKLQESGAELVRPGASVKLSCKTSGYIFTSYWIHWVKQRAAAGLEWIARIYPGTGSSYYNVKFKGKATLTADKSSSTAY
MQLSSLKSDDSAVYFCVRWGFIPVREDYVLDYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPV
TLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
;
H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ILE n 
1 3   VAL n 
1 4   MET n 
1 5   THR n 
1 6   GLN n 
1 7   SER n 
1 8   PRO n 
1 9   LEU n 
1 10  THR n 
1 11  LEU n 
1 12  SER n 
1 13  VAL n 
1 14  THR n 
1 15  ILE n 
1 16  GLY n 
1 17  GLN n 
1 18  PRO n 
1 19  ALA n 
1 20  SER n 
1 21  ILE n 
1 22  SER n 
1 23  CYS n 
1 24  LYS n 
1 25  SER n 
1 26  SER n 
1 27  GLN n 
1 28  SER n 
1 29  LEU n 
1 30  LEU n 
1 31  TYR n 
1 32  SER n 
1 33  ASN n 
1 34  GLY n 
1 35  LYS n 
1 36  THR n 
1 37  TYR n 
1 38  LEU n 
1 39  SER n 
1 40  TRP n 
1 41  LEU n 
1 42  LEU n 
1 43  GLN n 
1 44  ARG n 
1 45  PRO n 
1 46  GLY n 
1 47  GLN n 
1 48  SER n 
1 49  PRO n 
1 50  LYS n 
1 51  ARG n 
1 52  LEU n 
1 53  ILE n 
1 54  TYR n 
1 55  LEU n 
1 56  VAL n 
1 57  SER n 
1 58  LYS n 
1 59  LEU n 
1 60  ASP n 
1 61  SER n 
1 62  GLY n 
1 63  VAL n 
1 64  PRO n 
1 65  ASP n 
1 66  ARG n 
1 67  PHE n 
1 68  THR n 
1 69  GLY n 
1 70  SER n 
1 71  GLY n 
1 72  SER n 
1 73  GLY n 
1 74  THR n 
1 75  ASP n 
1 76  PHE n 
1 77  THR n 
1 78  LEU n 
1 79  LYS n 
1 80  ILE n 
1 81  SER n 
1 82  ARG n 
1 83  VAL n 
1 84  GLU n 
1 85  ALA n 
1 86  ALA n 
1 87  ASP n 
1 88  LEU n 
1 89  GLY n 
1 90  LEU n 
1 91  TYR n 
1 92  TYR n 
1 93  CYS n 
1 94  VAL n 
1 95  GLN n 
1 96  GLY n 
1 97  THR n 
1 98  HIS n 
1 99  PHE n 
1 100 PRO n 
1 101 TYR n 
1 102 THR n 
1 103 PHE n 
1 104 GLY n 
1 105 GLY n 
1 106 GLY n 
1 107 THR n 
1 108 LYS n 
1 109 LEU n 
1 110 GLU n 
1 111 ILE n 
1 112 LEU n 
1 113 ARG n 
1 114 ALA n 
1 115 ASP n 
1 116 ALA n 
1 117 ALA n 
1 118 PRO n 
1 119 THR n 
1 120 VAL n 
1 121 SER n 
1 122 ILE n 
1 123 PHE n 
1 124 PRO n 
1 125 PRO n 
1 126 SER n 
1 127 SER n 
1 128 GLU n 
1 129 GLN n 
1 130 LEU n 
1 131 THR n 
1 132 SER n 
1 133 GLY n 
1 134 GLY n 
1 135 ALA n 
1 136 SER n 
1 137 VAL n 
1 138 VAL n 
1 139 CYS n 
1 140 PHE n 
1 141 LEU n 
1 142 ASN n 
1 143 ASN n 
1 144 PHE n 
1 145 TYR n 
1 146 PRO n 
1 147 LYS n 
1 148 ASP n 
1 149 ILE n 
1 150 ASN n 
1 151 VAL n 
1 152 LYS n 
1 153 TRP n 
1 154 LYS n 
1 155 ILE n 
1 156 ASP n 
1 157 GLY n 
1 158 SER n 
1 159 GLU n 
1 160 ARG n 
1 161 GLN n 
1 162 ASN n 
1 163 GLY n 
1 164 VAL n 
1 165 LEU n 
1 166 ASN n 
1 167 SER n 
1 168 TRP n 
1 169 THR n 
1 170 ASP n 
1 171 GLN n 
1 172 ASP n 
1 173 SER n 
1 174 LYS n 
1 175 ASP n 
1 176 SER n 
1 177 THR n 
1 178 TYR n 
1 179 SER n 
1 180 MET n 
1 181 SER n 
1 182 SER n 
1 183 THR n 
1 184 LEU n 
1 185 THR n 
1 186 LEU n 
1 187 THR n 
1 188 LYS n 
1 189 ASP n 
1 190 GLU n 
1 191 TYR n 
1 192 GLU n 
1 193 ARG n 
1 194 HIS n 
1 195 ASN n 
1 196 SER n 
1 197 TYR n 
1 198 THR n 
1 199 CYS n 
1 200 GLU n 
1 201 ALA n 
1 202 THR n 
1 203 HIS n 
1 204 LYS n 
1 205 THR n 
1 206 SER n 
1 207 THR n 
1 208 SER n 
1 209 PRO n 
1 210 ILE n 
1 211 VAL n 
1 212 LYS n 
1 213 SER n 
1 214 PHE n 
1 215 ASN n 
1 216 ARG n 
1 217 ASN n 
1 218 GLU n 
1 219 CYS n 
2 1   GLU n 
2 2   VAL n 
2 3   LYS n 
2 4   LEU n 
2 5   GLN n 
2 6   GLU n 
2 7   SER n 
2 8   GLY n 
2 9   ALA n 
2 10  GLU n 
2 11  LEU n 
2 12  VAL n 
2 13  ARG n 
2 14  PRO n 
2 15  GLY n 
2 16  ALA n 
2 17  SER n 
2 18  VAL n 
2 19  LYS n 
2 20  LEU n 
2 21  SER n 
2 22  CYS n 
2 23  LYS n 
2 24  THR n 
2 25  SER n 
2 26  GLY n 
2 27  TYR n 
2 28  ILE n 
2 29  PHE n 
2 30  THR n 
2 31  SER n 
2 32  TYR n 
2 33  TRP n 
2 34  ILE n 
2 35  HIS n 
2 36  TRP n 
2 37  VAL n 
2 38  LYS n 
2 39  GLN n 
2 40  ARG n 
2 41  ALA n 
2 42  ALA n 
2 43  ALA n 
2 44  GLY n 
2 45  LEU n 
2 46  GLU n 
2 47  TRP n 
2 48  ILE n 
2 49  ALA n 
2 50  ARG n 
2 51  ILE n 
2 52  TYR n 
2 53  PRO n 
2 54  GLY n 
2 55  THR n 
2 56  GLY n 
2 57  SER n 
2 58  SER n 
2 59  TYR n 
2 60  TYR n 
2 61  ASN n 
2 62  VAL n 
2 63  LYS n 
2 64  PHE n 
2 65  LYS n 
2 66  GLY n 
2 67  LYS n 
2 68  ALA n 
2 69  THR n 
2 70  LEU n 
2 71  THR n 
2 72  ALA n 
2 73  ASP n 
2 74  LYS n 
2 75  SER n 
2 76  SER n 
2 77  SER n 
2 78  THR n 
2 79  ALA n 
2 80  TYR n 
2 81  MET n 
2 82  GLN n 
2 83  LEU n 
2 84  SER n 
2 85  SER n 
2 86  LEU n 
2 87  LYS n 
2 88  SER n 
2 89  ASP n 
2 90  ASP n 
2 91  SER n 
2 92  ALA n 
2 93  VAL n 
2 94  TYR n 
2 95  PHE n 
2 96  CYS n 
2 97  VAL n 
2 98  ARG n 
2 99  TRP n 
2 100 GLY n 
2 101 PHE n 
2 102 ILE n 
2 103 PRO n 
2 104 VAL n 
2 105 ARG n 
2 106 GLU n 
2 107 ASP n 
2 108 TYR n 
2 109 VAL n 
2 110 LEU n 
2 111 ASP n 
2 112 TYR n 
2 113 TRP n 
2 114 GLY n 
2 115 GLN n 
2 116 GLY n 
2 117 THR n 
2 118 LEU n 
2 119 VAL n 
2 120 THR n 
2 121 VAL n 
2 122 SER n 
2 123 SER n 
2 124 ALA n 
2 125 LYS n 
2 126 THR n 
2 127 THR n 
2 128 ALA n 
2 129 PRO n 
2 130 SER n 
2 131 VAL n 
2 132 TYR n 
2 133 PRO n 
2 134 LEU n 
2 135 ALA n 
2 136 PRO n 
2 137 VAL n 
2 138 CYS n 
2 139 GLY n 
2 140 ASP n 
2 141 THR n 
2 142 THR n 
2 143 GLY n 
2 144 SER n 
2 145 SER n 
2 146 VAL n 
2 147 THR n 
2 148 LEU n 
2 149 GLY n 
2 150 CYS n 
2 151 LEU n 
2 152 VAL n 
2 153 LYS n 
2 154 GLY n 
2 155 TYR n 
2 156 PHE n 
2 157 PRO n 
2 158 GLU n 
2 159 PRO n 
2 160 VAL n 
2 161 THR n 
2 162 LEU n 
2 163 THR n 
2 164 TRP n 
2 165 ASN n 
2 166 SER n 
2 167 GLY n 
2 168 SER n 
2 169 LEU n 
2 170 SER n 
2 171 SER n 
2 172 GLY n 
2 173 VAL n 
2 174 HIS n 
2 175 THR n 
2 176 PHE n 
2 177 PRO n 
2 178 ALA n 
2 179 VAL n 
2 180 LEU n 
2 181 GLN n 
2 182 SER n 
2 183 ASP n 
2 184 LEU n 
2 185 TYR n 
2 186 THR n 
2 187 LEU n 
2 188 SER n 
2 189 SER n 
2 190 SER n 
2 191 VAL n 
2 192 THR n 
2 193 VAL n 
2 194 THR n 
2 195 SER n 
2 196 SER n 
2 197 THR n 
2 198 TRP n 
2 199 PRO n 
2 200 SER n 
2 201 GLN n 
2 202 SER n 
2 203 ILE n 
2 204 THR n 
2 205 CYS n 
2 206 ASN n 
2 207 VAL n 
2 208 ALA n 
2 209 HIS n 
2 210 PRO n 
2 211 ALA n 
2 212 SER n 
2 213 SER n 
2 214 THR n 
2 215 LYS n 
2 216 VAL n 
2 217 ASP n 
2 218 LYS n 
2 219 LYS n 
2 220 ILE n 
2 221 GLU n 
2 222 PRO n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? 'house mouse' 'Mus musculus' 10090 Mus ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? 'house mouse' 'Mus musculus' 10090 Mus ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 PIR S16112     1 S16112 1 
;DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLYWYLQKPGQSPKPLIYRVSNRFSGVPDRFSGSGSGTDFTLKI
SRVEAEDLGVYFCFQGTHVPYTFGGGTRLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSER
QNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
? 
2 UNP GCAM_MOUSE 2 P01865 1 
;AKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSI
TCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISW
FVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEE
MTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHT
TKSFSRTPGLDLDDVCAEAQDGELDGLWTTITIFISLFLLSVCYSASVTLFKVKWIFSSVVELKQTISPDYRNMIGQGA
;
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1YEE L 1   ? 219 ? S16112 1 ? 219 ? 1   214 
2 2 1YEE H 124 ? 222 ? P01865 1 ? 99  ? 114 223 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1YEE ILE L 2   ? PIR S16112 VAL 2   CONFLICT 2   1  
1 1YEE SER L 7   ? PIR S16112 THR 7   CONFLICT 7   2  
1 1YEE THR L 10  ? PIR S16112 SER 10  CONFLICT 10  3  
1 1YEE SER L 12  ? PIR S16112 PRO 12  CONFLICT 12  4  
1 1YEE THR L 14  ? PIR S16112 SER 14  CONFLICT 14  5  
1 1YEE ILE L 15  ? PIR S16112 LEU 15  CONFLICT 15  6  
1 1YEE GLN L 17  ? PIR S16112 ASP 17  CONFLICT 17  7  
1 1YEE PRO L 18  ? PIR S16112 GLN 18  CONFLICT 18  8  
1 1YEE LYS L 24  ? PIR S16112 ARG 24  CONFLICT 24  9  
1 1YEE LEU L 29  B PIR S16112 VAL 30  CONFLICT 27  10 
1 1YEE TYR L 31  D PIR S16112 HIS 31  CONFLICT 27  11 
1 1YEE LYS L 35  ? PIR S16112 ASN 35  CONFLICT 30  12 
1 1YEE SER L 39  ? PIR S16112 TYR 39  CONFLICT 34  13 
1 1YEE LEU L 41  ? PIR S16112 TYR 41  CONFLICT 36  14 
1 1YEE ARG L 44  ? PIR S16112 LYS 44  CONFLICT 39  15 
1 1YEE ARG L 51  ? PIR S16112 PRO 51  CONFLICT 46  16 
1 1YEE LEU L 55  ? PIR S16112 ARG 55  CONFLICT 50  17 
1 1YEE LYS L 58  ? PIR S16112 ASN 58  CONFLICT 53  18 
1 1YEE LEU L 59  ? PIR S16112 ARG 59  CONFLICT 54  19 
1 1YEE ASP L 60  ? PIR S16112 PHE 60  CONFLICT 55  20 
1 1YEE THR L 68  ? PIR S16112 SER 68  CONFLICT 63  21 
1 1YEE ALA L 86  ? PIR S16112 GLU 86  CONFLICT 81  22 
1 1YEE LEU L 90  ? PIR S16112 VAL 90  CONFLICT 85  23 
1 1YEE TYR L 92  ? PIR S16112 PHE 92  CONFLICT 87  24 
1 1YEE VAL L 94  ? PIR S16112 PHE 94  CONFLICT 89  25 
1 1YEE PHE L 99  ? PIR S16112 VAL 99  CONFLICT 94  26 
1 1YEE LYS L 108 ? PIR S16112 ARG 108 CONFLICT 103 27 
1 1YEE LEU L 112 ? PIR S16112 LYS 112 CONFLICT 107 28 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                 ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                              ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                         ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                               ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                         ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                 ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                               ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                   ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                              ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                 ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                  ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                              ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                           ? 'C9 H11 N O2'     165.189 
PNB non-polymer         . 4-NITRO-BENZYLPHOSPHONOBUTANOYL-GLYCINE ? 'C13 H17 N2 O8 P' 360.256 
PRO 'L-peptide linking' y PROLINE                                 ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                  ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                               ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                              ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                  ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1YEE 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.48 
_exptl_crystal.density_percent_sol   50.48 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 5.6' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           280 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1995-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GRAPHITE(002)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.375 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'LURE BEAMLINE D41A' 
_diffrn_source.pdbx_synchrotron_site       LURE 
_diffrn_source.pdbx_synchrotron_beamline   D41A 
_diffrn_source.pdbx_wavelength             1.375 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1YEE 
_reflns.observed_criterion_sigma_I   1. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20. 
_reflns.d_resolution_high            2.2 
_reflns.number_obs                   21342 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95. 
_reflns.pdbx_Rmerge_I_obs            0.083 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.6 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1YEE 
_refine.ls_number_reflns_obs                     77209 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             7.0 
_refine.ls_d_res_high                            2.2 
_refine.ls_percent_reflns_obs                    95. 
_refine.ls_R_factor_obs                          0.204 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.204 
_refine.ls_R_factor_R_free                       0.26 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               20. 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;RESIDUES POORLY DEFINED BY THE ELECTRON DENSITY:
CHAIN L: 213 - 214
CHAIN H: 129 - 132
;
_refine.pdbx_starting_model                      'PDB ENTRY 1YEC' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1YEE 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3380 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         24 
_refine_hist.number_atoms_solvent             93 
_refine_hist.number_atoms_total               3497 
_refine_hist.d_res_high                       2.2 
_refine_hist.d_res_low                        7.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.013 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.89  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      28.79 ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.56  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1YEE 
_struct.title                     'STRUCTURE OF A CATALYTIC ANTIBODY, IGG2A FAB FRAGMENT (D2.5)' 
_struct.pdbx_descriptor           'IGG2A FAB FRAGMENT (D2.5), 4-NITRO-BENZYLPHOSPHONOBUTANOYL-GLYCINE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1YEE 
_struct_keywords.pdbx_keywords   'CATALYTIC ANTIBODY' 
_struct_keywords.text            'CATALYTIC ANTIBODY, TRANSITION STATE ANALOGUE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 85  ? ASP A 87  ? ALA L 80  ASP L 82  5 ? 3 
HELX_P HELX_P2 2 SER A 127 ? SER A 132 ? SER L 122 SER L 127 1 ? 6 
HELX_P HELX_P3 3 LYS A 188 ? ARG A 193 ? LYS L 183 ARG L 188 1 ? 6 
HELX_P HELX_P4 4 PHE B 29  ? SER B 31  ? PHE H 29  SER H 31  5 ? 3 
HELX_P HELX_P5 5 VAL B 62  ? PHE B 64  ? VAL H 61  PHE H 63  5 ? 3 
HELX_P HELX_P6 6 SER B 88  ? ASP B 90  ? SER H 84  ASP H 86  5 ? 3 
HELX_P HELX_P7 7 ASN B 165 ? GLY B 167 ? ASN H 160 GLY H 162 5 ? 3 
HELX_P HELX_P8 8 PRO B 210 ? SER B 212 ? PRO H 211 SER H 213 5 ? 3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 23  SG ? ? ? 1_555 A CYS 93  SG ? ? L CYS 23  L CYS 88  1_555 ? ? ? ? ? ? ? 2.000 ? 
disulf2 disulf ? ? A CYS 139 SG ? ? ? 1_555 A CYS 199 SG ? ? L CYS 134 L CYS 194 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf3 disulf ? ? B CYS 22  SG ? ? ? 1_555 B CYS 96  SG ? ? H CYS 22  H CYS 92  1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf4 disulf ? ? B CYS 150 SG ? ? ? 1_555 B CYS 205 SG ? ? H CYS 140 H CYS 206 1_555 ? ? ? ? ? ? ? 2.023 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 7   A . ? SER 7   L PRO 8   A ? PRO 8   L 1 -0.37 
2 PHE 99  A . ? PHE 94  L PRO 100 A ? PRO 95  L 1 -0.29 
3 TYR 145 A . ? TYR 140 L PRO 146 A ? PRO 141 L 1 0.33  
4 PHE 156 B . ? PHE 146 H PRO 157 B ? PRO 147 H 1 -1.22 
5 GLU 158 B . ? GLU 148 H PRO 159 B ? PRO 149 H 1 0.12  
6 TRP 198 B . ? TRP 197 H PRO 199 B ? PRO 198 H 1 0.63  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 5 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 6 ? 
G ? 4 ? 
H ? 3 ? 
I ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
F 5 6 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 MET A 4   ? SER A 7   ? MET L 4   SER L 7   
A 2 ALA A 19  ? SER A 25  ? ALA L 19  SER L 25  
A 3 ASP A 75  ? ILE A 80  ? ASP L 70  ILE L 75  
A 4 PHE A 67  ? SER A 72  ? PHE L 62  SER L 67  
B 1 THR A 10  ? THR A 14  ? THR L 10  THR L 14  
B 2 THR A 107 ? LEU A 112 ? THR L 102 LEU L 107 
B 3 GLY A 89  ? GLN A 95  ? GLY L 84  GLN L 90  
B 4 LEU A 38  ? GLN A 43  ? LEU L 33  GLN L 38  
B 5 LYS A 50  ? ILE A 53  ? LYS L 45  ILE L 48  
C 1 THR A 119 ? PHE A 123 ? THR L 114 PHE L 118 
C 2 GLY A 134 ? ASN A 142 ? GLY L 129 ASN L 137 
C 3 MET A 180 ? THR A 187 ? MET L 175 THR L 182 
C 4 VAL A 164 ? TRP A 168 ? VAL L 159 TRP L 163 
D 1 SER A 158 ? ARG A 160 ? SER L 153 ARG L 155 
D 2 ILE A 149 ? ILE A 155 ? ILE L 144 ILE L 150 
D 3 SER A 196 ? HIS A 203 ? SER L 191 HIS L 198 
D 4 ILE A 210 ? ASN A 215 ? ILE L 205 ASN L 210 
E 1 LYS B 3   ? GLU B 6   ? LYS H 3   GLU H 6   
E 2 VAL B 18  ? SER B 25  ? VAL H 18  SER H 25  
E 3 THR B 78  ? LEU B 83  ? THR H 77  LEU H 82  
E 4 ALA B 68  ? ASP B 73  ? ALA H 67  ASP H 72  
F 1 GLU B 10  ? VAL B 12  ? GLU H 10  VAL H 12  
F 2 THR B 117 ? VAL B 121 ? THR H 107 VAL H 111 
F 3 ALA B 92  ? VAL B 97  ? ALA H 88  VAL H 93  
F 4 TRP B 33  ? ARG B 40  ? TRP H 33  ARG H 40  
F 5 GLY B 44  ? TYR B 52  ? GLY H 44  TYR H 52  
F 6 SER B 57  ? TYR B 60  ? SER H 56  TYR H 59  
G 1 SER B 130 ? LEU B 134 ? SER H 120 LEU H 124 
G 2 SER B 145 ? TYR B 155 ? SER H 135 TYR H 145 
G 3 TYR B 185 ? THR B 194 ? TYR H 183 THR H 192 
G 4 VAL B 173 ? THR B 175 ? VAL H 169 THR H 171 
H 1 THR B 161 ? TRP B 164 ? THR H 151 TRP H 155 
H 2 THR B 204 ? HIS B 209 ? THR H 204 HIS H 210 
H 3 THR B 214 ? LYS B 219 ? THR H 215 LYS H 220 
I 1 VAL B 179 ? GLN B 181 ? VAL H 175 GLN H 177 
I 2 LEU B 184 ? THR B 186 ? LEU H 182 THR H 184 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 5   ? O THR L 5   N LYS A 24  ? N LYS L 24  
A 2 3 O ALA A 19  ? O ALA L 19  N ILE A 80  ? N ILE L 75  
A 3 4 O ASP A 75  ? O ASP L 70  N SER A 72  ? N SER L 67  
B 1 2 O LEU A 11  ? O LEU L 11  N LYS A 108 ? N LYS L 103 
B 2 3 O THR A 107 ? O THR L 102 N TYR A 91  ? N TYR L 86  
B 3 4 O LEU A 90  ? O LEU L 85  N GLN A 43  ? N GLN L 38  
B 4 5 O TRP A 40  ? O TRP L 35  N ILE A 53  ? N ILE L 48  
C 1 2 O THR A 119 ? O THR L 114 N ASN A 142 ? N ASN L 137 
C 2 3 O ALA A 135 ? O ALA L 130 N LEU A 186 ? N LEU L 181 
C 3 4 O SER A 181 ? O SER L 176 N SER A 167 ? N SER L 162 
D 1 2 O SER A 158 ? O SER L 153 N ILE A 155 ? N ILE L 150 
D 2 3 O ASN A 150 ? O ASN L 145 N THR A 202 ? N THR L 197 
D 3 4 O TYR A 197 ? O TYR L 192 N PHE A 214 ? N PHE L 209 
E 1 2 O LYS B 3   ? O LYS H 3   N SER B 25  ? N SER H 25  
E 2 3 O VAL B 18  ? O VAL H 18  N LEU B 83  ? N LEU H 82  
E 3 4 O THR B 78  ? O THR H 77  N ASP B 73  ? N ASP H 72  
F 1 2 O GLU B 10  ? O GLU H 10  N THR B 120 ? N THR H 110 
F 2 3 O THR B 117 ? O THR H 107 N TYR B 94  ? N TYR H 90  
F 3 4 O VAL B 93  ? O VAL H 89  N GLN B 39  ? N GLN H 39  
F 4 5 O ILE B 34  ? O ILE H 34  N ILE B 51  ? N ILE H 51  
F 5 6 O ARG B 50  ? O ARG H 50  N TYR B 59  ? N TYR H 58  
G 1 2 O SER B 130 ? O SER H 120 N LYS B 153 ? N LYS H 143 
G 2 3 O VAL B 146 ? O VAL H 136 N VAL B 193 ? N VAL H 191 
G 3 4 O SER B 190 ? O SER H 188 N HIS B 174 ? N HIS H 170 
H 1 2 O THR B 161 ? O THR H 151 N ALA B 208 ? N ALA H 209 
H 2 3 O CYS B 205 ? O CYS H 206 N LYS B 218 ? N LYS H 219 
I 1 2 O VAL B 179 ? O VAL H 175 N THR B 186 ? N THR H 184 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    10 
_struct_site.details              'BINDING SITE FOR RESIDUE PNB H 551' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 HIS B 35  ? HIS H 35  . ? 1_555 ? 
2  AC1 10 TRP B 99  ? TRP H 95  . ? 1_555 ? 
3  AC1 10 PHE B 101 ? PHE H 97  . ? 1_555 ? 
4  AC1 10 TYR B 108 D TYR H 100 . ? 1_555 ? 
5  AC1 10 HOH E .   ? HOH H 580 . ? 1_555 ? 
6  AC1 10 TYR A 31  D TYR L 27  . ? 1_555 ? 
7  AC1 10 VAL A 94  ? VAL L 89  . ? 1_555 ? 
8  AC1 10 GLY A 96  ? GLY L 91  . ? 1_555 ? 
9  AC1 10 TYR A 101 ? TYR L 96  . ? 1_555 ? 
10 AC1 10 PHE A 103 ? PHE L 98  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1YEE 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1YEE 
_atom_sites.fract_transf_matrix[1][1]   0.014721 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001205 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012990 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.021907 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 1   ? 12.331  -14.329 17.161  1.00 28.46 ? 1   ASP L N   1 
ATOM   2    C CA  . ASP A 1 1   ? 11.961  -13.547 15.951  1.00 27.96 ? 1   ASP L CA  1 
ATOM   3    C C   . ASP A 1 1   ? 13.038  -13.770 14.929  1.00 26.37 ? 1   ASP L C   1 
ATOM   4    O O   . ASP A 1 1   ? 14.156  -14.103 15.309  1.00 25.39 ? 1   ASP L O   1 
ATOM   5    C CB  . ASP A 1 1   ? 11.892  -12.061 16.289  1.00 29.74 ? 1   ASP L CB  1 
ATOM   6    C CG  . ASP A 1 1   ? 10.967  -11.775 17.456  1.00 31.59 ? 1   ASP L CG  1 
ATOM   7    O OD1 . ASP A 1 1   ? 10.118  -12.640 17.787  1.00 32.39 ? 1   ASP L OD1 1 
ATOM   8    O OD2 . ASP A 1 1   ? 11.093  -10.679 18.049  1.00 32.82 ? 1   ASP L OD2 1 
ATOM   9    N N   . ILE A 1 2   ? 12.678  -13.638 13.647  1.00 24.98 ? 2   ILE L N   1 
ATOM   10   C CA  . ILE A 1 2   ? 13.609  -13.794 12.514  1.00 22.86 ? 2   ILE L CA  1 
ATOM   11   C C   . ILE A 1 2   ? 14.524  -12.579 12.437  1.00 21.25 ? 2   ILE L C   1 
ATOM   12   O O   . ILE A 1 2   ? 14.035  -11.453 12.391  1.00 21.08 ? 2   ILE L O   1 
ATOM   13   C CB  . ILE A 1 2   ? 12.861  -13.816 11.163  1.00 23.00 ? 2   ILE L CB  1 
ATOM   14   C CG1 . ILE A 1 2   ? 11.713  -14.798 11.226  1.00 23.04 ? 2   ILE L CG1 1 
ATOM   15   C CG2 . ILE A 1 2   ? 13.808  -14.162 10.023  1.00 21.71 ? 2   ILE L CG2 1 
ATOM   16   C CD1 . ILE A 1 2   ? 12.127  -16.133 11.600  1.00 24.14 ? 2   ILE L CD1 1 
ATOM   17   N N   . VAL A 1 3   ? 15.835  -12.787 12.406  1.00 18.77 ? 3   VAL L N   1 
ATOM   18   C CA  . VAL A 1 3   ? 16.731  -11.651 12.290  1.00 17.32 ? 3   VAL L CA  1 
ATOM   19   C C   . VAL A 1 3   ? 16.995  -11.413 10.804  1.00 16.86 ? 3   VAL L C   1 
ATOM   20   O O   . VAL A 1 3   ? 17.226  -12.363 10.047  1.00 16.45 ? 3   VAL L O   1 
ATOM   21   C CB  . VAL A 1 3   ? 18.070  -11.899 13.005  1.00 17.35 ? 3   VAL L CB  1 
ATOM   22   C CG1 . VAL A 1 3   ? 18.887  -10.628 13.025  1.00 16.43 ? 3   VAL L CG1 1 
ATOM   23   C CG2 . VAL A 1 3   ? 17.826  -12.389 14.408  1.00 16.67 ? 3   VAL L CG2 1 
ATOM   24   N N   . MET A 1 4   ? 16.883  -10.159 10.380  1.00 16.60 ? 4   MET L N   1 
ATOM   25   C CA  . MET A 1 4   ? 17.122  -9.770  8.991   1.00 15.29 ? 4   MET L CA  1 
ATOM   26   C C   . MET A 1 4   ? 18.448  -9.000  8.961   1.00 15.71 ? 4   MET L C   1 
ATOM   27   O O   . MET A 1 4   ? 18.578  -7.936  9.585   1.00 15.87 ? 4   MET L O   1 
ATOM   28   C CB  . MET A 1 4   ? 15.999  -8.855  8.477   1.00 14.89 ? 4   MET L CB  1 
ATOM   29   C CG  . MET A 1 4   ? 14.620  -9.465  8.391   1.00 13.22 ? 4   MET L CG  1 
ATOM   30   S SD  . MET A 1 4   ? 14.664  -10.902 7.360   1.00 13.48 ? 4   MET L SD  1 
ATOM   31   C CE  . MET A 1 4   ? 14.419  -10.200 5.845   1.00 13.47 ? 4   MET L CE  1 
ATOM   32   N N   . THR A 1 5   ? 19.436  -9.544  8.260   1.00 15.47 ? 5   THR L N   1 
ATOM   33   C CA  . THR A 1 5   ? 20.744  -8.903  8.172   1.00 15.32 ? 5   THR L CA  1 
ATOM   34   C C   . THR A 1 5   ? 21.021  -8.262  6.804   1.00 14.34 ? 5   THR L C   1 
ATOM   35   O O   . THR A 1 5   ? 20.965  -8.919  5.781   1.00 13.93 ? 5   THR L O   1 
ATOM   36   C CB  . THR A 1 5   ? 21.871  -9.916  8.563   1.00 15.80 ? 5   THR L CB  1 
ATOM   37   O OG1 . THR A 1 5   ? 21.553  -10.501 9.834   1.00 16.33 ? 5   THR L OG1 1 
ATOM   38   C CG2 . THR A 1 5   ? 23.233  -9.215  8.683   1.00 15.56 ? 5   THR L CG2 1 
ATOM   39   N N   . GLN A 1 6   ? 21.288  -6.963  6.803   1.00 15.03 ? 6   GLN L N   1 
ATOM   40   C CA  . GLN A 1 6   ? 21.578  -6.219  5.582   1.00 16.58 ? 6   GLN L CA  1 
ATOM   41   C C   . GLN A 1 6   ? 23.067  -5.855  5.446   1.00 18.35 ? 6   GLN L C   1 
ATOM   42   O O   . GLN A 1 6   ? 23.732  -5.557  6.441   1.00 19.23 ? 6   GLN L O   1 
ATOM   43   C CB  . GLN A 1 6   ? 20.779  -4.911  5.567   1.00 14.44 ? 6   GLN L CB  1 
ATOM   44   C CG  . GLN A 1 6   ? 19.328  -5.096  5.289   1.00 13.71 ? 6   GLN L CG  1 
ATOM   45   C CD  . GLN A 1 6   ? 18.614  -3.796  5.154   1.00 13.47 ? 6   GLN L CD  1 
ATOM   46   O OE1 . GLN A 1 6   ? 17.706  -3.522  5.911   1.00 14.31 ? 6   GLN L OE1 1 
ATOM   47   N NE2 . GLN A 1 6   ? 19.022  -2.971  4.197   1.00 13.40 ? 6   GLN L NE2 1 
ATOM   48   N N   . SER A 1 7   ? 23.580  -5.882  4.220   1.00 19.34 ? 7   SER L N   1 
ATOM   49   C CA  . SER A 1 7   ? 24.957  -5.493  3.963   1.00 21.61 ? 7   SER L CA  1 
ATOM   50   C C   . SER A 1 7   ? 25.082  -4.932  2.542   1.00 22.32 ? 7   SER L C   1 
ATOM   51   O O   . SER A 1 7   ? 24.341  -5.341  1.647   1.00 23.12 ? 7   SER L O   1 
ATOM   52   C CB  . SER A 1 7   ? 25.944  -6.658  4.206   1.00 21.88 ? 7   SER L CB  1 
ATOM   53   O OG  . SER A 1 7   ? 25.563  -7.836  3.526   1.00 22.48 ? 7   SER L OG  1 
ATOM   54   N N   . PRO A 1 8   ? 25.918  -3.897  2.350   1.00 22.68 ? 8   PRO L N   1 
ATOM   55   C CA  . PRO A 1 8   ? 26.732  -3.228  3.365   1.00 22.79 ? 8   PRO L CA  1 
ATOM   56   C C   . PRO A 1 8   ? 25.864  -2.316  4.202   1.00 24.04 ? 8   PRO L C   1 
ATOM   57   O O   . PRO A 1 8   ? 24.725  -2.014  3.829   1.00 24.43 ? 8   PRO L O   1 
ATOM   58   C CB  . PRO A 1 8   ? 27.683  -2.377  2.530   1.00 22.75 ? 8   PRO L CB  1 
ATOM   59   C CG  . PRO A 1 8   ? 26.843  -2.011  1.352   1.00 22.50 ? 8   PRO L CG  1 
ATOM   60   C CD  . PRO A 1 8   ? 26.204  -3.342  1.014   1.00 22.32 ? 8   PRO L CD  1 
ATOM   61   N N   . LEU A 1 9   ? 26.413  -1.874  5.325   1.00 24.23 ? 9   LEU L N   1 
ATOM   62   C CA  . LEU A 1 9   ? 25.712  -0.964  6.212   1.00 25.23 ? 9   LEU L CA  1 
ATOM   63   C C   . LEU A 1 9   ? 25.629  0.390   5.557   1.00 24.25 ? 9   LEU L C   1 
ATOM   64   O O   . LEU A 1 9   ? 24.715  1.161   5.802   1.00 24.81 ? 9   LEU L O   1 
ATOM   65   C CB  . LEU A 1 9   ? 26.432  -0.856  7.562   1.00 27.23 ? 9   LEU L CB  1 
ATOM   66   C CG  . LEU A 1 9   ? 26.053  -2.005  8.512   1.00 29.81 ? 9   LEU L CG  1 
ATOM   67   C CD1 . LEU A 1 9   ? 24.501  -2.125  8.557   1.00 30.98 ? 9   LEU L CD1 1 
ATOM   68   C CD2 . LEU A 1 9   ? 26.657  -3.350  8.037   1.00 31.13 ? 9   LEU L CD2 1 
ATOM   69   N N   . THR A 1 10  ? 26.547  0.651   4.652   1.00 24.04 ? 10  THR L N   1 
ATOM   70   C CA  . THR A 1 10  ? 26.558  1.926   3.979   1.00 24.54 ? 10  THR L CA  1 
ATOM   71   C C   . THR A 1 10  ? 27.282  1.782   2.636   1.00 22.70 ? 10  THR L C   1 
ATOM   72   O O   . THR A 1 10  ? 28.124  0.922   2.484   1.00 22.16 ? 10  THR L O   1 
ATOM   73   C CB  . THR A 1 10  ? 27.238  2.948   4.906   1.00 25.72 ? 10  THR L CB  1 
ATOM   74   O OG1 . THR A 1 10  ? 27.410  4.199   4.230   1.00 28.42 ? 10  THR L OG1 1 
ATOM   75   C CG2 . THR A 1 10  ? 28.581  2.417   5.379   1.00 26.88 ? 10  THR L CG2 1 
ATOM   76   N N   . LEU A 1 11  ? 26.846  2.504   1.620   1.00 22.27 ? 11  LEU L N   1 
ATOM   77   C CA  . LEU A 1 11  ? 27.531  2.424   0.348   1.00 22.35 ? 11  LEU L CA  1 
ATOM   78   C C   . LEU A 1 11  ? 27.564  3.762   -0.327  1.00 21.72 ? 11  LEU L C   1 
ATOM   79   O O   . LEU A 1 11  ? 26.625  4.540   -0.211  1.00 23.11 ? 11  LEU L O   1 
ATOM   80   C CB  . LEU A 1 11  ? 26.984  1.318   -0.587  1.00 23.10 ? 11  LEU L CB  1 
ATOM   81   C CG  . LEU A 1 11  ? 25.621  0.992   -1.225  1.00 22.64 ? 11  LEU L CG  1 
ATOM   82   C CD1 . LEU A 1 11  ? 25.002  2.128   -1.955  1.00 23.86 ? 11  LEU L CD1 1 
ATOM   83   C CD2 . LEU A 1 11  ? 25.870  -0.115  -2.211  1.00 22.40 ? 11  LEU L CD2 1 
ATOM   84   N N   . SER A 1 12  ? 28.678  4.059   -0.984  1.00 20.44 ? 12  SER L N   1 
ATOM   85   C CA  . SER A 1 12  ? 28.835  5.329   -1.667  1.00 19.36 ? 12  SER L CA  1 
ATOM   86   C C   . SER A 1 12  ? 28.935  5.003   -3.134  1.00 18.29 ? 12  SER L C   1 
ATOM   87   O O   . SER A 1 12  ? 29.855  4.314   -3.539  1.00 18.96 ? 12  SER L O   1 
ATOM   88   C CB  . SER A 1 12  ? 30.103  6.006   -1.181  1.00 20.31 ? 12  SER L CB  1 
ATOM   89   O OG  . SER A 1 12  ? 30.080  7.371   -1.554  1.00 24.70 ? 12  SER L OG  1 
ATOM   90   N N   . VAL A 1 13  ? 27.984  5.468   -3.933  1.00 16.19 ? 13  VAL L N   1 
ATOM   91   C CA  . VAL A 1 13  ? 27.985  5.151   -5.352  1.00 14.44 ? 13  VAL L CA  1 
ATOM   92   C C   . VAL A 1 13  ? 27.968  6.411   -6.175  1.00 14.15 ? 13  VAL L C   1 
ATOM   93   O O   . VAL A 1 13  ? 27.411  7.412   -5.749  1.00 14.17 ? 13  VAL L O   1 
ATOM   94   C CB  . VAL A 1 13  ? 26.732  4.321   -5.729  1.00 14.62 ? 13  VAL L CB  1 
ATOM   95   C CG1 . VAL A 1 13  ? 26.795  3.893   -7.187  1.00 13.75 ? 13  VAL L CG1 1 
ATOM   96   C CG2 . VAL A 1 13  ? 26.608  3.106   -4.833  1.00 14.91 ? 13  VAL L CG2 1 
ATOM   97   N N   . THR A 1 14  ? 28.592  6.398   -7.340  1.00 13.98 ? 14  THR L N   1 
ATOM   98   C CA  . THR A 1 14  ? 28.556  7.589   -8.152  1.00 15.13 ? 14  THR L CA  1 
ATOM   99   C C   . THR A 1 14  ? 27.335  7.519   -9.071  1.00 14.01 ? 14  THR L C   1 
ATOM   100  O O   . THR A 1 14  ? 26.930  6.446   -9.514  1.00 14.47 ? 14  THR L O   1 
ATOM   101  C CB  . THR A 1 14  ? 29.890  7.829   -8.957  1.00 16.97 ? 14  THR L CB  1 
ATOM   102  O OG1 . THR A 1 14  ? 29.768  7.310   -10.282 1.00 19.52 ? 14  THR L OG1 1 
ATOM   103  C CG2 . THR A 1 14  ? 31.080  7.171   -8.281  1.00 17.02 ? 14  THR L CG2 1 
ATOM   104  N N   . ILE A 1 15  ? 26.741  8.663   -9.346  1.00 13.45 ? 15  ILE L N   1 
ATOM   105  C CA  . ILE A 1 15  ? 25.575  8.721   -10.208 1.00 13.87 ? 15  ILE L CA  1 
ATOM   106  C C   . ILE A 1 15  ? 25.856  8.097   -11.569 1.00 14.06 ? 15  ILE L C   1 
ATOM   107  O O   . ILE A 1 15  ? 26.914  8.333   -12.157 1.00 14.69 ? 15  ILE L O   1 
ATOM   108  C CB  . ILE A 1 15  ? 25.104  10.172  -10.384 1.00 13.87 ? 15  ILE L CB  1 
ATOM   109  C CG1 . ILE A 1 15  ? 24.538  10.679  -9.066  1.00 14.77 ? 15  ILE L CG1 1 
ATOM   110  C CG2 . ILE A 1 15  ? 24.045  10.275  -11.453 1.00 14.46 ? 15  ILE L CG2 1 
ATOM   111  C CD1 . ILE A 1 15  ? 23.813  11.953  -9.226  1.00 16.36 ? 15  ILE L CD1 1 
ATOM   112  N N   . GLY A 1 16  ? 24.921  7.293   -12.065 1.00 12.68 ? 16  GLY L N   1 
ATOM   113  C CA  . GLY A 1 16  ? 25.118  6.664   -13.355 1.00 10.89 ? 16  GLY L CA  1 
ATOM   114  C C   . GLY A 1 16  ? 25.659  5.258   -13.246 1.00 11.21 ? 16  GLY L C   1 
ATOM   115  O O   . GLY A 1 16  ? 25.647  4.511   -14.219 1.00 12.39 ? 16  GLY L O   1 
ATOM   116  N N   . GLN A 1 17  ? 26.088  4.874   -12.055 1.00 10.44 ? 17  GLN L N   1 
ATOM   117  C CA  . GLN A 1 17  ? 26.631  3.552   -11.846 1.00 10.01 ? 17  GLN L CA  1 
ATOM   118  C C   . GLN A 1 17  ? 25.629  2.645   -11.141 1.00 9.90  ? 17  GLN L C   1 
ATOM   119  O O   . GLN A 1 17  ? 24.697  3.119   -10.525 1.00 8.75  ? 17  GLN L O   1 
ATOM   120  C CB  . GLN A 1 17  ? 27.918  3.677   -11.031 1.00 9.48  ? 17  GLN L CB  1 
ATOM   121  C CG  . GLN A 1 17  ? 29.051  4.290   -11.812 1.00 10.06 ? 17  GLN L CG  1 
ATOM   122  C CD  . GLN A 1 17  ? 29.334  3.514   -13.085 1.00 9.55  ? 17  GLN L CD  1 
ATOM   123  O OE1 . GLN A 1 17  ? 29.391  2.288   -13.083 1.00 11.45 ? 17  GLN L OE1 1 
ATOM   124  N NE2 . GLN A 1 17  ? 29.441  4.219   -14.184 1.00 8.89  ? 17  GLN L NE2 1 
ATOM   125  N N   . PRO A 1 18  ? 25.825  1.330   -11.208 1.00 12.03 ? 18  PRO L N   1 
ATOM   126  C CA  . PRO A 1 18  ? 24.932  0.358   -10.577 1.00 12.49 ? 18  PRO L CA  1 
ATOM   127  C C   . PRO A 1 18  ? 25.279  0.161   -9.103  1.00 14.67 ? 18  PRO L C   1 
ATOM   128  O O   . PRO A 1 18  ? 26.396  0.475   -8.669  1.00 15.77 ? 18  PRO L O   1 
ATOM   129  C CB  . PRO A 1 18  ? 25.204  -0.940  -11.351 1.00 12.39 ? 18  PRO L CB  1 
ATOM   130  C CG  . PRO A 1 18  ? 26.014  -0.499  -12.590 1.00 12.36 ? 18  PRO L CG  1 
ATOM   131  C CD  . PRO A 1 18  ? 26.829  0.637   -12.048 1.00 12.58 ? 18  PRO L CD  1 
ATOM   132  N N   . ALA A 1 19  ? 24.329  -0.391  -8.356  1.00 15.31 ? 19  ALA L N   1 
ATOM   133  C CA  . ALA A 1 19  ? 24.478  -0.661  -6.934  1.00 16.55 ? 19  ALA L CA  1 
ATOM   134  C C   . ALA A 1 19  ? 23.602  -1.860  -6.591  1.00 17.11 ? 19  ALA L C   1 
ATOM   135  O O   . ALA A 1 19  ? 22.685  -2.206  -7.336  1.00 16.27 ? 19  ALA L O   1 
ATOM   136  C CB  . ALA A 1 19  ? 24.012  0.549   -6.110  1.00 16.30 ? 19  ALA L CB  1 
ATOM   137  N N   . SER A 1 20  ? 23.915  -2.516  -5.483  1.00 17.63 ? 20  SER L N   1 
ATOM   138  C CA  . SER A 1 20  ? 23.123  -3.642  -5.040  1.00 17.13 ? 20  SER L CA  1 
ATOM   139  C C   . SER A 1 20  ? 23.281  -3.805  -3.538  1.00 16.77 ? 20  SER L C   1 
ATOM   140  O O   . SER A 1 20  ? 24.340  -3.523  -2.966  1.00 17.51 ? 20  SER L O   1 
ATOM   141  C CB  . SER A 1 20  ? 23.491  -4.909  -5.784  1.00 17.53 ? 20  SER L CB  1 
ATOM   142  O OG  . SER A 1 20  ? 24.499  -5.580  -5.100  1.00 19.63 ? 20  SER L OG  1 
ATOM   143  N N   . ILE A 1 21  ? 22.171  -4.138  -2.895  1.00 16.58 ? 21  ILE L N   1 
ATOM   144  C CA  . ILE A 1 21  ? 22.119  -4.320  -1.460  1.00 15.59 ? 21  ILE L CA  1 
ATOM   145  C C   . ILE A 1 21  ? 21.659  -5.747  -1.208  1.00 14.86 ? 21  ILE L C   1 
ATOM   146  O O   . ILE A 1 21  ? 20.867  -6.308  -1.962  1.00 14.29 ? 21  ILE L O   1 
ATOM   147  C CB  . ILE A 1 21  ? 21.156  -3.291  -0.810  1.00 15.50 ? 21  ILE L CB  1 
ATOM   148  C CG1 . ILE A 1 21  ? 21.550  -1.874  -1.259  1.00 16.10 ? 21  ILE L CG1 1 
ATOM   149  C CG2 . ILE A 1 21  ? 21.199  -3.427  0.725   1.00 15.61 ? 21  ILE L CG2 1 
ATOM   150  C CD1 . ILE A 1 21  ? 20.598  -0.768  -0.870  1.00 15.56 ? 21  ILE L CD1 1 
ATOM   151  N N   . SER A 1 22  ? 22.163  -6.320  -0.133  1.00 15.21 ? 22  SER L N   1 
ATOM   152  C CA  . SER A 1 22  ? 21.861  -7.677  0.224   1.00 16.33 ? 22  SER L CA  1 
ATOM   153  C C   . SER A 1 22  ? 21.120  -7.737  1.556   1.00 16.00 ? 22  SER L C   1 
ATOM   154  O O   . SER A 1 22  ? 21.334  -6.920  2.454   1.00 14.66 ? 22  SER L O   1 
ATOM   155  C CB  . SER A 1 22  ? 23.184  -8.439  0.291   1.00 18.97 ? 22  SER L CB  1 
ATOM   156  O OG  . SER A 1 22  ? 23.033  -9.761  0.780   1.00 23.57 ? 22  SER L OG  1 
ATOM   157  N N   . CYS A 1 23  ? 20.232  -8.716  1.661   1.00 16.05 ? 23  CYS L N   1 
ATOM   158  C CA  . CYS A 1 23  ? 19.442  -8.942  2.861   1.00 16.51 ? 23  CYS L CA  1 
ATOM   159  C C   . CYS A 1 23  ? 19.387  -10.463 3.139   1.00 16.18 ? 23  CYS L C   1 
ATOM   160  O O   . CYS A 1 23  ? 19.059  -11.260 2.272   1.00 15.17 ? 23  CYS L O   1 
ATOM   161  C CB  . CYS A 1 23  ? 18.051  -8.332  2.666   1.00 17.06 ? 23  CYS L CB  1 
ATOM   162  S SG  . CYS A 1 23  ? 16.927  -8.632  4.057   1.00 18.37 ? 23  CYS L SG  1 
ATOM   163  N N   . LYS A 1 24  ? 19.735  -10.860 4.350   1.00 17.95 ? 24  LYS L N   1 
ATOM   164  C CA  . LYS A 1 24  ? 19.772  -12.278 4.707   1.00 19.07 ? 24  LYS L CA  1 
ATOM   165  C C   . LYS A 1 24  ? 18.861  -12.566 5.881   1.00 17.96 ? 24  LYS L C   1 
ATOM   166  O O   . LYS A 1 24  ? 18.899  -11.853 6.883   1.00 17.45 ? 24  LYS L O   1 
ATOM   167  C CB  . LYS A 1 24  ? 21.211  -12.655 5.087   1.00 21.06 ? 24  LYS L CB  1 
ATOM   168  C CG  . LYS A 1 24  ? 21.752  -13.914 4.427   1.00 24.42 ? 24  LYS L CG  1 
ATOM   169  C CD  . LYS A 1 24  ? 21.373  -15.136 5.247   1.00 27.29 ? 24  LYS L CD  1 
ATOM   170  C CE  . LYS A 1 24  ? 21.653  -16.449 4.516   1.00 29.06 ? 24  LYS L CE  1 
ATOM   171  N NZ  . LYS A 1 24  ? 20.995  -17.620 5.212   1.00 31.68 ? 24  LYS L NZ  1 
ATOM   172  N N   . SER A 1 25  ? 18.039  -13.599 5.774   1.00 17.41 ? 25  SER L N   1 
ATOM   173  C CA  . SER A 1 25  ? 17.180  -13.923 6.899   1.00 18.28 ? 25  SER L CA  1 
ATOM   174  C C   . SER A 1 25  ? 17.705  -15.118 7.697   1.00 18.99 ? 25  SER L C   1 
ATOM   175  O O   . SER A 1 25  ? 18.412  -15.981 7.167   1.00 17.37 ? 25  SER L O   1 
ATOM   176  C CB  . SER A 1 25  ? 15.756  -14.188 6.448   1.00 17.64 ? 25  SER L CB  1 
ATOM   177  O OG  . SER A 1 25  ? 15.742  -15.183 5.456   1.00 19.55 ? 25  SER L OG  1 
ATOM   178  N N   . SER A 1 26  ? 17.373  -15.141 8.985   1.00 20.15 ? 26  SER L N   1 
ATOM   179  C CA  . SER A 1 26  ? 17.772  -16.228 9.852   1.00 21.93 ? 26  SER L CA  1 
ATOM   180  C C   . SER A 1 26  ? 16.990  -17.501 9.538   1.00 23.19 ? 26  SER L C   1 
ATOM   181  O O   . SER A 1 26  ? 17.368  -18.585 9.975   1.00 25.73 ? 26  SER L O   1 
ATOM   182  C CB  . SER A 1 26  ? 17.594  -15.835 11.327  1.00 22.69 ? 26  SER L CB  1 
ATOM   183  O OG  . SER A 1 26  ? 16.283  -15.350 11.612  1.00 23.21 ? 26  SER L OG  1 
ATOM   184  N N   . GLN A 1 27  ? 15.888  -17.381 8.804   1.00 23.17 ? 27  GLN L N   1 
ATOM   185  C CA  . GLN A 1 27  ? 15.082  -18.544 8.458   1.00 23.08 ? 27  GLN L CA  1 
ATOM   186  C C   . GLN A 1 27  ? 14.496  -18.295 7.107   1.00 21.92 ? 27  GLN L C   1 
ATOM   187  O O   . GLN A 1 27  ? 14.286  -17.153 6.729   1.00 20.77 ? 27  GLN L O   1 
ATOM   188  C CB  . GLN A 1 27  ? 13.915  -18.729 9.432   1.00 25.96 ? 27  GLN L CB  1 
ATOM   189  C CG  . GLN A 1 27  ? 14.294  -19.095 10.855  1.00 29.31 ? 27  GLN L CG  1 
ATOM   190  C CD  . GLN A 1 27  ? 13.086  -19.098 11.793  1.00 30.64 ? 27  GLN L CD  1 
ATOM   191  O OE1 . GLN A 1 27  ? 12.048  -19.707 11.501  1.00 32.33 ? 27  GLN L OE1 1 
ATOM   192  N NE2 . GLN A 1 27  ? 13.209  -18.394 12.913  1.00 31.40 ? 27  GLN L NE2 1 
ATOM   193  N N   . SER A 1 28  A 14.179  -19.377 6.412   1.00 21.20 ? 27  SER L N   1 
ATOM   194  C CA  . SER A 1 28  A 13.590  -19.301 5.091   1.00 21.76 ? 27  SER L CA  1 
ATOM   195  C C   . SER A 1 28  A 12.342  -18.445 5.156   1.00 20.81 ? 27  SER L C   1 
ATOM   196  O O   . SER A 1 28  A 11.605  -18.524 6.129   1.00 21.53 ? 27  SER L O   1 
ATOM   197  C CB  . SER A 1 28  A 13.207  -20.696 4.601   1.00 21.54 ? 27  SER L CB  1 
ATOM   198  O OG  . SER A 1 28  A 12.523  -20.622 3.350   1.00 23.90 ? 27  SER L OG  1 
ATOM   199  N N   . LEU A 1 29  B 12.113  -17.638 4.121   1.00 20.57 ? 27  LEU L N   1 
ATOM   200  C CA  . LEU A 1 29  B 10.930  -16.791 4.045   1.00 19.57 ? 27  LEU L CA  1 
ATOM   201  C C   . LEU A 1 29  B 9.871   -17.420 3.136   1.00 19.87 ? 27  LEU L C   1 
ATOM   202  O O   . LEU A 1 29  B 8.847   -16.793 2.829   1.00 19.05 ? 27  LEU L O   1 
ATOM   203  C CB  . LEU A 1 29  B 11.283  -15.376 3.576   1.00 18.18 ? 27  LEU L CB  1 
ATOM   204  C CG  . LEU A 1 29  B 12.273  -14.636 4.480   1.00 18.50 ? 27  LEU L CG  1 
ATOM   205  C CD1 . LEU A 1 29  B 12.400  -13.181 4.052   1.00 16.54 ? 27  LEU L CD1 1 
ATOM   206  C CD2 . LEU A 1 29  B 11.842  -14.739 5.948   1.00 18.55 ? 27  LEU L CD2 1 
ATOM   207  N N   . LEU A 1 30  C 10.115  -18.654 2.705   1.00 21.14 ? 27  LEU L N   1 
ATOM   208  C CA  . LEU A 1 30  C 9.155   -19.359 1.860   1.00 23.50 ? 27  LEU L CA  1 
ATOM   209  C C   . LEU A 1 30  C 7.963   -19.786 2.726   1.00 25.07 ? 27  LEU L C   1 
ATOM   210  O O   . LEU A 1 30  C 8.118   -20.509 3.728   1.00 25.10 ? 27  LEU L O   1 
ATOM   211  C CB  . LEU A 1 30  C 9.792   -20.578 1.186   1.00 22.62 ? 27  LEU L CB  1 
ATOM   212  C CG  . LEU A 1 30  C 9.114   -21.227 -0.031  1.00 23.08 ? 27  LEU L CG  1 
ATOM   213  C CD1 . LEU A 1 30  C 8.562   -22.605 0.292   1.00 24.05 ? 27  LEU L CD1 1 
ATOM   214  C CD2 . LEU A 1 30  C 8.066   -20.341 -0.644  1.00 22.39 ? 27  LEU L CD2 1 
ATOM   215  N N   . TYR A 1 31  D 6.788   -19.276 2.366   1.00 26.46 ? 27  TYR L N   1 
ATOM   216  C CA  . TYR A 1 31  D 5.564   -19.583 3.083   1.00 27.63 ? 27  TYR L CA  1 
ATOM   217  C C   . TYR A 1 31  D 4.961   -20.860 2.495   1.00 28.07 ? 27  TYR L C   1 
ATOM   218  O O   . TYR A 1 31  D 5.284   -21.251 1.360   1.00 27.30 ? 27  TYR L O   1 
ATOM   219  C CB  . TYR A 1 31  D 4.593   -18.404 2.964   1.00 28.82 ? 27  TYR L CB  1 
ATOM   220  C CG  . TYR A 1 31  D 3.564   -18.357 4.060   1.00 30.14 ? 27  TYR L CG  1 
ATOM   221  C CD1 . TYR A 1 31  D 3.942   -18.324 5.397   1.00 30.15 ? 27  TYR L CD1 1 
ATOM   222  C CD2 . TYR A 1 31  D 2.203   -18.351 3.758   1.00 30.94 ? 27  TYR L CD2 1 
ATOM   223  C CE1 . TYR A 1 31  D 2.983   -18.284 6.422   1.00 31.75 ? 27  TYR L CE1 1 
ATOM   224  C CE2 . TYR A 1 31  D 1.225   -18.311 4.771   1.00 31.99 ? 27  TYR L CE2 1 
ATOM   225  C CZ  . TYR A 1 31  D 1.620   -18.274 6.103   1.00 32.60 ? 27  TYR L CZ  1 
ATOM   226  O OH  . TYR A 1 31  D 0.661   -18.195 7.100   1.00 33.19 ? 27  TYR L OH  1 
ATOM   227  N N   . SER A 1 32  E 4.078   -21.504 3.256   1.00 28.87 ? 27  SER L N   1 
ATOM   228  C CA  . SER A 1 32  E 3.433   -22.747 2.815   1.00 29.12 ? 27  SER L CA  1 
ATOM   229  C C   . SER A 1 32  E 2.485   -22.649 1.620   1.00 29.01 ? 27  SER L C   1 
ATOM   230  O O   . SER A 1 32  E 2.063   -23.666 1.090   1.00 30.07 ? 27  SER L O   1 
ATOM   231  C CB  . SER A 1 32  E 2.735   -23.425 3.983   1.00 29.83 ? 27  SER L CB  1 
ATOM   232  O OG  . SER A 1 32  E 2.191   -22.469 4.879   1.00 31.83 ? 27  SER L OG  1 
ATOM   233  N N   . ASN A 1 33  ? 2.161   -21.430 1.200   1.00 28.15 ? 28  ASN L N   1 
ATOM   234  C CA  . ASN A 1 33  ? 1.285   -21.196 0.057   1.00 26.74 ? 28  ASN L CA  1 
ATOM   235  C C   . ASN A 1 33  ? 2.149   -20.914 -1.158  1.00 25.74 ? 28  ASN L C   1 
ATOM   236  O O   . ASN A 1 33  ? 1.648   -20.445 -2.189  1.00 25.39 ? 28  ASN L O   1 
ATOM   237  C CB  . ASN A 1 33  ? 0.411   -19.970 0.300   1.00 27.94 ? 28  ASN L CB  1 
ATOM   238  C CG  . ASN A 1 33  ? 1.227   -18.678 0.392   1.00 27.51 ? 28  ASN L CG  1 
ATOM   239  O OD1 . ASN A 1 33  ? 2.398   -18.690 0.771   1.00 26.10 ? 28  ASN L OD1 1 
ATOM   240  N ND2 . ASN A 1 33  ? 0.594   -17.561 0.063   1.00 28.71 ? 28  ASN L ND2 1 
ATOM   241  N N   . GLY A 1 34  ? 3.457   -21.083 -0.986  1.00 24.81 ? 29  GLY L N   1 
ATOM   242  C CA  . GLY A 1 34  ? 4.400   -20.860 -2.073  1.00 23.89 ? 29  GLY L CA  1 
ATOM   243  C C   . GLY A 1 34  ? 4.838   -19.427 -2.319  1.00 23.04 ? 29  GLY L C   1 
ATOM   244  O O   . GLY A 1 34  ? 5.508   -19.148 -3.316  1.00 25.00 ? 29  GLY L O   1 
ATOM   245  N N   . LYS A 1 35  ? 4.486   -18.519 -1.414  1.00 22.17 ? 30  LYS L N   1 
ATOM   246  C CA  . LYS A 1 35  ? 4.849   -17.121 -1.544  1.00 19.12 ? 30  LYS L CA  1 
ATOM   247  C C   . LYS A 1 35  ? 5.881   -16.803 -0.508  1.00 16.77 ? 30  LYS L C   1 
ATOM   248  O O   . LYS A 1 35  ? 5.948   -17.465 0.520   1.00 15.50 ? 30  LYS L O   1 
ATOM   249  C CB  . LYS A 1 35  ? 3.615   -16.239 -1.392  1.00 20.55 ? 30  LYS L CB  1 
ATOM   250  C CG  . LYS A 1 35  ? 2.878   -16.097 -2.705  1.00 22.15 ? 30  LYS L CG  1 
ATOM   251  C CD  . LYS A 1 35  ? 1.403   -15.770 -2.553  1.00 22.83 ? 30  LYS L CD  1 
ATOM   252  C CE  . LYS A 1 35  ? 0.812   -15.410 -3.925  1.00 23.05 ? 30  LYS L CE  1 
ATOM   253  N NZ  . LYS A 1 35  ? -0.626  -15.787 -4.045  1.00 24.71 ? 30  LYS L NZ  1 
ATOM   254  N N   . THR A 1 36  ? 6.726   -15.832 -0.844  1.00 15.14 ? 31  THR L N   1 
ATOM   255  C CA  . THR A 1 36  ? 7.814   -15.350 -0.008  1.00 14.44 ? 31  THR L CA  1 
ATOM   256  C C   . THR A 1 36  ? 7.546   -13.879 0.229   1.00 13.77 ? 31  THR L C   1 
ATOM   257  O O   . THR A 1 36  ? 7.748   -13.062 -0.661  1.00 15.56 ? 31  THR L O   1 
ATOM   258  C CB  . THR A 1 36  ? 9.166   -15.500 -0.738  1.00 15.23 ? 31  THR L CB  1 
ATOM   259  O OG1 . THR A 1 36  ? 9.382   -16.887 -1.054  1.00 15.71 ? 31  THR L OG1 1 
ATOM   260  C CG2 . THR A 1 36  ? 10.325  -14.996 0.143   1.00 15.86 ? 31  THR L CG2 1 
ATOM   261  N N   . TYR A 1 37  ? 7.155   -13.532 1.447   1.00 12.34 ? 32  TYR L N   1 
ATOM   262  C CA  . TYR A 1 37  ? 6.816   -12.162 1.745   1.00 11.89 ? 32  TYR L CA  1 
ATOM   263  C C   . TYR A 1 37  ? 8.017   -11.335 2.165   1.00 10.53 ? 32  TYR L C   1 
ATOM   264  O O   . TYR A 1 37  ? 8.292   -11.194 3.354   1.00 11.13 ? 32  TYR L O   1 
ATOM   265  C CB  . TYR A 1 37  ? 5.721   -12.125 2.820   1.00 11.39 ? 32  TYR L CB  1 
ATOM   266  C CG  . TYR A 1 37  ? 4.482   -12.904 2.467   1.00 11.65 ? 32  TYR L CG  1 
ATOM   267  C CD1 . TYR A 1 37  ? 3.529   -12.378 1.606   1.00 11.79 ? 32  TYR L CD1 1 
ATOM   268  C CD2 . TYR A 1 37  ? 4.240   -14.158 3.042   1.00 12.89 ? 32  TYR L CD2 1 
ATOM   269  C CE1 . TYR A 1 37  ? 2.354   -13.069 1.325   1.00 12.53 ? 32  TYR L CE1 1 
ATOM   270  C CE2 . TYR A 1 37  ? 3.058   -14.874 2.774   1.00 13.52 ? 32  TYR L CE2 1 
ATOM   271  C CZ  . TYR A 1 37  ? 2.111   -14.320 1.914   1.00 14.01 ? 32  TYR L CZ  1 
ATOM   272  O OH  . TYR A 1 37  ? 0.911   -14.998 1.648   1.00 16.22 ? 32  TYR L OH  1 
ATOM   273  N N   . LEU A 1 38  ? 8.767   -10.844 1.189   1.00 8.78  ? 33  LEU L N   1 
ATOM   274  C CA  . LEU A 1 38  ? 9.927   -10.007 1.472   1.00 8.03  ? 33  LEU L CA  1 
ATOM   275  C C   . LEU A 1 38  ? 9.729   -8.733  0.648   1.00 8.01  ? 33  LEU L C   1 
ATOM   276  O O   . LEU A 1 38  ? 9.456   -8.791  -0.554  1.00 7.47  ? 33  LEU L O   1 
ATOM   277  C CB  . LEU A 1 38  ? 11.244  -10.751 1.126   1.00 8.14  ? 33  LEU L CB  1 
ATOM   278  C CG  . LEU A 1 38  ? 12.633  -10.141 1.377   1.00 5.84  ? 33  LEU L CG  1 
ATOM   279  C CD1 . LEU A 1 38  ? 12.901  -9.062  0.369   1.00 6.42  ? 33  LEU L CD1 1 
ATOM   280  C CD2 . LEU A 1 38  ? 12.761  -9.594  2.730   1.00 5.21  ? 33  LEU L CD2 1 
ATOM   281  N N   . SER A 1 39  ? 9.769   -7.594  1.326   1.00 8.02  ? 34  SER L N   1 
ATOM   282  C CA  . SER A 1 39  ? 9.573   -6.297  0.702   1.00 8.16  ? 34  SER L CA  1 
ATOM   283  C C   . SER A 1 39  ? 10.801  -5.422  0.935   1.00 9.01  ? 34  SER L C   1 
ATOM   284  O O   . SER A 1 39  ? 11.599  -5.694  1.851   1.00 9.17  ? 34  SER L O   1 
ATOM   285  C CB  . SER A 1 39  ? 8.334   -5.614  1.318   1.00 8.50  ? 34  SER L CB  1 
ATOM   286  O OG  . SER A 1 39  ? 7.168   -6.439  1.210   1.00 10.27 ? 34  SER L OG  1 
ATOM   287  N N   . TRP A 1 40  ? 10.943  -4.388  0.104   1.00 7.63  ? 35  TRP L N   1 
ATOM   288  C CA  . TRP A 1 40  ? 12.033  -3.421  0.204   1.00 8.73  ? 35  TRP L CA  1 
ATOM   289  C C   . TRP A 1 40  ? 11.419  -2.013  0.325   1.00 8.58  ? 35  TRP L C   1 
ATOM   290  O O   . TRP A 1 40  ? 10.474  -1.681  -0.417  1.00 8.14  ? 35  TRP L O   1 
ATOM   291  C CB  . TRP A 1 40  ? 12.939  -3.473  -1.045  1.00 7.99  ? 35  TRP L CB  1 
ATOM   292  C CG  . TRP A 1 40  ? 13.840  -4.692  -1.120  1.00 7.48  ? 35  TRP L CG  1 
ATOM   293  C CD1 . TRP A 1 40  ? 13.579  -5.888  -1.752  1.00 7.57  ? 35  TRP L CD1 1 
ATOM   294  C CD2 . TRP A 1 40  ? 15.137  -4.822  -0.539  1.00 6.99  ? 35  TRP L CD2 1 
ATOM   295  N NE1 . TRP A 1 40  ? 14.642  -6.752  -1.582  1.00 7.58  ? 35  TRP L NE1 1 
ATOM   296  C CE2 . TRP A 1 40  ? 15.608  -6.125  -0.841  1.00 6.84  ? 35  TRP L CE2 1 
ATOM   297  C CE3 . TRP A 1 40  ? 15.955  -3.961  0.211   1.00 6.88  ? 35  TRP L CE3 1 
ATOM   298  C CZ2 . TRP A 1 40  ? 16.855  -6.585  -0.418  1.00 7.07  ? 35  TRP L CZ2 1 
ATOM   299  C CZ3 . TRP A 1 40  ? 17.196  -4.425  0.630   1.00 5.93  ? 35  TRP L CZ3 1 
ATOM   300  C CH2 . TRP A 1 40  ? 17.631  -5.723  0.315   1.00 5.59  ? 35  TRP L CH2 1 
ATOM   301  N N   . LEU A 1 41  ? 11.938  -1.211  1.260   1.00 8.03  ? 36  LEU L N   1 
ATOM   302  C CA  . LEU A 1 41  ? 11.469  0.156   1.499   1.00 9.02  ? 36  LEU L CA  1 
ATOM   303  C C   . LEU A 1 41  ? 12.625  1.117   1.306   1.00 9.49  ? 36  LEU L C   1 
ATOM   304  O O   . LEU A 1 41  ? 13.788  0.734   1.433   1.00 10.02 ? 36  LEU L O   1 
ATOM   305  C CB  . LEU A 1 41  ? 11.023  0.343   2.961   1.00 10.45 ? 36  LEU L CB  1 
ATOM   306  C CG  . LEU A 1 41  ? 9.955   -0.445  3.731   1.00 12.68 ? 36  LEU L CG  1 
ATOM   307  C CD1 . LEU A 1 41  ? 8.753   0.412   3.944   1.00 14.01 ? 36  LEU L CD1 1 
ATOM   308  C CD2 . LEU A 1 41  ? 9.563   -1.713  3.041   1.00 12.84 ? 36  LEU L CD2 1 
ATOM   309  N N   . LEU A 1 42  ? 12.297  2.377   1.068   1.00 9.85  ? 37  LEU L N   1 
ATOM   310  C CA  . LEU A 1 42  ? 13.299  3.431   0.940   1.00 10.50 ? 37  LEU L CA  1 
ATOM   311  C C   . LEU A 1 42  ? 12.751  4.540   1.817   1.00 10.93 ? 37  LEU L C   1 
ATOM   312  O O   . LEU A 1 42  ? 11.537  4.775   1.847   1.00 9.45  ? 37  LEU L O   1 
ATOM   313  C CB  . LEU A 1 42  ? 13.359  3.988   -0.496  1.00 10.56 ? 37  LEU L CB  1 
ATOM   314  C CG  . LEU A 1 42  ? 14.535  4.820   -1.035  1.00 10.71 ? 37  LEU L CG  1 
ATOM   315  C CD1 . LEU A 1 42  ? 14.029  5.686   -2.159  1.00 10.86 ? 37  LEU L CD1 1 
ATOM   316  C CD2 . LEU A 1 42  ? 15.214  5.684   -0.004  1.00 9.69  ? 37  LEU L CD2 1 
ATOM   317  N N   . GLN A 1 43  ? 13.614  5.159   2.600   1.00 10.90 ? 38  GLN L N   1 
ATOM   318  C CA  . GLN A 1 43  ? 13.157  6.268   3.394   1.00 12.97 ? 38  GLN L CA  1 
ATOM   319  C C   . GLN A 1 43  ? 14.103  7.406   3.050   1.00 15.54 ? 38  GLN L C   1 
ATOM   320  O O   . GLN A 1 43  ? 15.303  7.340   3.349   1.00 16.23 ? 38  GLN L O   1 
ATOM   321  C CB  . GLN A 1 43  ? 13.210  5.956   4.881   1.00 11.21 ? 38  GLN L CB  1 
ATOM   322  C CG  . GLN A 1 43  ? 12.859  7.151   5.753   1.00 10.16 ? 38  GLN L CG  1 
ATOM   323  C CD  . GLN A 1 43  ? 12.837  6.799   7.220   1.00 10.43 ? 38  GLN L CD  1 
ATOM   324  O OE1 . GLN A 1 43  ? 13.416  5.799   7.644   1.00 10.15 ? 38  GLN L OE1 1 
ATOM   325  N NE2 . GLN A 1 43  ? 12.144  7.605   8.005   1.00 10.40 ? 38  GLN L NE2 1 
ATOM   326  N N   . ARG A 1 44  ? 13.600  8.387   2.314   1.00 18.66 ? 39  ARG L N   1 
ATOM   327  C CA  . ARG A 1 44  ? 14.416  9.531   1.955   1.00 20.98 ? 39  ARG L CA  1 
ATOM   328  C C   . ARG A 1 44  ? 14.470  10.450  3.145   1.00 21.69 ? 39  ARG L C   1 
ATOM   329  O O   . ARG A 1 44  ? 13.536  10.448  3.964   1.00 20.93 ? 39  ARG L O   1 
ATOM   330  C CB  . ARG A 1 44  ? 13.854  10.258  0.758   1.00 21.86 ? 39  ARG L CB  1 
ATOM   331  C CG  . ARG A 1 44  ? 14.191  9.604   -0.517  1.00 25.37 ? 39  ARG L CG  1 
ATOM   332  C CD  . ARG A 1 44  ? 12.959  9.517   -1.325  1.00 29.31 ? 39  ARG L CD  1 
ATOM   333  N NE  . ARG A 1 44  ? 13.195  9.871   -2.715  1.00 33.38 ? 39  ARG L NE  1 
ATOM   334  C CZ  . ARG A 1 44  ? 12.579  9.276   -3.732  1.00 35.71 ? 39  ARG L CZ  1 
ATOM   335  N NH1 . ARG A 1 44  ? 11.719  8.293   -3.498  1.00 37.11 ? 39  ARG L NH1 1 
ATOM   336  N NH2 . ARG A 1 44  ? 12.732  9.724   -4.974  1.00 37.52 ? 39  ARG L NH2 1 
ATOM   337  N N   . PRO A 1 45  ? 15.590  11.214  3.284   1.00 22.62 ? 40  PRO L N   1 
ATOM   338  C CA  . PRO A 1 45  ? 15.848  12.170  4.368   1.00 22.78 ? 40  PRO L CA  1 
ATOM   339  C C   . PRO A 1 45  ? 14.624  13.018  4.658   1.00 23.31 ? 40  PRO L C   1 
ATOM   340  O O   . PRO A 1 45  ? 14.078  13.665  3.755   1.00 24.06 ? 40  PRO L O   1 
ATOM   341  C CB  . PRO A 1 45  ? 16.978  13.019  3.800   1.00 23.45 ? 40  PRO L CB  1 
ATOM   342  C CG  . PRO A 1 45  ? 17.754  12.014  2.987   1.00 23.63 ? 40  PRO L CG  1 
ATOM   343  C CD  . PRO A 1 45  ? 16.650  11.303  2.256   1.00 22.67 ? 40  PRO L CD  1 
ATOM   344  N N   . GLY A 1 46  ? 14.169  12.972  5.906   1.00 22.84 ? 41  GLY L N   1 
ATOM   345  C CA  . GLY A 1 46  ? 13.005  13.741  6.287   1.00 23.52 ? 41  GLY L CA  1 
ATOM   346  C C   . GLY A 1 46  ? 11.690  13.296  5.664   1.00 24.11 ? 41  GLY L C   1 
ATOM   347  O O   . GLY A 1 46  ? 10.846  14.137  5.343   1.00 25.13 ? 41  GLY L O   1 
ATOM   348  N N   . GLN A 1 47  ? 11.515  11.992  5.454   1.00 24.18 ? 42  GLN L N   1 
ATOM   349  C CA  . GLN A 1 47  ? 10.271  11.465  4.887   1.00 23.49 ? 42  GLN L CA  1 
ATOM   350  C C   . GLN A 1 47  ? 9.902   10.161  5.557   1.00 21.27 ? 42  GLN L C   1 
ATOM   351  O O   . GLN A 1 47  ? 10.710  9.590   6.278   1.00 20.88 ? 42  GLN L O   1 
ATOM   352  C CB  . GLN A 1 47  ? 10.406  11.201  3.397   1.00 25.64 ? 42  GLN L CB  1 
ATOM   353  C CG  . GLN A 1 47  ? 11.527  11.932  2.748   1.00 29.26 ? 42  GLN L CG  1 
ATOM   354  C CD  . GLN A 1 47  ? 11.060  12.844  1.664   1.00 31.54 ? 42  GLN L CD  1 
ATOM   355  O OE1 . GLN A 1 47  ? 10.863  12.421  0.518   1.00 32.03 ? 42  GLN L OE1 1 
ATOM   356  N NE2 . GLN A 1 47  ? 10.864  14.117  2.011   1.00 33.54 ? 42  GLN L NE2 1 
ATOM   357  N N   . SER A 1 48  ? 8.660   9.722   5.359   1.00 20.15 ? 43  SER L N   1 
ATOM   358  C CA  . SER A 1 48  ? 8.191   8.432   5.894   1.00 19.07 ? 43  SER L CA  1 
ATOM   359  C C   . SER A 1 48  ? 8.734   7.380   4.932   1.00 17.15 ? 43  SER L C   1 
ATOM   360  O O   . SER A 1 48  ? 9.030   7.695   3.766   1.00 18.44 ? 43  SER L O   1 
ATOM   361  C CB  . SER A 1 48  ? 6.660   8.343   5.853   1.00 18.88 ? 43  SER L CB  1 
ATOM   362  O OG  . SER A 1 48  ? 6.104   9.595   5.540   1.00 21.05 ? 43  SER L OG  1 
ATOM   363  N N   . PRO A 1 49  ? 8.912   6.134   5.395   1.00 14.51 ? 44  PRO L N   1 
ATOM   364  C CA  . PRO A 1 49  ? 9.426   5.125   4.454   1.00 13.46 ? 44  PRO L CA  1 
ATOM   365  C C   . PRO A 1 49  ? 8.372   4.913   3.343   1.00 12.22 ? 44  PRO L C   1 
ATOM   366  O O   . PRO A 1 49  ? 7.249   5.428   3.419   1.00 11.80 ? 44  PRO L O   1 
ATOM   367  C CB  . PRO A 1 49  ? 9.578   3.880   5.337   1.00 14.30 ? 44  PRO L CB  1 
ATOM   368  C CG  . PRO A 1 49  ? 9.799   4.445   6.693   1.00 14.13 ? 44  PRO L CG  1 
ATOM   369  C CD  . PRO A 1 49  ? 8.838   5.606   6.755   1.00 13.77 ? 44  PRO L CD  1 
ATOM   370  N N   . LYS A 1 50  ? 8.727   4.179   2.307   1.00 10.68 ? 45  LYS L N   1 
ATOM   371  C CA  . LYS A 1 50  ? 7.804   3.922   1.219   1.00 9.88  ? 45  LYS L CA  1 
ATOM   372  C C   . LYS A 1 50  ? 8.321   2.688   0.543   1.00 8.69  ? 45  LYS L C   1 
ATOM   373  O O   . LYS A 1 50  ? 9.510   2.580   0.269   1.00 9.70  ? 45  LYS L O   1 
ATOM   374  C CB  . LYS A 1 50  ? 7.810   5.065   0.213   1.00 11.63 ? 45  LYS L CB  1 
ATOM   375  C CG  . LYS A 1 50  ? 6.735   4.913   -0.897  1.00 14.82 ? 45  LYS L CG  1 
ATOM   376  C CD  . LYS A 1 50  ? 5.301   5.052   -0.334  1.00 14.92 ? 45  LYS L CD  1 
ATOM   377  C CE  . LYS A 1 50  ? 4.219   5.092   -1.412  1.00 16.15 ? 45  LYS L CE  1 
ATOM   378  N NZ  . LYS A 1 50  ? 2.993   5.904   -0.912  1.00 16.38 ? 45  LYS L NZ  1 
ATOM   379  N N   . ARG A 1 51  ? 7.445   1.726   0.342   1.00 7.48  ? 46  ARG L N   1 
ATOM   380  C CA  . ARG A 1 51  ? 7.821   0.479   -0.276  1.00 6.11  ? 46  ARG L CA  1 
ATOM   381  C C   . ARG A 1 51  ? 8.150   0.691   -1.752  1.00 6.49  ? 46  ARG L C   1 
ATOM   382  O O   . ARG A 1 51  ? 7.654   1.591   -2.413  1.00 4.84  ? 46  ARG L O   1 
ATOM   383  C CB  . ARG A 1 51  ? 6.702   -0.534  -0.088  1.00 5.37  ? 46  ARG L CB  1 
ATOM   384  C CG  . ARG A 1 51  ? 7.055   -1.965  -0.351  1.00 5.60  ? 46  ARG L CG  1 
ATOM   385  C CD  . ARG A 1 51  ? 5.840   -2.870  -0.070  1.00 5.84  ? 46  ARG L CD  1 
ATOM   386  N NE  . ARG A 1 51  ? 4.744   -2.615  -1.001  1.00 5.18  ? 46  ARG L NE  1 
ATOM   387  C CZ  . ARG A 1 51  ? 3.477   -2.508  -0.639  1.00 4.37  ? 46  ARG L CZ  1 
ATOM   388  N NH1 . ARG A 1 51  ? 3.169   -2.656  0.621   1.00 5.47  ? 46  ARG L NH1 1 
ATOM   389  N NH2 . ARG A 1 51  ? 2.538   -2.174  -1.515  1.00 3.43  ? 46  ARG L NH2 1 
ATOM   390  N N   . LEU A 1 52  ? 9.016   -0.161  -2.259  1.00 6.75  ? 47  LEU L N   1 
ATOM   391  C CA  . LEU A 1 52  ? 9.424   -0.080  -3.641  1.00 7.26  ? 47  LEU L CA  1 
ATOM   392  C C   . LEU A 1 52  ? 9.068   -1.392  -4.256  1.00 5.77  ? 47  LEU L C   1 
ATOM   393  O O   . LEU A 1 52  ? 8.615   -1.453  -5.387  1.00 6.02  ? 47  LEU L O   1 
ATOM   394  C CB  . LEU A 1 52  ? 10.949  0.003   -3.721  1.00 7.90  ? 47  LEU L CB  1 
ATOM   395  C CG  . LEU A 1 52  ? 11.777  1.252   -3.865  1.00 8.62  ? 47  LEU L CG  1 
ATOM   396  C CD1 . LEU A 1 52  ? 11.012  2.482   -3.511  1.00 10.11 ? 47  LEU L CD1 1 
ATOM   397  C CD2 . LEU A 1 52  ? 13.000  1.064   -2.989  1.00 8.63  ? 47  LEU L CD2 1 
ATOM   398  N N   . ILE A 1 53  ? 9.259   -2.440  -3.471  1.00 5.59  ? 48  ILE L N   1 
ATOM   399  C CA  . ILE A 1 53  ? 9.085   -3.807  -3.941  1.00 6.16  ? 48  ILE L CA  1 
ATOM   400  C C   . ILE A 1 53  ? 8.414   -4.707  -2.934  1.00 4.96  ? 48  ILE L C   1 
ATOM   401  O O   . ILE A 1 53  ? 8.697   -4.632  -1.754  1.00 4.51  ? 48  ILE L O   1 
ATOM   402  C CB  . ILE A 1 53  ? 10.528  -4.428  -4.301  1.00 6.34  ? 48  ILE L CB  1 
ATOM   403  C CG1 . ILE A 1 53  ? 11.111  -3.764  -5.566  1.00 7.10  ? 48  ILE L CG1 1 
ATOM   404  C CG2 . ILE A 1 53  ? 10.470  -5.937  -4.466  1.00 7.09  ? 48  ILE L CG2 1 
ATOM   405  C CD1 . ILE A 1 53  ? 12.405  -4.325  -6.025  1.00 6.79  ? 48  ILE L CD1 1 
ATOM   406  N N   . TYR A 1 54  ? 7.518   -5.557  -3.417  1.00 7.38  ? 49  TYR L N   1 
ATOM   407  C CA  . TYR A 1 54  ? 6.840   -6.539  -2.584  1.00 8.54  ? 49  TYR L CA  1 
ATOM   408  C C   . TYR A 1 54  ? 6.950   -7.923  -3.260  1.00 10.48 ? 49  TYR L C   1 
ATOM   409  O O   . TYR A 1 54  ? 7.247   -8.032  -4.458  1.00 10.49 ? 49  TYR L O   1 
ATOM   410  C CB  . TYR A 1 54  ? 5.376   -6.146  -2.279  1.00 7.20  ? 49  TYR L CB  1 
ATOM   411  C CG  . TYR A 1 54  ? 4.501   -6.017  -3.480  1.00 7.16  ? 49  TYR L CG  1 
ATOM   412  C CD1 . TYR A 1 54  ? 4.452   -4.837  -4.198  1.00 8.11  ? 49  TYR L CD1 1 
ATOM   413  C CD2 . TYR A 1 54  ? 3.786   -7.104  -3.950  1.00 8.09  ? 49  TYR L CD2 1 
ATOM   414  C CE1 . TYR A 1 54  ? 3.720   -4.741  -5.374  1.00 8.85  ? 49  TYR L CE1 1 
ATOM   415  C CE2 . TYR A 1 54  ? 3.048   -7.034  -5.121  1.00 8.28  ? 49  TYR L CE2 1 
ATOM   416  C CZ  . TYR A 1 54  ? 3.021   -5.851  -5.839  1.00 9.55  ? 49  TYR L CZ  1 
ATOM   417  O OH  . TYR A 1 54  ? 2.353   -5.793  -7.053  1.00 9.44  ? 49  TYR L OH  1 
ATOM   418  N N   . LEU A 1 55  ? 6.777   -8.974  -2.460  1.00 12.56 ? 50  LEU L N   1 
ATOM   419  C CA  . LEU A 1 55  ? 6.861   -10.356 -2.908  1.00 12.05 ? 50  LEU L CA  1 
ATOM   420  C C   . LEU A 1 55  ? 8.153   -10.614 -3.635  1.00 13.85 ? 50  LEU L C   1 
ATOM   421  O O   . LEU A 1 55  ? 8.129   -11.132 -4.766  1.00 13.89 ? 50  LEU L O   1 
ATOM   422  C CB  . LEU A 1 55  ? 5.671   -10.722 -3.788  1.00 12.31 ? 50  LEU L CB  1 
ATOM   423  C CG  . LEU A 1 55  ? 4.354   -10.806 -3.015  1.00 12.18 ? 50  LEU L CG  1 
ATOM   424  C CD1 . LEU A 1 55  ? 3.231   -11.104 -3.976  1.00 12.06 ? 50  LEU L CD1 1 
ATOM   425  C CD2 . LEU A 1 55  ? 4.438   -11.863 -1.913  1.00 11.20 ? 50  LEU L CD2 1 
ATOM   426  N N   . VAL A 1 56  ? 9.255   -10.137 -3.035  1.00 13.14 ? 51  VAL L N   1 
ATOM   427  C CA  . VAL A 1 56  ? 10.620  -10.319 -3.550  1.00 12.54 ? 51  VAL L CA  1 
ATOM   428  C C   . VAL A 1 56  ? 10.993  -9.536  -4.815  1.00 13.38 ? 51  VAL L C   1 
ATOM   429  O O   . VAL A 1 56  ? 12.087  -8.992  -4.920  1.00 14.02 ? 51  VAL L O   1 
ATOM   430  C CB  . VAL A 1 56  ? 10.888  -11.835 -3.832  1.00 12.74 ? 51  VAL L CB  1 
ATOM   431  C CG1 . VAL A 1 56  ? 12.217  -12.043 -4.522  1.00 11.30 ? 51  VAL L CG1 1 
ATOM   432  C CG2 . VAL A 1 56  ? 10.809  -12.640 -2.560  1.00 13.08 ? 51  VAL L CG2 1 
ATOM   433  N N   . SER A 1 57  ? 10.080  -9.442  -5.765  1.00 14.05 ? 52  SER L N   1 
ATOM   434  C CA  . SER A 1 57  ? 10.428  -8.796  -6.995  1.00 14.67 ? 52  SER L CA  1 
ATOM   435  C C   . SER A 1 57  ? 9.345   -7.998  -7.671  1.00 15.87 ? 52  SER L C   1 
ATOM   436  O O   . SER A 1 57  ? 9.551   -7.520  -8.791  1.00 17.25 ? 52  SER L O   1 
ATOM   437  C CB  . SER A 1 57  ? 10.939  -9.849  -7.962  1.00 14.92 ? 52  SER L CB  1 
ATOM   438  O OG  . SER A 1 57  ? 10.008  -10.906 -8.061  1.00 15.62 ? 52  SER L OG  1 
ATOM   439  N N   . LYS A 1 58  ? 8.184   -7.864  -7.048  1.00 15.93 ? 53  LYS L N   1 
ATOM   440  C CA  . LYS A 1 58  ? 7.149   -7.078  -7.685  1.00 15.46 ? 53  LYS L CA  1 
ATOM   441  C C   . LYS A 1 58  ? 7.356   -5.614  -7.287  1.00 14.01 ? 53  LYS L C   1 
ATOM   442  O O   . LYS A 1 58  ? 7.602   -5.285  -6.132  1.00 13.09 ? 53  LYS L O   1 
ATOM   443  C CB  . LYS A 1 58  ? 5.747   -7.599  -7.339  1.00 17.97 ? 53  LYS L CB  1 
ATOM   444  C CG  . LYS A 1 58  ? 5.439   -9.017  -7.867  1.00 20.90 ? 53  LYS L CG  1 
ATOM   445  C CD  . LYS A 1 58  ? 6.275   -10.080 -7.138  1.00 24.18 ? 53  LYS L CD  1 
ATOM   446  C CE  . LYS A 1 58  ? 5.943   -11.558 -7.546  1.00 25.71 ? 53  LYS L CE  1 
ATOM   447  N NZ  . LYS A 1 58  ? 6.767   -12.617 -6.811  1.00 25.27 ? 53  LYS L NZ  1 
ATOM   448  N N   . LEU A 1 59  ? 7.322   -4.750  -8.283  1.00 12.81 ? 54  LEU L N   1 
ATOM   449  C CA  . LEU A 1 59  ? 7.522   -3.337  -8.098  1.00 12.23 ? 54  LEU L CA  1 
ATOM   450  C C   . LEU A 1 59  ? 6.183   -2.624  -7.886  1.00 12.75 ? 54  LEU L C   1 
ATOM   451  O O   . LEU A 1 59  ? 5.182   -2.978  -8.516  1.00 12.22 ? 54  LEU L O   1 
ATOM   452  C CB  . LEU A 1 59  ? 8.194   -2.802  -9.351  1.00 12.79 ? 54  LEU L CB  1 
ATOM   453  C CG  . LEU A 1 59  ? 9.009   -1.515  -9.353  1.00 14.55 ? 54  LEU L CG  1 
ATOM   454  C CD1 . LEU A 1 59  ? 10.324  -1.728  -8.653  1.00 13.72 ? 54  LEU L CD1 1 
ATOM   455  C CD2 . LEU A 1 59  ? 9.276   -1.119  -10.793 1.00 14.36 ? 54  LEU L CD2 1 
ATOM   456  N N   . ASP A 1 60  ? 6.158   -1.657  -6.969  1.00 11.83 ? 55  ASP L N   1 
ATOM   457  C CA  . ASP A 1 60  ? 4.962   -0.868  -6.731  1.00 12.66 ? 55  ASP L CA  1 
ATOM   458  C C   . ASP A 1 60  ? 4.788   0.136   -7.864  1.00 13.28 ? 55  ASP L C   1 
ATOM   459  O O   . ASP A 1 60  ? 5.714   0.408   -8.634  1.00 11.69 ? 55  ASP L O   1 
ATOM   460  C CB  . ASP A 1 60  ? 5.046   -0.103  -5.401  1.00 13.00 ? 55  ASP L CB  1 
ATOM   461  C CG  . ASP A 1 60  ? 4.604   -0.943  -4.216  1.00 14.91 ? 55  ASP L CG  1 
ATOM   462  O OD1 . ASP A 1 60  ? 3.379   -1.021  -3.952  1.00 16.35 ? 55  ASP L OD1 1 
ATOM   463  O OD2 . ASP A 1 60  ? 5.472   -1.560  -3.567  1.00 14.82 ? 55  ASP L OD2 1 
ATOM   464  N N   . SER A 1 61  ? 3.605   0.731   -7.927  1.00 14.16 ? 56  SER L N   1 
ATOM   465  C CA  . SER A 1 61  ? 3.308   1.719   -8.944  1.00 13.74 ? 56  SER L CA  1 
ATOM   466  C C   . SER A 1 61  ? 4.003   2.997   -8.596  1.00 12.50 ? 56  SER L C   1 
ATOM   467  O O   . SER A 1 61  ? 4.127   3.328   -7.432  1.00 11.20 ? 56  SER L O   1 
ATOM   468  C CB  . SER A 1 61  ? 1.817   2.004   -8.965  1.00 15.86 ? 56  SER L CB  1 
ATOM   469  O OG  . SER A 1 61  ? 1.115   0.803   -9.148  1.00 20.77 ? 56  SER L OG  1 
ATOM   470  N N   . GLY A 1 62  ? 4.324   3.777   -9.615  1.00 12.29 ? 57  GLY L N   1 
ATOM   471  C CA  . GLY A 1 62  ? 4.981   5.051   -9.398  1.00 12.05 ? 57  GLY L CA  1 
ATOM   472  C C   . GLY A 1 62  ? 6.464   4.896   -9.190  1.00 11.77 ? 57  GLY L C   1 
ATOM   473  O O   . GLY A 1 62  ? 7.152   5.882   -8.976  1.00 13.85 ? 57  GLY L O   1 
ATOM   474  N N   . VAL A 1 63  ? 6.949   3.664   -9.239  1.00 11.82 ? 58  VAL L N   1 
ATOM   475  C CA  . VAL A 1 63  ? 8.360   3.372   -9.035  1.00 13.49 ? 58  VAL L CA  1 
ATOM   476  C C   . VAL A 1 63  ? 9.031   3.105   -10.390 1.00 14.26 ? 58  VAL L C   1 
ATOM   477  O O   . VAL A 1 63  ? 8.497   2.345   -11.215 1.00 13.57 ? 58  VAL L O   1 
ATOM   478  C CB  . VAL A 1 63  ? 8.557   2.119   -8.098  1.00 13.11 ? 58  VAL L CB  1 
ATOM   479  C CG1 . VAL A 1 63  ? 10.036  1.795   -7.952  1.00 13.63 ? 58  VAL L CG1 1 
ATOM   480  C CG2 . VAL A 1 63  ? 7.976   2.369   -6.700  1.00 11.98 ? 58  VAL L CG2 1 
ATOM   481  N N   . PRO A 1 64  ? 10.153  3.807   -10.677 1.00 15.45 ? 59  PRO L N   1 
ATOM   482  C CA  . PRO A 1 64  ? 10.878  3.614   -11.948 1.00 15.64 ? 59  PRO L CA  1 
ATOM   483  C C   . PRO A 1 64  ? 11.518  2.227   -11.946 1.00 15.56 ? 59  PRO L C   1 
ATOM   484  O O   . PRO A 1 64  ? 11.928  1.725   -10.901 1.00 16.94 ? 59  PRO L O   1 
ATOM   485  C CB  . PRO A 1 64  ? 11.926  4.724   -11.929 1.00 14.90 ? 59  PRO L CB  1 
ATOM   486  C CG  . PRO A 1 64  ? 12.206  4.916   -10.490 1.00 16.32 ? 59  PRO L CG  1 
ATOM   487  C CD  . PRO A 1 64  ? 10.813  4.836   -9.849  1.00 15.77 ? 59  PRO L CD  1 
ATOM   488  N N   . ASP A 1 65  ? 11.566  1.575   -13.091 1.00 15.13 ? 60  ASP L N   1 
ATOM   489  C CA  . ASP A 1 65  ? 12.133  0.245   -13.109 1.00 15.58 ? 60  ASP L CA  1 
ATOM   490  C C   . ASP A 1 65  ? 13.639  0.111   -13.160 1.00 15.36 ? 60  ASP L C   1 
ATOM   491  O O   . ASP A 1 65  ? 14.158  -0.796  -13.813 1.00 15.93 ? 60  ASP L O   1 
ATOM   492  C CB  . ASP A 1 65  ? 11.459  -0.655  -14.153 1.00 16.87 ? 60  ASP L CB  1 
ATOM   493  C CG  . ASP A 1 65  ? 11.402  -0.041  -15.538 1.00 19.00 ? 60  ASP L CG  1 
ATOM   494  O OD1 . ASP A 1 65  ? 11.898  1.080   -15.782 1.00 20.25 ? 60  ASP L OD1 1 
ATOM   495  O OD2 . ASP A 1 65  ? 10.828  -0.707  -16.411 1.00 20.95 ? 60  ASP L OD2 1 
ATOM   496  N N   . ARG A 1 66  ? 14.338  1.011   -12.472 1.00 14.42 ? 61  ARG L N   1 
ATOM   497  C CA  . ARG A 1 66  ? 15.780  0.936   -12.365 1.00 14.91 ? 61  ARG L CA  1 
ATOM   498  C C   . ARG A 1 66  ? 16.035  -0.041  -11.231 1.00 15.77 ? 61  ARG L C   1 
ATOM   499  O O   . ARG A 1 66  ? 17.166  -0.470  -11.022 1.00 16.62 ? 61  ARG L O   1 
ATOM   500  C CB  . ARG A 1 66  ? 16.391  2.234   -11.876 1.00 16.51 ? 61  ARG L CB  1 
ATOM   501  C CG  . ARG A 1 66  ? 16.134  3.458   -12.662 1.00 17.37 ? 61  ARG L CG  1 
ATOM   502  C CD  . ARG A 1 66  ? 17.094  4.493   -12.151 1.00 18.36 ? 61  ARG L CD  1 
ATOM   503  N NE  . ARG A 1 66  ? 16.884  4.787   -10.732 1.00 18.82 ? 61  ARG L NE  1 
ATOM   504  C CZ  . ARG A 1 66  ? 16.118  5.790   -10.325 1.00 20.35 ? 61  ARG L CZ  1 
ATOM   505  N NH1 . ARG A 1 66  ? 15.492  6.557   -11.222 1.00 21.70 ? 61  ARG L NH1 1 
ATOM   506  N NH2 . ARG A 1 66  ? 16.035  6.095   -9.051  1.00 19.82 ? 61  ARG L NH2 1 
ATOM   507  N N   . PHE A 1 67  ? 15.007  -0.247  -10.407 1.00 15.77 ? 62  PHE L N   1 
ATOM   508  C CA  . PHE A 1 67  ? 15.061  -1.119  -9.244  1.00 14.02 ? 62  PHE L CA  1 
ATOM   509  C C   . PHE A 1 67  ? 14.541  -2.467  -9.580  1.00 14.19 ? 62  PHE L C   1 
ATOM   510  O O   . PHE A 1 67  ? 13.417  -2.556  -10.085 1.00 14.33 ? 62  PHE L O   1 
ATOM   511  C CB  . PHE A 1 67  ? 14.131  -0.578  -8.161  1.00 13.45 ? 62  PHE L CB  1 
ATOM   512  C CG  . PHE A 1 67  ? 14.609  0.679   -7.533  1.00 12.48 ? 62  PHE L CG  1 
ATOM   513  C CD1 . PHE A 1 67  ? 15.504  0.631   -6.469  1.00 11.60 ? 62  PHE L CD1 1 
ATOM   514  C CD2 . PHE A 1 67  ? 14.195  1.911   -8.019  1.00 12.58 ? 62  PHE L CD2 1 
ATOM   515  C CE1 . PHE A 1 67  ? 15.987  1.799   -5.898  1.00 11.34 ? 62  PHE L CE1 1 
ATOM   516  C CE2 . PHE A 1 67  ? 14.682  3.087   -7.451  1.00 13.11 ? 62  PHE L CE2 1 
ATOM   517  C CZ  . PHE A 1 67  ? 15.586  3.027   -6.383  1.00 11.51 ? 62  PHE L CZ  1 
ATOM   518  N N   . THR A 1 68  ? 15.306  -3.504  -9.232  1.00 13.40 ? 63  THR L N   1 
ATOM   519  C CA  . THR A 1 68  ? 14.878  -4.894  -9.423  1.00 14.53 ? 63  THR L CA  1 
ATOM   520  C C   . THR A 1 68  ? 15.242  -5.708  -8.180  1.00 14.34 ? 63  THR L C   1 
ATOM   521  O O   . THR A 1 68  ? 16.250  -5.442  -7.554  1.00 14.74 ? 63  THR L O   1 
ATOM   522  C CB  . THR A 1 68  ? 15.500  -5.561  -10.651 1.00 15.04 ? 63  THR L CB  1 
ATOM   523  O OG1 . THR A 1 68  ? 16.914  -5.668  -10.476 1.00 17.25 ? 63  THR L OG1 1 
ATOM   524  C CG2 . THR A 1 68  ? 15.197  -4.741  -11.889 1.00 15.56 ? 63  THR L CG2 1 
ATOM   525  N N   . GLY A 1 69  ? 14.424  -6.695  -7.824  1.00 14.20 ? 64  GLY L N   1 
ATOM   526  C CA  . GLY A 1 69  ? 14.727  -7.476  -6.644  1.00 13.15 ? 64  GLY L CA  1 
ATOM   527  C C   . GLY A 1 69  ? 14.743  -8.937  -6.974  1.00 13.48 ? 64  GLY L C   1 
ATOM   528  O O   . GLY A 1 69  ? 14.059  -9.362  -7.889  1.00 13.16 ? 64  GLY L O   1 
ATOM   529  N N   . SER A 1 70  ? 15.533  -9.718  -6.260  1.00 13.31 ? 65  SER L N   1 
ATOM   530  C CA  . SER A 1 70  ? 15.553  -11.143 -6.533  1.00 14.65 ? 65  SER L CA  1 
ATOM   531  C C   . SER A 1 70  ? 16.021  -11.900 -5.305  1.00 12.81 ? 65  SER L C   1 
ATOM   532  O O   . SER A 1 70  ? 16.229  -11.294 -4.271  1.00 12.23 ? 65  SER L O   1 
ATOM   533  C CB  . SER A 1 70  ? 16.417  -11.433 -7.765  1.00 16.36 ? 65  SER L CB  1 
ATOM   534  O OG  . SER A 1 70  ? 17.663  -10.771 -7.666  1.00 19.05 ? 65  SER L OG  1 
ATOM   535  N N   . GLY A 1 71  ? 16.064  -13.228 -5.383  1.00 13.93 ? 66  GLY L N   1 
ATOM   536  C CA  . GLY A 1 71  ? 16.510  -14.023 -4.244  1.00 15.20 ? 66  GLY L CA  1 
ATOM   537  C C   . GLY A 1 71  ? 15.491  -15.084 -3.892  1.00 16.53 ? 66  GLY L C   1 
ATOM   538  O O   . GLY A 1 71  ? 14.464  -15.198 -4.572  1.00 16.88 ? 66  GLY L O   1 
ATOM   539  N N   . SER A 1 72  ? 15.771  -15.872 -2.861  1.00 17.35 ? 67  SER L N   1 
ATOM   540  C CA  . SER A 1 72  ? 14.862  -16.920 -2.434  1.00 18.61 ? 67  SER L CA  1 
ATOM   541  C C   . SER A 1 72  ? 15.353  -17.579 -1.160  1.00 19.58 ? 67  SER L C   1 
ATOM   542  O O   . SER A 1 72  ? 16.529  -17.491 -0.814  1.00 20.38 ? 67  SER L O   1 
ATOM   543  C CB  . SER A 1 72  ? 14.683  -17.971 -3.531  1.00 20.45 ? 67  SER L CB  1 
ATOM   544  O OG  . SER A 1 72  ? 15.894  -18.657 -3.821  1.00 23.31 ? 67  SER L OG  1 
ATOM   545  N N   . GLY A 1 73  ? 14.435  -18.205 -0.437  1.00 19.96 ? 68  GLY L N   1 
ATOM   546  C CA  . GLY A 1 73  ? 14.798  -18.858 0.796   1.00 19.44 ? 68  GLY L CA  1 
ATOM   547  C C   . GLY A 1 73  ? 15.237  -17.864 1.847   1.00 19.76 ? 68  GLY L C   1 
ATOM   548  O O   . GLY A 1 73  ? 14.375  -17.238 2.502   1.00 20.48 ? 68  GLY L O   1 
ATOM   549  N N   . THR A 1 74  ? 16.554  -17.657 1.960   1.00 18.68 ? 69  THR L N   1 
ATOM   550  C CA  . THR A 1 74  ? 17.121  -16.741 2.952   1.00 17.79 ? 69  THR L CA  1 
ATOM   551  C C   . THR A 1 74  ? 17.953  -15.615 2.351   1.00 16.67 ? 69  THR L C   1 
ATOM   552  O O   . THR A 1 74  ? 18.380  -14.700 3.066   1.00 16.50 ? 69  THR L O   1 
ATOM   553  C CB  . THR A 1 74  ? 18.042  -17.501 3.941   1.00 18.40 ? 69  THR L CB  1 
ATOM   554  O OG1 . THR A 1 74  ? 18.987  -18.285 3.206   1.00 19.40 ? 69  THR L OG1 1 
ATOM   555  C CG2 . THR A 1 74  ? 17.261  -18.415 4.863   1.00 18.72 ? 69  THR L CG2 1 
ATOM   556  N N   . ASP A 1 75  ? 18.163  -15.663 1.045   1.00 16.50 ? 70  ASP L N   1 
ATOM   557  C CA  . ASP A 1 75  ? 19.017  -14.676 0.365   1.00 16.56 ? 70  ASP L CA  1 
ATOM   558  C C   . ASP A 1 75  ? 18.311  -13.775 -0.627  1.00 14.19 ? 70  ASP L C   1 
ATOM   559  O O   . ASP A 1 75  ? 17.756  -14.244 -1.610  1.00 14.78 ? 70  ASP L O   1 
ATOM   560  C CB  . ASP A 1 75  ? 20.180  -15.400 -0.328  1.00 18.28 ? 70  ASP L CB  1 
ATOM   561  C CG  . ASP A 1 75  ? 20.974  -16.269 0.633   1.00 20.28 ? 70  ASP L CG  1 
ATOM   562  O OD1 . ASP A 1 75  ? 21.506  -15.706 1.613   1.00 21.97 ? 70  ASP L OD1 1 
ATOM   563  O OD2 . ASP A 1 75  ? 21.059  -17.504 0.415   1.00 21.61 ? 70  ASP L OD2 1 
ATOM   564  N N   . PHE A 1 76  ? 18.422  -12.475 -0.407  1.00 12.79 ? 71  PHE L N   1 
ATOM   565  C CA  . PHE A 1 76  ? 17.758  -11.487 -1.243  1.00 11.88 ? 71  PHE L CA  1 
ATOM   566  C C   . PHE A 1 76  ? 18.671  -10.326 -1.573  1.00 11.19 ? 71  PHE L C   1 
ATOM   567  O O   . PHE A 1 76  ? 19.586  -10.007 -0.810  1.00 10.54 ? 71  PHE L O   1 
ATOM   568  C CB  . PHE A 1 76  ? 16.492  -11.024 -0.522  1.00 11.06 ? 71  PHE L CB  1 
ATOM   569  C CG  . PHE A 1 76  ? 15.591  -12.169 -0.160  1.00 11.27 ? 71  PHE L CG  1 
ATOM   570  C CD1 . PHE A 1 76  ? 14.750  -12.737 -1.119  1.00 10.43 ? 71  PHE L CD1 1 
ATOM   571  C CD2 . PHE A 1 76  ? 15.638  -12.732 1.114   1.00 10.71 ? 71  PHE L CD2 1 
ATOM   572  C CE1 . PHE A 1 76  ? 13.985  -13.836 -0.811  1.00 11.41 ? 71  PHE L CE1 1 
ATOM   573  C CE2 . PHE A 1 76  ? 14.868  -13.841 1.431   1.00 10.02 ? 71  PHE L CE2 1 
ATOM   574  C CZ  . PHE A 1 76  ? 14.046  -14.391 0.477   1.00 10.58 ? 71  PHE L CZ  1 
ATOM   575  N N   . THR A 1 77  ? 18.388  -9.704  -2.713  1.00 11.57 ? 72  THR L N   1 
ATOM   576  C CA  . THR A 1 77  ? 19.151  -8.587  -3.243  1.00 11.81 ? 72  THR L CA  1 
ATOM   577  C C   . THR A 1 77  ? 18.271  -7.514  -3.875  1.00 11.29 ? 72  THR L C   1 
ATOM   578  O O   . THR A 1 77  ? 17.297  -7.816  -4.572  1.00 10.32 ? 72  THR L O   1 
ATOM   579  C CB  . THR A 1 77  ? 20.085  -9.067  -4.406  1.00 11.68 ? 72  THR L CB  1 
ATOM   580  O OG1 . THR A 1 77  ? 20.882  -10.147 -3.945  1.00 14.42 ? 72  THR L OG1 1 
ATOM   581  C CG2 . THR A 1 77  ? 21.029  -7.949  -4.872  1.00 12.03 ? 72  THR L CG2 1 
ATOM   582  N N   . LEU A 1 78  ? 18.644  -6.264  -3.656  1.00 10.74 ? 73  LEU L N   1 
ATOM   583  C CA  . LEU A 1 78  ? 17.967  -5.156  -4.308  1.00 11.83 ? 73  LEU L CA  1 
ATOM   584  C C   . LEU A 1 78  ? 19.056  -4.650  -5.276  1.00 12.71 ? 73  LEU L C   1 
ATOM   585  O O   . LEU A 1 78  ? 20.218  -4.507  -4.887  1.00 13.13 ? 73  LEU L O   1 
ATOM   586  C CB  . LEU A 1 78  ? 17.586  -4.043  -3.311  1.00 11.30 ? 73  LEU L CB  1 
ATOM   587  C CG  . LEU A 1 78  ? 17.113  -2.679  -3.853  1.00 10.92 ? 73  LEU L CG  1 
ATOM   588  C CD1 . LEU A 1 78  ? 15.896  -2.839  -4.704  1.00 11.63 ? 73  LEU L CD1 1 
ATOM   589  C CD2 . LEU A 1 78  ? 16.801  -1.728  -2.729  1.00 11.34 ? 73  LEU L CD2 1 
ATOM   590  N N   . LYS A 1 79  ? 18.704  -4.426  -6.531  1.00 13.38 ? 74  LYS L N   1 
ATOM   591  C CA  . LYS A 1 79  ? 19.671  -3.936  -7.491  1.00 14.48 ? 74  LYS L CA  1 
ATOM   592  C C   . LYS A 1 79  ? 19.157  -2.686  -8.169  1.00 14.11 ? 74  LYS L C   1 
ATOM   593  O O   . LYS A 1 79  ? 17.967  -2.614  -8.521  1.00 14.20 ? 74  LYS L O   1 
ATOM   594  C CB  . LYS A 1 79  ? 19.968  -4.997  -8.539  1.00 16.65 ? 74  LYS L CB  1 
ATOM   595  C CG  . LYS A 1 79  ? 20.233  -6.348  -7.937  1.00 19.87 ? 74  LYS L CG  1 
ATOM   596  C CD  . LYS A 1 79  ? 20.830  -7.271  -8.961  1.00 23.26 ? 74  LYS L CD  1 
ATOM   597  C CE  . LYS A 1 79  ? 20.222  -8.682  -8.932  1.00 25.36 ? 74  LYS L CE  1 
ATOM   598  N NZ  . LYS A 1 79  ? 19.080  -8.792  -9.911  1.00 27.07 ? 74  LYS L NZ  1 
ATOM   599  N N   . ILE A 1 80  ? 20.021  -1.670  -8.247  1.00 12.78 ? 75  ILE L N   1 
ATOM   600  C CA  . ILE A 1 80  ? 19.703  -0.415  -8.917  1.00 12.16 ? 75  ILE L CA  1 
ATOM   601  C C   . ILE A 1 80  ? 20.598  -0.432  -10.143 1.00 12.34 ? 75  ILE L C   1 
ATOM   602  O O   . ILE A 1 80  ? 21.813  -0.440  -10.023 1.00 12.96 ? 75  ILE L O   1 
ATOM   603  C CB  . ILE A 1 80  ? 20.015  0.828   -8.053  1.00 11.51 ? 75  ILE L CB  1 
ATOM   604  C CG1 . ILE A 1 80  ? 19.595  0.581   -6.601  1.00 12.91 ? 75  ILE L CG1 1 
ATOM   605  C CG2 . ILE A 1 80  ? 19.243  2.040   -8.590  1.00 10.64 ? 75  ILE L CG2 1 
ATOM   606  C CD1 . ILE A 1 80  ? 19.985  1.697   -5.602  1.00 11.89 ? 75  ILE L CD1 1 
ATOM   607  N N   . SER A 1 81  ? 20.009  -0.497  -11.323 1.00 13.42 ? 76  SER L N   1 
ATOM   608  C CA  . SER A 1 81  ? 20.782  -0.541  -12.561 1.00 15.17 ? 76  SER L CA  1 
ATOM   609  C C   . SER A 1 81  ? 21.610  0.719   -12.825 1.00 15.99 ? 76  SER L C   1 
ATOM   610  O O   . SER A 1 81  ? 22.667  0.647   -13.458 1.00 17.52 ? 76  SER L O   1 
ATOM   611  C CB  . SER A 1 81  ? 19.859  -0.801  -13.755 1.00 14.42 ? 76  SER L CB  1 
ATOM   612  O OG  . SER A 1 81  ? 18.877  0.220   -13.848 1.00 16.19 ? 76  SER L OG  1 
ATOM   613  N N   . ARG A 1 82  ? 21.103  1.867   -12.384 1.00 16.28 ? 77  ARG L N   1 
ATOM   614  C CA  . ARG A 1 82  ? 21.774  3.144   -12.562 1.00 17.31 ? 77  ARG L CA  1 
ATOM   615  C C   . ARG A 1 82  ? 21.316  4.104   -11.452 1.00 17.00 ? 77  ARG L C   1 
ATOM   616  O O   . ARG A 1 82  ? 20.151  4.511   -11.394 1.00 17.40 ? 77  ARG L O   1 
ATOM   617  C CB  . ARG A 1 82  ? 21.462  3.717   -13.964 1.00 19.15 ? 77  ARG L CB  1 
ATOM   618  C CG  . ARG A 1 82  ? 22.039  5.114   -14.226 1.00 22.68 ? 77  ARG L CG  1 
ATOM   619  C CD  . ARG A 1 82  ? 21.609  5.753   -15.559 1.00 25.03 ? 77  ARG L CD  1 
ATOM   620  N NE  . ARG A 1 82  ? 21.864  4.906   -16.736 1.00 30.57 ? 77  ARG L NE  1 
ATOM   621  C CZ  . ARG A 1 82  ? 23.050  4.704   -17.352 1.00 32.72 ? 77  ARG L CZ  1 
ATOM   622  N NH1 . ARG A 1 82  ? 24.177  5.281   -16.925 1.00 33.70 ? 77  ARG L NH1 1 
ATOM   623  N NH2 . ARG A 1 82  ? 23.114  3.892   -18.414 1.00 33.71 ? 77  ARG L NH2 1 
ATOM   624  N N   . VAL A 1 83  ? 22.236  4.451   -10.564 1.00 15.94 ? 78  VAL L N   1 
ATOM   625  C CA  . VAL A 1 83  ? 21.955  5.341   -9.442  1.00 15.97 ? 78  VAL L CA  1 
ATOM   626  C C   . VAL A 1 83  ? 21.743  6.802   -9.845  1.00 16.80 ? 78  VAL L C   1 
ATOM   627  O O   . VAL A 1 83  ? 22.446  7.324   -10.704 1.00 16.87 ? 78  VAL L O   1 
ATOM   628  C CB  . VAL A 1 83  ? 23.084  5.204   -8.350  1.00 15.46 ? 78  VAL L CB  1 
ATOM   629  C CG1 . VAL A 1 83  ? 23.007  6.311   -7.302  1.00 13.82 ? 78  VAL L CG1 1 
ATOM   630  C CG2 . VAL A 1 83  ? 22.990  3.823   -7.690  1.00 13.69 ? 78  VAL L CG2 1 
ATOM   631  N N   . GLU A 1 84  ? 20.748  7.445   -9.230  1.00 17.79 ? 79  GLU L N   1 
ATOM   632  C CA  . GLU A 1 84  ? 20.427  8.845   -9.482  1.00 17.73 ? 79  GLU L CA  1 
ATOM   633  C C   . GLU A 1 84  ? 20.532  9.562   -8.143  1.00 17.16 ? 79  GLU L C   1 
ATOM   634  O O   . GLU A 1 84  ? 20.464  8.938   -7.090  1.00 17.43 ? 79  GLU L O   1 
ATOM   635  C CB  . GLU A 1 84  ? 18.998  8.998   -10.009 1.00 20.43 ? 79  GLU L CB  1 
ATOM   636  C CG  . GLU A 1 84  ? 18.640  8.236   -11.298 1.00 23.60 ? 79  GLU L CG  1 
ATOM   637  C CD  . GLU A 1 84  ? 19.332  8.757   -12.562 1.00 26.30 ? 79  GLU L CD  1 
ATOM   638  O OE1 . GLU A 1 84  ? 19.853  9.899   -12.560 1.00 28.00 ? 79  GLU L OE1 1 
ATOM   639  O OE2 . GLU A 1 84  ? 19.353  8.008   -13.578 1.00 28.24 ? 79  GLU L OE2 1 
ATOM   640  N N   . ALA A 1 85  ? 20.662  10.879  -8.183  1.00 17.13 ? 80  ALA L N   1 
ATOM   641  C CA  . ALA A 1 85  ? 20.786  11.688  -6.978  1.00 15.94 ? 80  ALA L CA  1 
ATOM   642  C C   . ALA A 1 85  ? 19.653  11.459  -5.977  1.00 15.68 ? 80  ALA L C   1 
ATOM   643  O O   . ALA A 1 85  ? 19.852  11.576  -4.777  1.00 14.06 ? 80  ALA L O   1 
ATOM   644  C CB  . ALA A 1 85  ? 20.857  13.148  -7.360  1.00 15.00 ? 80  ALA L CB  1 
ATOM   645  N N   . ALA A 1 86  ? 18.480  11.111  -6.504  1.00 17.30 ? 81  ALA L N   1 
ATOM   646  C CA  . ALA A 1 86  ? 17.226  10.856  -5.749  1.00 17.45 ? 81  ALA L CA  1 
ATOM   647  C C   . ALA A 1 86  ? 17.198  9.545   -4.925  1.00 16.67 ? 81  ALA L C   1 
ATOM   648  O O   . ALA A 1 86  ? 16.306  9.335   -4.090  1.00 15.93 ? 81  ALA L O   1 
ATOM   649  C CB  . ALA A 1 86  ? 16.036  10.866  -6.748  1.00 16.97 ? 81  ALA L CB  1 
ATOM   650  N N   . ASP A 1 87  ? 18.166  8.672   -5.196  1.00 15.52 ? 82  ASP L N   1 
ATOM   651  C CA  . ASP A 1 87  ? 18.276  7.380   -4.548  1.00 14.09 ? 82  ASP L CA  1 
ATOM   652  C C   . ASP A 1 87  ? 18.850  7.437   -3.150  1.00 13.07 ? 82  ASP L C   1 
ATOM   653  O O   . ASP A 1 87  ? 18.809  6.466   -2.397  1.00 12.72 ? 82  ASP L O   1 
ATOM   654  C CB  . ASP A 1 87  ? 19.059  6.444   -5.464  1.00 14.97 ? 82  ASP L CB  1 
ATOM   655  C CG  . ASP A 1 87  ? 18.268  6.091   -6.708  1.00 15.37 ? 82  ASP L CG  1 
ATOM   656  O OD1 . ASP A 1 87  ? 17.051  6.360   -6.727  1.00 16.28 ? 82  ASP L OD1 1 
ATOM   657  O OD2 . ASP A 1 87  ? 18.826  5.533   -7.661  1.00 16.92 ? 82  ASP L OD2 1 
ATOM   658  N N   . LEU A 1 88  ? 19.373  8.596   -2.820  1.00 11.84 ? 83  LEU L N   1 
ATOM   659  C CA  . LEU A 1 88  ? 19.939  8.897   -1.518  1.00 14.12 ? 83  LEU L CA  1 
ATOM   660  C C   . LEU A 1 88  ? 18.958  8.519   -0.378  1.00 13.96 ? 83  LEU L C   1 
ATOM   661  O O   . LEU A 1 88  ? 17.748  8.812   -0.435  1.00 15.98 ? 83  LEU L O   1 
ATOM   662  C CB  . LEU A 1 88  ? 20.188  10.416  -1.516  1.00 15.10 ? 83  LEU L CB  1 
ATOM   663  C CG  . LEU A 1 88  ? 20.824  11.261  -0.433  1.00 15.42 ? 83  LEU L CG  1 
ATOM   664  C CD1 . LEU A 1 88  ? 21.649  12.336  -1.131  1.00 16.73 ? 83  LEU L CD1 1 
ATOM   665  C CD2 . LEU A 1 88  ? 19.784  11.894  0.417   1.00 15.31 ? 83  LEU L CD2 1 
ATOM   666  N N   . GLY A 1 89  ? 19.463  7.862   0.654   1.00 13.57 ? 84  GLY L N   1 
ATOM   667  C CA  . GLY A 1 89  ? 18.606  7.516   1.769   1.00 12.28 ? 84  GLY L CA  1 
ATOM   668  C C   . GLY A 1 89  ? 18.892  6.170   2.382   1.00 11.93 ? 84  GLY L C   1 
ATOM   669  O O   . GLY A 1 89  ? 19.960  5.591   2.157   1.00 12.26 ? 84  GLY L O   1 
ATOM   670  N N   . LEU A 1 90  ? 17.933  5.687   3.161   1.00 10.11 ? 85  LEU L N   1 
ATOM   671  C CA  . LEU A 1 90  ? 18.038  4.401   3.823   1.00 11.43 ? 85  LEU L CA  1 
ATOM   672  C C   . LEU A 1 90  ? 17.143  3.348   3.202   1.00 11.26 ? 85  LEU L C   1 
ATOM   673  O O   . LEU A 1 90  ? 15.948  3.565   2.995   1.00 12.08 ? 85  LEU L O   1 
ATOM   674  C CB  . LEU A 1 90  ? 17.682  4.534   5.300   1.00 12.07 ? 85  LEU L CB  1 
ATOM   675  C CG  . LEU A 1 90  ? 18.853  4.965   6.154   1.00 12.86 ? 85  LEU L CG  1 
ATOM   676  C CD1 . LEU A 1 90  ? 18.380  6.007   7.115   1.00 13.55 ? 85  LEU L CD1 1 
ATOM   677  C CD2 . LEU A 1 90  ? 19.398  3.718   6.840   1.00 12.99 ? 85  LEU L CD2 1 
ATOM   678  N N   . TYR A 1 91  ? 17.731  2.189   2.942   1.00 10.99 ? 86  TYR L N   1 
ATOM   679  C CA  . TYR A 1 91  ? 17.014  1.073   2.364   1.00 9.02  ? 86  TYR L CA  1 
ATOM   680  C C   . TYR A 1 91  ? 16.819  -0.040  3.398   1.00 9.31  ? 86  TYR L C   1 
ATOM   681  O O   . TYR A 1 91  ? 17.765  -0.375  4.142   1.00 9.90  ? 86  TYR L O   1 
ATOM   682  C CB  . TYR A 1 91  ? 17.778  0.559   1.151   1.00 8.24  ? 86  TYR L CB  1 
ATOM   683  C CG  . TYR A 1 91  ? 17.789  1.547   0.021   1.00 8.88  ? 86  TYR L CG  1 
ATOM   684  C CD1 . TYR A 1 91  ? 18.646  2.669   0.042   1.00 9.14  ? 86  TYR L CD1 1 
ATOM   685  C CD2 . TYR A 1 91  ? 16.922  1.390   -1.081  1.00 8.30  ? 86  TYR L CD2 1 
ATOM   686  C CE1 . TYR A 1 91  ? 18.634  3.623   -1.014  1.00 8.05  ? 86  TYR L CE1 1 
ATOM   687  C CE2 . TYR A 1 91  ? 16.917  2.324   -2.143  1.00 7.59  ? 86  TYR L CE2 1 
ATOM   688  C CZ  . TYR A 1 91  ? 17.773  3.430   -2.094  1.00 7.35  ? 86  TYR L CZ  1 
ATOM   689  O OH  . TYR A 1 91  ? 17.787  4.320   -3.126  1.00 7.11  ? 86  TYR L OH  1 
ATOM   690  N N   . TYR A 1 92  ? 15.603  -0.613  3.426   1.00 8.80  ? 87  TYR L N   1 
ATOM   691  C CA  . TYR A 1 92  ? 15.245  -1.708  4.342   1.00 7.31  ? 87  TYR L CA  1 
ATOM   692  C C   . TYR A 1 92  ? 14.510  -2.863  3.670   1.00 7.69  ? 87  TYR L C   1 
ATOM   693  O O   . TYR A 1 92  ? 13.722  -2.672  2.748   1.00 5.96  ? 87  TYR L O   1 
ATOM   694  C CB  . TYR A 1 92  ? 14.287  -1.245  5.435   1.00 6.40  ? 87  TYR L CB  1 
ATOM   695  C CG  . TYR A 1 92  ? 14.721  -0.086  6.266   1.00 6.03  ? 87  TYR L CG  1 
ATOM   696  C CD1 . TYR A 1 92  ? 15.429  -0.290  7.437   1.00 6.33  ? 87  TYR L CD1 1 
ATOM   697  C CD2 . TYR A 1 92  ? 14.380  1.227   5.904   1.00 6.80  ? 87  TYR L CD2 1 
ATOM   698  C CE1 . TYR A 1 92  ? 15.795  0.768   8.229   1.00 7.00  ? 87  TYR L CE1 1 
ATOM   699  C CE2 . TYR A 1 92  ? 14.741  2.299   6.693   1.00 6.92  ? 87  TYR L CE2 1 
ATOM   700  C CZ  . TYR A 1 92  ? 15.450  2.050   7.853   1.00 7.92  ? 87  TYR L CZ  1 
ATOM   701  O OH  . TYR A 1 92  ? 15.815  3.096   8.658   1.00 11.64 ? 87  TYR L OH  1 
ATOM   702  N N   . CYS A 1 93  ? 14.799  -4.067  4.142   1.00 9.42  ? 88  CYS L N   1 
ATOM   703  C CA  . CYS A 1 93  ? 14.093  -5.256  3.700   1.00 11.12 ? 88  CYS L CA  1 
ATOM   704  C C   . CYS A 1 93  ? 13.272  -5.606  4.986   1.00 11.65 ? 88  CYS L C   1 
ATOM   705  O O   . CYS A 1 93  ? 13.700  -5.288  6.120   1.00 9.48  ? 88  CYS L O   1 
ATOM   706  C CB  . CYS A 1 93  ? 15.061  -6.380  3.316   1.00 12.36 ? 88  CYS L CB  1 
ATOM   707  S SG  . CYS A 1 93  ? 16.245  -6.840  4.625   1.00 16.47 ? 88  CYS L SG  1 
ATOM   708  N N   . VAL A 1 94  ? 12.081  -6.178  4.800   1.00 11.37 ? 89  VAL L N   1 
ATOM   709  C CA  . VAL A 1 94  ? 11.192  -6.555  5.904   1.00 9.70  ? 89  VAL L CA  1 
ATOM   710  C C   . VAL A 1 94  ? 10.653  -7.914  5.499   1.00 10.48 ? 89  VAL L C   1 
ATOM   711  O O   . VAL A 1 94  ? 10.470  -8.182  4.296   1.00 10.44 ? 89  VAL L O   1 
ATOM   712  C CB  . VAL A 1 94  ? 9.905   -5.697  5.949   1.00 9.50  ? 89  VAL L CB  1 
ATOM   713  C CG1 . VAL A 1 94  ? 9.403   -5.546  7.357   1.00 10.54 ? 89  VAL L CG1 1 
ATOM   714  C CG2 . VAL A 1 94  ? 10.046  -4.422  5.221   1.00 9.57  ? 89  VAL L CG2 1 
ATOM   715  N N   . GLN A 1 95  ? 10.373  -8.766  6.475   1.00 10.16 ? 90  GLN L N   1 
ATOM   716  C CA  . GLN A 1 95  ? 9.781   -10.059 6.153   1.00 10.89 ? 90  GLN L CA  1 
ATOM   717  C C   . GLN A 1 95  ? 8.415   -10.174 6.863   1.00 11.65 ? 90  GLN L C   1 
ATOM   718  O O   . GLN A 1 95  ? 8.238   -9.708  8.010   1.00 12.31 ? 90  GLN L O   1 
ATOM   719  C CB  . GLN A 1 95  ? 10.707  -11.228 6.542   1.00 10.02 ? 90  GLN L CB  1 
ATOM   720  C CG  . GLN A 1 95  ? 10.988  -11.424 8.055   1.00 10.18 ? 90  GLN L CG  1 
ATOM   721  C CD  . GLN A 1 95  ? 9.846   -12.100 8.818   1.00 9.86  ? 90  GLN L CD  1 
ATOM   722  O OE1 . GLN A 1 95  ? 9.056   -12.867 8.232   1.00 10.54 ? 90  GLN L OE1 1 
ATOM   723  N NE2 . GLN A 1 95  ? 9.763   -11.829 10.117  1.00 6.74  ? 90  GLN L NE2 1 
ATOM   724  N N   . GLY A 1 96  ? 7.451   -10.774 6.187   1.00 11.11 ? 91  GLY L N   1 
ATOM   725  C CA  . GLY A 1 96  ? 6.152   -10.954 6.800   1.00 13.27 ? 91  GLY L CA  1 
ATOM   726  C C   . GLY A 1 96  ? 5.719   -12.401 6.799   1.00 15.18 ? 91  GLY L C   1 
ATOM   727  O O   . GLY A 1 96  ? 4.541   -12.697 6.993   1.00 16.47 ? 91  GLY L O   1 
ATOM   728  N N   . THR A 1 97  ? 6.668   -13.299 6.550   1.00 15.91 ? 92  THR L N   1 
ATOM   729  C CA  . THR A 1 97  ? 6.383   -14.724 6.512   1.00 16.93 ? 92  THR L CA  1 
ATOM   730  C C   . THR A 1 97  ? 6.260   -15.238 7.944   1.00 18.62 ? 92  THR L C   1 
ATOM   731  O O   . THR A 1 97  ? 5.453   -16.116 8.248   1.00 20.44 ? 92  THR L O   1 
ATOM   732  C CB  . THR A 1 97  ? 7.502   -15.496 5.747   1.00 15.69 ? 92  THR L CB  1 
ATOM   733  O OG1 . THR A 1 97  ? 7.441   -15.149 4.370   1.00 13.94 ? 92  THR L OG1 1 
ATOM   734  C CG2 . THR A 1 97  ? 7.338   -17.022 5.883   1.00 14.40 ? 92  THR L CG2 1 
ATOM   735  N N   . HIS A 1 98  ? 7.055   -14.665 8.837   1.00 20.39 ? 93  HIS L N   1 
ATOM   736  C CA  . HIS A 1 98  ? 7.034   -15.080 10.236  1.00 20.72 ? 93  HIS L CA  1 
ATOM   737  C C   . HIS A 1 98  ? 6.502   -13.938 11.129  1.00 19.49 ? 93  HIS L C   1 
ATOM   738  O O   . HIS A 1 98  ? 6.798   -12.771 10.905  1.00 18.25 ? 93  HIS L O   1 
ATOM   739  C CB  . HIS A 1 98  ? 8.454   -15.515 10.691  1.00 22.31 ? 93  HIS L CB  1 
ATOM   740  C CG  . HIS A 1 98  ? 9.109   -16.542 9.808   1.00 23.65 ? 93  HIS L CG  1 
ATOM   741  N ND1 . HIS A 1 98  ? 8.769   -17.880 9.828   1.00 24.66 ? 93  HIS L ND1 1 
ATOM   742  C CD2 . HIS A 1 98  ? 10.093  -16.421 8.885   1.00 24.13 ? 93  HIS L CD2 1 
ATOM   743  C CE1 . HIS A 1 98  ? 9.512   -18.539 8.955   1.00 24.28 ? 93  HIS L CE1 1 
ATOM   744  N NE2 . HIS A 1 98  ? 10.323  -17.677 8.370   1.00 24.32 ? 93  HIS L NE2 1 
ATOM   745  N N   . PHE A 1 99  ? 5.658   -14.279 12.094  1.00 18.80 ? 94  PHE L N   1 
ATOM   746  C CA  . PHE A 1 99  ? 5.117   -13.299 13.024  1.00 18.16 ? 94  PHE L CA  1 
ATOM   747  C C   . PHE A 1 99  ? 6.034   -13.330 14.258  1.00 17.93 ? 94  PHE L C   1 
ATOM   748  O O   . PHE A 1 99  ? 6.507   -14.407 14.649  1.00 18.53 ? 94  PHE L O   1 
ATOM   749  C CB  . PHE A 1 99  ? 3.680   -13.683 13.407  1.00 17.85 ? 94  PHE L CB  1 
ATOM   750  C CG  . PHE A 1 99  ? 2.917   -12.583 14.098  1.00 17.65 ? 94  PHE L CG  1 
ATOM   751  C CD1 . PHE A 1 99  ? 2.309   -11.568 13.355  1.00 18.17 ? 94  PHE L CD1 1 
ATOM   752  C CD2 . PHE A 1 99  ? 2.842   -12.535 15.487  1.00 17.56 ? 94  PHE L CD2 1 
ATOM   753  C CE1 . PHE A 1 99  ? 1.644   -10.515 13.986  1.00 18.22 ? 94  PHE L CE1 1 
ATOM   754  C CE2 . PHE A 1 99  ? 2.183   -11.491 16.132  1.00 18.00 ? 94  PHE L CE2 1 
ATOM   755  C CZ  . PHE A 1 99  ? 1.584   -10.477 15.373  1.00 18.17 ? 94  PHE L CZ  1 
ATOM   756  N N   . PRO A 1 100 ? 6.419   -12.150 14.795  1.00 17.07 ? 95  PRO L N   1 
ATOM   757  C CA  . PRO A 1 100 ? 6.052   -10.818 14.312  1.00 16.45 ? 95  PRO L CA  1 
ATOM   758  C C   . PRO A 1 100 ? 6.921   -10.431 13.127  1.00 16.97 ? 95  PRO L C   1 
ATOM   759  O O   . PRO A 1 100 ? 8.015   -10.985 12.933  1.00 16.21 ? 95  PRO L O   1 
ATOM   760  C CB  . PRO A 1 100 ? 6.377   -9.933  15.506  1.00 15.95 ? 95  PRO L CB  1 
ATOM   761  C CG  . PRO A 1 100 ? 7.619   -10.568 16.047  1.00 16.80 ? 95  PRO L CG  1 
ATOM   762  C CD  . PRO A 1 100 ? 7.265   -12.045 16.003  1.00 16.50 ? 95  PRO L CD  1 
ATOM   763  N N   . TYR A 1 101 ? 6.442   -9.445  12.371  1.00 16.11 ? 96  TYR L N   1 
ATOM   764  C CA  . TYR A 1 101 ? 7.151   -8.945  11.211  1.00 15.27 ? 96  TYR L CA  1 
ATOM   765  C C   . TYR A 1 101 ? 8.434   -8.236  11.664  1.00 14.87 ? 96  TYR L C   1 
ATOM   766  O O   . TYR A 1 101 ? 8.417   -7.448  12.633  1.00 14.19 ? 96  TYR L O   1 
ATOM   767  C CB  . TYR A 1 101 ? 6.231   -8.018  10.421  1.00 15.37 ? 96  TYR L CB  1 
ATOM   768  C CG  . TYR A 1 101 ? 4.859   -8.625  10.185  1.00 15.73 ? 96  TYR L CG  1 
ATOM   769  C CD1 . TYR A 1 101 ? 4.712   -9.988  9.931   1.00 16.57 ? 96  TYR L CD1 1 
ATOM   770  C CD2 . TYR A 1 101 ? 3.708   -7.825  10.188  1.00 16.85 ? 96  TYR L CD2 1 
ATOM   771  C CE1 . TYR A 1 101 ? 3.460   -10.544 9.677   1.00 17.30 ? 96  TYR L CE1 1 
ATOM   772  C CE2 . TYR A 1 101 ? 2.442   -8.366  9.935   1.00 16.94 ? 96  TYR L CE2 1 
ATOM   773  C CZ  . TYR A 1 101 ? 2.332   -9.717  9.677   1.00 18.10 ? 96  TYR L CZ  1 
ATOM   774  O OH  . TYR A 1 101 ? 1.089   -10.215 9.377   1.00 20.20 ? 96  TYR L OH  1 
ATOM   775  N N   . THR A 1 102 ? 9.542   -8.525  10.972  1.00 14.13 ? 97  THR L N   1 
ATOM   776  C CA  . THR A 1 102 ? 10.836  -7.954  11.320  1.00 12.53 ? 97  THR L CA  1 
ATOM   777  C C   . THR A 1 102 ? 11.554  -7.307  10.127  1.00 11.80 ? 97  THR L C   1 
ATOM   778  O O   . THR A 1 102 ? 11.522  -7.821  9.003   1.00 11.58 ? 97  THR L O   1 
ATOM   779  C CB  . THR A 1 102 ? 11.748  -9.022  12.033  1.00 12.79 ? 97  THR L CB  1 
ATOM   780  O OG1 . THR A 1 102 ? 11.743  -10.240 11.287  1.00 14.90 ? 97  THR L OG1 1 
ATOM   781  C CG2 . THR A 1 102 ? 11.241  -9.344  13.443  1.00 11.99 ? 97  THR L CG2 1 
ATOM   782  N N   . PHE A 1 103 ? 12.149  -6.145  10.401  1.00 11.68 ? 98  PHE L N   1 
ATOM   783  C CA  . PHE A 1 103 ? 12.902  -5.321  9.456   1.00 11.02 ? 98  PHE L CA  1 
ATOM   784  C C   . PHE A 1 103 ? 14.412  -5.537  9.531   1.00 11.08 ? 98  PHE L C   1 
ATOM   785  O O   . PHE A 1 103 ? 14.950  -5.808  10.597  1.00 10.28 ? 98  PHE L O   1 
ATOM   786  C CB  . PHE A 1 103 ? 12.716  -3.844  9.806   1.00 9.73  ? 98  PHE L CB  1 
ATOM   787  C CG  . PHE A 1 103 ? 11.398  -3.298  9.446   1.00 9.58  ? 98  PHE L CG  1 
ATOM   788  C CD1 . PHE A 1 103 ? 10.335  -3.404  10.319  1.00 9.76  ? 98  PHE L CD1 1 
ATOM   789  C CD2 . PHE A 1 103 ? 11.212  -2.652  8.228   1.00 9.55  ? 98  PHE L CD2 1 
ATOM   790  C CE1 . PHE A 1 103 ? 9.100   -2.869  9.981   1.00 10.08 ? 98  PHE L CE1 1 
ATOM   791  C CE2 . PHE A 1 103 ? 9.991   -2.123  7.889   1.00 9.82  ? 98  PHE L CE2 1 
ATOM   792  C CZ  . PHE A 1 103 ? 8.930   -2.226  8.759   1.00 9.26  ? 98  PHE L CZ  1 
ATOM   793  N N   . GLY A 1 104 ? 15.094  -5.279  8.422   1.00 12.17 ? 99  GLY L N   1 
ATOM   794  C CA  . GLY A 1 104 ? 16.539  -5.368  8.415   1.00 13.31 ? 99  GLY L CA  1 
ATOM   795  C C   . GLY A 1 104 ? 17.055  -4.122  9.117   1.00 13.45 ? 99  GLY L C   1 
ATOM   796  O O   . GLY A 1 104 ? 16.274  -3.198  9.400   1.00 14.29 ? 99  GLY L O   1 
ATOM   797  N N   . GLY A 1 105 ? 18.361  -4.055  9.354   1.00 14.18 ? 100 GLY L N   1 
ATOM   798  C CA  . GLY A 1 105 ? 18.946  -2.911  10.038  1.00 12.11 ? 100 GLY L CA  1 
ATOM   799  C C   . GLY A 1 105 ? 19.046  -1.619  9.252   1.00 13.36 ? 100 GLY L C   1 
ATOM   800  O O   . GLY A 1 105 ? 19.079  -0.512  9.845   1.00 13.68 ? 100 GLY L O   1 
ATOM   801  N N   . GLY A 1 106 ? 19.083  -1.732  7.925   1.00 12.51 ? 101 GLY L N   1 
ATOM   802  C CA  . GLY A 1 106 ? 19.189  -0.545  7.090   1.00 12.76 ? 101 GLY L CA  1 
ATOM   803  C C   . GLY A 1 106 ? 20.553  -0.391  6.427   1.00 13.68 ? 101 GLY L C   1 
ATOM   804  O O   . GLY A 1 106 ? 21.589  -0.851  6.927   1.00 12.95 ? 101 GLY L O   1 
ATOM   805  N N   . THR A 1 107 ? 20.538  0.220   5.254   1.00 13.85 ? 102 THR L N   1 
ATOM   806  C CA  . THR A 1 107 ? 21.753  0.429   4.491   1.00 13.61 ? 102 THR L CA  1 
ATOM   807  C C   . THR A 1 107 ? 21.643  1.853   3.981   1.00 14.03 ? 102 THR L C   1 
ATOM   808  O O   . THR A 1 107 ? 20.634  2.190   3.339   1.00 14.48 ? 102 THR L O   1 
ATOM   809  C CB  . THR A 1 107 ? 21.833  -0.567  3.260   1.00 13.47 ? 102 THR L CB  1 
ATOM   810  O OG1 . THR A 1 107 ? 22.058  -1.916  3.705   1.00 12.06 ? 102 THR L OG1 1 
ATOM   811  C CG2 . THR A 1 107 ? 22.931  -0.154  2.280   1.00 12.27 ? 102 THR L CG2 1 
ATOM   812  N N   . LYS A 1 108 ? 22.589  2.713   4.356   1.00 13.66 ? 103 LYS L N   1 
ATOM   813  C CA  . LYS A 1 108 ? 22.550  4.078   3.847   1.00 16.10 ? 103 LYS L CA  1 
ATOM   814  C C   . LYS A 1 108 ? 23.251  4.166   2.501   1.00 16.06 ? 103 LYS L C   1 
ATOM   815  O O   . LYS A 1 108 ? 24.386  3.713   2.362   1.00 16.83 ? 103 LYS L O   1 
ATOM   816  C CB  . LYS A 1 108 ? 23.206  5.099   4.792   1.00 17.74 ? 103 LYS L CB  1 
ATOM   817  C CG  . LYS A 1 108 ? 23.453  6.473   4.092   1.00 20.62 ? 103 LYS L CG  1 
ATOM   818  C CD  . LYS A 1 108 ? 22.551  7.620   4.586   1.00 23.36 ? 103 LYS L CD  1 
ATOM   819  C CE  . LYS A 1 108 ? 22.158  8.687   3.487   1.00 25.54 ? 103 LYS L CE  1 
ATOM   820  N NZ  . LYS A 1 108 ? 23.265  9.355   2.662   1.00 26.03 ? 103 LYS L NZ  1 
ATOM   821  N N   . LEU A 1 109 ? 22.558  4.689   1.500   1.00 15.27 ? 104 LEU L N   1 
ATOM   822  C CA  . LEU A 1 109 ? 23.173  4.874   0.214   1.00 15.01 ? 104 LEU L CA  1 
ATOM   823  C C   . LEU A 1 109 ? 23.533  6.346   0.132   1.00 16.26 ? 104 LEU L C   1 
ATOM   824  O O   . LEU A 1 109 ? 22.667  7.212   0.299   1.00 16.21 ? 104 LEU L O   1 
ATOM   825  C CB  . LEU A 1 109 ? 22.223  4.512   -0.929  1.00 14.85 ? 104 LEU L CB  1 
ATOM   826  C CG  . LEU A 1 109 ? 22.763  4.629   -2.365  1.00 15.19 ? 104 LEU L CG  1 
ATOM   827  C CD1 . LEU A 1 109 ? 22.036  3.686   -3.303  1.00 16.42 ? 104 LEU L CD1 1 
ATOM   828  C CD2 . LEU A 1 109 ? 22.633  6.040   -2.863  1.00 16.22 ? 104 LEU L CD2 1 
ATOM   829  N N   . GLU A 1 110 ? 24.816  6.639   -0.070  1.00 17.28 ? 105 GLU L N   1 
ATOM   830  C CA  . GLU A 1 110 ? 25.241  8.022   -0.223  1.00 17.43 ? 105 GLU L CA  1 
ATOM   831  C C   . GLU A 1 110 ? 25.827  8.185   -1.608  1.00 15.43 ? 105 GLU L C   1 
ATOM   832  O O   . GLU A 1 110 ? 26.344  7.240   -2.188  1.00 15.21 ? 105 GLU L O   1 
ATOM   833  C CB  . GLU A 1 110 ? 26.231  8.452   0.870   1.00 19.62 ? 105 GLU L CB  1 
ATOM   834  C CG  . GLU A 1 110 ? 27.642  8.006   0.687   1.00 23.58 ? 105 GLU L CG  1 
ATOM   835  C CD  . GLU A 1 110 ? 28.674  9.070   1.085   1.00 24.70 ? 105 GLU L CD  1 
ATOM   836  O OE1 . GLU A 1 110 ? 28.626  9.595   2.215   1.00 26.56 ? 105 GLU L OE1 1 
ATOM   837  O OE2 . GLU A 1 110 ? 29.566  9.347   0.268   1.00 25.05 ? 105 GLU L OE2 1 
ATOM   838  N N   . ILE A 1 111 ? 25.612  9.344   -2.193  1.00 15.73 ? 106 ILE L N   1 
ATOM   839  C CA  . ILE A 1 111 ? 26.137  9.637   -3.524  1.00 16.64 ? 106 ILE L CA  1 
ATOM   840  C C   . ILE A 1 111 ? 27.602  10.079  -3.434  1.00 16.21 ? 106 ILE L C   1 
ATOM   841  O O   . ILE A 1 111 ? 27.952  10.967  -2.647  1.00 15.46 ? 106 ILE L O   1 
ATOM   842  C CB  . ILE A 1 111 ? 25.312  10.739  -4.229  1.00 17.22 ? 106 ILE L CB  1 
ATOM   843  C CG1 . ILE A 1 111 ? 23.820  10.375  -4.213  1.00 17.37 ? 106 ILE L CG1 1 
ATOM   844  C CG2 . ILE A 1 111 ? 25.813  10.950  -5.655  1.00 17.41 ? 106 ILE L CG2 1 
ATOM   845  C CD1 . ILE A 1 111 ? 23.496  9.030   -4.797  1.00 19.16 ? 106 ILE L CD1 1 
ATOM   846  N N   . LEU A 1 112 ? 28.452  9.425   -4.213  1.00 15.75 ? 107 LEU L N   1 
ATOM   847  C CA  . LEU A 1 112 ? 29.860  9.739   -4.229  1.00 17.44 ? 107 LEU L CA  1 
ATOM   848  C C   . LEU A 1 112 ? 30.027  10.806  -5.284  1.00 16.98 ? 107 LEU L C   1 
ATOM   849  O O   . LEU A 1 112 ? 29.655  10.604  -6.430  1.00 17.17 ? 107 LEU L O   1 
ATOM   850  C CB  . LEU A 1 112 ? 30.668  8.492   -4.597  1.00 19.67 ? 107 LEU L CB  1 
ATOM   851  C CG  . LEU A 1 112 ? 32.208  8.447   -4.643  1.00 20.91 ? 107 LEU L CG  1 
ATOM   852  C CD1 . LEU A 1 112 ? 32.781  8.832   -3.332  1.00 22.90 ? 107 LEU L CD1 1 
ATOM   853  C CD2 . LEU A 1 112 ? 32.700  7.042   -4.963  1.00 21.15 ? 107 LEU L CD2 1 
ATOM   854  N N   . ARG A 1 113 ? 30.446  11.989  -4.866  1.00 16.32 ? 108 ARG L N   1 
ATOM   855  C CA  . ARG A 1 113 ? 30.670  13.079  -5.798  1.00 15.90 ? 108 ARG L CA  1 
ATOM   856  C C   . ARG A 1 113 ? 32.114  13.567  -5.682  1.00 16.39 ? 108 ARG L C   1 
ATOM   857  O O   . ARG A 1 113 ? 32.881  13.055  -4.871  1.00 15.80 ? 108 ARG L O   1 
ATOM   858  C CB  . ARG A 1 113 ? 29.658  14.213  -5.586  1.00 15.82 ? 108 ARG L CB  1 
ATOM   859  C CG  . ARG A 1 113 ? 29.419  14.605  -4.142  1.00 15.88 ? 108 ARG L CG  1 
ATOM   860  C CD  . ARG A 1 113 ? 30.053  15.909  -3.839  1.00 16.38 ? 108 ARG L CD  1 
ATOM   861  N NE  . ARG A 1 113 ? 29.539  16.965  -4.700  1.00 18.66 ? 108 ARG L NE  1 
ATOM   862  C CZ  . ARG A 1 113 ? 30.232  18.044  -5.060  1.00 18.37 ? 108 ARG L CZ  1 
ATOM   863  N NH1 . ARG A 1 113 ? 31.473  18.206  -4.654  1.00 19.62 ? 108 ARG L NH1 1 
ATOM   864  N NH2 . ARG A 1 113 ? 29.655  19.005  -5.746  1.00 18.35 ? 108 ARG L NH2 1 
ATOM   865  N N   . ALA A 1 114 ? 32.505  14.494  -6.549  1.00 16.77 ? 109 ALA L N   1 
ATOM   866  C CA  . ALA A 1 114 ? 33.860  15.019  -6.538  1.00 17.57 ? 109 ALA L CA  1 
ATOM   867  C C   . ALA A 1 114 ? 34.091  15.738  -5.226  1.00 18.46 ? 109 ALA L C   1 
ATOM   868  O O   . ALA A 1 114 ? 33.159  16.281  -4.638  1.00 18.28 ? 109 ALA L O   1 
ATOM   869  C CB  . ALA A 1 114 ? 34.059  15.969  -7.698  1.00 17.06 ? 109 ALA L CB  1 
ATOM   870  N N   . ASP A 1 115 ? 35.324  15.676  -4.739  1.00 20.19 ? 110 ASP L N   1 
ATOM   871  C CA  . ASP A 1 115 ? 35.694  16.335  -3.501  1.00 21.82 ? 110 ASP L CA  1 
ATOM   872  C C   . ASP A 1 115 ? 35.397  17.821  -3.605  1.00 21.39 ? 110 ASP L C   1 
ATOM   873  O O   . ASP A 1 115 ? 35.628  18.427  -4.654  1.00 21.27 ? 110 ASP L O   1 
ATOM   874  C CB  . ASP A 1 115 ? 37.172  16.131  -3.214  1.00 24.41 ? 110 ASP L CB  1 
ATOM   875  C CG  . ASP A 1 115 ? 37.490  14.733  -2.732  1.00 26.82 ? 110 ASP L CG  1 
ATOM   876  O OD1 . ASP A 1 115 ? 36.744  13.771  -3.039  1.00 28.59 ? 110 ASP L OD1 1 
ATOM   877  O OD2 . ASP A 1 115 ? 38.510  14.592  -2.032  1.00 29.82 ? 110 ASP L OD2 1 
ATOM   878  N N   . ALA A 1 116 ? 34.853  18.381  -2.521  1.00 20.34 ? 111 ALA L N   1 
ATOM   879  C CA  . ALA A 1 116 ? 34.494  19.790  -2.434  1.00 18.35 ? 111 ALA L CA  1 
ATOM   880  C C   . ALA A 1 116 ? 34.900  20.331  -1.081  1.00 17.75 ? 111 ALA L C   1 
ATOM   881  O O   . ALA A 1 116 ? 34.589  19.750  -0.048  1.00 16.20 ? 111 ALA L O   1 
ATOM   882  C CB  . ALA A 1 116 ? 33.010  19.973  -2.640  1.00 17.52 ? 111 ALA L CB  1 
ATOM   883  N N   . ALA A 1 117 ? 35.665  21.415  -1.109  1.00 18.20 ? 112 ALA L N   1 
ATOM   884  C CA  . ALA A 1 117 ? 36.144  22.059  0.099   1.00 18.59 ? 112 ALA L CA  1 
ATOM   885  C C   . ALA A 1 117 ? 35.037  22.909  0.714   1.00 18.01 ? 112 ALA L C   1 
ATOM   886  O O   . ALA A 1 117 ? 34.245  23.517  0.007   1.00 17.17 ? 112 ALA L O   1 
ATOM   887  C CB  . ALA A 1 117 ? 37.366  22.922  -0.204  1.00 19.68 ? 112 ALA L CB  1 
ATOM   888  N N   . PRO A 1 118 ? 35.008  22.985  2.050   1.00 17.80 ? 113 PRO L N   1 
ATOM   889  C CA  . PRO A 1 118 ? 34.021  23.743  2.812   1.00 17.40 ? 113 PRO L CA  1 
ATOM   890  C C   . PRO A 1 118 ? 34.161  25.240  2.647   1.00 16.90 ? 113 PRO L C   1 
ATOM   891  O O   . PRO A 1 118 ? 35.262  25.759  2.456   1.00 17.42 ? 113 PRO L O   1 
ATOM   892  C CB  . PRO A 1 118 ? 34.369  23.389  4.269   1.00 17.63 ? 113 PRO L CB  1 
ATOM   893  C CG  . PRO A 1 118 ? 35.250  22.187  4.193   1.00 18.11 ? 113 PRO L CG  1 
ATOM   894  C CD  . PRO A 1 118 ? 36.027  22.414  2.952   1.00 18.17 ? 113 PRO L CD  1 
ATOM   895  N N   . THR A 1 119 ? 33.051  25.944  2.726   1.00 15.36 ? 114 THR L N   1 
ATOM   896  C CA  . THR A 1 119 ? 33.119  27.386  2.705   1.00 15.98 ? 114 THR L CA  1 
ATOM   897  C C   . THR A 1 119 ? 32.883  27.634  4.196   1.00 15.48 ? 114 THR L C   1 
ATOM   898  O O   . THR A 1 119 ? 31.878  27.179  4.739   1.00 15.66 ? 114 THR L O   1 
ATOM   899  C CB  . THR A 1 119 ? 32.029  27.968  1.850   1.00 16.37 ? 114 THR L CB  1 
ATOM   900  O OG1 . THR A 1 119 ? 32.151  27.424  0.535   1.00 17.65 ? 114 THR L OG1 1 
ATOM   901  C CG2 . THR A 1 119 ? 32.139  29.480  1.811   1.00 15.51 ? 114 THR L CG2 1 
ATOM   902  N N   . VAL A 1 120 ? 33.863  28.227  4.872   1.00 15.13 ? 115 VAL L N   1 
ATOM   903  C CA  . VAL A 1 120 ? 33.798  28.449  6.314   1.00 14.56 ? 115 VAL L CA  1 
ATOM   904  C C   . VAL A 1 120 ? 33.471  29.893  6.669   1.00 15.02 ? 115 VAL L C   1 
ATOM   905  O O   . VAL A 1 120 ? 33.987  30.816  6.038   1.00 16.63 ? 115 VAL L O   1 
ATOM   906  C CB  . VAL A 1 120 ? 35.131  27.986  6.964   1.00 13.97 ? 115 VAL L CB  1 
ATOM   907  C CG1 . VAL A 1 120 ? 35.113  28.187  8.468   1.00 13.23 ? 115 VAL L CG1 1 
ATOM   908  C CG2 . VAL A 1 120 ? 35.363  26.528  6.642   1.00 13.02 ? 115 VAL L CG2 1 
ATOM   909  N N   . SER A 1 121 ? 32.576  30.079  7.640   1.00 15.00 ? 116 SER L N   1 
ATOM   910  C CA  . SER A 1 121 ? 32.149  31.402  8.103   1.00 14.36 ? 116 SER L CA  1 
ATOM   911  C C   . SER A 1 121 ? 32.167  31.449  9.618   1.00 13.41 ? 116 SER L C   1 
ATOM   912  O O   . SER A 1 121 ? 31.762  30.497  10.268  1.00 14.79 ? 116 SER L O   1 
ATOM   913  C CB  . SER A 1 121 ? 30.743  31.730  7.589   1.00 15.31 ? 116 SER L CB  1 
ATOM   914  O OG  . SER A 1 121 ? 30.752  31.769  6.171   1.00 17.32 ? 116 SER L OG  1 
ATOM   915  N N   . ILE A 1 122 ? 32.534  32.597  10.167  1.00 13.15 ? 117 ILE L N   1 
ATOM   916  C CA  . ILE A 1 122 ? 32.630  32.753  11.595  1.00 12.94 ? 117 ILE L CA  1 
ATOM   917  C C   . ILE A 1 122 ? 31.809  33.961  12.062  1.00 13.81 ? 117 ILE L C   1 
ATOM   918  O O   . ILE A 1 122 ? 31.724  34.986  11.362  1.00 12.80 ? 117 ILE L O   1 
ATOM   919  C CB  . ILE A 1 122 ? 34.155  32.812  12.071  1.00 13.02 ? 117 ILE L CB  1 
ATOM   920  C CG1 . ILE A 1 122 ? 34.251  32.620  13.589  1.00 12.72 ? 117 ILE L CG1 1 
ATOM   921  C CG2 . ILE A 1 122 ? 34.822  34.135  11.685  1.00 12.48 ? 117 ILE L CG2 1 
ATOM   922  C CD1 . ILE A 1 122 ? 35.666  32.278  14.094  1.00 12.28 ? 117 ILE L CD1 1 
ATOM   923  N N   . PHE A 1 123 ? 31.162  33.804  13.227  1.00 14.04 ? 118 PHE L N   1 
ATOM   924  C CA  . PHE A 1 123 ? 30.327  34.855  13.802  1.00 13.22 ? 118 PHE L CA  1 
ATOM   925  C C   . PHE A 1 123 ? 30.588  35.030  15.282  1.00 13.75 ? 118 PHE L C   1 
ATOM   926  O O   . PHE A 1 123 ? 30.656  34.050  16.027  1.00 13.32 ? 118 PHE L O   1 
ATOM   927  C CB  . PHE A 1 123 ? 28.837  34.525  13.618  1.00 12.30 ? 118 PHE L CB  1 
ATOM   928  C CG  . PHE A 1 123 ? 28.470  34.200  12.218  1.00 11.52 ? 118 PHE L CG  1 
ATOM   929  C CD1 . PHE A 1 123 ? 28.596  32.915  11.750  1.00 11.43 ? 118 PHE L CD1 1 
ATOM   930  C CD2 . PHE A 1 123 ? 28.020  35.190  11.362  1.00 12.45 ? 118 PHE L CD2 1 
ATOM   931  C CE1 . PHE A 1 123 ? 28.279  32.611  10.457  1.00 11.86 ? 118 PHE L CE1 1 
ATOM   932  C CE2 . PHE A 1 123 ? 27.699  34.900  10.054  1.00 12.89 ? 118 PHE L CE2 1 
ATOM   933  C CZ  . PHE A 1 123 ? 27.828  33.599  9.601   1.00 13.20 ? 118 PHE L CZ  1 
ATOM   934  N N   . PRO A 1 124 ? 30.779  36.279  15.717  1.00 14.16 ? 119 PRO L N   1 
ATOM   935  C CA  . PRO A 1 124 ? 31.030  36.626  17.115  1.00 14.67 ? 119 PRO L CA  1 
ATOM   936  C C   . PRO A 1 124 ? 29.658  36.598  17.833  1.00 16.00 ? 119 PRO L C   1 
ATOM   937  O O   . PRO A 1 124 ? 28.603  36.448  17.198  1.00 15.13 ? 119 PRO L O   1 
ATOM   938  C CB  . PRO A 1 124 ? 31.537  38.064  17.027  1.00 14.24 ? 119 PRO L CB  1 
ATOM   939  C CG  . PRO A 1 124 ? 31.878  38.268  15.601  1.00 13.34 ? 119 PRO L CG  1 
ATOM   940  C CD  . PRO A 1 124 ? 30.886  37.477  14.866  1.00 13.82 ? 119 PRO L CD  1 
ATOM   941  N N   . PRO A 1 125 ? 29.654  36.739  19.165  1.00 16.87 ? 120 PRO L N   1 
ATOM   942  C CA  . PRO A 1 125 ? 28.353  36.728  19.859  1.00 17.93 ? 120 PRO L CA  1 
ATOM   943  C C   . PRO A 1 125 ? 27.515  37.949  19.469  1.00 18.70 ? 120 PRO L C   1 
ATOM   944  O O   . PRO A 1 125 ? 28.049  38.957  19.012  1.00 18.89 ? 120 PRO L O   1 
ATOM   945  C CB  . PRO A 1 125 ? 28.756  36.805  21.332  1.00 17.09 ? 120 PRO L CB  1 
ATOM   946  C CG  . PRO A 1 125 ? 30.089  36.161  21.353  1.00 17.19 ? 120 PRO L CG  1 
ATOM   947  C CD  . PRO A 1 125 ? 30.764  36.696  20.118  1.00 16.33 ? 120 PRO L CD  1 
ATOM   948  N N   . SER A 1 126 ? 26.199  37.850  19.629  1.00 20.56 ? 121 SER L N   1 
ATOM   949  C CA  . SER A 1 126 ? 25.301  38.962  19.342  1.00 20.88 ? 121 SER L CA  1 
ATOM   950  C C   . SER A 1 126 ? 25.188  39.806  20.623  1.00 21.77 ? 121 SER L C   1 
ATOM   951  O O   . SER A 1 126 ? 25.233  39.269  21.741  1.00 20.38 ? 121 SER L O   1 
ATOM   952  C CB  . SER A 1 126 ? 23.914  38.430  18.948  1.00 20.41 ? 121 SER L CB  1 
ATOM   953  O OG  . SER A 1 126 ? 23.274  37.778  20.042  1.00 20.60 ? 121 SER L OG  1 
ATOM   954  N N   . SER A 1 127 ? 25.044  41.119  20.449  1.00 23.34 ? 122 SER L N   1 
ATOM   955  C CA  . SER A 1 127 ? 24.881  42.050  21.572  1.00 25.56 ? 122 SER L CA  1 
ATOM   956  C C   . SER A 1 127 ? 23.763  41.568  22.467  1.00 25.11 ? 122 SER L C   1 
ATOM   957  O O   . SER A 1 127 ? 23.831  41.668  23.684  1.00 26.22 ? 122 SER L O   1 
ATOM   958  C CB  . SER A 1 127 ? 24.512  43.451  21.075  1.00 26.47 ? 122 SER L CB  1 
ATOM   959  O OG  . SER A 1 127 ? 25.545  43.990  20.276  1.00 29.21 ? 122 SER L OG  1 
ATOM   960  N N   . GLU A 1 128 ? 22.717  41.073  21.832  1.00 25.80 ? 123 GLU L N   1 
ATOM   961  C CA  . GLU A 1 128 ? 21.552  40.551  22.524  1.00 26.52 ? 123 GLU L CA  1 
ATOM   962  C C   . GLU A 1 128 ? 21.923  39.411  23.472  1.00 24.67 ? 123 GLU L C   1 
ATOM   963  O O   . GLU A 1 128 ? 21.434  39.355  24.591  1.00 25.91 ? 123 GLU L O   1 
ATOM   964  C CB  . GLU A 1 128 ? 20.522  40.069  21.493  1.00 29.14 ? 123 GLU L CB  1 
ATOM   965  C CG  . GLU A 1 128 ? 19.907  41.173  20.661  1.00 31.73 ? 123 GLU L CG  1 
ATOM   966  C CD  . GLU A 1 128 ? 20.503  41.321  19.262  1.00 34.08 ? 123 GLU L CD  1 
ATOM   967  O OE1 . GLU A 1 128 ? 21.709  41.029  19.034  1.00 33.79 ? 123 GLU L OE1 1 
ATOM   968  O OE2 . GLU A 1 128 ? 19.726  41.767  18.378  1.00 36.15 ? 123 GLU L OE2 1 
ATOM   969  N N   . GLN A 1 129 ? 22.792  38.506  23.028  1.00 22.64 ? 124 GLN L N   1 
ATOM   970  C CA  . GLN A 1 129 ? 23.204  37.388  23.863  1.00 19.87 ? 124 GLN L CA  1 
ATOM   971  C C   . GLN A 1 129 ? 24.129  37.832  24.985  1.00 20.31 ? 124 GLN L C   1 
ATOM   972  O O   . GLN A 1 129 ? 24.011  37.396  26.132  1.00 20.14 ? 124 GLN L O   1 
ATOM   973  C CB  . GLN A 1 129 ? 23.913  36.337  23.033  1.00 17.66 ? 124 GLN L CB  1 
ATOM   974  C CG  . GLN A 1 129 ? 24.215  35.098  23.838  1.00 15.26 ? 124 GLN L CG  1 
ATOM   975  C CD  . GLN A 1 129 ? 24.876  34.025  23.045  1.00 13.91 ? 124 GLN L CD  1 
ATOM   976  O OE1 . GLN A 1 129 ? 25.453  34.278  21.984  1.00 13.17 ? 124 GLN L OE1 1 
ATOM   977  N NE2 . GLN A 1 129 ? 24.810  32.803  23.553  1.00 13.56 ? 124 GLN L NE2 1 
ATOM   978  N N   . LEU A 1 130 ? 25.093  38.665  24.631  1.00 22.07 ? 125 LEU L N   1 
ATOM   979  C CA  . LEU A 1 130 ? 26.051  39.167  25.606  1.00 23.96 ? 125 LEU L CA  1 
ATOM   980  C C   . LEU A 1 130 ? 25.296  39.838  26.736  1.00 25.74 ? 125 LEU L C   1 
ATOM   981  O O   . LEU A 1 130 ? 25.623  39.661  27.910  1.00 26.37 ? 125 LEU L O   1 
ATOM   982  C CB  . LEU A 1 130 ? 27.036  40.147  24.947  1.00 22.53 ? 125 LEU L CB  1 
ATOM   983  C CG  . LEU A 1 130 ? 28.103  39.432  24.116  1.00 22.07 ? 125 LEU L CG  1 
ATOM   984  C CD1 . LEU A 1 130 ? 28.862  40.426  23.294  1.00 22.19 ? 125 LEU L CD1 1 
ATOM   985  C CD2 . LEU A 1 130 ? 29.041  38.654  25.026  1.00 21.23 ? 125 LEU L CD2 1 
ATOM   986  N N   . THR A 1 131 ? 24.235  40.551  26.367  1.00 27.62 ? 126 THR L N   1 
ATOM   987  C CA  . THR A 1 131 ? 23.383  41.256  27.308  1.00 28.70 ? 126 THR L CA  1 
ATOM   988  C C   . THR A 1 131 ? 22.777  40.311  28.346  1.00 29.48 ? 126 THR L C   1 
ATOM   989  O O   . THR A 1 131 ? 22.431  40.722  29.440  1.00 30.43 ? 126 THR L O   1 
ATOM   990  C CB  . THR A 1 131 ? 22.331  42.043  26.530  1.00 29.63 ? 126 THR L CB  1 
ATOM   991  O OG1 . THR A 1 131 ? 22.956  43.196  25.942  1.00 30.08 ? 126 THR L OG1 1 
ATOM   992  C CG2 . THR A 1 131 ? 21.206  42.484  27.415  1.00 31.18 ? 126 THR L CG2 1 
ATOM   993  N N   . SER A 1 132 ? 22.747  39.028  28.023  1.00 30.67 ? 127 SER L N   1 
ATOM   994  C CA  . SER A 1 132 ? 22.232  37.997  28.915  1.00 31.25 ? 127 SER L CA  1 
ATOM   995  C C   . SER A 1 132 ? 23.395  37.303  29.640  1.00 30.51 ? 127 SER L C   1 
ATOM   996  O O   . SER A 1 132 ? 23.213  36.299  30.342  1.00 30.12 ? 127 SER L O   1 
ATOM   997  C CB  . SER A 1 132 ? 21.450  36.984  28.082  1.00 32.41 ? 127 SER L CB  1 
ATOM   998  O OG  . SER A 1 132 ? 20.589  37.680  27.180  1.00 34.72 ? 127 SER L OG  1 
ATOM   999  N N   . GLY A 1 133 ? 24.597  37.819  29.416  1.00 30.01 ? 128 GLY L N   1 
ATOM   1000 C CA  . GLY A 1 133 ? 25.789  37.269  30.034  1.00 28.50 ? 128 GLY L CA  1 
ATOM   1001 C C   . GLY A 1 133 ? 26.362  36.032  29.376  1.00 27.84 ? 128 GLY L C   1 
ATOM   1002 O O   . GLY A 1 133 ? 27.246  35.368  29.939  1.00 28.43 ? 128 GLY L O   1 
ATOM   1003 N N   . GLY A 1 134 ? 25.898  35.718  28.170  1.00 27.43 ? 129 GLY L N   1 
ATOM   1004 C CA  . GLY A 1 134 ? 26.414  34.541  27.477  1.00 23.34 ? 129 GLY L CA  1 
ATOM   1005 C C   . GLY A 1 134 ? 27.091  34.958  26.196  1.00 21.45 ? 129 GLY L C   1 
ATOM   1006 O O   . GLY A 1 134 ? 26.968  36.110  25.774  1.00 20.38 ? 129 GLY L O   1 
ATOM   1007 N N   . ALA A 1 135 ? 27.823  34.042  25.584  1.00 19.15 ? 130 ALA L N   1 
ATOM   1008 C CA  . ALA A 1 135 ? 28.484  34.361  24.338  1.00 17.80 ? 130 ALA L CA  1 
ATOM   1009 C C   . ALA A 1 135 ? 28.678  33.106  23.520  1.00 16.73 ? 130 ALA L C   1 
ATOM   1010 O O   . ALA A 1 135 ? 29.315  32.170  23.974  1.00 16.54 ? 130 ALA L O   1 
ATOM   1011 C CB  . ALA A 1 135 ? 29.819  35.016  24.605  1.00 17.93 ? 130 ALA L CB  1 
ATOM   1012 N N   . SER A 1 136 ? 28.040  33.025  22.364  1.00 15.52 ? 131 SER L N   1 
ATOM   1013 C CA  . SER A 1 136 ? 28.230  31.857  21.506  1.00 14.60 ? 131 SER L CA  1 
ATOM   1014 C C   . SER A 1 136 ? 28.966  32.310  20.238  1.00 13.76 ? 131 SER L C   1 
ATOM   1015 O O   . SER A 1 136 ? 28.650  33.362  19.669  1.00 14.24 ? 131 SER L O   1 
ATOM   1016 C CB  . SER A 1 136 ? 26.891  31.184  21.163  1.00 15.68 ? 131 SER L CB  1 
ATOM   1017 O OG  . SER A 1 136 ? 26.395  30.444  22.274  1.00 16.13 ? 131 SER L OG  1 
ATOM   1018 N N   . VAL A 1 137 ? 30.028  31.593  19.894  1.00 11.15 ? 132 VAL L N   1 
ATOM   1019 C CA  . VAL A 1 137 ? 30.796  31.889  18.707  1.00 11.39 ? 132 VAL L CA  1 
ATOM   1020 C C   . VAL A 1 137 ? 30.378  30.752  17.791  1.00 10.43 ? 132 VAL L C   1 
ATOM   1021 O O   . VAL A 1 137 ? 30.472  29.588  18.150  1.00 10.93 ? 132 VAL L O   1 
ATOM   1022 C CB  . VAL A 1 137 ? 32.355  31.865  18.974  1.00 11.81 ? 132 VAL L CB  1 
ATOM   1023 C CG1 . VAL A 1 137 ? 33.130  32.287  17.707  1.00 11.57 ? 132 VAL L CG1 1 
ATOM   1024 C CG2 . VAL A 1 137 ? 32.706  32.821  20.101  1.00 12.47 ? 132 VAL L CG2 1 
ATOM   1025 N N   . VAL A 1 138 ? 29.957  31.089  16.591  1.00 10.61 ? 133 VAL L N   1 
ATOM   1026 C CA  . VAL A 1 138 ? 29.468  30.101  15.668  1.00 10.17 ? 133 VAL L CA  1 
ATOM   1027 C C   . VAL A 1 138 ? 30.329  30.012  14.443  1.00 11.90 ? 133 VAL L C   1 
ATOM   1028 O O   . VAL A 1 138 ? 30.745  31.020  13.881  1.00 11.30 ? 133 VAL L O   1 
ATOM   1029 C CB  . VAL A 1 138 ? 28.015  30.481  15.212  1.00 10.28 ? 133 VAL L CB  1 
ATOM   1030 C CG1 . VAL A 1 138 ? 27.429  29.425  14.241  1.00 9.67  ? 133 VAL L CG1 1 
ATOM   1031 C CG2 . VAL A 1 138 ? 27.113  30.622  16.430  1.00 8.43  ? 133 VAL L CG2 1 
ATOM   1032 N N   . CYS A 1 139 ? 30.512  28.791  13.974  1.00 13.74 ? 134 CYS L N   1 
ATOM   1033 C CA  . CYS A 1 139 ? 31.262  28.581  12.758  1.00 15.95 ? 134 CYS L CA  1 
ATOM   1034 C C   . CYS A 1 139 ? 30.457  27.655  11.824  1.00 14.20 ? 134 CYS L C   1 
ATOM   1035 O O   . CYS A 1 139 ? 30.003  26.592  12.252  1.00 13.00 ? 134 CYS L O   1 
ATOM   1036 C CB  . CYS A 1 139 ? 32.606  27.964  13.123  1.00 18.53 ? 134 CYS L CB  1 
ATOM   1037 S SG  . CYS A 1 139 ? 33.843  28.030  11.810  1.00 22.88 ? 134 CYS L SG  1 
ATOM   1038 N N   . PHE A 1 140 ? 30.186  28.102  10.602  1.00 12.61 ? 135 PHE L N   1 
ATOM   1039 C CA  . PHE A 1 140 ? 29.472  27.257  9.641   1.00 12.93 ? 135 PHE L CA  1 
ATOM   1040 C C   . PHE A 1 140 ? 30.505  26.722  8.648   1.00 12.93 ? 135 PHE L C   1 
ATOM   1041 O O   . PHE A 1 140 ? 31.409  27.454  8.234   1.00 13.04 ? 135 PHE L O   1 
ATOM   1042 C CB  . PHE A 1 140 ? 28.427  28.034  8.827   1.00 12.69 ? 135 PHE L CB  1 
ATOM   1043 C CG  . PHE A 1 140 ? 27.239  28.486  9.606   1.00 13.35 ? 135 PHE L CG  1 
ATOM   1044 C CD1 . PHE A 1 140 ? 26.472  27.577  10.320  1.00 13.57 ? 135 PHE L CD1 1 
ATOM   1045 C CD2 . PHE A 1 140 ? 26.899  29.838  9.650   1.00 13.75 ? 135 PHE L CD2 1 
ATOM   1046 C CE1 . PHE A 1 140 ? 25.373  28.008  11.094  1.00 14.10 ? 135 PHE L CE1 1 
ATOM   1047 C CE2 . PHE A 1 140 ? 25.813  30.275  10.411  1.00 14.71 ? 135 PHE L CE2 1 
ATOM   1048 C CZ  . PHE A 1 140 ? 25.049  29.345  11.142  1.00 13.69 ? 135 PHE L CZ  1 
ATOM   1049 N N   . LEU A 1 141 ? 30.370  25.450  8.281   1.00 12.93 ? 136 LEU L N   1 
ATOM   1050 C CA  . LEU A 1 141 ? 31.249  24.784  7.306   1.00 13.90 ? 136 LEU L CA  1 
ATOM   1051 C C   . LEU A 1 141 ? 30.293  24.180  6.284   1.00 13.15 ? 136 LEU L C   1 
ATOM   1052 O O   . LEU A 1 141 ? 29.846  23.039  6.421   1.00 12.52 ? 136 LEU L O   1 
ATOM   1053 C CB  . LEU A 1 141 ? 32.119  23.704  7.980   1.00 13.60 ? 136 LEU L CB  1 
ATOM   1054 C CG  . LEU A 1 141 ? 32.970  24.306  9.093   1.00 14.35 ? 136 LEU L CG  1 
ATOM   1055 C CD1 . LEU A 1 141 ? 32.439  23.854  10.437  1.00 13.81 ? 136 LEU L CD1 1 
ATOM   1056 C CD2 . LEU A 1 141 ? 34.418  23.933  8.915   1.00 14.74 ? 136 LEU L CD2 1 
ATOM   1057 N N   . ASN A 1 142 ? 30.042  24.932  5.226   1.00 13.10 ? 137 ASN L N   1 
ATOM   1058 C CA  . ASN A 1 142 ? 29.057  24.532  4.249   1.00 13.89 ? 137 ASN L CA  1 
ATOM   1059 C C   . ASN A 1 142 ? 29.516  23.959  2.937   1.00 15.60 ? 137 ASN L C   1 
ATOM   1060 O O   . ASN A 1 142 ? 30.611  24.265  2.466   1.00 15.36 ? 137 ASN L O   1 
ATOM   1061 C CB  . ASN A 1 142 ? 28.113  25.716  3.983   1.00 13.63 ? 137 ASN L CB  1 
ATOM   1062 C CG  . ASN A 1 142 ? 27.297  26.138  5.229   1.00 13.77 ? 137 ASN L CG  1 
ATOM   1063 O OD1 . ASN A 1 142 ? 27.037  25.343  6.150   1.00 13.12 ? 137 ASN L OD1 1 
ATOM   1064 N ND2 . ASN A 1 142 ? 26.877  27.390  5.243   1.00 13.54 ? 137 ASN L ND2 1 
ATOM   1065 N N   . ASN A 1 143 ? 28.645  23.122  2.359   1.00 15.73 ? 138 ASN L N   1 
ATOM   1066 C CA  . ASN A 1 143 ? 28.839  22.472  1.060   1.00 15.94 ? 138 ASN L CA  1 
ATOM   1067 C C   . ASN A 1 143 ? 30.166  21.753  0.792   1.00 15.58 ? 138 ASN L C   1 
ATOM   1068 O O   . ASN A 1 143 ? 30.837  22.013  -0.201  1.00 14.89 ? 138 ASN L O   1 
ATOM   1069 C CB  . ASN A 1 143 ? 28.541  23.461  -0.059  1.00 17.08 ? 138 ASN L CB  1 
ATOM   1070 C CG  . ASN A 1 143 ? 27.176  24.098  0.089   1.00 18.84 ? 138 ASN L CG  1 
ATOM   1071 O OD1 . ASN A 1 143 ? 26.992  25.028  0.882   1.00 19.34 ? 138 ASN L OD1 1 
ATOM   1072 N ND2 . ASN A 1 143 ? 26.192  23.562  -0.631  1.00 19.34 ? 138 ASN L ND2 1 
ATOM   1073 N N   . PHE A 1 144 ? 30.490  20.784  1.638   1.00 14.59 ? 139 PHE L N   1 
ATOM   1074 C CA  . PHE A 1 144 ? 31.710  20.031  1.471   1.00 13.46 ? 139 PHE L CA  1 
ATOM   1075 C C   . PHE A 1 144 ? 31.445  18.541  1.201   1.00 13.92 ? 139 PHE L C   1 
ATOM   1076 O O   . PHE A 1 144 ? 30.340  18.037  1.417   1.00 13.41 ? 139 PHE L O   1 
ATOM   1077 C CB  . PHE A 1 144 ? 32.622  20.212  2.701   1.00 12.33 ? 139 PHE L CB  1 
ATOM   1078 C CG  . PHE A 1 144 ? 32.024  19.724  3.993   1.00 10.73 ? 139 PHE L CG  1 
ATOM   1079 C CD1 . PHE A 1 144 ? 32.163  18.400  4.382   1.00 10.61 ? 139 PHE L CD1 1 
ATOM   1080 C CD2 . PHE A 1 144 ? 31.349  20.595  4.836   1.00 10.22 ? 139 PHE L CD2 1 
ATOM   1081 C CE1 . PHE A 1 144 ? 31.636  17.950  5.598   1.00 10.16 ? 139 PHE L CE1 1 
ATOM   1082 C CE2 . PHE A 1 144 ? 30.831  20.154  6.047   1.00 9.36  ? 139 PHE L CE2 1 
ATOM   1083 C CZ  . PHE A 1 144 ? 30.971  18.839  6.428   1.00 8.17  ? 139 PHE L CZ  1 
ATOM   1084 N N   . TYR A 1 145 ? 32.477  17.848  0.727   1.00 13.99 ? 140 TYR L N   1 
ATOM   1085 C CA  . TYR A 1 145 ? 32.422  16.426  0.447   1.00 14.29 ? 140 TYR L CA  1 
ATOM   1086 C C   . TYR A 1 145 ? 33.872  15.965  0.287   1.00 15.79 ? 140 TYR L C   1 
ATOM   1087 O O   . TYR A 1 145 ? 34.661  16.608  -0.403  1.00 15.37 ? 140 TYR L O   1 
ATOM   1088 C CB  . TYR A 1 145 ? 31.621  16.133  -0.825  1.00 13.42 ? 140 TYR L CB  1 
ATOM   1089 C CG  . TYR A 1 145 ? 31.447  14.648  -1.058  1.00 14.36 ? 140 TYR L CG  1 
ATOM   1090 C CD1 . TYR A 1 145 ? 32.439  13.899  -1.720  1.00 15.21 ? 140 TYR L CD1 1 
ATOM   1091 C CD2 . TYR A 1 145 ? 30.353  13.965  -0.541  1.00 14.21 ? 140 TYR L CD2 1 
ATOM   1092 C CE1 . TYR A 1 145 ? 32.343  12.519  -1.834  1.00 13.42 ? 140 TYR L CE1 1 
ATOM   1093 C CE2 . TYR A 1 145 ? 30.246  12.592  -0.660  1.00 13.36 ? 140 TYR L CE2 1 
ATOM   1094 C CZ  . TYR A 1 145 ? 31.245  11.877  -1.294  1.00 13.27 ? 140 TYR L CZ  1 
ATOM   1095 O OH  . TYR A 1 145 ? 31.197  10.510  -1.301  1.00 14.10 ? 140 TYR L OH  1 
ATOM   1096 N N   . PRO A 1 146 ? 34.244  14.825  0.896   1.00 17.26 ? 141 PRO L N   1 
ATOM   1097 C CA  . PRO A 1 146 ? 33.500  13.869  1.729   1.00 18.44 ? 141 PRO L CA  1 
ATOM   1098 C C   . PRO A 1 146 ? 33.056  14.444  3.046   1.00 19.09 ? 141 PRO L C   1 
ATOM   1099 O O   . PRO A 1 146 ? 33.524  15.488  3.472   1.00 18.44 ? 141 PRO L O   1 
ATOM   1100 C CB  . PRO A 1 146 ? 34.513  12.744  1.961   1.00 18.52 ? 141 PRO L CB  1 
ATOM   1101 C CG  . PRO A 1 146 ? 35.377  12.818  0.769   1.00 18.84 ? 141 PRO L CG  1 
ATOM   1102 C CD  . PRO A 1 146 ? 35.588  14.305  0.620   1.00 17.98 ? 141 PRO L CD  1 
ATOM   1103 N N   . LYS A 1 147 ? 32.225  13.676  3.726   1.00 21.43 ? 142 LYS L N   1 
ATOM   1104 C CA  . LYS A 1 147 ? 31.641  14.055  4.997   1.00 23.86 ? 142 LYS L CA  1 
ATOM   1105 C C   . LYS A 1 147 ? 32.607  14.134  6.184   1.00 23.80 ? 142 LYS L C   1 
ATOM   1106 O O   . LYS A 1 147 ? 32.365  14.841  7.165   1.00 24.63 ? 142 LYS L O   1 
ATOM   1107 C CB  . LYS A 1 147 ? 30.466  13.109  5.244   1.00 25.28 ? 142 LYS L CB  1 
ATOM   1108 C CG  . LYS A 1 147 ? 30.084  12.822  6.655   1.00 28.30 ? 142 LYS L CG  1 
ATOM   1109 C CD  . LYS A 1 147 ? 29.476  11.416  6.691   1.00 31.57 ? 142 LYS L CD  1 
ATOM   1110 C CE  . LYS A 1 147 ? 30.437  10.365  6.043   1.00 33.62 ? 142 LYS L CE  1 
ATOM   1111 N NZ  . LYS A 1 147 ? 29.826  9.010   5.765   1.00 34.50 ? 142 LYS L NZ  1 
ATOM   1112 N N   . ASP A 1 148 ? 33.721  13.436  6.097   1.00 25.48 ? 143 ASP L N   1 
ATOM   1113 C CA  . ASP A 1 148 ? 34.669  13.474  7.204   1.00 26.96 ? 143 ASP L CA  1 
ATOM   1114 C C   . ASP A 1 148 ? 35.370  14.840  7.230   1.00 25.43 ? 143 ASP L C   1 
ATOM   1115 O O   . ASP A 1 148 ? 35.956  15.273  6.233   1.00 26.35 ? 143 ASP L O   1 
ATOM   1116 C CB  . ASP A 1 148 ? 35.673  12.321  7.077   1.00 30.09 ? 143 ASP L CB  1 
ATOM   1117 C CG  . ASP A 1 148 ? 34.990  10.981  6.769   1.00 33.04 ? 143 ASP L CG  1 
ATOM   1118 O OD1 . ASP A 1 148 ? 34.770  10.695  5.554   1.00 34.84 ? 143 ASP L OD1 1 
ATOM   1119 O OD2 . ASP A 1 148 ? 34.660  10.231  7.730   1.00 33.63 ? 143 ASP L OD2 1 
ATOM   1120 N N   . ILE A 1 149 ? 35.261  15.529  8.353   1.00 23.38 ? 144 ILE L N   1 
ATOM   1121 C CA  . ILE A 1 149 ? 35.859  16.840  8.534   1.00 21.57 ? 144 ILE L CA  1 
ATOM   1122 C C   . ILE A 1 149 ? 36.168  17.002  10.020  1.00 23.54 ? 144 ILE L C   1 
ATOM   1123 O O   . ILE A 1 149 ? 35.534  16.361  10.875  1.00 22.73 ? 144 ILE L O   1 
ATOM   1124 C CB  . ILE A 1 149 ? 34.896  17.930  8.090   1.00 19.44 ? 144 ILE L CB  1 
ATOM   1125 C CG1 . ILE A 1 149 ? 35.566  19.303  8.136   1.00 17.42 ? 144 ILE L CG1 1 
ATOM   1126 C CG2 . ILE A 1 149 ? 33.660  17.860  8.926   1.00 19.20 ? 144 ILE L CG2 1 
ATOM   1127 C CD1 . ILE A 1 149 ? 34.931  20.318  7.206   1.00 15.58 ? 144 ILE L CD1 1 
ATOM   1128 N N   . ASN A 1 150 ? 37.139  17.847  10.335  1.00 24.47 ? 145 ASN L N   1 
ATOM   1129 C CA  . ASN A 1 150 ? 37.510  18.049  11.714  1.00 26.19 ? 145 ASN L CA  1 
ATOM   1130 C C   . ASN A 1 150 ? 37.689  19.533  11.986  1.00 25.22 ? 145 ASN L C   1 
ATOM   1131 O O   . ASN A 1 150 ? 38.450  20.205  11.295  1.00 26.40 ? 145 ASN L O   1 
ATOM   1132 C CB  . ASN A 1 150 ? 38.818  17.304  11.995  1.00 29.21 ? 145 ASN L CB  1 
ATOM   1133 C CG  . ASN A 1 150 ? 38.891  16.765  13.413  1.00 32.45 ? 145 ASN L CG  1 
ATOM   1134 O OD1 . ASN A 1 150 ? 38.420  15.653  13.678  1.00 34.35 ? 145 ASN L OD1 1 
ATOM   1135 N ND2 . ASN A 1 150 ? 39.489  17.541  14.338  1.00 33.46 ? 145 ASN L ND2 1 
ATOM   1136 N N   . VAL A 1 151 ? 36.980  20.062  12.971  1.00 23.91 ? 146 VAL L N   1 
ATOM   1137 C CA  . VAL A 1 151 ? 37.148  21.471  13.290  1.00 23.50 ? 146 VAL L CA  1 
ATOM   1138 C C   . VAL A 1 151 ? 37.657  21.673  14.712  1.00 23.10 ? 146 VAL L C   1 
ATOM   1139 O O   . VAL A 1 151 ? 37.287  20.941  15.636  1.00 22.19 ? 146 VAL L O   1 
ATOM   1140 C CB  . VAL A 1 151 ? 35.866  22.373  12.995  1.00 23.75 ? 146 VAL L CB  1 
ATOM   1141 C CG1 . VAL A 1 151 ? 34.779  21.587  12.307  1.00 23.45 ? 146 VAL L CG1 1 
ATOM   1142 C CG2 . VAL A 1 151 ? 35.363  23.095  14.266  1.00 24.11 ? 146 VAL L CG2 1 
ATOM   1143 N N   . LYS A 1 152 ? 38.562  22.639  14.851  1.00 23.36 ? 147 LYS L N   1 
ATOM   1144 C CA  . LYS A 1 152 ? 39.146  22.992  16.133  1.00 22.23 ? 147 LYS L CA  1 
ATOM   1145 C C   . LYS A 1 152 ? 38.943  24.456  16.463  1.00 19.99 ? 147 LYS L C   1 
ATOM   1146 O O   . LYS A 1 152 ? 38.966  25.306  15.580  1.00 17.59 ? 147 LYS L O   1 
ATOM   1147 C CB  . LYS A 1 152 ? 40.643  22.660  16.177  1.00 24.16 ? 147 LYS L CB  1 
ATOM   1148 C CG  . LYS A 1 152 ? 40.962  21.354  16.892  1.00 26.76 ? 147 LYS L CG  1 
ATOM   1149 C CD  . LYS A 1 152 ? 39.873  20.949  17.964  1.00 29.68 ? 147 LYS L CD  1 
ATOM   1150 C CE  . LYS A 1 152 ? 39.596  21.984  19.098  1.00 29.92 ? 147 LYS L CE  1 
ATOM   1151 N NZ  . LYS A 1 152 ? 38.289  21.769  19.805  1.00 29.35 ? 147 LYS L NZ  1 
ATOM   1152 N N   . TRP A 1 153 ? 38.647  24.714  17.735  1.00 19.14 ? 148 TRP L N   1 
ATOM   1153 C CA  . TRP A 1 153 ? 38.471  26.066  18.242  1.00 17.17 ? 148 TRP L CA  1 
ATOM   1154 C C   . TRP A 1 153 ? 39.749  26.435  18.974  1.00 17.33 ? 148 TRP L C   1 
ATOM   1155 O O   . TRP A 1 153 ? 40.371  25.589  19.620  1.00 15.35 ? 148 TRP L O   1 
ATOM   1156 C CB  . TRP A 1 153 ? 37.257  26.174  19.180  1.00 15.59 ? 148 TRP L CB  1 
ATOM   1157 C CG  . TRP A 1 153 ? 35.946  26.188  18.444  1.00 14.67 ? 148 TRP L CG  1 
ATOM   1158 C CD1 . TRP A 1 153 ? 35.108  25.125  18.241  1.00 14.57 ? 148 TRP L CD1 1 
ATOM   1159 C CD2 . TRP A 1 153 ? 35.333  27.306  17.790  1.00 13.73 ? 148 TRP L CD2 1 
ATOM   1160 N NE1 . TRP A 1 153 ? 34.022  25.514  17.500  1.00 13.57 ? 148 TRP L NE1 1 
ATOM   1161 C CE2 . TRP A 1 153 ? 34.135  26.847  17.208  1.00 13.75 ? 148 TRP L CE2 1 
ATOM   1162 C CE3 . TRP A 1 153 ? 35.680  28.653  17.638  1.00 13.79 ? 148 TRP L CE3 1 
ATOM   1163 C CZ2 . TRP A 1 153 ? 33.280  27.688  16.484  1.00 13.22 ? 148 TRP L CZ2 1 
ATOM   1164 C CZ3 . TRP A 1 153 ? 34.818  29.494  16.908  1.00 13.15 ? 148 TRP L CZ3 1 
ATOM   1165 C CH2 . TRP A 1 153 ? 33.638  29.000  16.345  1.00 12.40 ? 148 TRP L CH2 1 
ATOM   1166 N N   . LYS A 1 154 ? 40.142  27.696  18.840  1.00 17.89 ? 149 LYS L N   1 
ATOM   1167 C CA  . LYS A 1 154 ? 41.336  28.217  19.463  1.00 17.75 ? 149 LYS L CA  1 
ATOM   1168 C C   . LYS A 1 154 ? 41.065  29.599  19.939  1.00 16.81 ? 149 LYS L C   1 
ATOM   1169 O O   . LYS A 1 154 ? 40.592  30.420  19.190  1.00 16.40 ? 149 LYS L O   1 
ATOM   1170 C CB  . LYS A 1 154 ? 42.481  28.271  18.469  1.00 19.48 ? 149 LYS L CB  1 
ATOM   1171 C CG  . LYS A 1 154 ? 43.017  26.927  18.105  1.00 21.45 ? 149 LYS L CG  1 
ATOM   1172 C CD  . LYS A 1 154 ? 44.205  27.117  17.232  1.00 24.40 ? 149 LYS L CD  1 
ATOM   1173 C CE  . LYS A 1 154 ? 44.712  25.784  16.736  1.00 27.26 ? 149 LYS L CE  1 
ATOM   1174 N NZ  . LYS A 1 154 ? 45.788  25.996  15.717  1.00 29.72 ? 149 LYS L NZ  1 
ATOM   1175 N N   . ILE A 1 155 ? 41.353  29.846  21.203  1.00 17.67 ? 150 ILE L N   1 
ATOM   1176 C CA  . ILE A 1 155 ? 41.142  31.149  21.800  1.00 19.10 ? 150 ILE L CA  1 
ATOM   1177 C C   . ILE A 1 155 ? 42.545  31.647  22.103  1.00 19.60 ? 150 ILE L C   1 
ATOM   1178 O O   . ILE A 1 155 ? 43.285  30.974  22.807  1.00 20.82 ? 150 ILE L O   1 
ATOM   1179 C CB  . ILE A 1 155 ? 40.290  31.021  23.081  1.00 18.93 ? 150 ILE L CB  1 
ATOM   1180 C CG1 . ILE A 1 155 ? 38.969  30.309  22.732  1.00 20.01 ? 150 ILE L CG1 1 
ATOM   1181 C CG2 . ILE A 1 155 ? 40.005  32.391  23.645  1.00 19.43 ? 150 ILE L CG2 1 
ATOM   1182 C CD1 . ILE A 1 155 ? 38.054  30.015  23.882  1.00 20.03 ? 150 ILE L CD1 1 
ATOM   1183 N N   . ASP A 1 156 ? 42.940  32.757  21.481  1.00 19.95 ? 151 ASP L N   1 
ATOM   1184 C CA  . ASP A 1 156 ? 44.277  33.329  21.664  1.00 21.41 ? 151 ASP L CA  1 
ATOM   1185 C C   . ASP A 1 156 ? 45.357  32.279  21.405  1.00 21.98 ? 151 ASP L C   1 
ATOM   1186 O O   . ASP A 1 156 ? 46.313  32.151  22.162  1.00 21.10 ? 151 ASP L O   1 
ATOM   1187 C CB  . ASP A 1 156 ? 44.444  33.892  23.076  1.00 21.38 ? 151 ASP L CB  1 
ATOM   1188 C CG  . ASP A 1 156 ? 43.654  35.153  23.300  1.00 22.01 ? 151 ASP L CG  1 
ATOM   1189 O OD1 . ASP A 1 156 ? 43.531  35.979  22.374  1.00 22.75 ? 151 ASP L OD1 1 
ATOM   1190 O OD2 . ASP A 1 156 ? 43.166  35.330  24.423  1.00 22.93 ? 151 ASP L OD2 1 
ATOM   1191 N N   . GLY A 1 157 ? 45.157  31.478  20.371  1.00 23.47 ? 152 GLY L N   1 
ATOM   1192 C CA  . GLY A 1 157 ? 46.125  30.460  20.061  1.00 24.79 ? 152 GLY L CA  1 
ATOM   1193 C C   . GLY A 1 157 ? 45.939  29.129  20.748  1.00 26.93 ? 152 GLY L C   1 
ATOM   1194 O O   . GLY A 1 157 ? 46.437  28.136  20.236  1.00 27.79 ? 152 GLY L O   1 
ATOM   1195 N N   . SER A 1 158 ? 45.248  29.057  21.882  1.00 29.17 ? 153 SER L N   1 
ATOM   1196 C CA  . SER A 1 158 ? 45.086  27.749  22.522  1.00 31.15 ? 153 SER L CA  1 
ATOM   1197 C C   . SER A 1 158 ? 43.765  27.056  22.225  1.00 31.65 ? 153 SER L C   1 
ATOM   1198 O O   . SER A 1 158 ? 42.709  27.674  22.131  1.00 30.42 ? 153 SER L O   1 
ATOM   1199 C CB  . SER A 1 158 ? 45.356  27.810  24.031  1.00 32.64 ? 153 SER L CB  1 
ATOM   1200 O OG  . SER A 1 158 ? 44.450  28.666  24.698  1.00 35.26 ? 153 SER L OG  1 
ATOM   1201 N N   . GLU A 1 159 ? 43.854  25.747  22.079  1.00 33.62 ? 154 GLU L N   1 
ATOM   1202 C CA  . GLU A 1 159 ? 42.722  24.902  21.760  1.00 36.66 ? 154 GLU L CA  1 
ATOM   1203 C C   . GLU A 1 159 ? 41.693  24.739  22.869  1.00 37.47 ? 154 GLU L C   1 
ATOM   1204 O O   . GLU A 1 159 ? 42.018  24.360  23.983  1.00 38.29 ? 154 GLU L O   1 
ATOM   1205 C CB  . GLU A 1 159 ? 43.245  23.533  21.295  1.00 37.82 ? 154 GLU L CB  1 
ATOM   1206 C CG  . GLU A 1 159 ? 42.205  22.431  21.224  1.00 40.17 ? 154 GLU L CG  1 
ATOM   1207 C CD  . GLU A 1 159 ? 42.612  21.283  20.300  1.00 42.09 ? 154 GLU L CD  1 
ATOM   1208 O OE1 . GLU A 1 159 ? 43.630  21.406  19.562  1.00 42.68 ? 154 GLU L OE1 1 
ATOM   1209 O OE2 . GLU A 1 159 ? 41.887  20.260  20.295  1.00 42.89 ? 154 GLU L OE2 1 
ATOM   1210 N N   . ARG A 1 160 ? 40.442  25.036  22.560  1.00 38.95 ? 155 ARG L N   1 
ATOM   1211 C CA  . ARG A 1 160 ? 39.369  24.887  23.534  1.00 40.17 ? 155 ARG L CA  1 
ATOM   1212 C C   . ARG A 1 160 ? 38.545  23.699  23.053  1.00 40.69 ? 155 ARG L C   1 
ATOM   1213 O O   . ARG A 1 160 ? 38.184  23.617  21.878  1.00 40.83 ? 155 ARG L O   1 
ATOM   1214 C CB  . ARG A 1 160 ? 38.522  26.164  23.599  1.00 40.56 ? 155 ARG L CB  1 
ATOM   1215 C CG  . ARG A 1 160 ? 37.220  26.042  24.366  1.00 42.13 ? 155 ARG L CG  1 
ATOM   1216 C CD  . ARG A 1 160 ? 37.450  25.613  25.800  1.00 44.17 ? 155 ARG L CD  1 
ATOM   1217 N NE  . ARG A 1 160 ? 37.307  26.701  26.772  1.00 46.01 ? 155 ARG L NE  1 
ATOM   1218 C CZ  . ARG A 1 160 ? 36.171  27.022  27.391  1.00 46.61 ? 155 ARG L CZ  1 
ATOM   1219 N NH1 . ARG A 1 160 ? 35.043  26.357  27.149  1.00 46.47 ? 155 ARG L NH1 1 
ATOM   1220 N NH2 . ARG A 1 160 ? 36.177  27.975  28.305  1.00 47.26 ? 155 ARG L NH2 1 
ATOM   1221 N N   . GLN A 1 161 ? 38.311  22.740  23.933  1.00 41.24 ? 156 GLN L N   1 
ATOM   1222 C CA  . GLN A 1 161 ? 37.526  21.583  23.537  1.00 42.38 ? 156 GLN L CA  1 
ATOM   1223 C C   . GLN A 1 161 ? 36.199  21.492  24.259  1.00 41.60 ? 156 GLN L C   1 
ATOM   1224 O O   . GLN A 1 161 ? 35.271  20.846  23.778  1.00 42.31 ? 156 GLN L O   1 
ATOM   1225 C CB  . GLN A 1 161 ? 38.313  20.305  23.741  1.00 44.60 ? 156 GLN L CB  1 
ATOM   1226 C CG  . GLN A 1 161 ? 39.365  20.065  22.689  1.00 47.05 ? 156 GLN L CG  1 
ATOM   1227 C CD  . GLN A 1 161 ? 40.241  18.872  23.017  1.00 48.57 ? 156 GLN L CD  1 
ATOM   1228 O OE1 . GLN A 1 161 ? 41.252  18.636  22.344  1.00 49.97 ? 156 GLN L OE1 1 
ATOM   1229 N NE2 . GLN A 1 161 ? 39.869  18.111  24.057  1.00 48.35 ? 156 GLN L NE2 1 
ATOM   1230 N N   . ASN A 1 162 ? 36.119  22.119  25.421  1.00 40.31 ? 157 ASN L N   1 
ATOM   1231 C CA  . ASN A 1 162 ? 34.896  22.093  26.192  1.00 40.35 ? 157 ASN L CA  1 
ATOM   1232 C C   . ASN A 1 162 ? 33.968  23.247  25.806  1.00 38.68 ? 157 ASN L C   1 
ATOM   1233 O O   . ASN A 1 162 ? 34.403  24.387  25.609  1.00 38.90 ? 157 ASN L O   1 
ATOM   1234 C CB  . ASN A 1 162 ? 35.201  22.094  27.702  1.00 42.90 ? 157 ASN L CB  1 
ATOM   1235 C CG  . ASN A 1 162 ? 36.203  23.181  28.104  1.00 45.14 ? 157 ASN L CG  1 
ATOM   1236 O OD1 . ASN A 1 162 ? 37.407  23.087  27.794  1.00 45.83 ? 157 ASN L OD1 1 
ATOM   1237 N ND2 . ASN A 1 162 ? 35.714  24.225  28.777  1.00 46.12 ? 157 ASN L ND2 1 
ATOM   1238 N N   . GLY A 1 163 ? 32.691  22.929  25.638  1.00 35.64 ? 158 GLY L N   1 
ATOM   1239 C CA  . GLY A 1 163 ? 31.738  23.957  25.280  1.00 32.68 ? 158 GLY L CA  1 
ATOM   1240 C C   . GLY A 1 163 ? 31.419  24.005  23.803  1.00 30.12 ? 158 GLY L C   1 
ATOM   1241 O O   . GLY A 1 163 ? 30.853  24.984  23.329  1.00 29.89 ? 158 GLY L O   1 
ATOM   1242 N N   . VAL A 1 164 ? 31.744  22.932  23.090  1.00 28.34 ? 159 VAL L N   1 
ATOM   1243 C CA  . VAL A 1 164 ? 31.495  22.852  21.651  1.00 27.25 ? 159 VAL L CA  1 
ATOM   1244 C C   . VAL A 1 164 ? 30.234  22.044  21.333  1.00 26.64 ? 159 VAL L C   1 
ATOM   1245 O O   . VAL A 1 164 ? 30.009  20.976  21.888  1.00 26.99 ? 159 VAL L O   1 
ATOM   1246 C CB  . VAL A 1 164 ? 32.686  22.227  20.920  1.00 26.40 ? 159 VAL L CB  1 
ATOM   1247 C CG1 . VAL A 1 164 ? 32.461  22.264  19.416  1.00 25.88 ? 159 VAL L CG1 1 
ATOM   1248 C CG2 . VAL A 1 164 ? 33.974  22.949  21.309  1.00 26.53 ? 159 VAL L CG2 1 
ATOM   1249 N N   . LEU A 1 165 ? 29.415  22.572  20.439  1.00 25.68 ? 160 LEU L N   1 
ATOM   1250 C CA  . LEU A 1 165 ? 28.183  21.920  20.044  1.00 24.86 ? 160 LEU L CA  1 
ATOM   1251 C C   . LEU A 1 165 ? 28.200  21.832  18.515  1.00 23.24 ? 160 LEU L C   1 
ATOM   1252 O O   . LEU A 1 165 ? 28.096  22.850  17.813  1.00 22.42 ? 160 LEU L O   1 
ATOM   1253 C CB  . LEU A 1 165 ? 27.001  22.762  20.547  1.00 26.64 ? 160 LEU L CB  1 
ATOM   1254 C CG  . LEU A 1 165 ? 25.564  22.225  20.511  1.00 27.99 ? 160 LEU L CG  1 
ATOM   1255 C CD1 . LEU A 1 165 ? 24.922  22.381  19.118  1.00 28.03 ? 160 LEU L CD1 1 
ATOM   1256 C CD2 . LEU A 1 165 ? 25.596  20.777  20.962  1.00 28.67 ? 160 LEU L CD2 1 
ATOM   1257 N N   . ASN A 1 166 ? 28.350  20.615  18.010  1.00 20.98 ? 161 ASN L N   1 
ATOM   1258 C CA  . ASN A 1 166 ? 28.412  20.369  16.578  1.00 20.40 ? 161 ASN L CA  1 
ATOM   1259 C C   . ASN A 1 166 ? 27.143  19.754  16.031  1.00 19.79 ? 161 ASN L C   1 
ATOM   1260 O O   . ASN A 1 166 ? 26.473  19.008  16.715  1.00 20.82 ? 161 ASN L O   1 
ATOM   1261 C CB  . ASN A 1 166 ? 29.574  19.427  16.250  1.00 19.73 ? 161 ASN L CB  1 
ATOM   1262 C CG  . ASN A 1 166 ? 30.923  20.074  16.428  1.00 19.43 ? 161 ASN L CG  1 
ATOM   1263 O OD1 . ASN A 1 166 ? 31.027  21.257  16.686  1.00 19.96 ? 161 ASN L OD1 1 
ATOM   1264 N ND2 . ASN A 1 166 ? 31.965  19.302  16.251  1.00 20.28 ? 161 ASN L ND2 1 
ATOM   1265 N N   . SER A 1 167 ? 26.847  20.016  14.770  1.00 18.86 ? 162 SER L N   1 
ATOM   1266 C CA  . SER A 1 167 ? 25.667  19.452  14.148  1.00 17.96 ? 162 SER L CA  1 
ATOM   1267 C C   . SER A 1 167 ? 25.943  19.337  12.651  1.00 18.70 ? 162 SER L C   1 
ATOM   1268 O O   . SER A 1 167 ? 26.493  20.253  12.038  1.00 18.17 ? 162 SER L O   1 
ATOM   1269 C CB  . SER A 1 167 ? 24.455  20.351  14.418  1.00 17.47 ? 162 SER L CB  1 
ATOM   1270 O OG  . SER A 1 167 ? 23.276  19.800  13.870  1.00 15.36 ? 162 SER L OG  1 
ATOM   1271 N N   . TRP A 1 168 ? 25.636  18.187  12.072  1.00 20.66 ? 163 TRP L N   1 
ATOM   1272 C CA  . TRP A 1 168 ? 25.851  17.979  10.642  1.00 22.78 ? 163 TRP L CA  1 
ATOM   1273 C C   . TRP A 1 168 ? 24.500  17.749  10.010  1.00 21.79 ? 163 TRP L C   1 
ATOM   1274 O O   . TRP A 1 168 ? 23.593  17.206  10.646  1.00 21.22 ? 163 TRP L O   1 
ATOM   1275 C CB  . TRP A 1 168 ? 26.680  16.712  10.356  1.00 25.47 ? 163 TRP L CB  1 
ATOM   1276 C CG  . TRP A 1 168 ? 28.098  16.728  10.807  1.00 28.76 ? 163 TRP L CG  1 
ATOM   1277 C CD1 . TRP A 1 168 ? 29.202  16.943  10.028  1.00 29.74 ? 163 TRP L CD1 1 
ATOM   1278 C CD2 . TRP A 1 168 ? 28.582  16.459  12.132  1.00 30.64 ? 163 TRP L CD2 1 
ATOM   1279 N NE1 . TRP A 1 168 ? 30.343  16.820  10.789  1.00 31.26 ? 163 TRP L NE1 1 
ATOM   1280 C CE2 . TRP A 1 168 ? 29.994  16.522  12.081  1.00 31.46 ? 163 TRP L CE2 1 
ATOM   1281 C CE3 . TRP A 1 168 ? 27.958  16.166  13.358  1.00 32.06 ? 163 TRP L CE3 1 
ATOM   1282 C CZ2 . TRP A 1 168 ? 30.798  16.301  13.212  1.00 32.69 ? 163 TRP L CZ2 1 
ATOM   1283 C CZ3 . TRP A 1 168 ? 28.755  15.943  14.484  1.00 33.25 ? 163 TRP L CZ3 1 
ATOM   1284 C CH2 . TRP A 1 168 ? 30.165  16.014  14.400  1.00 33.29 ? 163 TRP L CH2 1 
ATOM   1285 N N   . THR A 1 169 ? 24.363  18.168  8.765   1.00 20.99 ? 164 THR L N   1 
ATOM   1286 C CA  . THR A 1 169 ? 23.142  17.914  8.047   1.00 21.46 ? 164 THR L CA  1 
ATOM   1287 C C   . THR A 1 169 ? 23.370  16.561  7.347   1.00 23.88 ? 164 THR L C   1 
ATOM   1288 O O   . THR A 1 169 ? 24.474  15.969  7.407   1.00 24.22 ? 164 THR L O   1 
ATOM   1289 C CB  . THR A 1 169 ? 22.891  18.968  6.962   1.00 20.31 ? 164 THR L CB  1 
ATOM   1290 O OG1 . THR A 1 169 ? 23.986  18.983  6.036   1.00 20.12 ? 164 THR L OG1 1 
ATOM   1291 C CG2 . THR A 1 169 ? 22.712  20.345  7.576   1.00 20.46 ? 164 THR L CG2 1 
ATOM   1292 N N   . ASP A 1 170 ? 22.319  16.038  6.726   1.00 25.59 ? 165 ASP L N   1 
ATOM   1293 C CA  . ASP A 1 170 ? 22.457  14.804  5.982   1.00 26.47 ? 165 ASP L CA  1 
ATOM   1294 C C   . ASP A 1 170 ? 22.843  15.249  4.567   1.00 24.84 ? 165 ASP L C   1 
ATOM   1295 O O   . ASP A 1 170 ? 22.819  16.448  4.253   1.00 23.44 ? 165 ASP L O   1 
ATOM   1296 C CB  . ASP A 1 170 ? 21.145  14.015  5.975   1.00 30.74 ? 165 ASP L CB  1 
ATOM   1297 C CG  . ASP A 1 170 ? 21.303  12.613  5.354   1.00 34.64 ? 165 ASP L CG  1 
ATOM   1298 O OD1 . ASP A 1 170 ? 22.441  12.051  5.320   1.00 36.10 ? 165 ASP L OD1 1 
ATOM   1299 O OD2 . ASP A 1 170 ? 20.276  12.065  4.890   1.00 36.98 ? 165 ASP L OD2 1 
ATOM   1300 N N   . GLN A 1 171 ? 23.213  14.304  3.715   1.00 23.01 ? 166 GLN L N   1 
ATOM   1301 C CA  . GLN A 1 171 ? 23.594  14.650  2.359   1.00 21.51 ? 166 GLN L CA  1 
ATOM   1302 C C   . GLN A 1 171 ? 22.447  15.324  1.625   1.00 22.47 ? 166 GLN L C   1 
ATOM   1303 O O   . GLN A 1 171 ? 21.321  14.838  1.638   1.00 22.98 ? 166 GLN L O   1 
ATOM   1304 C CB  . GLN A 1 171 ? 24.051  13.416  1.606   1.00 18.62 ? 166 GLN L CB  1 
ATOM   1305 C CG  . GLN A 1 171 ? 24.567  13.731  0.229   1.00 16.63 ? 166 GLN L CG  1 
ATOM   1306 C CD  . GLN A 1 171 ? 25.271  12.568  -0.407  1.00 15.39 ? 166 GLN L CD  1 
ATOM   1307 O OE1 . GLN A 1 171 ? 24.710  11.481  -0.522  1.00 14.59 ? 166 GLN L OE1 1 
ATOM   1308 N NE2 . GLN A 1 171 ? 26.510  12.778  -0.814  1.00 14.21 ? 166 GLN L NE2 1 
ATOM   1309 N N   . ASP A 1 172 ? 22.739  16.469  1.025   1.00 24.38 ? 167 ASP L N   1 
ATOM   1310 C CA  . ASP A 1 172 ? 21.769  17.242  0.252   1.00 26.38 ? 167 ASP L CA  1 
ATOM   1311 C C   . ASP A 1 172 ? 21.590  16.553  -1.104  1.00 27.29 ? 167 ASP L C   1 
ATOM   1312 O O   . ASP A 1 172 ? 22.569  16.318  -1.822  1.00 27.16 ? 167 ASP L O   1 
ATOM   1313 C CB  . ASP A 1 172 ? 22.327  18.660  0.067   1.00 27.01 ? 167 ASP L CB  1 
ATOM   1314 C CG  . ASP A 1 172 ? 21.418  19.571  -0.751  1.00 28.35 ? 167 ASP L CG  1 
ATOM   1315 O OD1 . ASP A 1 172 ? 21.119  19.251  -1.908  1.00 28.15 ? 167 ASP L OD1 1 
ATOM   1316 O OD2 . ASP A 1 172 ? 21.065  20.661  -0.265  1.00 29.85 ? 167 ASP L OD2 1 
ATOM   1317 N N   . SER A 1 173 ? 20.356  16.243  -1.476  1.00 28.78 ? 168 SER L N   1 
ATOM   1318 C CA  . SER A 1 173 ? 20.118  15.586  -2.768  1.00 31.09 ? 168 SER L CA  1 
ATOM   1319 C C   . SER A 1 173 ? 20.429  16.490  -3.968  1.00 31.89 ? 168 SER L C   1 
ATOM   1320 O O   . SER A 1 173 ? 20.951  16.031  -4.987  1.00 33.18 ? 168 SER L O   1 
ATOM   1321 C CB  . SER A 1 173 ? 18.678  15.076  -2.855  1.00 31.06 ? 168 SER L CB  1 
ATOM   1322 O OG  . SER A 1 173 ? 17.763  16.035  -2.341  1.00 32.33 ? 168 SER L OG  1 
ATOM   1323 N N   . LYS A 1 174 ? 20.172  17.783  -3.820  1.00 31.41 ? 169 LYS L N   1 
ATOM   1324 C CA  . LYS A 1 174 ? 20.407  18.720  -4.899  1.00 32.12 ? 169 LYS L CA  1 
ATOM   1325 C C   . LYS A 1 174 ? 21.864  18.768  -5.376  1.00 30.61 ? 169 LYS L C   1 
ATOM   1326 O O   . LYS A 1 174 ? 22.108  18.806  -6.581  1.00 31.80 ? 169 LYS L O   1 
ATOM   1327 C CB  . LYS A 1 174 ? 19.929  20.142  -4.528  1.00 34.65 ? 169 LYS L CB  1 
ATOM   1328 C CG  . LYS A 1 174 ? 18.915  20.281  -3.343  1.00 37.42 ? 169 LYS L CG  1 
ATOM   1329 C CD  . LYS A 1 174 ? 17.662  19.379  -3.430  1.00 39.28 ? 169 LYS L CD  1 
ATOM   1330 C CE  . LYS A 1 174 ? 16.814  19.417  -2.134  1.00 39.58 ? 169 LYS L CE  1 
ATOM   1331 N NZ  . LYS A 1 174 ? 17.494  18.814  -0.934  1.00 40.48 ? 169 LYS L NZ  1 
ATOM   1332 N N   . ASP A 1 175 ? 22.825  18.768  -4.448  1.00 28.32 ? 170 ASP L N   1 
ATOM   1333 C CA  . ASP A 1 175 ? 24.261  18.842  -4.800  1.00 24.72 ? 170 ASP L CA  1 
ATOM   1334 C C   . ASP A 1 175 ? 25.188  17.754  -4.184  1.00 22.26 ? 170 ASP L C   1 
ATOM   1335 O O   . ASP A 1 175 ? 26.414  17.774  -4.366  1.00 20.48 ? 170 ASP L O   1 
ATOM   1336 C CB  . ASP A 1 175 ? 24.805  20.259  -4.499  1.00 25.25 ? 170 ASP L CB  1 
ATOM   1337 C CG  . ASP A 1 175 ? 24.863  20.579  -3.005  1.00 25.99 ? 170 ASP L CG  1 
ATOM   1338 O OD1 . ASP A 1 175 ? 24.042  20.066  -2.236  1.00 27.19 ? 170 ASP L OD1 1 
ATOM   1339 O OD2 . ASP A 1 175 ? 25.736  21.356  -2.584  1.00 27.26 ? 170 ASP L OD2 1 
ATOM   1340 N N   . SER A 1 176 ? 24.595  16.833  -3.435  1.00 18.91 ? 171 SER L N   1 
ATOM   1341 C CA  . SER A 1 176 ? 25.321  15.749  -2.802  1.00 17.10 ? 171 SER L CA  1 
ATOM   1342 C C   . SER A 1 176 ? 26.417  16.084  -1.790  1.00 15.52 ? 171 SER L C   1 
ATOM   1343 O O   . SER A 1 176 ? 27.261  15.235  -1.484  1.00 14.58 ? 171 SER L O   1 
ATOM   1344 C CB  . SER A 1 176 ? 25.854  14.828  -3.871  1.00 17.07 ? 171 SER L CB  1 
ATOM   1345 O OG  . SER A 1 176 ? 24.784  14.425  -4.704  1.00 19.33 ? 171 SER L OG  1 
ATOM   1346 N N   . THR A 1 177 ? 26.378  17.300  -1.247  1.00 14.76 ? 172 THR L N   1 
ATOM   1347 C CA  . THR A 1 177 ? 27.345  17.754  -0.234  1.00 12.67 ? 172 THR L CA  1 
ATOM   1348 C C   . THR A 1 177 ? 26.707  17.733  1.171   1.00 12.97 ? 172 THR L C   1 
ATOM   1349 O O   . THR A 1 177 ? 25.485  17.544  1.310   1.00 11.83 ? 172 THR L O   1 
ATOM   1350 C CB  . THR A 1 177 ? 27.788  19.213  -0.469  1.00 12.16 ? 172 THR L CB  1 
ATOM   1351 O OG1 . THR A 1 177 ? 26.640  20.073  -0.429  1.00 13.24 ? 172 THR L OG1 1 
ATOM   1352 C CG2 . THR A 1 177 ? 28.550  19.379  -1.791  1.00 11.11 ? 172 THR L CG2 1 
ATOM   1353 N N   . TYR A 1 178 ? 27.537  17.949  2.195   1.00 11.94 ? 173 TYR L N   1 
ATOM   1354 C CA  . TYR A 1 178 ? 27.088  18.003  3.572   1.00 10.89 ? 173 TYR L CA  1 
ATOM   1355 C C   . TYR A 1 178 ? 27.469  19.387  4.088   1.00 11.63 ? 173 TYR L C   1 
ATOM   1356 O O   . TYR A 1 178 ? 28.250  20.096  3.431   1.00 12.44 ? 173 TYR L O   1 
ATOM   1357 C CB  . TYR A 1 178 ? 27.821  16.953  4.405   1.00 11.07 ? 173 TYR L CB  1 
ATOM   1358 C CG  . TYR A 1 178 ? 27.581  15.526  3.971   1.00 11.69 ? 173 TYR L CG  1 
ATOM   1359 C CD1 . TYR A 1 178 ? 28.321  14.957  2.933   1.00 11.15 ? 173 TYR L CD1 1 
ATOM   1360 C CD2 . TYR A 1 178 ? 26.652  14.713  4.634   1.00 11.86 ? 173 TYR L CD2 1 
ATOM   1361 C CE1 . TYR A 1 178 ? 28.156  13.618  2.575   1.00 10.40 ? 173 TYR L CE1 1 
ATOM   1362 C CE2 . TYR A 1 178 ? 26.482  13.360  4.276   1.00 10.83 ? 173 TYR L CE2 1 
ATOM   1363 C CZ  . TYR A 1 178 ? 27.250  12.842  3.254   1.00 10.24 ? 173 TYR L CZ  1 
ATOM   1364 O OH  . TYR A 1 178 ? 27.161  11.530  2.952   1.00 9.70  ? 173 TYR L OH  1 
ATOM   1365 N N   . SER A 1 179 ? 26.859  19.816  5.194   1.00 10.69 ? 174 SER L N   1 
ATOM   1366 C CA  . SER A 1 179 ? 27.194  21.082  5.822   1.00 9.81  ? 174 SER L CA  1 
ATOM   1367 C C   . SER A 1 179 ? 27.294  20.806  7.306   1.00 10.39 ? 174 SER L C   1 
ATOM   1368 O O   . SER A 1 179 ? 26.825  19.772  7.772   1.00 9.64  ? 174 SER L O   1 
ATOM   1369 C CB  . SER A 1 179 ? 26.176  22.164  5.549   1.00 8.99  ? 174 SER L CB  1 
ATOM   1370 O OG  . SER A 1 179 ? 26.186  22.505  4.186   1.00 10.57 ? 174 SER L OG  1 
ATOM   1371 N N   . MET A 1 180 ? 27.976  21.682  8.038   1.00 11.61 ? 175 MET L N   1 
ATOM   1372 C CA  . MET A 1 180 ? 28.120  21.474  9.463   1.00 12.46 ? 175 MET L CA  1 
ATOM   1373 C C   . MET A 1 180 ? 28.200  22.780  10.234  1.00 11.29 ? 175 MET L C   1 
ATOM   1374 O O   . MET A 1 180 ? 28.666  23.801  9.741   1.00 11.33 ? 175 MET L O   1 
ATOM   1375 C CB  . MET A 1 180 ? 29.306  20.536  9.764   1.00 14.47 ? 175 MET L CB  1 
ATOM   1376 C CG  . MET A 1 180 ? 30.375  21.090  10.666  1.00 16.98 ? 175 MET L CG  1 
ATOM   1377 S SD  . MET A 1 180 ? 31.324  19.765  11.328  1.00 19.83 ? 175 MET L SD  1 
ATOM   1378 C CE  . MET A 1 180 ? 31.444  20.213  12.948  1.00 18.57 ? 175 MET L CE  1 
ATOM   1379 N N   . SER A 1 181 ? 27.683  22.728  11.445  1.00 10.86 ? 176 SER L N   1 
ATOM   1380 C CA  . SER A 1 181 ? 27.651  23.868  12.331  1.00 11.30 ? 176 SER L CA  1 
ATOM   1381 C C   . SER A 1 181 ? 28.427  23.469  13.578  1.00 11.71 ? 176 SER L C   1 
ATOM   1382 O O   . SER A 1 181 ? 28.337  22.321  14.032  1.00 9.38  ? 176 SER L O   1 
ATOM   1383 C CB  . SER A 1 181 ? 26.198  24.168  12.699  1.00 10.60 ? 176 SER L CB  1 
ATOM   1384 O OG  . SER A 1 181 ? 26.090  25.379  13.397  1.00 12.49 ? 176 SER L OG  1 
ATOM   1385 N N   . SER A 1 182 ? 29.167  24.429  14.124  1.00 12.70 ? 177 SER L N   1 
ATOM   1386 C CA  . SER A 1 182 ? 29.972  24.223  15.312  1.00 13.36 ? 177 SER L CA  1 
ATOM   1387 C C   . SER A 1 182 ? 29.812  25.501  16.135  1.00 14.75 ? 177 SER L C   1 
ATOM   1388 O O   . SER A 1 182 ? 30.133  26.594  15.642  1.00 14.88 ? 177 SER L O   1 
ATOM   1389 C CB  . SER A 1 182 ? 31.420  24.034  14.881  1.00 13.99 ? 177 SER L CB  1 
ATOM   1390 O OG  . SER A 1 182 ? 32.266  23.723  15.964  1.00 15.71 ? 177 SER L OG  1 
ATOM   1391 N N   . THR A 1 183 ? 29.234  25.378  17.336  1.00 14.84 ? 178 THR L N   1 
ATOM   1392 C CA  . THR A 1 183 ? 29.032  26.521  18.225  1.00 14.95 ? 178 THR L CA  1 
ATOM   1393 C C   . THR A 1 183 ? 29.839  26.333  19.500  1.00 15.30 ? 178 THR L C   1 
ATOM   1394 O O   . THR A 1 183 ? 29.798  25.271  20.104  1.00 15.09 ? 178 THR L O   1 
ATOM   1395 C CB  . THR A 1 183 ? 27.563  26.665  18.636  1.00 15.15 ? 178 THR L CB  1 
ATOM   1396 O OG1 . THR A 1 183 ? 26.740  26.680  17.464  1.00 16.11 ? 178 THR L OG1 1 
ATOM   1397 C CG2 . THR A 1 183 ? 27.347  27.949  19.400  1.00 14.81 ? 178 THR L CG2 1 
ATOM   1398 N N   . LEU A 1 184 ? 30.623  27.343  19.857  1.00 16.08 ? 179 LEU L N   1 
ATOM   1399 C CA  . LEU A 1 184 ? 31.430  27.325  21.077  1.00 17.45 ? 179 LEU L CA  1 
ATOM   1400 C C   . LEU A 1 184 ? 30.830  28.333  22.063  1.00 18.30 ? 179 LEU L C   1 
ATOM   1401 O O   . LEU A 1 184 ? 30.920  29.538  21.823  1.00 18.39 ? 179 LEU L O   1 
ATOM   1402 C CB  . LEU A 1 184 ? 32.862  27.754  20.758  1.00 16.64 ? 179 LEU L CB  1 
ATOM   1403 C CG  . LEU A 1 184 ? 33.796  28.030  21.936  1.00 16.24 ? 179 LEU L CG  1 
ATOM   1404 C CD1 . LEU A 1 184 ? 34.145  26.708  22.598  1.00 16.36 ? 179 LEU L CD1 1 
ATOM   1405 C CD2 . LEU A 1 184 ? 35.051  28.758  21.455  1.00 15.34 ? 179 LEU L CD2 1 
ATOM   1406 N N   . THR A 1 185 ? 30.197  27.870  23.141  1.00 19.19 ? 180 THR L N   1 
ATOM   1407 C CA  . THR A 1 185 ? 29.604  28.803  24.101  1.00 19.36 ? 180 THR L CA  1 
ATOM   1408 C C   . THR A 1 185 ? 30.473  29.040  25.329  1.00 19.56 ? 180 THR L C   1 
ATOM   1409 O O   . THR A 1 185 ? 31.060  28.113  25.875  1.00 20.79 ? 180 THR L O   1 
ATOM   1410 C CB  . THR A 1 185 ? 28.168  28.385  24.529  1.00 18.65 ? 180 THR L CB  1 
ATOM   1411 O OG1 . THR A 1 185 ? 27.357  28.193  23.359  1.00 18.73 ? 180 THR L OG1 1 
ATOM   1412 C CG2 . THR A 1 185 ? 27.529  29.492  25.391  1.00 17.39 ? 180 THR L CG2 1 
ATOM   1413 N N   . LEU A 1 186 ? 30.545  30.296  25.750  1.00 21.67 ? 181 LEU L N   1 
ATOM   1414 C CA  . LEU A 1 186 ? 31.335  30.733  26.911  1.00 23.14 ? 181 LEU L CA  1 
ATOM   1415 C C   . LEU A 1 186 ? 30.472  31.673  27.709  1.00 23.78 ? 181 LEU L C   1 
ATOM   1416 O O   . LEU A 1 186 ? 29.370  32.039  27.275  1.00 24.44 ? 181 LEU L O   1 
ATOM   1417 C CB  . LEU A 1 186 ? 32.549  31.559  26.459  1.00 22.27 ? 181 LEU L CB  1 
ATOM   1418 C CG  . LEU A 1 186 ? 33.395  31.031  25.319  1.00 22.57 ? 181 LEU L CG  1 
ATOM   1419 C CD1 . LEU A 1 186 ? 34.437  32.059  24.988  1.00 22.81 ? 181 LEU L CD1 1 
ATOM   1420 C CD2 . LEU A 1 186 ? 34.028  29.714  25.739  1.00 22.38 ? 181 LEU L CD2 1 
ATOM   1421 N N   . THR A 1 187 ? 30.976  32.091  28.864  1.00 25.38 ? 182 THR L N   1 
ATOM   1422 C CA  . THR A 1 187 ? 30.249  33.068  29.655  1.00 26.65 ? 182 THR L CA  1 
ATOM   1423 C C   . THR A 1 187 ? 30.683  34.413  29.036  1.00 27.40 ? 182 THR L C   1 
ATOM   1424 O O   . THR A 1 187 ? 31.731  34.480  28.388  1.00 27.36 ? 182 THR L O   1 
ATOM   1425 C CB  . THR A 1 187 ? 30.651  33.028  31.160  1.00 26.80 ? 182 THR L CB  1 
ATOM   1426 O OG1 . THR A 1 187 ? 32.068  33.204  31.299  1.00 27.44 ? 182 THR L OG1 1 
ATOM   1427 C CG2 . THR A 1 187 ? 30.249  31.711  31.785  1.00 26.43 ? 182 THR L CG2 1 
ATOM   1428 N N   . LYS A 1 188 ? 29.884  35.459  29.210  1.00 28.19 ? 183 LYS L N   1 
ATOM   1429 C CA  . LYS A 1 188 ? 30.215  36.774  28.693  1.00 29.66 ? 183 LYS L CA  1 
ATOM   1430 C C   . LYS A 1 188 ? 31.573  37.258  29.209  1.00 31.29 ? 183 LYS L C   1 
ATOM   1431 O O   . LYS A 1 188 ? 32.405  37.744  28.435  1.00 32.05 ? 183 LYS L O   1 
ATOM   1432 C CB  . LYS A 1 188 ? 29.135  37.771  29.101  1.00 30.01 ? 183 LYS L CB  1 
ATOM   1433 C CG  . LYS A 1 188 ? 29.584  39.212  29.127  1.00 30.89 ? 183 LYS L CG  1 
ATOM   1434 C CD  . LYS A 1 188 ? 28.511  40.058  29.780  1.00 32.69 ? 183 LYS L CD  1 
ATOM   1435 C CE  . LYS A 1 188 ? 29.061  41.363  30.393  1.00 34.15 ? 183 LYS L CE  1 
ATOM   1436 N NZ  . LYS A 1 188 ? 29.645  41.225  31.792  1.00 33.97 ? 183 LYS L NZ  1 
ATOM   1437 N N   . ASP A 1 189 ? 31.813  37.113  30.507  1.00 32.72 ? 184 ASP L N   1 
ATOM   1438 C CA  . ASP A 1 189 ? 33.066  37.575  31.092  1.00 34.29 ? 184 ASP L CA  1 
ATOM   1439 C C   . ASP A 1 189 ? 34.317  36.823  30.676  1.00 32.86 ? 184 ASP L C   1 
ATOM   1440 O O   . ASP A 1 189 ? 35.405  37.386  30.684  1.00 32.73 ? 184 ASP L O   1 
ATOM   1441 C CB  . ASP A 1 189 ? 32.951  37.683  32.607  1.00 37.52 ? 184 ASP L CB  1 
ATOM   1442 C CG  . ASP A 1 189 ? 32.021  38.816  33.029  1.00 40.48 ? 184 ASP L CG  1 
ATOM   1443 O OD1 . ASP A 1 189 ? 31.956  39.843  32.301  1.00 41.36 ? 184 ASP L OD1 1 
ATOM   1444 O OD2 . ASP A 1 189 ? 31.346  38.677  34.078  1.00 42.45 ? 184 ASP L OD2 1 
ATOM   1445 N N   . GLU A 1 190 ? 34.163  35.560  30.309  1.00 31.17 ? 185 GLU L N   1 
ATOM   1446 C CA  . GLU A 1 190 ? 35.288  34.777  29.843  1.00 30.10 ? 185 GLU L CA  1 
ATOM   1447 C C   . GLU A 1 190 ? 35.602  35.191  28.392  1.00 28.17 ? 185 GLU L C   1 
ATOM   1448 O O   . GLU A 1 190 ? 36.764  35.246  27.975  1.00 27.50 ? 185 GLU L O   1 
ATOM   1449 C CB  . GLU A 1 190 ? 34.942  33.311  29.883  1.00 31.77 ? 185 GLU L CB  1 
ATOM   1450 C CG  . GLU A 1 190 ? 36.157  32.475  29.816  1.00 36.33 ? 185 GLU L CG  1 
ATOM   1451 C CD  . GLU A 1 190 ? 35.853  31.033  29.485  1.00 39.83 ? 185 GLU L CD  1 
ATOM   1452 O OE1 . GLU A 1 190 ? 34.810  30.473  29.951  1.00 40.68 ? 185 GLU L OE1 1 
ATOM   1453 O OE2 . GLU A 1 190 ? 36.687  30.465  28.738  1.00 41.88 ? 185 GLU L OE2 1 
ATOM   1454 N N   . TYR A 1 191 ? 34.544  35.497  27.642  1.00 24.93 ? 186 TYR L N   1 
ATOM   1455 C CA  . TYR A 1 191 ? 34.638  35.930  26.257  1.00 22.11 ? 186 TYR L CA  1 
ATOM   1456 C C   . TYR A 1 191 ? 35.425  37.235  26.175  1.00 22.66 ? 186 TYR L C   1 
ATOM   1457 O O   . TYR A 1 191 ? 36.380  37.352  25.404  1.00 21.49 ? 186 TYR L O   1 
ATOM   1458 C CB  . TYR A 1 191 ? 33.227  36.117  25.672  1.00 18.97 ? 186 TYR L CB  1 
ATOM   1459 C CG  . TYR A 1 191 ? 33.206  36.722  24.272  1.00 17.02 ? 186 TYR L CG  1 
ATOM   1460 C CD1 . TYR A 1 191 ? 33.608  35.975  23.158  1.00 15.13 ? 186 TYR L CD1 1 
ATOM   1461 C CD2 . TYR A 1 191 ? 32.858  38.067  24.073  1.00 15.91 ? 186 TYR L CD2 1 
ATOM   1462 C CE1 . TYR A 1 191 ? 33.678  36.556  21.894  1.00 13.47 ? 186 TYR L CE1 1 
ATOM   1463 C CE2 . TYR A 1 191 ? 32.923  38.646  22.811  1.00 14.28 ? 186 TYR L CE2 1 
ATOM   1464 C CZ  . TYR A 1 191 ? 33.339  37.885  21.736  1.00 13.91 ? 186 TYR L CZ  1 
ATOM   1465 O OH  . TYR A 1 191 ? 33.455  38.475  20.504  1.00 14.87 ? 186 TYR L OH  1 
ATOM   1466 N N   . GLU A 1 192 ? 35.048  38.194  27.010  1.00 24.14 ? 187 GLU L N   1 
ATOM   1467 C CA  . GLU A 1 192 ? 35.697  39.499  27.036  1.00 26.84 ? 187 GLU L CA  1 
ATOM   1468 C C   . GLU A 1 192 ? 37.129  39.464  27.548  1.00 27.30 ? 187 GLU L C   1 
ATOM   1469 O O   . GLU A 1 192 ? 37.845  40.459  27.499  1.00 27.10 ? 187 GLU L O   1 
ATOM   1470 C CB  . GLU A 1 192 ? 34.869  40.459  27.870  1.00 29.00 ? 187 GLU L CB  1 
ATOM   1471 C CG  . GLU A 1 192 ? 33.407  40.420  27.492  1.00 32.52 ? 187 GLU L CG  1 
ATOM   1472 C CD  . GLU A 1 192 ? 32.704  41.731  27.748  1.00 34.81 ? 187 GLU L CD  1 
ATOM   1473 O OE1 . GLU A 1 192 ? 32.577  42.134  28.936  1.00 36.41 ? 187 GLU L OE1 1 
ATOM   1474 O OE2 . GLU A 1 192 ? 32.288  42.361  26.745  1.00 36.10 ? 187 GLU L OE2 1 
ATOM   1475 N N   . ARG A 1 193 ? 37.544  38.309  28.046  1.00 28.24 ? 188 ARG L N   1 
ATOM   1476 C CA  . ARG A 1 193 ? 38.889  38.143  28.553  1.00 28.50 ? 188 ARG L CA  1 
ATOM   1477 C C   . ARG A 1 193 ? 39.903  37.732  27.465  1.00 27.17 ? 188 ARG L C   1 
ATOM   1478 O O   . ARG A 1 193 ? 41.103  37.676  27.741  1.00 27.27 ? 188 ARG L O   1 
ATOM   1479 C CB  . ARG A 1 193 ? 38.861  37.120  29.694  1.00 30.60 ? 188 ARG L CB  1 
ATOM   1480 C CG  . ARG A 1 193 ? 39.080  37.735  31.067  1.00 33.99 ? 188 ARG L CG  1 
ATOM   1481 C CD  . ARG A 1 193 ? 38.190  37.134  32.152  1.00 37.23 ? 188 ARG L CD  1 
ATOM   1482 N NE  . ARG A 1 193 ? 38.196  35.671  32.210  1.00 40.04 ? 188 ARG L NE  1 
ATOM   1483 C CZ  . ARG A 1 193 ? 37.252  34.944  32.819  1.00 41.78 ? 188 ARG L CZ  1 
ATOM   1484 N NH1 . ARG A 1 193 ? 36.221  35.533  33.433  1.00 42.37 ? 188 ARG L NH1 1 
ATOM   1485 N NH2 . ARG A 1 193 ? 37.323  33.616  32.805  1.00 42.92 ? 188 ARG L NH2 1 
ATOM   1486 N N   . HIS A 1 194 ? 39.432  37.453  26.244  1.00 25.00 ? 189 HIS L N   1 
ATOM   1487 C CA  . HIS A 1 194 ? 40.300  37.023  25.149  1.00 22.73 ? 189 HIS L CA  1 
ATOM   1488 C C   . HIS A 1 194 ? 40.270  37.895  23.913  1.00 22.34 ? 189 HIS L C   1 
ATOM   1489 O O   . HIS A 1 194 ? 39.395  38.738  23.783  1.00 22.58 ? 189 HIS L O   1 
ATOM   1490 C CB  . HIS A 1 194 ? 40.020  35.585  24.805  1.00 23.52 ? 189 HIS L CB  1 
ATOM   1491 C CG  . HIS A 1 194 ? 40.210  34.669  25.968  1.00 24.41 ? 189 HIS L CG  1 
ATOM   1492 N ND1 . HIS A 1 194 ? 41.433  34.132  26.305  1.00 24.75 ? 189 HIS L ND1 1 
ATOM   1493 C CD2 . HIS A 1 194 ? 39.335  34.230  26.902  1.00 24.61 ? 189 HIS L CD2 1 
ATOM   1494 C CE1 . HIS A 1 194 ? 41.303  33.397  27.395  1.00 25.20 ? 189 HIS L CE1 1 
ATOM   1495 N NE2 . HIS A 1 194 ? 40.039  33.442  27.775  1.00 25.47 ? 189 HIS L NE2 1 
ATOM   1496 N N   . ASN A 1 195 ? 41.230  37.686  23.009  1.00 21.48 ? 190 ASN L N   1 
ATOM   1497 C CA  . ASN A 1 195 ? 41.360  38.517  21.812  1.00 21.57 ? 190 ASN L CA  1 
ATOM   1498 C C   . ASN A 1 195 ? 40.951  37.902  20.480  1.00 19.40 ? 190 ASN L C   1 
ATOM   1499 O O   . ASN A 1 195 ? 40.102  38.440  19.788  1.00 17.86 ? 190 ASN L O   1 
ATOM   1500 C CB  . ASN A 1 195 ? 42.795  39.103  21.733  1.00 24.71 ? 190 ASN L CB  1 
ATOM   1501 C CG  . ASN A 1 195 ? 43.100  39.845  20.387  1.00 28.63 ? 190 ASN L CG  1 
ATOM   1502 O OD1 . ASN A 1 195 ? 42.403  40.819  19.996  1.00 29.89 ? 190 ASN L OD1 1 
ATOM   1503 N ND2 . ASN A 1 195 ? 44.187  39.407  19.699  1.00 28.25 ? 190 ASN L ND2 1 
ATOM   1504 N N   . SER A 1 196 ? 41.520  36.761  20.124  1.00 17.99 ? 191 SER L N   1 
ATOM   1505 C CA  . SER A 1 196 ? 41.195  36.192  18.842  1.00 17.04 ? 191 SER L CA  1 
ATOM   1506 C C   . SER A 1 196 ? 40.511  34.870  18.948  1.00 16.29 ? 191 SER L C   1 
ATOM   1507 O O   . SER A 1 196 ? 40.836  34.051  19.793  1.00 15.21 ? 191 SER L O   1 
ATOM   1508 C CB  . SER A 1 196 ? 42.442  36.031  18.017  1.00 17.12 ? 191 SER L CB  1 
ATOM   1509 O OG  . SER A 1 196 ? 43.222  35.060  18.634  1.00 17.99 ? 191 SER L OG  1 
ATOM   1510 N N   . TYR A 1 197 ? 39.571  34.658  18.044  1.00 16.03 ? 192 TYR L N   1 
ATOM   1511 C CA  . TYR A 1 197 ? 38.814  33.432  18.025  1.00 15.29 ? 192 TYR L CA  1 
ATOM   1512 C C   . TYR A 1 197 ? 39.040  32.844  16.656  1.00 14.61 ? 192 TYR L C   1 
ATOM   1513 O O   . TYR A 1 197 ? 39.044  33.547  15.659  1.00 14.81 ? 192 TYR L O   1 
ATOM   1514 C CB  . TYR A 1 197 ? 37.346  33.720  18.335  1.00 14.46 ? 192 TYR L CB  1 
ATOM   1515 C CG  . TYR A 1 197 ? 37.166  34.206  19.756  1.00 14.37 ? 192 TYR L CG  1 
ATOM   1516 C CD1 . TYR A 1 197 ? 37.429  35.535  20.094  1.00 14.79 ? 192 TYR L CD1 1 
ATOM   1517 C CD2 . TYR A 1 197 ? 36.785  33.327  20.775  1.00 15.13 ? 192 TYR L CD2 1 
ATOM   1518 C CE1 . TYR A 1 197 ? 37.329  35.994  21.404  1.00 14.78 ? 192 TYR L CE1 1 
ATOM   1519 C CE2 . TYR A 1 197 ? 36.678  33.776  22.110  1.00 16.31 ? 192 TYR L CE2 1 
ATOM   1520 C CZ  . TYR A 1 197 ? 36.957  35.115  22.409  1.00 16.30 ? 192 TYR L CZ  1 
ATOM   1521 O OH  . TYR A 1 197 ? 36.904  35.557  23.710  1.00 16.73 ? 192 TYR L OH  1 
ATOM   1522 N N   . THR A 1 198 ? 39.206  31.538  16.623  1.00 14.19 ? 193 THR L N   1 
ATOM   1523 C CA  . THR A 1 198 ? 39.512  30.867  15.408  1.00 13.89 ? 193 THR L CA  1 
ATOM   1524 C C   . THR A 1 198 ? 38.826  29.544  15.279  1.00 14.12 ? 193 THR L C   1 
ATOM   1525 O O   . THR A 1 198 ? 38.745  28.763  16.203  1.00 13.61 ? 193 THR L O   1 
ATOM   1526 C CB  . THR A 1 198 ? 41.041  30.657  15.354  1.00 15.00 ? 193 THR L CB  1 
ATOM   1527 O OG1 . THR A 1 198 ? 41.659  31.935  15.176  1.00 14.67 ? 193 THR L OG1 1 
ATOM   1528 C CG2 . THR A 1 198 ? 41.446  29.710  14.224  1.00 13.64 ? 193 THR L CG2 1 
ATOM   1529 N N   . CYS A 1 199 ? 38.429  29.259  14.068  1.00 15.30 ? 194 CYS L N   1 
ATOM   1530 C CA  . CYS A 1 199 ? 37.760  28.032  13.765  1.00 17.39 ? 194 CYS L CA  1 
ATOM   1531 C C   . CYS A 1 199 ? 38.637  27.437  12.695  1.00 17.12 ? 194 CYS L C   1 
ATOM   1532 O O   . CYS A 1 199 ? 38.914  28.096  11.700  1.00 16.08 ? 194 CYS L O   1 
ATOM   1533 C CB  . CYS A 1 199 ? 36.396  28.388  13.196  1.00 18.59 ? 194 CYS L CB  1 
ATOM   1534 S SG  . CYS A 1 199 ? 35.430  27.008  12.572  1.00 21.76 ? 194 CYS L SG  1 
ATOM   1535 N N   . GLU A 1 200 ? 39.137  26.233  12.937  1.00 18.46 ? 195 GLU L N   1 
ATOM   1536 C CA  . GLU A 1 200 ? 39.996  25.555  11.971  1.00 20.33 ? 195 GLU L CA  1 
ATOM   1537 C C   . GLU A 1 200 ? 39.380  24.249  11.467  1.00 19.63 ? 195 GLU L C   1 
ATOM   1538 O O   . GLU A 1 200 ? 38.975  23.399  12.252  1.00 18.80 ? 195 GLU L O   1 
ATOM   1539 C CB  . GLU A 1 200 ? 41.379  25.238  12.573  1.00 21.69 ? 195 GLU L CB  1 
ATOM   1540 C CG  . GLU A 1 200 ? 42.191  26.429  13.022  1.00 24.61 ? 195 GLU L CG  1 
ATOM   1541 C CD  . GLU A 1 200 ? 43.670  26.090  13.253  1.00 27.14 ? 195 GLU L CD  1 
ATOM   1542 O OE1 . GLU A 1 200 ? 44.017  24.875  13.310  1.00 27.47 ? 195 GLU L OE1 1 
ATOM   1543 O OE2 . GLU A 1 200 ? 44.483  27.047  13.381  1.00 28.42 ? 195 GLU L OE2 1 
ATOM   1544 N N   . ALA A 1 201 ? 39.358  24.076  10.153  1.00 19.92 ? 196 ALA L N   1 
ATOM   1545 C CA  . ALA A 1 201 ? 38.817  22.865  9.569   1.00 20.84 ? 196 ALA L CA  1 
ATOM   1546 C C   . ALA A 1 201 ? 39.902  22.095  8.803   1.00 21.57 ? 196 ALA L C   1 
ATOM   1547 O O   . ALA A 1 201 ? 40.629  22.669  7.975   1.00 21.87 ? 196 ALA L O   1 
ATOM   1548 C CB  . ALA A 1 201 ? 37.653  23.195  8.653   1.00 20.24 ? 196 ALA L CB  1 
ATOM   1549 N N   . THR A 1 202 ? 40.032  20.815  9.149   1.00 21.24 ? 197 THR L N   1 
ATOM   1550 C CA  . THR A 1 202 ? 40.964  19.885  8.532   1.00 21.56 ? 197 THR L CA  1 
ATOM   1551 C C   . THR A 1 202 ? 40.030  18.953  7.749   1.00 20.97 ? 197 THR L C   1 
ATOM   1552 O O   . THR A 1 202 ? 39.095  18.383  8.308   1.00 21.07 ? 197 THR L O   1 
ATOM   1553 C CB  . THR A 1 202 ? 41.787  19.102  9.612   1.00 22.29 ? 197 THR L CB  1 
ATOM   1554 O OG1 . THR A 1 202 ? 42.873  19.920  10.089  1.00 22.75 ? 197 THR L OG1 1 
ATOM   1555 C CG2 . THR A 1 202 ? 42.344  17.808  9.039   1.00 22.55 ? 197 THR L CG2 1 
ATOM   1556 N N   . HIS A 1 203 ? 40.294  18.804  6.462   1.00 19.37 ? 198 HIS L N   1 
ATOM   1557 C CA  . HIS A 1 203 ? 39.458  18.022  5.583   1.00 19.01 ? 198 HIS L CA  1 
ATOM   1558 C C   . HIS A 1 203 ? 40.366  17.529  4.465   1.00 19.73 ? 198 HIS L C   1 
ATOM   1559 O O   . HIS A 1 203 ? 41.327  18.205  4.116   1.00 18.88 ? 198 HIS L O   1 
ATOM   1560 C CB  . HIS A 1 203 ? 38.380  18.963  5.021   1.00 17.95 ? 198 HIS L CB  1 
ATOM   1561 C CG  . HIS A 1 203 ? 37.360  18.290  4.156   1.00 16.88 ? 198 HIS L CG  1 
ATOM   1562 N ND1 . HIS A 1 203 ? 37.228  18.566  2.814   1.00 16.36 ? 198 HIS L ND1 1 
ATOM   1563 C CD2 . HIS A 1 203 ? 36.399  17.388  4.455   1.00 15.50 ? 198 HIS L CD2 1 
ATOM   1564 C CE1 . HIS A 1 203 ? 36.227  17.859  2.322   1.00 16.59 ? 198 HIS L CE1 1 
ATOM   1565 N NE2 . HIS A 1 203 ? 35.707  17.141  3.298   1.00 15.52 ? 198 HIS L NE2 1 
ATOM   1566 N N   . LYS A 1 204 ? 40.000  16.426  3.826   1.00 20.87 ? 199 LYS L N   1 
ATOM   1567 C CA  . LYS A 1 204 ? 40.836  15.853  2.786   1.00 23.08 ? 199 LYS L CA  1 
ATOM   1568 C C   . LYS A 1 204 ? 41.133  16.716  1.579   1.00 24.12 ? 199 LYS L C   1 
ATOM   1569 O O   . LYS A 1 204 ? 42.076  16.449  0.832   1.00 24.73 ? 199 LYS L O   1 
ATOM   1570 C CB  . LYS A 1 204 ? 40.269  14.519  2.328   1.00 25.10 ? 199 LYS L CB  1 
ATOM   1571 C CG  . LYS A 1 204 ? 39.111  14.605  1.359   1.00 26.06 ? 199 LYS L CG  1 
ATOM   1572 C CD  . LYS A 1 204 ? 38.850  13.238  0.758   1.00 27.12 ? 199 LYS L CD  1 
ATOM   1573 C CE  . LYS A 1 204 ? 40.111  12.691  0.111   1.00 28.77 ? 199 LYS L CE  1 
ATOM   1574 N NZ  . LYS A 1 204 ? 39.850  11.859  -1.099  1.00 29.01 ? 199 LYS L NZ  1 
ATOM   1575 N N   . THR A 1 205 ? 40.336  17.751  1.371   1.00 24.98 ? 200 THR L N   1 
ATOM   1576 C CA  . THR A 1 205 ? 40.556  18.610  0.229   1.00 25.13 ? 200 THR L CA  1 
ATOM   1577 C C   . THR A 1 205 ? 41.827  19.495  0.328   1.00 26.60 ? 200 THR L C   1 
ATOM   1578 O O   . THR A 1 205 ? 42.127  20.275  -0.593  1.00 27.16 ? 200 THR L O   1 
ATOM   1579 C CB  . THR A 1 205 ? 39.289  19.455  -0.072  1.00 24.92 ? 200 THR L CB  1 
ATOM   1580 O OG1 . THR A 1 205 ? 38.832  20.102  1.129   1.00 24.22 ? 200 THR L OG1 1 
ATOM   1581 C CG2 . THR A 1 205 ? 38.177  18.570  -0.657  1.00 24.33 ? 200 THR L CG2 1 
ATOM   1582 N N   . SER A 1 206 ? 42.604  19.351  1.395   1.00 26.48 ? 201 SER L N   1 
ATOM   1583 C CA  . SER A 1 206 ? 43.805  20.168  1.529   1.00 27.94 ? 201 SER L CA  1 
ATOM   1584 C C   . SER A 1 206 ? 44.716  19.695  2.652   1.00 28.22 ? 201 SER L C   1 
ATOM   1585 O O   . SER A 1 206 ? 44.262  19.070  3.608   1.00 28.60 ? 201 SER L O   1 
ATOM   1586 C CB  . SER A 1 206 ? 43.407  21.640  1.748   1.00 28.96 ? 201 SER L CB  1 
ATOM   1587 O OG  . SER A 1 206 ? 44.538  22.498  1.940   1.00 30.30 ? 201 SER L OG  1 
ATOM   1588 N N   . THR A 1 207 ? 46.007  19.981  2.540   1.00 29.19 ? 202 THR L N   1 
ATOM   1589 C CA  . THR A 1 207 ? 46.936  19.589  3.594   1.00 30.25 ? 202 THR L CA  1 
ATOM   1590 C C   . THR A 1 207 ? 47.039  20.703  4.632   1.00 31.04 ? 202 THR L C   1 
ATOM   1591 O O   . THR A 1 207 ? 47.338  20.454  5.795   1.00 31.79 ? 202 THR L O   1 
ATOM   1592 C CB  . THR A 1 207 ? 48.314  19.136  3.036   1.00 29.83 ? 202 THR L CB  1 
ATOM   1593 O OG1 . THR A 1 207 ? 48.824  20.111  2.116   1.00 29.19 ? 202 THR L OG1 1 
ATOM   1594 C CG2 . THR A 1 207 ? 48.144  17.813  2.312   1.00 29.14 ? 202 THR L CG2 1 
ATOM   1595 N N   . SER A 1 208 ? 46.795  21.935  4.213   1.00 31.98 ? 203 SER L N   1 
ATOM   1596 C CA  . SER A 1 208 ? 46.796  23.041  5.157   1.00 33.65 ? 203 SER L CA  1 
ATOM   1597 C C   . SER A 1 208 ? 45.310  23.397  5.445   1.00 33.53 ? 203 SER L C   1 
ATOM   1598 O O   . SER A 1 208 ? 44.527  23.667  4.515   1.00 33.95 ? 203 SER L O   1 
ATOM   1599 C CB  . SER A 1 208 ? 47.600  24.232  4.611   1.00 33.76 ? 203 SER L CB  1 
ATOM   1600 O OG  . SER A 1 208 ? 47.327  24.440  3.238   1.00 35.48 ? 203 SER L OG  1 
ATOM   1601 N N   . PRO A 1 209 ? 44.888  23.292  6.723   1.00 32.70 ? 204 PRO L N   1 
ATOM   1602 C CA  . PRO A 1 209 ? 43.544  23.566  7.251   1.00 31.90 ? 204 PRO L CA  1 
ATOM   1603 C C   . PRO A 1 209 ? 42.972  24.948  6.963   1.00 31.13 ? 204 PRO L C   1 
ATOM   1604 O O   . PRO A 1 209 ? 43.719  25.936  6.897   1.00 30.95 ? 204 PRO L O   1 
ATOM   1605 C CB  . PRO A 1 209 ? 43.715  23.357  8.756   1.00 32.80 ? 204 PRO L CB  1 
ATOM   1606 C CG  . PRO A 1 209 ? 45.184  23.557  8.992   1.00 32.94 ? 204 PRO L CG  1 
ATOM   1607 C CD  . PRO A 1 209 ? 45.781  22.857  7.811   1.00 32.93 ? 204 PRO L CD  1 
ATOM   1608 N N   . ILE A 1 210 ? 41.647  25.011  6.771   1.00 30.09 ? 205 ILE L N   1 
ATOM   1609 C CA  . ILE A 1 210 ? 40.970  26.289  6.503   1.00 28.35 ? 205 ILE L CA  1 
ATOM   1610 C C   . ILE A 1 210 ? 40.817  26.940  7.853   1.00 27.19 ? 205 ILE L C   1 
ATOM   1611 O O   . ILE A 1 210 ? 40.427  26.304  8.823   1.00 27.56 ? 205 ILE L O   1 
ATOM   1612 C CB  . ILE A 1 210 ? 39.542  26.168  5.839   1.00 27.98 ? 205 ILE L CB  1 
ATOM   1613 C CG1 . ILE A 1 210 ? 39.596  25.522  4.457   1.00 27.64 ? 205 ILE L CG1 1 
ATOM   1614 C CG2 . ILE A 1 210 ? 38.969  27.551  5.619   1.00 27.87 ? 205 ILE L CG2 1 
ATOM   1615 C CD1 . ILE A 1 210 ? 39.694  24.035  4.494   1.00 30.03 ? 205 ILE L CD1 1 
ATOM   1616 N N   . VAL A 1 211 ? 41.134  28.213  7.915   1.00 26.48 ? 206 VAL L N   1 
ATOM   1617 C CA  . VAL A 1 211 ? 41.051  28.929  9.162   1.00 25.46 ? 206 VAL L CA  1 
ATOM   1618 C C   . VAL A 1 211 ? 40.264  30.218  8.969   1.00 25.26 ? 206 VAL L C   1 
ATOM   1619 O O   . VAL A 1 211 ? 40.548  31.012  8.064   1.00 25.91 ? 206 VAL L O   1 
ATOM   1620 C CB  . VAL A 1 211 ? 42.484  29.230  9.689   1.00 25.56 ? 206 VAL L CB  1 
ATOM   1621 C CG1 . VAL A 1 211 ? 42.479  30.329  10.759  1.00 25.40 ? 206 VAL L CG1 1 
ATOM   1622 C CG2 . VAL A 1 211 ? 43.105  27.957  10.242  1.00 25.37 ? 206 VAL L CG2 1 
ATOM   1623 N N   . LYS A 1 212 ? 39.207  30.368  9.754   1.00 23.14 ? 207 LYS L N   1 
ATOM   1624 C CA  . LYS A 1 212 ? 38.408  31.585  9.730   1.00 21.58 ? 207 LYS L CA  1 
ATOM   1625 C C   . LYS A 1 212 ? 38.630  32.078  11.137  1.00 18.60 ? 207 LYS L C   1 
ATOM   1626 O O   . LYS A 1 212 ? 38.629  31.286  12.069  1.00 17.19 ? 207 LYS L O   1 
ATOM   1627 C CB  . LYS A 1 212 ? 36.928  31.299  9.497   1.00 22.83 ? 207 LYS L CB  1 
ATOM   1628 C CG  . LYS A 1 212 ? 36.264  32.377  8.703   1.00 25.01 ? 207 LYS L CG  1 
ATOM   1629 C CD  . LYS A 1 212 ? 36.624  32.237  7.242   1.00 26.95 ? 207 LYS L CD  1 
ATOM   1630 C CE  . LYS A 1 212 ? 37.385  33.456  6.712   1.00 29.88 ? 207 LYS L CE  1 
ATOM   1631 N NZ  . LYS A 1 212 ? 36.656  34.770  6.827   1.00 31.05 ? 207 LYS L NZ  1 
ATOM   1632 N N   . SER A 1 213 ? 38.810  33.376  11.307  1.00 17.40 ? 208 SER L N   1 
ATOM   1633 C CA  . SER A 1 213 ? 39.112  33.901  12.629  1.00 15.74 ? 208 SER L CA  1 
ATOM   1634 C C   . SER A 1 213 ? 38.714  35.351  12.727  1.00 13.01 ? 208 SER L C   1 
ATOM   1635 O O   . SER A 1 213 ? 38.499  35.992  11.708  1.00 12.25 ? 208 SER L O   1 
ATOM   1636 C CB  . SER A 1 213 ? 40.623  33.746  12.881  1.00 16.54 ? 208 SER L CB  1 
ATOM   1637 O OG  . SER A 1 213 ? 41.039  34.417  14.049  1.00 18.70 ? 208 SER L OG  1 
ATOM   1638 N N   . PHE A 1 214 ? 38.556  35.851  13.944  1.00 11.11 ? 209 PHE L N   1 
ATOM   1639 C CA  . PHE A 1 214 ? 38.208  37.261  14.156  1.00 9.94  ? 209 PHE L CA  1 
ATOM   1640 C C   . PHE A 1 214 ? 38.872  37.687  15.453  1.00 10.40 ? 209 PHE L C   1 
ATOM   1641 O O   . PHE A 1 214 ? 39.227  36.839  16.278  1.00 8.89  ? 209 PHE L O   1 
ATOM   1642 C CB  . PHE A 1 214 ? 36.655  37.537  14.152  1.00 7.94  ? 209 PHE L CB  1 
ATOM   1643 C CG  . PHE A 1 214 ? 35.905  37.102  15.418  1.00 6.17  ? 209 PHE L CG  1 
ATOM   1644 C CD1 . PHE A 1 214 ? 35.834  37.928  16.527  1.00 4.95  ? 209 PHE L CD1 1 
ATOM   1645 C CD2 . PHE A 1 214 ? 35.304  35.849  15.503  1.00 5.84  ? 209 PHE L CD2 1 
ATOM   1646 C CE1 . PHE A 1 214 ? 35.198  37.511  17.698  1.00 3.55  ? 209 PHE L CE1 1 
ATOM   1647 C CE2 . PHE A 1 214 ? 34.664  35.436  16.686  1.00 4.47  ? 209 PHE L CE2 1 
ATOM   1648 C CZ  . PHE A 1 214 ? 34.618  36.265  17.774  1.00 2.93  ? 209 PHE L CZ  1 
ATOM   1649 N N   . ASN A 1 215 ? 39.199  38.971  15.536  1.00 13.21 ? 210 ASN L N   1 
ATOM   1650 C CA  . ASN A 1 215 ? 39.798  39.527  16.739  1.00 16.74 ? 210 ASN L CA  1 
ATOM   1651 C C   . ASN A 1 215 ? 38.743  40.418  17.334  1.00 21.22 ? 210 ASN L C   1 
ATOM   1652 O O   . ASN A 1 215 ? 38.043  41.125  16.602  1.00 20.22 ? 210 ASN L O   1 
ATOM   1653 C CB  . ASN A 1 215 ? 41.023  40.403  16.444  1.00 14.50 ? 210 ASN L CB  1 
ATOM   1654 C CG  . ASN A 1 215 ? 42.208  39.601  15.980  1.00 14.59 ? 210 ASN L CG  1 
ATOM   1655 O OD1 . ASN A 1 215 ? 42.296  38.402  16.250  1.00 14.34 ? 210 ASN L OD1 1 
ATOM   1656 N ND2 . ASN A 1 215 ? 43.104  40.237  15.220  1.00 13.81 ? 210 ASN L ND2 1 
ATOM   1657 N N   . ARG A 1 216 ? 38.562  40.334  18.642  1.00 26.60 ? 211 ARG L N   1 
ATOM   1658 C CA  . ARG A 1 216 ? 37.627  41.213  19.282  1.00 33.76 ? 211 ARG L CA  1 
ATOM   1659 C C   . ARG A 1 216 ? 38.560  42.270  19.843  1.00 39.15 ? 211 ARG L C   1 
ATOM   1660 O O   . ARG A 1 216 ? 39.604  41.954  20.424  1.00 40.84 ? 211 ARG L O   1 
ATOM   1661 C CB  . ARG A 1 216 ? 36.836  40.502  20.372  1.00 33.71 ? 211 ARG L CB  1 
ATOM   1662 C CG  . ARG A 1 216 ? 37.653  39.887  21.481  1.00 34.08 ? 211 ARG L CG  1 
ATOM   1663 C CD  . ARG A 1 216 ? 36.749  39.506  22.658  1.00 34.26 ? 211 ARG L CD  1 
ATOM   1664 N NE  . ARG A 1 216 ? 36.093  40.675  23.222  1.00 33.25 ? 211 ARG L NE  1 
ATOM   1665 C CZ  . ARG A 1 216 ? 36.687  41.537  24.038  1.00 33.88 ? 211 ARG L CZ  1 
ATOM   1666 N NH1 . ARG A 1 216 ? 37.950  41.364  24.396  1.00 33.05 ? 211 ARG L NH1 1 
ATOM   1667 N NH2 . ARG A 1 216 ? 36.012  42.588  24.482  1.00 34.86 ? 211 ARG L NH2 1 
ATOM   1668 N N   . ASN A 1 217 ? 38.288  43.525  19.535  1.00 45.63 ? 212 ASN L N   1 
ATOM   1669 C CA  . ASN A 1 217 ? 39.152  44.578  20.039  1.00 52.89 ? 212 ASN L CA  1 
ATOM   1670 C C   . ASN A 1 217 ? 38.278  45.607  20.754  1.00 57.56 ? 212 ASN L C   1 
ATOM   1671 O O   . ASN A 1 217 ? 38.252  45.651  21.993  1.00 58.54 ? 212 ASN L O   1 
ATOM   1672 C CB  . ASN A 1 217 ? 39.961  45.183  18.887  1.00 52.85 ? 212 ASN L CB  1 
ATOM   1673 C CG  . ASN A 1 217 ? 40.699  44.124  18.074  1.00 53.22 ? 212 ASN L CG  1 
ATOM   1674 O OD1 . ASN A 1 217 ? 40.491  44.008  16.866  1.00 53.42 ? 212 ASN L OD1 1 
ATOM   1675 N ND2 . ASN A 1 217 ? 41.532  43.323  18.738  1.00 53.00 ? 212 ASN L ND2 1 
ATOM   1676 N N   . GLU A 1 218 ? 37.529  46.374  19.958  1.00 62.71 ? 213 GLU L N   1 
ATOM   1677 C CA  . GLU A 1 218 ? 36.566  47.405  20.389  1.00 66.77 ? 213 GLU L CA  1 
ATOM   1678 C C   . GLU A 1 218 ? 36.037  47.956  19.075  1.00 68.44 ? 213 GLU L C   1 
ATOM   1679 O O   . GLU A 1 218 ? 36.692  47.798  18.036  1.00 68.59 ? 213 GLU L O   1 
ATOM   1680 C CB  . GLU A 1 218 ? 37.210  48.563  21.187  1.00 68.42 ? 213 GLU L CB  1 
ATOM   1681 C CG  . GLU A 1 218 ? 37.565  48.296  22.673  1.00 70.30 ? 213 GLU L CG  1 
ATOM   1682 C CD  . GLU A 1 218 ? 36.428  47.679  23.500  1.00 71.47 ? 213 GLU L CD  1 
ATOM   1683 O OE1 . GLU A 1 218 ? 35.238  47.805  23.111  1.00 72.41 ? 213 GLU L OE1 1 
ATOM   1684 O OE2 . GLU A 1 218 ? 36.738  47.062  24.545  1.00 71.82 ? 213 GLU L OE2 1 
ATOM   1685 N N   . CYS A 1 219 ? 34.865  48.586  19.121  1.00 70.53 ? 214 CYS L N   1 
ATOM   1686 C CA  . CYS A 1 219 ? 34.237  49.171  17.929  1.00 72.57 ? 214 CYS L CA  1 
ATOM   1687 C C   . CYS A 1 219 ? 33.690  48.113  16.938  1.00 72.89 ? 214 CYS L C   1 
ATOM   1688 O O   . CYS A 1 219 ? 33.441  48.475  15.763  1.00 73.09 ? 214 CYS L O   1 
ATOM   1689 C CB  . CYS A 1 219 ? 35.226  50.104  17.209  1.00 73.34 ? 214 CYS L CB  1 
ATOM   1690 S SG  . CYS A 1 219 ? 36.272  51.124  18.296  1.00 75.34 ? 214 CYS L SG  1 
ATOM   1691 N N   . GLU B 2 1   ? -8.704  10.475  -2.799  1.00 35.84 ? 1   GLU H N   1 
ATOM   1692 C CA  . GLU B 2 1   ? -7.215  10.548  -2.654  1.00 34.23 ? 1   GLU H CA  1 
ATOM   1693 C C   . GLU B 2 1   ? -6.859  10.124  -1.224  1.00 30.89 ? 1   GLU H C   1 
ATOM   1694 O O   . GLU B 2 1   ? -7.288  10.767  -0.267  1.00 29.69 ? 1   GLU H O   1 
ATOM   1695 C CB  . GLU B 2 1   ? -6.696  11.966  -3.002  1.00 37.24 ? 1   GLU H CB  1 
ATOM   1696 C CG  . GLU B 2 1   ? -7.560  13.168  -2.526  1.00 41.05 ? 1   GLU H CG  1 
ATOM   1697 C CD  . GLU B 2 1   ? -8.878  13.374  -3.319  1.00 43.10 ? 1   GLU H CD  1 
ATOM   1698 O OE1 . GLU B 2 1   ? -9.906  12.723  -2.985  1.00 44.23 ? 1   GLU H OE1 1 
ATOM   1699 O OE2 . GLU B 2 1   ? -8.897  14.224  -4.247  1.00 44.81 ? 1   GLU H OE2 1 
ATOM   1700 N N   . VAL B 2 2   ? -6.155  9.000   -1.089  1.00 26.80 ? 2   VAL H N   1 
ATOM   1701 C CA  . VAL B 2 2   ? -5.802  8.492   0.227   1.00 24.36 ? 2   VAL H CA  1 
ATOM   1702 C C   . VAL B 2 2   ? -4.863  9.400   0.999   1.00 24.07 ? 2   VAL H C   1 
ATOM   1703 O O   . VAL B 2 2   ? -3.803  9.771   0.489   1.00 24.65 ? 2   VAL H O   1 
ATOM   1704 C CB  . VAL B 2 2   ? -5.195  7.080   0.180   1.00 22.66 ? 2   VAL H CB  1 
ATOM   1705 C CG1 . VAL B 2 2   ? -4.911  6.580   1.624   1.00 19.69 ? 2   VAL H CG1 1 
ATOM   1706 C CG2 . VAL B 2 2   ? -6.139  6.136   -0.560  1.00 20.97 ? 2   VAL H CG2 1 
ATOM   1707 N N   . LYS B 2 3   ? -5.279  9.748   2.218   1.00 21.63 ? 3   LYS H N   1 
ATOM   1708 C CA  . LYS B 2 3   ? -4.531  10.598  3.125   1.00 21.27 ? 3   LYS H CA  1 
ATOM   1709 C C   . LYS B 2 3   ? -4.682  10.021  4.525   1.00 19.74 ? 3   LYS H C   1 
ATOM   1710 O O   . LYS B 2 3   ? -5.795  9.688   4.934   1.00 16.79 ? 3   LYS H O   1 
ATOM   1711 C CB  . LYS B 2 3   ? -5.107  12.026  3.182   1.00 24.02 ? 3   LYS H CB  1 
ATOM   1712 C CG  . LYS B 2 3   ? -4.957  12.928  1.952   1.00 27.00 ? 3   LYS H CG  1 
ATOM   1713 C CD  . LYS B 2 3   ? -5.392  14.361  2.306   1.00 29.57 ? 3   LYS H CD  1 
ATOM   1714 C CE  . LYS B 2 3   ? -6.774  14.378  3.045   1.00 31.79 ? 3   LYS H CE  1 
ATOM   1715 N NZ  . LYS B 2 3   ? -7.200  15.705  3.695   1.00 32.13 ? 3   LYS H NZ  1 
ATOM   1716 N N   . LEU B 2 4   ? -3.565  9.918   5.250   1.00 18.52 ? 4   LEU H N   1 
ATOM   1717 C CA  . LEU B 2 4   ? -3.545  9.426   6.637   1.00 17.56 ? 4   LEU H CA  1 
ATOM   1718 C C   . LEU B 2 4   ? -2.953  10.567  7.447   1.00 18.59 ? 4   LEU H C   1 
ATOM   1719 O O   . LEU B 2 4   ? -1.756  10.823  7.387   1.00 19.21 ? 4   LEU H O   1 
ATOM   1720 C CB  . LEU B 2 4   ? -2.679  8.165   6.793   1.00 15.18 ? 4   LEU H CB  1 
ATOM   1721 C CG  . LEU B 2 4   ? -3.353  6.815   6.554   1.00 13.98 ? 4   LEU H CG  1 
ATOM   1722 C CD1 . LEU B 2 4   ? -3.471  6.547   5.094   1.00 14.65 ? 4   LEU H CD1 1 
ATOM   1723 C CD2 . LEU B 2 4   ? -2.560  5.731   7.172   1.00 13.39 ? 4   LEU H CD2 1 
ATOM   1724 N N   . GLN B 2 5   ? -3.807  11.321  8.122   1.00 19.56 ? 5   GLN H N   1 
ATOM   1725 C CA  . GLN B 2 5   ? -3.352  12.449  8.904   1.00 20.12 ? 5   GLN H CA  1 
ATOM   1726 C C   . GLN B 2 5   ? -3.162  12.135  10.376  1.00 18.54 ? 5   GLN H C   1 
ATOM   1727 O O   . GLN B 2 5   ? -4.107  11.811  11.073  1.00 18.73 ? 5   GLN H O   1 
ATOM   1728 C CB  . GLN B 2 5   ? -4.257  13.653  8.650   1.00 23.55 ? 5   GLN H CB  1 
ATOM   1729 C CG  . GLN B 2 5   ? -3.778  14.476  7.419   1.00 28.73 ? 5   GLN H CG  1 
ATOM   1730 C CD  . GLN B 2 5   ? -4.867  14.848  6.376   1.00 31.55 ? 5   GLN H CD  1 
ATOM   1731 O OE1 . GLN B 2 5   ? -4.583  14.912  5.161   1.00 32.60 ? 5   GLN H OE1 1 
ATOM   1732 N NE2 . GLN B 2 5   ? -6.092  15.120  6.845   1.00 32.75 ? 5   GLN H NE2 1 
ATOM   1733 N N   . GLU B 2 6   ? -1.911  12.178  10.822  1.00 17.29 ? 6   GLU H N   1 
ATOM   1734 C CA  . GLU B 2 6   ? -1.556  11.887  12.202  1.00 17.06 ? 6   GLU H CA  1 
ATOM   1735 C C   . GLU B 2 6   ? -1.495  13.103  13.102  1.00 18.59 ? 6   GLU H C   1 
ATOM   1736 O O   . GLU B 2 6   ? -1.181  14.209  12.658  1.00 18.94 ? 6   GLU H O   1 
ATOM   1737 C CB  . GLU B 2 6   ? -0.229  11.143  12.281  1.00 15.12 ? 6   GLU H CB  1 
ATOM   1738 C CG  . GLU B 2 6   ? -0.304  9.770   11.717  1.00 13.34 ? 6   GLU H CG  1 
ATOM   1739 C CD  . GLU B 2 6   ? 0.953   9.003   11.937  1.00 13.73 ? 6   GLU H CD  1 
ATOM   1740 O OE1 . GLU B 2 6   ? 1.213   8.590   13.089  1.00 13.72 ? 6   GLU H OE1 1 
ATOM   1741 O OE2 . GLU B 2 6   ? 1.678   8.791   10.948  1.00 14.43 ? 6   GLU H OE2 1 
ATOM   1742 N N   . SER B 2 7   ? -1.771  12.868  14.382  1.00 19.98 ? 7   SER H N   1 
ATOM   1743 C CA  . SER B 2 7   ? -1.767  13.916  15.391  1.00 20.74 ? 7   SER H CA  1 
ATOM   1744 C C   . SER B 2 7   ? -0.414  14.606  15.607  1.00 21.16 ? 7   SER H C   1 
ATOM   1745 O O   . SER B 2 7   ? 0.641   14.149  15.148  1.00 20.12 ? 7   SER H O   1 
ATOM   1746 C CB  . SER B 2 7   ? -2.323  13.371  16.714  1.00 22.16 ? 7   SER H CB  1 
ATOM   1747 O OG  . SER B 2 7   ? -2.033  11.984  16.912  1.00 23.70 ? 7   SER H OG  1 
ATOM   1748 N N   . GLY B 2 8   ? -0.468  15.723  16.321  1.00 21.63 ? 8   GLY H N   1 
ATOM   1749 C CA  . GLY B 2 8   ? 0.729   16.498  16.580  1.00 21.62 ? 8   GLY H CA  1 
ATOM   1750 C C   . GLY B 2 8   ? 1.691   15.830  17.533  1.00 21.39 ? 8   GLY H C   1 
ATOM   1751 O O   . GLY B 2 8   ? 1.325   14.856  18.207  1.00 21.86 ? 8   GLY H O   1 
ATOM   1752 N N   . ALA B 2 9   ? 2.933   16.329  17.517  1.00 20.55 ? 9   ALA H N   1 
ATOM   1753 C CA  . ALA B 2 9   ? 4.024   15.853  18.360  1.00 19.03 ? 9   ALA H CA  1 
ATOM   1754 C C   . ALA B 2 9   ? 3.567   15.957  19.799  1.00 18.56 ? 9   ALA H C   1 
ATOM   1755 O O   . ALA B 2 9   ? 2.865   16.879  20.157  1.00 18.43 ? 9   ALA H O   1 
ATOM   1756 C CB  . ALA B 2 9   ? 5.250   16.696  18.136  1.00 18.45 ? 9   ALA H CB  1 
ATOM   1757 N N   . GLU B 2 10  ? 3.987   15.021  20.628  1.00 19.07 ? 10  GLU H N   1 
ATOM   1758 C CA  . GLU B 2 10  ? 3.566   15.010  22.014  1.00 19.18 ? 10  GLU H CA  1 
ATOM   1759 C C   . GLU B 2 10  ? 4.711   15.060  22.994  1.00 18.00 ? 10  GLU H C   1 
ATOM   1760 O O   . GLU B 2 10  ? 5.771   14.446  22.775  1.00 17.09 ? 10  GLU H O   1 
ATOM   1761 C CB  . GLU B 2 10  ? 2.802   13.715  22.296  1.00 21.23 ? 10  GLU H CB  1 
ATOM   1762 C CG  . GLU B 2 10  ? 1.605   13.470  21.420  1.00 24.72 ? 10  GLU H CG  1 
ATOM   1763 C CD  . GLU B 2 10  ? 0.321   14.031  22.005  1.00 26.82 ? 10  GLU H CD  1 
ATOM   1764 O OE1 . GLU B 2 10  ? 0.388   14.723  23.042  1.00 28.36 ? 10  GLU H OE1 1 
ATOM   1765 O OE2 . GLU B 2 10  ? -0.766  13.769  21.431  1.00 29.05 ? 10  GLU H OE2 1 
ATOM   1766 N N   . LEU B 2 11  ? 4.477   15.770  24.090  1.00 16.74 ? 11  LEU H N   1 
ATOM   1767 C CA  . LEU B 2 11  ? 5.431   15.839  25.189  1.00 16.36 ? 11  LEU H CA  1 
ATOM   1768 C C   . LEU B 2 11  ? 4.624   15.081  26.241  1.00 16.72 ? 11  LEU H C   1 
ATOM   1769 O O   . LEU B 2 11  ? 3.505   15.477  26.561  1.00 16.43 ? 11  LEU H O   1 
ATOM   1770 C CB  . LEU B 2 11  ? 5.661   17.275  25.674  1.00 15.39 ? 11  LEU H CB  1 
ATOM   1771 C CG  . LEU B 2 11  ? 7.010   17.582  26.350  1.00 15.21 ? 11  LEU H CG  1 
ATOM   1772 C CD1 . LEU B 2 11  ? 6.813   18.709  27.319  1.00 14.76 ? 11  LEU H CD1 1 
ATOM   1773 C CD2 . LEU B 2 11  ? 7.637   16.371  27.038  1.00 14.22 ? 11  LEU H CD2 1 
ATOM   1774 N N   . VAL B 2 12  ? 5.167   13.977  26.742  1.00 17.68 ? 12  VAL H N   1 
ATOM   1775 C CA  . VAL B 2 12  ? 4.473   13.160  27.728  1.00 16.98 ? 12  VAL H CA  1 
ATOM   1776 C C   . VAL B 2 12  ? 5.400   12.871  28.888  1.00 16.68 ? 12  VAL H C   1 
ATOM   1777 O O   . VAL B 2 12  ? 6.606   12.792  28.715  1.00 14.90 ? 12  VAL H O   1 
ATOM   1778 C CB  . VAL B 2 12  ? 4.006   11.826  27.094  1.00 17.05 ? 12  VAL H CB  1 
ATOM   1779 C CG1 . VAL B 2 12  ? 3.171   11.018  28.084  1.00 16.87 ? 12  VAL H CG1 1 
ATOM   1780 C CG2 . VAL B 2 12  ? 3.237   12.112  25.813  1.00 16.48 ? 12  VAL H CG2 1 
ATOM   1781 N N   . ARG B 2 13  ? 4.821   12.765  30.080  1.00 17.74 ? 13  ARG H N   1 
ATOM   1782 C CA  . ARG B 2 13  ? 5.562   12.473  31.301  1.00 17.68 ? 13  ARG H CA  1 
ATOM   1783 C C   . ARG B 2 13  ? 5.686   10.964  31.490  1.00 16.07 ? 13  ARG H C   1 
ATOM   1784 O O   . ARG B 2 13  ? 4.807   10.203  31.089  1.00 16.96 ? 13  ARG H O   1 
ATOM   1785 C CB  . ARG B 2 13  ? 4.849   13.100  32.498  1.00 19.45 ? 13  ARG H CB  1 
ATOM   1786 C CG  . ARG B 2 13  ? 4.885   14.615  32.492  1.00 22.59 ? 13  ARG H CG  1 
ATOM   1787 C CD  . ARG B 2 13  ? 6.341   15.098  32.374  1.00 26.45 ? 13  ARG H CD  1 
ATOM   1788 N NE  . ARG B 2 13  ? 6.482   16.556  32.412  1.00 29.27 ? 13  ARG H NE  1 
ATOM   1789 C CZ  . ARG B 2 13  ? 7.064   17.302  31.469  1.00 29.77 ? 13  ARG H CZ  1 
ATOM   1790 N NH1 . ARG B 2 13  ? 7.580   16.764  30.380  1.00 29.97 ? 13  ARG H NH1 1 
ATOM   1791 N NH2 . ARG B 2 13  ? 7.103   18.617  31.608  1.00 30.82 ? 13  ARG H NH2 1 
ATOM   1792 N N   . PRO B 2 14  ? 6.794   10.508  32.073  1.00 15.26 ? 14  PRO H N   1 
ATOM   1793 C CA  . PRO B 2 14  ? 6.996   9.067   32.298  1.00 14.85 ? 14  PRO H CA  1 
ATOM   1794 C C   . PRO B 2 14  ? 5.855   8.436   33.114  1.00 14.53 ? 14  PRO H C   1 
ATOM   1795 O O   . PRO B 2 14  ? 5.269   9.078   33.991  1.00 15.04 ? 14  PRO H O   1 
ATOM   1796 C CB  . PRO B 2 14  ? 8.293   9.024   33.111  1.00 13.73 ? 14  PRO H CB  1 
ATOM   1797 C CG  . PRO B 2 14  ? 9.001   10.284  32.709  1.00 13.76 ? 14  PRO H CG  1 
ATOM   1798 C CD  . PRO B 2 14  ? 7.917   11.303  32.602  1.00 14.21 ? 14  PRO H CD  1 
ATOM   1799 N N   . GLY B 2 15  ? 5.541   7.186   32.812  1.00 12.61 ? 15  GLY H N   1 
ATOM   1800 C CA  . GLY B 2 15  ? 4.506   6.493   33.533  1.00 13.75 ? 15  GLY H CA  1 
ATOM   1801 C C   . GLY B 2 15  ? 3.145   6.812   32.993  1.00 14.58 ? 15  GLY H C   1 
ATOM   1802 O O   . GLY B 2 15  ? 2.228   6.020   33.165  1.00 14.62 ? 15  GLY H O   1 
ATOM   1803 N N   . ALA B 2 16  ? 3.027   7.948   32.299  1.00 15.79 ? 16  ALA H N   1 
ATOM   1804 C CA  . ALA B 2 16  ? 1.751   8.384   31.701  1.00 16.34 ? 16  ALA H CA  1 
ATOM   1805 C C   . ALA B 2 16  ? 1.377   7.589   30.446  1.00 16.62 ? 16  ALA H C   1 
ATOM   1806 O O   . ALA B 2 16  ? 2.112   6.681   30.029  1.00 17.44 ? 16  ALA H O   1 
ATOM   1807 C CB  . ALA B 2 16  ? 1.783   9.893   31.390  1.00 14.85 ? 16  ALA H CB  1 
ATOM   1808 N N   . SER B 2 17  ? 0.253   7.965   29.841  1.00 17.08 ? 17  SER H N   1 
ATOM   1809 C CA  . SER B 2 17  ? -0.271  7.304   28.651  1.00 17.57 ? 17  SER H CA  1 
ATOM   1810 C C   . SER B 2 17  ? -0.486  8.317   27.522  1.00 17.30 ? 17  SER H C   1 
ATOM   1811 O O   . SER B 2 17  ? -0.648  9.494   27.786  1.00 17.79 ? 17  SER H O   1 
ATOM   1812 C CB  . SER B 2 17  ? -1.618  6.701   29.004  1.00 18.75 ? 17  SER H CB  1 
ATOM   1813 O OG  . SER B 2 17  ? -1.682  5.345   28.646  1.00 22.24 ? 17  SER H OG  1 
ATOM   1814 N N   . VAL B 2 18  ? -0.402  7.883   26.271  1.00 16.67 ? 18  VAL H N   1 
ATOM   1815 C CA  . VAL B 2 18  ? -0.693  8.774   25.140  1.00 15.66 ? 18  VAL H CA  1 
ATOM   1816 C C   . VAL B 2 18  ? -1.595  8.042   24.180  1.00 15.10 ? 18  VAL H C   1 
ATOM   1817 O O   . VAL B 2 18  ? -1.452  6.836   23.960  1.00 14.79 ? 18  VAL H O   1 
ATOM   1818 C CB  . VAL B 2 18  ? 0.516   9.195   24.238  1.00 15.73 ? 18  VAL H CB  1 
ATOM   1819 C CG1 . VAL B 2 18  ? 0.834   10.641  24.437  1.00 14.96 ? 18  VAL H CG1 1 
ATOM   1820 C CG2 . VAL B 2 18  ? 1.692   8.256   24.355  1.00 13.98 ? 18  VAL H CG2 1 
ATOM   1821 N N   . LYS B 2 19  ? -2.465  8.798   23.537  1.00 15.18 ? 19  LYS H N   1 
ATOM   1822 C CA  . LYS B 2 19  ? -3.367  8.217   22.571  1.00 16.80 ? 19  LYS H CA  1 
ATOM   1823 C C   . LYS B 2 19  ? -3.032  8.918   21.256  1.00 15.31 ? 19  LYS H C   1 
ATOM   1824 O O   . LYS B 2 19  ? -3.233  10.130  21.115  1.00 14.75 ? 19  LYS H O   1 
ATOM   1825 C CB  . LYS B 2 19  ? -4.830  8.457   22.977  1.00 18.14 ? 19  LYS H CB  1 
ATOM   1826 C CG  . LYS B 2 19  ? -5.852  7.669   22.162  1.00 20.69 ? 19  LYS H CG  1 
ATOM   1827 C CD  . LYS B 2 19  ? -7.219  8.287   22.292  1.00 22.67 ? 19  LYS H CD  1 
ATOM   1828 C CE  . LYS B 2 19  ? -7.163  9.767   21.838  1.00 26.23 ? 19  LYS H CE  1 
ATOM   1829 N NZ  . LYS B 2 19  ? -8.389  10.596  22.216  1.00 28.35 ? 19  LYS H NZ  1 
ATOM   1830 N N   . LEU B 2 20  ? -2.444  8.168   20.335  1.00 13.73 ? 20  LEU H N   1 
ATOM   1831 C CA  . LEU B 2 20  ? -2.076  8.724   19.043  1.00 13.33 ? 20  LEU H CA  1 
ATOM   1832 C C   . LEU B 2 20  ? -3.175  8.464   18.044  1.00 11.73 ? 20  LEU H C   1 
ATOM   1833 O O   . LEU B 2 20  ? -3.771  7.395   18.058  1.00 10.21 ? 20  LEU H O   1 
ATOM   1834 C CB  . LEU B 2 20  ? -0.781  8.095   18.538  1.00 13.96 ? 20  LEU H CB  1 
ATOM   1835 C CG  . LEU B 2 20  ? 0.427   8.150   19.481  1.00 15.20 ? 20  LEU H CG  1 
ATOM   1836 C CD1 . LEU B 2 20  ? 1.631   7.600   18.751  1.00 16.05 ? 20  LEU H CD1 1 
ATOM   1837 C CD2 . LEU B 2 20  ? 0.726   9.564   19.968  1.00 14.47 ? 20  LEU H CD2 1 
ATOM   1838 N N   . SER B 2 21  ? -3.500  9.465   17.232  1.00 11.53 ? 21  SER H N   1 
ATOM   1839 C CA  . SER B 2 21  ? -4.511  9.250   16.229  1.00 12.89 ? 21  SER H CA  1 
ATOM   1840 C C   . SER B 2 21  ? -4.008  9.323   14.787  1.00 13.14 ? 21  SER H C   1 
ATOM   1841 O O   . SER B 2 21  ? -3.015  9.993   14.460  1.00 12.68 ? 21  SER H O   1 
ATOM   1842 C CB  . SER B 2 21  ? -5.721  10.137  16.437  1.00 12.79 ? 21  SER H CB  1 
ATOM   1843 O OG  . SER B 2 21  ? -5.362  11.475  16.402  1.00 15.31 ? 21  SER H OG  1 
ATOM   1844 N N   . CYS B 2 22  ? -4.730  8.596   13.949  1.00 14.09 ? 22  CYS H N   1 
ATOM   1845 C CA  . CYS B 2 22  ? -4.473  8.460   12.534  1.00 14.36 ? 22  CYS H CA  1 
ATOM   1846 C C   . CYS B 2 22  ? -5.811  8.591   11.803  1.00 14.52 ? 22  CYS H C   1 
ATOM   1847 O O   . CYS B 2 22  ? -6.546  7.603   11.659  1.00 14.20 ? 22  CYS H O   1 
ATOM   1848 C CB  . CYS B 2 22  ? -3.901  7.070   12.277  1.00 13.62 ? 22  CYS H CB  1 
ATOM   1849 S SG  . CYS B 2 22  ? -3.515  6.758   10.533  1.00 13.79 ? 22  CYS H SG  1 
ATOM   1850 N N   . LYS B 2 23  ? -6.127  9.813   11.374  1.00 14.73 ? 23  LYS H N   1 
ATOM   1851 C CA  . LYS B 2 23  ? -7.367  10.112  10.675  1.00 15.44 ? 23  LYS H CA  1 
ATOM   1852 C C   . LYS B 2 23  ? -7.146  9.752   9.218   1.00 15.12 ? 23  LYS H C   1 
ATOM   1853 O O   . LYS B 2 23  ? -6.166  10.190  8.627   1.00 15.23 ? 23  LYS H O   1 
ATOM   1854 C CB  . LYS B 2 23  ? -7.687  11.607  10.810  1.00 16.58 ? 23  LYS H CB  1 
ATOM   1855 C CG  . LYS B 2 23  ? -9.182  11.958  10.826  1.00 19.26 ? 23  LYS H CG  1 
ATOM   1856 C CD  . LYS B 2 23  ? -9.825  12.009  9.450   1.00 21.49 ? 23  LYS H CD  1 
ATOM   1857 C CE  . LYS B 2 23  ? -11.359 12.149  9.535   1.00 23.40 ? 23  LYS H CE  1 
ATOM   1858 N NZ  . LYS B 2 23  ? -11.821 13.202  10.521  1.00 25.56 ? 23  LYS H NZ  1 
ATOM   1859 N N   . THR B 2 24  ? -8.034  8.936   8.650   1.00 15.34 ? 24  THR H N   1 
ATOM   1860 C CA  . THR B 2 24  ? -7.915  8.516   7.254   1.00 14.85 ? 24  THR H CA  1 
ATOM   1861 C C   . THR B 2 24  ? -8.972  9.129   6.331   1.00 15.76 ? 24  THR H C   1 
ATOM   1862 O O   . THR B 2 24  ? -10.026 9.581   6.787   1.00 18.28 ? 24  THR H O   1 
ATOM   1863 C CB  . THR B 2 24  ? -7.966  6.969   7.115   1.00 14.68 ? 24  THR H CB  1 
ATOM   1864 O OG1 . THR B 2 24  ? -9.314  6.514   7.246   1.00 14.65 ? 24  THR H OG1 1 
ATOM   1865 C CG2 . THR B 2 24  ? -7.101  6.287   8.182   1.00 13.43 ? 24  THR H CG2 1 
ATOM   1866 N N   . SER B 2 25  ? -8.686  9.167   5.035   1.00 15.41 ? 25  SER H N   1 
ATOM   1867 C CA  . SER B 2 25  ? -9.635  9.688   4.070   1.00 15.59 ? 25  SER H CA  1 
ATOM   1868 C C   . SER B 2 25  ? -9.342  9.135   2.683   1.00 15.16 ? 25  SER H C   1 
ATOM   1869 O O   . SER B 2 25  ? -8.228  8.712   2.420   1.00 15.08 ? 25  SER H O   1 
ATOM   1870 C CB  . SER B 2 25  ? -9.558  11.213  4.020   1.00 17.10 ? 25  SER H CB  1 
ATOM   1871 O OG  . SER B 2 25  ? -8.327  11.666  3.458   1.00 18.69 ? 25  SER H OG  1 
ATOM   1872 N N   . GLY B 2 26  ? -10.355 9.093   1.819   1.00 14.78 ? 26  GLY H N   1 
ATOM   1873 C CA  . GLY B 2 26  ? -10.148 8.657   0.456   1.00 13.30 ? 26  GLY H CA  1 
ATOM   1874 C C   . GLY B 2 26  ? -10.248 7.193   0.068   1.00 14.58 ? 26  GLY H C   1 
ATOM   1875 O O   . GLY B 2 26  ? -9.891  6.856   -1.077  1.00 14.94 ? 26  GLY H O   1 
ATOM   1876 N N   . TYR B 2 27  ? -10.720 6.339   0.980   1.00 14.10 ? 27  TYR H N   1 
ATOM   1877 C CA  . TYR B 2 27  ? -10.886 4.908   0.718   1.00 13.50 ? 27  TYR H CA  1 
ATOM   1878 C C   . TYR B 2 27  ? -11.869 4.390   1.772   1.00 13.86 ? 27  TYR H C   1 
ATOM   1879 O O   . TYR B 2 27  ? -12.142 5.101   2.743   1.00 14.67 ? 27  TYR H O   1 
ATOM   1880 C CB  . TYR B 2 27  ? -9.528  4.170   0.799   1.00 13.21 ? 27  TYR H CB  1 
ATOM   1881 C CG  . TYR B 2 27  ? -8.941  4.013   2.193   1.00 12.61 ? 27  TYR H CG  1 
ATOM   1882 C CD1 . TYR B 2 27  ? -8.225  5.046   2.792   1.00 12.29 ? 27  TYR H CD1 1 
ATOM   1883 C CD2 . TYR B 2 27  ? -9.100  2.821   2.904   1.00 12.19 ? 27  TYR H CD2 1 
ATOM   1884 C CE1 . TYR B 2 27  ? -7.682  4.889   4.059   1.00 11.38 ? 27  TYR H CE1 1 
ATOM   1885 C CE2 . TYR B 2 27  ? -8.573  2.660   4.173   1.00 11.65 ? 27  TYR H CE2 1 
ATOM   1886 C CZ  . TYR B 2 27  ? -7.867  3.695   4.733   1.00 11.72 ? 27  TYR H CZ  1 
ATOM   1887 O OH  . TYR B 2 27  ? -7.326  3.531   5.972   1.00 13.08 ? 27  TYR H OH  1 
ATOM   1888 N N   . ILE B 2 28  ? -12.430 3.193   1.580   1.00 13.60 ? 28  ILE H N   1 
ATOM   1889 C CA  . ILE B 2 28  ? -13.358 2.615   2.564   1.00 12.94 ? 28  ILE H CA  1 
ATOM   1890 C C   . ILE B 2 28  ? -12.535 2.119   3.757   1.00 13.32 ? 28  ILE H C   1 
ATOM   1891 O O   . ILE B 2 28  ? -11.819 1.116   3.667   1.00 13.42 ? 28  ILE H O   1 
ATOM   1892 C CB  . ILE B 2 28  ? -14.217 1.441   1.967   1.00 13.15 ? 28  ILE H CB  1 
ATOM   1893 C CG1 . ILE B 2 28  ? -15.124 1.949   0.835   1.00 11.03 ? 28  ILE H CG1 1 
ATOM   1894 C CG2 . ILE B 2 28  ? -15.113 0.780   3.058   1.00 11.02 ? 28  ILE H CG2 1 
ATOM   1895 C CD1 . ILE B 2 28  ? -15.913 0.829   0.180   1.00 10.76 ? 28  ILE H CD1 1 
ATOM   1896 N N   . PHE B 2 29  ? -12.639 2.859   4.865   1.00 13.93 ? 29  PHE H N   1 
ATOM   1897 C CA  . PHE B 2 29  ? -11.913 2.609   6.120   1.00 13.05 ? 29  PHE H CA  1 
ATOM   1898 C C   . PHE B 2 29  ? -11.957 1.187   6.657   1.00 13.14 ? 29  PHE H C   1 
ATOM   1899 O O   . PHE B 2 29  ? -10.928 0.618   7.019   1.00 11.54 ? 29  PHE H O   1 
ATOM   1900 C CB  . PHE B 2 29  ? -12.412 3.609   7.187   1.00 14.36 ? 29  PHE H CB  1 
ATOM   1901 C CG  . PHE B 2 29  ? -11.765 3.470   8.567   1.00 14.09 ? 29  PHE H CG  1 
ATOM   1902 C CD1 . PHE B 2 29  ? -10.396 3.667   8.749   1.00 15.07 ? 29  PHE H CD1 1 
ATOM   1903 C CD2 . PHE B 2 29  ? -12.550 3.249   9.685   1.00 13.87 ? 29  PHE H CD2 1 
ATOM   1904 C CE1 . PHE B 2 29  ? -9.827  3.653   10.035  1.00 15.51 ? 29  PHE H CE1 1 
ATOM   1905 C CE2 . PHE B 2 29  ? -11.997 3.232   10.967  1.00 14.40 ? 29  PHE H CE2 1 
ATOM   1906 C CZ  . PHE B 2 29  ? -10.641 3.435   11.139  1.00 15.31 ? 29  PHE H CZ  1 
ATOM   1907 N N   . THR B 2 30  ? -13.157 0.627   6.702   1.00 13.58 ? 30  THR H N   1 
ATOM   1908 C CA  . THR B 2 30  ? -13.390 -0.702  7.229   1.00 13.53 ? 30  THR H CA  1 
ATOM   1909 C C   . THR B 2 30  ? -12.849 -1.848  6.385   1.00 12.41 ? 30  THR H C   1 
ATOM   1910 O O   . THR B 2 30  ? -12.787 -2.972  6.861   1.00 14.58 ? 30  THR H O   1 
ATOM   1911 C CB  . THR B 2 30  ? -14.917 -0.896  7.520   1.00 14.27 ? 30  THR H CB  1 
ATOM   1912 O OG1 . THR B 2 30  ? -15.684 -0.620  6.338   1.00 15.54 ? 30  THR H OG1 1 
ATOM   1913 C CG2 . THR B 2 30  ? -15.361 0.084   8.612   1.00 13.45 ? 30  THR H CG2 1 
ATOM   1914 N N   . SER B 2 31  ? -12.383 -1.540  5.182   1.00 11.79 ? 31  SER H N   1 
ATOM   1915 C CA  . SER B 2 31  ? -11.867 -2.526  4.232   1.00 11.91 ? 31  SER H CA  1 
ATOM   1916 C C   . SER B 2 31  ? -10.386 -2.875  4.303   1.00 11.38 ? 31  SER H C   1 
ATOM   1917 O O   . SER B 2 31  ? -9.956  -3.789  3.622   1.00 11.34 ? 31  SER H O   1 
ATOM   1918 C CB  . SER B 2 31  ? -12.070 -2.015  2.807   1.00 12.83 ? 31  SER H CB  1 
ATOM   1919 O OG  . SER B 2 31  ? -13.407 -2.076  2.391   1.00 16.21 ? 31  SER H OG  1 
ATOM   1920 N N   . TYR B 2 32  ? -9.576  -2.067  4.977   1.00 11.01 ? 32  TYR H N   1 
ATOM   1921 C CA  . TYR B 2 32  ? -8.139  -2.334  5.024   1.00 10.17 ? 32  TYR H CA  1 
ATOM   1922 C C   . TYR B 2 32  ? -7.523  -2.333  6.403   1.00 9.72  ? 32  TYR H C   1 
ATOM   1923 O O   . TYR B 2 32  ? -7.981  -1.605  7.282   1.00 9.13  ? 32  TYR H O   1 
ATOM   1924 C CB  . TYR B 2 32  ? -7.405  -1.285  4.220   1.00 10.30 ? 32  TYR H CB  1 
ATOM   1925 C CG  . TYR B 2 32  ? -7.682  -1.310  2.762   1.00 10.78 ? 32  TYR H CG  1 
ATOM   1926 C CD1 . TYR B 2 32  ? -6.888  -2.078  1.905   1.00 12.16 ? 32  TYR H CD1 1 
ATOM   1927 C CD2 . TYR B 2 32  ? -8.684  -0.518  2.212   1.00 11.55 ? 32  TYR H CD2 1 
ATOM   1928 C CE1 . TYR B 2 32  ? -7.078  -2.055  0.532   1.00 12.75 ? 32  TYR H CE1 1 
ATOM   1929 C CE2 . TYR B 2 32  ? -8.889  -0.491  0.830   1.00 12.41 ? 32  TYR H CE2 1 
ATOM   1930 C CZ  . TYR B 2 32  ? -8.080  -1.263  0.003   1.00 13.29 ? 32  TYR H CZ  1 
ATOM   1931 O OH  . TYR B 2 32  ? -8.277  -1.272  -1.360  1.00 16.34 ? 32  TYR H OH  1 
ATOM   1932 N N   . TRP B 2 33  ? -6.463  -3.122  6.569   1.00 10.48 ? 33  TRP H N   1 
ATOM   1933 C CA  . TRP B 2 33  ? -5.715  -3.168  7.841   1.00 10.75 ? 33  TRP H CA  1 
ATOM   1934 C C   . TRP B 2 33  ? -4.833  -1.923  7.955   1.00 10.27 ? 33  TRP H C   1 
ATOM   1935 O O   . TRP B 2 33  ? -4.292  -1.425  6.950   1.00 8.81  ? 33  TRP H O   1 
ATOM   1936 C CB  . TRP B 2 33  ? -4.788  -4.409  7.959   1.00 10.19 ? 33  TRP H CB  1 
ATOM   1937 C CG  . TRP B 2 33  ? -5.497  -5.744  8.100   1.00 10.20 ? 33  TRP H CG  1 
ATOM   1938 C CD1 . TRP B 2 33  ? -5.990  -6.512  7.081   1.00 9.98  ? 33  TRP H CD1 1 
ATOM   1939 C CD2 . TRP B 2 33  ? -5.797  -6.453  9.321   1.00 8.56  ? 33  TRP H CD2 1 
ATOM   1940 N NE1 . TRP B 2 33  ? -6.579  -7.653  7.596   1.00 9.55  ? 33  TRP H NE1 1 
ATOM   1941 C CE2 . TRP B 2 33  ? -6.471  -7.641  8.964   1.00 9.34  ? 33  TRP H CE2 1 
ATOM   1942 C CE3 . TRP B 2 33  ? -5.565  -6.199  10.672  1.00 8.99  ? 33  TRP H CE3 1 
ATOM   1943 C CZ2 . TRP B 2 33  ? -6.916  -8.578  9.917   1.00 9.11  ? 33  TRP H CZ2 1 
ATOM   1944 C CZ3 . TRP B 2 33  ? -6.011  -7.137  11.631  1.00 9.36  ? 33  TRP H CZ3 1 
ATOM   1945 C CH2 . TRP B 2 33  ? -6.675  -8.306  11.245  1.00 9.00  ? 33  TRP H CH2 1 
ATOM   1946 N N   . ILE B 2 34  ? -4.759  -1.395  9.170   1.00 10.10 ? 34  ILE H N   1 
ATOM   1947 C CA  . ILE B 2 34  ? -3.922  -0.251  9.491   1.00 10.36 ? 34  ILE H CA  1 
ATOM   1948 C C   . ILE B 2 34  ? -2.851  -0.847  10.403  1.00 9.60  ? 34  ILE H C   1 
ATOM   1949 O O   . ILE B 2 34  ? -3.169  -1.651  11.279  1.00 9.70  ? 34  ILE H O   1 
ATOM   1950 C CB  . ILE B 2 34  ? -4.702  0.826   10.281  1.00 10.96 ? 34  ILE H CB  1 
ATOM   1951 C CG1 . ILE B 2 34  ? -5.858  1.346   9.434   1.00 10.54 ? 34  ILE H CG1 1 
ATOM   1952 C CG2 . ILE B 2 34  ? -3.762  2.033   10.681  1.00 11.20 ? 34  ILE H CG2 1 
ATOM   1953 C CD1 . ILE B 2 34  ? -5.470  2.560   8.596   1.00 11.93 ? 34  ILE H CD1 1 
ATOM   1954 N N   . HIS B 2 35  ? -1.585  -0.544  10.113  1.00 8.60  ? 35  HIS H N   1 
ATOM   1955 C CA  . HIS B 2 35  ? -0.449  -1.025  10.903  1.00 7.52  ? 35  HIS H CA  1 
ATOM   1956 C C   . HIS B 2 35  ? 0.218   0.136   11.601  1.00 7.22  ? 35  HIS H C   1 
ATOM   1957 O O   . HIS B 2 35  ? 0.116   1.272   11.157  1.00 6.95  ? 35  HIS H O   1 
ATOM   1958 C CB  . HIS B 2 35  ? 0.622   -1.703  10.033  1.00 6.83  ? 35  HIS H CB  1 
ATOM   1959 C CG  . HIS B 2 35  ? 0.133   -2.900  9.288   1.00 5.76  ? 35  HIS H CG  1 
ATOM   1960 N ND1 . HIS B 2 35  ? 0.622   -4.171  9.507   1.00 5.80  ? 35  HIS H ND1 1 
ATOM   1961 C CD2 . HIS B 2 35  ? -0.799  -3.019  8.310   1.00 5.61  ? 35  HIS H CD2 1 
ATOM   1962 C CE1 . HIS B 2 35  ? 0.013   -5.016  8.696   1.00 5.70  ? 35  HIS H CE1 1 
ATOM   1963 N NE2 . HIS B 2 35  ? -0.856  -4.340  7.963   1.00 6.15  ? 35  HIS H NE2 1 
ATOM   1964 N N   . TRP B 2 36  ? 0.877   -0.146  12.718  1.00 7.79  ? 36  TRP H N   1 
ATOM   1965 C CA  . TRP B 2 36  ? 1.610   0.885   13.439  1.00 8.40  ? 36  TRP H CA  1 
ATOM   1966 C C   . TRP B 2 36  ? 3.075   0.484   13.477  1.00 8.21  ? 36  TRP H C   1 
ATOM   1967 O O   . TRP B 2 36  ? 3.393   -0.684  13.735  1.00 5.98  ? 36  TRP H O   1 
ATOM   1968 C CB  . TRP B 2 36  ? 1.033   1.108   14.824  1.00 7.54  ? 36  TRP H CB  1 
ATOM   1969 C CG  . TRP B 2 36  ? -0.249  1.831   14.734  1.00 7.66  ? 36  TRP H CG  1 
ATOM   1970 C CD1 . TRP B 2 36  ? -1.482  1.283   14.490  1.00 8.22  ? 36  TRP H CD1 1 
ATOM   1971 C CD2 . TRP B 2 36  ? -0.463  3.233   14.921  1.00 8.27  ? 36  TRP H CD2 1 
ATOM   1972 N NE1 . TRP B 2 36  ? -2.451  2.255   14.528  1.00 8.02  ? 36  TRP H NE1 1 
ATOM   1973 C CE2 . TRP B 2 36  ? -1.861  3.465   14.788  1.00 8.15  ? 36  TRP H CE2 1 
ATOM   1974 C CE3 . TRP B 2 36  ? 0.386   4.322   15.205  1.00 9.18  ? 36  TRP H CE3 1 
ATOM   1975 C CZ2 . TRP B 2 36  ? -2.439  4.742   14.928  1.00 7.50  ? 36  TRP H CZ2 1 
ATOM   1976 C CZ3 . TRP B 2 36  ? -0.185  5.594   15.347  1.00 8.29  ? 36  TRP H CZ3 1 
ATOM   1977 C CH2 . TRP B 2 36  ? -1.597  5.788   15.206  1.00 8.05  ? 36  TRP H CH2 1 
ATOM   1978 N N   . VAL B 2 37  ? 3.935   1.427   13.084  1.00 9.38  ? 37  VAL H N   1 
ATOM   1979 C CA  . VAL B 2 37  ? 5.382   1.223   13.017  1.00 9.38  ? 37  VAL H CA  1 
ATOM   1980 C C   . VAL B 2 37  ? 6.137   2.258   13.849  1.00 11.32 ? 37  VAL H C   1 
ATOM   1981 O O   . VAL B 2 37  ? 5.777   3.439   13.889  1.00 11.44 ? 37  VAL H O   1 
ATOM   1982 C CB  . VAL B 2 37  ? 5.865   1.268   11.550  1.00 8.86  ? 37  VAL H CB  1 
ATOM   1983 C CG1 . VAL B 2 37  ? 7.383   1.320   11.470  1.00 8.84  ? 37  VAL H CG1 1 
ATOM   1984 C CG2 . VAL B 2 37  ? 5.360   0.047   10.832  1.00 8.28  ? 37  VAL H CG2 1 
ATOM   1985 N N   . LYS B 2 38  ? 7.187   1.807   14.518  1.00 11.86 ? 38  LYS H N   1 
ATOM   1986 C CA  . LYS B 2 38  ? 7.983   2.680   15.349  1.00 13.28 ? 38  LYS H CA  1 
ATOM   1987 C C   . LYS B 2 38  ? 9.365   2.962   14.752  1.00 13.69 ? 38  LYS H C   1 
ATOM   1988 O O   . LYS B 2 38  ? 10.050  2.067   14.254  1.00 12.11 ? 38  LYS H O   1 
ATOM   1989 C CB  . LYS B 2 38  ? 8.170   2.038   16.723  1.00 13.26 ? 38  LYS H CB  1 
ATOM   1990 C CG  . LYS B 2 38  ? 9.025   2.831   17.650  1.00 14.46 ? 38  LYS H CG  1 
ATOM   1991 C CD  . LYS B 2 38  ? 9.423   1.997   18.832  1.00 15.59 ? 38  LYS H CD  1 
ATOM   1992 C CE  . LYS B 2 38  ? 10.173  2.847   19.840  1.00 16.87 ? 38  LYS H CE  1 
ATOM   1993 N NZ  . LYS B 2 38  ? 10.455  2.074   21.076  1.00 18.16 ? 38  LYS H NZ  1 
ATOM   1994 N N   . GLN B 2 39  ? 9.784   4.209   14.831  1.00 15.04 ? 39  GLN H N   1 
ATOM   1995 C CA  . GLN B 2 39  ? 11.103  4.534   14.354  1.00 17.83 ? 39  GLN H CA  1 
ATOM   1996 C C   . GLN B 2 39  ? 11.854  5.352   15.399  1.00 19.72 ? 39  GLN H C   1 
ATOM   1997 O O   . GLN B 2 39  ? 11.481  6.489   15.699  1.00 19.03 ? 39  GLN H O   1 
ATOM   1998 C CB  . GLN B 2 39  ? 11.073  5.273   13.022  1.00 17.35 ? 39  GLN H CB  1 
ATOM   1999 C CG  . GLN B 2 39  ? 12.503  5.501   12.579  1.00 18.48 ? 39  GLN H CG  1 
ATOM   2000 C CD  . GLN B 2 39  ? 12.615  6.068   11.233  1.00 18.49 ? 39  GLN H CD  1 
ATOM   2001 O OE1 . GLN B 2 39  ? 12.082  7.142   10.968  1.00 18.49 ? 39  GLN H OE1 1 
ATOM   2002 N NE2 . GLN B 2 39  ? 13.317  5.357   10.346  1.00 18.53 ? 39  GLN H NE2 1 
ATOM   2003 N N   . ARG B 2 40  ? 12.900  4.768   15.969  1.00 23.74 ? 40  ARG H N   1 
ATOM   2004 C CA  . ARG B 2 40  ? 13.688  5.474   16.972  1.00 29.78 ? 40  ARG H CA  1 
ATOM   2005 C C   . ARG B 2 40  ? 14.935  5.971   16.257  1.00 32.60 ? 40  ARG H C   1 
ATOM   2006 O O   . ARG B 2 40  ? 15.449  5.256   15.416  1.00 33.83 ? 40  ARG H O   1 
ATOM   2007 C CB  . ARG B 2 40  ? 14.039  4.526   18.105  1.00 31.43 ? 40  ARG H CB  1 
ATOM   2008 C CG  . ARG B 2 40  ? 14.412  5.210   19.402  1.00 33.97 ? 40  ARG H CG  1 
ATOM   2009 C CD  . ARG B 2 40  ? 14.089  4.326   20.624  1.00 35.56 ? 40  ARG H CD  1 
ATOM   2010 N NE  . ARG B 2 40  ? 15.176  4.394   21.597  1.00 37.92 ? 40  ARG H NE  1 
ATOM   2011 C CZ  . ARG B 2 40  ? 15.452  5.453   22.362  1.00 39.26 ? 40  ARG H CZ  1 
ATOM   2012 N NH1 . ARG B 2 40  ? 14.701  6.558   22.306  1.00 39.38 ? 40  ARG H NH1 1 
ATOM   2013 N NH2 . ARG B 2 40  ? 16.555  5.445   23.114  1.00 39.98 ? 40  ARG H NH2 1 
ATOM   2014 N N   . ALA B 2 41  ? 15.340  7.224   16.490  1.00 37.27 ? 41  ALA H N   1 
ATOM   2015 C CA  . ALA B 2 41  ? 16.544  7.813   15.842  1.00 40.69 ? 41  ALA H CA  1 
ATOM   2016 C C   . ALA B 2 41  ? 17.720  6.862   15.993  1.00 41.89 ? 41  ALA H C   1 
ATOM   2017 O O   . ALA B 2 41  ? 18.519  6.957   16.932  1.00 42.64 ? 41  ALA H O   1 
ATOM   2018 C CB  . ALA B 2 41  ? 16.890  9.167   16.449  1.00 40.18 ? 41  ALA H CB  1 
ATOM   2019 N N   . ALA B 2 42  ? 17.772  5.921   15.064  1.00 43.41 ? 42  ALA H N   1 
ATOM   2020 C CA  . ALA B 2 42  ? 18.775  4.873   15.011  1.00 43.78 ? 42  ALA H CA  1 
ATOM   2021 C C   . ALA B 2 42  ? 18.431  4.090   13.748  1.00 43.68 ? 42  ALA H C   1 
ATOM   2022 O O   . ALA B 2 42  ? 18.515  2.857   13.741  1.00 44.20 ? 42  ALA H O   1 
ATOM   2023 C CB  . ALA B 2 42  ? 18.667  3.955   16.253  1.00 42.10 ? 42  ALA H CB  1 
ATOM   2024 N N   . ALA B 2 43  ? 17.950  4.797   12.719  1.00 43.11 ? 43  ALA H N   1 
ATOM   2025 C CA  . ALA B 2 43  ? 17.603  4.181   11.429  1.00 41.41 ? 43  ALA H CA  1 
ATOM   2026 C C   . ALA B 2 43  ? 16.914  2.829   11.607  1.00 38.85 ? 43  ALA H C   1 
ATOM   2027 O O   . ALA B 2 43  ? 17.089  1.922   10.788  1.00 39.86 ? 43  ALA H O   1 
ATOM   2028 C CB  . ALA B 2 43  ? 18.890  3.995   10.577  1.00 41.36 ? 43  ALA H CB  1 
ATOM   2029 N N   . GLY B 2 44  ? 16.184  2.672   12.699  1.00 34.41 ? 44  GLY H N   1 
ATOM   2030 C CA  . GLY B 2 44  ? 15.531  1.399   12.937  1.00 29.17 ? 44  GLY H CA  1 
ATOM   2031 C C   . GLY B 2 44  ? 14.025  1.456   12.839  1.00 24.81 ? 44  GLY H C   1 
ATOM   2032 O O   . GLY B 2 44  ? 13.402  2.405   13.323  1.00 24.40 ? 44  GLY H O   1 
ATOM   2033 N N   . LEU B 2 45  ? 13.442  0.461   12.185  1.00 20.66 ? 45  LEU H N   1 
ATOM   2034 C CA  . LEU B 2 45  ? 12.001  0.366   12.038  1.00 17.76 ? 45  LEU H CA  1 
ATOM   2035 C C   . LEU B 2 45  ? 11.537  -0.867  12.787  1.00 16.88 ? 45  LEU H C   1 
ATOM   2036 O O   . LEU B 2 45  ? 12.213  -1.917  12.753  1.00 16.16 ? 45  LEU H O   1 
ATOM   2037 C CB  . LEU B 2 45  ? 11.599  0.292   10.565  1.00 15.87 ? 45  LEU H CB  1 
ATOM   2038 C CG  . LEU B 2 45  ? 11.702  1.606   9.773   1.00 14.85 ? 45  LEU H CG  1 
ATOM   2039 C CD1 . LEU B 2 45  ? 11.560  1.263   8.325   1.00 14.76 ? 45  LEU H CD1 1 
ATOM   2040 C CD2 . LEU B 2 45  ? 10.670  2.643   10.189  1.00 12.49 ? 45  LEU H CD2 1 
ATOM   2041 N N   . GLU B 2 46  ? 10.426  -0.730  13.513  1.00 15.96 ? 46  GLU H N   1 
ATOM   2042 C CA  . GLU B 2 46  ? 9.874   -1.842  14.278  1.00 14.84 ? 46  GLU H CA  1 
ATOM   2043 C C   . GLU B 2 46  ? 8.390   -1.936  14.136  1.00 12.88 ? 46  GLU H C   1 
ATOM   2044 O O   . GLU B 2 46  ? 7.696   -0.938  14.326  1.00 11.31 ? 46  GLU H O   1 
ATOM   2045 C CB  . GLU B 2 46  ? 10.180  -1.674  15.752  1.00 17.36 ? 46  GLU H CB  1 
ATOM   2046 C CG  . GLU B 2 46  ? 10.386  -3.010  16.409  1.00 20.75 ? 46  GLU H CG  1 
ATOM   2047 C CD  . GLU B 2 46  ? 10.788  -2.909  17.847  1.00 23.05 ? 46  GLU H CD  1 
ATOM   2048 O OE1 . GLU B 2 46  ? 11.510  -1.945  18.233  1.00 23.50 ? 46  GLU H OE1 1 
ATOM   2049 O OE2 . GLU B 2 46  ? 10.360  -3.822  18.583  1.00 25.29 ? 46  GLU H OE2 1 
ATOM   2050 N N   . TRP B 2 47  ? 7.904   -3.147  13.885  1.00 11.54 ? 47  TRP H N   1 
ATOM   2051 C CA  . TRP B 2 47  ? 6.474   -3.385  13.708  1.00 10.62 ? 47  TRP H CA  1 
ATOM   2052 C C   . TRP B 2 47  ? 5.799   -3.642  15.050  1.00 10.97 ? 47  TRP H C   1 
ATOM   2053 O O   . TRP B 2 47  ? 6.186   -4.541  15.801  1.00 10.53 ? 47  TRP H O   1 
ATOM   2054 C CB  . TRP B 2 47  ? 6.232   -4.539  12.723  1.00 10.58 ? 47  TRP H CB  1 
ATOM   2055 C CG  . TRP B 2 47  ? 4.776   -4.776  12.428  1.00 10.24 ? 47  TRP H CG  1 
ATOM   2056 C CD1 . TRP B 2 47  ? 3.998   -4.101  11.522  1.00 9.59  ? 47  TRP H CD1 1 
ATOM   2057 C CD2 . TRP B 2 47  ? 3.904   -5.715  13.088  1.00 9.70  ? 47  TRP H CD2 1 
ATOM   2058 N NE1 . TRP B 2 47  ? 2.692   -4.550  11.592  1.00 9.34  ? 47  TRP H NE1 1 
ATOM   2059 C CE2 . TRP B 2 47  ? 2.610   -5.544  12.536  1.00 10.36 ? 47  TRP H CE2 1 
ATOM   2060 C CE3 . TRP B 2 47  ? 4.093   -6.676  14.101  1.00 8.73  ? 47  TRP H CE3 1 
ATOM   2061 C CZ2 . TRP B 2 47  ? 1.500   -6.307  12.970  1.00 10.72 ? 47  TRP H CZ2 1 
ATOM   2062 C CZ3 . TRP B 2 47  ? 3.009   -7.420  14.531  1.00 8.80  ? 47  TRP H CZ3 1 
ATOM   2063 C CH2 . TRP B 2 47  ? 1.720   -7.235  13.969  1.00 9.55  ? 47  TRP H CH2 1 
ATOM   2064 N N   . ILE B 2 48  ? 4.793   -2.825  15.347  1.00 10.97 ? 48  ILE H N   1 
ATOM   2065 C CA  . ILE B 2 48  ? 4.064   -2.900  16.606  1.00 10.56 ? 48  ILE H CA  1 
ATOM   2066 C C   . ILE B 2 48  ? 2.794   -3.740  16.553  1.00 10.24 ? 48  ILE H C   1 
ATOM   2067 O O   . ILE B 2 48  ? 2.668   -4.718  17.297  1.00 9.85  ? 48  ILE H O   1 
ATOM   2068 C CB  . ILE B 2 48  ? 3.707   -1.483  17.106  1.00 10.37 ? 48  ILE H CB  1 
ATOM   2069 C CG1 . ILE B 2 48  ? 4.983   -0.686  17.394  1.00 8.79  ? 48  ILE H CG1 1 
ATOM   2070 C CG2 . ILE B 2 48  ? 2.814   -1.560  18.337  1.00 10.18 ? 48  ILE H CG2 1 
ATOM   2071 C CD1 . ILE B 2 48  ? 4.765   0.800   17.408  1.00 7.99  ? 48  ILE H CD1 1 
ATOM   2072 N N   . ALA B 2 49  ? 1.856   -3.365  15.683  1.00 10.04 ? 49  ALA H N   1 
ATOM   2073 C CA  . ALA B 2 49  ? 0.582   -4.077  15.577  1.00 9.37  ? 49  ALA H CA  1 
ATOM   2074 C C   . ALA B 2 49  ? -0.265  -3.596  14.407  1.00 9.39  ? 49  ALA H C   1 
ATOM   2075 O O   . ALA B 2 49  ? 0.023   -2.566  13.795  1.00 10.08 ? 49  ALA H O   1 
ATOM   2076 C CB  . ALA B 2 49  ? -0.192  -3.903  16.870  1.00 8.91  ? 49  ALA H CB  1 
ATOM   2077 N N   . ARG B 2 50  ? -1.326  -4.344  14.123  1.00 9.67  ? 50  ARG H N   1 
ATOM   2078 C CA  . ARG B 2 50  ? -2.266  -4.036  13.053  1.00 9.77  ? 50  ARG H CA  1 
ATOM   2079 C C   . ARG B 2 50  ? -3.698  -4.239  13.534  1.00 10.41 ? 50  ARG H C   1 
ATOM   2080 O O   . ARG B 2 50  ? -3.950  -5.044  14.439  1.00 9.62  ? 50  ARG H O   1 
ATOM   2081 C CB  . ARG B 2 50  ? -2.010  -4.941  11.853  1.00 10.83 ? 50  ARG H CB  1 
ATOM   2082 C CG  . ARG B 2 50  ? -2.250  -6.416  12.078  1.00 11.77 ? 50  ARG H CG  1 
ATOM   2083 C CD  . ARG B 2 50  ? -1.833  -7.156  10.841  1.00 12.90 ? 50  ARG H CD  1 
ATOM   2084 N NE  . ARG B 2 50  ? -2.548  -8.405  10.647  1.00 16.26 ? 50  ARG H NE  1 
ATOM   2085 C CZ  . ARG B 2 50  ? -2.105  -9.598  11.038  1.00 17.97 ? 50  ARG H CZ  1 
ATOM   2086 N NH1 . ARG B 2 50  ? -0.934  -9.727  11.670  1.00 18.47 ? 50  ARG H NH1 1 
ATOM   2087 N NH2 . ARG B 2 50  ? -2.821  -10.675 10.745  1.00 18.17 ? 50  ARG H NH2 1 
ATOM   2088 N N   . ILE B 2 51  ? -4.629  -3.527  12.911  1.00 10.59 ? 51  ILE H N   1 
ATOM   2089 C CA  . ILE B 2 51  ? -6.041  -3.624  13.275  1.00 10.72 ? 51  ILE H CA  1 
ATOM   2090 C C   . ILE B 2 51  ? -6.914  -3.587  12.039  1.00 10.26 ? 51  ILE H C   1 
ATOM   2091 O O   . ILE B 2 51  ? -6.553  -2.921  11.076  1.00 9.60  ? 51  ILE H O   1 
ATOM   2092 C CB  . ILE B 2 51  ? -6.459  -2.480  14.226  1.00 10.74 ? 51  ILE H CB  1 
ATOM   2093 C CG1 . ILE B 2 51  ? -7.864  -2.728  14.766  1.00 11.49 ? 51  ILE H CG1 1 
ATOM   2094 C CG2 . ILE B 2 51  ? -6.379  -1.115  13.516  1.00 11.10 ? 51  ILE H CG2 1 
ATOM   2095 C CD1 . ILE B 2 51  ? -8.277  -1.782  15.852  1.00 11.41 ? 51  ILE H CD1 1 
ATOM   2096 N N   . TYR B 2 52  ? -7.994  -4.380  12.025  1.00 11.17 ? 52  TYR H N   1 
ATOM   2097 C CA  . TYR B 2 52  ? -8.944  -4.407  10.900  1.00 11.92 ? 52  TYR H CA  1 
ATOM   2098 C C   . TYR B 2 52  ? -10.132 -3.630  11.432  1.00 13.59 ? 52  TYR H C   1 
ATOM   2099 O O   . TYR B 2 52  ? -10.957 -4.186  12.147  1.00 14.28 ? 52  TYR H O   1 
ATOM   2100 C CB  . TYR B 2 52  ? -9.385  -5.815  10.593  1.00 11.60 ? 52  TYR H CB  1 
ATOM   2101 C CG  . TYR B 2 52  ? -10.104 -5.887  9.288   1.00 13.63 ? 52  TYR H CG  1 
ATOM   2102 C CD1 . TYR B 2 52  ? -9.437  -5.610  8.107   1.00 13.35 ? 52  TYR H CD1 1 
ATOM   2103 C CD2 . TYR B 2 52  ? -11.462 -6.217  9.226   1.00 14.58 ? 52  TYR H CD2 1 
ATOM   2104 C CE1 . TYR B 2 52  ? -10.093 -5.663  6.888   1.00 14.67 ? 52  TYR H CE1 1 
ATOM   2105 C CE2 . TYR B 2 52  ? -12.141 -6.270  8.007   1.00 14.56 ? 52  TYR H CE2 1 
ATOM   2106 C CZ  . TYR B 2 52  ? -11.447 -5.999  6.843   1.00 15.80 ? 52  TYR H CZ  1 
ATOM   2107 O OH  . TYR B 2 52  ? -12.076 -6.117  5.617   1.00 16.98 ? 52  TYR H OH  1 
ATOM   2108 N N   . PRO B 2 53  A -10.292 -2.367  11.010  1.00 14.50 ? 52  PRO H N   1 
ATOM   2109 C CA  . PRO B 2 53  A -11.394 -1.541  11.503  1.00 16.32 ? 52  PRO H CA  1 
ATOM   2110 C C   . PRO B 2 53  A -12.779 -2.100  11.272  1.00 18.02 ? 52  PRO H C   1 
ATOM   2111 O O   . PRO B 2 53  A -13.702 -1.755  11.983  1.00 18.93 ? 52  PRO H O   1 
ATOM   2112 C CB  . PRO B 2 53  A -11.171 -0.212  10.793  1.00 15.55 ? 52  PRO H CB  1 
ATOM   2113 C CG  . PRO B 2 53  A -9.687  -0.242  10.439  1.00 14.71 ? 52  PRO H CG  1 
ATOM   2114 C CD  . PRO B 2 53  A -9.530  -1.646  9.981   1.00 13.74 ? 52  PRO H CD  1 
ATOM   2115 N N   . GLY B 2 54  ? -12.916 -2.980  10.295  1.00 19.95 ? 53  GLY H N   1 
ATOM   2116 C CA  . GLY B 2 54  ? -14.212 -3.552  10.021  1.00 21.92 ? 53  GLY H CA  1 
ATOM   2117 C C   . GLY B 2 54  ? -14.723 -4.470  11.115  1.00 23.17 ? 53  GLY H C   1 
ATOM   2118 O O   . GLY B 2 54  ? -15.933 -4.610  11.280  1.00 24.34 ? 53  GLY H O   1 
ATOM   2119 N N   . THR B 2 55  ? -13.816 -5.113  11.844  1.00 22.90 ? 54  THR H N   1 
ATOM   2120 C CA  . THR B 2 55  ? -14.211 -6.035  12.893  1.00 22.41 ? 54  THR H CA  1 
ATOM   2121 C C   . THR B 2 55  ? -13.595 -5.699  14.226  1.00 22.76 ? 54  THR H C   1 
ATOM   2122 O O   . THR B 2 55  ? -14.004 -6.228  15.255  1.00 23.48 ? 54  THR H O   1 
ATOM   2123 C CB  . THR B 2 55  ? -13.757 -7.435  12.555  1.00 22.87 ? 54  THR H CB  1 
ATOM   2124 O OG1 . THR B 2 55  ? -12.358 -7.416  12.252  1.00 23.71 ? 54  THR H OG1 1 
ATOM   2125 C CG2 . THR B 2 55  ? -14.508 -7.963  11.352  1.00 23.12 ? 54  THR H CG2 1 
ATOM   2126 N N   . GLY B 2 56  ? -12.594 -4.831  14.213  1.00 22.59 ? 55  GLY H N   1 
ATOM   2127 C CA  . GLY B 2 56  ? -11.915 -4.485  15.442  1.00 21.27 ? 55  GLY H CA  1 
ATOM   2128 C C   . GLY B 2 56  ? -10.882 -5.540  15.771  1.00 21.16 ? 55  GLY H C   1 
ATOM   2129 O O   . GLY B 2 56  ? -10.296 -5.512  16.827  1.00 23.79 ? 55  GLY H O   1 
ATOM   2130 N N   . SER B 2 57  ? -10.663 -6.488  14.879  1.00 21.67 ? 56  SER H N   1 
ATOM   2131 C CA  . SER B 2 57  ? -9.671  -7.537  15.088  1.00 22.49 ? 56  SER H CA  1 
ATOM   2132 C C   . SER B 2 57  ? -8.242  -6.945  15.067  1.00 22.04 ? 56  SER H C   1 
ATOM   2133 O O   . SER B 2 57  ? -7.824  -6.350  14.075  1.00 22.02 ? 56  SER H O   1 
ATOM   2134 C CB  . SER B 2 57  ? -9.838  -8.580  13.989  1.00 23.73 ? 56  SER H CB  1 
ATOM   2135 O OG  . SER B 2 57  ? -8.788  -9.534  14.006  1.00 28.07 ? 56  SER H OG  1 
ATOM   2136 N N   . SER B 2 58  ? -7.494  -7.153  16.143  1.00 22.27 ? 57  SER H N   1 
ATOM   2137 C CA  . SER B 2 58  ? -6.137  -6.634  16.284  1.00 22.32 ? 57  SER H CA  1 
ATOM   2138 C C   . SER B 2 58  ? -5.079  -7.699  16.517  1.00 22.31 ? 57  SER H C   1 
ATOM   2139 O O   . SER B 2 58  ? -5.362  -8.710  17.149  1.00 21.95 ? 57  SER H O   1 
ATOM   2140 C CB  . SER B 2 58  ? -6.102  -5.661  17.453  1.00 22.73 ? 57  SER H CB  1 
ATOM   2141 O OG  . SER B 2 58  ? -6.984  -4.570  17.228  1.00 24.81 ? 57  SER H OG  1 
ATOM   2142 N N   . TYR B 2 59  ? -3.862  -7.459  16.011  1.00 22.36 ? 58  TYR H N   1 
ATOM   2143 C CA  . TYR B 2 59  ? -2.715  -8.370  16.193  1.00 21.44 ? 58  TYR H CA  1 
ATOM   2144 C C   . TYR B 2 59  ? -1.548  -7.589  16.766  1.00 19.31 ? 58  TYR H C   1 
ATOM   2145 O O   . TYR B 2 59  ? -1.218  -6.548  16.239  1.00 18.84 ? 58  TYR H O   1 
ATOM   2146 C CB  . TYR B 2 59  ? -2.319  -9.017  14.877  1.00 23.75 ? 58  TYR H CB  1 
ATOM   2147 C CG  . TYR B 2 59  ? -3.301  -10.066 14.489  1.00 26.73 ? 58  TYR H CG  1 
ATOM   2148 C CD1 . TYR B 2 59  ? -3.254  -11.332 15.069  1.00 28.24 ? 58  TYR H CD1 1 
ATOM   2149 C CD2 . TYR B 2 59  ? -4.336  -9.775  13.616  1.00 28.11 ? 58  TYR H CD2 1 
ATOM   2150 C CE1 . TYR B 2 59  ? -4.219  -12.276 14.795  1.00 29.73 ? 58  TYR H CE1 1 
ATOM   2151 C CE2 . TYR B 2 59  ? -5.307  -10.707 13.330  1.00 29.54 ? 58  TYR H CE2 1 
ATOM   2152 C CZ  . TYR B 2 59  ? -5.249  -11.958 13.919  1.00 30.61 ? 58  TYR H CZ  1 
ATOM   2153 O OH  . TYR B 2 59  ? -6.225  -12.905 13.623  1.00 32.78 ? 58  TYR H OH  1 
ATOM   2154 N N   . TYR B 2 60  ? -0.913  -8.103  17.818  1.00 17.34 ? 59  TYR H N   1 
ATOM   2155 C CA  . TYR B 2 60  ? 0.199   -7.415  18.476  1.00 15.94 ? 59  TYR H CA  1 
ATOM   2156 C C   . TYR B 2 60  ? 1.538   -8.127  18.473  1.00 17.08 ? 59  TYR H C   1 
ATOM   2157 O O   . TYR B 2 60  ? 1.624   -9.345  18.604  1.00 17.17 ? 59  TYR H O   1 
ATOM   2158 C CB  . TYR B 2 60  ? -0.150  -7.130  19.942  1.00 13.79 ? 59  TYR H CB  1 
ATOM   2159 C CG  . TYR B 2 60  ? -1.339  -6.220  20.129  1.00 13.64 ? 59  TYR H CG  1 
ATOM   2160 C CD1 . TYR B 2 60  ? -2.635  -6.733  20.169  1.00 12.86 ? 59  TYR H CD1 1 
ATOM   2161 C CD2 . TYR B 2 60  ? -1.175  -4.841  20.242  1.00 12.96 ? 59  TYR H CD2 1 
ATOM   2162 C CE1 . TYR B 2 60  ? -3.745  -5.900  20.313  1.00 12.37 ? 59  TYR H CE1 1 
ATOM   2163 C CE2 . TYR B 2 60  ? -2.284  -4.000  20.387  1.00 13.95 ? 59  TYR H CE2 1 
ATOM   2164 C CZ  . TYR B 2 60  ? -3.570  -4.540  20.425  1.00 12.99 ? 59  TYR H CZ  1 
ATOM   2165 O OH  . TYR B 2 60  ? -4.665  -3.714  20.601  1.00 11.97 ? 59  TYR H OH  1 
ATOM   2166 N N   . ASN B 2 61  ? 2.601   -7.347  18.342  1.00 19.12 ? 60  ASN H N   1 
ATOM   2167 C CA  . ASN B 2 61  ? 3.960   -7.876  18.420  1.00 19.45 ? 60  ASN H CA  1 
ATOM   2168 C C   . ASN B 2 61  ? 4.067   -8.091  19.945  1.00 20.58 ? 60  ASN H C   1 
ATOM   2169 O O   . ASN B 2 61  ? 3.758   -7.172  20.734  1.00 19.49 ? 60  ASN H O   1 
ATOM   2170 C CB  . ASN B 2 61  ? 4.949   -6.793  17.952  1.00 20.37 ? 60  ASN H CB  1 
ATOM   2171 C CG  . ASN B 2 61  ? 6.415   -7.179  18.153  1.00 20.70 ? 60  ASN H CG  1 
ATOM   2172 O OD1 . ASN B 2 61  ? 6.733   -8.227  18.707  1.00 22.11 ? 60  ASN H OD1 1 
ATOM   2173 N ND2 . ASN B 2 61  ? 7.310   -6.313  17.715  1.00 21.01 ? 60  ASN H ND2 1 
ATOM   2174 N N   . VAL B 2 62  ? 4.452   -9.290  20.374  1.00 21.08 ? 61  VAL H N   1 
ATOM   2175 C CA  . VAL B 2 62  ? 4.545   -9.552  21.806  1.00 21.42 ? 61  VAL H CA  1 
ATOM   2176 C C   . VAL B 2 62  ? 5.402   -8.557  22.561  1.00 21.30 ? 61  VAL H C   1 
ATOM   2177 O O   . VAL B 2 62  ? 5.131   -8.324  23.720  1.00 20.78 ? 61  VAL H O   1 
ATOM   2178 C CB  . VAL B 2 62  ? 5.032   -10.958 22.140  1.00 22.88 ? 61  VAL H CB  1 
ATOM   2179 C CG1 . VAL B 2 62  ? 4.403   -11.399 23.454  1.00 22.67 ? 61  VAL H CG1 1 
ATOM   2180 C CG2 . VAL B 2 62  ? 4.684   -11.928 21.028  1.00 24.11 ? 61  VAL H CG2 1 
ATOM   2181 N N   . LYS B 2 63  ? 6.432   -7.985  21.930  1.00 20.93 ? 62  LYS H N   1 
ATOM   2182 C CA  . LYS B 2 63  ? 7.263   -6.972  22.602  1.00 22.05 ? 62  LYS H CA  1 
ATOM   2183 C C   . LYS B 2 63  ? 6.405   -5.808  23.099  1.00 21.86 ? 62  LYS H C   1 
ATOM   2184 O O   . LYS B 2 63  ? 6.790   -5.106  24.035  1.00 22.80 ? 62  LYS H O   1 
ATOM   2185 C CB  . LYS B 2 63  ? 8.288   -6.344  21.650  1.00 23.51 ? 62  LYS H CB  1 
ATOM   2186 C CG  . LYS B 2 63  ? 9.526   -7.178  21.324  1.00 26.84 ? 62  LYS H CG  1 
ATOM   2187 C CD  . LYS B 2 63  ? 10.624  -6.332  20.608  1.00 26.67 ? 62  LYS H CD  1 
ATOM   2188 C CE  . LYS B 2 63  ? 10.941  -5.051  21.403  1.00 28.14 ? 62  LYS H CE  1 
ATOM   2189 N NZ  . LYS B 2 63  ? 12.051  -4.219  20.850  1.00 27.70 ? 62  LYS H NZ  1 
ATOM   2190 N N   . PHE B 2 64  ? 5.294   -5.545  22.408  1.00 20.56 ? 63  PHE H N   1 
ATOM   2191 C CA  . PHE B 2 64  ? 4.406   -4.442  22.761  1.00 19.95 ? 63  PHE H CA  1 
ATOM   2192 C C   . PHE B 2 64  ? 3.081   -4.824  23.398  1.00 21.04 ? 63  PHE H C   1 
ATOM   2193 O O   . PHE B 2 64  ? 2.248   -3.957  23.623  1.00 20.94 ? 63  PHE H O   1 
ATOM   2194 C CB  . PHE B 2 64  ? 4.133   -3.584  21.538  1.00 18.97 ? 63  PHE H CB  1 
ATOM   2195 C CG  . PHE B 2 64  ? 5.362   -3.013  20.941  1.00 18.69 ? 63  PHE H CG  1 
ATOM   2196 C CD1 . PHE B 2 64  ? 5.866   -1.803  21.403  1.00 18.36 ? 63  PHE H CD1 1 
ATOM   2197 C CD2 . PHE B 2 64  ? 6.082   -3.732  19.992  1.00 17.80 ? 63  PHE H CD2 1 
ATOM   2198 C CE1 . PHE B 2 64  ? 7.072   -1.331  20.933  1.00 17.92 ? 63  PHE H CE1 1 
ATOM   2199 C CE2 . PHE B 2 64  ? 7.286   -3.270  19.520  1.00 17.24 ? 63  PHE H CE2 1 
ATOM   2200 C CZ  . PHE B 2 64  ? 7.786   -2.072  19.989  1.00 18.04 ? 63  PHE H CZ  1 
ATOM   2201 N N   . LYS B 2 65  ? 2.868   -6.104  23.677  1.00 23.44 ? 64  LYS H N   1 
ATOM   2202 C CA  . LYS B 2 65  ? 1.624   -6.529  24.305  1.00 27.10 ? 64  LYS H CA  1 
ATOM   2203 C C   . LYS B 2 65  ? 1.571   -5.885  25.686  1.00 27.82 ? 64  LYS H C   1 
ATOM   2204 O O   . LYS B 2 65  ? 2.507   -6.038  26.469  1.00 29.63 ? 64  LYS H O   1 
ATOM   2205 C CB  . LYS B 2 65  ? 1.590   -8.046  24.448  1.00 28.94 ? 64  LYS H CB  1 
ATOM   2206 C CG  . LYS B 2 65  ? 0.333   -8.666  23.866  1.00 32.11 ? 64  LYS H CG  1 
ATOM   2207 C CD  . LYS B 2 65  ? 0.605   -10.080 23.333  1.00 34.17 ? 64  LYS H CD  1 
ATOM   2208 C CE  . LYS B 2 65  ? 1.309   -11.009 24.373  1.00 35.88 ? 64  LYS H CE  1 
ATOM   2209 N NZ  . LYS B 2 65  ? 0.502   -11.446 25.578  1.00 36.18 ? 64  LYS H NZ  1 
ATOM   2210 N N   . GLY B 2 66  ? 0.512   -5.129  25.967  1.00 27.52 ? 65  GLY H N   1 
ATOM   2211 C CA  . GLY B 2 66  ? 0.396   -4.465  27.260  1.00 27.37 ? 65  GLY H CA  1 
ATOM   2212 C C   . GLY B 2 66  ? 0.679   -2.982  27.139  1.00 26.98 ? 65  GLY H C   1 
ATOM   2213 O O   . GLY B 2 66  ? -0.047  -2.152  27.680  1.00 28.35 ? 65  GLY H O   1 
ATOM   2214 N N   . LYS B 2 67  ? 1.717   -2.678  26.365  1.00 25.47 ? 66  LYS H N   1 
ATOM   2215 C CA  . LYS B 2 67  ? 2.184   -1.334  26.082  1.00 23.10 ? 66  LYS H CA  1 
ATOM   2216 C C   . LYS B 2 67  ? 1.273   -0.597  25.098  1.00 22.23 ? 66  LYS H C   1 
ATOM   2217 O O   . LYS B 2 67  ? 0.987   0.586   25.269  1.00 22.43 ? 66  LYS H O   1 
ATOM   2218 C CB  . LYS B 2 67  ? 3.569   -1.447  25.451  1.00 22.77 ? 66  LYS H CB  1 
ATOM   2219 C CG  . LYS B 2 67  ? 4.299   -0.143  25.267  1.00 22.79 ? 66  LYS H CG  1 
ATOM   2220 C CD  . LYS B 2 67  ? 4.982   0.194   26.537  1.00 22.97 ? 66  LYS H CD  1 
ATOM   2221 C CE  . LYS B 2 67  ? 5.758   1.443   26.420  1.00 22.14 ? 66  LYS H CE  1 
ATOM   2222 N NZ  . LYS B 2 67  ? 6.326   1.683   27.760  1.00 22.99 ? 66  LYS H NZ  1 
ATOM   2223 N N   . ALA B 2 68  ? 0.913   -1.273  24.013  1.00 20.82 ? 67  ALA H N   1 
ATOM   2224 C CA  . ALA B 2 68  ? 0.075   -0.673  22.982  1.00 20.00 ? 67  ALA H CA  1 
ATOM   2225 C C   . ALA B 2 68  ? -1.342  -1.209  22.979  1.00 19.34 ? 67  ALA H C   1 
ATOM   2226 O O   . ALA B 2 68  ? -1.582  -2.368  23.304  1.00 19.91 ? 67  ALA H O   1 
ATOM   2227 C CB  . ALA B 2 68  ? 0.691   -0.910  21.620  1.00 19.10 ? 67  ALA H CB  1 
ATOM   2228 N N   . THR B 2 69  ? -2.271  -0.378  22.537  1.00 18.01 ? 68  THR H N   1 
ATOM   2229 C CA  . THR B 2 69  ? -3.659  -0.788  22.428  1.00 16.24 ? 68  THR H CA  1 
ATOM   2230 C C   . THR B 2 69  ? -4.264  -0.083  21.227  1.00 13.89 ? 68  THR H C   1 
ATOM   2231 O O   . THR B 2 69  ? -4.382  1.142   21.195  1.00 13.13 ? 68  THR H O   1 
ATOM   2232 C CB  . THR B 2 69  ? -4.464  -0.456  23.715  1.00 18.27 ? 68  THR H CB  1 
ATOM   2233 O OG1 . THR B 2 69  ? -3.833  -1.081  24.843  1.00 20.24 ? 68  THR H OG1 1 
ATOM   2234 C CG2 . THR B 2 69  ? -5.918  -0.969  23.603  1.00 18.70 ? 68  THR H CG2 1 
ATOM   2235 N N   . LEU B 2 70  ? -4.641  -0.856  20.227  1.00 12.50 ? 69  LEU H N   1 
ATOM   2236 C CA  . LEU B 2 70  ? -5.238  -0.268  19.051  1.00 11.83 ? 69  LEU H CA  1 
ATOM   2237 C C   . LEU B 2 70  ? -6.763  -0.226  19.167  1.00 12.63 ? 69  LEU H C   1 
ATOM   2238 O O   . LEU B 2 70  ? -7.371  -1.113  19.755  1.00 11.19 ? 69  LEU H O   1 
ATOM   2239 C CB  . LEU B 2 70  ? -4.827  -1.059  17.788  1.00 10.59 ? 69  LEU H CB  1 
ATOM   2240 C CG  . LEU B 2 70  ? -3.343  -1.337  17.481  1.00 9.22  ? 69  LEU H CG  1 
ATOM   2241 C CD1 . LEU B 2 70  ? -3.210  -1.775  16.036  1.00 6.76  ? 69  LEU H CD1 1 
ATOM   2242 C CD2 . LEU B 2 70  ? -2.497  -0.086  17.733  1.00 8.44  ? 69  LEU H CD2 1 
ATOM   2243 N N   . THR B 2 71  ? -7.355  0.863   18.692  1.00 14.14 ? 70  THR H N   1 
ATOM   2244 C CA  . THR B 2 71  ? -8.811  1.030   18.630  1.00 14.80 ? 70  THR H CA  1 
ATOM   2245 C C   . THR B 2 71  ? -9.078  1.747   17.309  1.00 16.33 ? 70  THR H C   1 
ATOM   2246 O O   . THR B 2 71  ? -8.166  2.344   16.716  1.00 15.60 ? 70  THR H O   1 
ATOM   2247 C CB  . THR B 2 71  ? -9.420  1.861   19.770  1.00 14.96 ? 70  THR H CB  1 
ATOM   2248 O OG1 . THR B 2 71  ? -8.746  3.117   19.905  1.00 15.41 ? 70  THR H OG1 1 
ATOM   2249 C CG2 . THR B 2 71  ? -9.337  1.102   21.071  1.00 15.94 ? 70  THR H CG2 1 
ATOM   2250 N N   . ALA B 2 72  ? -10.317 1.677   16.840  1.00 17.40 ? 71  ALA H N   1 
ATOM   2251 C CA  . ALA B 2 72  ? -10.693 2.313   15.584  1.00 19.62 ? 71  ALA H CA  1 
ATOM   2252 C C   . ALA B 2 72  ? -12.104 2.891   15.705  1.00 20.92 ? 71  ALA H C   1 
ATOM   2253 O O   . ALA B 2 72  ? -13.003 2.262   16.285  1.00 22.64 ? 71  ALA H O   1 
ATOM   2254 C CB  . ALA B 2 72  ? -10.626 1.281   14.427  1.00 18.68 ? 71  ALA H CB  1 
ATOM   2255 N N   . ASP B 2 73  ? -12.286 4.108   15.217  1.00 21.86 ? 72  ASP H N   1 
ATOM   2256 C CA  . ASP B 2 73  ? -13.598 4.724   15.254  1.00 22.35 ? 72  ASP H CA  1 
ATOM   2257 C C   . ASP B 2 73  ? -14.193 4.749   13.849  1.00 22.18 ? 72  ASP H C   1 
ATOM   2258 O O   . ASP B 2 73  ? -13.872 5.624   13.044  1.00 20.01 ? 72  ASP H O   1 
ATOM   2259 C CB  . ASP B 2 73  ? -13.528 6.141   15.801  1.00 24.25 ? 72  ASP H CB  1 
ATOM   2260 C CG  . ASP B 2 73  ? -14.900 6.797   15.871  1.00 26.15 ? 72  ASP H CG  1 
ATOM   2261 O OD1 . ASP B 2 73  ? -15.923 6.074   15.818  1.00 25.22 ? 72  ASP H OD1 1 
ATOM   2262 O OD2 . ASP B 2 73  ? -14.955 8.043   15.980  1.00 28.24 ? 72  ASP H OD2 1 
ATOM   2263 N N   . LYS B 2 74  ? -15.077 3.799   13.574  1.00 23.31 ? 73  LYS H N   1 
ATOM   2264 C CA  . LYS B 2 74  ? -15.712 3.709   12.273  1.00 25.63 ? 73  LYS H CA  1 
ATOM   2265 C C   . LYS B 2 74  ? -16.449 4.952   11.789  1.00 26.11 ? 73  LYS H C   1 
ATOM   2266 O O   . LYS B 2 74  ? -16.420 5.255   10.596  1.00 27.26 ? 73  LYS H O   1 
ATOM   2267 C CB  . LYS B 2 74  ? -16.601 2.482   12.209  1.00 26.94 ? 73  LYS H CB  1 
ATOM   2268 C CG  . LYS B 2 74  ? -15.780 1.215   12.220  1.00 29.27 ? 73  LYS H CG  1 
ATOM   2269 C CD  . LYS B 2 74  ? -16.623 -0.027  11.914  1.00 30.99 ? 73  LYS H CD  1 
ATOM   2270 C CE  . LYS B 2 74  ? -17.406 -0.516  13.124  1.00 32.04 ? 73  LYS H CE  1 
ATOM   2271 N NZ  . LYS B 2 74  ? -17.735 -1.982  13.036  1.00 33.22 ? 73  LYS H NZ  1 
ATOM   2272 N N   . SER B 2 75  ? -17.066 5.699   12.699  1.00 26.31 ? 74  SER H N   1 
ATOM   2273 C CA  . SER B 2 75  ? -17.779 6.901   12.292  1.00 27.41 ? 74  SER H CA  1 
ATOM   2274 C C   . SER B 2 75  ? -16.851 8.012   11.780  1.00 27.56 ? 74  SER H C   1 
ATOM   2275 O O   . SER B 2 75  ? -17.093 8.587   10.713  1.00 29.28 ? 74  SER H O   1 
ATOM   2276 C CB  . SER B 2 75  ? -18.665 7.417   13.420  1.00 27.86 ? 74  SER H CB  1 
ATOM   2277 O OG  . SER B 2 75  ? -17.900 7.809   14.537  1.00 30.58 ? 74  SER H OG  1 
ATOM   2278 N N   . SER B 2 76  ? -15.763 8.271   12.496  1.00 26.14 ? 75  SER H N   1 
ATOM   2279 C CA  . SER B 2 76  ? -14.830 9.307   12.088  1.00 24.22 ? 75  SER H CA  1 
ATOM   2280 C C   . SER B 2 76  ? -13.672 8.813   11.214  1.00 23.56 ? 75  SER H C   1 
ATOM   2281 O O   . SER B 2 76  ? -12.812 9.612   10.815  1.00 23.83 ? 75  SER H O   1 
ATOM   2282 C CB  . SER B 2 76  ? -14.273 9.989   13.321  1.00 25.47 ? 75  SER H CB  1 
ATOM   2283 O OG  . SER B 2 76  ? -13.557 9.051   14.117  1.00 27.94 ? 75  SER H OG  1 
ATOM   2284 N N   . SER B 2 77  ? -13.616 7.505   10.953  1.00 21.51 ? 76  SER H N   1 
ATOM   2285 C CA  . SER B 2 77  ? -12.546 6.912   10.120  1.00 19.81 ? 76  SER H CA  1 
ATOM   2286 C C   . SER B 2 77  ? -11.155 7.174   10.686  1.00 17.36 ? 76  SER H C   1 
ATOM   2287 O O   . SER B 2 77  ? -10.201 7.399   9.951   1.00 17.17 ? 76  SER H O   1 
ATOM   2288 C CB  . SER B 2 77  ? -12.616 7.441   8.676   1.00 19.11 ? 76  SER H CB  1 
ATOM   2289 O OG  . SER B 2 77  ? -13.704 6.864   7.972   1.00 20.48 ? 76  SER H OG  1 
ATOM   2290 N N   . THR B 2 78  ? -11.049 7.090   12.003  1.00 16.73 ? 77  THR H N   1 
ATOM   2291 C CA  . THR B 2 78  ? -9.810  7.352   12.707  1.00 14.75 ? 77  THR H CA  1 
ATOM   2292 C C   . THR B 2 78  ? -9.370  6.128   13.475  1.00 13.78 ? 77  THR H C   1 
ATOM   2293 O O   . THR B 2 78  ? -10.183 5.502   14.180  1.00 13.72 ? 77  THR H O   1 
ATOM   2294 C CB  . THR B 2 78  ? -9.992  8.541   13.696  1.00 15.24 ? 77  THR H CB  1 
ATOM   2295 O OG1 . THR B 2 78  ? -10.510 9.677   12.983  1.00 16.54 ? 77  THR H OG1 1 
ATOM   2296 C CG2 . THR B 2 78  ? -8.664  8.945   14.322  1.00 15.63 ? 77  THR H CG2 1 
ATOM   2297 N N   . ALA B 2 79  ? -8.112  5.735   13.283  1.00 11.66 ? 78  ALA H N   1 
ATOM   2298 C CA  . ALA B 2 79  ? -7.566  4.617   14.030  1.00 10.69 ? 78  ALA H CA  1 
ATOM   2299 C C   . ALA B 2 79  ? -6.768  5.225   15.178  1.00 10.43 ? 78  ALA H C   1 
ATOM   2300 O O   . ALA B 2 79  ? -6.320  6.366   15.105  1.00 8.67  ? 78  ALA H O   1 
ATOM   2301 C CB  . ALA B 2 79  ? -6.686  3.773   13.166  1.00 10.51 ? 78  ALA H CB  1 
ATOM   2302 N N   . TYR B 2 80  ? -6.581  4.465   16.240  1.00 12.77 ? 79  TYR H N   1 
ATOM   2303 C CA  . TYR B 2 80  ? -5.847  4.966   17.393  1.00 14.99 ? 79  TYR H CA  1 
ATOM   2304 C C   . TYR B 2 80  ? -4.889  3.955   17.988  1.00 14.36 ? 79  TYR H C   1 
ATOM   2305 O O   . TYR B 2 80  ? -5.113  2.737   17.917  1.00 14.26 ? 79  TYR H O   1 
ATOM   2306 C CB  . TYR B 2 80  ? -6.808  5.338   18.516  1.00 16.66 ? 79  TYR H CB  1 
ATOM   2307 C CG  . TYR B 2 80  ? -7.752  6.437   18.196  1.00 18.29 ? 79  TYR H CG  1 
ATOM   2308 C CD1 . TYR B 2 80  ? -7.387  7.775   18.419  1.00 18.71 ? 79  TYR H CD1 1 
ATOM   2309 C CD2 . TYR B 2 80  ? -9.049  6.152   17.760  1.00 18.46 ? 79  TYR H CD2 1 
ATOM   2310 C CE1 . TYR B 2 80  ? -8.287  8.796   18.232  1.00 18.30 ? 79  TYR H CE1 1 
ATOM   2311 C CE2 . TYR B 2 80  ? -9.957  7.164   17.569  1.00 19.42 ? 79  TYR H CE2 1 
ATOM   2312 C CZ  . TYR B 2 80  ? -9.568  8.484   17.811  1.00 19.74 ? 79  TYR H CZ  1 
ATOM   2313 O OH  . TYR B 2 80  ? -10.480 9.500   17.645  1.00 21.58 ? 79  TYR H OH  1 
ATOM   2314 N N   . MET B 2 81  ? -3.838  4.483   18.602  1.00 13.95 ? 80  MET H N   1 
ATOM   2315 C CA  . MET B 2 81  ? -2.893  3.647   19.301  1.00 14.15 ? 80  MET H CA  1 
ATOM   2316 C C   . MET B 2 81  ? -2.591  4.282   20.630  1.00 14.21 ? 80  MET H C   1 
ATOM   2317 O O   . MET B 2 81  ? -2.180  5.436   20.705  1.00 14.72 ? 80  MET H O   1 
ATOM   2318 C CB  . MET B 2 81  ? -1.597  3.443   18.551  1.00 15.02 ? 80  MET H CB  1 
ATOM   2319 C CG  . MET B 2 81  ? -0.659  2.495   19.331  1.00 16.03 ? 80  MET H CG  1 
ATOM   2320 S SD  . MET B 2 81  ? 0.868   2.098   18.479  1.00 16.73 ? 80  MET H SD  1 
ATOM   2321 C CE  . MET B 2 81  ? 1.621   3.704   18.501  1.00 14.85 ? 80  MET H CE  1 
ATOM   2322 N N   . GLN B 2 82  ? -2.879  3.548   21.690  1.00 15.27 ? 81  GLN H N   1 
ATOM   2323 C CA  . GLN B 2 82  ? -2.588  4.028   23.017  1.00 15.55 ? 81  GLN H CA  1 
ATOM   2324 C C   . GLN B 2 82  ? -1.330  3.363   23.524  1.00 14.94 ? 81  GLN H C   1 
ATOM   2325 O O   . GLN B 2 82  ? -1.174  2.139   23.417  1.00 13.43 ? 81  GLN H O   1 
ATOM   2326 C CB  . GLN B 2 82  ? -3.719  3.741   23.989  1.00 16.24 ? 81  GLN H CB  1 
ATOM   2327 C CG  . GLN B 2 82  ? -3.449  4.416   25.310  1.00 19.44 ? 81  GLN H CG  1 
ATOM   2328 C CD  . GLN B 2 82  ? -4.687  4.635   26.119  1.00 21.81 ? 81  GLN H CD  1 
ATOM   2329 O OE1 . GLN B 2 82  ? -5.189  3.696   26.735  1.00 23.78 ? 81  GLN H OE1 1 
ATOM   2330 N NE2 . GLN B 2 82  ? -5.194  5.878   26.139  1.00 21.89 ? 81  GLN H NE2 1 
ATOM   2331 N N   . LEU B 2 83  ? -0.443  4.194   24.065  1.00 15.07 ? 82  LEU H N   1 
ATOM   2332 C CA  . LEU B 2 83  ? 0.823   3.738   24.641  1.00 16.24 ? 82  LEU H CA  1 
ATOM   2333 C C   . LEU B 2 83  ? 0.796   4.075   26.132  1.00 14.95 ? 82  LEU H C   1 
ATOM   2334 O O   . LEU B 2 83  ? 0.517   5.220   26.515  1.00 13.94 ? 82  LEU H O   1 
ATOM   2335 C CB  . LEU B 2 83  ? 2.019   4.426   23.957  1.00 16.74 ? 82  LEU H CB  1 
ATOM   2336 C CG  . LEU B 2 83  ? 2.302   4.143   22.477  1.00 16.88 ? 82  LEU H CG  1 
ATOM   2337 C CD1 . LEU B 2 83  ? 3.125   5.274   21.932  1.00 17.25 ? 82  LEU H CD1 1 
ATOM   2338 C CD2 . LEU B 2 83  ? 3.016   2.803   22.302  1.00 17.13 ? 82  LEU H CD2 1 
ATOM   2339 N N   . SER B 2 84  A 1.119   3.086   26.958  1.00 14.45 ? 82  SER H N   1 
ATOM   2340 C CA  . SER B 2 84  A 1.099   3.243   28.413  1.00 15.11 ? 82  SER H CA  1 
ATOM   2341 C C   . SER B 2 84  A 2.446   2.996   29.049  1.00 13.96 ? 82  SER H C   1 
ATOM   2342 O O   . SER B 2 84  A 3.354   2.450   28.412  1.00 12.99 ? 82  SER H O   1 
ATOM   2343 C CB  . SER B 2 84  A 0.116   2.226   29.036  1.00 15.96 ? 82  SER H CB  1 
ATOM   2344 O OG  . SER B 2 84  A -1.111  2.189   28.342  1.00 18.37 ? 82  SER H OG  1 
ATOM   2345 N N   . SER B 2 85  B 2.527   3.322   30.339  1.00 14.02 ? 82  SER H N   1 
ATOM   2346 C CA  . SER B 2 85  B 3.734   3.105   31.144  1.00 14.79 ? 82  SER H CA  1 
ATOM   2347 C C   . SER B 2 85  B 4.961   3.631   30.425  1.00 13.78 ? 82  SER H C   1 
ATOM   2348 O O   . SER B 2 85  B 6.013   2.983   30.392  1.00 14.11 ? 82  SER H O   1 
ATOM   2349 C CB  . SER B 2 85  B 3.928   1.612   31.411  1.00 16.04 ? 82  SER H CB  1 
ATOM   2350 O OG  . SER B 2 85  B 2.723   0.984   31.799  1.00 17.81 ? 82  SER H OG  1 
ATOM   2351 N N   . LEU B 2 86  C 4.821   4.821   29.870  1.00 12.73 ? 82  LEU H N   1 
ATOM   2352 C CA  . LEU B 2 86  C 5.900   5.427   29.133  1.00 13.70 ? 82  LEU H CA  1 
ATOM   2353 C C   . LEU B 2 86  C 7.201   5.678   29.938  1.00 14.54 ? 82  LEU H C   1 
ATOM   2354 O O   . LEU B 2 86  C 7.184   5.954   31.137  1.00 14.57 ? 82  LEU H O   1 
ATOM   2355 C CB  . LEU B 2 86  C 5.387   6.696   28.454  1.00 12.58 ? 82  LEU H CB  1 
ATOM   2356 C CG  . LEU B 2 86  C 4.241   6.448   27.467  1.00 12.33 ? 82  LEU H CG  1 
ATOM   2357 C CD1 . LEU B 2 86  C 3.765   7.767   26.926  1.00 12.58 ? 82  LEU H CD1 1 
ATOM   2358 C CD2 . LEU B 2 86  C 4.671   5.521   26.322  1.00 11.19 ? 82  LEU H CD2 1 
ATOM   2359 N N   . LYS B 2 87  ? 8.327   5.545   29.245  1.00 14.70 ? 83  LYS H N   1 
ATOM   2360 C CA  . LYS B 2 87  ? 9.650   5.751   29.794  1.00 14.05 ? 83  LYS H CA  1 
ATOM   2361 C C   . LYS B 2 87  ? 10.407  6.443   28.663  1.00 14.06 ? 83  LYS H C   1 
ATOM   2362 O O   . LYS B 2 87  ? 9.968   6.397   27.517  1.00 12.52 ? 83  LYS H O   1 
ATOM   2363 C CB  . LYS B 2 87  ? 10.275  4.400   30.121  1.00 14.49 ? 83  LYS H CB  1 
ATOM   2364 C CG  . LYS B 2 87  ? 10.390  3.464   28.946  1.00 14.53 ? 83  LYS H CG  1 
ATOM   2365 C CD  . LYS B 2 87  ? 11.088  2.189   29.360  1.00 16.09 ? 83  LYS H CD  1 
ATOM   2366 C CE  . LYS B 2 87  ? 11.234  1.177   28.223  1.00 16.77 ? 83  LYS H CE  1 
ATOM   2367 N NZ  . LYS B 2 87  ? 9.979   0.871   27.460  1.00 16.94 ? 83  LYS H NZ  1 
ATOM   2368 N N   . SER B 2 88  ? 11.557  7.036   28.969  1.00 15.15 ? 84  SER H N   1 
ATOM   2369 C CA  . SER B 2 88  ? 12.358  7.748   27.969  1.00 16.46 ? 84  SER H CA  1 
ATOM   2370 C C   . SER B 2 88  ? 12.674  6.997   26.674  1.00 15.96 ? 84  SER H C   1 
ATOM   2371 O O   . SER B 2 88  ? 12.583  7.575   25.600  1.00 14.74 ? 84  SER H O   1 
ATOM   2372 C CB  . SER B 2 88  ? 13.625  8.345   28.592  1.00 18.00 ? 84  SER H CB  1 
ATOM   2373 O OG  . SER B 2 88  ? 14.503  7.329   29.029  1.00 22.08 ? 84  SER H OG  1 
ATOM   2374 N N   . ASP B 2 89  ? 12.966  5.705   26.764  1.00 16.70 ? 85  ASP H N   1 
ATOM   2375 C CA  . ASP B 2 89  ? 13.227  4.894   25.578  1.00 18.72 ? 85  ASP H CA  1 
ATOM   2376 C C   . ASP B 2 89  ? 11.996  4.714   24.652  1.00 18.54 ? 85  ASP H C   1 
ATOM   2377 O O   . ASP B 2 89  ? 12.097  4.063   23.606  1.00 19.98 ? 85  ASP H O   1 
ATOM   2378 C CB  . ASP B 2 89  ? 13.782  3.518   25.974  1.00 21.15 ? 85  ASP H CB  1 
ATOM   2379 C CG  . ASP B 2 89  ? 15.133  3.609   26.685  1.00 24.57 ? 85  ASP H CG  1 
ATOM   2380 O OD1 . ASP B 2 89  ? 16.057  4.267   26.143  1.00 25.72 ? 85  ASP H OD1 1 
ATOM   2381 O OD2 . ASP B 2 89  ? 15.281  3.011   27.784  1.00 26.60 ? 85  ASP H OD2 1 
ATOM   2382 N N   . ASP B 2 90  ? 10.831  5.232   25.035  1.00 16.55 ? 86  ASP H N   1 
ATOM   2383 C CA  . ASP B 2 90  ? 9.648   5.118   24.179  1.00 14.66 ? 86  ASP H CA  1 
ATOM   2384 C C   . ASP B 2 90  ? 9.555   6.327   23.259  1.00 14.01 ? 86  ASP H C   1 
ATOM   2385 O O   . ASP B 2 90  ? 8.694   6.370   22.375  1.00 13.08 ? 86  ASP H O   1 
ATOM   2386 C CB  . ASP B 2 90  ? 8.367   5.012   25.005  1.00 13.90 ? 86  ASP H CB  1 
ATOM   2387 C CG  . ASP B 2 90  ? 8.274   3.718   25.786  1.00 13.70 ? 86  ASP H CG  1 
ATOM   2388 O OD1 . ASP B 2 90  ? 8.653   2.630   25.307  1.00 14.85 ? 86  ASP H OD1 1 
ATOM   2389 O OD2 . ASP B 2 90  ? 7.784   3.776   26.912  1.00 14.49 ? 86  ASP H OD2 1 
ATOM   2390 N N   . SER B 2 91  ? 10.422  7.318   23.500  1.00 13.43 ? 87  SER H N   1 
ATOM   2391 C CA  . SER B 2 91  ? 10.471  8.535   22.683  1.00 12.87 ? 87  SER H CA  1 
ATOM   2392 C C   . SER B 2 91  ? 10.877  8.099   21.271  1.00 11.75 ? 87  SER H C   1 
ATOM   2393 O O   . SER B 2 91  ? 11.883  7.410   21.091  1.00 12.42 ? 87  SER H O   1 
ATOM   2394 C CB  . SER B 2 91  ? 11.481  9.537   23.274  1.00 11.79 ? 87  SER H CB  1 
ATOM   2395 O OG  . SER B 2 91  ? 11.229  9.723   24.662  1.00 10.28 ? 87  SER H OG  1 
ATOM   2396 N N   . ALA B 2 92  ? 10.068  8.443   20.277  1.00 10.75 ? 88  ALA H N   1 
ATOM   2397 C CA  . ALA B 2 92  ? 10.355  8.040   18.908  1.00 10.08 ? 88  ALA H CA  1 
ATOM   2398 C C   . ALA B 2 92  ? 9.277   8.608   18.028  1.00 9.37  ? 88  ALA H C   1 
ATOM   2399 O O   . ALA B 2 92  ? 8.465   9.387   18.490  1.00 9.55  ? 88  ALA H O   1 
ATOM   2400 C CB  . ALA B 2 92  ? 10.326  6.495   18.819  1.00 11.02 ? 88  ALA H CB  1 
ATOM   2401 N N   . VAL B 2 93  ? 9.290   8.239   16.756  1.00 8.95  ? 89  VAL H N   1 
ATOM   2402 C CA  . VAL B 2 93  ? 8.266   8.667   15.809  1.00 8.26  ? 89  VAL H CA  1 
ATOM   2403 C C   . VAL B 2 93  ? 7.494   7.398   15.464  1.00 8.03  ? 89  VAL H C   1 
ATOM   2404 O O   . VAL B 2 93  ? 8.086   6.358   15.177  1.00 7.00  ? 89  VAL H O   1 
ATOM   2405 C CB  . VAL B 2 93  ? 8.845   9.317   14.508  1.00 7.52  ? 89  VAL H CB  1 
ATOM   2406 C CG1 . VAL B 2 93  ? 7.745   9.636   13.543  1.00 7.53  ? 89  VAL H CG1 1 
ATOM   2407 C CG2 . VAL B 2 93  ? 9.540   10.604  14.828  1.00 7.90  ? 89  VAL H CG2 1 
ATOM   2408 N N   . TYR B 2 94  ? 6.179   7.462   15.666  1.00 8.95  ? 90  TYR H N   1 
ATOM   2409 C CA  . TYR B 2 94  ? 5.250   6.355   15.385  1.00 7.70  ? 90  TYR H CA  1 
ATOM   2410 C C   . TYR B 2 94  ? 4.423   6.639   14.132  1.00 7.76  ? 90  TYR H C   1 
ATOM   2411 O O   . TYR B 2 94  ? 3.830   7.717   13.997  1.00 8.16  ? 90  TYR H O   1 
ATOM   2412 C CB  . TYR B 2 94  ? 4.306   6.149   16.566  1.00 6.52  ? 90  TYR H CB  1 
ATOM   2413 C CG  . TYR B 2 94  ? 5.020   5.748   17.817  1.00 5.83  ? 90  TYR H CG  1 
ATOM   2414 C CD1 . TYR B 2 94  ? 5.550   6.708   18.678  1.00 6.16  ? 90  TYR H CD1 1 
ATOM   2415 C CD2 . TYR B 2 94  ? 5.206   4.410   18.126  1.00 6.24  ? 90  TYR H CD2 1 
ATOM   2416 C CE1 . TYR B 2 94  ? 6.253   6.340   19.827  1.00 6.18  ? 90  TYR H CE1 1 
ATOM   2417 C CE2 . TYR B 2 94  ? 5.921   4.026   19.277  1.00 6.72  ? 90  TYR H CE2 1 
ATOM   2418 C CZ  . TYR B 2 94  ? 6.436   5.004   20.115  1.00 6.46  ? 90  TYR H CZ  1 
ATOM   2419 O OH  . TYR B 2 94  ? 7.159   4.643   21.231  1.00 7.13  ? 90  TYR H OH  1 
ATOM   2420 N N   . PHE B 2 95  ? 4.420   5.684   13.209  1.00 7.05  ? 91  PHE H N   1 
ATOM   2421 C CA  . PHE B 2 95  ? 3.679   5.796   11.966  1.00 7.43  ? 91  PHE H CA  1 
ATOM   2422 C C   . PHE B 2 95  ? 2.450   4.867   11.915  1.00 8.73  ? 91  PHE H C   1 
ATOM   2423 O O   . PHE B 2 95  ? 2.463   3.745   12.424  1.00 9.09  ? 91  PHE H O   1 
ATOM   2424 C CB  . PHE B 2 95  ? 4.548   5.368   10.760  1.00 7.21  ? 91  PHE H CB  1 
ATOM   2425 C CG  . PHE B 2 95  ? 5.769   6.212   10.520  1.00 8.26  ? 91  PHE H CG  1 
ATOM   2426 C CD1 . PHE B 2 95  ? 5.675   7.422   9.840   1.00 8.32  ? 91  PHE H CD1 1 
ATOM   2427 C CD2 . PHE B 2 95  ? 7.028   5.778   10.944  1.00 9.48  ? 91  PHE H CD2 1 
ATOM   2428 C CE1 . PHE B 2 95  ? 6.816   8.196   9.586   1.00 8.87  ? 91  PHE H CE1 1 
ATOM   2429 C CE2 . PHE B 2 95  ? 8.171   6.541   10.691  1.00 9.98  ? 91  PHE H CE2 1 
ATOM   2430 C CZ  . PHE B 2 95  ? 8.063   7.752   10.012  1.00 9.69  ? 91  PHE H CZ  1 
ATOM   2431 N N   . CYS B 2 96  ? 1.395   5.351   11.284  1.00 9.73  ? 92  CYS H N   1 
ATOM   2432 C CA  . CYS B 2 96  ? 0.238   4.526   11.016  1.00 9.77  ? 92  CYS H CA  1 
ATOM   2433 C C   . CYS B 2 96  ? 0.444   4.328   9.494   1.00 9.90  ? 92  CYS H C   1 
ATOM   2434 O O   . CYS B 2 96  ? 0.966   5.230   8.793   1.00 6.92  ? 92  CYS H O   1 
ATOM   2435 C CB  . CYS B 2 96  ? -1.068  5.238   11.359  1.00 10.91 ? 92  CYS H CB  1 
ATOM   2436 S SG  . CYS B 2 96  ? -1.476  6.805   10.528  1.00 12.52 ? 92  CYS H SG  1 
ATOM   2437 N N   . VAL B 2 97  ? 0.141   3.120   9.014   1.00 10.04 ? 93  VAL H N   1 
ATOM   2438 C CA  . VAL B 2 97  ? 0.345   2.773   7.617   1.00 9.78  ? 93  VAL H CA  1 
ATOM   2439 C C   . VAL B 2 97  ? -0.822  1.970   7.054   1.00 10.05 ? 93  VAL H C   1 
ATOM   2440 O O   . VAL B 2 97  ? -1.301  1.051   7.701   1.00 9.94  ? 93  VAL H O   1 
ATOM   2441 C CB  . VAL B 2 97  ? 1.579   1.816   7.452   1.00 9.37  ? 93  VAL H CB  1 
ATOM   2442 C CG1 . VAL B 2 97  ? 2.037   1.750   5.998   1.00 7.97  ? 93  VAL H CG1 1 
ATOM   2443 C CG2 . VAL B 2 97  ? 2.704   2.198   8.384   1.00 9.11  ? 93  VAL H CG2 1 
ATOM   2444 N N   . ARG B 2 98  ? -1.301  2.346   5.872   1.00 10.01 ? 94  ARG H N   1 
ATOM   2445 C CA  . ARG B 2 98  ? -2.300  1.549   5.199   1.00 9.69  ? 94  ARG H CA  1 
ATOM   2446 C C   . ARG B 2 98  ? -1.414  0.757   4.221   1.00 8.08  ? 94  ARG H C   1 
ATOM   2447 O O   . ARG B 2 98  ? -1.238  1.134   3.064   1.00 6.64  ? 94  ARG H O   1 
ATOM   2448 C CB  . ARG B 2 98  ? -3.323  2.357   4.411   1.00 9.51  ? 94  ARG H CB  1 
ATOM   2449 C CG  . ARG B 2 98  ? -4.503  1.451   4.210   1.00 11.93 ? 94  ARG H CG  1 
ATOM   2450 C CD  . ARG B 2 98  ? -5.131  1.507   2.879   1.00 13.79 ? 94  ARG H CD  1 
ATOM   2451 N NE  . ARG B 2 98  ? -4.225  1.489   1.748   1.00 15.10 ? 94  ARG H NE  1 
ATOM   2452 C CZ  . ARG B 2 98  ? -4.664  1.656   0.503   1.00 15.70 ? 94  ARG H CZ  1 
ATOM   2453 N NH1 . ARG B 2 98  ? -5.965  1.791   0.297   1.00 13.17 ? 94  ARG H NH1 1 
ATOM   2454 N NH2 . ARG B 2 98  ? -3.820  1.918   -0.494  1.00 16.47 ? 94  ARG H NH2 1 
ATOM   2455 N N   . TRP B 2 99  ? -0.808  -0.295  4.763   1.00 9.05  ? 95  TRP H N   1 
ATOM   2456 C CA  . TRP B 2 99  ? 0.140   -1.165  4.070   1.00 8.62  ? 95  TRP H CA  1 
ATOM   2457 C C   . TRP B 2 99  ? -0.252  -1.703  2.696   1.00 8.85  ? 95  TRP H C   1 
ATOM   2458 O O   . TRP B 2 99  ? 0.597   -1.801  1.827   1.00 9.22  ? 95  TRP H O   1 
ATOM   2459 C CB  . TRP B 2 99  ? 0.614   -2.257  5.034   1.00 8.08  ? 95  TRP H CB  1 
ATOM   2460 C CG  . TRP B 2 99  ? 1.704   -3.158  4.520   1.00 8.81  ? 95  TRP H CG  1 
ATOM   2461 C CD1 . TRP B 2 99  ? 1.604   -4.497  4.295   1.00 8.40  ? 95  TRP H CD1 1 
ATOM   2462 C CD2 . TRP B 2 99  ? 3.072   -2.795  4.201   1.00 9.15  ? 95  TRP H CD2 1 
ATOM   2463 N NE1 . TRP B 2 99  ? 2.807   -4.993  3.859   1.00 9.62  ? 95  TRP H NE1 1 
ATOM   2464 C CE2 . TRP B 2 99  ? 3.727   -3.978  3.794   1.00 8.86  ? 95  TRP H CE2 1 
ATOM   2465 C CE3 . TRP B 2 99  ? 3.804   -1.587  4.231   1.00 8.33  ? 95  TRP H CE3 1 
ATOM   2466 C CZ2 . TRP B 2 99  ? 5.081   -3.999  3.418   1.00 8.90  ? 95  TRP H CZ2 1 
ATOM   2467 C CZ3 . TRP B 2 99  ? 5.151   -1.604  3.861   1.00 7.42  ? 95  TRP H CZ3 1 
ATOM   2468 C CH2 . TRP B 2 99  ? 5.774   -2.804  3.461   1.00 8.44  ? 95  TRP H CH2 1 
ATOM   2469 N N   . GLY B 2 100 ? -1.508  -2.097  2.500   1.00 9.29  ? 96  GLY H N   1 
ATOM   2470 C CA  . GLY B 2 100 ? -1.925  -2.552  1.184   1.00 7.48  ? 96  GLY H CA  1 
ATOM   2471 C C   . GLY B 2 100 ? -2.011  -4.030  0.896   1.00 9.12  ? 96  GLY H C   1 
ATOM   2472 O O   . GLY B 2 100 ? -2.483  -4.409  -0.171  1.00 10.17 ? 96  GLY H O   1 
ATOM   2473 N N   . PHE B 2 101 ? -1.538  -4.884  1.797   1.00 9.75  ? 97  PHE H N   1 
ATOM   2474 C CA  . PHE B 2 101 ? -1.632  -6.328  1.580   1.00 9.42  ? 97  PHE H CA  1 
ATOM   2475 C C   . PHE B 2 101 ? -3.078  -6.760  1.824   1.00 10.98 ? 97  PHE H C   1 
ATOM   2476 O O   . PHE B 2 101 ? -3.670  -6.465  2.871   1.00 10.91 ? 97  PHE H O   1 
ATOM   2477 C CB  . PHE B 2 101 ? -0.729  -7.070  2.550   1.00 8.17  ? 97  PHE H CB  1 
ATOM   2478 C CG  . PHE B 2 101 ? -0.824  -8.550  2.426   1.00 7.87  ? 97  PHE H CG  1 
ATOM   2479 C CD1 . PHE B 2 101 ? -0.545  -9.170  1.218   1.00 7.73  ? 97  PHE H CD1 1 
ATOM   2480 C CD2 . PHE B 2 101 ? -1.207  -9.326  3.506   1.00 6.21  ? 97  PHE H CD2 1 
ATOM   2481 C CE1 . PHE B 2 101 ? -0.650  -10.558 1.088   1.00 7.97  ? 97  PHE H CE1 1 
ATOM   2482 C CE2 . PHE B 2 101 ? -1.310  -10.704 3.379   1.00 6.14  ? 97  PHE H CE2 1 
ATOM   2483 C CZ  . PHE B 2 101 ? -1.034  -11.317 2.176   1.00 6.26  ? 97  PHE H CZ  1 
ATOM   2484 N N   . ILE B 2 102 ? -3.655  -7.443  0.852   1.00 13.31 ? 98  ILE H N   1 
ATOM   2485 C CA  . ILE B 2 102 ? -5.029  -7.888  0.962   1.00 14.58 ? 98  ILE H CA  1 
ATOM   2486 C C   . ILE B 2 102 ? -4.937  -9.374  1.224   1.00 15.37 ? 98  ILE H C   1 
ATOM   2487 O O   . ILE B 2 102 ? -4.716  -10.145 0.291   1.00 14.59 ? 98  ILE H O   1 
ATOM   2488 C CB  . ILE B 2 102 ? -5.807  -7.707  -0.375  1.00 16.35 ? 98  ILE H CB  1 
ATOM   2489 C CG1 . ILE B 2 102 ? -5.493  -6.359  -1.050  1.00 16.86 ? 98  ILE H CG1 1 
ATOM   2490 C CG2 . ILE B 2 102 ? -7.309  -7.856  -0.134  1.00 15.01 ? 98  ILE H CG2 1 
ATOM   2491 C CD1 . ILE B 2 102 ? -6.273  -5.205  -0.527  1.00 17.68 ? 98  ILE H CD1 1 
ATOM   2492 N N   . PRO B 2 103 ? -5.118  -9.795  2.493   1.00 16.44 ? 99  PRO H N   1 
ATOM   2493 C CA  . PRO B 2 103 ? -5.061  -11.193 2.926   1.00 18.54 ? 99  PRO H CA  1 
ATOM   2494 C C   . PRO B 2 103 ? -5.845  -12.180 2.076   1.00 21.44 ? 99  PRO H C   1 
ATOM   2495 O O   . PRO B 2 103 ? -5.288  -13.176 1.642   1.00 23.21 ? 99  PRO H O   1 
ATOM   2496 C CB  . PRO B 2 103 ? -5.609  -11.128 4.342   1.00 17.52 ? 99  PRO H CB  1 
ATOM   2497 C CG  . PRO B 2 103 ? -5.094  -9.790  4.812   1.00 16.65 ? 99  PRO H CG  1 
ATOM   2498 C CD  . PRO B 2 103 ? -5.372  -8.908  3.643   1.00 16.36 ? 99  PRO H CD  1 
ATOM   2499 N N   . VAL B 2 104 ? -7.125  -11.903 1.829   1.00 24.13 ? 100 VAL H N   1 
ATOM   2500 C CA  . VAL B 2 104 ? -7.968  -12.801 1.034   1.00 25.84 ? 100 VAL H CA  1 
ATOM   2501 C C   . VAL B 2 104 ? -7.386  -13.043 -0.363  1.00 26.45 ? 100 VAL H C   1 
ATOM   2502 O O   . VAL B 2 104 ? -7.430  -14.156 -0.901  1.00 26.90 ? 100 VAL H O   1 
ATOM   2503 C CB  . VAL B 2 104 ? -9.431  -12.255 0.921   1.00 26.60 ? 100 VAL H CB  1 
ATOM   2504 C CG1 . VAL B 2 104 ? -9.794  -11.469 2.178   1.00 27.26 ? 100 VAL H CG1 1 
ATOM   2505 C CG2 . VAL B 2 104 ? -9.619  -11.389 -0.324  1.00 26.86 ? 100 VAL H CG2 1 
ATOM   2506 N N   . ARG B 2 105 A -6.804  -11.992 -0.921  1.00 26.67 ? 100 ARG H N   1 
ATOM   2507 C CA  . ARG B 2 105 A -6.228  -12.044 -2.245  1.00 27.22 ? 100 ARG H CA  1 
ATOM   2508 C C   . ARG B 2 105 A -4.783  -12.462 -2.209  1.00 26.01 ? 100 ARG H C   1 
ATOM   2509 O O   . ARG B 2 105 A -4.237  -12.882 -3.227  1.00 24.59 ? 100 ARG H O   1 
ATOM   2510 C CB  . ARG B 2 105 A -6.241  -10.655 -2.859  1.00 30.52 ? 100 ARG H CB  1 
ATOM   2511 C CG  . ARG B 2 105 A -7.575  -10.036 -3.034  1.00 33.79 ? 100 ARG H CG  1 
ATOM   2512 C CD  . ARG B 2 105 A -7.823  -9.854  -4.494  1.00 37.44 ? 100 ARG H CD  1 
ATOM   2513 N NE  . ARG B 2 105 A -8.245  -11.102 -5.111  1.00 41.09 ? 100 ARG H NE  1 
ATOM   2514 C CZ  . ARG B 2 105 A -9.377  -11.746 -4.807  1.00 43.05 ? 100 ARG H CZ  1 
ATOM   2515 N NH1 . ARG B 2 105 A -10.212 -11.277 -3.864  1.00 43.12 ? 100 ARG H NH1 1 
ATOM   2516 N NH2 . ARG B 2 105 A -9.721  -12.815 -5.523  1.00 44.02 ? 100 ARG H NH2 1 
ATOM   2517 N N   . GLU B 2 106 B -4.153  -12.210 -1.067  1.00 25.10 ? 100 GLU H N   1 
ATOM   2518 C CA  . GLU B 2 106 B -2.746  -12.470 -0.870  1.00 25.18 ? 100 GLU H CA  1 
ATOM   2519 C C   . GLU B 2 106 B -1.960  -11.660 -1.901  1.00 23.94 ? 100 GLU H C   1 
ATOM   2520 O O   . GLU B 2 106 B -0.915  -12.096 -2.399  1.00 23.21 ? 100 GLU H O   1 
ATOM   2521 C CB  . GLU B 2 106 B -2.449  -13.967 -0.974  1.00 26.76 ? 100 GLU H CB  1 
ATOM   2522 C CG  . GLU B 2 106 B -2.946  -14.741 0.226   1.00 28.65 ? 100 GLU H CG  1 
ATOM   2523 C CD  . GLU B 2 106 B -2.804  -16.239 0.086   1.00 30.61 ? 100 GLU H CD  1 
ATOM   2524 O OE1 . GLU B 2 106 B -2.396  -16.723 -0.994  1.00 30.96 ? 100 GLU H OE1 1 
ATOM   2525 O OE2 . GLU B 2 106 B -3.113  -16.951 1.073   1.00 32.57 ? 100 GLU H OE2 1 
ATOM   2526 N N   . ASP B 2 107 C -2.489  -10.481 -2.226  1.00 22.49 ? 100 ASP H N   1 
ATOM   2527 C CA  . ASP B 2 107 C -1.848  -9.569  -3.183  1.00 21.05 ? 100 ASP H CA  1 
ATOM   2528 C C   . ASP B 2 107 C -1.704  -8.203  -2.510  1.00 18.42 ? 100 ASP H C   1 
ATOM   2529 O O   . ASP B 2 107 C -2.102  -8.023  -1.363  1.00 18.49 ? 100 ASP H O   1 
ATOM   2530 C CB  . ASP B 2 107 C -2.628  -9.451  -4.514  1.00 22.86 ? 100 ASP H CB  1 
ATOM   2531 C CG  . ASP B 2 107 C -1.709  -9.121  -5.734  1.00 24.93 ? 100 ASP H CG  1 
ATOM   2532 O OD1 . ASP B 2 107 C -0.506  -8.768  -5.581  1.00 24.51 ? 100 ASP H OD1 1 
ATOM   2533 O OD2 . ASP B 2 107 C -2.204  -9.218  -6.880  1.00 26.75 ? 100 ASP H OD2 1 
ATOM   2534 N N   . TYR B 2 108 D -1.132  -7.248  -3.233  1.00 15.92 ? 100 TYR H N   1 
ATOM   2535 C CA  . TYR B 2 108 D -0.875  -5.936  -2.698  1.00 13.53 ? 100 TYR H CA  1 
ATOM   2536 C C   . TYR B 2 108 D -1.445  -4.787  -3.448  1.00 13.54 ? 100 TYR H C   1 
ATOM   2537 O O   . TYR B 2 108 D -1.462  -4.773  -4.665  1.00 14.43 ? 100 TYR H O   1 
ATOM   2538 C CB  . TYR B 2 108 D 0.614   -5.687  -2.622  1.00 10.62 ? 100 TYR H CB  1 
ATOM   2539 C CG  . TYR B 2 108 D 1.285   -6.479  -1.550  1.00 8.26  ? 100 TYR H CG  1 
ATOM   2540 C CD1 . TYR B 2 108 D 1.501   -7.849  -1.713  1.00 6.96  ? 100 TYR H CD1 1 
ATOM   2541 C CD2 . TYR B 2 108 D 1.750   -5.852  -0.409  1.00 6.68  ? 100 TYR H CD2 1 
ATOM   2542 C CE1 . TYR B 2 108 D 2.172   -8.576  -0.779  1.00 7.61  ? 100 TYR H CE1 1 
ATOM   2543 C CE2 . TYR B 2 108 D 2.430   -6.558  0.540   1.00 7.75  ? 100 TYR H CE2 1 
ATOM   2544 C CZ  . TYR B 2 108 D 2.644   -7.929  0.353   1.00 8.22  ? 100 TYR H CZ  1 
ATOM   2545 O OH  . TYR B 2 108 D 3.349   -8.640  1.307   1.00 9.77  ? 100 TYR H OH  1 
ATOM   2546 N N   . VAL B 2 109 E -1.750  -3.755  -2.686  1.00 13.72 ? 100 VAL H N   1 
ATOM   2547 C CA  . VAL B 2 109 E -2.278  -2.505  -3.192  1.00 13.69 ? 100 VAL H CA  1 
ATOM   2548 C C   . VAL B 2 109 E -1.218  -1.536  -2.618  1.00 12.83 ? 100 VAL H C   1 
ATOM   2549 O O   . VAL B 2 109 E -0.441  -1.916  -1.733  1.00 13.57 ? 100 VAL H O   1 
ATOM   2550 C CB  . VAL B 2 109 E -3.757  -2.313  -2.659  1.00 14.49 ? 100 VAL H CB  1 
ATOM   2551 C CG1 . VAL B 2 109 E -3.894  -1.133  -1.748  1.00 14.26 ? 100 VAL H CG1 1 
ATOM   2552 C CG2 . VAL B 2 109 E -4.725  -2.256  -3.815  1.00 14.19 ? 100 VAL H CG2 1 
ATOM   2553 N N   . LEU B 2 110 F -1.119  -0.342  -3.174  1.00 11.26 ? 100 LEU H N   1 
ATOM   2554 C CA  . LEU B 2 110 F -0.147  0.660   -2.742  1.00 11.17 ? 100 LEU H CA  1 
ATOM   2555 C C   . LEU B 2 110 F -0.204  0.986   -1.250  1.00 10.84 ? 100 LEU H C   1 
ATOM   2556 O O   . LEU B 2 110 F -1.282  1.031   -0.650  1.00 11.36 ? 100 LEU H O   1 
ATOM   2557 C CB  . LEU B 2 110 F -0.386  1.943   -3.541  1.00 10.70 ? 100 LEU H CB  1 
ATOM   2558 C CG  . LEU B 2 110 F 0.672   2.866   -4.115  1.00 11.25 ? 100 LEU H CG  1 
ATOM   2559 C CD1 . LEU B 2 110 F 0.444   4.249   -3.558  1.00 10.94 ? 100 LEU H CD1 1 
ATOM   2560 C CD2 . LEU B 2 110 F 2.064   2.385   -3.774  1.00 11.55 ? 100 LEU H CD2 1 
ATOM   2561 N N   . ASP B 2 111 ? 0.970   1.209   -0.664  1.00 9.76  ? 101 ASP H N   1 
ATOM   2562 C CA  . ASP B 2 111 ? 1.084   1.593   0.743   1.00 8.64  ? 101 ASP H CA  1 
ATOM   2563 C C   . ASP B 2 111 ? 0.967   3.112   0.878   1.00 8.40  ? 101 ASP H C   1 
ATOM   2564 O O   . ASP B 2 111 ? 1.431   3.852   0.022   1.00 8.53  ? 101 ASP H O   1 
ATOM   2565 C CB  . ASP B 2 111 ? 2.421   1.101   1.391   1.00 7.39  ? 101 ASP H CB  1 
ATOM   2566 C CG  . ASP B 2 111 ? 3.690   1.487   0.586   1.00 6.58  ? 101 ASP H CG  1 
ATOM   2567 O OD1 . ASP B 2 111 ? 3.761   1.292   -0.637  1.00 6.06  ? 101 ASP H OD1 1 
ATOM   2568 O OD2 . ASP B 2 111 ? 4.661   1.963   1.192   1.00 7.25  ? 101 ASP H OD2 1 
ATOM   2569 N N   . TYR B 2 112 ? 0.270   3.565   1.917   1.00 8.89  ? 102 TYR H N   1 
ATOM   2570 C CA  . TYR B 2 112 ? 0.130   4.989   2.218   1.00 9.12  ? 102 TYR H CA  1 
ATOM   2571 C C   . TYR B 2 112 ? 0.538   5.109   3.664   1.00 8.86  ? 102 TYR H C   1 
ATOM   2572 O O   . TYR B 2 112 ? 0.135   4.289   4.479   1.00 8.52  ? 102 TYR H O   1 
ATOM   2573 C CB  . TYR B 2 112 ? -1.296  5.470   2.019   1.00 8.59  ? 102 TYR H CB  1 
ATOM   2574 C CG  . TYR B 2 112 ? -1.629  5.648   0.559   1.00 8.22  ? 102 TYR H CG  1 
ATOM   2575 C CD1 . TYR B 2 112 ? -1.404  6.876   -0.082  1.00 8.40  ? 102 TYR H CD1 1 
ATOM   2576 C CD2 . TYR B 2 112 ? -2.186  4.594   -0.182  1.00 8.87  ? 102 TYR H CD2 1 
ATOM   2577 C CE1 . TYR B 2 112 ? -1.736  7.049   -1.434  1.00 8.61  ? 102 TYR H CE1 1 
ATOM   2578 C CE2 . TYR B 2 112 ? -2.521  4.747   -1.521  1.00 8.52  ? 102 TYR H CE2 1 
ATOM   2579 C CZ  . TYR B 2 112 ? -2.296  5.980   -2.141  1.00 9.33  ? 102 TYR H CZ  1 
ATOM   2580 O OH  . TYR B 2 112 ? -2.641  6.151   -3.459  1.00 11.05 ? 102 TYR H OH  1 
ATOM   2581 N N   . TRP B 2 113 ? 1.373   6.096   3.966   1.00 8.80  ? 103 TRP H N   1 
ATOM   2582 C CA  . TRP B 2 113 ? 1.905   6.294   5.320   1.00 8.11  ? 103 TRP H CA  1 
ATOM   2583 C C   . TRP B 2 113 ? 1.429   7.602   5.942   1.00 9.06  ? 103 TRP H C   1 
ATOM   2584 O O   . TRP B 2 113 ? 1.104   8.539   5.220   1.00 9.37  ? 103 TRP H O   1 
ATOM   2585 C CB  . TRP B 2 113 ? 3.451   6.300   5.258   1.00 6.38  ? 103 TRP H CB  1 
ATOM   2586 C CG  . TRP B 2 113 ? 4.072   4.962   4.917   1.00 4.44  ? 103 TRP H CG  1 
ATOM   2587 C CD1 . TRP B 2 113 ? 3.979   4.275   3.730   1.00 5.01  ? 103 TRP H CD1 1 
ATOM   2588 C CD2 . TRP B 2 113 ? 4.801   4.125   5.798   1.00 4.05  ? 103 TRP H CD2 1 
ATOM   2589 N NE1 . TRP B 2 113 ? 4.590   3.045   3.840   1.00 3.73  ? 103 TRP H NE1 1 
ATOM   2590 C CE2 . TRP B 2 113 ? 5.105   2.933   5.102   1.00 3.80  ? 103 TRP H CE2 1 
ATOM   2591 C CE3 . TRP B 2 113 ? 5.225   4.258   7.130   1.00 4.78  ? 103 TRP H CE3 1 
ATOM   2592 C CZ2 . TRP B 2 113 ? 5.807   1.883   5.687   1.00 3.84  ? 103 TRP H CZ2 1 
ATOM   2593 C CZ3 . TRP B 2 113 ? 5.922   3.207   7.711   1.00 4.32  ? 103 TRP H CZ3 1 
ATOM   2594 C CH2 . TRP B 2 113 ? 6.202   2.034   6.988   1.00 3.51  ? 103 TRP H CH2 1 
ATOM   2595 N N   . GLY B 2 114 ? 1.293   7.642   7.267   1.00 8.91  ? 104 GLY H N   1 
ATOM   2596 C CA  . GLY B 2 114 ? 0.921   8.899   7.890   1.00 8.90  ? 104 GLY H CA  1 
ATOM   2597 C C   . GLY B 2 114 ? 2.223   9.656   7.965   1.00 9.67  ? 104 GLY H C   1 
ATOM   2598 O O   . GLY B 2 114 ? 3.258   9.046   7.715   1.00 10.93 ? 104 GLY H O   1 
ATOM   2599 N N   . GLN B 2 115 ? 2.221   10.945  8.295   1.00 11.73 ? 105 GLN H N   1 
ATOM   2600 C CA  . GLN B 2 115 ? 3.489   11.679  8.382   1.00 12.85 ? 105 GLN H CA  1 
ATOM   2601 C C   . GLN B 2 115 ? 4.342   11.379  9.613   1.00 13.08 ? 105 GLN H C   1 
ATOM   2602 O O   . GLN B 2 115 ? 5.516   11.701  9.632   1.00 15.00 ? 105 GLN H O   1 
ATOM   2603 C CB  . GLN B 2 115 ? 3.305   13.187  8.181   1.00 15.40 ? 105 GLN H CB  1 
ATOM   2604 C CG  . GLN B 2 115 ? 2.754   13.994  9.349   1.00 18.22 ? 105 GLN H CG  1 
ATOM   2605 C CD  . GLN B 2 115 ? 1.295   13.704  9.627   1.00 20.14 ? 105 GLN H CD  1 
ATOM   2606 O OE1 . GLN B 2 115 ? 0.673   12.877  8.940   1.00 19.32 ? 105 GLN H OE1 1 
ATOM   2607 N NE2 . GLN B 2 115 ? 0.745   14.348  10.677  1.00 20.87 ? 105 GLN H NE2 1 
ATOM   2608 N N   . GLY B 2 116 ? 3.767   10.708  10.604  1.00 12.82 ? 106 GLY H N   1 
ATOM   2609 C CA  . GLY B 2 116 ? 4.494   10.337  11.797  1.00 11.67 ? 106 GLY H CA  1 
ATOM   2610 C C   . GLY B 2 116 ? 4.222   11.286  12.937  1.00 11.79 ? 106 GLY H C   1 
ATOM   2611 O O   . GLY B 2 116 ? 3.975   12.462  12.696  1.00 12.65 ? 106 GLY H O   1 
ATOM   2612 N N   . THR B 2 117 ? 4.185   10.754  14.157  1.00 9.63  ? 107 THR H N   1 
ATOM   2613 C CA  . THR B 2 117 ? 3.975   11.539  15.358  1.00 9.49  ? 107 THR H CA  1 
ATOM   2614 C C   . THR B 2 117 ? 5.162   11.281  16.261  1.00 10.09 ? 107 THR H C   1 
ATOM   2615 O O   . THR B 2 117 ? 5.427   10.143  16.660  1.00 9.69  ? 107 THR H O   1 
ATOM   2616 C CB  . THR B 2 117 ? 2.727   11.116  16.127  1.00 9.72  ? 107 THR H CB  1 
ATOM   2617 O OG1 . THR B 2 117 ? 1.579   11.328  15.294  1.00 9.55  ? 107 THR H OG1 1 
ATOM   2618 C CG2 . THR B 2 117 ? 2.600   11.943  17.459  1.00 9.25  ? 107 THR H CG2 1 
ATOM   2619 N N   . LEU B 2 118 ? 5.882   12.343  16.560  1.00 9.87  ? 108 LEU H N   1 
ATOM   2620 C CA  . LEU B 2 118 ? 7.057   12.272  17.400  1.00 12.98 ? 108 LEU H CA  1 
ATOM   2621 C C   . LEU B 2 118 ? 6.614   12.452  18.852  1.00 12.08 ? 108 LEU H C   1 
ATOM   2622 O O   . LEU B 2 118 ? 5.946   13.418  19.194  1.00 13.74 ? 108 LEU H O   1 
ATOM   2623 C CB  . LEU B 2 118 ? 8.032   13.358  16.937  1.00 14.23 ? 108 LEU H CB  1 
ATOM   2624 C CG  . LEU B 2 118 ? 9.385   13.681  17.538  1.00 17.77 ? 108 LEU H CG  1 
ATOM   2625 C CD1 . LEU B 2 118 ? 9.285   15.069  18.237  1.00 19.30 ? 108 LEU H CD1 1 
ATOM   2626 C CD2 . LEU B 2 118 ? 9.971   12.555  18.433  1.00 19.31 ? 108 LEU H CD2 1 
ATOM   2627 N N   . VAL B 2 119 ? 6.934   11.470  19.674  1.00 10.94 ? 109 VAL H N   1 
ATOM   2628 C CA  . VAL B 2 119 ? 6.583   11.442  21.081  1.00 11.07 ? 109 VAL H CA  1 
ATOM   2629 C C   . VAL B 2 119 ? 7.864   11.615  21.883  1.00 10.72 ? 109 VAL H C   1 
ATOM   2630 O O   . VAL B 2 119 ? 8.830   10.904  21.660  1.00 10.80 ? 109 VAL H O   1 
ATOM   2631 C CB  . VAL B 2 119 ? 5.926   10.048  21.450  1.00 9.84  ? 109 VAL H CB  1 
ATOM   2632 C CG1 . VAL B 2 119 ? 5.818   9.870   22.961  1.00 10.18 ? 109 VAL H CG1 1 
ATOM   2633 C CG2 . VAL B 2 119 ? 4.566   9.922   20.800  1.00 8.89  ? 109 VAL H CG2 1 
ATOM   2634 N N   . THR B 2 120 ? 7.890   12.596  22.769  1.00 11.75 ? 110 THR H N   1 
ATOM   2635 C CA  . THR B 2 120 ? 9.052   12.825  23.628  1.00 11.39 ? 110 THR H CA  1 
ATOM   2636 C C   . THR B 2 120 ? 8.538   12.547  25.028  1.00 10.34 ? 110 THR H C   1 
ATOM   2637 O O   . THR B 2 120 ? 7.595   13.195  25.476  1.00 10.33 ? 110 THR H O   1 
ATOM   2638 C CB  . THR B 2 120 ? 9.525   14.306  23.587  1.00 12.01 ? 110 THR H CB  1 
ATOM   2639 O OG1 . THR B 2 120 ? 9.999   14.633  22.272  1.00 13.69 ? 110 THR H OG1 1 
ATOM   2640 C CG2 . THR B 2 120 ? 10.595  14.570  24.634  1.00 8.95  ? 110 THR H CG2 1 
ATOM   2641 N N   . VAL B 2 121 ? 9.120   11.562  25.688  1.00 10.49 ? 111 VAL H N   1 
ATOM   2642 C CA  . VAL B 2 121 ? 8.727   11.215  27.042  1.00 11.21 ? 111 VAL H CA  1 
ATOM   2643 C C   . VAL B 2 121 ? 9.792   11.807  27.953  1.00 12.71 ? 111 VAL H C   1 
ATOM   2644 O O   . VAL B 2 121 ? 10.915  11.331  27.993  1.00 14.20 ? 111 VAL H O   1 
ATOM   2645 C CB  . VAL B 2 121 ? 8.654   9.685   27.245  1.00 10.17 ? 111 VAL H CB  1 
ATOM   2646 C CG1 . VAL B 2 121 ? 8.250   9.361   28.693  1.00 9.36  ? 111 VAL H CG1 1 
ATOM   2647 C CG2 . VAL B 2 121 ? 7.676   9.078   26.253  1.00 8.77  ? 111 VAL H CG2 1 
ATOM   2648 N N   . SER B 2 122 ? 9.446   12.835  28.704  1.00 13.44 ? 112 SER H N   1 
ATOM   2649 C CA  . SER B 2 122 ? 10.423  13.473  29.559  1.00 14.04 ? 112 SER H CA  1 
ATOM   2650 C C   . SER B 2 122 ? 9.685   14.191  30.648  1.00 14.11 ? 112 SER H C   1 
ATOM   2651 O O   . SER B 2 122 ? 8.492   14.391  30.559  1.00 14.21 ? 112 SER H O   1 
ATOM   2652 C CB  . SER B 2 122 ? 11.218  14.493  28.723  1.00 13.87 ? 112 SER H CB  1 
ATOM   2653 O OG  . SER B 2 122 ? 12.094  15.314  29.493  1.00 15.01 ? 112 SER H OG  1 
ATOM   2654 N N   . SER B 2 123 ? 10.393  14.521  31.708  1.00 15.48 ? 113 SER H N   1 
ATOM   2655 C CA  . SER B 2 123 ? 9.803   15.271  32.783  1.00 18.06 ? 113 SER H CA  1 
ATOM   2656 C C   . SER B 2 123 ? 10.375  16.687  32.691  1.00 18.08 ? 113 SER H C   1 
ATOM   2657 O O   . SER B 2 123 ? 10.090  17.529  33.516  1.00 20.24 ? 113 SER H O   1 
ATOM   2658 C CB  . SER B 2 123 ? 10.142  14.627  34.109  1.00 18.64 ? 113 SER H CB  1 
ATOM   2659 O OG  . SER B 2 123 ? 11.539  14.676  34.282  1.00 21.76 ? 113 SER H OG  1 
ATOM   2660 N N   . ALA B 2 124 ? 11.195  16.944  31.680  1.00 19.47 ? 114 ALA H N   1 
ATOM   2661 C CA  . ALA B 2 124 ? 11.774  18.275  31.485  1.00 19.35 ? 114 ALA H CA  1 
ATOM   2662 C C   . ALA B 2 124 ? 10.621  19.196  31.155  1.00 19.67 ? 114 ALA H C   1 
ATOM   2663 O O   . ALA B 2 124 ? 9.673   18.801  30.466  1.00 20.16 ? 114 ALA H O   1 
ATOM   2664 C CB  . ALA B 2 124 ? 12.800  18.269  30.330  1.00 18.47 ? 114 ALA H CB  1 
ATOM   2665 N N   . LYS B 2 125 ? 10.728  20.439  31.601  1.00 20.98 ? 115 LYS H N   1 
ATOM   2666 C CA  . LYS B 2 125 ? 9.680   21.416  31.373  1.00 21.76 ? 115 LYS H CA  1 
ATOM   2667 C C   . LYS B 2 125 ? 9.880   22.220  30.107  1.00 19.76 ? 115 LYS H C   1 
ATOM   2668 O O   . LYS B 2 125 ? 11.006  22.508  29.676  1.00 19.51 ? 115 LYS H O   1 
ATOM   2669 C CB  . LYS B 2 125 ? 9.537   22.360  32.587  1.00 24.37 ? 115 LYS H CB  1 
ATOM   2670 C CG  . LYS B 2 125 ? 10.303  23.668  32.453  1.00 27.61 ? 115 LYS H CG  1 
ATOM   2671 C CD  . LYS B 2 125 ? 10.849  24.180  33.783  1.00 30.95 ? 115 LYS H CD  1 
ATOM   2672 C CE  . LYS B 2 125 ? 11.330  25.647  33.664  1.00 32.71 ? 115 LYS H CE  1 
ATOM   2673 N NZ  . LYS B 2 125 ? 12.101  25.951  32.406  1.00 33.59 ? 115 LYS H NZ  1 
ATOM   2674 N N   . THR B 2 126 ? 8.753   22.617  29.553  1.00 17.31 ? 116 THR H N   1 
ATOM   2675 C CA  . THR B 2 126 ? 8.706   23.413  28.363  1.00 17.00 ? 116 THR H CA  1 
ATOM   2676 C C   . THR B 2 126 ? 9.437   24.769  28.531  1.00 16.90 ? 116 THR H C   1 
ATOM   2677 O O   . THR B 2 126 ? 9.223   25.532  29.489  1.00 15.45 ? 116 THR H O   1 
ATOM   2678 C CB  . THR B 2 126 ? 7.238   23.546  27.940  1.00 17.21 ? 116 THR H CB  1 
ATOM   2679 O OG1 . THR B 2 126 ? 6.726   22.225  27.711  1.00 18.05 ? 116 THR H OG1 1 
ATOM   2680 C CG2 . THR B 2 126 ? 7.081   24.384  26.670  1.00 17.57 ? 116 THR H CG2 1 
ATOM   2681 N N   . THR B 2 127 ? 10.291  25.074  27.565  1.00 16.31 ? 117 THR H N   1 
ATOM   2682 C CA  . THR B 2 127 ? 11.080  26.285  27.613  1.00 15.06 ? 117 THR H CA  1 
ATOM   2683 C C   . THR B 2 127 ? 11.180  26.954  26.241  1.00 13.55 ? 117 THR H C   1 
ATOM   2684 O O   . THR B 2 127 ? 11.419  26.297  25.228  1.00 11.73 ? 117 THR H O   1 
ATOM   2685 C CB  . THR B 2 127 ? 12.483  25.947  28.173  1.00 15.99 ? 117 THR H CB  1 
ATOM   2686 O OG1 . THR B 2 127 ? 12.351  25.278  29.442  1.00 16.91 ? 117 THR H OG1 1 
ATOM   2687 C CG2 . THR B 2 127 ? 13.289  27.193  28.354  1.00 16.14 ? 117 THR H CG2 1 
ATOM   2688 N N   . ALA B 2 128 ? 10.882  28.249  26.231  1.00 12.42 ? 118 ALA H N   1 
ATOM   2689 C CA  . ALA B 2 128 ? 10.923  29.095  25.046  1.00 12.61 ? 118 ALA H CA  1 
ATOM   2690 C C   . ALA B 2 128 ? 12.376  29.345  24.658  1.00 12.47 ? 118 ALA H C   1 
ATOM   2691 O O   . ALA B 2 128 ? 13.240  29.440  25.519  1.00 12.97 ? 118 ALA H O   1 
ATOM   2692 C CB  . ALA B 2 128 ? 10.222  30.426  25.344  1.00 11.94 ? 118 ALA H CB  1 
ATOM   2693 N N   . PRO B 2 129 ? 12.656  29.490  23.353  1.00 12.92 ? 119 PRO H N   1 
ATOM   2694 C CA  . PRO B 2 129 ? 14.045  29.722  22.948  1.00 12.78 ? 119 PRO H CA  1 
ATOM   2695 C C   . PRO B 2 129 ? 14.418  31.177  22.861  1.00 14.00 ? 119 PRO H C   1 
ATOM   2696 O O   . PRO B 2 129 ? 13.558  32.064  22.823  1.00 14.40 ? 119 PRO H O   1 
ATOM   2697 C CB  . PRO B 2 129 ? 14.098  29.080  21.572  1.00 12.11 ? 119 PRO H CB  1 
ATOM   2698 C CG  . PRO B 2 129 ? 12.743  29.411  21.020  1.00 11.89 ? 119 PRO H CG  1 
ATOM   2699 C CD  . PRO B 2 129 ? 11.804  29.197  22.182  1.00 11.61 ? 119 PRO H CD  1 
ATOM   2700 N N   . SER B 2 130 ? 15.725  31.408  22.832  1.00 15.37 ? 120 SER H N   1 
ATOM   2701 C CA  . SER B 2 130 ? 16.296  32.740  22.689  1.00 15.31 ? 120 SER H CA  1 
ATOM   2702 C C   . SER B 2 130 ? 16.793  32.695  21.244  1.00 14.43 ? 120 SER H C   1 
ATOM   2703 O O   . SER B 2 130 ? 17.396  31.691  20.827  1.00 13.54 ? 120 SER H O   1 
ATOM   2704 C CB  . SER B 2 130 ? 17.472  32.913  23.661  1.00 18.32 ? 120 SER H CB  1 
ATOM   2705 O OG  . SER B 2 130 ? 17.072  32.882  25.032  1.00 19.62 ? 120 SER H OG  1 
ATOM   2706 N N   . VAL B 2 131 ? 16.477  33.733  20.474  1.00 13.16 ? 121 VAL H N   1 
ATOM   2707 C CA  . VAL B 2 131 ? 16.847  33.811  19.056  1.00 13.07 ? 121 VAL H CA  1 
ATOM   2708 C C   . VAL B 2 131 ? 17.871  34.921  18.847  1.00 13.19 ? 121 VAL H C   1 
ATOM   2709 O O   . VAL B 2 131 ? 17.623  36.065  19.182  1.00 13.86 ? 121 VAL H O   1 
ATOM   2710 C CB  . VAL B 2 131 ? 15.575  34.040  18.170  1.00 11.70 ? 121 VAL H CB  1 
ATOM   2711 C CG1 . VAL B 2 131 ? 15.928  34.159  16.712  1.00 9.66  ? 121 VAL H CG1 1 
ATOM   2712 C CG2 . VAL B 2 131 ? 14.633  32.873  18.352  1.00 11.37 ? 121 VAL H CG2 1 
ATOM   2713 N N   . TYR B 2 132 ? 19.042  34.571  18.341  1.00 13.71 ? 122 TYR H N   1 
ATOM   2714 C CA  . TYR B 2 132 ? 20.088  35.562  18.132  1.00 14.37 ? 122 TYR H CA  1 
ATOM   2715 C C   . TYR B 2 132 ? 20.460  35.667  16.676  1.00 15.41 ? 122 TYR H C   1 
ATOM   2716 O O   . TYR B 2 132 ? 20.542  34.673  15.964  1.00 14.92 ? 122 TYR H O   1 
ATOM   2717 C CB  . TYR B 2 132 ? 21.317  35.238  18.978  1.00 13.35 ? 122 TYR H CB  1 
ATOM   2718 C CG  . TYR B 2 132 ? 20.972  35.054  20.440  1.00 13.01 ? 122 TYR H CG  1 
ATOM   2719 C CD1 . TYR B 2 132 ? 20.455  36.111  21.185  1.00 12.55 ? 122 TYR H CD1 1 
ATOM   2720 C CD2 . TYR B 2 132 ? 21.157  33.820  21.077  1.00 12.49 ? 122 TYR H CD2 1 
ATOM   2721 C CE1 . TYR B 2 132 ? 20.131  35.952  22.526  1.00 12.56 ? 122 TYR H CE1 1 
ATOM   2722 C CE2 . TYR B 2 132 ? 20.840  33.651  22.420  1.00 12.90 ? 122 TYR H CE2 1 
ATOM   2723 C CZ  . TYR B 2 132 ? 20.330  34.725  23.132  1.00 12.84 ? 122 TYR H CZ  1 
ATOM   2724 O OH  . TYR B 2 132 ? 20.044  34.581  24.471  1.00 15.76 ? 122 TYR H OH  1 
ATOM   2725 N N   . PRO B 2 133 ? 20.653  36.893  16.203  1.00 17.36 ? 123 PRO H N   1 
ATOM   2726 C CA  . PRO B 2 133 ? 21.023  37.136  14.803  1.00 19.10 ? 123 PRO H CA  1 
ATOM   2727 C C   . PRO B 2 133 ? 22.525  36.929  14.620  1.00 20.28 ? 123 PRO H C   1 
ATOM   2728 O O   . PRO B 2 133 ? 23.307  37.276  15.513  1.00 22.47 ? 123 PRO H O   1 
ATOM   2729 C CB  . PRO B 2 133 ? 20.656  38.601  14.613  1.00 19.30 ? 123 PRO H CB  1 
ATOM   2730 C CG  . PRO B 2 133 ? 21.034  39.186  15.972  1.00 19.39 ? 123 PRO H CG  1 
ATOM   2731 C CD  . PRO B 2 133 ? 20.514  38.152  16.959  1.00 17.85 ? 123 PRO H CD  1 
ATOM   2732 N N   . LEU B 2 134 ? 22.930  36.343  13.501  1.00 19.71 ? 124 LEU H N   1 
ATOM   2733 C CA  . LEU B 2 134 ? 24.345  36.144  13.248  1.00 20.21 ? 124 LEU H CA  1 
ATOM   2734 C C   . LEU B 2 134 ? 24.754  36.917  11.991  1.00 21.95 ? 124 LEU H C   1 
ATOM   2735 O O   . LEU B 2 134 ? 24.385  36.527  10.893  1.00 20.78 ? 124 LEU H O   1 
ATOM   2736 C CB  . LEU B 2 134 ? 24.651  34.658  13.071  1.00 19.23 ? 124 LEU H CB  1 
ATOM   2737 C CG  . LEU B 2 134 ? 24.352  33.718  14.242  1.00 18.77 ? 124 LEU H CG  1 
ATOM   2738 C CD1 . LEU B 2 134 ? 24.537  32.286  13.822  1.00 16.42 ? 124 LEU H CD1 1 
ATOM   2739 C CD2 . LEU B 2 134 ? 25.257  34.050  15.424  1.00 19.42 ? 124 LEU H CD2 1 
ATOM   2740 N N   . ALA B 2 135 ? 25.386  38.083  12.169  1.00 25.13 ? 125 ALA H N   1 
ATOM   2741 C CA  . ALA B 2 135 ? 25.897  38.913  11.053  1.00 27.54 ? 125 ALA H CA  1 
ATOM   2742 C C   . ALA B 2 135 ? 27.416  38.775  11.104  1.00 29.83 ? 125 ALA H C   1 
ATOM   2743 O O   . ALA B 2 135 ? 28.009  38.698  12.183  1.00 29.04 ? 125 ALA H O   1 
ATOM   2744 C CB  . ALA B 2 135 ? 25.496  40.383  11.202  1.00 26.30 ? 125 ALA H CB  1 
ATOM   2745 N N   . PRO B 2 136 ? 28.070  38.753  9.941   1.00 33.62 ? 126 PRO H N   1 
ATOM   2746 C CA  . PRO B 2 136 ? 29.532  38.610  9.838   1.00 36.64 ? 126 PRO H CA  1 
ATOM   2747 C C   . PRO B 2 136 ? 30.419  39.705  10.425  1.00 40.05 ? 126 PRO H C   1 
ATOM   2748 O O   . PRO B 2 136 ? 30.073  40.880  10.416  1.00 38.32 ? 126 PRO H O   1 
ATOM   2749 C CB  . PRO B 2 136 ? 29.745  38.492  8.342   1.00 35.89 ? 126 PRO H CB  1 
ATOM   2750 C CG  . PRO B 2 136 ? 28.633  39.357  7.787   1.00 35.10 ? 126 PRO H CG  1 
ATOM   2751 C CD  . PRO B 2 136 ? 27.456  38.960  8.618   1.00 33.89 ? 126 PRO H CD  1 
ATOM   2752 N N   . VAL B 2 137 ? 31.553  39.282  10.972  1.00 46.24 ? 127 VAL H N   1 
ATOM   2753 C CA  . VAL B 2 137 ? 32.564  40.190  11.532  1.00 52.79 ? 127 VAL H CA  1 
ATOM   2754 C C   . VAL B 2 137 ? 33.878  39.911  10.803  1.00 57.02 ? 127 VAL H C   1 
ATOM   2755 O O   . VAL B 2 137 ? 34.713  40.815  10.628  1.00 58.33 ? 127 VAL H O   1 
ATOM   2756 C CB  . VAL B 2 137 ? 32.751  40.017  13.068  1.00 52.75 ? 127 VAL H CB  1 
ATOM   2757 C CG1 . VAL B 2 137 ? 34.231  40.169  13.480  1.00 52.05 ? 127 VAL H CG1 1 
ATOM   2758 C CG2 . VAL B 2 137 ? 31.910  41.068  13.797  1.00 53.72 ? 127 VAL H CG2 1 
ATOM   2759 N N   . CYS B 2 138 ? 34.060  38.646  10.409  1.00 61.07 ? 128 CYS H N   1 
ATOM   2760 C CA  . CYS B 2 138 ? 35.236  38.211  9.659   1.00 64.35 ? 128 CYS H CA  1 
ATOM   2761 C C   . CYS B 2 138 ? 34.821  37.076  8.744   1.00 66.67 ? 128 CYS H C   1 
ATOM   2762 O O   . CYS B 2 138 ? 34.962  37.176  7.528   1.00 67.26 ? 128 CYS H O   1 
ATOM   2763 C CB  . CYS B 2 138 ? 36.384  37.797  10.578  1.00 64.30 ? 128 CYS H CB  1 
ATOM   2764 S SG  . CYS B 2 138 ? 37.338  39.206  11.232  1.00 64.27 ? 128 CYS H SG  1 
ATOM   2765 N N   . GLY B 2 139 ? 34.267  36.017  9.323   1.00 69.53 ? 129 GLY H N   1 
ATOM   2766 C CA  . GLY B 2 139 ? 33.799  34.905  8.514   1.00 72.03 ? 129 GLY H CA  1 
ATOM   2767 C C   . GLY B 2 139 ? 32.535  35.409  7.856   1.00 73.89 ? 129 GLY H C   1 
ATOM   2768 O O   . GLY B 2 139 ? 31.579  35.782  8.547   1.00 74.08 ? 129 GLY H O   1 
ATOM   2769 N N   . ASP B 2 140 ? 32.525  35.429  6.530   1.00 75.98 ? 130 ASP H N   1 
ATOM   2770 C CA  . ASP B 2 140 ? 31.382  35.969  5.798   1.00 77.76 ? 130 ASP H CA  1 
ATOM   2771 C C   . ASP B 2 140 ? 31.255  35.558  4.334   1.00 78.23 ? 130 ASP H C   1 
ATOM   2772 O O   . ASP B 2 140 ? 30.149  35.342  3.844   1.00 78.22 ? 130 ASP H O   1 
ATOM   2773 C CB  . ASP B 2 140 ? 31.423  37.519  5.846   1.00 78.27 ? 130 ASP H CB  1 
ATOM   2774 C CG  . ASP B 2 140 ? 32.861  38.106  5.737   1.00 78.52 ? 130 ASP H CG  1 
ATOM   2775 O OD1 . ASP B 2 140 ? 33.749  37.486  5.107   1.00 78.53 ? 130 ASP H OD1 1 
ATOM   2776 O OD2 . ASP B 2 140 ? 33.107  39.196  6.301   1.00 78.21 ? 130 ASP H OD2 1 
ATOM   2777 N N   . THR B 2 141 ? 32.404  35.497  3.661   1.00 78.57 ? 131 THR H N   1 
ATOM   2778 C CA  . THR B 2 141 ? 32.571  35.214  2.227   1.00 78.37 ? 131 THR H CA  1 
ATOM   2779 C C   . THR B 2 141 ? 32.929  36.605  1.684   1.00 77.26 ? 131 THR H C   1 
ATOM   2780 O O   . THR B 2 141 ? 33.913  36.773  0.949   1.00 77.23 ? 131 THR H O   1 
ATOM   2781 C CB  . THR B 2 141 ? 31.282  34.688  1.498   1.00 79.05 ? 131 THR H CB  1 
ATOM   2782 O OG1 . THR B 2 141 ? 30.804  33.478  2.118   1.00 78.92 ? 131 THR H OG1 1 
ATOM   2783 C CG2 . THR B 2 141 ? 31.594  34.422  0.016   1.00 79.40 ? 131 THR H CG2 1 
ATOM   2784 N N   . THR B 2 142 ? 32.162  37.596  2.147   1.00 75.45 ? 132 THR H N   1 
ATOM   2785 C CA  . THR B 2 142 ? 32.318  39.017  1.825   1.00 73.54 ? 132 THR H CA  1 
ATOM   2786 C C   . THR B 2 142 ? 31.995  39.436  0.386   1.00 72.00 ? 132 THR H C   1 
ATOM   2787 O O   . THR B 2 142 ? 30.867  39.861  0.106   1.00 72.23 ? 132 THR H O   1 
ATOM   2788 C CB  . THR B 2 142 ? 33.724  39.568  2.233   1.00 73.81 ? 132 THR H CB  1 
ATOM   2789 O OG1 . THR B 2 142 ? 34.458  38.573  2.962   1.00 73.38 ? 132 THR H OG1 1 
ATOM   2790 C CG2 . THR B 2 142 ? 33.582  40.822  3.093   1.00 73.87 ? 132 THR H CG2 1 
ATOM   2791 N N   . GLY B 2 143 ? 32.991  39.350  -0.504  1.00 69.31 ? 133 GLY H N   1 
ATOM   2792 C CA  . GLY B 2 143 ? 32.818  39.736  -1.900  1.00 65.11 ? 133 GLY H CA  1 
ATOM   2793 C C   . GLY B 2 143 ? 32.072  38.693  -2.711  1.00 61.96 ? 133 GLY H C   1 
ATOM   2794 O O   . GLY B 2 143 ? 32.399  37.501  -2.629  1.00 62.72 ? 133 GLY H O   1 
ATOM   2795 N N   . SER B 2 144 ? 31.101  39.158  -3.506  1.00 57.98 ? 134 SER H N   1 
ATOM   2796 C CA  . SER B 2 144 ? 30.234  38.326  -4.352  1.00 53.74 ? 134 SER H CA  1 
ATOM   2797 C C   . SER B 2 144 ? 29.041  37.806  -3.535  1.00 50.37 ? 134 SER H C   1 
ATOM   2798 O O   . SER B 2 144 ? 27.884  38.039  -3.901  1.00 50.10 ? 134 SER H O   1 
ATOM   2799 C CB  . SER B 2 144 ? 31.003  37.160  -4.995  1.00 54.46 ? 134 SER H CB  1 
ATOM   2800 O OG  . SER B 2 144 ? 30.195  36.434  -5.906  1.00 54.70 ? 134 SER H OG  1 
ATOM   2801 N N   . SER B 2 145 ? 29.310  37.120  -2.427  1.00 45.76 ? 135 SER H N   1 
ATOM   2802 C CA  . SER B 2 145 ? 28.238  36.606  -1.586  1.00 41.08 ? 135 SER H CA  1 
ATOM   2803 C C   . SER B 2 145 ? 28.551  36.760  -0.104  1.00 38.03 ? 135 SER H C   1 
ATOM   2804 O O   . SER B 2 145 ? 29.715  36.903  0.292   1.00 37.54 ? 135 SER H O   1 
ATOM   2805 C CB  . SER B 2 145 ? 27.938  35.147  -1.914  1.00 40.46 ? 135 SER H CB  1 
ATOM   2806 O OG  . SER B 2 145 ? 29.033  34.324  -1.593  1.00 40.08 ? 135 SER H OG  1 
ATOM   2807 N N   . VAL B 2 146 ? 27.498  36.750  0.707   1.00 33.63 ? 136 VAL H N   1 
ATOM   2808 C CA  . VAL B 2 146 ? 27.625  36.883  2.142   1.00 29.64 ? 136 VAL H CA  1 
ATOM   2809 C C   . VAL B 2 146 ? 26.701  35.865  2.810   1.00 27.65 ? 136 VAL H C   1 
ATOM   2810 O O   . VAL B 2 146 ? 25.679  35.475  2.243   1.00 27.10 ? 136 VAL H O   1 
ATOM   2811 C CB  . VAL B 2 146 ? 27.254  38.324  2.596   1.00 29.61 ? 136 VAL H CB  1 
ATOM   2812 C CG1 . VAL B 2 146 ? 25.810  38.619  2.292   1.00 30.05 ? 136 VAL H CG1 1 
ATOM   2813 C CG2 . VAL B 2 146 ? 27.503  38.503  4.070   1.00 28.91 ? 136 VAL H CG2 1 
ATOM   2814 N N   . THR B 2 147 ? 27.126  35.333  3.947   1.00 25.04 ? 137 THR H N   1 
ATOM   2815 C CA  . THR B 2 147 ? 26.292  34.413  4.677   1.00 22.37 ? 137 THR H CA  1 
ATOM   2816 C C   . THR B 2 147 ? 25.973  34.880  6.097   1.00 20.46 ? 137 THR H C   1 
ATOM   2817 O O   . THR B 2 147 ? 26.826  35.367  6.846   1.00 19.66 ? 137 THR H O   1 
ATOM   2818 C CB  . THR B 2 147 ? 26.751  32.918  4.592   1.00 22.63 ? 137 THR H CB  1 
ATOM   2819 O OG1 . THR B 2 147 ? 26.858  32.341  5.908   1.00 22.86 ? 137 THR H OG1 1 
ATOM   2820 C CG2 . THR B 2 147 ? 28.006  32.752  3.762   1.00 21.80 ? 137 THR H CG2 1 
ATOM   2821 N N   . LEU B 2 148 ? 24.678  34.864  6.383   1.00 18.99 ? 138 LEU H N   1 
ATOM   2822 C CA  . LEU B 2 148 ? 24.153  35.275  7.666   1.00 16.06 ? 138 LEU H CA  1 
ATOM   2823 C C   . LEU B 2 148 ? 23.669  34.047  8.389   1.00 14.07 ? 138 LEU H C   1 
ATOM   2824 O O   . LEU B 2 148 ? 23.495  32.983  7.792   1.00 13.47 ? 138 LEU H O   1 
ATOM   2825 C CB  . LEU B 2 148 ? 22.974  36.219  7.482   1.00 17.08 ? 138 LEU H CB  1 
ATOM   2826 C CG  . LEU B 2 148 ? 23.089  37.599  6.832   1.00 17.72 ? 138 LEU H CG  1 
ATOM   2827 C CD1 . LEU B 2 148 ? 24.524  38.122  6.850   1.00 18.01 ? 138 LEU H CD1 1 
ATOM   2828 C CD2 . LEU B 2 148 ? 22.500  37.558  5.458   1.00 17.94 ? 138 LEU H CD2 1 
ATOM   2829 N N   . GLY B 2 149 ? 23.338  34.228  9.653   1.00 13.03 ? 139 GLY H N   1 
ATOM   2830 C CA  . GLY B 2 149 ? 22.878  33.111  10.436  1.00 12.74 ? 139 GLY H CA  1 
ATOM   2831 C C   . GLY B 2 149 ? 21.886  33.464  11.519  1.00 12.11 ? 139 GLY H C   1 
ATOM   2832 O O   . GLY B 2 149 ? 21.695  34.630  11.872  1.00 10.68 ? 139 GLY H O   1 
ATOM   2833 N N   . CYS B 2 150 ? 21.345  32.414  12.117  1.00 12.38 ? 140 CYS H N   1 
ATOM   2834 C CA  . CYS B 2 150 ? 20.362  32.540  13.162  1.00 13.38 ? 140 CYS H CA  1 
ATOM   2835 C C   . CYS B 2 150 ? 20.615  31.431  14.145  1.00 11.06 ? 140 CYS H C   1 
ATOM   2836 O O   . CYS B 2 150 ? 20.740  30.273  13.751  1.00 10.68 ? 140 CYS H O   1 
ATOM   2837 C CB  . CYS B 2 150 ? 18.992  32.344  12.544  1.00 16.83 ? 140 CYS H CB  1 
ATOM   2838 S SG  . CYS B 2 150 ? 17.715  33.209  13.458  1.00 22.24 ? 140 CYS H SG  1 
ATOM   2839 N N   . LEU B 2 151 ? 20.738  31.787  15.415  1.00 9.97  ? 141 LEU H N   1 
ATOM   2840 C CA  . LEU B 2 151 ? 20.998  30.818  16.470  1.00 10.00 ? 141 LEU H CA  1 
ATOM   2841 C C   . LEU B 2 151 ? 19.759  30.763  17.332  1.00 10.21 ? 141 LEU H C   1 
ATOM   2842 O O   . LEU B 2 151 ? 19.277  31.799  17.782  1.00 10.22 ? 141 LEU H O   1 
ATOM   2843 C CB  . LEU B 2 151 ? 22.197  31.254  17.331  1.00 9.25  ? 141 LEU H CB  1 
ATOM   2844 C CG  . LEU B 2 151 ? 22.606  30.357  18.515  1.00 10.04 ? 141 LEU H CG  1 
ATOM   2845 C CD1 . LEU B 2 151 ? 23.090  28.967  18.059  1.00 9.18  ? 141 LEU H CD1 1 
ATOM   2846 C CD2 . LEU B 2 151 ? 23.683  31.034  19.323  1.00 9.66  ? 141 LEU H CD2 1 
ATOM   2847 N N   . VAL B 2 152 ? 19.228  29.568  17.540  1.00 10.08 ? 142 VAL H N   1 
ATOM   2848 C CA  . VAL B 2 152 ? 18.037  29.395  18.352  1.00 10.62 ? 142 VAL H CA  1 
ATOM   2849 C C   . VAL B 2 152 ? 18.456  28.542  19.520  1.00 11.99 ? 142 VAL H C   1 
ATOM   2850 O O   . VAL B 2 152 ? 18.659  27.346  19.374  1.00 13.66 ? 142 VAL H O   1 
ATOM   2851 C CB  . VAL B 2 152 ? 16.980  28.638  17.563  1.00 11.01 ? 142 VAL H CB  1 
ATOM   2852 C CG1 . VAL B 2 152 ? 15.687  28.454  18.387  1.00 11.34 ? 142 VAL H CG1 1 
ATOM   2853 C CG2 . VAL B 2 152 ? 16.731  29.343  16.247  1.00 10.28 ? 142 VAL H CG2 1 
ATOM   2854 N N   . LYS B 2 153 ? 18.634  29.110  20.692  1.00 13.77 ? 143 LYS H N   1 
ATOM   2855 C CA  . LYS B 2 153 ? 19.058  28.211  21.755  1.00 15.30 ? 143 LYS H CA  1 
ATOM   2856 C C   . LYS B 2 153 ? 18.306  28.181  23.074  1.00 13.38 ? 143 LYS H C   1 
ATOM   2857 O O   . LYS B 2 153 ? 17.556  29.092  23.393  1.00 13.54 ? 143 LYS H O   1 
ATOM   2858 C CB  . LYS B 2 153 ? 20.565  28.320  21.975  1.00 17.24 ? 143 LYS H CB  1 
ATOM   2859 C CG  . LYS B 2 153 ? 21.040  29.547  22.606  1.00 18.47 ? 143 LYS H CG  1 
ATOM   2860 C CD  . LYS B 2 153 ? 22.504  29.347  22.952  1.00 21.83 ? 143 LYS H CD  1 
ATOM   2861 C CE  . LYS B 2 153 ? 22.681  28.084  23.799  1.00 24.75 ? 143 LYS H CE  1 
ATOM   2862 N NZ  . LYS B 2 153 ? 23.848  28.109  24.751  1.00 26.09 ? 143 LYS H NZ  1 
ATOM   2863 N N   . GLY B 2 154 ? 18.425  27.061  23.771  1.00 12.32 ? 144 GLY H N   1 
ATOM   2864 C CA  . GLY B 2 154 ? 17.777  26.926  25.053  1.00 12.63 ? 144 GLY H CA  1 
ATOM   2865 C C   . GLY B 2 154 ? 16.272  26.674  25.023  1.00 12.50 ? 144 GLY H C   1 
ATOM   2866 O O   . GLY B 2 154 ? 15.498  27.304  25.755  1.00 14.59 ? 144 GLY H O   1 
ATOM   2867 N N   . TYR B 2 155 ? 15.830  25.717  24.231  1.00 11.77 ? 145 TYR H N   1 
ATOM   2868 C CA  . TYR B 2 155 ? 14.401  25.473  24.198  1.00 10.53 ? 145 TYR H CA  1 
ATOM   2869 C C   . TYR B 2 155 ? 14.036  24.017  24.439  1.00 9.83  ? 145 TYR H C   1 
ATOM   2870 O O   . TYR B 2 155 ? 14.876  23.115  24.367  1.00 10.43 ? 145 TYR H O   1 
ATOM   2871 C CB  . TYR B 2 155 ? 13.800  26.010  22.893  1.00 9.19  ? 145 TYR H CB  1 
ATOM   2872 C CG  . TYR B 2 155 ? 14.163  25.232  21.649  1.00 9.59  ? 145 TYR H CG  1 
ATOM   2873 C CD1 . TYR B 2 155 ? 13.407  24.119  21.247  1.00 9.45  ? 145 TYR H CD1 1 
ATOM   2874 C CD2 . TYR B 2 155 ? 15.283  25.565  20.906  1.00 9.47  ? 145 TYR H CD2 1 
ATOM   2875 C CE1 . TYR B 2 155 ? 13.775  23.367  20.151  1.00 9.62  ? 145 TYR H CE1 1 
ATOM   2876 C CE2 . TYR B 2 155 ? 15.664  24.818  19.802  1.00 9.03  ? 145 TYR H CE2 1 
ATOM   2877 C CZ  . TYR B 2 155 ? 14.919  23.724  19.428  1.00 9.80  ? 145 TYR H CZ  1 
ATOM   2878 O OH  . TYR B 2 155 ? 15.330  22.980  18.343  1.00 10.19 ? 145 TYR H OH  1 
ATOM   2879 N N   . PHE B 2 156 ? 12.794  23.789  24.817  1.00 9.71  ? 146 PHE H N   1 
ATOM   2880 C CA  . PHE B 2 156 ? 12.338  22.434  25.020  1.00 9.86  ? 146 PHE H CA  1 
ATOM   2881 C C   . PHE B 2 156 ? 10.825  22.473  25.016  1.00 10.15 ? 146 PHE H C   1 
ATOM   2882 O O   . PHE B 2 156 ? 10.227  23.459  25.424  1.00 10.59 ? 146 PHE H O   1 
ATOM   2883 C CB  . PHE B 2 156 ? 12.887  21.841  26.316  1.00 8.98  ? 146 PHE H CB  1 
ATOM   2884 C CG  . PHE B 2 156 ? 12.718  20.348  26.404  1.00 9.32  ? 146 PHE H CG  1 
ATOM   2885 C CD1 . PHE B 2 156 ? 13.670  19.503  25.868  1.00 9.34  ? 146 PHE H CD1 1 
ATOM   2886 C CD2 . PHE B 2 156 ? 11.584  19.785  27.016  1.00 10.61 ? 146 PHE H CD2 1 
ATOM   2887 C CE1 . PHE B 2 156 ? 13.516  18.126  25.928  1.00 10.60 ? 146 PHE H CE1 1 
ATOM   2888 C CE2 . PHE B 2 156 ? 11.406  18.402  27.088  1.00 10.08 ? 146 PHE H CE2 1 
ATOM   2889 C CZ  . PHE B 2 156 ? 12.382  17.562  26.538  1.00 10.82 ? 146 PHE H CZ  1 
ATOM   2890 N N   . PRO B 2 157 ? 10.198  21.500  24.361  1.00 11.19 ? 147 PRO H N   1 
ATOM   2891 C CA  . PRO B 2 157 ? 10.770  20.381  23.604  1.00 10.72 ? 147 PRO H CA  1 
ATOM   2892 C C   . PRO B 2 157 ? 10.853  20.701  22.120  1.00 10.99 ? 147 PRO H C   1 
ATOM   2893 O O   . PRO B 2 157 ? 10.606  21.832  21.684  1.00 10.59 ? 147 PRO H O   1 
ATOM   2894 C CB  . PRO B 2 157 ? 9.710   19.303  23.811  1.00 11.37 ? 147 PRO H CB  1 
ATOM   2895 C CG  . PRO B 2 157 ? 8.428   20.111  23.663  1.00 11.05 ? 147 PRO H CG  1 
ATOM   2896 C CD  . PRO B 2 157 ? 8.726   21.370  24.479  1.00 10.99 ? 147 PRO H CD  1 
ATOM   2897 N N   . GLU B 2 158 ? 11.253  19.712  21.345  1.00 13.38 ? 148 GLU H N   1 
ATOM   2898 C CA  . GLU B 2 158 ? 11.246  19.876  19.892  1.00 16.31 ? 148 GLU H CA  1 
ATOM   2899 C C   . GLU B 2 158 ? 9.752   19.757  19.484  1.00 16.84 ? 148 GLU H C   1 
ATOM   2900 O O   . GLU B 2 158 ? 8.944   19.195  20.228  1.00 17.27 ? 148 GLU H O   1 
ATOM   2901 C CB  . GLU B 2 158 ? 12.060  18.780  19.207  1.00 16.76 ? 148 GLU H CB  1 
ATOM   2902 C CG  . GLU B 2 158 ? 13.521  19.132  19.082  1.00 19.74 ? 148 GLU H CG  1 
ATOM   2903 C CD  . GLU B 2 158 ? 13.861  19.719  17.727  1.00 21.89 ? 148 GLU H CD  1 
ATOM   2904 O OE1 . GLU B 2 158 ? 13.679  20.948  17.479  1.00 22.24 ? 148 GLU H OE1 1 
ATOM   2905 O OE2 . GLU B 2 158 ? 14.323  18.918  16.896  1.00 23.79 ? 148 GLU H OE2 1 
ATOM   2906 N N   . PRO B 2 159 ? 9.364   20.311  18.320  1.00 16.52 ? 149 PRO H N   1 
ATOM   2907 C CA  . PRO B 2 159 ? 10.226  21.032  17.370  1.00 15.50 ? 149 PRO H CA  1 
ATOM   2908 C C   . PRO B 2 159 ? 10.105  22.542  17.396  1.00 14.84 ? 149 PRO H C   1 
ATOM   2909 O O   . PRO B 2 159 ? 9.284   23.128  18.094  1.00 13.93 ? 149 PRO H O   1 
ATOM   2910 C CB  . PRO B 2 159 ? 9.725   20.513  16.034  1.00 16.01 ? 149 PRO H CB  1 
ATOM   2911 C CG  . PRO B 2 159 ? 8.222   20.497  16.281  1.00 17.25 ? 149 PRO H CG  1 
ATOM   2912 C CD  . PRO B 2 159 ? 8.064   19.976  17.708  1.00 15.08 ? 149 PRO H CD  1 
ATOM   2913 N N   . VAL B 2 160 ? 10.933  23.156  16.577  1.00 15.21 ? 150 VAL H N   1 
ATOM   2914 C CA  . VAL B 2 160 ? 10.939  24.593  16.389  1.00 15.85 ? 150 VAL H CA  1 
ATOM   2915 C C   . VAL B 2 160 ? 10.816  24.706  14.857  1.00 16.32 ? 150 VAL H C   1 
ATOM   2916 O O   . VAL B 2 160 ? 11.140  23.760  14.149  1.00 16.12 ? 150 VAL H O   1 
ATOM   2917 C CB  . VAL B 2 160 ? 12.271  25.228  16.933  1.00 15.21 ? 150 VAL H CB  1 
ATOM   2918 C CG1 . VAL B 2 160 ? 12.896  26.186  15.927  1.00 15.73 ? 150 VAL H CG1 1 
ATOM   2919 C CG2 . VAL B 2 160 ? 12.016  25.965  18.226  1.00 14.17 ? 150 VAL H CG2 1 
ATOM   2920 N N   . THR B 2 161 ? 10.242  25.794  14.359  1.00 16.65 ? 151 THR H N   1 
ATOM   2921 C CA  . THR B 2 161 ? 10.134  25.998  12.922  1.00 18.19 ? 151 THR H CA  1 
ATOM   2922 C C   . THR B 2 161 ? 10.929  27.272  12.629  1.00 16.35 ? 151 THR H C   1 
ATOM   2923 O O   . THR B 2 161 ? 10.739  28.290  13.317  1.00 16.18 ? 151 THR H O   1 
ATOM   2924 C CB  . THR B 2 161 ? 8.666   26.188  12.498  1.00 20.64 ? 151 THR H CB  1 
ATOM   2925 O OG1 . THR B 2 161 ? 7.873   25.157  13.108  1.00 24.52 ? 151 THR H OG1 1 
ATOM   2926 C CG2 . THR B 2 161 ? 8.520   26.092  10.969  1.00 22.07 ? 151 THR H CG2 1 
ATOM   2927 N N   . LEU B 2 162 ? 11.862  27.185  11.675  1.00 14.29 ? 152 LEU H N   1 
ATOM   2928 C CA  . LEU B 2 162 ? 12.714  28.323  11.300  1.00 12.18 ? 152 LEU H CA  1 
ATOM   2929 C C   . LEU B 2 162 ? 12.644  28.607  9.783   1.00 11.16 ? 152 LEU H C   1 
ATOM   2930 O O   . LEU B 2 162 ? 12.732  27.698  8.975   1.00 8.85  ? 152 LEU H O   1 
ATOM   2931 C CB  . LEU B 2 162 ? 14.188  28.082  11.752  1.00 11.98 ? 152 LEU H CB  1 
ATOM   2932 C CG  . LEU B 2 162 ? 15.252  29.206  11.651  1.00 10.74 ? 152 LEU H CG  1 
ATOM   2933 C CD1 . LEU B 2 162 ? 16.398  28.982  12.598  1.00 10.70 ? 152 LEU H CD1 1 
ATOM   2934 C CD2 . LEU B 2 162 ? 15.759  29.356  10.239  1.00 9.99  ? 152 LEU H CD2 1 
ATOM   2935 N N   . THR B 2 163 ? 12.404  29.860  9.409   1.00 9.34  ? 154 THR H N   1 
ATOM   2936 C CA  . THR B 2 163 ? 12.367  30.206  8.004   1.00 9.13  ? 154 THR H CA  1 
ATOM   2937 C C   . THR B 2 163 ? 13.043  31.542  7.870   1.00 8.16  ? 154 THR H C   1 
ATOM   2938 O O   . THR B 2 163 ? 13.272  32.225  8.850   1.00 6.94  ? 154 THR H O   1 
ATOM   2939 C CB  . THR B 2 163 ? 10.935  30.350  7.451   1.00 9.68  ? 154 THR H CB  1 
ATOM   2940 O OG1 . THR B 2 163 ? 10.218  31.353  8.190   1.00 10.83 ? 154 THR H OG1 1 
ATOM   2941 C CG2 . THR B 2 163 ? 10.200  29.025  7.487   1.00 10.27 ? 154 THR H CG2 1 
ATOM   2942 N N   . TRP B 2 164 ? 13.344  31.898  6.635   1.00 8.89  ? 155 TRP H N   1 
ATOM   2943 C CA  . TRP B 2 164 ? 13.971  33.160  6.308   1.00 10.21 ? 155 TRP H CA  1 
ATOM   2944 C C   . TRP B 2 164 ? 12.993  33.920  5.437   1.00 10.80 ? 155 TRP H C   1 
ATOM   2945 O O   . TRP B 2 164 ? 12.517  33.394  4.433   1.00 11.31 ? 155 TRP H O   1 
ATOM   2946 C CB  . TRP B 2 164 ? 15.275  32.924  5.529   1.00 9.27  ? 155 TRP H CB  1 
ATOM   2947 C CG  . TRP B 2 164 ? 16.337  32.294  6.365   1.00 7.96  ? 155 TRP H CG  1 
ATOM   2948 C CD1 . TRP B 2 164 ? 16.606  30.954  6.500   1.00 7.29  ? 155 TRP H CD1 1 
ATOM   2949 C CD2 . TRP B 2 164 ? 17.229  32.976  7.241   1.00 7.77  ? 155 TRP H CD2 1 
ATOM   2950 N NE1 . TRP B 2 164 ? 17.602  30.764  7.423   1.00 7.86  ? 155 TRP H NE1 1 
ATOM   2951 C CE2 . TRP B 2 164 ? 18.012  31.989  7.891   1.00 8.09  ? 155 TRP H CE2 1 
ATOM   2952 C CE3 . TRP B 2 164 ? 17.445  34.336  7.548   1.00 7.88  ? 155 TRP H CE3 1 
ATOM   2953 C CZ2 . TRP B 2 164 ? 19.003  32.318  8.831   1.00 7.50  ? 155 TRP H CZ2 1 
ATOM   2954 C CZ3 . TRP B 2 164 ? 18.428  34.666  8.487   1.00 7.85  ? 155 TRP H CZ3 1 
ATOM   2955 C CH2 . TRP B 2 164 ? 19.194  33.659  9.115   1.00 8.63  ? 155 TRP H CH2 1 
ATOM   2956 N N   . ASN B 2 165 ? 12.683  35.149  5.831   1.00 13.05 ? 160 ASN H N   1 
ATOM   2957 C CA  . ASN B 2 165 ? 11.760  35.992  5.072   1.00 14.68 ? 160 ASN H CA  1 
ATOM   2958 C C   . ASN B 2 165 ? 10.448  35.250  4.815   1.00 14.86 ? 160 ASN H C   1 
ATOM   2959 O O   . ASN B 2 165 ? 9.951   35.219  3.684   1.00 14.62 ? 160 ASN H O   1 
ATOM   2960 C CB  . ASN B 2 165 ? 12.421  36.434  3.754   1.00 15.07 ? 160 ASN H CB  1 
ATOM   2961 C CG  . ASN B 2 165 ? 13.386  37.583  3.949   1.00 15.46 ? 160 ASN H CG  1 
ATOM   2962 O OD1 . ASN B 2 165 ? 13.511  38.112  5.056   1.00 16.55 ? 160 ASN H OD1 1 
ATOM   2963 N ND2 . ASN B 2 165 ? 14.058  37.991  2.887   1.00 15.46 ? 160 ASN H ND2 1 
ATOM   2964 N N   . SER B 2 166 ? 9.946   34.610  5.868   1.00 14.88 ? 161 SER H N   1 
ATOM   2965 C CA  . SER B 2 166 ? 8.697   33.824  5.843   1.00 17.04 ? 161 SER H CA  1 
ATOM   2966 C C   . SER B 2 166 ? 8.760   32.569  4.968   1.00 17.73 ? 161 SER H C   1 
ATOM   2967 O O   . SER B 2 166 ? 7.734   31.897  4.760   1.00 17.58 ? 161 SER H O   1 
ATOM   2968 C CB  . SER B 2 166 ? 7.507   34.673  5.396   1.00 16.95 ? 161 SER H CB  1 
ATOM   2969 O OG  . SER B 2 166 ? 7.419   35.865  6.156   1.00 19.64 ? 161 SER H OG  1 
ATOM   2970 N N   . GLY B 2 167 ? 9.958   32.255  4.460   1.00 17.84 ? 162 GLY H N   1 
ATOM   2971 C CA  . GLY B 2 167 ? 10.137  31.087  3.619   1.00 16.56 ? 162 GLY H CA  1 
ATOM   2972 C C   . GLY B 2 167 ? 10.331  31.492  2.176   1.00 17.27 ? 162 GLY H C   1 
ATOM   2973 O O   . GLY B 2 167 ? 10.463  30.627  1.301   1.00 16.74 ? 162 GLY H O   1 
ATOM   2974 N N   . SER B 2 168 ? 10.309  32.801  1.907   1.00 17.48 ? 163 SER H N   1 
ATOM   2975 C CA  . SER B 2 168 ? 10.510  33.261  0.536   1.00 17.67 ? 163 SER H CA  1 
ATOM   2976 C C   . SER B 2 168 ? 11.967  33.046  0.159   1.00 18.16 ? 163 SER H C   1 
ATOM   2977 O O   . SER B 2 168 ? 12.291  32.908  -1.031  1.00 18.24 ? 163 SER H O   1 
ATOM   2978 C CB  . SER B 2 168 ? 10.056  34.721  0.318   1.00 17.59 ? 163 SER H CB  1 
ATOM   2979 O OG  . SER B 2 168 ? 10.747  35.664  1.115   1.00 17.48 ? 163 SER H OG  1 
ATOM   2980 N N   . LEU B 2 169 ? 12.839  32.984  1.170   1.00 17.48 ? 164 LEU H N   1 
ATOM   2981 C CA  . LEU B 2 169 ? 14.265  32.724  0.933   1.00 19.12 ? 164 LEU H CA  1 
ATOM   2982 C C   . LEU B 2 169 ? 14.489  31.256  1.244   1.00 19.27 ? 164 LEU H C   1 
ATOM   2983 O O   . LEU B 2 169 ? 14.516  30.868  2.413   1.00 18.81 ? 164 LEU H O   1 
ATOM   2984 C CB  . LEU B 2 169 ? 15.142  33.591  1.845   1.00 19.07 ? 164 LEU H CB  1 
ATOM   2985 C CG  . LEU B 2 169 ? 16.093  34.587  1.187   1.00 19.40 ? 164 LEU H CG  1 
ATOM   2986 C CD1 . LEU B 2 169 ? 15.421  35.331  0.046   1.00 19.42 ? 164 LEU H CD1 1 
ATOM   2987 C CD2 . LEU B 2 169 ? 16.568  35.556  2.245   1.00 19.59 ? 164 LEU H CD2 1 
ATOM   2988 N N   . SER B 2 170 ? 14.603  30.432  0.209   1.00 20.83 ? 165 SER H N   1 
ATOM   2989 C CA  . SER B 2 170 ? 14.784  29.000  0.410   1.00 22.59 ? 165 SER H CA  1 
ATOM   2990 C C   . SER B 2 170 ? 16.078  28.425  -0.143  1.00 23.23 ? 165 SER H C   1 
ATOM   2991 O O   . SER B 2 170 ? 16.563  27.396  0.352   1.00 23.89 ? 165 SER H O   1 
ATOM   2992 C CB  . SER B 2 170 ? 13.577  28.209  -0.123  1.00 23.46 ? 165 SER H CB  1 
ATOM   2993 O OG  . SER B 2 170 ? 13.414  28.364  -1.537  1.00 24.74 ? 165 SER H OG  1 
ATOM   2994 N N   . SER B 2 171 ? 16.609  29.035  -1.197  1.00 23.42 ? 166 SER H N   1 
ATOM   2995 C CA  . SER B 2 171 ? 17.876  28.555  -1.755  1.00 24.22 ? 166 SER H CA  1 
ATOM   2996 C C   . SER B 2 171 ? 19.025  29.090  -0.917  1.00 22.37 ? 166 SER H C   1 
ATOM   2997 O O   . SER B 2 171 ? 18.943  30.177  -0.347  1.00 23.90 ? 166 SER H O   1 
ATOM   2998 C CB  . SER B 2 171 ? 18.073  29.015  -3.204  1.00 25.30 ? 166 SER H CB  1 
ATOM   2999 O OG  . SER B 2 171 ? 17.186  28.323  -4.070  1.00 29.23 ? 166 SER H OG  1 
ATOM   3000 N N   . GLY B 2 172 ? 20.098  28.330  -0.846  1.00 20.56 ? 167 GLY H N   1 
ATOM   3001 C CA  . GLY B 2 172 ? 21.240  28.788  -0.081  1.00 20.01 ? 167 GLY H CA  1 
ATOM   3002 C C   . GLY B 2 172 ? 21.073  28.768  1.433   1.00 18.34 ? 167 GLY H C   1 
ATOM   3003 O O   . GLY B 2 172 ? 21.867  29.408  2.150   1.00 17.46 ? 167 GLY H O   1 
ATOM   3004 N N   . VAL B 2 173 ? 20.048  28.076  1.936   1.00 16.41 ? 169 VAL H N   1 
ATOM   3005 C CA  . VAL B 2 173 ? 19.887  28.017  3.372   1.00 15.07 ? 169 VAL H CA  1 
ATOM   3006 C C   . VAL B 2 173 ? 20.140  26.593  3.868   1.00 13.88 ? 169 VAL H C   1 
ATOM   3007 O O   . VAL B 2 173 ? 19.911  25.637  3.137   1.00 13.39 ? 169 VAL H O   1 
ATOM   3008 C CB  . VAL B 2 173 ? 18.517  28.608  3.867   1.00 15.20 ? 169 VAL H CB  1 
ATOM   3009 C CG1 . VAL B 2 173 ? 17.984  29.660  2.907   1.00 13.74 ? 169 VAL H CG1 1 
ATOM   3010 C CG2 . VAL B 2 173 ? 17.537  27.550  4.156   1.00 14.42 ? 169 VAL H CG2 1 
ATOM   3011 N N   . HIS B 2 174 ? 20.744  26.474  5.049   1.00 12.96 ? 170 HIS H N   1 
ATOM   3012 C CA  . HIS B 2 174 ? 21.024  25.182  5.674   1.00 13.28 ? 170 HIS H CA  1 
ATOM   3013 C C   . HIS B 2 174 ? 20.559  25.316  7.103   1.00 13.47 ? 170 HIS H C   1 
ATOM   3014 O O   . HIS B 2 174 ? 21.022  26.211  7.813   1.00 14.72 ? 170 HIS H O   1 
ATOM   3015 C CB  . HIS B 2 174 ? 22.526  24.869  5.728   1.00 14.25 ? 170 HIS H CB  1 
ATOM   3016 C CG  . HIS B 2 174 ? 23.169  24.700  4.388   1.00 14.47 ? 170 HIS H CG  1 
ATOM   3017 N ND1 . HIS B 2 174 ? 24.005  25.647  3.842   1.00 15.85 ? 170 HIS H ND1 1 
ATOM   3018 C CD2 . HIS B 2 174 ? 23.112  23.686  3.497   1.00 14.52 ? 170 HIS H CD2 1 
ATOM   3019 C CE1 . HIS B 2 174 ? 24.440  25.225  2.667   1.00 15.52 ? 170 HIS H CE1 1 
ATOM   3020 N NE2 . HIS B 2 174 ? 23.914  24.040  2.438   1.00 15.74 ? 170 HIS H NE2 1 
ATOM   3021 N N   . THR B 2 175 ? 19.614  24.477  7.512   1.00 13.66 ? 171 THR H N   1 
ATOM   3022 C CA  . THR B 2 175 ? 19.102  24.488  8.875   1.00 13.95 ? 171 THR H CA  1 
ATOM   3023 C C   . THR B 2 175 ? 19.644  23.220  9.483   1.00 14.36 ? 171 THR H C   1 
ATOM   3024 O O   . THR B 2 175 ? 19.448  22.146  8.936   1.00 15.49 ? 171 THR H O   1 
ATOM   3025 C CB  . THR B 2 175 ? 17.549  24.524  8.927   1.00 13.50 ? 171 THR H CB  1 
ATOM   3026 O OG1 . THR B 2 175 ? 17.097  25.766  8.364   1.00 14.04 ? 171 THR H OG1 1 
ATOM   3027 C CG2 . THR B 2 175 ? 17.042  24.436  10.365  1.00 12.03 ? 171 THR H CG2 1 
ATOM   3028 N N   . PHE B 2 176 ? 20.406  23.364  10.561  1.00 14.04 ? 172 PHE H N   1 
ATOM   3029 C CA  . PHE B 2 176 ? 21.017  22.223  11.202  1.00 13.99 ? 172 PHE H CA  1 
ATOM   3030 C C   . PHE B 2 176 ? 20.147  21.574  12.277  1.00 15.00 ? 172 PHE H C   1 
ATOM   3031 O O   . PHE B 2 176 ? 19.463  22.250  13.059  1.00 16.36 ? 172 PHE H O   1 
ATOM   3032 C CB  . PHE B 2 176 ? 22.390  22.616  11.756  1.00 12.61 ? 172 PHE H CB  1 
ATOM   3033 C CG  . PHE B 2 176 ? 23.302  23.202  10.717  1.00 11.93 ? 172 PHE H CG  1 
ATOM   3034 C CD1 . PHE B 2 176 ? 23.243  24.550  10.403  1.00 12.15 ? 172 PHE H CD1 1 
ATOM   3035 C CD2 . PHE B 2 176 ? 24.159  22.397  9.993   1.00 11.94 ? 172 PHE H CD2 1 
ATOM   3036 C CE1 . PHE B 2 176 ? 24.027  25.088  9.369   1.00 12.18 ? 172 PHE H CE1 1 
ATOM   3037 C CE2 . PHE B 2 176 ? 24.935  22.926  8.963   1.00 11.54 ? 172 PHE H CE2 1 
ATOM   3038 C CZ  . PHE B 2 176 ? 24.871  24.271  8.650   1.00 10.59 ? 172 PHE H CZ  1 
ATOM   3039 N N   . PRO B 2 177 ? 20.146  20.244  12.311  1.00 14.60 ? 173 PRO H N   1 
ATOM   3040 C CA  . PRO B 2 177 ? 19.386  19.434  13.265  1.00 14.63 ? 173 PRO H CA  1 
ATOM   3041 C C   . PRO B 2 177 ? 19.669  19.875  14.694  1.00 15.19 ? 173 PRO H C   1 
ATOM   3042 O O   . PRO B 2 177 ? 20.812  20.100  15.049  1.00 15.36 ? 173 PRO H O   1 
ATOM   3043 C CB  . PRO B 2 177 ? 19.946  18.035  13.029  1.00 14.63 ? 173 PRO H CB  1 
ATOM   3044 C CG  . PRO B 2 177 ? 20.300  18.063  11.551  1.00 15.03 ? 173 PRO H CG  1 
ATOM   3045 C CD  . PRO B 2 177 ? 20.922  19.407  11.376  1.00 14.39 ? 173 PRO H CD  1 
ATOM   3046 N N   . ALA B 2 178 ? 18.623  20.017  15.499  1.00 15.56 ? 174 ALA H N   1 
ATOM   3047 C CA  . ALA B 2 178 ? 18.754  20.416  16.894  1.00 16.23 ? 174 ALA H CA  1 
ATOM   3048 C C   . ALA B 2 178 ? 19.555  19.394  17.698  1.00 17.00 ? 174 ALA H C   1 
ATOM   3049 O O   . ALA B 2 178 ? 19.478  18.179  17.449  1.00 16.89 ? 174 ALA H O   1 
ATOM   3050 C CB  . ALA B 2 178 ? 17.369  20.607  17.521  1.00 15.55 ? 174 ALA H CB  1 
ATOM   3051 N N   . VAL B 2 179 ? 20.334  19.899  18.647  1.00 17.38 ? 175 VAL H N   1 
ATOM   3052 C CA  . VAL B 2 179 ? 21.150  19.066  19.515  1.00 18.15 ? 175 VAL H CA  1 
ATOM   3053 C C   . VAL B 2 179 ? 20.717  19.382  20.923  1.00 18.58 ? 175 VAL H C   1 
ATOM   3054 O O   . VAL B 2 179 ? 20.616  20.541  21.296  1.00 19.39 ? 175 VAL H O   1 
ATOM   3055 C CB  . VAL B 2 179 ? 22.666  19.371  19.392  1.00 18.00 ? 175 VAL H CB  1 
ATOM   3056 C CG1 . VAL B 2 179 ? 23.440  18.609  20.466  1.00 18.08 ? 175 VAL H CG1 1 
ATOM   3057 C CG2 . VAL B 2 179 ? 23.171  18.968  18.036  1.00 16.83 ? 175 VAL H CG2 1 
ATOM   3058 N N   . LEU B 2 180 ? 20.430  18.335  21.681  1.00 20.42 ? 176 LEU H N   1 
ATOM   3059 C CA  . LEU B 2 180 ? 19.996  18.436  23.058  1.00 21.84 ? 176 LEU H CA  1 
ATOM   3060 C C   . LEU B 2 180 ? 21.218  18.426  23.952  1.00 24.44 ? 176 LEU H C   1 
ATOM   3061 O O   . LEU B 2 180 ? 22.096  17.592  23.795  1.00 24.18 ? 176 LEU H O   1 
ATOM   3062 C CB  . LEU B 2 180 ? 19.105  17.224  23.384  1.00 20.55 ? 176 LEU H CB  1 
ATOM   3063 C CG  . LEU B 2 180 ? 18.312  17.035  24.689  1.00 19.48 ? 176 LEU H CG  1 
ATOM   3064 C CD1 . LEU B 2 180 ? 19.157  16.423  25.756  1.00 20.59 ? 176 LEU H CD1 1 
ATOM   3065 C CD2 . LEU B 2 180 ? 17.737  18.333  25.154  1.00 18.59 ? 176 LEU H CD2 1 
ATOM   3066 N N   . GLN B 2 181 ? 21.295  19.399  24.846  1.00 28.83 ? 177 GLN H N   1 
ATOM   3067 C CA  . GLN B 2 181 ? 22.363  19.498  25.840  1.00 32.22 ? 177 GLN H CA  1 
ATOM   3068 C C   . GLN B 2 181 ? 21.725  19.988  27.135  1.00 32.62 ? 177 GLN H C   1 
ATOM   3069 O O   . GLN B 2 181 ? 21.137  21.073  27.181  1.00 32.27 ? 177 GLN H O   1 
ATOM   3070 C CB  . GLN B 2 181 ? 23.474  20.461  25.406  1.00 34.94 ? 177 GLN H CB  1 
ATOM   3071 C CG  . GLN B 2 181 ? 24.331  19.924  24.257  1.00 38.89 ? 177 GLN H CG  1 
ATOM   3072 C CD  . GLN B 2 181 ? 25.716  20.553  24.189  1.00 40.97 ? 177 GLN H CD  1 
ATOM   3073 O OE1 . GLN B 2 181 ? 25.950  21.651  24.712  1.00 42.24 ? 177 GLN H OE1 1 
ATOM   3074 N NE2 . GLN B 2 181 ? 26.650  19.850  23.543  1.00 42.27 ? 177 GLN H NE2 1 
ATOM   3075 N N   . SER B 2 182 ? 21.785  19.140  28.159  1.00 33.56 ? 178 SER H N   1 
ATOM   3076 C CA  . SER B 2 182 ? 21.232  19.435  29.480  1.00 34.35 ? 178 SER H CA  1 
ATOM   3077 C C   . SER B 2 182 ? 19.739  19.822  29.472  1.00 33.76 ? 178 SER H C   1 
ATOM   3078 O O   . SER B 2 182 ? 19.315  20.834  30.058  1.00 34.14 ? 178 SER H O   1 
ATOM   3079 C CB  . SER B 2 182 ? 22.111  20.464  30.224  1.00 35.40 ? 178 SER H CB  1 
ATOM   3080 O OG  . SER B 2 182 ? 22.320  21.677  29.502  1.00 38.37 ? 178 SER H OG  1 
ATOM   3081 N N   . ASP B 2 183 ? 18.948  18.952  28.844  1.00 32.01 ? 181 ASP H N   1 
ATOM   3082 C CA  . ASP B 2 183 ? 17.504  19.130  28.715  1.00 30.00 ? 181 ASP H CA  1 
ATOM   3083 C C   . ASP B 2 183 ? 17.082  20.366  27.952  1.00 26.74 ? 181 ASP H C   1 
ATOM   3084 O O   . ASP B 2 183 ? 15.955  20.813  28.100  1.00 27.39 ? 181 ASP H O   1 
ATOM   3085 C CB  . ASP B 2 183 ? 16.800  19.091  30.076  1.00 32.76 ? 181 ASP H CB  1 
ATOM   3086 C CG  . ASP B 2 183 ? 16.589  17.667  30.592  1.00 34.18 ? 181 ASP H CG  1 
ATOM   3087 O OD1 . ASP B 2 183 ? 16.096  16.806  29.826  1.00 35.79 ? 181 ASP H OD1 1 
ATOM   3088 O OD2 . ASP B 2 183 ? 16.911  17.415  31.773  1.00 35.48 ? 181 ASP H OD2 1 
ATOM   3089 N N   . LEU B 2 184 ? 17.972  20.896  27.120  1.00 23.21 ? 182 LEU H N   1 
ATOM   3090 C CA  . LEU B 2 184 ? 17.671  22.067  26.308  1.00 20.45 ? 182 LEU H CA  1 
ATOM   3091 C C   . LEU B 2 184 ? 18.256  21.876  24.922  1.00 19.01 ? 182 LEU H C   1 
ATOM   3092 O O   . LEU B 2 184 ? 19.297  21.262  24.774  1.00 19.28 ? 182 LEU H O   1 
ATOM   3093 C CB  . LEU B 2 184 ? 18.226  23.350  26.938  1.00 19.39 ? 182 LEU H CB  1 
ATOM   3094 C CG  . LEU B 2 184 ? 17.500  23.925  28.176  1.00 18.95 ? 182 LEU H CG  1 
ATOM   3095 C CD1 . LEU B 2 184 ? 18.208  25.169  28.657  1.00 17.80 ? 182 LEU H CD1 1 
ATOM   3096 C CD2 . LEU B 2 184 ? 16.044  24.241  27.893  1.00 17.73 ? 182 LEU H CD2 1 
ATOM   3097 N N   . TYR B 2 185 ? 17.578  22.396  23.908  1.00 16.94 ? 183 TYR H N   1 
ATOM   3098 C CA  . TYR B 2 185 ? 18.038  22.263  22.532  1.00 15.14 ? 183 TYR H CA  1 
ATOM   3099 C C   . TYR B 2 185 ? 18.668  23.515  21.969  1.00 13.44 ? 183 TYR H C   1 
ATOM   3100 O O   . TYR B 2 185 ? 18.385  24.634  22.412  1.00 11.58 ? 183 TYR H O   1 
ATOM   3101 C CB  . TYR B 2 185 ? 16.874  21.916  21.600  1.00 14.53 ? 183 TYR H CB  1 
ATOM   3102 C CG  . TYR B 2 185 ? 16.332  20.528  21.726  1.00 13.85 ? 183 TYR H CG  1 
ATOM   3103 C CD1 . TYR B 2 185 ? 16.979  19.458  21.114  1.00 13.20 ? 183 TYR H CD1 1 
ATOM   3104 C CD2 . TYR B 2 185 ? 15.160  20.279  22.454  1.00 14.27 ? 183 TYR H CD2 1 
ATOM   3105 C CE1 . TYR B 2 185 ? 16.491  18.173  21.215  1.00 13.72 ? 183 TYR H CE1 1 
ATOM   3106 C CE2 . TYR B 2 185 ? 14.655  18.978  22.563  1.00 14.59 ? 183 TYR H CE2 1 
ATOM   3107 C CZ  . TYR B 2 185 ? 15.331  17.936  21.936  1.00 14.67 ? 183 TYR H CZ  1 
ATOM   3108 O OH  . TYR B 2 185 ? 14.826  16.663  21.998  1.00 16.15 ? 183 TYR H OH  1 
ATOM   3109 N N   . THR B 2 186 ? 19.490  23.298  20.954  1.00 13.31 ? 184 THR H N   1 
ATOM   3110 C CA  . THR B 2 186 ? 20.121  24.372  20.207  1.00 13.97 ? 184 THR H CA  1 
ATOM   3111 C C   . THR B 2 186 ? 20.007  24.028  18.731  1.00 12.92 ? 184 THR H C   1 
ATOM   3112 O O   . THR B 2 186 ? 20.223  22.878  18.329  1.00 12.67 ? 184 THR H O   1 
ATOM   3113 C CB  . THR B 2 186 ? 21.604  24.564  20.556  1.00 15.61 ? 184 THR H CB  1 
ATOM   3114 O OG1 . THR B 2 186 ? 21.716  24.975  21.921  1.00 16.55 ? 184 THR H OG1 1 
ATOM   3115 C CG2 . THR B 2 186 ? 22.219  25.671  19.674  1.00 16.29 ? 184 THR H CG2 1 
ATOM   3116 N N   . LEU B 2 187 ? 19.644  25.021  17.930  1.00 10.62 ? 185 LEU H N   1 
ATOM   3117 C CA  . LEU B 2 187 ? 19.518  24.838  16.500  1.00 9.25  ? 185 LEU H CA  1 
ATOM   3118 C C   . LEU B 2 187 ? 20.074  26.096  15.805  1.00 8.62  ? 185 LEU H C   1 
ATOM   3119 O O   . LEU B 2 187 ? 20.065  27.175  16.380  1.00 8.33  ? 185 LEU H O   1 
ATOM   3120 C CB  . LEU B 2 187 ? 18.032  24.586  16.171  1.00 10.71 ? 185 LEU H CB  1 
ATOM   3121 C CG  . LEU B 2 187 ? 17.523  24.465  14.740  1.00 11.13 ? 185 LEU H CG  1 
ATOM   3122 C CD1 . LEU B 2 187 ? 16.507  23.363  14.618  1.00 11.71 ? 185 LEU H CD1 1 
ATOM   3123 C CD2 . LEU B 2 187 ? 16.951  25.796  14.313  1.00 11.63 ? 185 LEU H CD2 1 
ATOM   3124 N N   . SER B 2 188 ? 20.691  25.947  14.641  1.00 8.55  ? 186 SER H N   1 
ATOM   3125 C CA  . SER B 2 188 ? 21.202  27.119  13.919  1.00 9.84  ? 186 SER H CA  1 
ATOM   3126 C C   . SER B 2 188 ? 20.866  26.972  12.448  1.00 8.84  ? 186 SER H C   1 
ATOM   3127 O O   . SER B 2 188 ? 20.502  25.885  11.978  1.00 10.30 ? 186 SER H O   1 
ATOM   3128 C CB  . SER B 2 188 ? 22.722  27.324  14.116  1.00 11.83 ? 186 SER H CB  1 
ATOM   3129 O OG  . SER B 2 188 ? 23.466  26.179  13.722  1.00 12.35 ? 186 SER H OG  1 
ATOM   3130 N N   . SER B 2 189 ? 20.926  28.069  11.728  1.00 8.02  ? 187 SER H N   1 
ATOM   3131 C CA  . SER B 2 189 ? 20.621  28.030  10.311  1.00 7.53  ? 187 SER H CA  1 
ATOM   3132 C C   . SER B 2 189 ? 21.449  29.103  9.664   1.00 6.70  ? 187 SER H C   1 
ATOM   3133 O O   . SER B 2 189 ? 21.701  30.120  10.290  1.00 7.79  ? 187 SER H O   1 
ATOM   3134 C CB  . SER B 2 189 ? 19.135  28.345  10.094  1.00 7.99  ? 187 SER H CB  1 
ATOM   3135 O OG  . SER B 2 189 ? 18.805  28.364  8.709   1.00 8.94  ? 187 SER H OG  1 
ATOM   3136 N N   . SER B 2 190 ? 21.892  28.882  8.434   1.00 6.66  ? 188 SER H N   1 
ATOM   3137 C CA  . SER B 2 190 ? 22.647  29.908  7.717   1.00 7.74  ? 188 SER H CA  1 
ATOM   3138 C C   . SER B 2 190 ? 21.932  30.211  6.418   1.00 8.26  ? 188 SER H C   1 
ATOM   3139 O O   . SER B 2 190 ? 21.195  29.369  5.903   1.00 9.42  ? 188 SER H O   1 
ATOM   3140 C CB  . SER B 2 190 ? 24.065  29.439  7.373   1.00 8.23  ? 188 SER H CB  1 
ATOM   3141 O OG  . SER B 2 190 ? 24.054  28.304  6.518   1.00 7.52  ? 188 SER H OG  1 
ATOM   3142 N N   . VAL B 2 191 ? 22.117  31.422  5.911   1.00 9.46  ? 189 VAL H N   1 
ATOM   3143 C CA  . VAL B 2 191 ? 21.556  31.788  4.625   1.00 9.97  ? 189 VAL H CA  1 
ATOM   3144 C C   . VAL B 2 191 ? 22.643  32.569  3.877   1.00 11.43 ? 189 VAL H C   1 
ATOM   3145 O O   . VAL B 2 191 ? 23.267  33.482  4.434   1.00 10.75 ? 189 VAL H O   1 
ATOM   3146 C CB  . VAL B 2 191 ? 20.229  32.612  4.751   1.00 10.53 ? 189 VAL H CB  1 
ATOM   3147 C CG1 . VAL B 2 191 ? 20.477  33.985  5.368   1.00 9.15  ? 189 VAL H CG1 1 
ATOM   3148 C CG2 . VAL B 2 191 ? 19.519  32.707  3.390   1.00 9.33  ? 189 VAL H CG2 1 
ATOM   3149 N N   . THR B 2 192 ? 22.915  32.174  2.644   1.00 12.68 ? 190 THR H N   1 
ATOM   3150 C CA  . THR B 2 192 ? 23.906  32.860  1.846   1.00 14.47 ? 190 THR H CA  1 
ATOM   3151 C C   . THR B 2 192 ? 23.167  33.615  0.759   1.00 16.29 ? 190 THR H C   1 
ATOM   3152 O O   . THR B 2 192 ? 22.370  33.020  0.041   1.00 16.06 ? 190 THR H O   1 
ATOM   3153 C CB  . THR B 2 192 ? 24.843  31.868  1.185   1.00 15.16 ? 190 THR H CB  1 
ATOM   3154 O OG1 . THR B 2 192 ? 25.417  31.025  2.185   1.00 17.89 ? 190 THR H OG1 1 
ATOM   3155 C CG2 . THR B 2 192 ? 25.955  32.590  0.459   1.00 16.13 ? 190 THR H CG2 1 
ATOM   3156 N N   . VAL B 2 193 ? 23.384  34.928  0.676   1.00 18.55 ? 191 VAL H N   1 
ATOM   3157 C CA  . VAL B 2 193 ? 22.769  35.760  -0.357  1.00 20.40 ? 191 VAL H CA  1 
ATOM   3158 C C   . VAL B 2 193 ? 23.909  36.559  -1.002  1.00 23.38 ? 191 VAL H C   1 
ATOM   3159 O O   . VAL B 2 193 ? 25.053  36.501  -0.545  1.00 23.18 ? 191 VAL H O   1 
ATOM   3160 C CB  . VAL B 2 193 ? 21.705  36.746  0.214   1.00 20.03 ? 191 VAL H CB  1 
ATOM   3161 C CG1 . VAL B 2 193 ? 20.589  35.982  0.936   1.00 20.46 ? 191 VAL H CG1 1 
ATOM   3162 C CG2 . VAL B 2 193 ? 22.340  37.760  1.119   1.00 18.58 ? 191 VAL H CG2 1 
ATOM   3163 N N   . THR B 2 194 ? 23.616  37.304  -2.059  1.00 26.43 ? 192 THR H N   1 
ATOM   3164 C CA  . THR B 2 194 ? 24.656  38.092  -2.714  1.00 28.68 ? 192 THR H CA  1 
ATOM   3165 C C   . THR B 2 194 ? 24.936  39.357  -1.933  1.00 29.33 ? 192 THR H C   1 
ATOM   3166 O O   . THR B 2 194 ? 24.080  39.835  -1.200  1.00 30.49 ? 192 THR H O   1 
ATOM   3167 C CB  . THR B 2 194 ? 24.235  38.524  -4.123  1.00 29.06 ? 192 THR H CB  1 
ATOM   3168 O OG1 . THR B 2 194 ? 22.888  39.022  -4.079  1.00 30.02 ? 192 THR H OG1 1 
ATOM   3169 C CG2 . THR B 2 194 ? 24.349  37.365  -5.101  1.00 28.96 ? 192 THR H CG2 1 
ATOM   3170 N N   . SER B 2 195 ? 26.108  39.935  -2.153  1.00 30.56 ? 193 SER H N   1 
ATOM   3171 C CA  . SER B 2 195 ? 26.479  41.182  -1.498  1.00 31.89 ? 193 SER H CA  1 
ATOM   3172 C C   . SER B 2 195 ? 25.517  42.319  -1.862  1.00 31.46 ? 193 SER H C   1 
ATOM   3173 O O   . SER B 2 195 ? 25.386  43.288  -1.128  1.00 31.76 ? 193 SER H O   1 
ATOM   3174 C CB  . SER B 2 195 ? 27.893  41.579  -1.919  1.00 33.21 ? 193 SER H CB  1 
ATOM   3175 O OG  . SER B 2 195 ? 28.803  40.528  -1.657  1.00 35.03 ? 193 SER H OG  1 
ATOM   3176 N N   . SER B 2 196 ? 24.850  42.199  -3.001  1.00 30.93 ? 194 SER H N   1 
ATOM   3177 C CA  . SER B 2 196 ? 23.930  43.225  -3.467  1.00 31.20 ? 194 SER H CA  1 
ATOM   3178 C C   . SER B 2 196 ? 22.561  43.157  -2.814  1.00 30.69 ? 194 SER H C   1 
ATOM   3179 O O   . SER B 2 196 ? 21.787  44.107  -2.874  1.00 31.80 ? 194 SER H O   1 
ATOM   3180 C CB  . SER B 2 196 ? 23.760  43.085  -4.969  1.00 32.27 ? 194 SER H CB  1 
ATOM   3181 O OG  . SER B 2 196 ? 24.914  42.472  -5.519  1.00 34.16 ? 194 SER H OG  1 
ATOM   3182 N N   . THR B 2 197 ? 22.231  42.000  -2.263  1.00 29.66 ? 196 THR H N   1 
ATOM   3183 C CA  . THR B 2 197 ? 20.948  41.802  -1.618  1.00 27.13 ? 196 THR H CA  1 
ATOM   3184 C C   . THR B 2 197 ? 21.010  42.395  -0.219  1.00 26.41 ? 196 THR H C   1 
ATOM   3185 O O   . THR B 2 197 ? 20.310  43.361  0.076   1.00 25.24 ? 196 THR H O   1 
ATOM   3186 C CB  . THR B 2 197 ? 20.623  40.309  -1.571  1.00 26.79 ? 196 THR H CB  1 
ATOM   3187 O OG1 . THR B 2 197 ? 20.654  39.795  -2.909  1.00 27.05 ? 196 THR H OG1 1 
ATOM   3188 C CG2 . THR B 2 197 ? 19.267  40.048  -0.963  1.00 25.21 ? 196 THR H CG2 1 
ATOM   3189 N N   . TRP B 2 198 ? 21.918  41.889  0.606   1.00 25.80 ? 197 TRP H N   1 
ATOM   3190 C CA  . TRP B 2 198 ? 22.032  42.372  1.972   1.00 26.05 ? 197 TRP H CA  1 
ATOM   3191 C C   . TRP B 2 198 ? 23.330  43.147  2.092   1.00 27.04 ? 197 TRP H C   1 
ATOM   3192 O O   . TRP B 2 198 ? 24.341  42.735  1.541   1.00 27.86 ? 197 TRP H O   1 
ATOM   3193 C CB  . TRP B 2 198 ? 22.035  41.174  2.928   1.00 25.63 ? 197 TRP H CB  1 
ATOM   3194 C CG  . TRP B 2 198 ? 22.020  41.541  4.379   1.00 24.82 ? 197 TRP H CG  1 
ATOM   3195 C CD1 . TRP B 2 198 ? 20.921  41.751  5.156   1.00 24.31 ? 197 TRP H CD1 1 
ATOM   3196 C CD2 . TRP B 2 198 ? 23.166  41.746  5.230   1.00 25.00 ? 197 TRP H CD2 1 
ATOM   3197 N NE1 . TRP B 2 198 ? 21.304  42.074  6.436   1.00 24.47 ? 197 TRP H NE1 1 
ATOM   3198 C CE2 . TRP B 2 198 ? 22.675  42.079  6.512   1.00 25.34 ? 197 TRP H CE2 1 
ATOM   3199 C CE3 . TRP B 2 198 ? 24.560  41.685  5.030   1.00 24.86 ? 197 TRP H CE3 1 
ATOM   3200 C CZ2 . TRP B 2 198 ? 23.530  42.352  7.598   1.00 25.28 ? 197 TRP H CZ2 1 
ATOM   3201 C CZ3 . TRP B 2 198 ? 25.410  41.958  6.107   1.00 24.67 ? 197 TRP H CZ3 1 
ATOM   3202 C CH2 . TRP B 2 198 ? 24.889  42.286  7.372   1.00 25.39 ? 197 TRP H CH2 1 
ATOM   3203 N N   . PRO B 2 199 ? 23.348  44.252  2.847   1.00 27.32 ? 198 PRO H N   1 
ATOM   3204 C CA  . PRO B 2 199 ? 22.346  44.948  3.660   1.00 29.01 ? 198 PRO H CA  1 
ATOM   3205 C C   . PRO B 2 199 ? 21.263  45.744  2.924   1.00 30.17 ? 198 PRO H C   1 
ATOM   3206 O O   . PRO B 2 199 ? 20.321  46.199  3.566   1.00 30.59 ? 198 PRO H O   1 
ATOM   3207 C CB  . PRO B 2 199 ? 23.194  45.916  4.495   1.00 28.59 ? 198 PRO H CB  1 
ATOM   3208 C CG  . PRO B 2 199 ? 24.552  45.339  4.455   1.00 29.66 ? 198 PRO H CG  1 
ATOM   3209 C CD  . PRO B 2 199 ? 24.663  44.860  3.052   1.00 28.32 ? 198 PRO H CD  1 
ATOM   3210 N N   . SER B 2 200 ? 21.424  45.971  1.622   1.00 31.05 ? 200 SER H N   1 
ATOM   3211 C CA  . SER B 2 200 ? 20.450  46.737  0.843   1.00 32.16 ? 200 SER H CA  1 
ATOM   3212 C C   . SER B 2 200 ? 19.016  46.468  1.263   1.00 32.84 ? 200 SER H C   1 
ATOM   3213 O O   . SER B 2 200 ? 18.239  47.404  1.488   1.00 33.14 ? 200 SER H O   1 
ATOM   3214 C CB  . SER B 2 200 ? 20.562  46.388  -0.633  1.00 32.10 ? 200 SER H CB  1 
ATOM   3215 O OG  . SER B 2 200 ? 21.905  46.393  -1.042  1.00 33.96 ? 200 SER H OG  1 
ATOM   3216 N N   . GLN B 2 201 ? 18.662  45.186  1.348   1.00 33.40 ? 201 GLN H N   1 
ATOM   3217 C CA  . GLN B 2 201 ? 17.308  44.799  1.720   1.00 32.99 ? 201 GLN H CA  1 
ATOM   3218 C C   . GLN B 2 201 ? 17.243  44.055  3.056   1.00 29.85 ? 201 GLN H C   1 
ATOM   3219 O O   . GLN B 2 201 ? 18.262  43.664  3.621   1.00 28.31 ? 201 GLN H O   1 
ATOM   3220 C CB  . GLN B 2 201 ? 16.641  44.008  0.588   1.00 36.45 ? 201 GLN H CB  1 
ATOM   3221 C CG  . GLN B 2 201 ? 17.499  42.895  0.073   1.00 41.13 ? 201 GLN H CG  1 
ATOM   3222 C CD  . GLN B 2 201 ? 18.021  42.014  1.210   1.00 44.28 ? 201 GLN H CD  1 
ATOM   3223 O OE1 . GLN B 2 201 ? 19.057  42.307  1.825   1.00 45.96 ? 201 GLN H OE1 1 
ATOM   3224 N NE2 . GLN B 2 201 ? 17.244  41.004  1.572   1.00 45.70 ? 201 GLN H NE2 1 
ATOM   3225 N N   . SER B 2 202 ? 16.022  43.790  3.494   1.00 26.56 ? 202 SER H N   1 
ATOM   3226 C CA  . SER B 2 202 ? 15.769  43.165  4.779   1.00 23.96 ? 202 SER H CA  1 
ATOM   3227 C C   . SER B 2 202 ? 15.809  41.649  4.738   1.00 20.98 ? 202 SER H C   1 
ATOM   3228 O O   . SER B 2 202 ? 15.304  41.033  3.798   1.00 20.90 ? 202 SER H O   1 
ATOM   3229 C CB  . SER B 2 202 ? 14.420  43.689  5.313   1.00 24.39 ? 202 SER H CB  1 
ATOM   3230 O OG  . SER B 2 202 ? 13.963  42.992  6.456   1.00 26.88 ? 202 SER H OG  1 
ATOM   3231 N N   . ILE B 2 203 ? 16.481  41.064  5.723   1.00 17.65 ? 203 ILE H N   1 
ATOM   3232 C CA  . ILE B 2 203 ? 16.579  39.614  5.849   1.00 15.62 ? 203 ILE H CA  1 
ATOM   3233 C C   . ILE B 2 203 ? 16.280  39.301  7.311   1.00 16.23 ? 203 ILE H C   1 
ATOM   3234 O O   . ILE B 2 203 ? 16.993  39.744  8.221   1.00 14.93 ? 203 ILE H O   1 
ATOM   3235 C CB  . ILE B 2 203 ? 17.964  39.038  5.422   1.00 15.24 ? 203 ILE H CB  1 
ATOM   3236 C CG1 . ILE B 2 203 ? 18.178  39.267  3.921   1.00 14.56 ? 203 ILE H CG1 1 
ATOM   3237 C CG2 . ILE B 2 203 ? 18.066  37.532  5.764   1.00 12.94 ? 203 ILE H CG2 1 
ATOM   3238 C CD1 . ILE B 2 203 ? 19.424  38.703  3.368   1.00 14.94 ? 203 ILE H CD1 1 
ATOM   3239 N N   . THR B 2 204 ? 15.181  38.577  7.517   1.00 14.61 ? 204 THR H N   1 
ATOM   3240 C CA  . THR B 2 204 ? 14.724  38.218  8.822   1.00 13.74 ? 204 THR H CA  1 
ATOM   3241 C C   . THR B 2 204 ? 14.648  36.720  9.011   1.00 12.99 ? 204 THR H C   1 
ATOM   3242 O O   . THR B 2 204 ? 14.416  35.970  8.095   1.00 12.46 ? 204 THR H O   1 
ATOM   3243 C CB  . THR B 2 204 ? 13.352  38.862  9.072   1.00 14.96 ? 204 THR H CB  1 
ATOM   3244 O OG1 . THR B 2 204 ? 13.487  40.286  8.951   1.00 16.89 ? 204 THR H OG1 1 
ATOM   3245 C CG2 . THR B 2 204 ? 12.804  38.520  10.463  1.00 14.81 ? 204 THR H CG2 1 
ATOM   3246 N N   . CYS B 2 205 ? 14.855  36.305  10.238  1.00 12.45 ? 206 CYS H N   1 
ATOM   3247 C CA  . CYS B 2 205 ? 14.806  34.920  10.620  1.00 13.70 ? 206 CYS H CA  1 
ATOM   3248 C C   . CYS B 2 205 ? 13.477  34.787  11.402  1.00 12.71 ? 206 CYS H C   1 
ATOM   3249 O O   . CYS B 2 205 ? 13.216  35.550  12.334  1.00 9.54  ? 206 CYS H O   1 
ATOM   3250 C CB  . CYS B 2 205 ? 16.012  34.662  11.514  1.00 16.35 ? 206 CYS H CB  1 
ATOM   3251 S SG  . CYS B 2 205 ? 16.072  33.052  12.289  1.00 19.23 ? 206 CYS H SG  1 
ATOM   3252 N N   . ASN B 2 206 ? 12.618  33.863  10.979  1.00 12.45 ? 207 ASN H N   1 
ATOM   3253 C CA  . ASN B 2 206 ? 11.319  33.679  11.618  1.00 11.67 ? 207 ASN H CA  1 
ATOM   3254 C C   . ASN B 2 206 ? 11.407  32.390  12.401  1.00 10.45 ? 207 ASN H C   1 
ATOM   3255 O O   . ASN B 2 206 ? 11.733  31.356  11.847  1.00 11.49 ? 207 ASN H O   1 
ATOM   3256 C CB  . ASN B 2 206 ? 10.211  33.580  10.557  1.00 11.83 ? 207 ASN H CB  1 
ATOM   3257 C CG  . ASN B 2 206 ? 10.391  34.564  9.411   1.00 12.28 ? 207 ASN H CG  1 
ATOM   3258 O OD1 . ASN B 2 206 ? 10.587  34.150  8.271   1.00 13.68 ? 207 ASN H OD1 1 
ATOM   3259 N ND2 . ASN B 2 206 ? 10.338  35.857  9.700   1.00 10.94 ? 207 ASN H ND2 1 
ATOM   3260 N N   . VAL B 2 207 ? 11.144  32.452  13.698  1.00 10.10 ? 208 VAL H N   1 
ATOM   3261 C CA  . VAL B 2 207 ? 11.229  31.272  14.524  1.00 9.35  ? 208 VAL H CA  1 
ATOM   3262 C C   . VAL B 2 207 ? 9.919   31.053  15.272  1.00 10.45 ? 208 VAL H C   1 
ATOM   3263 O O   . VAL B 2 207 ? 9.369   31.982  15.881  1.00 10.51 ? 208 VAL H O   1 
ATOM   3264 C CB  . VAL B 2 207 ? 12.425  31.388  15.515  1.00 8.21  ? 208 VAL H CB  1 
ATOM   3265 C CG1 . VAL B 2 207 ? 12.493  30.161  16.428  1.00 8.44  ? 208 VAL H CG1 1 
ATOM   3266 C CG2 . VAL B 2 207 ? 13.736  31.476  14.760  1.00 6.26  ? 208 VAL H CG2 1 
ATOM   3267 N N   . ALA B 2 208 ? 9.419   29.821  15.230  1.00 11.37 ? 209 ALA H N   1 
ATOM   3268 C CA  . ALA B 2 208 ? 8.180   29.489  15.943  1.00 11.67 ? 209 ALA H CA  1 
ATOM   3269 C C   . ALA B 2 208 ? 8.380   28.240  16.788  1.00 11.76 ? 209 ALA H C   1 
ATOM   3270 O O   . ALA B 2 208 ? 9.018   27.274  16.369  1.00 12.10 ? 209 ALA H O   1 
ATOM   3271 C CB  . ALA B 2 208 ? 7.015   29.287  14.966  1.00 10.67 ? 209 ALA H CB  1 
ATOM   3272 N N   . HIS B 2 209 ? 7.848   28.277  17.995  1.00 11.71 ? 210 HIS H N   1 
ATOM   3273 C CA  . HIS B 2 209 ? 7.943   27.158  18.917  1.00 12.93 ? 210 HIS H CA  1 
ATOM   3274 C C   . HIS B 2 209 ? 6.528   27.030  19.528  1.00 13.98 ? 210 HIS H C   1 
ATOM   3275 O O   . HIS B 2 209 ? 6.222   27.549  20.620  1.00 13.83 ? 210 HIS H O   1 
ATOM   3276 C CB  . HIS B 2 209 ? 9.000   27.480  19.967  1.00 12.19 ? 210 HIS H CB  1 
ATOM   3277 C CG  . HIS B 2 209 ? 9.250   26.378  20.936  1.00 10.62 ? 210 HIS H CG  1 
ATOM   3278 N ND1 . HIS B 2 209 ? 9.151   26.560  22.299  1.00 10.06 ? 210 HIS H ND1 1 
ATOM   3279 C CD2 . HIS B 2 209 ? 9.677   25.109  20.753  1.00 9.92  ? 210 HIS H CD2 1 
ATOM   3280 C CE1 . HIS B 2 209 ? 9.512   25.453  22.912  1.00 9.81  ? 210 HIS H CE1 1 
ATOM   3281 N NE2 . HIS B 2 209 ? 9.839   24.557  21.996  1.00 10.40 ? 210 HIS H NE2 1 
ATOM   3282 N N   . PRO B 2 210 ? 5.659   26.287  18.851  1.00 14.36 ? 211 PRO H N   1 
ATOM   3283 C CA  . PRO B 2 210 ? 4.294   26.121  19.325  1.00 15.35 ? 211 PRO H CA  1 
ATOM   3284 C C   . PRO B 2 210 ? 4.135   25.586  20.735  1.00 16.02 ? 211 PRO H C   1 
ATOM   3285 O O   . PRO B 2 210 ? 3.215   25.989  21.433  1.00 16.21 ? 211 PRO H O   1 
ATOM   3286 C CB  . PRO B 2 210 ? 3.652   25.248  18.250  1.00 14.81 ? 211 PRO H CB  1 
ATOM   3287 C CG  . PRO B 2 210 ? 4.795   24.451  17.724  1.00 14.64 ? 211 PRO H CG  1 
ATOM   3288 C CD  . PRO B 2 210 ? 5.931   25.426  17.684  1.00 14.65 ? 211 PRO H CD  1 
ATOM   3289 N N   . ALA B 2 211 ? 5.066   24.748  21.178  1.00 16.16 ? 212 ALA H N   1 
ATOM   3290 C CA  . ALA B 2 211 ? 4.990   24.186  22.523  1.00 17.13 ? 212 ALA H CA  1 
ATOM   3291 C C   . ALA B 2 211 ? 4.904   25.270  23.571  1.00 18.12 ? 212 ALA H C   1 
ATOM   3292 O O   . ALA B 2 211 ? 4.315   25.072  24.637  1.00 19.85 ? 212 ALA H O   1 
ATOM   3293 C CB  . ALA B 2 211 ? 6.187   23.290  22.809  1.00 16.38 ? 212 ALA H CB  1 
ATOM   3294 N N   . SER B 2 212 ? 5.495   26.419  23.269  1.00 19.28 ? 213 SER H N   1 
ATOM   3295 C CA  . SER B 2 212 ? 5.487   27.516  24.208  1.00 20.37 ? 213 SER H CA  1 
ATOM   3296 C C   . SER B 2 212 ? 4.713   28.708  23.691  1.00 22.10 ? 213 SER H C   1 
ATOM   3297 O O   . SER B 2 212 ? 4.693   29.735  24.362  1.00 24.53 ? 213 SER H O   1 
ATOM   3298 C CB  . SER B 2 212 ? 6.917   27.935  24.566  1.00 20.01 ? 213 SER H CB  1 
ATOM   3299 O OG  . SER B 2 212 ? 7.649   28.391  23.438  1.00 21.39 ? 213 SER H OG  1 
ATOM   3300 N N   . SER B 2 213 ? 4.048   28.576  22.537  1.00 22.88 ? 214 SER H N   1 
ATOM   3301 C CA  . SER B 2 213 ? 3.296   29.694  21.943  1.00 24.33 ? 214 SER H CA  1 
ATOM   3302 C C   . SER B 2 213 ? 4.263   30.853  21.675  1.00 24.79 ? 214 SER H C   1 
ATOM   3303 O O   . SER B 2 213 ? 3.977   32.005  21.994  1.00 25.83 ? 214 SER H O   1 
ATOM   3304 C CB  . SER B 2 213 ? 2.169   30.176  22.888  1.00 24.97 ? 214 SER H CB  1 
ATOM   3305 O OG  . SER B 2 213 ? 1.105   29.239  22.964  1.00 25.47 ? 214 SER H OG  1 
ATOM   3306 N N   . THR B 2 214 ? 5.412   30.536  21.101  1.00 24.82 ? 215 THR H N   1 
ATOM   3307 C CA  . THR B 2 214 ? 6.417   31.538  20.844  1.00 24.45 ? 215 THR H CA  1 
ATOM   3308 C C   . THR B 2 214 ? 6.504   31.742  19.370  1.00 24.30 ? 215 THR H C   1 
ATOM   3309 O O   . THR B 2 214 ? 6.438   30.778  18.615  1.00 25.06 ? 215 THR H O   1 
ATOM   3310 C CB  . THR B 2 214 ? 7.766   31.031  21.334  1.00 25.44 ? 215 THR H CB  1 
ATOM   3311 O OG1 . THR B 2 214 ? 7.718   30.907  22.761  1.00 27.16 ? 215 THR H OG1 1 
ATOM   3312 C CG2 . THR B 2 214 ? 8.916   31.955  20.909  1.00 26.02 ? 215 THR H CG2 1 
ATOM   3313 N N   . LYS B 2 215 ? 6.645   32.996  18.969  1.00 24.04 ? 216 LYS H N   1 
ATOM   3314 C CA  . LYS B 2 215 ? 6.788   33.364  17.576  1.00 25.32 ? 216 LYS H CA  1 
ATOM   3315 C C   . LYS B 2 215 ? 7.612   34.654  17.572  1.00 25.27 ? 216 LYS H C   1 
ATOM   3316 O O   . LYS B 2 215 ? 7.134   35.704  17.975  1.00 25.48 ? 216 LYS H O   1 
ATOM   3317 C CB  . LYS B 2 215 ? 5.420   33.570  16.929  1.00 26.56 ? 216 LYS H CB  1 
ATOM   3318 C CG  . LYS B 2 215 ? 5.484   33.814  15.434  1.00 30.10 ? 216 LYS H CG  1 
ATOM   3319 C CD  . LYS B 2 215 ? 6.175   32.644  14.678  1.00 31.70 ? 216 LYS H CD  1 
ATOM   3320 C CE  . LYS B 2 215 ? 6.580   33.023  13.243  1.00 32.06 ? 216 LYS H CE  1 
ATOM   3321 N NZ  . LYS B 2 215 ? 7.507   34.199  13.306  1.00 32.63 ? 216 LYS H NZ  1 
ATOM   3322 N N   . VAL B 2 216 ? 8.869   34.566  17.167  1.00 24.96 ? 217 VAL H N   1 
ATOM   3323 C CA  . VAL B 2 216 ? 9.727   35.738  17.157  1.00 25.61 ? 217 VAL H CA  1 
ATOM   3324 C C   . VAL B 2 216 ? 10.325  35.951  15.772  1.00 25.51 ? 217 VAL H C   1 
ATOM   3325 O O   . VAL B 2 216 ? 10.437  35.014  14.990  1.00 25.11 ? 217 VAL H O   1 
ATOM   3326 C CB  . VAL B 2 216 ? 10.856  35.620  18.259  1.00 26.98 ? 217 VAL H CB  1 
ATOM   3327 C CG1 . VAL B 2 216 ? 11.511  34.266  18.214  1.00 27.69 ? 217 VAL H CG1 1 
ATOM   3328 C CG2 . VAL B 2 216 ? 11.944  36.698  18.087  1.00 28.00 ? 217 VAL H CG2 1 
ATOM   3329 N N   . ASP B 2 217 ? 10.628  37.202  15.446  1.00 25.75 ? 218 ASP H N   1 
ATOM   3330 C CA  . ASP B 2 217 ? 11.243  37.537  14.175  1.00 25.69 ? 218 ASP H CA  1 
ATOM   3331 C C   . ASP B 2 217 ? 12.465  38.384  14.473  1.00 25.76 ? 218 ASP H C   1 
ATOM   3332 O O   . ASP B 2 217 ? 12.378  39.386  15.175  1.00 26.31 ? 218 ASP H O   1 
ATOM   3333 C CB  . ASP B 2 217 ? 10.278  38.303  13.273  1.00 26.82 ? 218 ASP H CB  1 
ATOM   3334 C CG  . ASP B 2 217 ? 9.104   37.462  12.831  1.00 27.88 ? 218 ASP H CG  1 
ATOM   3335 O OD1 . ASP B 2 217 ? 9.330   36.338  12.345  1.00 28.93 ? 218 ASP H OD1 1 
ATOM   3336 O OD2 . ASP B 2 217 ? 7.952   37.907  13.001  1.00 28.98 ? 218 ASP H OD2 1 
ATOM   3337 N N   . LYS B 2 218 ? 13.620  37.934  14.000  1.00 25.85 ? 219 LYS H N   1 
ATOM   3338 C CA  . LYS B 2 218 ? 14.876  38.650  14.192  1.00 24.49 ? 219 LYS H CA  1 
ATOM   3339 C C   . LYS B 2 218 ? 15.505  39.092  12.874  1.00 23.48 ? 219 LYS H C   1 
ATOM   3340 O O   . LYS B 2 218 ? 15.848  38.275  12.015  1.00 20.82 ? 219 LYS H O   1 
ATOM   3341 C CB  . LYS B 2 218 ? 15.857  37.795  14.979  1.00 25.64 ? 219 LYS H CB  1 
ATOM   3342 C CG  . LYS B 2 218 ? 15.697  37.918  16.482  1.00 27.04 ? 219 LYS H CG  1 
ATOM   3343 C CD  . LYS B 2 218 ? 16.290  39.224  16.983  1.00 27.36 ? 219 LYS H CD  1 
ATOM   3344 C CE  . LYS B 2 218 ? 16.202  39.316  18.498  1.00 29.01 ? 219 LYS H CE  1 
ATOM   3345 N NZ  . LYS B 2 218 ? 14.804  39.136  19.013  1.00 29.72 ? 219 LYS H NZ  1 
ATOM   3346 N N   . LYS B 2 219 ? 15.608  40.402  12.715  1.00 23.54 ? 220 LYS H N   1 
ATOM   3347 C CA  . LYS B 2 219 ? 16.182  41.009  11.540  1.00 25.36 ? 220 LYS H CA  1 
ATOM   3348 C C   . LYS B 2 219 ? 17.684  40.946  11.731  1.00 25.65 ? 220 LYS H C   1 
ATOM   3349 O O   . LYS B 2 219 ? 18.170  41.157  12.843  1.00 24.48 ? 220 LYS H O   1 
ATOM   3350 C CB  . LYS B 2 219 ? 15.724  42.466  11.444  1.00 26.53 ? 220 LYS H CB  1 
ATOM   3351 C CG  . LYS B 2 219 ? 16.156  43.224  10.179  1.00 28.72 ? 220 LYS H CG  1 
ATOM   3352 C CD  . LYS B 2 219 ? 15.685  44.685  10.271  1.00 31.18 ? 220 LYS H CD  1 
ATOM   3353 C CE  . LYS B 2 219 ? 15.825  45.481  8.958   1.00 32.49 ? 220 LYS H CE  1 
ATOM   3354 N NZ  . LYS B 2 219 ? 17.243  45.616  8.471   1.00 34.01 ? 220 LYS H NZ  1 
ATOM   3355 N N   . ILE B 2 220 ? 18.395  40.561  10.671  1.00 26.91 ? 221 ILE H N   1 
ATOM   3356 C CA  . ILE B 2 220 ? 19.859  40.492  10.687  1.00 28.52 ? 221 ILE H CA  1 
ATOM   3357 C C   . ILE B 2 220 ? 20.395  41.836  10.186  1.00 30.13 ? 221 ILE H C   1 
ATOM   3358 O O   . ILE B 2 220 ? 20.358  42.113  8.993   1.00 29.79 ? 221 ILE H O   1 
ATOM   3359 C CB  . ILE B 2 220 ? 20.416  39.409  9.739   1.00 27.38 ? 221 ILE H CB  1 
ATOM   3360 C CG1 . ILE B 2 220 ? 19.660  38.083  9.892   1.00 27.14 ? 221 ILE H CG1 1 
ATOM   3361 C CG2 . ILE B 2 220 ? 21.903  39.249  9.985   1.00 26.90 ? 221 ILE H CG2 1 
ATOM   3362 C CD1 . ILE B 2 220 ? 19.756  37.435  11.245  1.00 26.16 ? 221 ILE H CD1 1 
ATOM   3363 N N   . GLU B 2 221 ? 20.860  42.680  11.100  1.00 33.00 ? 222 GLU H N   1 
ATOM   3364 C CA  . GLU B 2 221 ? 21.386  43.994  10.737  1.00 35.80 ? 222 GLU H CA  1 
ATOM   3365 C C   . GLU B 2 221 ? 22.911  43.990  10.815  1.00 36.26 ? 222 GLU H C   1 
ATOM   3366 O O   . GLU B 2 221 ? 23.490  43.207  11.574  1.00 35.84 ? 222 GLU H O   1 
ATOM   3367 C CB  . GLU B 2 221 ? 20.824  45.045  11.685  1.00 37.76 ? 222 GLU H CB  1 
ATOM   3368 C CG  . GLU B 2 221 ? 19.342  44.878  11.968  1.00 40.94 ? 222 GLU H CG  1 
ATOM   3369 C CD  . GLU B 2 221 ? 18.554  46.167  11.790  1.00 43.22 ? 222 GLU H CD  1 
ATOM   3370 O OE1 . GLU B 2 221 ? 18.726  46.826  10.739  1.00 44.75 ? 222 GLU H OE1 1 
ATOM   3371 O OE2 . GLU B 2 221 ? 17.759  46.520  12.692  1.00 44.22 ? 222 GLU H OE2 1 
ATOM   3372 N N   . PRO B 2 222 ? 23.578  44.831  10.000  1.00 37.19 ? 223 PRO H N   1 
ATOM   3373 C CA  . PRO B 2 222 ? 25.046  44.943  9.966   1.00 38.16 ? 223 PRO H CA  1 
ATOM   3374 C C   . PRO B 2 222 ? 25.675  45.422  11.295  1.00 39.01 ? 223 PRO H C   1 
ATOM   3375 O O   . PRO B 2 222 ? 25.025  46.213  12.018  1.00 39.28 ? 223 PRO H O   1 
ATOM   3376 C CB  . PRO B 2 222 ? 25.290  45.965  8.859   1.00 37.99 ? 223 PRO H CB  1 
ATOM   3377 C CG  . PRO B 2 222 ? 24.094  45.815  7.989   1.00 37.89 ? 223 PRO H CG  1 
ATOM   3378 C CD  . PRO B 2 222 ? 22.971  45.677  8.967   1.00 37.18 ? 223 PRO H CD  1 
HETATM 3379 N N1  . PNB C 3 .   ? 4.696   -2.252  7.542   1.00 15.96 ? 551 PNB H N1  1 
HETATM 3380 O O4  . PNB C 3 .   ? 3.661   -1.609  7.763   1.00 15.45 ? 551 PNB H O4  1 
HETATM 3381 O O5  . PNB C 3 .   ? 5.825   -1.694  7.429   1.00 16.66 ? 551 PNB H O5  1 
HETATM 3382 C C1  . PNB C 3 .   ? 4.806   -6.367  6.784   1.00 16.04 ? 551 PNB H C1  1 
HETATM 3383 C C2  . PNB C 3 .   ? 3.581   -5.778  7.208   1.00 15.15 ? 551 PNB H C2  1 
HETATM 3384 C C3  . PNB C 3 .   ? 3.499   -4.426  7.503   1.00 13.93 ? 551 PNB H C3  1 
HETATM 3385 C C4  . PNB C 3 .   ? 4.662   -3.678  7.363   1.00 15.36 ? 551 PNB H C4  1 
HETATM 3386 C C5  . PNB C 3 .   ? 5.875   -4.261  6.953   1.00 15.13 ? 551 PNB H C5  1 
HETATM 3387 C C6  . PNB C 3 .   ? 5.952   -5.612  6.661   1.00 15.49 ? 551 PNB H C6  1 
HETATM 3388 C C7  . PNB C 3 .   ? 4.927   -7.788  6.431   1.00 16.80 ? 551 PNB H C7  1 
HETATM 3389 O O1  . PNB C 3 .   ? 3.621   -8.310  6.113   1.00 18.91 ? 551 PNB H O1  1 
HETATM 3390 P P1  . PNB C 3 .   ? 3.175   -8.584  4.609   1.00 20.83 ? 551 PNB H P1  1 
HETATM 3391 O O2  . PNB C 3 .   ? 2.151   -7.670  4.338   1.00 22.61 ? 551 PNB H O2  1 
HETATM 3392 O O3  . PNB C 3 .   ? 4.297   -8.545  3.786   1.00 22.17 ? 551 PNB H O3  1 
HETATM 3393 C C8  . PNB C 3 .   ? 2.507   -10.174 4.572   1.00 20.93 ? 551 PNB H C8  1 
HETATM 3394 C C9  . PNB C 3 .   ? 2.205   -10.895 5.878   1.00 22.33 ? 551 PNB H C9  1 
HETATM 3395 C C10 . PNB C 3 .   ? 1.474   -12.151 5.428   1.00 24.30 ? 551 PNB H C10 1 
HETATM 3396 C C11 . PNB C 3 .   ? 1.105   -13.242 6.397   1.00 26.09 ? 551 PNB H C11 1 
HETATM 3397 O O6  . PNB C 3 .   ? -0.046  -13.569 6.486   1.00 26.66 ? 551 PNB H O6  1 
HETATM 3398 N N2  . PNB C 3 .   ? 2.046   -13.873 7.141   1.00 28.01 ? 551 PNB H N2  1 
HETATM 3399 C C12 . PNB C 3 .   ? 1.703   -14.865 7.973   1.00 29.34 ? 551 PNB H C12 1 
HETATM 3400 C C13 . PNB C 3 .   ? 1.448   -14.378 9.393   1.00 30.77 ? 551 PNB H C13 1 
HETATM 3401 O O7  . PNB C 3 .   ? 1.878   -15.110 10.335  1.00 32.12 ? 551 PNB H O7  1 
HETATM 3402 O O8  . PNB C 3 .   ? 0.760   -13.347 9.609   1.00 30.68 ? 551 PNB H O8  1 
HETATM 3403 O O   . HOH D 4 .   ? 14.232  -9.121  -3.339  1.00 18.00 ? 215 HOH L O   1 
HETATM 3404 O O   . HOH D 4 .   ? 1.546   -1.300  -5.915  1.00 20.76 ? 216 HOH L O   1 
HETATM 3405 O O   . HOH D 4 .   ? 29.854  29.067  5.459   1.00 11.31 ? 217 HOH L O   1 
HETATM 3406 O O   . HOH D 4 .   ? 15.318  7.379   -13.740 1.00 28.56 ? 218 HOH L O   1 
HETATM 3407 O O   . HOH D 4 .   ? 26.270  24.154  16.185  1.00 11.85 ? 219 HOH L O   1 
HETATM 3408 O O   . HOH D 4 .   ? 8.079   -17.815 -3.331  1.00 15.74 ? 220 HOH L O   1 
HETATM 3409 O O   . HOH D 4 .   ? 15.659  -1.658  11.497  1.00 14.58 ? 221 HOH L O   1 
HETATM 3410 O O   . HOH D 4 .   ? 9.515   -5.848  14.167  1.00 7.66  ? 222 HOH L O   1 
HETATM 3411 O O   . HOH D 4 .   ? 9.838   -13.122 13.605  1.00 12.88 ? 223 HOH L O   1 
HETATM 3412 O O   . HOH D 4 .   ? 17.632  -7.968  -7.752  1.00 29.27 ? 224 HOH L O   1 
HETATM 3413 O O   . HOH D 4 .   ? 24.911  35.193  19.552  1.00 13.02 ? 225 HOH L O   1 
HETATM 3414 O O   . HOH D 4 .   ? 19.131  -0.117  12.606  1.00 24.28 ? 226 HOH L O   1 
HETATM 3415 O O   . HOH D 4 .   ? 10.800  8.001   1.445   1.00 13.73 ? 227 HOH L O   1 
HETATM 3416 O O   . HOH D 4 .   ? 28.336  11.063  -8.736  1.00 15.88 ? 228 HOH L O   1 
HETATM 3417 O O   . HOH D 4 .   ? 43.024  32.147  18.211  1.00 20.07 ? 229 HOH L O   1 
HETATM 3418 O O   . HOH D 4 .   ? 20.955  12.252  -10.958 1.00 15.67 ? 230 HOH L O   1 
HETATM 3419 O O   . HOH D 4 .   ? 18.301  15.408  1.493   1.00 37.52 ? 231 HOH L O   1 
HETATM 3420 O O   . HOH D 4 .   ? 35.044  11.698  -3.998  1.00 23.16 ? 232 HOH L O   1 
HETATM 3421 O O   . HOH D 4 .   ? 27.120  -1.890  -5.084  1.00 21.67 ? 233 HOH L O   1 
HETATM 3422 O O   . HOH D 4 .   ? 20.969  -5.553  9.461   1.00 17.87 ? 234 HOH L O   1 
HETATM 3423 O O   . HOH D 4 .   ? 5.431   7.228   2.301   1.00 12.10 ? 235 HOH L O   1 
HETATM 3424 O O   . HOH D 4 .   ? 12.040  -17.730 -1.551  1.00 23.88 ? 236 HOH L O   1 
HETATM 3425 O O   . HOH D 4 .   ? 0.001   -8.030  7.161   1.00 21.24 ? 237 HOH L O   1 
HETATM 3426 O O   . HOH D 4 .   ? 25.117  21.075  2.149   1.00 16.32 ? 238 HOH L O   1 
HETATM 3427 O O   . HOH D 4 .   ? 31.086  23.010  -2.816  1.00 38.61 ? 239 HOH L O   1 
HETATM 3428 O O   . HOH D 4 .   ? 11.945  -6.715  -9.854  1.00 25.06 ? 240 HOH L O   1 
HETATM 3429 O O   . HOH D 4 .   ? 29.620  36.034  32.530  1.00 19.01 ? 241 HOH L O   1 
HETATM 3430 O O   . HOH D 4 .   ? 28.475  18.255  19.496  1.00 21.88 ? 242 HOH L O   1 
HETATM 3431 O O   . HOH D 4 .   ? 13.298  -22.108 1.485   1.00 24.47 ? 243 HOH L O   1 
HETATM 3432 O O   . HOH D 4 .   ? 6.335   -14.667 -3.614  1.00 40.35 ? 244 HOH L O   1 
HETATM 3433 O O   . HOH D 4 .   ? 16.271  11.219  -1.844  1.00 25.92 ? 245 HOH L O   1 
HETATM 3434 O O   . HOH D 4 .   ? 28.601  7.111   -13.862 1.00 23.89 ? 246 HOH L O   1 
HETATM 3435 O O   . HOH D 4 .   ? 17.989  -3.302  -11.629 1.00 26.74 ? 247 HOH L O   1 
HETATM 3436 O O   . HOH D 4 .   ? 4.794   4.193   -5.263  1.00 25.47 ? 248 HOH L O   1 
HETATM 3437 O O   . HOH D 4 .   ? 20.240  6.816   -19.084 1.00 26.74 ? 249 HOH L O   1 
HETATM 3438 O O   . HOH D 4 .   ? 3.653   2.871   -12.160 1.00 23.85 ? 250 HOH L O   1 
HETATM 3439 O O   . HOH D 4 .   ? 27.895  29.005  2.774   1.00 26.27 ? 251 HOH L O   1 
HETATM 3440 O O   . HOH D 4 .   ? 30.904  3.988   -8.290  1.00 37.05 ? 252 HOH L O   1 
HETATM 3441 O O   . HOH D 4 .   ? 38.069  14.417  4.811   1.00 27.36 ? 253 HOH L O   1 
HETATM 3442 O O   . HOH D 4 .   ? 31.232  11.216  2.770   1.00 23.01 ? 254 HOH L O   1 
HETATM 3443 O O   . HOH D 4 .   ? 42.473  21.287  4.977   1.00 22.45 ? 255 HOH L O   1 
HETATM 3444 O O   . HOH D 4 .   ? 27.776  25.563  22.627  1.00 21.50 ? 256 HOH L O   1 
HETATM 3445 O O   . HOH D 4 .   ? 32.158  24.488  -0.821  1.00 32.82 ? 257 HOH L O   1 
HETATM 3446 O O   . HOH D 4 .   ? 20.505  16.853  -8.003  1.00 27.27 ? 258 HOH L O   1 
HETATM 3447 O O   . HOH E 4 .   ? -3.732  -2.542  4.605   1.00 12.97 ? 552 HOH H O   1 
HETATM 3448 O O   . HOH E 4 .   ? -8.403  1.144   6.878   1.00 6.84  ? 553 HOH H O   1 
HETATM 3449 O O   . HOH E 4 .   ? -6.503  3.085   21.374  1.00 7.95  ? 554 HOH H O   1 
HETATM 3450 O O   . HOH E 4 .   ? 11.716  16.961  22.260  1.00 14.87 ? 555 HOH H O   1 
HETATM 3451 O O   . HOH E 4 .   ? 8.292   15.534  20.805  1.00 16.66 ? 556 HOH H O   1 
HETATM 3452 O O   . HOH E 4 .   ? -5.430  1.608   15.514  1.00 9.50  ? 557 HOH H O   1 
HETATM 3453 O O   . HOH E 4 .   ? -5.629  -4.747  4.181   1.00 9.59  ? 558 HOH H O   1 
HETATM 3454 O O   . HOH E 4 .   ? -7.866  -5.597  3.125   1.00 14.38 ? 559 HOH H O   1 
HETATM 3455 O O   . HOH E 4 .   ? 12.896  40.677  6.042   1.00 28.53 ? 560 HOH H O   1 
HETATM 3456 O O   . HOH E 4 .   ? -0.453  9.711   15.485  1.00 13.18 ? 561 HOH H O   1 
HETATM 3457 O O   . HOH E 4 .   ? 9.179   29.508  11.429  1.00 20.84 ? 562 HOH H O   1 
HETATM 3458 O O   . HOH E 4 .   ? 7.895   1.847   22.518  1.00 24.77 ? 563 HOH H O   1 
HETATM 3459 O O   . HOH E 4 .   ? -12.743 -1.111  -0.393  1.00 13.13 ? 564 HOH H O   1 
HETATM 3460 O O   . HOH E 4 .   ? 10.040  -6.205  16.862  1.00 24.40 ? 565 HOH H O   1 
HETATM 3461 O O   . HOH E 4 .   ? 14.096  21.896  30.115  1.00 20.23 ? 566 HOH H O   1 
HETATM 3462 O O   . HOH E 4 .   ? 6.940   23.142  19.839  1.00 16.96 ? 567 HOH H O   1 
HETATM 3463 O O   . HOH E 4 .   ? -1.993  0.644   26.177  1.00 17.98 ? 568 HOH H O   1 
HETATM 3464 O O   . HOH E 4 .   ? 23.552  44.843  -0.189  1.00 29.25 ? 569 HOH H O   1 
HETATM 3465 O O   . HOH E 4 .   ? 1.641   -11.047 20.749  1.00 38.10 ? 570 HOH H O   1 
HETATM 3466 O O   . HOH E 4 .   ? 21.289  21.650  3.773   1.00 28.24 ? 571 HOH H O   1 
HETATM 3467 O O   . HOH E 4 .   ? 15.885  19.896  14.533  1.00 41.39 ? 572 HOH H O   1 
HETATM 3468 O O   . HOH E 4 .   ? 24.022  28.534  3.880   1.00 24.31 ? 573 HOH H O   1 
HETATM 3469 O O   . HOH E 4 .   ? -11.781 1.524   -0.661  1.00 15.45 ? 574 HOH H O   1 
HETATM 3470 O O   . HOH E 4 .   ? -2.211  -10.521 19.230  1.00 17.11 ? 575 HOH H O   1 
HETATM 3471 O O   . HOH E 4 .   ? -9.547  0.775   -2.524  1.00 29.65 ? 576 HOH H O   1 
HETATM 3472 O O   . HOH E 4 .   ? 13.128  29.875  4.429   1.00 15.95 ? 577 HOH H O   1 
HETATM 3473 O O   . HOH E 4 .   ? 4.591   34.761  20.665  1.00 32.45 ? 578 HOH H O   1 
HETATM 3474 O O   . HOH E 4 .   ? 6.066   -9.057  0.488   1.00 14.26 ? 579 HOH H O   1 
HETATM 3475 O O   . HOH E 4 .   ? 6.670   -7.818  3.346   1.00 9.98  ? 580 HOH H O   1 
HETATM 3476 O O   . HOH E 4 .   ? 13.969  4.556   29.610  1.00 19.37 ? 581 HOH H O   1 
HETATM 3477 O O   . HOH E 4 .   ? 2.849   7.334   1.804   1.00 15.46 ? 582 HOH H O   1 
HETATM 3478 O O   . HOH E 4 .   ? 4.188   29.287  17.624  1.00 25.79 ? 583 HOH H O   1 
HETATM 3479 O O   . HOH E 4 .   ? -7.422  12.422  6.361   1.00 25.95 ? 584 HOH H O   1 
HETATM 3480 O O   . HOH E 4 .   ? 21.990  22.257  16.400  1.00 20.33 ? 585 HOH H O   1 
HETATM 3481 O O   . HOH E 4 .   ? 9.759   37.744  7.579   1.00 22.87 ? 586 HOH H O   1 
HETATM 3482 O O   . HOH E 4 .   ? -10.906 6.351   4.870   1.00 16.73 ? 587 HOH H O   1 
HETATM 3483 O O   . HOH E 4 .   ? 21.635  22.533  23.655  1.00 22.18 ? 588 HOH H O   1 
HETATM 3484 O O   . HOH E 4 .   ? 18.270  42.950  7.260   1.00 21.79 ? 589 HOH H O   1 
HETATM 3485 O O   . HOH E 4 .   ? -7.072  3.035   23.861  1.00 24.85 ? 590 HOH H O   1 
HETATM 3486 O O   . HOH E 4 .   ? 6.763   17.746  21.317  1.00 19.78 ? 591 HOH H O   1 
HETATM 3487 O O   . HOH E 4 .   ? 11.936  13.082  21.391  1.00 26.79 ? 592 HOH H O   1 
HETATM 3488 O O   . HOH E 4 .   ? 14.531  26.999  7.420   1.00 30.89 ? 593 HOH H O   1 
HETATM 3489 O O   . HOH E 4 .   ? 5.047   14.932  15.525  1.00 17.43 ? 594 HOH H O   1 
HETATM 3490 O O   . HOH E 4 .   ? 13.209  41.893  2.141   1.00 21.26 ? 595 HOH H O   1 
HETATM 3491 O O   . HOH E 4 .   ? -8.705  12.251  1.083   1.00 26.23 ? 596 HOH H O   1 
HETATM 3492 O O   . HOH E 4 .   ? -6.615  2.476   -2.613  1.00 41.52 ? 597 HOH H O   1 
HETATM 3493 O O   . HOH E 4 .   ? 27.685  42.875  9.874   1.00 24.36 ? 598 HOH H O   1 
HETATM 3494 O O   . HOH E 4 .   ? 8.783   38.896  17.548  1.00 24.64 ? 599 HOH H O   1 
HETATM 3495 O O   . HOH E 4 .   ? 14.148  27.349  4.736   1.00 30.85 ? 600 HOH H O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   1   ASP ASP L . n 
A 1 2   ILE 2   2   2   ILE ILE L . n 
A 1 3   VAL 3   3   3   VAL VAL L . n 
A 1 4   MET 4   4   4   MET MET L . n 
A 1 5   THR 5   5   5   THR THR L . n 
A 1 6   GLN 6   6   6   GLN GLN L . n 
A 1 7   SER 7   7   7   SER SER L . n 
A 1 8   PRO 8   8   8   PRO PRO L . n 
A 1 9   LEU 9   9   9   LEU LEU L . n 
A 1 10  THR 10  10  10  THR THR L . n 
A 1 11  LEU 11  11  11  LEU LEU L . n 
A 1 12  SER 12  12  12  SER SER L . n 
A 1 13  VAL 13  13  13  VAL VAL L . n 
A 1 14  THR 14  14  14  THR THR L . n 
A 1 15  ILE 15  15  15  ILE ILE L . n 
A 1 16  GLY 16  16  16  GLY GLY L . n 
A 1 17  GLN 17  17  17  GLN GLN L . n 
A 1 18  PRO 18  18  18  PRO PRO L . n 
A 1 19  ALA 19  19  19  ALA ALA L . n 
A 1 20  SER 20  20  20  SER SER L . n 
A 1 21  ILE 21  21  21  ILE ILE L . n 
A 1 22  SER 22  22  22  SER SER L . n 
A 1 23  CYS 23  23  23  CYS CYS L . n 
A 1 24  LYS 24  24  24  LYS LYS L . n 
A 1 25  SER 25  25  25  SER SER L . n 
A 1 26  SER 26  26  26  SER SER L . n 
A 1 27  GLN 27  27  27  GLN GLN L . n 
A 1 28  SER 28  27  27  SER SER L A n 
A 1 29  LEU 29  27  27  LEU LEU L B n 
A 1 30  LEU 30  27  27  LEU LEU L C n 
A 1 31  TYR 31  27  27  TYR TYR L D n 
A 1 32  SER 32  27  27  SER SER L E n 
A 1 33  ASN 33  28  28  ASN ASN L . n 
A 1 34  GLY 34  29  29  GLY GLY L . n 
A 1 35  LYS 35  30  30  LYS LYS L . n 
A 1 36  THR 36  31  31  THR THR L . n 
A 1 37  TYR 37  32  32  TYR TYR L . n 
A 1 38  LEU 38  33  33  LEU LEU L . n 
A 1 39  SER 39  34  34  SER SER L . n 
A 1 40  TRP 40  35  35  TRP TRP L . n 
A 1 41  LEU 41  36  36  LEU LEU L . n 
A 1 42  LEU 42  37  37  LEU LEU L . n 
A 1 43  GLN 43  38  38  GLN GLN L . n 
A 1 44  ARG 44  39  39  ARG ARG L . n 
A 1 45  PRO 45  40  40  PRO PRO L . n 
A 1 46  GLY 46  41  41  GLY GLY L . n 
A 1 47  GLN 47  42  42  GLN GLN L . n 
A 1 48  SER 48  43  43  SER SER L . n 
A 1 49  PRO 49  44  44  PRO PRO L . n 
A 1 50  LYS 50  45  45  LYS LYS L . n 
A 1 51  ARG 51  46  46  ARG ARG L . n 
A 1 52  LEU 52  47  47  LEU LEU L . n 
A 1 53  ILE 53  48  48  ILE ILE L . n 
A 1 54  TYR 54  49  49  TYR TYR L . n 
A 1 55  LEU 55  50  50  LEU LEU L . n 
A 1 56  VAL 56  51  51  VAL VAL L . n 
A 1 57  SER 57  52  52  SER SER L . n 
A 1 58  LYS 58  53  53  LYS LYS L . n 
A 1 59  LEU 59  54  54  LEU LEU L . n 
A 1 60  ASP 60  55  55  ASP ASP L . n 
A 1 61  SER 61  56  56  SER SER L . n 
A 1 62  GLY 62  57  57  GLY GLY L . n 
A 1 63  VAL 63  58  58  VAL VAL L . n 
A 1 64  PRO 64  59  59  PRO PRO L . n 
A 1 65  ASP 65  60  60  ASP ASP L . n 
A 1 66  ARG 66  61  61  ARG ARG L . n 
A 1 67  PHE 67  62  62  PHE PHE L . n 
A 1 68  THR 68  63  63  THR THR L . n 
A 1 69  GLY 69  64  64  GLY GLY L . n 
A 1 70  SER 70  65  65  SER SER L . n 
A 1 71  GLY 71  66  66  GLY GLY L . n 
A 1 72  SER 72  67  67  SER SER L . n 
A 1 73  GLY 73  68  68  GLY GLY L . n 
A 1 74  THR 74  69  69  THR THR L . n 
A 1 75  ASP 75  70  70  ASP ASP L . n 
A 1 76  PHE 76  71  71  PHE PHE L . n 
A 1 77  THR 77  72  72  THR THR L . n 
A 1 78  LEU 78  73  73  LEU LEU L . n 
A 1 79  LYS 79  74  74  LYS LYS L . n 
A 1 80  ILE 80  75  75  ILE ILE L . n 
A 1 81  SER 81  76  76  SER SER L . n 
A 1 82  ARG 82  77  77  ARG ARG L . n 
A 1 83  VAL 83  78  78  VAL VAL L . n 
A 1 84  GLU 84  79  79  GLU GLU L . n 
A 1 85  ALA 85  80  80  ALA ALA L . n 
A 1 86  ALA 86  81  81  ALA ALA L . n 
A 1 87  ASP 87  82  82  ASP ASP L . n 
A 1 88  LEU 88  83  83  LEU LEU L . n 
A 1 89  GLY 89  84  84  GLY GLY L . n 
A 1 90  LEU 90  85  85  LEU LEU L . n 
A 1 91  TYR 91  86  86  TYR TYR L . n 
A 1 92  TYR 92  87  87  TYR TYR L . n 
A 1 93  CYS 93  88  88  CYS CYS L . n 
A 1 94  VAL 94  89  89  VAL VAL L . n 
A 1 95  GLN 95  90  90  GLN GLN L . n 
A 1 96  GLY 96  91  91  GLY GLY L . n 
A 1 97  THR 97  92  92  THR THR L . n 
A 1 98  HIS 98  93  93  HIS HIS L . n 
A 1 99  PHE 99  94  94  PHE PHE L . n 
A 1 100 PRO 100 95  95  PRO PRO L . n 
A 1 101 TYR 101 96  96  TYR TYR L . n 
A 1 102 THR 102 97  97  THR THR L . n 
A 1 103 PHE 103 98  98  PHE PHE L . n 
A 1 104 GLY 104 99  99  GLY GLY L . n 
A 1 105 GLY 105 100 100 GLY GLY L . n 
A 1 106 GLY 106 101 101 GLY GLY L . n 
A 1 107 THR 107 102 102 THR THR L . n 
A 1 108 LYS 108 103 103 LYS LYS L . n 
A 1 109 LEU 109 104 104 LEU LEU L . n 
A 1 110 GLU 110 105 105 GLU GLU L . n 
A 1 111 ILE 111 106 106 ILE ILE L . n 
A 1 112 LEU 112 107 107 LEU LEU L . n 
A 1 113 ARG 113 108 108 ARG ARG L . n 
A 1 114 ALA 114 109 109 ALA ALA L . n 
A 1 115 ASP 115 110 110 ASP ASP L . n 
A 1 116 ALA 116 111 111 ALA ALA L . n 
A 1 117 ALA 117 112 112 ALA ALA L . n 
A 1 118 PRO 118 113 113 PRO PRO L . n 
A 1 119 THR 119 114 114 THR THR L . n 
A 1 120 VAL 120 115 115 VAL VAL L . n 
A 1 121 SER 121 116 116 SER SER L . n 
A 1 122 ILE 122 117 117 ILE ILE L . n 
A 1 123 PHE 123 118 118 PHE PHE L . n 
A 1 124 PRO 124 119 119 PRO PRO L . n 
A 1 125 PRO 125 120 120 PRO PRO L . n 
A 1 126 SER 126 121 121 SER SER L . n 
A 1 127 SER 127 122 122 SER SER L . n 
A 1 128 GLU 128 123 123 GLU GLU L . n 
A 1 129 GLN 129 124 124 GLN GLN L . n 
A 1 130 LEU 130 125 125 LEU LEU L . n 
A 1 131 THR 131 126 126 THR THR L . n 
A 1 132 SER 132 127 127 SER SER L . n 
A 1 133 GLY 133 128 128 GLY GLY L . n 
A 1 134 GLY 134 129 129 GLY GLY L . n 
A 1 135 ALA 135 130 130 ALA ALA L . n 
A 1 136 SER 136 131 131 SER SER L . n 
A 1 137 VAL 137 132 132 VAL VAL L . n 
A 1 138 VAL 138 133 133 VAL VAL L . n 
A 1 139 CYS 139 134 134 CYS CYS L . n 
A 1 140 PHE 140 135 135 PHE PHE L . n 
A 1 141 LEU 141 136 136 LEU LEU L . n 
A 1 142 ASN 142 137 137 ASN ASN L . n 
A 1 143 ASN 143 138 138 ASN ASN L . n 
A 1 144 PHE 144 139 139 PHE PHE L . n 
A 1 145 TYR 145 140 140 TYR TYR L . n 
A 1 146 PRO 146 141 141 PRO PRO L . n 
A 1 147 LYS 147 142 142 LYS LYS L . n 
A 1 148 ASP 148 143 143 ASP ASP L . n 
A 1 149 ILE 149 144 144 ILE ILE L . n 
A 1 150 ASN 150 145 145 ASN ASN L . n 
A 1 151 VAL 151 146 146 VAL VAL L . n 
A 1 152 LYS 152 147 147 LYS LYS L . n 
A 1 153 TRP 153 148 148 TRP TRP L . n 
A 1 154 LYS 154 149 149 LYS LYS L . n 
A 1 155 ILE 155 150 150 ILE ILE L . n 
A 1 156 ASP 156 151 151 ASP ASP L . n 
A 1 157 GLY 157 152 152 GLY GLY L . n 
A 1 158 SER 158 153 153 SER SER L . n 
A 1 159 GLU 159 154 154 GLU GLU L . n 
A 1 160 ARG 160 155 155 ARG ARG L . n 
A 1 161 GLN 161 156 156 GLN GLN L . n 
A 1 162 ASN 162 157 157 ASN ASN L . n 
A 1 163 GLY 163 158 158 GLY GLY L . n 
A 1 164 VAL 164 159 159 VAL VAL L . n 
A 1 165 LEU 165 160 160 LEU LEU L . n 
A 1 166 ASN 166 161 161 ASN ASN L . n 
A 1 167 SER 167 162 162 SER SER L . n 
A 1 168 TRP 168 163 163 TRP TRP L . n 
A 1 169 THR 169 164 164 THR THR L . n 
A 1 170 ASP 170 165 165 ASP ASP L . n 
A 1 171 GLN 171 166 166 GLN GLN L . n 
A 1 172 ASP 172 167 167 ASP ASP L . n 
A 1 173 SER 173 168 168 SER SER L . n 
A 1 174 LYS 174 169 169 LYS LYS L . n 
A 1 175 ASP 175 170 170 ASP ASP L . n 
A 1 176 SER 176 171 171 SER SER L . n 
A 1 177 THR 177 172 172 THR THR L . n 
A 1 178 TYR 178 173 173 TYR TYR L . n 
A 1 179 SER 179 174 174 SER SER L . n 
A 1 180 MET 180 175 175 MET MET L . n 
A 1 181 SER 181 176 176 SER SER L . n 
A 1 182 SER 182 177 177 SER SER L . n 
A 1 183 THR 183 178 178 THR THR L . n 
A 1 184 LEU 184 179 179 LEU LEU L . n 
A 1 185 THR 185 180 180 THR THR L . n 
A 1 186 LEU 186 181 181 LEU LEU L . n 
A 1 187 THR 187 182 182 THR THR L . n 
A 1 188 LYS 188 183 183 LYS LYS L . n 
A 1 189 ASP 189 184 184 ASP ASP L . n 
A 1 190 GLU 190 185 185 GLU GLU L . n 
A 1 191 TYR 191 186 186 TYR TYR L . n 
A 1 192 GLU 192 187 187 GLU GLU L . n 
A 1 193 ARG 193 188 188 ARG ARG L . n 
A 1 194 HIS 194 189 189 HIS HIS L . n 
A 1 195 ASN 195 190 190 ASN ASN L . n 
A 1 196 SER 196 191 191 SER SER L . n 
A 1 197 TYR 197 192 192 TYR TYR L . n 
A 1 198 THR 198 193 193 THR THR L . n 
A 1 199 CYS 199 194 194 CYS CYS L . n 
A 1 200 GLU 200 195 195 GLU GLU L . n 
A 1 201 ALA 201 196 196 ALA ALA L . n 
A 1 202 THR 202 197 197 THR THR L . n 
A 1 203 HIS 203 198 198 HIS HIS L . n 
A 1 204 LYS 204 199 199 LYS LYS L . n 
A 1 205 THR 205 200 200 THR THR L . n 
A 1 206 SER 206 201 201 SER SER L . n 
A 1 207 THR 207 202 202 THR THR L . n 
A 1 208 SER 208 203 203 SER SER L . n 
A 1 209 PRO 209 204 204 PRO PRO L . n 
A 1 210 ILE 210 205 205 ILE ILE L . n 
A 1 211 VAL 211 206 206 VAL VAL L . n 
A 1 212 LYS 212 207 207 LYS LYS L . n 
A 1 213 SER 213 208 208 SER SER L . n 
A 1 214 PHE 214 209 209 PHE PHE L . n 
A 1 215 ASN 215 210 210 ASN ASN L . n 
A 1 216 ARG 216 211 211 ARG ARG L . n 
A 1 217 ASN 217 212 212 ASN ASN L . n 
A 1 218 GLU 218 213 213 GLU GLU L . n 
A 1 219 CYS 219 214 214 CYS CYS L . n 
B 2 1   GLU 1   1   1   GLU GLU H . n 
B 2 2   VAL 2   2   2   VAL VAL H . n 
B 2 3   LYS 3   3   3   LYS LYS H . n 
B 2 4   LEU 4   4   4   LEU LEU H . n 
B 2 5   GLN 5   5   5   GLN GLN H . n 
B 2 6   GLU 6   6   6   GLU GLU H . n 
B 2 7   SER 7   7   7   SER SER H . n 
B 2 8   GLY 8   8   8   GLY GLY H . n 
B 2 9   ALA 9   9   9   ALA ALA H . n 
B 2 10  GLU 10  10  10  GLU GLU H . n 
B 2 11  LEU 11  11  11  LEU LEU H . n 
B 2 12  VAL 12  12  12  VAL VAL H . n 
B 2 13  ARG 13  13  13  ARG ARG H . n 
B 2 14  PRO 14  14  14  PRO PRO H . n 
B 2 15  GLY 15  15  15  GLY GLY H . n 
B 2 16  ALA 16  16  16  ALA ALA H . n 
B 2 17  SER 17  17  17  SER SER H . n 
B 2 18  VAL 18  18  18  VAL VAL H . n 
B 2 19  LYS 19  19  19  LYS LYS H . n 
B 2 20  LEU 20  20  20  LEU LEU H . n 
B 2 21  SER 21  21  21  SER SER H . n 
B 2 22  CYS 22  22  22  CYS CYS H . n 
B 2 23  LYS 23  23  23  LYS LYS H . n 
B 2 24  THR 24  24  24  THR THR H . n 
B 2 25  SER 25  25  25  SER SER H . n 
B 2 26  GLY 26  26  26  GLY GLY H . n 
B 2 27  TYR 27  27  27  TYR TYR H . n 
B 2 28  ILE 28  28  28  ILE ILE H . n 
B 2 29  PHE 29  29  29  PHE PHE H . n 
B 2 30  THR 30  30  30  THR THR H . n 
B 2 31  SER 31  31  31  SER SER H . n 
B 2 32  TYR 32  32  32  TYR TYR H . n 
B 2 33  TRP 33  33  33  TRP TRP H . n 
B 2 34  ILE 34  34  34  ILE ILE H . n 
B 2 35  HIS 35  35  35  HIS HIS H . n 
B 2 36  TRP 36  36  36  TRP TRP H . n 
B 2 37  VAL 37  37  37  VAL VAL H . n 
B 2 38  LYS 38  38  38  LYS LYS H . n 
B 2 39  GLN 39  39  39  GLN GLN H . n 
B 2 40  ARG 40  40  40  ARG ARG H . n 
B 2 41  ALA 41  41  41  ALA ALA H . n 
B 2 42  ALA 42  42  42  ALA ALA H . n 
B 2 43  ALA 43  43  43  ALA ALA H . n 
B 2 44  GLY 44  44  44  GLY GLY H . n 
B 2 45  LEU 45  45  45  LEU LEU H . n 
B 2 46  GLU 46  46  46  GLU GLU H . n 
B 2 47  TRP 47  47  47  TRP TRP H . n 
B 2 48  ILE 48  48  48  ILE ILE H . n 
B 2 49  ALA 49  49  49  ALA ALA H . n 
B 2 50  ARG 50  50  50  ARG ARG H . n 
B 2 51  ILE 51  51  51  ILE ILE H . n 
B 2 52  TYR 52  52  52  TYR TYR H . n 
B 2 53  PRO 53  52  52  PRO PRO H A n 
B 2 54  GLY 54  53  53  GLY GLY H . n 
B 2 55  THR 55  54  54  THR THR H . n 
B 2 56  GLY 56  55  55  GLY GLY H . n 
B 2 57  SER 57  56  56  SER SER H . n 
B 2 58  SER 58  57  57  SER SER H . n 
B 2 59  TYR 59  58  58  TYR TYR H . n 
B 2 60  TYR 60  59  59  TYR TYR H . n 
B 2 61  ASN 61  60  60  ASN ASN H . n 
B 2 62  VAL 62  61  61  VAL VAL H . n 
B 2 63  LYS 63  62  62  LYS LYS H . n 
B 2 64  PHE 64  63  63  PHE PHE H . n 
B 2 65  LYS 65  64  64  LYS LYS H . n 
B 2 66  GLY 66  65  65  GLY GLY H . n 
B 2 67  LYS 67  66  66  LYS LYS H . n 
B 2 68  ALA 68  67  67  ALA ALA H . n 
B 2 69  THR 69  68  68  THR THR H . n 
B 2 70  LEU 70  69  69  LEU LEU H . n 
B 2 71  THR 71  70  70  THR THR H . n 
B 2 72  ALA 72  71  71  ALA ALA H . n 
B 2 73  ASP 73  72  72  ASP ASP H . n 
B 2 74  LYS 74  73  73  LYS LYS H . n 
B 2 75  SER 75  74  74  SER SER H . n 
B 2 76  SER 76  75  75  SER SER H . n 
B 2 77  SER 77  76  76  SER SER H . n 
B 2 78  THR 78  77  77  THR THR H . n 
B 2 79  ALA 79  78  78  ALA ALA H . n 
B 2 80  TYR 80  79  79  TYR TYR H . n 
B 2 81  MET 81  80  80  MET MET H . n 
B 2 82  GLN 82  81  81  GLN GLN H . n 
B 2 83  LEU 83  82  82  LEU LEU H . n 
B 2 84  SER 84  82  82  SER SER H A n 
B 2 85  SER 85  82  82  SER SER H B n 
B 2 86  LEU 86  82  82  LEU LEU H C n 
B 2 87  LYS 87  83  83  LYS LYS H . n 
B 2 88  SER 88  84  84  SER SER H . n 
B 2 89  ASP 89  85  85  ASP ASP H . n 
B 2 90  ASP 90  86  86  ASP ASP H . n 
B 2 91  SER 91  87  87  SER SER H . n 
B 2 92  ALA 92  88  88  ALA ALA H . n 
B 2 93  VAL 93  89  89  VAL VAL H . n 
B 2 94  TYR 94  90  90  TYR TYR H . n 
B 2 95  PHE 95  91  91  PHE PHE H . n 
B 2 96  CYS 96  92  92  CYS CYS H . n 
B 2 97  VAL 97  93  93  VAL VAL H . n 
B 2 98  ARG 98  94  94  ARG ARG H . n 
B 2 99  TRP 99  95  95  TRP TRP H . n 
B 2 100 GLY 100 96  96  GLY GLY H . n 
B 2 101 PHE 101 97  97  PHE PHE H . n 
B 2 102 ILE 102 98  98  ILE ILE H . n 
B 2 103 PRO 103 99  99  PRO PRO H . n 
B 2 104 VAL 104 100 100 VAL VAL H . n 
B 2 105 ARG 105 100 100 ARG ARG H A n 
B 2 106 GLU 106 100 100 GLU GLU H B n 
B 2 107 ASP 107 100 100 ASP ASP H C n 
B 2 108 TYR 108 100 100 TYR TYR H D n 
B 2 109 VAL 109 100 100 VAL VAL H E n 
B 2 110 LEU 110 100 100 LEU LEU H F n 
B 2 111 ASP 111 101 101 ASP ASP H . n 
B 2 112 TYR 112 102 102 TYR TYR H . n 
B 2 113 TRP 113 103 103 TRP TRP H . n 
B 2 114 GLY 114 104 104 GLY GLY H . n 
B 2 115 GLN 115 105 105 GLN GLN H . n 
B 2 116 GLY 116 106 106 GLY GLY H . n 
B 2 117 THR 117 107 107 THR THR H . n 
B 2 118 LEU 118 108 108 LEU LEU H . n 
B 2 119 VAL 119 109 109 VAL VAL H . n 
B 2 120 THR 120 110 110 THR THR H . n 
B 2 121 VAL 121 111 111 VAL VAL H . n 
B 2 122 SER 122 112 112 SER SER H . n 
B 2 123 SER 123 113 113 SER SER H . n 
B 2 124 ALA 124 114 114 ALA ALA H . n 
B 2 125 LYS 125 115 115 LYS LYS H . n 
B 2 126 THR 126 116 116 THR THR H . n 
B 2 127 THR 127 117 117 THR THR H . n 
B 2 128 ALA 128 118 118 ALA ALA H . n 
B 2 129 PRO 129 119 119 PRO PRO H . n 
B 2 130 SER 130 120 120 SER SER H . n 
B 2 131 VAL 131 121 121 VAL VAL H . n 
B 2 132 TYR 132 122 122 TYR TYR H . n 
B 2 133 PRO 133 123 123 PRO PRO H . n 
B 2 134 LEU 134 124 124 LEU LEU H . n 
B 2 135 ALA 135 125 125 ALA ALA H . n 
B 2 136 PRO 136 126 126 PRO PRO H . n 
B 2 137 VAL 137 127 127 VAL VAL H . n 
B 2 138 CYS 138 128 128 CYS CYS H . n 
B 2 139 GLY 139 129 129 GLY GLY H . n 
B 2 140 ASP 140 130 130 ASP ASP H . n 
B 2 141 THR 141 131 131 THR THR H . n 
B 2 142 THR 142 132 132 THR THR H . n 
B 2 143 GLY 143 133 133 GLY GLY H . n 
B 2 144 SER 144 134 134 SER SER H . n 
B 2 145 SER 145 135 135 SER SER H . n 
B 2 146 VAL 146 136 136 VAL VAL H . n 
B 2 147 THR 147 137 137 THR THR H . n 
B 2 148 LEU 148 138 138 LEU LEU H . n 
B 2 149 GLY 149 139 139 GLY GLY H . n 
B 2 150 CYS 150 140 140 CYS CYS H . n 
B 2 151 LEU 151 141 141 LEU LEU H . n 
B 2 152 VAL 152 142 142 VAL VAL H . n 
B 2 153 LYS 153 143 143 LYS LYS H . n 
B 2 154 GLY 154 144 144 GLY GLY H . n 
B 2 155 TYR 155 145 145 TYR TYR H . n 
B 2 156 PHE 156 146 146 PHE PHE H . n 
B 2 157 PRO 157 147 147 PRO PRO H . n 
B 2 158 GLU 158 148 148 GLU GLU H . n 
B 2 159 PRO 159 149 149 PRO PRO H . n 
B 2 160 VAL 160 150 150 VAL VAL H . n 
B 2 161 THR 161 151 151 THR THR H . n 
B 2 162 LEU 162 152 152 LEU LEU H . n 
B 2 163 THR 163 154 154 THR THR H . n 
B 2 164 TRP 164 155 155 TRP TRP H . n 
B 2 165 ASN 165 160 160 ASN ASN H . n 
B 2 166 SER 166 161 161 SER SER H . n 
B 2 167 GLY 167 162 162 GLY GLY H . n 
B 2 168 SER 168 163 163 SER SER H . n 
B 2 169 LEU 169 164 164 LEU LEU H . n 
B 2 170 SER 170 165 165 SER SER H . n 
B 2 171 SER 171 166 166 SER SER H . n 
B 2 172 GLY 172 167 167 GLY GLY H . n 
B 2 173 VAL 173 169 169 VAL VAL H . n 
B 2 174 HIS 174 170 170 HIS HIS H . n 
B 2 175 THR 175 171 171 THR THR H . n 
B 2 176 PHE 176 172 172 PHE PHE H . n 
B 2 177 PRO 177 173 173 PRO PRO H . n 
B 2 178 ALA 178 174 174 ALA ALA H . n 
B 2 179 VAL 179 175 175 VAL VAL H . n 
B 2 180 LEU 180 176 176 LEU LEU H . n 
B 2 181 GLN 181 177 177 GLN GLN H . n 
B 2 182 SER 182 178 178 SER SER H . n 
B 2 183 ASP 183 181 181 ASP ASP H . n 
B 2 184 LEU 184 182 182 LEU LEU H . n 
B 2 185 TYR 185 183 183 TYR TYR H . n 
B 2 186 THR 186 184 184 THR THR H . n 
B 2 187 LEU 187 185 185 LEU LEU H . n 
B 2 188 SER 188 186 186 SER SER H . n 
B 2 189 SER 189 187 187 SER SER H . n 
B 2 190 SER 190 188 188 SER SER H . n 
B 2 191 VAL 191 189 189 VAL VAL H . n 
B 2 192 THR 192 190 190 THR THR H . n 
B 2 193 VAL 193 191 191 VAL VAL H . n 
B 2 194 THR 194 192 192 THR THR H . n 
B 2 195 SER 195 193 193 SER SER H . n 
B 2 196 SER 196 194 194 SER SER H . n 
B 2 197 THR 197 196 196 THR THR H . n 
B 2 198 TRP 198 197 197 TRP TRP H . n 
B 2 199 PRO 199 198 198 PRO PRO H . n 
B 2 200 SER 200 200 200 SER SER H . n 
B 2 201 GLN 201 201 201 GLN GLN H . n 
B 2 202 SER 202 202 202 SER SER H . n 
B 2 203 ILE 203 203 203 ILE ILE H . n 
B 2 204 THR 204 204 204 THR THR H . n 
B 2 205 CYS 205 206 206 CYS CYS H . n 
B 2 206 ASN 206 207 207 ASN ASN H . n 
B 2 207 VAL 207 208 208 VAL VAL H . n 
B 2 208 ALA 208 209 209 ALA ALA H . n 
B 2 209 HIS 209 210 210 HIS HIS H . n 
B 2 210 PRO 210 211 211 PRO PRO H . n 
B 2 211 ALA 211 212 212 ALA ALA H . n 
B 2 212 SER 212 213 213 SER SER H . n 
B 2 213 SER 213 214 214 SER SER H . n 
B 2 214 THR 214 215 215 THR THR H . n 
B 2 215 LYS 215 216 216 LYS LYS H . n 
B 2 216 VAL 216 217 217 VAL VAL H . n 
B 2 217 ASP 217 218 218 ASP ASP H . n 
B 2 218 LYS 218 219 219 LYS LYS H . n 
B 2 219 LYS 219 220 220 LYS LYS H . n 
B 2 220 ILE 220 221 221 ILE ILE H . n 
B 2 221 GLU 221 222 222 GLU GLU H . n 
B 2 222 PRO 222 223 223 PRO PRO H . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4850  ? 
1 MORE         -19   ? 
1 'SSA (A^2)'  19010 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1997-10-15 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOSFLM 'data reduction' 5.2 ? 1 
CCP4   'data reduction' .   ? 2 
X-PLOR 'model building' 3.1 ? 3 
X-PLOR refinement       3.1 ? 4 
CCP4   'data scaling'   .   ? 5 
X-PLOR phasing          3.1 ? 6 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             L 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              11 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             L 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              11 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             L 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              11 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                135.58 
_pdbx_validate_rmsd_angle.angle_target_value         115.30 
_pdbx_validate_rmsd_angle.angle_deviation            20.28 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL L 51  ? ? 70.93   -39.94  
2  1 ASP L 60  ? ? -81.27  36.70   
3  1 ASN L 212 ? ? -126.82 -72.57  
4  1 GLU L 213 ? ? 179.14  159.12  
5  1 ALA H 41  ? ? -49.47  84.68   
6  1 ALA H 42  ? ? -178.09 34.92   
7  1 ALA H 88  ? ? -178.75 -173.53 
8  1 CYS H 128 ? ? -148.35 -57.03  
9  1 ASP H 130 ? ? -161.13 -39.16  
10 1 THR H 131 ? ? 106.28  -45.28  
11 1 THR H 132 ? ? 68.79   -87.21  
12 1 SER H 134 ? ? 85.00   -56.11  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 4-NITRO-BENZYLPHOSPHONOBUTANOYL-GLYCINE PNB 
4 water                                   HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 PNB 1  551 551 PNB PNB H . 
D 4 HOH 1  215 6   HOH HOH L . 
D 4 HOH 2  216 7   HOH HOH L . 
D 4 HOH 3  217 8   HOH HOH L . 
D 4 HOH 4  218 10  HOH HOH L . 
D 4 HOH 5  219 11  HOH HOH L . 
D 4 HOH 6  220 13  HOH HOH L . 
D 4 HOH 7  221 14  HOH HOH L . 
D 4 HOH 8  222 15  HOH HOH L . 
D 4 HOH 9  223 17  HOH HOH L . 
D 4 HOH 10 224 18  HOH HOH L . 
D 4 HOH 11 225 19  HOH HOH L . 
D 4 HOH 12 226 20  HOH HOH L . 
D 4 HOH 13 227 23  HOH HOH L . 
D 4 HOH 14 228 24  HOH HOH L . 
D 4 HOH 15 229 25  HOH HOH L . 
D 4 HOH 16 230 26  HOH HOH L . 
D 4 HOH 17 231 32  HOH HOH L . 
D 4 HOH 18 232 35  HOH HOH L . 
D 4 HOH 19 233 36  HOH HOH L . 
D 4 HOH 20 234 37  HOH HOH L . 
D 4 HOH 21 235 38  HOH HOH L . 
D 4 HOH 22 236 39  HOH HOH L . 
D 4 HOH 23 237 42  HOH HOH L . 
D 4 HOH 24 238 46  HOH HOH L . 
D 4 HOH 25 239 48  HOH HOH L . 
D 4 HOH 26 240 49  HOH HOH L . 
D 4 HOH 27 241 51  HOH HOH L . 
D 4 HOH 28 242 52  HOH HOH L . 
D 4 HOH 29 243 54  HOH HOH L . 
D 4 HOH 30 244 55  HOH HOH L . 
D 4 HOH 31 245 57  HOH HOH L . 
D 4 HOH 32 246 68  HOH HOH L . 
D 4 HOH 33 247 70  HOH HOH L . 
D 4 HOH 34 248 71  HOH HOH L . 
D 4 HOH 35 249 72  HOH HOH L . 
D 4 HOH 36 250 74  HOH HOH L . 
D 4 HOH 37 251 78  HOH HOH L . 
D 4 HOH 38 252 79  HOH HOH L . 
D 4 HOH 39 253 83  HOH HOH L . 
D 4 HOH 40 254 85  HOH HOH L . 
D 4 HOH 41 255 86  HOH HOH L . 
D 4 HOH 42 256 88  HOH HOH L . 
D 4 HOH 43 257 89  HOH HOH L . 
D 4 HOH 44 258 93  HOH HOH L . 
E 4 HOH 1  552 1   HOH HOH H . 
E 4 HOH 2  553 2   HOH HOH H . 
E 4 HOH 3  554 3   HOH HOH H . 
E 4 HOH 4  555 4   HOH HOH H . 
E 4 HOH 5  556 5   HOH HOH H . 
E 4 HOH 6  557 9   HOH HOH H . 
E 4 HOH 7  558 12  HOH HOH H . 
E 4 HOH 8  559 16  HOH HOH H . 
E 4 HOH 9  560 21  HOH HOH H . 
E 4 HOH 10 561 22  HOH HOH H . 
E 4 HOH 11 562 27  HOH HOH H . 
E 4 HOH 12 563 28  HOH HOH H . 
E 4 HOH 13 564 29  HOH HOH H . 
E 4 HOH 14 565 30  HOH HOH H . 
E 4 HOH 15 566 31  HOH HOH H . 
E 4 HOH 16 567 33  HOH HOH H . 
E 4 HOH 17 568 34  HOH HOH H . 
E 4 HOH 18 569 40  HOH HOH H . 
E 4 HOH 19 570 41  HOH HOH H . 
E 4 HOH 20 571 43  HOH HOH H . 
E 4 HOH 21 572 44  HOH HOH H . 
E 4 HOH 22 573 45  HOH HOH H . 
E 4 HOH 23 574 47  HOH HOH H . 
E 4 HOH 24 575 50  HOH HOH H . 
E 4 HOH 25 576 53  HOH HOH H . 
E 4 HOH 26 577 56  HOH HOH H . 
E 4 HOH 27 578 58  HOH HOH H . 
E 4 HOH 28 579 59  HOH HOH H . 
E 4 HOH 29 580 60  HOH HOH H . 
E 4 HOH 30 581 61  HOH HOH H . 
E 4 HOH 31 582 62  HOH HOH H . 
E 4 HOH 32 583 63  HOH HOH H . 
E 4 HOH 33 584 64  HOH HOH H . 
E 4 HOH 34 585 65  HOH HOH H . 
E 4 HOH 35 586 66  HOH HOH H . 
E 4 HOH 36 587 67  HOH HOH H . 
E 4 HOH 37 588 69  HOH HOH H . 
E 4 HOH 38 589 73  HOH HOH H . 
E 4 HOH 39 590 75  HOH HOH H . 
E 4 HOH 40 591 76  HOH HOH H . 
E 4 HOH 41 592 77  HOH HOH H . 
E 4 HOH 42 593 80  HOH HOH H . 
E 4 HOH 43 594 81  HOH HOH H . 
E 4 HOH 44 595 82  HOH HOH H . 
E 4 HOH 45 596 84  HOH HOH H . 
E 4 HOH 46 597 87  HOH HOH H . 
E 4 HOH 47 598 90  HOH HOH H . 
E 4 HOH 48 599 91  HOH HOH H . 
E 4 HOH 49 600 92  HOH HOH H . 
#