data_1YH3
# 
_entry.id   1YH3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1YH3         
RCSB  RCSB031503   
WWPDB D_1000031503 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1YH3 
_pdbx_database_status.recvd_initial_deposition_date   2005-01-06 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Liu, Q.'         1 
'Kriksunov, I.A.' 2 
'Graeff, R.'      3 
'Munshi, C.'      4 
'Lee, H.C.'       5 
'Hao, Q.'         6 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of human CD38 extracellular domain.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            13 
_citation.page_first                1331 
_citation.page_last                 1339 
_citation.year                      2005 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16154090 
_citation.pdbx_database_id_DOI      10.1016/j.str.2005.05.012 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Liu, Q.'         1 
primary 'Kriksunov, I.A.' 2 
primary 'Graeff, R.'      3 
primary 'Munshi, C.'      4 
primary 'Lee, H.C.'       5 
primary 'Hao, Q.'         6 
# 
_cell.entry_id           1YH3 
_cell.length_a           41.839 
_cell.length_b           51.491 
_cell.length_c           66.439 
_cell.angle_alpha        108.27 
_cell.angle_beta         90.47 
_cell.angle_gamma        97.29 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1YH3 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'ADP-ribosyl cyclase 1' 29649.637 2   3.2.2.5 'N100D, N164A, N219D, N209D' 'human CD38 extracellular domain' ? 
2 water   nat water                   18.015    324 ?       ?                            ?                                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Cyclic ADP-ribose hydrolase 1, cADPr hydrolase 1, Lymphocyte differentiation antigen CD38, T10, Acute lymphoblastic leukemia cells antigen CD38
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;RWRQTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILL
WSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFATSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVV
HVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKF
LQCVKNPEDSSCTSEI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;RWRQTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILL
WSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFATSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVV
HVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKF
LQCVKNPEDSSCTSEI
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ARG n 
1 2   TRP n 
1 3   ARG n 
1 4   GLN n 
1 5   THR n 
1 6   TRP n 
1 7   SER n 
1 8   GLY n 
1 9   PRO n 
1 10  GLY n 
1 11  THR n 
1 12  THR n 
1 13  LYS n 
1 14  ARG n 
1 15  PHE n 
1 16  PRO n 
1 17  GLU n 
1 18  THR n 
1 19  VAL n 
1 20  LEU n 
1 21  ALA n 
1 22  ARG n 
1 23  CYS n 
1 24  VAL n 
1 25  LYS n 
1 26  TYR n 
1 27  THR n 
1 28  GLU n 
1 29  ILE n 
1 30  HIS n 
1 31  PRO n 
1 32  GLU n 
1 33  MET n 
1 34  ARG n 
1 35  HIS n 
1 36  VAL n 
1 37  ASP n 
1 38  CYS n 
1 39  GLN n 
1 40  SER n 
1 41  VAL n 
1 42  TRP n 
1 43  ASP n 
1 44  ALA n 
1 45  PHE n 
1 46  LYS n 
1 47  GLY n 
1 48  ALA n 
1 49  PHE n 
1 50  ILE n 
1 51  SER n 
1 52  LYS n 
1 53  HIS n 
1 54  PRO n 
1 55  CYS n 
1 56  ASP n 
1 57  ILE n 
1 58  THR n 
1 59  GLU n 
1 60  GLU n 
1 61  ASP n 
1 62  TYR n 
1 63  GLN n 
1 64  PRO n 
1 65  LEU n 
1 66  MET n 
1 67  LYS n 
1 68  LEU n 
1 69  GLY n 
1 70  THR n 
1 71  GLN n 
1 72  THR n 
1 73  VAL n 
1 74  PRO n 
1 75  CYS n 
1 76  ASN n 
1 77  LYS n 
1 78  ILE n 
1 79  LEU n 
1 80  LEU n 
1 81  TRP n 
1 82  SER n 
1 83  ARG n 
1 84  ILE n 
1 85  LYS n 
1 86  ASP n 
1 87  LEU n 
1 88  ALA n 
1 89  HIS n 
1 90  GLN n 
1 91  PHE n 
1 92  THR n 
1 93  GLN n 
1 94  VAL n 
1 95  GLN n 
1 96  ARG n 
1 97  ASP n 
1 98  MET n 
1 99  PHE n 
1 100 THR n 
1 101 LEU n 
1 102 GLU n 
1 103 ASP n 
1 104 THR n 
1 105 LEU n 
1 106 LEU n 
1 107 GLY n 
1 108 TYR n 
1 109 LEU n 
1 110 ALA n 
1 111 ASP n 
1 112 ASP n 
1 113 LEU n 
1 114 THR n 
1 115 TRP n 
1 116 CYS n 
1 117 GLY n 
1 118 GLU n 
1 119 PHE n 
1 120 ALA n 
1 121 THR n 
1 122 SER n 
1 123 LYS n 
1 124 ILE n 
1 125 ASN n 
1 126 TYR n 
1 127 GLN n 
1 128 SER n 
1 129 CYS n 
1 130 PRO n 
1 131 ASP n 
1 132 TRP n 
1 133 ARG n 
1 134 LYS n 
1 135 ASP n 
1 136 CYS n 
1 137 SER n 
1 138 ASN n 
1 139 ASN n 
1 140 PRO n 
1 141 VAL n 
1 142 SER n 
1 143 VAL n 
1 144 PHE n 
1 145 TRP n 
1 146 LYS n 
1 147 THR n 
1 148 VAL n 
1 149 SER n 
1 150 ARG n 
1 151 ARG n 
1 152 PHE n 
1 153 ALA n 
1 154 GLU n 
1 155 ALA n 
1 156 ALA n 
1 157 CYS n 
1 158 ASP n 
1 159 VAL n 
1 160 VAL n 
1 161 HIS n 
1 162 VAL n 
1 163 MET n 
1 164 LEU n 
1 165 ASP n 
1 166 GLY n 
1 167 SER n 
1 168 ARG n 
1 169 SER n 
1 170 LYS n 
1 171 ILE n 
1 172 PHE n 
1 173 ASP n 
1 174 LYS n 
1 175 ASP n 
1 176 SER n 
1 177 THR n 
1 178 PHE n 
1 179 GLY n 
1 180 SER n 
1 181 VAL n 
1 182 GLU n 
1 183 VAL n 
1 184 HIS n 
1 185 ASN n 
1 186 LEU n 
1 187 GLN n 
1 188 PRO n 
1 189 GLU n 
1 190 LYS n 
1 191 VAL n 
1 192 GLN n 
1 193 THR n 
1 194 LEU n 
1 195 GLU n 
1 196 ALA n 
1 197 TRP n 
1 198 VAL n 
1 199 ILE n 
1 200 HIS n 
1 201 GLY n 
1 202 GLY n 
1 203 ARG n 
1 204 GLU n 
1 205 ASP n 
1 206 SER n 
1 207 ARG n 
1 208 ASP n 
1 209 LEU n 
1 210 CYS n 
1 211 GLN n 
1 212 ASP n 
1 213 PRO n 
1 214 THR n 
1 215 ILE n 
1 216 LYS n 
1 217 GLU n 
1 218 LEU n 
1 219 GLU n 
1 220 SER n 
1 221 ILE n 
1 222 ILE n 
1 223 SER n 
1 224 LYS n 
1 225 ARG n 
1 226 ASN n 
1 227 ILE n 
1 228 GLN n 
1 229 PHE n 
1 230 SER n 
1 231 CYS n 
1 232 LYS n 
1 233 ASN n 
1 234 ILE n 
1 235 TYR n 
1 236 ARG n 
1 237 PRO n 
1 238 ASP n 
1 239 LYS n 
1 240 PHE n 
1 241 LEU n 
1 242 GLN n 
1 243 CYS n 
1 244 VAL n 
1 245 LYS n 
1 246 ASN n 
1 247 PRO n 
1 248 GLU n 
1 249 ASP n 
1 250 SER n 
1 251 SER n 
1 252 CYS n 
1 253 THR n 
1 254 SER n 
1 255 GLU n 
1 256 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 CD38 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Pichia pastoris' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4922 
_entity_src_gen.host_org_genus                     Pichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               X-33 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CD38_HUMAN 
_struct_ref.pdbx_db_accession          P28907 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RWRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCNKILL
WSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVV
HVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKF
LQCVKNPEDSSCTSEI
;
_struct_ref.pdbx_align_begin           45 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1YH3 A 1 ? 256 ? P28907 45 ? 300 ? 45 300 
2 1 1YH3 B 1 ? 256 ? P28907 45 ? 300 ? 45 300 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1YH3 THR A 5   ? UNP P28907 GLN 49  'SEE REMARK 999' 49  1  
1 1YH3 ASP A 56  ? UNP P28907 ASN 100 ENGINEERED       100 2  
1 1YH3 ALA A 120 ? UNP P28907 ASN 164 ENGINEERED       164 3  
1 1YH3 ASP A 165 ? UNP P28907 ASN 209 ENGINEERED       209 4  
1 1YH3 ASP A 175 ? UNP P28907 ASN 219 ENGINEERED       219 5  
2 1YH3 THR B 5   ? UNP P28907 GLN 49  'SEE REMARK 999' 49  6  
2 1YH3 ASP B 56  ? UNP P28907 ASN 100 ENGINEERED       100 7  
2 1YH3 ALA B 120 ? UNP P28907 ASN 164 ENGINEERED       164 8  
2 1YH3 ASP B 165 ? UNP P28907 ASN 209 ENGINEERED       209 9  
2 1YH3 ASP B 175 ? UNP P28907 ASN 219 ENGINEERED       219 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1YH3 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.4 
_exptl_crystal.density_percent_sol   48 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            297 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'MES, PEG4000, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 297K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2004-07-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 Channel' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.916 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.916 
# 
_reflns.entry_id                     1YH3 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.d_resolution_high            1.90 
_reflns.d_resolution_low             30 
_reflns.number_all                   41065 
_reflns.number_obs                   40203 
_reflns.percent_possible_obs         97.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.93 
_reflns_shell.percent_possible_all   94.6 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1YH3 
_refine.ls_number_reflns_obs                     37426 
_refine.ls_number_reflns_all                     39418 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10.00 
_refine.ls_d_res_high                            1.91 
_refine.ls_percent_reflns_obs                    98.06 
_refine.ls_R_factor_obs                          0.19174 
_refine.ls_R_factor_all                          0.19174 
_refine.ls_R_factor_R_work                       0.18849 
_refine.ls_R_factor_R_free                       0.25336 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1992 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.958 
_refine.correlation_coeff_Fo_to_Fc_free          0.922 
_refine.B_iso_mean                               28.562 
_refine.aniso_B[1][1]                            -2.17 
_refine.aniso_B[2][2]                            1.15 
_refine.aniso_B[3][3]                            2.81 
_refine.aniso_B[1][2]                            0.66 
_refine.aniso_B[1][3]                            1.21 
_refine.aniso_B[2][3]                            2.56 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.171 
_refine.pdbx_overall_ESU_R_Free                  0.168 
_refine.overall_SU_ML                            0.128 
_refine.overall_SU_B                             4.383 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3986 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             324 
_refine_hist.number_atoms_total               4310 
_refine_hist.d_res_high                       1.91 
_refine_hist.d_res_low                        10.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.029 0.021 ? 4102 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      2.264 1.933 ? 5556 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   7.334 5.000 ? 502  'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.174 0.200 ? 588  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.011 0.020 ? 3117 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.263 0.200 ? 1990 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.206 0.200 ? 295  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.409 0.200 ? 75   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.191 0.200 ? 23   'X-RAY DIFFRACTION' ? 
r_mcbond_it              1.539 1.500 ? 2496 'X-RAY DIFFRACTION' ? 
r_mcangle_it             2.659 2.000 ? 4035 'X-RAY DIFFRACTION' ? 
r_scbond_it              4.200 3.000 ? 1606 'X-RAY DIFFRACTION' ? 
r_scangle_it             6.297 4.500 ? 1521 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.910 
_refine_ls_shell.d_res_low                        1.958 
_refine_ls_shell.number_reflns_R_work             2617 
_refine_ls_shell.R_factor_R_work                  0.254 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.296 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             154 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1YH3 
_struct.title                     'Crystal structure of human CD38 extracellular domain' 
_struct.pdbx_descriptor           'ADP-ribosyl cyclase 1 (E.C.3.2.2.5)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1YH3 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'parallel beta sheets, two domains, membrane association, cell surface receptor, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 'The active assembly is a monomer' ? 
2 ?                                  ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 14  ? HIS A 30  ? ARG A 58  HIS A 74  1 ? 17 
HELX_P HELX_P2  2  PRO A 31  ? ARG A 34  ? PRO A 75  ARG A 78  5 ? 4  
HELX_P HELX_P3  3  ASP A 37  ? ALA A 48  ? ASP A 81  ALA A 92  1 ? 12 
HELX_P HELX_P4  4  THR A 58  ? ASP A 61  ? THR A 102 ASP A 105 5 ? 4  
HELX_P HELX_P5  5  TYR A 62  ? GLY A 69  ? TYR A 106 GLY A 113 1 ? 8  
HELX_P HELX_P6  6  PRO A 74  ? LYS A 77  ? PRO A 118 LYS A 121 5 ? 4  
HELX_P HELX_P7  7  ILE A 84  ? VAL A 94  ? ILE A 128 VAL A 138 1 ? 11 
HELX_P HELX_P8  8  THR A 100 ? ASP A 103 ? THR A 144 ASP A 147 5 ? 4  
HELX_P HELX_P9  9  THR A 104 ? ASP A 111 ? THR A 148 ASP A 155 1 ? 8  
HELX_P HELX_P10 10 ASN A 139 ? ALA A 156 ? ASN A 183 ALA A 200 1 ? 18 
HELX_P HELX_P11 11 SER A 176 ? VAL A 181 ? SER A 220 VAL A 225 1 ? 6  
HELX_P HELX_P12 12 GLU A 182 ? ASN A 185 ? GLU A 226 ASN A 229 5 ? 4  
HELX_P HELX_P13 13 ASP A 208 ? GLN A 211 ? ASP A 252 GLN A 255 5 ? 4  
HELX_P HELX_P14 14 ASP A 212 ? ARG A 225 ? ASP A 256 ARG A 269 1 ? 14 
HELX_P HELX_P15 15 ARG A 236 ? ASN A 246 ? ARG A 280 ASN A 290 1 ? 11 
HELX_P HELX_P16 16 ARG B 14  ? GLU B 28  ? ARG B 58  GLU B 72  1 ? 15 
HELX_P HELX_P17 17 HIS B 30  ? ARG B 34  ? HIS B 74  ARG B 78  5 ? 5  
HELX_P HELX_P18 18 ASP B 37  ? ALA B 48  ? ASP B 81  ALA B 92  1 ? 12 
HELX_P HELX_P19 19 THR B 58  ? GLY B 69  ? THR B 102 GLY B 113 1 ? 12 
HELX_P HELX_P20 20 ILE B 84  ? GLN B 95  ? ILE B 128 GLN B 139 1 ? 12 
HELX_P HELX_P21 21 THR B 100 ? ASP B 103 ? THR B 144 ASP B 147 5 ? 4  
HELX_P HELX_P22 22 THR B 104 ? ASP B 111 ? THR B 148 ASP B 155 1 ? 8  
HELX_P HELX_P23 23 ASN B 139 ? ALA B 156 ? ASN B 183 ALA B 200 1 ? 18 
HELX_P HELX_P24 24 SER B 176 ? VAL B 181 ? SER B 220 VAL B 225 1 ? 6  
HELX_P HELX_P25 25 GLU B 182 ? LEU B 186 ? GLU B 226 LEU B 230 5 ? 5  
HELX_P HELX_P26 26 ASP B 208 ? GLN B 211 ? ASP B 252 GLN B 255 5 ? 4  
HELX_P HELX_P27 27 ASP B 212 ? LYS B 224 ? ASP B 256 LYS B 268 1 ? 13 
HELX_P HELX_P28 28 ARG B 236 ? ASN B 246 ? ARG B 280 ASN B 290 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 23  SG ? ? ? 1_555 A CYS 38  SG ? ? A CYS 67  A CYS 82  1_555 ? ? ? ? ? ? ? 2.149 ? 
disulf2  disulf ? ? A CYS 55  SG ? ? ? 1_555 A CYS 136 SG ? ? A CYS 99  A CYS 180 1_555 ? ? ? ? ? ? ? 2.193 ? 
disulf3  disulf ? ? A CYS 75  SG ? ? ? 1_555 A CYS 157 SG ? ? A CYS 119 A CYS 201 1_555 ? ? ? ? ? ? ? 2.132 ? 
disulf4  disulf ? ? A CYS 116 SG ? ? ? 1_555 A CYS 129 SG ? ? A CYS 160 A CYS 173 1_555 ? ? ? ? ? ? ? 2.168 ? 
disulf5  disulf ? ? A CYS 210 SG ? ? ? 1_555 A CYS 231 SG ? ? A CYS 254 A CYS 275 1_555 ? ? ? ? ? ? ? 2.158 ? 
disulf6  disulf ? ? B CYS 23  SG ? ? ? 1_555 B CYS 38  SG ? ? B CYS 67  B CYS 82  1_555 ? ? ? ? ? ? ? 2.061 ? 
disulf7  disulf ? ? B CYS 55  SG ? ? ? 1_555 B CYS 136 SG ? ? B CYS 99  B CYS 180 1_555 ? ? ? ? ? ? ? 2.080 ? 
disulf8  disulf ? ? B CYS 75  SG ? ? ? 1_555 B CYS 157 SG ? ? B CYS 119 B CYS 201 1_555 ? ? ? ? ? ? ? 2.066 ? 
disulf9  disulf ? ? B CYS 116 SG ? ? ? 1_555 B CYS 129 SG ? ? B CYS 160 B CYS 173 1_555 ? ? ? ? ? ? ? 2.166 ? 
disulf10 disulf ? ? B CYS 210 SG ? ? ? 1_555 B CYS 231 SG ? ? B CYS 254 B CYS 275 1_555 ? ? ? ? ? ? ? 2.068 ? 
disulf11 disulf ? ? B CYS 243 SG ? ? ? 1_555 B CYS 252 SG ? ? B CYS 287 B CYS 296 1_555 ? ? ? ? ? ? ? 2.774 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 4 ? 
C ? 2 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 8   ? PRO A 9   ? GLY A 52  PRO A 53  
A 2 SER A 128 ? CYS A 129 ? SER A 172 CYS A 173 
B 1 LEU A 79  ? SER A 82  ? LEU A 123 SER A 126 
B 2 ASP A 158 ? ASP A 165 ? ASP A 202 ASP A 209 
B 3 VAL A 191 ? ILE A 199 ? VAL A 235 ILE A 243 
B 4 GLN A 228 ? ILE A 234 ? GLN A 272 ILE A 278 
C 1 GLY B 8   ? PRO B 9   ? GLY B 52  PRO B 53  
C 2 SER B 128 ? CYS B 129 ? SER B 172 CYS B 173 
D 1 LEU B 79  ? SER B 82  ? LEU B 123 SER B 126 
D 2 ASP B 158 ? ASP B 165 ? ASP B 202 ASP B 209 
D 3 VAL B 191 ? ILE B 199 ? VAL B 235 ILE B 243 
D 4 GLN B 228 ? ILE B 234 ? GLN B 272 ILE B 278 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLY A 8   ? N GLY A 52  O CYS A 129 ? O CYS A 173 
B 1 2 N LEU A 80  ? N LEU A 124 O HIS A 161 ? O HIS A 205 
B 2 3 N LEU A 164 ? N LEU A 208 O ILE A 199 ? O ILE A 243 
B 3 4 N VAL A 198 ? N VAL A 242 O ILE A 234 ? O ILE A 278 
C 1 2 N GLY B 8   ? N GLY B 52  O CYS B 129 ? O CYS B 173 
D 1 2 N LEU B 80  ? N LEU B 124 O HIS B 161 ? O HIS B 205 
D 2 3 N VAL B 160 ? N VAL B 204 O GLU B 195 ? O GLU B 239 
D 3 4 N ALA B 196 ? N ALA B 240 O LYS B 232 ? O LYS B 276 
# 
_database_PDB_matrix.entry_id          1YH3 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1YH3 
_atom_sites.fract_transf_matrix[1][1]   0.023901 
_atom_sites.fract_transf_matrix[1][2]   0.003057 
_atom_sites.fract_transf_matrix[1][3]   0.001229 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019579 
_atom_sites.fract_transf_matrix[2][3]   0.006547 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015871 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ARG A 1 1   ? 20.659  -21.170 11.953  1.00 46.67 ? 45  ARG A N   1 
ATOM   2    C CA  . ARG A 1 1   ? 22.019  -21.207 12.566  1.00 46.45 ? 45  ARG A CA  1 
ATOM   3    C C   . ARG A 1 1   ? 22.383  -19.845 13.142  1.00 45.16 ? 45  ARG A C   1 
ATOM   4    O O   . ARG A 1 1   ? 21.505  -19.017 13.412  1.00 44.79 ? 45  ARG A O   1 
ATOM   5    C CB  . ARG A 1 1   ? 23.072  -21.663 11.552  1.00 46.78 ? 45  ARG A CB  1 
ATOM   6    C CG  . ARG A 1 1   ? 22.566  -22.626 10.464  1.00 51.56 ? 45  ARG A CG  1 
ATOM   7    C CD  . ARG A 1 1   ? 23.693  -23.299 9.651   1.00 57.81 ? 45  ARG A CD  1 
ATOM   8    N NE  . ARG A 1 1   ? 23.991  -22.665 8.354   1.00 59.94 ? 45  ARG A NE  1 
ATOM   9    C CZ  . ARG A 1 1   ? 24.396  -21.397 8.170   1.00 63.67 ? 45  ARG A CZ  1 
ATOM   10   N NH1 . ARG A 1 1   ? 24.546  -20.558 9.206   1.00 64.47 ? 45  ARG A NH1 1 
ATOM   11   N NH2 . ARG A 1 1   ? 24.646  -20.957 6.931   1.00 62.52 ? 45  ARG A NH2 1 
ATOM   12   N N   . TRP A 1 2   ? 23.685  -19.621 13.306  1.00 44.12 ? 46  TRP A N   1 
ATOM   13   C CA  . TRP A 1 2   ? 24.204  -18.466 14.026  1.00 43.22 ? 46  TRP A CA  1 
ATOM   14   C C   . TRP A 1 2   ? 24.635  -17.326 13.115  1.00 43.10 ? 46  TRP A C   1 
ATOM   15   O O   . TRP A 1 2   ? 24.910  -16.226 13.615  1.00 43.19 ? 46  TRP A O   1 
ATOM   16   C CB  . TRP A 1 2   ? 25.395  -18.895 14.887  1.00 43.42 ? 46  TRP A CB  1 
ATOM   17   C CG  . TRP A 1 2   ? 26.515  -19.491 14.082  1.00 44.44 ? 46  TRP A CG  1 
ATOM   18   C CD1 . TRP A 1 2   ? 27.544  -18.810 13.433  1.00 44.36 ? 46  TRP A CD1 1 
ATOM   19   C CD2 . TRP A 1 2   ? 26.727  -20.880 13.805  1.00 44.40 ? 46  TRP A CD2 1 
ATOM   20   N NE1 . TRP A 1 2   ? 28.367  -19.703 12.790  1.00 43.49 ? 46  TRP A NE1 1 
ATOM   21   C CE2 . TRP A 1 2   ? 27.900  -20.978 13.002  1.00 43.85 ? 46  TRP A CE2 1 
ATOM   22   C CE3 . TRP A 1 2   ? 26.054  -22.060 14.159  1.00 45.46 ? 46  TRP A CE3 1 
ATOM   23   C CZ2 . TRP A 1 2   ? 28.404  -22.208 12.550  1.00 44.67 ? 46  TRP A CZ2 1 
ATOM   24   C CZ3 . TRP A 1 2   ? 26.559  -23.289 13.711  1.00 46.94 ? 46  TRP A CZ3 1 
ATOM   25   C CH2 . TRP A 1 2   ? 27.719  -23.349 12.905  1.00 45.75 ? 46  TRP A CH2 1 
ATOM   26   N N   . ARG A 1 3   ? 24.693  -17.585 11.797  1.00 41.68 ? 47  ARG A N   1 
ATOM   27   C CA  . ARG A 1 3   ? 25.217  -16.632 10.822  1.00 40.94 ? 47  ARG A CA  1 
ATOM   28   C C   . ARG A 1 3   ? 24.090  -15.963 9.976   1.00 40.02 ? 47  ARG A C   1 
ATOM   29   O O   . ARG A 1 3   ? 23.680  -14.814 10.261  1.00 41.85 ? 47  ARG A O   1 
ATOM   30   C CB  . ARG A 1 3   ? 26.228  -17.332 9.899   1.00 41.31 ? 47  ARG A CB  1 
ATOM   31   C CG  . ARG A 1 3   ? 27.616  -16.792 9.991   1.00 44.80 ? 47  ARG A CG  1 
ATOM   32   C CD  . ARG A 1 3   ? 28.304  -16.516 8.654   1.00 50.43 ? 47  ARG A CD  1 
ATOM   33   N NE  . ARG A 1 3   ? 27.652  -15.445 7.883   1.00 54.27 ? 47  ARG A NE  1 
ATOM   34   C CZ  . ARG A 1 3   ? 27.186  -15.588 6.629   1.00 55.03 ? 47  ARG A CZ  1 
ATOM   35   N NH1 . ARG A 1 3   ? 27.297  -16.763 5.992   1.00 54.89 ? 47  ARG A NH1 1 
ATOM   36   N NH2 . ARG A 1 3   ? 26.610  -14.555 6.007   1.00 54.37 ? 47  ARG A NH2 1 
ATOM   37   N N   . GLN A 1 4   ? 23.623  -16.668 8.952   1.00 35.95 ? 48  GLN A N   1 
ATOM   38   C CA  . GLN A 1 4   ? 22.558  -16.209 8.006   1.00 34.49 ? 48  GLN A CA  1 
ATOM   39   C C   . GLN A 1 4   ? 23.165  -15.535 6.801   1.00 31.42 ? 48  GLN A C   1 
ATOM   40   O O   . GLN A 1 4   ? 23.957  -14.641 6.948   1.00 31.28 ? 48  GLN A O   1 
ATOM   41   C CB  . GLN A 1 4   ? 21.493  -15.272 8.632   1.00 34.89 ? 48  GLN A CB  1 
ATOM   42   C CG  . GLN A 1 4   ? 20.424  -15.882 9.597   1.00 36.07 ? 48  GLN A CG  1 
ATOM   43   C CD  . GLN A 1 4   ? 20.020  -17.314 9.278   1.00 39.73 ? 48  GLN A CD  1 
ATOM   44   O OE1 . GLN A 1 4   ? 20.374  -17.840 8.234   1.00 40.97 ? 48  GLN A OE1 1 
ATOM   45   N NE2 . GLN A 1 4   ? 19.269  -17.942 10.181  1.00 42.13 ? 48  GLN A NE2 1 
ATOM   46   N N   . THR A 1 5   ? 22.810  -15.947 5.593   1.00 29.05 ? 49  THR A N   1 
ATOM   47   C CA  . THR A 1 5   ? 23.354  -15.253 4.433   1.00 25.89 ? 49  THR A CA  1 
ATOM   48   C C   . THR A 1 5   ? 22.921  -13.776 4.408   1.00 22.83 ? 49  THR A C   1 
ATOM   49   O O   . THR A 1 5   ? 23.734  -12.914 4.186   1.00 21.59 ? 49  THR A O   1 
ATOM   50   C CB  . THR A 1 5   ? 22.787  -15.900 3.216   1.00 28.32 ? 49  THR A CB  1 
ATOM   51   O OG1 . THR A 1 5   ? 23.058  -17.294 3.333   1.00 27.22 ? 49  THR A OG1 1 
ATOM   52   C CG2 . THR A 1 5   ? 23.471  -15.349 1.872   1.00 27.77 ? 49  THR A CG2 1 
ATOM   53   N N   . TRP A 1 6   ? 21.654  -13.481 4.666   1.00 18.78 ? 50  TRP A N   1 
ATOM   54   C CA  . TRP A 1 6   ? 21.151  -12.094 4.465   1.00 18.11 ? 50  TRP A CA  1 
ATOM   55   C C   . TRP A 1 6   ? 20.775  -11.537 5.799   1.00 17.44 ? 50  TRP A C   1 
ATOM   56   O O   . TRP A 1 6   ? 20.634  -12.331 6.756   1.00 16.52 ? 50  TRP A O   1 
ATOM   57   C CB  . TRP A 1 6   ? 19.911  -12.163 3.596   1.00 15.64 ? 50  TRP A CB  1 
ATOM   58   C CG  . TRP A 1 6   ? 20.148  -12.822 2.221   1.00 12.83 ? 50  TRP A CG  1 
ATOM   59   C CD1 . TRP A 1 6   ? 19.555  -13.911 1.738   1.00 12.53 ? 50  TRP A CD1 1 
ATOM   60   C CD2 . TRP A 1 6   ? 21.038  -12.365 1.208   1.00 16.05 ? 50  TRP A CD2 1 
ATOM   61   N NE1 . TRP A 1 6   ? 19.969  -14.174 0.443   1.00 12.72 ? 50  TRP A NE1 1 
ATOM   62   C CE2 . TRP A 1 6   ? 20.902  -13.237 0.101   1.00 16.88 ? 50  TRP A CE2 1 
ATOM   63   C CE3 . TRP A 1 6   ? 21.905  -11.265 1.098   1.00 14.80 ? 50  TRP A CE3 1 
ATOM   64   C CZ2 . TRP A 1 6   ? 21.610  -13.060 -1.095  1.00 14.54 ? 50  TRP A CZ2 1 
ATOM   65   C CZ3 . TRP A 1 6   ? 22.635  -11.090 -0.093  1.00 18.69 ? 50  TRP A CZ3 1 
ATOM   66   C CH2 . TRP A 1 6   ? 22.458  -11.991 -1.181  1.00 13.77 ? 50  TRP A CH2 1 
ATOM   67   N N   . SER A 1 7   ? 20.553  -10.220 5.865   1.00 17.42 ? 51  SER A N   1 
ATOM   68   C CA  . SER A 1 7   ? 20.198  -9.565  7.134   1.00 18.84 ? 51  SER A CA  1 
ATOM   69   C C   . SER A 1 7   ? 18.694  -9.364  7.418   1.00 19.19 ? 51  SER A C   1 
ATOM   70   O O   . SER A 1 7   ? 18.333  -8.745  8.427   1.00 21.74 ? 51  SER A O   1 
ATOM   71   C CB  . SER A 1 7   ? 20.878  -8.170  7.233   1.00 18.17 ? 51  SER A CB  1 
ATOM   72   O OG  . SER A 1 7   ? 22.289  -8.303  7.158   1.00 17.61 ? 51  SER A OG  1 
ATOM   73   N N   . GLY A 1 8   ? 17.814  -9.764  6.520   1.00 17.66 ? 52  GLY A N   1 
ATOM   74   C CA  . GLY A 1 8   ? 16.400  -9.661  6.821   1.00 17.89 ? 52  GLY A CA  1 
ATOM   75   C C   . GLY A 1 8   ? 15.756  -11.012 7.077   1.00 18.01 ? 52  GLY A C   1 
ATOM   76   O O   . GLY A 1 8   ? 16.345  -12.088 6.845   1.00 15.13 ? 52  GLY A O   1 
ATOM   77   N N   . PRO A 1 9   ? 14.547  -10.947 7.601   1.00 20.23 ? 53  PRO A N   1 
ATOM   78   C CA  . PRO A 1 9   ? 13.780  -12.183 7.916   1.00 20.57 ? 53  PRO A CA  1 
ATOM   79   C C   . PRO A 1 9   ? 13.607  -13.036 6.664   1.00 18.70 ? 53  PRO A C   1 
ATOM   80   O O   . PRO A 1 9   ? 13.540  -12.493 5.539   1.00 17.55 ? 53  PRO A O   1 
ATOM   81   C CB  . PRO A 1 9   ? 12.427  -11.634 8.330   1.00 21.16 ? 53  PRO A CB  1 
ATOM   82   C CG  . PRO A 1 9   ? 12.390  -10.344 7.538   1.00 25.01 ? 53  PRO A CG  1 
ATOM   83   C CD  . PRO A 1 9   ? 13.783  -9.718  7.933   1.00 21.45 ? 53  PRO A CD  1 
ATOM   84   N N   . GLY A 1 10  ? 13.571  -14.343 6.868   1.00 16.72 ? 54  GLY A N   1 
ATOM   85   C CA  . GLY A 1 10  ? 13.331  -15.295 5.798   1.00 18.22 ? 54  GLY A CA  1 
ATOM   86   C C   . GLY A 1 10  ? 11.892  -15.333 5.390   1.00 15.87 ? 54  GLY A C   1 
ATOM   87   O O   . GLY A 1 10  ? 11.031  -14.607 5.975   1.00 17.96 ? 54  GLY A O   1 
ATOM   88   N N   . THR A 1 11  ? 11.633  -16.110 4.359   1.00 15.37 ? 55  THR A N   1 
ATOM   89   C CA  . THR A 1 11  ? 10.297  -16.174 3.800   1.00 12.19 ? 55  THR A CA  1 
ATOM   90   C C   . THR A 1 11  ? 9.374   -16.542 4.960   1.00 14.85 ? 55  THR A C   1 
ATOM   91   O O   . THR A 1 11  ? 9.668   -17.428 5.748   1.00 12.69 ? 55  THR A O   1 
ATOM   92   C CB  . THR A 1 11  ? 10.281  -17.203 2.692   1.00 14.01 ? 55  THR A CB  1 
ATOM   93   O OG1 . THR A 1 11  ? 11.130  -16.777 1.608   1.00 11.16 ? 55  THR A OG1 1 
ATOM   94   C CG2 . THR A 1 11  ? 8.886   -17.428 2.066   1.00 10.04 ? 55  THR A CG2 1 
ATOM   95   N N   . THR A 1 12  ? 8.187   -15.928 4.985   1.00 15.26 ? 56  THR A N   1 
ATOM   96   C CA  . THR A 1 12  ? 7.228   -16.173 6.049   1.00 16.12 ? 56  THR A CA  1 
ATOM   97   C C   . THR A 1 12  ? 6.881   -17.703 6.109   1.00 15.92 ? 56  THR A C   1 
ATOM   98   O O   . THR A 1 12  ? 6.714   -18.333 5.050   1.00 13.13 ? 56  THR A O   1 
ATOM   99   C CB  . THR A 1 12  ? 5.923   -15.370 5.716   1.00 18.05 ? 56  THR A CB  1 
ATOM   100  O OG1 . THR A 1 12  ? 6.258   -13.975 5.581   1.00 13.46 ? 56  THR A OG1 1 
ATOM   101  C CG2 . THR A 1 12  ? 4.962   -15.455 6.872   1.00 17.41 ? 56  THR A CG2 1 
ATOM   102  N N   . LYS A 1 13  ? 6.725   -18.295 7.300   1.00 13.99 ? 57  LYS A N   1 
ATOM   103  C CA  . LYS A 1 13  ? 6.372   -19.724 7.316   1.00 15.76 ? 57  LYS A CA  1 
ATOM   104  C C   . LYS A 1 13  ? 5.085   -19.949 6.538   1.00 13.74 ? 57  LYS A C   1 
ATOM   105  O O   . LYS A 1 13  ? 4.200   -19.064 6.522   1.00 11.94 ? 57  LYS A O   1 
ATOM   106  C CB  . LYS A 1 13  ? 6.196   -20.215 8.755   1.00 18.16 ? 57  LYS A CB  1 
ATOM   107  C CG  . LYS A 1 13  ? 7.553   -20.309 9.506   1.00 26.11 ? 57  LYS A CG  1 
ATOM   108  C CD  . LYS A 1 13  ? 8.492   -21.493 9.031   1.00 33.27 ? 57  LYS A CD  1 
ATOM   109  C CE  . LYS A 1 13  ? 8.261   -22.832 9.847   1.00 32.06 ? 57  LYS A CE  1 
ATOM   110  N NZ  . LYS A 1 13  ? 6.779   -23.208 10.138  1.00 34.74 ? 57  LYS A NZ  1 
ATOM   111  N N   . ARG A 1 14  ? 5.000   -21.037 5.783   1.00 11.73 ? 58  ARG A N   1 
ATOM   112  C CA  . ARG A 1 14  ? 3.772   -21.359 5.098   1.00 13.05 ? 58  ARG A CA  1 
ATOM   113  C C   . ARG A 1 14  ? 3.436   -20.461 3.894   1.00 13.72 ? 58  ARG A C   1 
ATOM   114  O O   . ARG A 1 14  ? 2.317   -20.461 3.368   1.00 12.65 ? 58  ARG A O   1 
ATOM   115  C CB  . ARG A 1 14  ? 2.594   -21.518 6.084   1.00 13.82 ? 58  ARG A CB  1 
ATOM   116  C CG  . ARG A 1 14  ? 2.736   -22.724 6.983   1.00 14.64 ? 58  ARG A CG  1 
ATOM   117  C CD  . ARG A 1 14  ? 1.592   -22.913 8.051   1.00 22.67 ? 58  ARG A CD  1 
ATOM   118  N NE  . ARG A 1 14  ? 0.270   -22.715 7.475   1.00 33.03 ? 58  ARG A NE  1 
ATOM   119  C CZ  . ARG A 1 14  ? -0.316  -23.525 6.602   1.00 34.28 ? 58  ARG A CZ  1 
ATOM   120  N NH1 . ARG A 1 14  ? 0.277   -24.631 6.163   1.00 35.09 ? 58  ARG A NH1 1 
ATOM   121  N NH2 . ARG A 1 14  ? -1.501  -23.201 6.138   1.00 35.67 ? 58  ARG A NH2 1 
ATOM   122  N N   . PHE A 1 15  ? 4.459   -19.780 3.367   1.00 12.88 ? 59  PHE A N   1 
ATOM   123  C CA  . PHE A 1 15  ? 4.186   -18.779 2.326   1.00 11.83 ? 59  PHE A CA  1 
ATOM   124  C C   . PHE A 1 15  ? 3.383   -19.307 1.120   1.00 13.44 ? 59  PHE A C   1 
ATOM   125  O O   . PHE A 1 15  ? 2.370   -18.703 0.776   1.00 10.87 ? 59  PHE A O   1 
ATOM   126  C CB  . PHE A 1 15  ? 5.555   -18.067 1.901   1.00 10.99 ? 59  PHE A CB  1 
ATOM   127  C CG  . PHE A 1 15  ? 5.420   -17.132 0.805   1.00 9.91  ? 59  PHE A CG  1 
ATOM   128  C CD1 . PHE A 1 15  ? 4.861   -15.872 1.007   1.00 11.92 ? 59  PHE A CD1 1 
ATOM   129  C CD2 . PHE A 1 15  ? 5.822   -17.469 -0.442  1.00 12.82 ? 59  PHE A CD2 1 
ATOM   130  C CE1 . PHE A 1 15  ? 4.795   -14.867 -0.068  1.00 15.65 ? 59  PHE A CE1 1 
ATOM   131  C CE2 . PHE A 1 15  ? 5.698   -16.512 -1.542  1.00 11.76 ? 59  PHE A CE2 1 
ATOM   132  C CZ  . PHE A 1 15  ? 5.158   -15.205 -1.343  1.00 12.53 ? 59  PHE A CZ  1 
ATOM   133  N N   . PRO A 1 16  ? 3.793   -20.436 0.490   1.00 12.79 ? 60  PRO A N   1 
ATOM   134  C CA  . PRO A 1 16  ? 3.017   -21.008 -0.656  1.00 13.49 ? 60  PRO A CA  1 
ATOM   135  C C   . PRO A 1 16  ? 1.526   -21.272 -0.282  1.00 13.34 ? 60  PRO A C   1 
ATOM   136  O O   . PRO A 1 16  ? 0.610   -20.834 -1.025  1.00 12.55 ? 60  PRO A O   1 
ATOM   137  C CB  . PRO A 1 16  ? 3.717   -22.364 -0.950  1.00 12.43 ? 60  PRO A CB  1 
ATOM   138  C CG  . PRO A 1 16  ? 5.211   -22.024 -0.489  1.00 14.95 ? 60  PRO A CG  1 
ATOM   139  C CD  . PRO A 1 16  ? 5.001   -21.227 0.822   1.00 12.64 ? 60  PRO A CD  1 
ATOM   140  N N   . GLU A 1 17  ? 1.312   -21.978 0.834   1.00 12.79 ? 61  GLU A N   1 
ATOM   141  C CA  . GLU A 1 17  ? -0.050  -22.244 1.315   1.00 12.84 ? 61  GLU A CA  1 
ATOM   142  C C   . GLU A 1 17  ? -0.828  -20.923 1.550   1.00 11.66 ? 61  GLU A C   1 
ATOM   143  O O   . GLU A 1 17  ? -2.006  -20.800 1.186   1.00 9.78  ? 61  GLU A O   1 
ATOM   144  C CB  . GLU A 1 17  ? -0.037  -23.220 2.516   1.00 12.35 ? 61  GLU A CB  1 
ATOM   145  C CG  . GLU A 1 17  ? 0.903   -24.440 2.224   1.00 19.06 ? 61  GLU A CG  1 
ATOM   146  C CD  . GLU A 1 17  ? 2.399   -24.370 2.789   1.00 28.60 ? 61  GLU A CD  1 
ATOM   147  O OE1 . GLU A 1 17  ? 3.229   -23.547 2.394   1.00 25.04 ? 61  GLU A OE1 1 
ATOM   148  O OE2 . GLU A 1 17  ? 2.826   -25.228 3.613   1.00 35.50 ? 61  GLU A OE2 1 
ATOM   149  N N   . THR A 1 18  ? -0.210  -19.957 2.211   1.00 11.38 ? 62  THR A N   1 
ATOM   150  C CA  . THR A 1 18  ? -0.862  -18.700 2.455   1.00 10.76 ? 62  THR A CA  1 
ATOM   151  C C   . THR A 1 18  ? -1.245  -17.954 1.256   1.00 12.03 ? 62  THR A C   1 
ATOM   152  O O   . THR A 1 18  ? -2.337  -17.380 1.235   1.00 10.57 ? 62  THR A O   1 
ATOM   153  C CB  . THR A 1 18  ? 0.043   -17.868 3.286   1.00 10.07 ? 62  THR A CB  1 
ATOM   154  O OG1 . THR A 1 18  ? 0.228   -18.584 4.481   1.00 11.94 ? 62  THR A OG1 1 
ATOM   155  C CG2 . THR A 1 18  ? -0.678  -16.508 3.813   1.00 10.80 ? 62  THR A CG2 1 
ATOM   156  N N   . VAL A 1 19  ? -0.339  -17.852 0.278   1.00 11.73 ? 63  VAL A N   1 
ATOM   157  C CA  . VAL A 1 19  ? -0.681  -17.059 -0.915  1.00 11.93 ? 63  VAL A CA  1 
ATOM   158  C C   . VAL A 1 19  ? -1.768  -17.779 -1.694  1.00 10.58 ? 63  VAL A C   1 
ATOM   159  O O   . VAL A 1 19  ? -2.676  -17.164 -2.250  1.00 10.44 ? 63  VAL A O   1 
ATOM   160  C CB  . VAL A 1 19  ? 0.590   -16.857 -1.815  1.00 11.51 ? 63  VAL A CB  1 
ATOM   161  C CG1 . VAL A 1 19  ? 0.222   -16.255 -3.055  1.00 12.79 ? 63  VAL A CG1 1 
ATOM   162  C CG2 . VAL A 1 19  ? 1.622   -15.985 -1.080  1.00 11.46 ? 63  VAL A CG2 1 
ATOM   163  N N   . LEU A 1 20  ? -1.709  -19.086 -1.774  1.00 10.97 ? 64  LEU A N   1 
ATOM   164  C CA  . LEU A 1 20  ? -2.770  -19.751 -2.544  1.00 11.68 ? 64  LEU A CA  1 
ATOM   165  C C   . LEU A 1 20  ? -4.163  -19.568 -1.858  1.00 12.76 ? 64  LEU A C   1 
ATOM   166  O O   . LEU A 1 20  ? -5.149  -19.240 -2.514  1.00 14.20 ? 64  LEU A O   1 
ATOM   167  C CB  . LEU A 1 20  ? -2.412  -21.242 -2.730  1.00 13.24 ? 64  LEU A CB  1 
ATOM   168  C CG  . LEU A 1 20  ? -3.286  -21.954 -3.754  1.00 15.40 ? 64  LEU A CG  1 
ATOM   169  C CD1 . LEU A 1 20  ? -3.026  -21.332 -5.118  1.00 21.80 ? 64  LEU A CD1 1 
ATOM   170  C CD2 . LEU A 1 20  ? -2.973  -23.510 -3.795  1.00 21.48 ? 64  LEU A CD2 1 
ATOM   171  N N   . ALA A 1 21  ? -4.196  -19.656 -0.523  1.00 13.94 ? 65  ALA A N   1 
ATOM   172  C CA  . ALA A 1 21  ? -5.407  -19.514 0.273   1.00 14.96 ? 65  ALA A CA  1 
ATOM   173  C C   . ALA A 1 21  ? -5.963  -18.126 0.237   1.00 15.55 ? 65  ALA A C   1 
ATOM   174  O O   . ALA A 1 21  ? -7.203  -17.923 0.293   1.00 11.75 ? 65  ALA A O   1 
ATOM   175  C CB  . ALA A 1 21  ? -5.127  -19.939 1.748   1.00 16.52 ? 65  ALA A CB  1 
ATOM   176  N N   . ARG A 1 22  ? -5.072  -17.125 0.206   1.00 13.03 ? 66  ARG A N   1 
ATOM   177  C CA  . ARG A 1 22  ? -5.557  -15.738 -0.057  1.00 12.84 ? 66  ARG A CA  1 
ATOM   178  C C   . ARG A 1 22  ? -6.135  -15.562 -1.423  1.00 14.06 ? 66  ARG A C   1 
ATOM   179  O O   . ARG A 1 22  ? -7.153  -14.847 -1.591  1.00 16.23 ? 66  ARG A O   1 
ATOM   180  C CB  . ARG A 1 22  ? -4.403  -14.766 0.051   1.00 12.81 ? 66  ARG A CB  1 
ATOM   181  C CG  . ARG A 1 22  ? -4.020  -14.623 1.470   1.00 8.16  ? 66  ARG A CG  1 
ATOM   182  C CD  . ARG A 1 22  ? -2.872  -13.660 1.622   1.00 15.31 ? 66  ARG A CD  1 
ATOM   183  N NE  . ARG A 1 22  ? -2.528  -13.430 3.024   1.00 10.84 ? 66  ARG A NE  1 
ATOM   184  C CZ  . ARG A 1 22  ? -1.675  -12.494 3.491   1.00 15.95 ? 66  ARG A CZ  1 
ATOM   185  N NH1 . ARG A 1 22  ? -1.066  -11.652 2.698   1.00 9.30  ? 66  ARG A NH1 1 
ATOM   186  N NH2 . ARG A 1 22  ? -1.463  -12.396 4.790   1.00 8.62  ? 66  ARG A NH2 1 
ATOM   187  N N   . CYS A 1 23  ? -5.512  -16.154 -2.419  1.00 12.74 ? 67  CYS A N   1 
ATOM   188  C CA  . CYS A 1 23  ? -6.102  -15.983 -3.764  1.00 15.01 ? 67  CYS A CA  1 
ATOM   189  C C   . CYS A 1 23  ? -7.519  -16.590 -3.870  1.00 15.27 ? 67  CYS A C   1 
ATOM   190  O O   . CYS A 1 23  ? -8.518  -15.940 -4.312  1.00 12.97 ? 67  CYS A O   1 
ATOM   191  C CB  . CYS A 1 23  ? -5.172  -16.625 -4.792  1.00 17.26 ? 67  CYS A CB  1 
ATOM   192  S SG  . CYS A 1 23  ? -5.568  -16.324 -6.489  1.00 17.38 ? 67  CYS A SG  1 
ATOM   193  N N   . VAL A 1 24  ? -7.605  -17.853 -3.515  1.00 15.65 ? 68  VAL A N   1 
ATOM   194  C CA  . VAL A 1 24  ? -8.928  -18.485 -3.376  1.00 16.21 ? 68  VAL A CA  1 
ATOM   195  C C   . VAL A 1 24  ? -9.957  -17.615 -2.602  1.00 18.15 ? 68  VAL A C   1 
ATOM   196  O O   . VAL A 1 24  ? -11.035 -17.298 -3.151  1.00 18.62 ? 68  VAL A O   1 
ATOM   197  C CB  . VAL A 1 24  ? -8.811  -19.897 -2.869  1.00 17.90 ? 68  VAL A CB  1 
ATOM   198  C CG1 . VAL A 1 24  ? -10.248 -20.528 -2.628  1.00 14.93 ? 68  VAL A CG1 1 
ATOM   199  C CG2 . VAL A 1 24  ? -8.051  -20.690 -3.900  1.00 16.63 ? 68  VAL A CG2 1 
ATOM   200  N N   . LYS A 1 25  ? -9.610  -17.140 -1.402  1.00 18.84 ? 69  LYS A N   1 
ATOM   201  C CA  . LYS A 1 25  ? -10.524 -16.354 -0.621  1.00 18.74 ? 69  LYS A CA  1 
ATOM   202  C C   . LYS A 1 25  ? -10.911 -15.031 -1.346  1.00 17.30 ? 69  LYS A C   1 
ATOM   203  O O   . LYS A 1 25  ? -12.105 -14.692 -1.378  1.00 17.37 ? 69  LYS A O   1 
ATOM   204  C CB  . LYS A 1 25  ? -10.010 -16.070 0.799   1.00 20.06 ? 69  LYS A CB  1 
ATOM   205  C CG  . LYS A 1 25  ? -10.988 -15.265 1.539   1.00 25.13 ? 69  LYS A CG  1 
ATOM   206  C CD  . LYS A 1 25  ? -10.771 -15.083 3.007   1.00 31.11 ? 69  LYS A CD  1 
ATOM   207  C CE  . LYS A 1 25  ? -12.125 -14.611 3.641   1.00 36.36 ? 69  LYS A CE  1 
ATOM   208  N NZ  . LYS A 1 25  ? -12.076 -13.155 4.188   1.00 39.05 ? 69  LYS A NZ  1 
ATOM   209  N N   . TYR A 1 26  ? -9.949  -14.341 -1.958  1.00 15.42 ? 70  TYR A N   1 
ATOM   210  C CA  . TYR A 1 26  ? -10.185 -13.052 -2.576  1.00 16.40 ? 70  TYR A CA  1 
ATOM   211  C C   . TYR A 1 26  ? -11.037 -13.189 -3.771  1.00 16.90 ? 70  TYR A C   1 
ATOM   212  O O   . TYR A 1 26  ? -11.897 -12.343 -3.986  1.00 17.11 ? 70  TYR A O   1 
ATOM   213  C CB  . TYR A 1 26  ? -8.860  -12.349 -2.995  1.00 16.26 ? 70  TYR A CB  1 
ATOM   214  C CG  . TYR A 1 26  ? -9.024  -10.907 -3.452  1.00 12.45 ? 70  TYR A CG  1 
ATOM   215  C CD1 . TYR A 1 26  ? -8.747  -9.845  -2.592  1.00 10.58 ? 70  TYR A CD1 1 
ATOM   216  C CD2 . TYR A 1 26  ? -9.422  -10.604 -4.763  1.00 12.63 ? 70  TYR A CD2 1 
ATOM   217  C CE1 . TYR A 1 26  ? -8.902  -8.491  -3.036  1.00 8.44  ? 70  TYR A CE1 1 
ATOM   218  C CE2 . TYR A 1 26  ? -9.573  -9.280  -5.207  1.00 8.13  ? 70  TYR A CE2 1 
ATOM   219  C CZ  . TYR A 1 26  ? -9.304  -8.259  -4.390  1.00 11.44 ? 70  TYR A CZ  1 
ATOM   220  O OH  . TYR A 1 26  ? -9.528  -7.022  -4.948  1.00 7.70  ? 70  TYR A OH  1 
ATOM   221  N N   . THR A 1 27  ? -10.796 -14.254 -4.553  1.00 16.57 ? 71  THR A N   1 
ATOM   222  C CA  . THR A 1 27  ? -11.547 -14.465 -5.763  1.00 18.87 ? 71  THR A CA  1 
ATOM   223  C C   . THR A 1 27  ? -12.913 -15.024 -5.438  1.00 19.34 ? 71  THR A C   1 
ATOM   224  O O   . THR A 1 27  ? -13.734 -15.102 -6.333  1.00 21.57 ? 71  THR A O   1 
ATOM   225  C CB  . THR A 1 27  ? -10.849 -15.396 -6.719  1.00 19.63 ? 71  THR A CB  1 
ATOM   226  O OG1 . THR A 1 27  ? -10.422 -16.588 -6.020  1.00 23.72 ? 71  THR A OG1 1 
ATOM   227  C CG2 . THR A 1 27  ? -9.560  -14.778 -7.212  1.00 18.14 ? 71  THR A CG2 1 
ATOM   228  N N   . GLU A 1 28  ? -13.169 -15.404 -4.185  1.00 19.05 ? 72  GLU A N   1 
ATOM   229  C CA  . GLU A 1 28  ? -14.525 -15.792 -3.738  1.00 20.26 ? 72  GLU A CA  1 
ATOM   230  C C   . GLU A 1 28  ? -15.356 -14.581 -3.420  1.00 19.06 ? 72  GLU A C   1 
ATOM   231  O O   . GLU A 1 28  ? -16.505 -14.539 -3.772  1.00 17.58 ? 72  GLU A O   1 
ATOM   232  C CB  . GLU A 1 28  ? -14.521 -16.772 -2.530  1.00 21.26 ? 72  GLU A CB  1 
ATOM   233  C CG  . GLU A 1 28  ? -14.104 -18.185 -2.972  1.00 24.77 ? 72  GLU A CG  1 
ATOM   234  C CD  . GLU A 1 28  ? -13.806 -19.200 -1.845  1.00 34.43 ? 72  GLU A CD  1 
ATOM   235  O OE1 . GLU A 1 28  ? -13.450 -18.769 -0.720  1.00 36.48 ? 72  GLU A OE1 1 
ATOM   236  O OE2 . GLU A 1 28  ? -13.901 -20.456 -2.099  1.00 33.65 ? 72  GLU A OE2 1 
ATOM   237  N N   . ILE A 1 29  ? -14.784 -13.633 -2.694  1.00 16.71 ? 73  ILE A N   1 
ATOM   238  C CA  . ILE A 1 29  ? -15.419 -12.368 -2.400  1.00 19.33 ? 73  ILE A CA  1 
ATOM   239  C C   . ILE A 1 29  ? -15.662 -11.398 -3.597  1.00 18.95 ? 73  ILE A C   1 
ATOM   240  O O   . ILE A 1 29  ? -16.668 -10.755 -3.667  1.00 19.82 ? 73  ILE A O   1 
ATOM   241  C CB  . ILE A 1 29  ? -14.486 -11.612 -1.395  1.00 19.80 ? 73  ILE A CB  1 
ATOM   242  C CG1 . ILE A 1 29  ? -14.323 -12.436 -0.149  1.00 23.41 ? 73  ILE A CG1 1 
ATOM   243  C CG2 . ILE A 1 29  ? -15.043 -10.181 -0.973  1.00 22.99 ? 73  ILE A CG2 1 
ATOM   244  C CD1 . ILE A 1 29  ? -13.495 -11.830 0.817   1.00 25.45 ? 73  ILE A CD1 1 
ATOM   245  N N   . HIS A 1 30  ? -14.697 -11.242 -4.463  1.00 19.37 ? 74  HIS A N   1 
ATOM   246  C CA  . HIS A 1 30  ? -14.736 -10.199 -5.468  1.00 20.90 ? 74  HIS A CA  1 
ATOM   247  C C   . HIS A 1 30  ? -15.156 -10.713 -6.835  1.00 22.51 ? 74  HIS A C   1 
ATOM   248  O O   . HIS A 1 30  ? -14.364 -11.385 -7.525  1.00 22.44 ? 74  HIS A O   1 
ATOM   249  C CB  . HIS A 1 30  ? -13.333 -9.587  -5.525  1.00 23.61 ? 74  HIS A CB  1 
ATOM   250  C CG  . HIS A 1 30  ? -13.002 -8.787  -4.300  1.00 18.36 ? 74  HIS A CG  1 
ATOM   251  N ND1 . HIS A 1 30  ? -12.307 -9.321  -3.232  1.00 21.19 ? 74  HIS A ND1 1 
ATOM   252  C CD2 . HIS A 1 30  ? -13.367 -7.546  -3.921  1.00 23.92 ? 74  HIS A CD2 1 
ATOM   253  C CE1 . HIS A 1 30  ? -12.218 -8.420  -2.270  1.00 21.17 ? 74  HIS A CE1 1 
ATOM   254  N NE2 . HIS A 1 30  ? -12.823 -7.322  -2.677  1.00 25.53 ? 74  HIS A NE2 1 
ATOM   255  N N   . PRO A 1 31  ? -16.400 -10.436 -7.241  1.00 22.01 ? 75  PRO A N   1 
ATOM   256  C CA  . PRO A 1 31  ? -16.954 -11.107 -8.416  1.00 23.08 ? 75  PRO A CA  1 
ATOM   257  C C   . PRO A 1 31  ? -16.165 -10.829 -9.743  1.00 23.79 ? 75  PRO A C   1 
ATOM   258  O O   . PRO A 1 31  ? -16.166 -11.656 -10.674 1.00 22.93 ? 75  PRO A O   1 
ATOM   259  C CB  . PRO A 1 31  ? -18.399 -10.539 -8.470  1.00 22.54 ? 75  PRO A CB  1 
ATOM   260  C CG  . PRO A 1 31  ? -18.280 -9.254  -7.799  1.00 21.24 ? 75  PRO A CG  1 
ATOM   261  C CD  . PRO A 1 31  ? -17.402 -9.537  -6.628  1.00 22.68 ? 75  PRO A CD  1 
ATOM   262  N N   . GLU A 1 32  ? -15.535 -9.661  -9.821  1.00 25.24 ? 76  GLU A N   1 
ATOM   263  C CA  . GLU A 1 32  ? -14.803 -9.280  -11.019 1.00 27.78 ? 76  GLU A CA  1 
ATOM   264  C C   . GLU A 1 32  ? -13.501 -10.067 -11.187 1.00 28.26 ? 76  GLU A C   1 
ATOM   265  O O   . GLU A 1 32  ? -12.957 -10.150 -12.297 1.00 29.24 ? 76  GLU A O   1 
ATOM   266  C CB  . GLU A 1 32  ? -14.526 -7.790  -10.998 1.00 28.21 ? 76  GLU A CB  1 
ATOM   267  C CG  . GLU A 1 32  ? -13.382 -7.414  -10.069 1.00 32.47 ? 76  GLU A CG  1 
ATOM   268  C CD  . GLU A 1 32  ? -13.789 -7.016  -8.652  1.00 36.29 ? 76  GLU A CD  1 
ATOM   269  O OE1 . GLU A 1 32  ? -14.864 -7.462  -8.112  1.00 36.44 ? 76  GLU A OE1 1 
ATOM   270  O OE2 . GLU A 1 32  ? -12.978 -6.242  -8.076  1.00 33.80 ? 76  GLU A OE2 1 
ATOM   271  N N   . MET A 1 33  ? -13.001 -10.653 -10.096 1.00 28.97 ? 77  MET A N   1 
ATOM   272  C CA  . MET A 1 33  ? -11.804 -11.507 -10.150 1.00 28.49 ? 77  MET A CA  1 
ATOM   273  C C   . MET A 1 33  ? -12.181 -12.984 -9.980  1.00 29.23 ? 77  MET A C   1 
ATOM   274  O O   . MET A 1 33  ? -11.330 -13.848 -9.795  1.00 28.88 ? 77  MET A O   1 
ATOM   275  C CB  . MET A 1 33  ? -10.831 -11.089 -9.067  1.00 27.82 ? 77  MET A CB  1 
ATOM   276  C CG  . MET A 1 33  ? -10.447 -9.610  -9.129  1.00 29.44 ? 77  MET A CG  1 
ATOM   277  S SD  . MET A 1 33  ? -9.542  -9.222  -10.629 1.00 23.76 ? 77  MET A SD  1 
ATOM   278  C CE  . MET A 1 33  ? -7.893  -9.907  -10.228 1.00 28.05 ? 77  MET A CE  1 
ATOM   279  N N   . ARG A 1 34  ? -13.463 -13.300 -10.073 1.00 29.55 ? 78  ARG A N   1 
ATOM   280  C CA  . ARG A 1 34  ? -13.856 -14.690 -9.885  1.00 30.89 ? 78  ARG A CA  1 
ATOM   281  C C   . ARG A 1 34  ? -13.430 -15.596 -11.105 1.00 29.24 ? 78  ARG A C   1 
ATOM   282  O O   . ARG A 1 34  ? -13.612 -16.790 -11.070 1.00 32.00 ? 78  ARG A O   1 
ATOM   283  C CB  . ARG A 1 34  ? -15.370 -14.794 -9.492  1.00 30.71 ? 78  ARG A CB  1 
ATOM   284  C CG  . ARG A 1 34  ? -16.248 -14.598 -10.678 1.00 31.52 ? 78  ARG A CG  1 
ATOM   285  C CD  . ARG A 1 34  ? -17.729 -14.463 -10.369 1.00 38.03 ? 78  ARG A CD  1 
ATOM   286  N NE  . ARG A 1 34  ? -18.181 -13.310 -11.113 1.00 41.59 ? 78  ARG A NE  1 
ATOM   287  C CZ  . ARG A 1 34  ? -19.275 -13.212 -11.788 1.00 41.95 ? 78  ARG A CZ  1 
ATOM   288  N NH1 . ARG A 1 34  ? -20.152 -14.205 -11.815 1.00 42.49 ? 78  ARG A NH1 1 
ATOM   289  N NH2 . ARG A 1 34  ? -19.494 -12.078 -12.427 1.00 45.49 ? 78  ARG A NH2 1 
ATOM   290  N N   . HIS A 1 35  ? -12.813 -15.010 -12.131 1.00 28.72 ? 79  HIS A N   1 
ATOM   291  C CA  . HIS A 1 35  ? -12.264 -15.710 -13.316 1.00 27.14 ? 79  HIS A CA  1 
ATOM   292  C C   . HIS A 1 35  ? -10.793 -16.206 -13.155 1.00 26.05 ? 79  HIS A C   1 
ATOM   293  O O   . HIS A 1 35  ? -10.235 -16.865 -14.047 1.00 26.52 ? 79  HIS A O   1 
ATOM   294  C CB  . HIS A 1 35  ? -12.296 -14.765 -14.540 1.00 27.55 ? 79  HIS A CB  1 
ATOM   295  C CG  . HIS A 1 35  ? -11.363 -13.587 -14.422 1.00 26.64 ? 79  HIS A CG  1 
ATOM   296  N ND1 . HIS A 1 35  ? -11.674 -12.471 -13.668 1.00 28.20 ? 79  HIS A ND1 1 
ATOM   297  C CD2 . HIS A 1 35  ? -10.098 -13.378 -14.906 1.00 31.48 ? 79  HIS A CD2 1 
ATOM   298  C CE1 . HIS A 1 35  ? -10.635 -11.627 -13.689 1.00 33.53 ? 79  HIS A CE1 1 
ATOM   299  N NE2 . HIS A 1 35  ? -9.669  -12.152 -14.434 1.00 28.34 ? 79  HIS A NE2 1 
ATOM   300  N N   . VAL A 1 36  ? -10.164 -15.877 -12.032 1.00 23.98 ? 80  VAL A N   1 
ATOM   301  C CA  . VAL A 1 36  ? -8.718  -16.010 -11.893 1.00 21.43 ? 80  VAL A CA  1 
ATOM   302  C C   . VAL A 1 36  ? -8.430  -17.470 -11.521 1.00 21.24 ? 80  VAL A C   1 
ATOM   303  O O   . VAL A 1 36  ? -9.172  -18.029 -10.703 1.00 23.90 ? 80  VAL A O   1 
ATOM   304  C CB  . VAL A 1 36  ? -8.251  -15.033 -10.738 1.00 21.67 ? 80  VAL A CB  1 
ATOM   305  C CG1 . VAL A 1 36  ? -6.849  -15.335 -10.277 1.00 20.45 ? 80  VAL A CG1 1 
ATOM   306  C CG2 . VAL A 1 36  ? -8.364  -13.547 -11.172 1.00 19.76 ? 80  VAL A CG2 1 
ATOM   307  N N   . ASP A 1 37  ? -7.405  -18.083 -12.094 1.00 19.46 ? 81  ASP A N   1 
ATOM   308  C CA  . ASP A 1 37  ? -7.027  -19.471 -11.709 1.00 19.09 ? 81  ASP A CA  1 
ATOM   309  C C   . ASP A 1 37  ? -5.930  -19.337 -10.615 1.00 18.27 ? 81  ASP A C   1 
ATOM   310  O O   . ASP A 1 37  ? -4.814  -19.000 -10.967 1.00 15.88 ? 81  ASP A O   1 
ATOM   311  C CB  . ASP A 1 37  ? -6.462  -20.193 -12.914 1.00 18.66 ? 81  ASP A CB  1 
ATOM   312  C CG  . ASP A 1 37  ? -5.965  -21.553 -12.562 1.00 22.34 ? 81  ASP A CG  1 
ATOM   313  O OD1 . ASP A 1 37  ? -6.748  -22.511 -12.704 1.00 29.09 ? 81  ASP A OD1 1 
ATOM   314  O OD2 . ASP A 1 37  ? -4.861  -21.815 -12.133 1.00 24.03 ? 81  ASP A OD2 1 
ATOM   315  N N   . CYS A 1 38  ? -6.247  -19.660 -9.350  1.00 15.31 ? 82  CYS A N   1 
ATOM   316  C CA  . CYS A 1 38  ? -5.304  -19.440 -8.285  1.00 18.33 ? 82  CYS A CA  1 
ATOM   317  C C   . CYS A 1 38  ? -3.996  -20.217 -8.355  1.00 16.35 ? 82  CYS A C   1 
ATOM   318  O O   . CYS A 1 38  ? -2.952  -19.714 -7.998  1.00 11.47 ? 82  CYS A O   1 
ATOM   319  C CB  . CYS A 1 38  ? -5.995  -19.555 -6.949  1.00 20.04 ? 82  CYS A CB  1 
ATOM   320  S SG  . CYS A 1 38  ? -6.934  -17.951 -6.816  1.00 31.50 ? 82  CYS A SG  1 
ATOM   321  N N   . GLN A 1 39  ? -4.048  -21.441 -8.875  1.00 14.50 ? 83  GLN A N   1 
ATOM   322  C CA  . GLN A 1 39  ? -2.803  -22.155 -9.034  1.00 14.39 ? 83  GLN A CA  1 
ATOM   323  C C   . GLN A 1 39  ? -1.918  -21.493 -10.100 1.00 12.68 ? 83  GLN A C   1 
ATOM   324  O O   . GLN A 1 39  ? -0.737  -21.494 -10.013 1.00 13.67 ? 83  GLN A O   1 
ATOM   325  C CB  . GLN A 1 39  ? -3.070  -23.664 -9.277  1.00 15.63 ? 83  GLN A CB  1 
ATOM   326  C CG  . GLN A 1 39  ? -1.814  -24.519 -9.461  1.00 14.50 ? 83  GLN A CG  1 
ATOM   327  C CD  . GLN A 1 39  ? -0.987  -24.740 -8.181  1.00 18.00 ? 83  GLN A CD  1 
ATOM   328  O OE1 . GLN A 1 39  ? 0.279   -24.771 -8.251  1.00 21.32 ? 83  GLN A OE1 1 
ATOM   329  N NE2 . GLN A 1 39  ? -1.671  -24.936 -7.026  1.00 18.93 ? 83  GLN A NE2 1 
ATOM   330  N N   . SER A 1 40  ? -2.510  -20.930 -11.124 1.00 13.77 ? 84  SER A N   1 
ATOM   331  C CA  . SER A 1 40  ? -1.715  -20.238 -12.129 1.00 12.91 ? 84  SER A CA  1 
ATOM   332  C C   . SER A 1 40  ? -1.155  -18.978 -11.487 1.00 12.30 ? 84  SER A C   1 
ATOM   333  O O   . SER A 1 40  ? -0.012  -18.619 -11.790 1.00 11.62 ? 84  SER A O   1 
ATOM   334  C CB  . SER A 1 40  ? -2.631  -19.760 -13.247 1.00 14.60 ? 84  SER A CB  1 
ATOM   335  O OG  . SER A 1 40  ? -3.103  -20.916 -13.893 1.00 18.54 ? 84  SER A OG  1 
ATOM   336  N N   . VAL A 1 41  ? -1.926  -18.385 -10.591 1.00 10.24 ? 85  VAL A N   1 
ATOM   337  C CA  . VAL A 1 41  ? -1.395  -17.151 -9.862  1.00 11.66 ? 85  VAL A CA  1 
ATOM   338  C C   . VAL A 1 41  ? -0.144  -17.566 -9.087  1.00 10.46 ? 85  VAL A C   1 
ATOM   339  O O   . VAL A 1 41  ? 0.869   -16.879 -9.172  1.00 13.40 ? 85  VAL A O   1 
ATOM   340  C CB  . VAL A 1 41  ? -2.456  -16.504 -9.053  1.00 11.18 ? 85  VAL A CB  1 
ATOM   341  C CG1 . VAL A 1 41  ? -1.922  -15.322 -8.099  1.00 8.72  ? 85  VAL A CG1 1 
ATOM   342  C CG2 . VAL A 1 41  ? -3.461  -15.903 -9.998  1.00 12.64 ? 85  VAL A CG2 1 
ATOM   343  N N   . TRP A 1 42  ? -0.215  -18.662 -8.324  1.00 12.28 ? 86  TRP A N   1 
ATOM   344  C CA  . TRP A 1 42  ? 0.870   -19.071 -7.441  1.00 12.63 ? 86  TRP A CA  1 
ATOM   345  C C   . TRP A 1 42  ? 2.098   -19.319 -8.336  1.00 14.16 ? 86  TRP A C   1 
ATOM   346  O O   . TRP A 1 42  ? 3.223   -18.901 -8.019  1.00 14.87 ? 86  TRP A O   1 
ATOM   347  C CB  . TRP A 1 42  ? 0.593   -20.374 -6.621  1.00 13.22 ? 86  TRP A CB  1 
ATOM   348  C CG  . TRP A 1 42  ? 1.843   -20.933 -5.981  1.00 13.50 ? 86  TRP A CG  1 
ATOM   349  C CD1 . TRP A 1 42  ? 2.378   -22.195 -6.121  1.00 13.80 ? 86  TRP A CD1 1 
ATOM   350  C CD2 . TRP A 1 42  ? 2.718   -20.222 -5.107  1.00 12.03 ? 86  TRP A CD2 1 
ATOM   351  N NE1 . TRP A 1 42  ? 3.563   -22.292 -5.453  1.00 16.71 ? 86  TRP A NE1 1 
ATOM   352  C CE2 . TRP A 1 42  ? 3.797   -21.089 -4.799  1.00 13.15 ? 86  TRP A CE2 1 
ATOM   353  C CE3 . TRP A 1 42  ? 2.720   -18.918 -4.608  1.00 14.54 ? 86  TRP A CE3 1 
ATOM   354  C CZ2 . TRP A 1 42  ? 4.851   -20.711 -3.987  1.00 18.36 ? 86  TRP A CZ2 1 
ATOM   355  C CZ3 . TRP A 1 42  ? 3.805   -18.497 -3.805  1.00 14.88 ? 86  TRP A CZ3 1 
ATOM   356  C CH2 . TRP A 1 42  ? 4.854   -19.397 -3.499  1.00 14.63 ? 86  TRP A CH2 1 
ATOM   357  N N   . ASP A 1 43  ? 1.893   -20.047 -9.415  1.00 13.20 ? 87  ASP A N   1 
ATOM   358  C CA  . ASP A 1 43  ? 2.987   -20.367 -10.294 1.00 14.76 ? 87  ASP A CA  1 
ATOM   359  C C   . ASP A 1 43  ? 3.627   -19.155 -10.901 1.00 13.37 ? 87  ASP A C   1 
ATOM   360  O O   . ASP A 1 43  ? 4.848   -19.167 -11.066 1.00 11.11 ? 87  ASP A O   1 
ATOM   361  C CB  . ASP A 1 43  ? 2.546   -21.327 -11.399 1.00 17.21 ? 87  ASP A CB  1 
ATOM   362  C CG  . ASP A 1 43  ? 2.224   -22.735 -10.852 1.00 24.42 ? 87  ASP A CG  1 
ATOM   363  O OD1 . ASP A 1 43  ? 2.728   -23.087 -9.757  1.00 32.05 ? 87  ASP A OD1 1 
ATOM   364  O OD2 . ASP A 1 43  ? 1.507   -23.529 -11.463 1.00 22.71 ? 87  ASP A OD2 1 
ATOM   365  N N   . ALA A 1 44  ? 2.815   -18.128 -11.243 1.00 12.70 ? 88  ALA A N   1 
ATOM   366  C CA  . ALA A 1 44  ? 3.368   -16.900 -11.860 1.00 11.29 ? 88  ALA A CA  1 
ATOM   367  C C   . ALA A 1 44  ? 4.160   -16.160 -10.777 1.00 10.54 ? 88  ALA A C   1 
ATOM   368  O O   . ALA A 1 44  ? 5.194   -15.574 -11.080 1.00 12.15 ? 88  ALA A O   1 
ATOM   369  C CB  . ALA A 1 44  ? 2.214   -15.952 -12.372 1.00 9.25  ? 88  ALA A CB  1 
ATOM   370  N N   . PHE A 1 45  ? 3.647   -16.216 -9.566  1.00 9.76  ? 89  PHE A N   1 
ATOM   371  C CA  . PHE A 1 45  ? 4.273   -15.537 -8.366  1.00 8.20  ? 89  PHE A CA  1 
ATOM   372  C C   . PHE A 1 45  ? 5.600   -16.182 -8.063  1.00 9.95  ? 89  PHE A C   1 
ATOM   373  O O   . PHE A 1 45  ? 6.674   -15.569 -8.022  1.00 7.31  ? 89  PHE A O   1 
ATOM   374  C CB  . PHE A 1 45  ? 3.367   -15.649 -7.126  1.00 7.70  ? 89  PHE A CB  1 
ATOM   375  C CG  . PHE A 1 45  ? 3.656   -14.552 -6.033  1.00 8.22  ? 89  PHE A CG  1 
ATOM   376  C CD1 . PHE A 1 45  ? 4.927   -14.096 -5.812  1.00 12.88 ? 89  PHE A CD1 1 
ATOM   377  C CD2 . PHE A 1 45  ? 2.639   -14.039 -5.303  1.00 15.30 ? 89  PHE A CD2 1 
ATOM   378  C CE1 . PHE A 1 45  ? 5.191   -13.059 -4.813  1.00 4.99  ? 89  PHE A CE1 1 
ATOM   379  C CE2 . PHE A 1 45  ? 2.841   -13.121 -4.317  1.00 14.05 ? 89  PHE A CE2 1 
ATOM   380  C CZ  . PHE A 1 45  ? 4.164   -12.612 -4.107  1.00 7.90  ? 89  PHE A CZ  1 
ATOM   381  N N   . LYS A 1 46  ? 5.571   -17.497 -7.903  1.00 10.41 ? 90  LYS A N   1 
ATOM   382  C CA  . LYS A 1 46  ? 6.786   -18.231 -7.640  1.00 11.00 ? 90  LYS A CA  1 
ATOM   383  C C   . LYS A 1 46  ? 7.824   -18.146 -8.778  1.00 12.73 ? 90  LYS A C   1 
ATOM   384  O O   . LYS A 1 46  ? 9.016   -18.051 -8.568  1.00 12.58 ? 90  LYS A O   1 
ATOM   385  C CB  . LYS A 1 46  ? 6.396   -19.687 -7.315  1.00 13.14 ? 90  LYS A CB  1 
ATOM   386  C CG  . LYS A 1 46  ? 7.594   -20.554 -7.077  1.00 20.49 ? 90  LYS A CG  1 
ATOM   387  C CD  . LYS A 1 46  ? 7.089   -21.972 -6.699  1.00 24.07 ? 90  LYS A CD  1 
ATOM   388  C CE  . LYS A 1 46  ? 6.498   -22.615 -7.890  1.00 24.44 ? 90  LYS A CE  1 
ATOM   389  N NZ  . LYS A 1 46  ? 7.159   -24.013 -8.131  1.00 37.35 ? 90  LYS A NZ  1 
ATOM   390  N N   . GLY A 1 47  ? 7.370   -18.184 -10.008 1.00 13.44 ? 91  GLY A N   1 
ATOM   391  C CA  . GLY A 1 47  ? 8.283   -17.959 -11.110 1.00 12.68 ? 91  GLY A CA  1 
ATOM   392  C C   . GLY A 1 47  ? 9.017   -16.652 -11.088 1.00 13.53 ? 91  GLY A C   1 
ATOM   393  O O   . GLY A 1 47  ? 10.135  -16.559 -11.621 1.00 11.66 ? 91  GLY A O   1 
ATOM   394  N N   . ALA A 1 48  ? 8.436   -15.609 -10.488 1.00 9.20  ? 92  ALA A N   1 
ATOM   395  C CA  . ALA A 1 48  ? 9.206   -14.359 -10.485 1.00 9.46  ? 92  ALA A CA  1 
ATOM   396  C C   . ALA A 1 48  ? 10.486  -14.378 -9.705  1.00 12.44 ? 92  ALA A C   1 
ATOM   397  O O   . ALA A 1 48  ? 11.351  -13.493 -9.989  1.00 11.09 ? 92  ALA A O   1 
ATOM   398  C CB  . ALA A 1 48  ? 8.258   -13.178 -9.985  1.00 7.92  ? 92  ALA A CB  1 
ATOM   399  N N   . PHE A 1 49  ? 10.649  -15.300 -8.709  1.00 9.67  ? 93  PHE A N   1 
ATOM   400  C CA  . PHE A 1 49  ? 11.813  -15.172 -7.792  1.00 11.54 ? 93  PHE A CA  1 
ATOM   401  C C   . PHE A 1 49  ? 12.560  -16.510 -7.445  1.00 11.56 ? 93  PHE A C   1 
ATOM   402  O O   . PHE A 1 49  ? 13.682  -16.497 -6.916  1.00 9.48  ? 93  PHE A O   1 
ATOM   403  C CB  . PHE A 1 49  ? 11.387  -14.425 -6.471  1.00 9.78  ? 93  PHE A CB  1 
ATOM   404  C CG  . PHE A 1 49  ? 10.496  -15.208 -5.632  1.00 10.19 ? 93  PHE A CG  1 
ATOM   405  C CD1 . PHE A 1 49  ? 11.031  -16.053 -4.603  1.00 10.98 ? 93  PHE A CD1 1 
ATOM   406  C CD2 . PHE A 1 49  ? 9.092   -15.183 -5.859  1.00 10.40 ? 93  PHE A CD2 1 
ATOM   407  C CE1 . PHE A 1 49  ? 10.207  -16.847 -3.832  1.00 11.74 ? 93  PHE A CE1 1 
ATOM   408  C CE2 . PHE A 1 49  ? 8.243   -15.999 -5.053  1.00 9.16  ? 93  PHE A CE2 1 
ATOM   409  C CZ  . PHE A 1 49  ? 8.766   -16.819 -4.053  1.00 12.12 ? 93  PHE A CZ  1 
ATOM   410  N N   . ILE A 1 50  ? 11.942  -17.631 -7.739  1.00 14.03 ? 94  ILE A N   1 
ATOM   411  C CA  . ILE A 1 50  ? 12.592  -18.955 -7.592  1.00 14.93 ? 94  ILE A CA  1 
ATOM   412  C C   . ILE A 1 50  ? 13.747  -19.123 -8.555  1.00 13.86 ? 94  ILE A C   1 
ATOM   413  O O   . ILE A 1 50  ? 13.627  -18.703 -9.712  1.00 13.50 ? 94  ILE A O   1 
ATOM   414  C CB  . ILE A 1 50  ? 11.517  -20.072 -7.807  1.00 15.94 ? 94  ILE A CB  1 
ATOM   415  C CG1 . ILE A 1 50  ? 10.666  -20.153 -6.520  1.00 20.26 ? 94  ILE A CG1 1 
ATOM   416  C CG2 . ILE A 1 50  ? 12.084  -21.410 -7.879  1.00 19.51 ? 94  ILE A CG2 1 
ATOM   417  C CD1 . ILE A 1 50  ? 11.408  -20.575 -5.213  1.00 18.28 ? 94  ILE A CD1 1 
ATOM   418  N N   . SER A 1 51  ? 14.864  -19.729 -8.106  1.00 13.55 ? 95  SER A N   1 
ATOM   419  C CA  . SER A 1 51  ? 16.040  -19.867 -8.969  1.00 13.75 ? 95  SER A CA  1 
ATOM   420  C C   . SER A 1 51  ? 16.636  -18.583 -9.520  1.00 15.79 ? 95  SER A C   1 
ATOM   421  O O   . SER A 1 51  ? 17.313  -18.602 -10.565 1.00 15.79 ? 95  SER A O   1 
ATOM   422  C CB  . SER A 1 51  ? 15.828  -20.945 -10.086 1.00 16.89 ? 95  SER A CB  1 
ATOM   423  O OG  . SER A 1 51  ? 15.399  -22.129 -9.416  1.00 13.89 ? 95  SER A OG  1 
ATOM   424  N N   . LYS A 1 52  ? 16.463  -17.471 -8.743  1.00 12.92 ? 96  LYS A N   1 
ATOM   425  C CA  . LYS A 1 52  ? 16.959  -16.151 -9.130  1.00 13.76 ? 96  LYS A CA  1 
ATOM   426  C C   . LYS A 1 52  ? 17.669  -15.616 -7.925  1.00 11.07 ? 96  LYS A C   1 
ATOM   427  O O   . LYS A 1 52  ? 17.289  -15.934 -6.756  1.00 11.00 ? 96  LYS A O   1 
ATOM   428  C CB  . LYS A 1 52  ? 15.815  -15.148 -9.546  1.00 14.21 ? 96  LYS A CB  1 
ATOM   429  C CG  . LYS A 1 52  ? 15.022  -15.760 -10.825 1.00 15.69 ? 96  LYS A CG  1 
ATOM   430  C CD  . LYS A 1 52  ? 13.812  -14.921 -11.370 1.00 23.54 ? 96  LYS A CD  1 
ATOM   431  C CE  . LYS A 1 52  ? 13.464  -15.238 -12.922 1.00 23.34 ? 96  LYS A CE  1 
ATOM   432  N NZ  . LYS A 1 52  ? 12.004  -14.831 -13.332 1.00 24.87 ? 96  LYS A NZ  1 
ATOM   433  N N   . HIS A 1 53  ? 18.741  -14.893 -8.216  1.00 10.73 ? 97  HIS A N   1 
ATOM   434  C CA  . HIS A 1 53  ? 19.556  -14.355 -7.131  1.00 12.67 ? 97  HIS A CA  1 
ATOM   435  C C   . HIS A 1 53  ? 18.642  -13.317 -6.459  1.00 11.38 ? 97  HIS A C   1 
ATOM   436  O O   . HIS A 1 53  ? 18.083  -12.505 -7.168  1.00 11.18 ? 97  HIS A O   1 
ATOM   437  C CB  . HIS A 1 53  ? 20.757  -13.609 -7.667  1.00 12.95 ? 97  HIS A CB  1 
ATOM   438  C CG  . HIS A 1 53  ? 21.712  -13.272 -6.589  1.00 13.94 ? 97  HIS A CG  1 
ATOM   439  N ND1 . HIS A 1 53  ? 21.500  -12.226 -5.716  1.00 11.38 ? 97  HIS A ND1 1 
ATOM   440  C CD2 . HIS A 1 53  ? 22.858  -13.881 -6.186  1.00 17.93 ? 97  HIS A CD2 1 
ATOM   441  C CE1 . HIS A 1 53  ? 22.499  -12.159 -4.869  1.00 11.59 ? 97  HIS A CE1 1 
ATOM   442  N NE2 . HIS A 1 53  ? 23.321  -13.168 -5.102  1.00 18.77 ? 97  HIS A NE2 1 
ATOM   443  N N   . PRO A 1 54  ? 18.428  -13.363 -5.160  1.00 12.09 ? 98  PRO A N   1 
ATOM   444  C CA  . PRO A 1 54  ? 17.439  -12.454 -4.575  1.00 10.82 ? 98  PRO A CA  1 
ATOM   445  C C   . PRO A 1 54  ? 17.956  -10.968 -4.532  1.00 13.03 ? 98  PRO A C   1 
ATOM   446  O O   . PRO A 1 54  ? 17.260  -10.109 -3.983  1.00 11.01 ? 98  PRO A O   1 
ATOM   447  C CB  . PRO A 1 54  ? 17.298  -13.004 -3.154  1.00 13.53 ? 98  PRO A CB  1 
ATOM   448  C CG  . PRO A 1 54  ? 18.635  -13.506 -2.827  1.00 14.27 ? 98  PRO A CG  1 
ATOM   449  C CD  . PRO A 1 54  ? 19.017  -14.237 -4.132  1.00 9.09  ? 98  PRO A CD  1 
ATOM   450  N N   . CYS A 1 55  ? 19.143  -10.688 -5.118  1.00 11.24 ? 99  CYS A N   1 
ATOM   451  C CA  . CYS A 1 55  ? 19.552  -9.246  -5.264  1.00 13.81 ? 99  CYS A CA  1 
ATOM   452  C C   . CYS A 1 55  ? 19.519  -8.776  -6.751  1.00 13.21 ? 99  CYS A C   1 
ATOM   453  O O   . CYS A 1 55  ? 19.989  -7.721  -7.082  1.00 15.81 ? 99  CYS A O   1 
ATOM   454  C CB  . CYS A 1 55  ? 20.963  -9.015  -4.662  1.00 12.72 ? 99  CYS A CB  1 
ATOM   455  S SG  . CYS A 1 55  ? 20.776  -9.113  -2.900  1.00 14.46 ? 99  CYS A SG  1 
ATOM   456  N N   . ASP A 1 56  ? 18.991  -9.586  -7.616  1.00 13.90 ? 100 ASP A N   1 
ATOM   457  C CA  . ASP A 1 56  ? 18.872  -9.317  -9.031  1.00 15.28 ? 100 ASP A CA  1 
ATOM   458  C C   . ASP A 1 56  ? 17.448  -9.368  -9.579  1.00 13.71 ? 100 ASP A C   1 
ATOM   459  O O   . ASP A 1 56  ? 17.214  -9.981  -10.653 1.00 17.38 ? 100 ASP A O   1 
ATOM   460  C CB  . ASP A 1 56  ? 19.566  -10.537 -9.706  1.00 18.00 ? 100 ASP A CB  1 
ATOM   461  C CG  . ASP A 1 56  ? 19.787  -10.308 -11.139 1.00 26.45 ? 100 ASP A CG  1 
ATOM   462  O OD1 . ASP A 1 56  ? 19.594  -11.295 -11.891 1.00 36.18 ? 100 ASP A OD1 1 
ATOM   463  O OD2 . ASP A 1 56  ? 20.105  -9.159  -11.565 1.00 34.57 ? 100 ASP A OD2 1 
ATOM   464  N N   . ILE A 1 57  ? 16.430  -8.940  -8.852  1.00 11.50 ? 101 ILE A N   1 
ATOM   465  C CA  . ILE A 1 57  ? 15.037  -9.130  -9.338  1.00 10.39 ? 101 ILE A CA  1 
ATOM   466  C C   . ILE A 1 57  ? 14.607  -7.882  -10.139 1.00 10.77 ? 101 ILE A C   1 
ATOM   467  O O   . ILE A 1 57  ? 15.020  -6.775  -9.788  1.00 10.94 ? 101 ILE A O   1 
ATOM   468  C CB  . ILE A 1 57  ? 14.078  -9.386  -8.128  1.00 10.32 ? 101 ILE A CB  1 
ATOM   469  C CG1 . ILE A 1 57  ? 14.620  -10.588 -7.259  1.00 6.47  ? 101 ILE A CG1 1 
ATOM   470  C CG2 . ILE A 1 57  ? 12.613  -9.567  -8.624  1.00 12.20 ? 101 ILE A CG2 1 
ATOM   471  C CD1 . ILE A 1 57  ? 14.484  -12.030 -7.933  1.00 5.02  ? 101 ILE A CD1 1 
ATOM   472  N N   . THR A 1 58  ? 13.804  -8.040  -11.202 1.00 11.17 ? 102 THR A N   1 
ATOM   473  C CA  . THR A 1 58  ? 13.396  -6.877  -12.013 1.00 11.28 ? 102 THR A CA  1 
ATOM   474  C C   . THR A 1 58  ? 11.893  -6.860  -12.013 1.00 11.00 ? 102 THR A C   1 
ATOM   475  O O   . THR A 1 58  ? 11.310  -7.838  -11.715 1.00 10.83 ? 102 THR A O   1 
ATOM   476  C CB  . THR A 1 58  ? 13.874  -6.972  -13.454 1.00 12.28 ? 102 THR A CB  1 
ATOM   477  O OG1 . THR A 1 58  ? 13.363  -8.171  -14.001 1.00 14.42 ? 102 THR A OG1 1 
ATOM   478  C CG2 . THR A 1 58  ? 15.312  -7.238  -13.495 1.00 14.47 ? 102 THR A CG2 1 
ATOM   479  N N   . GLU A 1 59  ? 11.299  -5.720  -12.370 1.00 10.76 ? 103 GLU A N   1 
ATOM   480  C CA  . GLU A 1 59  ? 9.905   -5.614  -12.708 1.00 15.15 ? 103 GLU A CA  1 
ATOM   481  C C   . GLU A 1 59  ? 9.484   -6.605  -13.766 1.00 13.93 ? 103 GLU A C   1 
ATOM   482  O O   . GLU A 1 59  ? 8.387   -7.168  -13.690 1.00 14.31 ? 103 GLU A O   1 
ATOM   483  C CB  . GLU A 1 59  ? 9.539   -4.178  -13.189 1.00 18.76 ? 103 GLU A CB  1 
ATOM   484  C CG  . GLU A 1 59  ? 8.349   -4.173  -14.159 1.00 26.95 ? 103 GLU A CG  1 
ATOM   485  C CD  . GLU A 1 59  ? 7.593   -2.847  -14.288 1.00 37.81 ? 103 GLU A CD  1 
ATOM   486  O OE1 . GLU A 1 59  ? 6.527   -2.832  -15.018 1.00 41.70 ? 103 GLU A OE1 1 
ATOM   487  O OE2 . GLU A 1 59  ? 8.023   -1.852  -13.663 1.00 38.28 ? 103 GLU A OE2 1 
ATOM   488  N N   . GLU A 1 60  ? 10.308  -6.825  -14.769 1.00 14.60 ? 104 GLU A N   1 
ATOM   489  C CA  . GLU A 1 60  ? 10.006  -7.937  -15.711 1.00 15.14 ? 104 GLU A CA  1 
ATOM   490  C C   . GLU A 1 60  ? 9.711   -9.283  -15.062 1.00 14.07 ? 104 GLU A C   1 
ATOM   491  O O   . GLU A 1 60  ? 8.806   -10.030 -15.513 1.00 13.42 ? 104 GLU A O   1 
ATOM   492  C CB  . GLU A 1 60  ? 11.132  -8.058  -16.758 1.00 16.57 ? 104 GLU A CB  1 
ATOM   493  C CG  . GLU A 1 60  ? 10.994  -6.929  -17.778 1.00 25.35 ? 104 GLU A CG  1 
ATOM   494  C CD  . GLU A 1 60  ? 11.861  -5.724  -17.400 1.00 34.54 ? 104 GLU A CD  1 
ATOM   495  O OE1 . GLU A 1 60  ? 12.269  -5.605  -16.210 1.00 30.11 ? 104 GLU A OE1 1 
ATOM   496  O OE2 . GLU A 1 60  ? 12.160  -4.903  -18.308 1.00 38.34 ? 104 GLU A OE2 1 
ATOM   497  N N   . ASP A 1 61  ? 10.465  -9.659  -14.020 1.00 12.67 ? 105 ASP A N   1 
ATOM   498  C CA  . ASP A 1 61  ? 10.184  -10.969 -13.352 1.00 13.69 ? 105 ASP A CA  1 
ATOM   499  C C   . ASP A 1 61  ? 8.716   -11.089 -12.923 1.00 11.57 ? 105 ASP A C   1 
ATOM   500  O O   . ASP A 1 61  ? 8.178   -12.175 -12.872 1.00 14.22 ? 105 ASP A O   1 
ATOM   501  C CB  . ASP A 1 61  ? 11.084  -11.215 -12.141 1.00 12.37 ? 105 ASP A CB  1 
ATOM   502  C CG  . ASP A 1 61  ? 12.554  -11.427 -12.496 1.00 20.81 ? 105 ASP A CG  1 
ATOM   503  O OD1 . ASP A 1 61  ? 12.785  -12.213 -13.471 1.00 20.48 ? 105 ASP A OD1 1 
ATOM   504  O OD2 . ASP A 1 61  ? 13.530  -10.868 -11.823 1.00 19.50 ? 105 ASP A OD2 1 
ATOM   505  N N   . TYR A 1 62  ? 8.063   -9.967  -12.627 1.00 9.83  ? 106 TYR A N   1 
ATOM   506  C CA  . TYR A 1 62  ? 6.712   -9.997  -12.106 1.00 9.64  ? 106 TYR A CA  1 
ATOM   507  C C   . TYR A 1 62  ? 5.638   -9.720  -13.114 1.00 11.75 ? 106 TYR A C   1 
ATOM   508  O O   . TYR A 1 62  ? 4.434   -9.585  -12.741 1.00 10.26 ? 106 TYR A O   1 
ATOM   509  C CB  . TYR A 1 62  ? 6.571   -8.901  -10.997 1.00 8.14  ? 106 TYR A CB  1 
ATOM   510  C CG  . TYR A 1 62  ? 7.156   -9.389  -9.673  1.00 11.53 ? 106 TYR A CG  1 
ATOM   511  C CD1 . TYR A 1 62  ? 8.317   -8.746  -9.112  1.00 7.11  ? 106 TYR A CD1 1 
ATOM   512  C CD2 . TYR A 1 62  ? 6.562   -10.435 -8.974  1.00 6.12  ? 106 TYR A CD2 1 
ATOM   513  C CE1 . TYR A 1 62  ? 8.850   -9.221  -7.895  1.00 8.41  ? 106 TYR A CE1 1 
ATOM   514  C CE2 . TYR A 1 62  ? 7.096   -10.897 -7.760  1.00 8.19  ? 106 TYR A CE2 1 
ATOM   515  C CZ  . TYR A 1 62  ? 8.249   -10.189 -7.198  1.00 4.42  ? 106 TYR A CZ  1 
ATOM   516  O OH  . TYR A 1 62  ? 8.831   -10.672 -6.044  1.00 4.47  ? 106 TYR A OH  1 
ATOM   517  N N   . GLN A 1 63  ? 6.027   -9.641  -14.391 1.00 13.66 ? 107 GLN A N   1 
ATOM   518  C CA  . GLN A 1 63  ? 5.074   -9.236  -15.409 1.00 15.88 ? 107 GLN A CA  1 
ATOM   519  C C   . GLN A 1 63  ? 4.020   -10.371 -15.625 1.00 14.41 ? 107 GLN A C   1 
ATOM   520  O O   . GLN A 1 63  ? 2.853   -10.064 -15.752 1.00 13.73 ? 107 GLN A O   1 
ATOM   521  C CB  . GLN A 1 63  ? 5.704   -8.807  -16.752 1.00 16.08 ? 107 GLN A CB  1 
ATOM   522  C CG  . GLN A 1 63  ? 6.111   -7.264  -16.844 1.00 24.72 ? 107 GLN A CG  1 
ATOM   523  C CD  . GLN A 1 63  ? 4.858   -6.256  -16.633 1.00 36.34 ? 107 GLN A CD  1 
ATOM   524  O OE1 . GLN A 1 63  ? 3.695   -6.687  -16.538 1.00 40.39 ? 107 GLN A OE1 1 
ATOM   525  N NE2 . GLN A 1 63  ? 5.134   -4.944  -16.588 1.00 41.24 ? 107 GLN A NE2 1 
ATOM   526  N N   . PRO A 1 64  ? 4.401   -11.656 -15.655 1.00 13.52 ? 108 PRO A N   1 
ATOM   527  C CA  . PRO A 1 64  ? 3.351   -12.680 -15.809 1.00 12.86 ? 108 PRO A CA  1 
ATOM   528  C C   . PRO A 1 64  ? 2.351   -12.618 -14.625 1.00 10.70 ? 108 PRO A C   1 
ATOM   529  O O   . PRO A 1 64  ? 1.168   -12.793 -14.862 1.00 7.01  ? 108 PRO A O   1 
ATOM   530  C CB  . PRO A 1 64  ? 4.132   -14.039 -15.790 1.00 13.36 ? 108 PRO A CB  1 
ATOM   531  C CG  . PRO A 1 64  ? 5.540   -13.691 -16.390 1.00 13.16 ? 108 PRO A CG  1 
ATOM   532  C CD  . PRO A 1 64  ? 5.746   -12.259 -15.633 1.00 12.62 ? 108 PRO A CD  1 
ATOM   533  N N   . LEU A 1 65  ? 2.823   -12.490 -13.399 1.00 9.99  ? 109 LEU A N   1 
ATOM   534  C CA  . LEU A 1 65  ? 1.918   -12.235 -12.253 1.00 10.29 ? 109 LEU A CA  1 
ATOM   535  C C   . LEU A 1 65  ? 1.016   -10.991 -12.374 1.00 11.74 ? 109 LEU A C   1 
ATOM   536  O O   . LEU A 1 65  ? -0.237  -11.057 -12.055 1.00 10.30 ? 109 LEU A O   1 
ATOM   537  C CB  . LEU A 1 65  ? 2.662   -12.224 -10.952 1.00 8.71  ? 109 LEU A CB  1 
ATOM   538  C CG  . LEU A 1 65  ? 1.881   -11.873 -9.640  1.00 11.74 ? 109 LEU A CG  1 
ATOM   539  C CD1 . LEU A 1 65  ? 0.794   -12.890 -9.275  1.00 13.31 ? 109 LEU A CD1 1 
ATOM   540  C CD2 . LEU A 1 65  ? 2.729   -11.646 -8.363  1.00 9.39  ? 109 LEU A CD2 1 
ATOM   541  N N   . MET A 1 66  ? 1.588   -9.888  -12.856 1.00 10.52 ? 110 MET A N   1 
ATOM   542  C CA  . MET A 1 66  ? 0.791   -8.654  -12.944 1.00 12.09 ? 110 MET A CA  1 
ATOM   543  C C   . MET A 1 66  ? -0.300  -8.826  -13.992 1.00 12.45 ? 110 MET A C   1 
ATOM   544  O O   . MET A 1 66  ? -1.418  -8.378  -13.811 1.00 11.34 ? 110 MET A O   1 
ATOM   545  C CB  . MET A 1 66  ? 1.611   -7.420  -13.417 1.00 10.84 ? 110 MET A CB  1 
ATOM   546  C CG  . MET A 1 66  ? 2.978   -7.440  -13.019 1.00 19.15 ? 110 MET A CG  1 
ATOM   547  S SD  . MET A 1 66  ? 3.275   -6.060  -11.985 1.00 37.00 ? 110 MET A SD  1 
ATOM   548  C CE  . MET A 1 66  ? 2.116   -6.460  -10.980 1.00 11.50 ? 110 MET A CE  1 
ATOM   549  N N   . LYS A 1 67  ? 0.038   -9.524  -15.087 1.00 12.89 ? 111 LYS A N   1 
ATOM   550  C CA  . LYS A 1 67  ? -0.977  -9.883  -16.080 1.00 14.31 ? 111 LYS A CA  1 
ATOM   551  C C   . LYS A 1 67  ? -2.144  -10.700 -15.511 1.00 13.57 ? 111 LYS A C   1 
ATOM   552  O O   . LYS A 1 67  ? -3.300  -10.411 -15.757 1.00 14.45 ? 111 LYS A O   1 
ATOM   553  C CB  . LYS A 1 67  ? -0.350  -10.848 -17.098 1.00 15.53 ? 111 LYS A CB  1 
ATOM   554  C CG  . LYS A 1 67  ? 0.536   -10.244 -18.108 1.00 24.46 ? 111 LYS A CG  1 
ATOM   555  C CD  . LYS A 1 67  ? 0.583   -11.171 -19.392 1.00 27.28 ? 111 LYS A CD  1 
ATOM   556  C CE  . LYS A 1 67  ? 1.743   -10.760 -20.316 1.00 35.06 ? 111 LYS A CE  1 
ATOM   557  N NZ  . LYS A 1 67  ? 2.491   -9.469  -19.948 1.00 37.23 ? 111 LYS A NZ  1 
ATOM   558  N N   . LEU A 1 68  ? -1.853  -11.768 -14.798 1.00 12.05 ? 112 LEU A N   1 
ATOM   559  C CA  . LEU A 1 68  ? -2.931  -12.605 -14.287 1.00 13.76 ? 112 LEU A CA  1 
ATOM   560  C C   . LEU A 1 68  ? -3.741  -11.812 -13.267 1.00 13.51 ? 112 LEU A C   1 
ATOM   561  O O   . LEU A 1 68  ? -4.930  -12.027 -13.123 1.00 12.26 ? 112 LEU A O   1 
ATOM   562  C CB  . LEU A 1 68  ? -2.388  -13.894 -13.633 1.00 11.41 ? 112 LEU A CB  1 
ATOM   563  C CG  . LEU A 1 68  ? -1.621  -14.921 -14.459 1.00 16.80 ? 112 LEU A CG  1 
ATOM   564  C CD1 . LEU A 1 68  ? -1.161  -16.043 -13.624 1.00 15.64 ? 112 LEU A CD1 1 
ATOM   565  C CD2 . LEU A 1 68  ? -2.563  -15.464 -15.534 1.00 10.51 ? 112 LEU A CD2 1 
ATOM   566  N N   . GLY A 1 69  ? -3.063  -10.957 -12.483 1.00 13.02 ? 113 GLY A N   1 
ATOM   567  C CA  . GLY A 1 69  ? -3.793  -10.156 -11.491 1.00 13.18 ? 113 GLY A CA  1 
ATOM   568  C C   . GLY A 1 69  ? -4.346  -8.813  -11.974 1.00 14.75 ? 113 GLY A C   1 
ATOM   569  O O   . GLY A 1 69  ? -4.671  -7.944  -11.150 1.00 15.63 ? 113 GLY A O   1 
ATOM   570  N N   . THR A 1 70  ? -4.456  -8.638  -13.294 1.00 15.85 ? 114 THR A N   1 
ATOM   571  C CA  . THR A 1 70  ? -4.999  -7.404  -13.877 1.00 16.95 ? 114 THR A CA  1 
ATOM   572  C C   . THR A 1 70  ? -6.407  -7.166  -13.290 1.00 16.86 ? 114 THR A C   1 
ATOM   573  O O   . THR A 1 70  ? -7.274  -8.044  -13.322 1.00 13.45 ? 114 THR A O   1 
ATOM   574  C CB  . THR A 1 70  ? -5.174  -7.568  -15.447 1.00 18.46 ? 114 THR A CB  1 
ATOM   575  O OG1 . THR A 1 70  ? -3.900  -7.723  -16.053 1.00 20.13 ? 114 THR A OG1 1 
ATOM   576  C CG2 . THR A 1 70  ? -5.679  -6.228  -16.059 1.00 22.78 ? 114 THR A CG2 1 
ATOM   577  N N   . GLN A 1 71  ? -6.635  -5.952  -12.823 1.00 16.60 ? 115 GLN A N   1 
ATOM   578  C CA  . GLN A 1 71  ? -7.859  -5.588  -12.155 1.00 17.99 ? 115 GLN A CA  1 
ATOM   579  C C   . GLN A 1 71  ? -8.078  -4.066  -12.266 1.00 19.43 ? 115 GLN A C   1 
ATOM   580  O O   . GLN A 1 71  ? -7.121  -3.280  -12.150 1.00 17.87 ? 115 GLN A O   1 
ATOM   581  C CB  . GLN A 1 71  ? -7.662  -5.957  -10.658 1.00 16.95 ? 115 GLN A CB  1 
ATOM   582  C CG  . GLN A 1 71  ? -8.755  -5.537  -9.743  1.00 16.52 ? 115 GLN A CG  1 
ATOM   583  C CD  . GLN A 1 71  ? -8.768  -6.235  -8.397  1.00 19.63 ? 115 GLN A CD  1 
ATOM   584  O OE1 . GLN A 1 71  ? -9.814  -6.257  -7.742  1.00 18.79 ? 115 GLN A OE1 1 
ATOM   585  N NE2 . GLN A 1 71  ? -7.622  -6.695  -7.937  1.00 14.09 ? 115 GLN A NE2 1 
ATOM   586  N N   . THR A 1 72  ? -9.340  -3.651  -12.413 1.00 21.93 ? 116 THR A N   1 
ATOM   587  C CA  . THR A 1 72  ? -9.659  -2.208  -12.311 1.00 22.48 ? 116 THR A CA  1 
ATOM   588  C C   . THR A 1 72  ? -10.541 -2.004  -11.079 1.00 22.56 ? 116 THR A C   1 
ATOM   589  O O   . THR A 1 72  ? -11.573 -2.696  -10.955 1.00 22.18 ? 116 THR A O   1 
ATOM   590  C CB  . THR A 1 72  ? -10.422 -1.716  -13.572 1.00 24.54 ? 116 THR A CB  1 
ATOM   591  O OG1 . THR A 1 72  ? -10.009 -2.471  -14.731 1.00 26.28 ? 116 THR A OG1 1 
ATOM   592  C CG2 . THR A 1 72  ? -10.001 -0.255  -13.936 1.00 23.99 ? 116 THR A CG2 1 
ATOM   593  N N   . VAL A 1 73  ? -10.081 -1.203  -10.108 1.00 20.91 ? 117 VAL A N   1 
ATOM   594  C CA  . VAL A 1 73  ? -10.970 -0.735  -9.038  1.00 19.26 ? 117 VAL A CA  1 
ATOM   595  C C   . VAL A 1 73  ? -11.410 0.660   -9.485  1.00 17.55 ? 117 VAL A C   1 
ATOM   596  O O   . VAL A 1 73  ? -10.746 1.265   -10.307 1.00 18.05 ? 117 VAL A O   1 
ATOM   597  C CB  . VAL A 1 73  ? -10.298 -0.768  -7.677  1.00 20.60 ? 117 VAL A CB  1 
ATOM   598  C CG1 . VAL A 1 73  ? -9.721  -2.199  -7.468  1.00 20.75 ? 117 VAL A CG1 1 
ATOM   599  C CG2 . VAL A 1 73  ? -9.218  0.366   -7.546  1.00 18.12 ? 117 VAL A CG2 1 
ATOM   600  N N   . PRO A 1 74  ? -12.539 1.156   -9.013  1.00 16.72 ? 118 PRO A N   1 
ATOM   601  C CA  . PRO A 1 74  ? -13.019 2.494   -9.450  1.00 15.29 ? 118 PRO A CA  1 
ATOM   602  C C   . PRO A 1 74  ? -11.848 3.501   -9.335  1.00 11.92 ? 118 PRO A C   1 
ATOM   603  O O   . PRO A 1 74  ? -11.369 3.747   -8.183  1.00 11.52 ? 118 PRO A O   1 
ATOM   604  C CB  . PRO A 1 74  ? -14.073 2.825   -8.436  1.00 12.96 ? 118 PRO A CB  1 
ATOM   605  C CG  . PRO A 1 74  ? -14.614 1.481   -7.992  1.00 19.27 ? 118 PRO A CG  1 
ATOM   606  C CD  . PRO A 1 74  ? -13.486 0.454   -8.148  1.00 17.19 ? 118 PRO A CD  1 
ATOM   607  N N   . CYS A 1 75  ? -11.477 4.184   -10.426 1.00 10.64 ? 119 CYS A N   1 
ATOM   608  C CA  . CYS A 1 75  ? -10.220 4.995   -10.397 1.00 12.11 ? 119 CYS A CA  1 
ATOM   609  C C   . CYS A 1 75  ? -10.297 6.310   -9.539  1.00 10.57 ? 119 CYS A C   1 
ATOM   610  O O   . CYS A 1 75  ? -9.269  6.866   -9.049  1.00 7.96  ? 119 CYS A O   1 
ATOM   611  C CB  . CYS A 1 75  ? -9.778  5.305   -11.851 1.00 15.43 ? 119 CYS A CB  1 
ATOM   612  S SG  . CYS A 1 75  ? -10.835 6.465   -12.790 1.00 28.19 ? 119 CYS A SG  1 
ATOM   613  N N   . ASN A 1 76  ? -11.528 6.748   -9.325  1.00 7.72  ? 120 ASN A N   1 
ATOM   614  C CA  . ASN A 1 76  ? -11.795 7.970   -8.566  1.00 8.04  ? 120 ASN A CA  1 
ATOM   615  C C   . ASN A 1 76  ? -12.023 7.697   -7.059  1.00 4.50  ? 120 ASN A C   1 
ATOM   616  O O   . ASN A 1 76  ? -12.343 8.626   -6.255  1.00 7.71  ? 120 ASN A O   1 
ATOM   617  C CB  . ASN A 1 76  ? -13.013 8.685   -9.200  1.00 6.93  ? 120 ASN A CB  1 
ATOM   618  C CG  . ASN A 1 76  ? -14.286 7.905   -9.096  1.00 11.95 ? 120 ASN A CG  1 
ATOM   619  O OD1 . ASN A 1 76  ? -14.297 6.696   -9.404  1.00 6.69  ? 120 ASN A OD1 1 
ATOM   620  N ND2 . ASN A 1 76  ? -15.382 8.576   -8.615  1.00 7.70  ? 120 ASN A ND2 1 
ATOM   621  N N   . LYS A 1 77  ? -11.790 6.490   -6.581  1.00 6.14  ? 121 LYS A N   1 
ATOM   622  C CA  . LYS A 1 77  ? -11.947 6.177   -5.117  1.00 7.02  ? 121 LYS A CA  1 
ATOM   623  C C   . LYS A 1 77  ? -10.707 5.549   -4.514  1.00 7.99  ? 121 LYS A C   1 
ATOM   624  O O   . LYS A 1 77  ? -10.790 4.611   -3.680  1.00 9.62  ? 121 LYS A O   1 
ATOM   625  C CB  . LYS A 1 77  ? -13.132 5.186   -5.006  1.00 9.41  ? 121 LYS A CB  1 
ATOM   626  C CG  . LYS A 1 77  ? -14.485 5.818   -5.493  1.00 14.11 ? 121 LYS A CG  1 
ATOM   627  C CD  . LYS A 1 77  ? -15.565 4.805   -5.585  1.00 15.66 ? 121 LYS A CD  1 
ATOM   628  C CE  . LYS A 1 77  ? -16.807 5.492   -6.207  1.00 19.59 ? 121 LYS A CE  1 
ATOM   629  N NZ  . LYS A 1 77  ? -17.478 6.618   -5.386  1.00 16.38 ? 121 LYS A NZ  1 
ATOM   630  N N   . ILE A 1 78  ? -9.534  5.999   -4.977  1.00 7.81  ? 122 ILE A N   1 
ATOM   631  C CA  . ILE A 1 78  ? -8.301  5.474   -4.456  1.00 6.14  ? 122 ILE A CA  1 
ATOM   632  C C   . ILE A 1 78  ? -7.841  6.241   -3.192  1.00 9.23  ? 122 ILE A C   1 
ATOM   633  O O   . ILE A 1 78  ? -7.933  7.494   -3.088  1.00 9.31  ? 122 ILE A O   1 
ATOM   634  C CB  . ILE A 1 78  ? -7.268  5.430   -5.586  1.00 11.08 ? 122 ILE A CB  1 
ATOM   635  C CG1 . ILE A 1 78  ? -7.735  4.170   -6.521  1.00 12.46 ? 122 ILE A CG1 1 
ATOM   636  C CG2 . ILE A 1 78  ? -5.812  5.228   -5.092  1.00 6.09  ? 122 ILE A CG2 1 
ATOM   637  C CD1 . ILE A 1 78  ? -6.752  3.919   -7.561  1.00 29.59 ? 122 ILE A CD1 1 
ATOM   638  N N   . LEU A 1 79  ? -7.417  5.381   -2.272  1.00 7.10  ? 123 LEU A N   1 
ATOM   639  C CA  . LEU A 1 79  ? -6.800  5.823   -1.011  1.00 6.75  ? 123 LEU A CA  1 
ATOM   640  C C   . LEU A 1 79  ? -5.374  5.350   -0.898  1.00 6.97  ? 123 LEU A C   1 
ATOM   641  O O   . LEU A 1 79  ? -5.099  4.181   -0.772  1.00 8.34  ? 123 LEU A O   1 
ATOM   642  C CB  . LEU A 1 79  ? -7.671  5.368   0.117   1.00 5.94  ? 123 LEU A CB  1 
ATOM   643  C CG  . LEU A 1 79  ? -6.964  5.812   1.437   1.00 4.95  ? 123 LEU A CG  1 
ATOM   644  C CD1 . LEU A 1 79  ? -6.880  7.400   1.699   1.00 8.26  ? 123 LEU A CD1 1 
ATOM   645  C CD2 . LEU A 1 79  ? -7.731  5.106   2.636   1.00 7.55  ? 123 LEU A CD2 1 
ATOM   646  N N   . LEU A 1 80  ? -4.437  6.281   -0.993  1.00 6.34  ? 124 LEU A N   1 
ATOM   647  C CA  . LEU A 1 80  ? -3.045  5.931   -0.822  1.00 9.12  ? 124 LEU A CA  1 
ATOM   648  C C   . LEU A 1 80  ? -2.770  6.144   0.656   1.00 9.21  ? 124 LEU A C   1 
ATOM   649  O O   . LEU A 1 80  ? -3.533  6.858   1.331   1.00 8.08  ? 124 LEU A O   1 
ATOM   650  C CB  . LEU A 1 80  ? -2.168  6.961   -1.586  1.00 7.75  ? 124 LEU A CB  1 
ATOM   651  C CG  . LEU A 1 80  ? -2.486  6.903   -3.074  1.00 10.44 ? 124 LEU A CG  1 
ATOM   652  C CD1 . LEU A 1 80  ? -1.600  7.830   -3.783  1.00 11.40 ? 124 LEU A CD1 1 
ATOM   653  C CD2 . LEU A 1 80  ? -2.245  5.439   -3.683  1.00 8.11  ? 124 LEU A CD2 1 
ATOM   654  N N   . TRP A 1 81  ? -1.680  5.553   1.166   1.00 9.97  ? 125 TRP A N   1 
ATOM   655  C CA  . TRP A 1 81  ? -1.370  5.838   2.569   1.00 11.67 ? 125 TRP A CA  1 
ATOM   656  C C   . TRP A 1 81  ? 0.072   5.749   2.812   1.00 12.25 ? 125 TRP A C   1 
ATOM   657  O O   . TRP A 1 81  ? 0.778   5.067   2.093   1.00 9.37  ? 125 TRP A O   1 
ATOM   658  C CB  . TRP A 1 81  ? -2.128  4.872   3.525   1.00 11.45 ? 125 TRP A CB  1 
ATOM   659  C CG  . TRP A 1 81  ? -1.895  3.381   3.248   1.00 7.74  ? 125 TRP A CG  1 
ATOM   660  C CD1 . TRP A 1 81  ? -2.506  2.560   2.296   1.00 10.18 ? 125 TRP A CD1 1 
ATOM   661  C CD2 . TRP A 1 81  ? -0.839  2.600   3.816   1.00 11.11 ? 125 TRP A CD2 1 
ATOM   662  N NE1 . TRP A 1 81  ? -1.935  1.313   2.334   1.00 10.18 ? 125 TRP A NE1 1 
ATOM   663  C CE2 . TRP A 1 81  ? -0.922  1.291   3.252   1.00 14.93 ? 125 TRP A CE2 1 
ATOM   664  C CE3 . TRP A 1 81  ? 0.146   2.865   4.806   1.00 14.05 ? 125 TRP A CE3 1 
ATOM   665  C CZ2 . TRP A 1 81  ? -0.041  0.253   3.606   1.00 18.25 ? 125 TRP A CZ2 1 
ATOM   666  C CZ3 . TRP A 1 81  ? 1.023   1.818   5.194   1.00 17.93 ? 125 TRP A CZ3 1 
ATOM   667  C CH2 . TRP A 1 81  ? 0.927   0.526   4.573   1.00 17.67 ? 125 TRP A CH2 1 
ATOM   668  N N   . SER A 1 82  ? 0.524   6.360   3.900   1.00 10.61 ? 126 SER A N   1 
ATOM   669  C CA  . SER A 1 82  ? 1.905   6.266   4.192   1.00 12.67 ? 126 SER A CA  1 
ATOM   670  C C   . SER A 1 82  ? 2.155   6.124   5.730   1.00 14.73 ? 126 SER A C   1 
ATOM   671  O O   . SER A 1 82  ? 1.782   7.028   6.434   1.00 11.65 ? 126 SER A O   1 
ATOM   672  C CB  . SER A 1 82  ? 2.512   7.562   3.698   1.00 14.47 ? 126 SER A CB  1 
ATOM   673  O OG  . SER A 1 82  ? 3.882   7.384   3.581   1.00 22.17 ? 126 SER A OG  1 
ATOM   674  N N   . ARG A 1 83  ? 2.736   5.016   6.241   1.00 15.40 ? 127 ARG A N   1 
ATOM   675  C CA  . ARG A 1 83  ? 3.072   4.880   7.670   1.00 19.52 ? 127 ARG A CA  1 
ATOM   676  C C   . ARG A 1 83  ? 1.893   4.914   8.643   1.00 20.43 ? 127 ARG A C   1 
ATOM   677  O O   . ARG A 1 83  ? 2.049   5.270   9.858   1.00 23.17 ? 127 ARG A O   1 
ATOM   678  C CB  . ARG A 1 83  ? 4.072   5.984   8.092   1.00 19.97 ? 127 ARG A CB  1 
ATOM   679  C CG  . ARG A 1 83  ? 5.503   5.652   7.839   1.00 27.35 ? 127 ARG A CG  1 
ATOM   680  C CD  . ARG A 1 83  ? 5.958   6.096   6.487   1.00 35.55 ? 127 ARG A CD  1 
ATOM   681  N NE  . ARG A 1 83  ? 7.222   5.487   6.036   1.00 35.46 ? 127 ARG A NE  1 
ATOM   682  C CZ  . ARG A 1 83  ? 8.354   6.152   5.943   1.00 34.79 ? 127 ARG A CZ  1 
ATOM   683  N NH1 . ARG A 1 83  ? 8.363   7.437   6.265   1.00 29.50 ? 127 ARG A NH1 1 
ATOM   684  N NH2 . ARG A 1 83  ? 9.473   5.558   5.493   1.00 35.46 ? 127 ARG A NH2 1 
ATOM   685  N N   . ILE A 1 84  ? 0.709   4.662   8.126   1.00 20.77 ? 128 ILE A N   1 
ATOM   686  C CA  . ILE A 1 84  ? -0.537  4.654   8.930   1.00 20.12 ? 128 ILE A CA  1 
ATOM   687  C C   . ILE A 1 84  ? -1.480  3.485   8.364   1.00 21.45 ? 128 ILE A C   1 
ATOM   688  O O   . ILE A 1 84  ? -2.686  3.681   8.061   1.00 19.79 ? 128 ILE A O   1 
ATOM   689  C CB  . ILE A 1 84  ? -1.189  6.070   8.905   1.00 20.34 ? 128 ILE A CB  1 
ATOM   690  C CG1 . ILE A 1 84  ? -2.316  6.125   9.965   1.00 19.37 ? 128 ILE A CG1 1 
ATOM   691  C CG2 . ILE A 1 84  ? -1.723  6.451   7.520   1.00 18.70 ? 128 ILE A CG2 1 
ATOM   692  C CD1 . ILE A 1 84  ? -1.757  6.512   11.298  1.00 25.51 ? 128 ILE A CD1 1 
ATOM   693  N N   . LYS A 1 85  ? -0.887  2.292   8.249   1.00 19.70 ? 129 LYS A N   1 
ATOM   694  C CA  . LYS A 1 85  ? -1.563  1.111   7.709   1.00 22.17 ? 129 LYS A CA  1 
ATOM   695  C C   . LYS A 1 85  ? -2.884  0.828   8.389   1.00 21.24 ? 129 LYS A C   1 
ATOM   696  O O   . LYS A 1 85  ? -3.922  0.659   7.718   1.00 20.62 ? 129 LYS A O   1 
ATOM   697  C CB  . LYS A 1 85  ? -0.615  -0.153  7.724   1.00 23.06 ? 129 LYS A CB  1 
ATOM   698  C CG  . LYS A 1 85  ? -1.279  -1.485  7.333   1.00 26.30 ? 129 LYS A CG  1 
ATOM   699  C CD  . LYS A 1 85  ? -0.509  -2.356  6.292   1.00 31.47 ? 129 LYS A CD  1 
ATOM   700  C CE  . LYS A 1 85  ? -0.590  -3.795  6.666   1.00 29.79 ? 129 LYS A CE  1 
ATOM   701  N NZ  . LYS A 1 85  ? 0.640   -4.423  6.220   1.00 29.01 ? 129 LYS A NZ  1 
ATOM   702  N N   . ASP A 1 86  ? -2.861  0.752   9.725   1.00 21.62 ? 130 ASP A N   1 
ATOM   703  C CA  . ASP A 1 86  ? -4.018  0.246   10.443  1.00 21.45 ? 130 ASP A CA  1 
ATOM   704  C C   . ASP A 1 86  ? -5.260  1.037   10.100  1.00 18.65 ? 130 ASP A C   1 
ATOM   705  O O   . ASP A 1 86  ? -6.354  0.482   9.868   1.00 16.29 ? 130 ASP A O   1 
ATOM   706  C CB  . ASP A 1 86  ? -3.759  0.329   11.963  1.00 23.66 ? 130 ASP A CB  1 
ATOM   707  C CG  . ASP A 1 86  ? -3.835  -0.995  12.598  1.00 34.38 ? 130 ASP A CG  1 
ATOM   708  O OD1 . ASP A 1 86  ? -5.006  -1.452  12.815  1.00 43.16 ? 130 ASP A OD1 1 
ATOM   709  O OD2 . ASP A 1 86  ? -2.797  -1.692  12.866  1.00 42.69 ? 130 ASP A OD2 1 
ATOM   710  N N   . LEU A 1 87  ? -5.135  2.360   10.134  1.00 18.93 ? 131 LEU A N   1 
ATOM   711  C CA  . LEU A 1 87  ? -6.345  3.174   10.057  1.00 16.74 ? 131 LEU A CA  1 
ATOM   712  C C   . LEU A 1 87  ? -6.780  3.215   8.607   1.00 14.45 ? 131 LEU A C   1 
ATOM   713  O O   . LEU A 1 87  ? -7.947  3.290   8.361   1.00 12.72 ? 131 LEU A O   1 
ATOM   714  C CB  . LEU A 1 87  ? -6.091  4.593   10.565  1.00 16.94 ? 131 LEU A CB  1 
ATOM   715  C CG  . LEU A 1 87  ? -7.139  5.570   11.133  1.00 22.85 ? 131 LEU A CG  1 
ATOM   716  C CD1 . LEU A 1 87  ? -6.966  7.062   10.718  1.00 23.69 ? 131 LEU A CD1 1 
ATOM   717  C CD2 . LEU A 1 87  ? -8.594  5.207   11.139  1.00 21.97 ? 131 LEU A CD2 1 
ATOM   718  N N   . ALA A 1 88  ? -5.838  3.192   7.657   1.00 12.42 ? 132 ALA A N   1 
ATOM   719  C CA  . ALA A 1 88  ? -6.255  3.228   6.239   1.00 12.59 ? 132 ALA A CA  1 
ATOM   720  C C   . ALA A 1 88  ? -7.121  1.998   5.962   1.00 11.17 ? 132 ALA A C   1 
ATOM   721  O O   . ALA A 1 88  ? -8.173  2.150   5.400   1.00 12.70 ? 132 ALA A O   1 
ATOM   722  C CB  . ALA A 1 88  ? -5.057  3.292   5.272   1.00 10.53 ? 132 ALA A CB  1 
ATOM   723  N N   . HIS A 1 89  ? -6.722  0.838   6.491   1.00 12.55 ? 133 HIS A N   1 
ATOM   724  C CA  . HIS A 1 89  ? -7.425  -0.454  6.237   1.00 13.99 ? 133 HIS A CA  1 
ATOM   725  C C   . HIS A 1 89  ? -8.773  -0.560  6.942   1.00 13.77 ? 133 HIS A C   1 
ATOM   726  O O   . HIS A 1 89  ? -9.835  -1.029  6.384   1.00 13.84 ? 133 HIS A O   1 
ATOM   727  C CB  . HIS A 1 89  ? -6.490  -1.682  6.535   1.00 13.02 ? 133 HIS A CB  1 
ATOM   728  C CG  . HIS A 1 89  ? -5.354  -1.776  5.561   1.00 21.18 ? 133 HIS A CG  1 
ATOM   729  N ND1 . HIS A 1 89  ? -5.483  -1.340  4.253   1.00 24.36 ? 133 HIS A ND1 1 
ATOM   730  C CD2 . HIS A 1 89  ? -4.090  -2.248  5.667   1.00 28.75 ? 133 HIS A CD2 1 
ATOM   731  C CE1 . HIS A 1 89  ? -4.341  -1.495  3.602   1.00 20.69 ? 133 HIS A CE1 1 
ATOM   732  N NE2 . HIS A 1 89  ? -3.473  -2.039  4.435   1.00 30.39 ? 133 HIS A NE2 1 
ATOM   733  N N   . GLN A 1 90  ? -8.776  -0.057  8.168   1.00 13.79 ? 134 GLN A N   1 
ATOM   734  C CA  . GLN A 1 90  ? -10.011 0.018   8.927   1.00 14.43 ? 134 GLN A CA  1 
ATOM   735  C C   . GLN A 1 90  ? -10.993 0.889   8.309   1.00 14.85 ? 134 GLN A C   1 
ATOM   736  O O   . GLN A 1 90  ? -12.188 0.585   8.346   1.00 14.12 ? 134 GLN A O   1 
ATOM   737  C CB  . GLN A 1 90  ? -9.756  0.580   10.292  1.00 14.34 ? 134 GLN A CB  1 
ATOM   738  C CG  . GLN A 1 90  ? -9.260  -0.500  11.206  1.00 20.83 ? 134 GLN A CG  1 
ATOM   739  C CD  . GLN A 1 90  ? -9.045  0.045   12.603  1.00 30.83 ? 134 GLN A CD  1 
ATOM   740  O OE1 . GLN A 1 90  ? -10.006 0.143   13.398  1.00 30.87 ? 134 GLN A OE1 1 
ATOM   741  N NE2 . GLN A 1 90  ? -7.799  0.382   12.919  1.00 32.09 ? 134 GLN A NE2 1 
ATOM   742  N N   . PHE A 1 91  ? -10.514 2.027   7.802   1.00 13.04 ? 135 PHE A N   1 
ATOM   743  C CA  . PHE A 1 91  ? -11.375 2.947   7.150   1.00 14.73 ? 135 PHE A CA  1 
ATOM   744  C C   . PHE A 1 91  ? -11.957 2.274   5.902   1.00 12.94 ? 135 PHE A C   1 
ATOM   745  O O   . PHE A 1 91  ? -13.183 2.321   5.714   1.00 12.19 ? 135 PHE A O   1 
ATOM   746  C CB  . PHE A 1 91  ? -10.591 4.258   6.755   1.00 14.82 ? 135 PHE A CB  1 
ATOM   747  C CG  . PHE A 1 91  ? -11.332 5.111   5.808   1.00 17.19 ? 135 PHE A CG  1 
ATOM   748  C CD1 . PHE A 1 91  ? -10.930 5.191   4.473   1.00 13.68 ? 135 PHE A CD1 1 
ATOM   749  C CD2 . PHE A 1 91  ? -12.449 5.871   6.229   1.00 17.19 ? 135 PHE A CD2 1 
ATOM   750  C CE1 . PHE A 1 91  ? -11.647 6.003   3.551   1.00 15.39 ? 135 PHE A CE1 1 
ATOM   751  C CE2 . PHE A 1 91  ? -13.201 6.667   5.278   1.00 18.63 ? 135 PHE A CE2 1 
ATOM   752  C CZ  . PHE A 1 91  ? -12.773 6.716   3.902   1.00 10.90 ? 135 PHE A CZ  1 
ATOM   753  N N   . THR A 1 92  ? -11.109 1.705   5.043   1.00 15.61 ? 136 THR A N   1 
ATOM   754  C CA  . THR A 1 92  ? -11.704 1.005   3.878   1.00 17.09 ? 136 THR A CA  1 
ATOM   755  C C   . THR A 1 92  ? -12.579 -0.237  4.176   1.00 20.20 ? 136 THR A C   1 
ATOM   756  O O   . THR A 1 92  ? -13.545 -0.501  3.416   1.00 20.69 ? 136 THR A O   1 
ATOM   757  C CB  . THR A 1 92  ? -10.748 0.636   2.784   1.00 18.98 ? 136 THR A CB  1 
ATOM   758  O OG1 . THR A 1 92  ? -9.686  -0.192  3.299   1.00 19.64 ? 136 THR A OG1 1 
ATOM   759  C CG2 . THR A 1 92  ? -10.018 1.961   2.200   1.00 16.46 ? 136 THR A CG2 1 
ATOM   760  N N   . GLN A 1 93  ? -12.219 -1.036  5.169   1.00 19.99 ? 137 GLN A N   1 
ATOM   761  C CA  . GLN A 1 93  ? -13.158 -2.098  5.594   1.00 21.39 ? 137 GLN A CA  1 
ATOM   762  C C   . GLN A 1 93  ? -14.613 -1.624  5.923   1.00 22.28 ? 137 GLN A C   1 
ATOM   763  O O   . GLN A 1 93  ? -15.548 -2.428  5.807   1.00 22.92 ? 137 GLN A O   1 
ATOM   764  C CB  . GLN A 1 93  ? -12.603 -2.893  6.775   1.00 22.08 ? 137 GLN A CB  1 
ATOM   765  C CG  . GLN A 1 93  ? -11.279 -3.652  6.514   1.00 26.85 ? 137 GLN A CG  1 
ATOM   766  C CD  . GLN A 1 93  ? -11.537 -4.995  5.813   1.00 32.60 ? 137 GLN A CD  1 
ATOM   767  O OE1 . GLN A 1 93  ? -11.180 -5.197  4.637   1.00 34.03 ? 137 GLN A OE1 1 
ATOM   768  N NE2 . GLN A 1 93  ? -12.157 -5.914  6.537   1.00 35.92 ? 137 GLN A NE2 1 
ATOM   769  N N   . VAL A 1 94  ? -14.837 -0.377  6.357   1.00 21.72 ? 138 VAL A N   1 
ATOM   770  C CA  . VAL A 1 94  ? -16.191 0.032   6.841   1.00 23.94 ? 138 VAL A CA  1 
ATOM   771  C C   . VAL A 1 94  ? -17.387 -0.002  5.912   1.00 25.00 ? 138 VAL A C   1 
ATOM   772  O O   . VAL A 1 94  ? -18.476 -0.560  6.253   1.00 26.79 ? 138 VAL A O   1 
ATOM   773  C CB  . VAL A 1 94  ? -16.236 1.463   7.474   1.00 24.70 ? 138 VAL A CB  1 
ATOM   774  C CG1 . VAL A 1 94  ? -17.728 1.984   7.626   1.00 22.53 ? 138 VAL A CG1 1 
ATOM   775  C CG2 . VAL A 1 94  ? -15.559 1.412   8.792   1.00 25.32 ? 138 VAL A CG2 1 
ATOM   776  N N   . GLN A 1 95  ? -17.259 0.672   4.782   1.00 24.44 ? 139 GLN A N   1 
ATOM   777  C CA  . GLN A 1 95  ? -18.320 0.671   3.789   1.00 25.05 ? 139 GLN A CA  1 
ATOM   778  C C   . GLN A 1 95  ? -17.711 0.817   2.389   1.00 26.63 ? 139 GLN A C   1 
ATOM   779  O O   . GLN A 1 95  ? -18.411 1.196   1.437   1.00 28.14 ? 139 GLN A O   1 
ATOM   780  N N   . ARG A 1 96  ? -16.420 0.536   2.284   1.00 25.13 ? 140 ARG A N   1 
ATOM   781  C CA  . ARG A 1 96  ? -15.709 0.497   1.035   1.00 29.01 ? 140 ARG A CA  1 
ATOM   782  C C   . ARG A 1 96  ? -15.798 1.859   0.370   1.00 29.23 ? 140 ARG A C   1 
ATOM   783  O O   . ARG A 1 96  ? -16.184 1.970   -0.807  1.00 28.26 ? 140 ARG A O   1 
ATOM   784  C CB  . ARG A 1 96  ? -16.250 -0.572  0.132   1.00 28.91 ? 140 ARG A CB  1 
ATOM   785  C CG  . ARG A 1 96  ? -16.959 -1.646  0.942   1.00 33.36 ? 140 ARG A CG  1 
ATOM   786  C CD  . ARG A 1 96  ? -16.369 -2.978  0.830   1.00 36.86 ? 140 ARG A CD  1 
ATOM   787  N NE  . ARG A 1 96  ? -15.259 -3.142  1.765   1.00 44.51 ? 140 ARG A NE  1 
ATOM   788  C CZ  . ARG A 1 96  ? -14.551 -4.272  1.899   1.00 42.96 ? 140 ARG A CZ  1 
ATOM   789  N NH1 . ARG A 1 96  ? -14.850 -5.332  1.158   1.00 42.63 ? 140 ARG A NH1 1 
ATOM   790  N NH2 . ARG A 1 96  ? -13.527 -4.328  2.748   1.00 36.31 ? 140 ARG A NH2 1 
ATOM   791  N N   . ASP A 1 97  ? -15.428 2.874   1.162   1.00 29.13 ? 141 ASP A N   1 
ATOM   792  C CA  . ASP A 1 97  ? -15.563 4.256   0.749   1.00 28.11 ? 141 ASP A CA  1 
ATOM   793  C C   . ASP A 1 97  ? -14.405 4.554   -0.231  1.00 26.06 ? 141 ASP A C   1 
ATOM   794  O O   . ASP A 1 97  ? -14.535 5.376   -1.149  1.00 25.52 ? 141 ASP A O   1 
ATOM   795  C CB  . ASP A 1 97  ? -15.540 5.192   1.972   1.00 28.74 ? 141 ASP A CB  1 
ATOM   796  C CG  . ASP A 1 97  ? -16.099 4.518   3.248   1.00 33.75 ? 141 ASP A CG  1 
ATOM   797  O OD1 . ASP A 1 97  ? -16.954 5.287   3.806   1.00 28.12 ? 141 ASP A OD1 1 
ATOM   798  O OD2 . ASP A 1 97  ? -15.779 3.287   3.739   1.00 31.36 ? 141 ASP A OD2 1 
ATOM   799  N N   . MET A 1 98  ? -13.294 3.832   -0.053  1.00 23.18 ? 142 MET A N   1 
ATOM   800  C CA  . MET A 1 98  ? -12.216 3.827   -1.000  1.00 18.12 ? 142 MET A CA  1 
ATOM   801  C C   . MET A 1 98  ? -11.497 2.432   -1.113  1.00 15.75 ? 142 MET A C   1 
ATOM   802  O O   . MET A 1 98  ? -11.881 1.398   -0.446  1.00 12.54 ? 142 MET A O   1 
ATOM   803  C CB  . MET A 1 98  ? -11.285 5.037   -0.623  1.00 20.12 ? 142 MET A CB  1 
ATOM   804  C CG  . MET A 1 98  ? -11.942 6.482   -0.663  1.00 21.48 ? 142 MET A CG  1 
ATOM   805  S SD  . MET A 1 98  ? -10.809 7.778   0.167   1.00 26.51 ? 142 MET A SD  1 
ATOM   806  C CE  . MET A 1 98  ? -11.911 9.255   0.478   1.00 19.68 ? 142 MET A CE  1 
ATOM   807  N N   . PHE A 1 99  ? -10.467 2.380   -1.968  1.00 12.92 ? 143 PHE A N   1 
ATOM   808  C CA  . PHE A 1 99  ? -9.698  1.146   -2.181  1.00 13.09 ? 143 PHE A CA  1 
ATOM   809  C C   . PHE A 1 99  ? -8.278  1.469   -1.907  1.00 10.09 ? 143 PHE A C   1 
ATOM   810  O O   . PHE A 1 99  ? -7.804  2.450   -2.485  1.00 11.93 ? 143 PHE A O   1 
ATOM   811  C CB  . PHE A 1 99  ? -9.887  0.698   -3.666  1.00 13.82 ? 143 PHE A CB  1 
ATOM   812  C CG  . PHE A 1 99  ? -11.333 0.413   -3.963  1.00 17.00 ? 143 PHE A CG  1 
ATOM   813  C CD1 . PHE A 1 99  ? -11.782 -0.923  -3.927  1.00 20.22 ? 143 PHE A CD1 1 
ATOM   814  C CD2 . PHE A 1 99  ? -12.248 1.428   -4.116  1.00 20.87 ? 143 PHE A CD2 1 
ATOM   815  C CE1 . PHE A 1 99  ? -13.158 -1.231  -4.041  1.00 22.74 ? 143 PHE A CE1 1 
ATOM   816  C CE2 . PHE A 1 99  ? -13.678 1.153   -4.292  1.00 20.41 ? 143 PHE A CE2 1 
ATOM   817  C CZ  . PHE A 1 99  ? -14.108 -0.183  -4.204  1.00 23.57 ? 143 PHE A CZ  1 
ATOM   818  N N   . THR A 1 100 ? -7.566  0.713   -1.080  1.00 8.73  ? 144 THR A N   1 
ATOM   819  C CA  . THR A 1 100 ? -6.109  0.916   -1.002  1.00 8.56  ? 144 THR A CA  1 
ATOM   820  C C   . THR A 1 100 ? -5.490  -0.176  -1.907  1.00 9.44  ? 144 THR A C   1 
ATOM   821  O O   . THR A 1 100 ? -6.157  -1.154  -2.363  1.00 6.74  ? 144 THR A O   1 
ATOM   822  C CB  . THR A 1 100 ? -5.575  0.573   0.368   1.00 11.00 ? 144 THR A CB  1 
ATOM   823  O OG1 . THR A 1 100 ? -5.979  -0.792  0.610   1.00 11.23 ? 144 THR A OG1 1 
ATOM   824  C CG2 . THR A 1 100 ? -6.216  1.463   1.537   1.00 9.63  ? 144 THR A CG2 1 
ATOM   825  N N   . LEU A 1 101 ? -4.157  -0.122  -1.994  1.00 8.06  ? 145 LEU A N   1 
ATOM   826  C CA  . LEU A 1 101 ? -3.436  -1.097  -2.851  1.00 8.15  ? 145 LEU A CA  1 
ATOM   827  C C   . LEU A 1 101 ? -3.658  -2.518  -2.333  1.00 9.04  ? 145 LEU A C   1 
ATOM   828  O O   . LEU A 1 101 ? -3.840  -3.512  -3.146  1.00 7.93  ? 145 LEU A O   1 
ATOM   829  C CB  . LEU A 1 101 ? -1.911  -0.723  -2.831  1.00 9.37  ? 145 LEU A CB  1 
ATOM   830  C CG  . LEU A 1 101 ? -1.008  -1.764  -3.561  1.00 6.36  ? 145 LEU A CG  1 
ATOM   831  C CD1 . LEU A 1 101 ? -1.332  -1.979  -5.166  1.00 11.35 ? 145 LEU A CD1 1 
ATOM   832  C CD2 . LEU A 1 101 ? 0.525   -1.322  -3.224  1.00 8.39  ? 145 LEU A CD2 1 
ATOM   833  N N   . GLU A 1 102 ? -3.821  -2.619  -1.027  1.00 9.06  ? 146 GLU A N   1 
ATOM   834  C CA  . GLU A 1 102 ? -3.935  -3.943  -0.374  1.00 12.98 ? 146 GLU A CA  1 
ATOM   835  C C   . GLU A 1 102 ? -5.389  -4.516  -0.456  1.00 12.66 ? 146 GLU A C   1 
ATOM   836  O O   . GLU A 1 102 ? -5.618  -5.613  -0.022  1.00 13.35 ? 146 GLU A O   1 
ATOM   837  C CB  . GLU A 1 102 ? -3.413  -3.916  1.099   1.00 10.65 ? 146 GLU A CB  1 
ATOM   838  C CG  . GLU A 1 102 ? -1.936  -3.503  1.230   1.00 16.68 ? 146 GLU A CG  1 
ATOM   839  C CD  . GLU A 1 102 ? -1.715  -1.981  1.126   1.00 15.80 ? 146 GLU A CD  1 
ATOM   840  O OE1 . GLU A 1 102 ? -2.630  -1.176  1.326   1.00 12.52 ? 146 GLU A OE1 1 
ATOM   841  O OE2 . GLU A 1 102 ? -0.589  -1.574  0.875   1.00 15.54 ? 146 GLU A OE2 1 
ATOM   842  N N   . ASP A 1 103 ? -6.321  -3.773  -1.087  1.00 11.66 ? 147 ASP A N   1 
ATOM   843  C CA  . ASP A 1 103 ? -7.674  -4.234  -1.395  1.00 9.38  ? 147 ASP A CA  1 
ATOM   844  C C   . ASP A 1 103 ? -7.775  -4.711  -2.845  1.00 10.35 ? 147 ASP A C   1 
ATOM   845  O O   . ASP A 1 103 ? -8.844  -5.169  -3.267  1.00 11.33 ? 147 ASP A O   1 
ATOM   846  C CB  . ASP A 1 103 ? -8.736  -3.084  -1.280  1.00 13.36 ? 147 ASP A CB  1 
ATOM   847  C CG  . ASP A 1 103 ? -8.919  -2.567  0.193   1.00 18.37 ? 147 ASP A CG  1 
ATOM   848  O OD1 . ASP A 1 103 ? -8.783  -1.341  0.514   1.00 17.94 ? 147 ASP A OD1 1 
ATOM   849  O OD2 . ASP A 1 103 ? -9.132  -3.410  1.103   1.00 20.22 ? 147 ASP A OD2 1 
ATOM   850  N N   . THR A 1 104 ? -6.718  -4.581  -3.602  1.00 5.57  ? 148 THR A N   1 
ATOM   851  C CA  . THR A 1 104 ? -6.597  -5.224  -4.888  1.00 6.99  ? 148 THR A CA  1 
ATOM   852  C C   . THR A 1 104 ? -6.049  -6.680  -4.661  1.00 8.90  ? 148 THR A C   1 
ATOM   853  O O   . THR A 1 104 ? -5.459  -6.955  -3.639  1.00 6.61  ? 148 THR A O   1 
ATOM   854  C CB  . THR A 1 104 ? -5.575  -4.484  -5.795  1.00 9.10  ? 148 THR A CB  1 
ATOM   855  O OG1 . THR A 1 104 ? -4.212  -4.687  -5.378  1.00 7.36  ? 148 THR A OG1 1 
ATOM   856  C CG2 . THR A 1 104 ? -5.785  -2.875  -5.853  1.00 11.05 ? 148 THR A CG2 1 
ATOM   857  N N   . LEU A 1 105 ? -6.302  -7.591  -5.595  1.00 6.37  ? 149 LEU A N   1 
ATOM   858  C CA  . LEU A 1 105 ? -5.852  -8.995  -5.427  1.00 7.91  ? 149 LEU A CA  1 
ATOM   859  C C   . LEU A 1 105 ? -4.328  -9.046  -5.140  1.00 9.13  ? 149 LEU A C   1 
ATOM   860  O O   . LEU A 1 105 ? -3.870  -9.656  -4.183  1.00 10.41 ? 149 LEU A O   1 
ATOM   861  C CB  . LEU A 1 105 ? -6.174  -9.799  -6.683  1.00 8.50  ? 149 LEU A CB  1 
ATOM   862  C CG  . LEU A 1 105 ? -5.490  -11.178 -6.668  1.00 7.27  ? 149 LEU A CG  1 
ATOM   863  C CD1 . LEU A 1 105 ? -6.000  -11.976 -5.563  1.00 9.04  ? 149 LEU A CD1 1 
ATOM   864  C CD2 . LEU A 1 105 ? -5.797  -11.844 -7.962  1.00 12.40 ? 149 LEU A CD2 1 
ATOM   865  N N   . LEU A 1 106 ? -3.537  -8.344  -5.925  1.00 8.92  ? 150 LEU A N   1 
ATOM   866  C CA  . LEU A 1 106 ? -2.105  -8.509  -5.813  1.00 6.40  ? 150 LEU A CA  1 
ATOM   867  C C   . LEU A 1 106 ? -1.565  -7.944  -4.502  1.00 5.84  ? 150 LEU A C   1 
ATOM   868  O O   . LEU A 1 106 ? -0.697  -8.550  -3.805  1.00 6.10  ? 150 LEU A O   1 
ATOM   869  C CB  . LEU A 1 106 ? -1.512  -7.781  -6.991  1.00 9.50  ? 150 LEU A CB  1 
ATOM   870  C CG  . LEU A 1 106 ? -1.648  -8.519  -8.320  1.00 11.14 ? 150 LEU A CG  1 
ATOM   871  C CD1 . LEU A 1 106 ? -1.302  -7.547  -9.499  1.00 11.88 ? 150 LEU A CD1 1 
ATOM   872  C CD2 . LEU A 1 106 ? -1.032  -9.882  -8.276  1.00 15.36 ? 150 LEU A CD2 1 
ATOM   873  N N   . GLY A 1 107 ? -2.101  -6.808  -4.142  1.00 6.49  ? 151 GLY A N   1 
ATOM   874  C CA  . GLY A 1 107 ? -1.731  -6.261  -2.837  1.00 6.67  ? 151 GLY A CA  1 
ATOM   875  C C   . GLY A 1 107 ? -2.239  -7.132  -1.708  1.00 6.40  ? 151 GLY A C   1 
ATOM   876  O O   . GLY A 1 107 ? -1.554  -7.335  -0.703  1.00 10.11 ? 151 GLY A O   1 
ATOM   877  N N   . TYR A 1 108 ? -3.470  -7.642  -1.837  1.00 6.01  ? 152 TYR A N   1 
ATOM   878  C CA  . TYR A 1 108 ? -3.990  -8.587  -0.890  1.00 7.28  ? 152 TYR A CA  1 
ATOM   879  C C   . TYR A 1 108 ? -3.139  -9.885  -0.690  1.00 6.70  ? 152 TYR A C   1 
ATOM   880  O O   . TYR A 1 108 ? -2.914  -10.290 0.463   1.00 7.11  ? 152 TYR A O   1 
ATOM   881  C CB  . TYR A 1 108 ? -5.444  -8.864  -1.267  1.00 7.82  ? 152 TYR A CB  1 
ATOM   882  C CG  . TYR A 1 108 ? -6.228  -9.737  -0.332  1.00 12.75 ? 152 TYR A CG  1 
ATOM   883  C CD1 . TYR A 1 108 ? -6.166  -11.127 -0.433  1.00 15.16 ? 152 TYR A CD1 1 
ATOM   884  C CD2 . TYR A 1 108 ? -7.054  -9.182  0.617   1.00 16.04 ? 152 TYR A CD2 1 
ATOM   885  C CE1 . TYR A 1 108 ? -6.897  -11.940 0.462   1.00 14.01 ? 152 TYR A CE1 1 
ATOM   886  C CE2 . TYR A 1 108 ? -7.790  -9.979  1.538   1.00 17.74 ? 152 TYR A CE2 1 
ATOM   887  C CZ  . TYR A 1 108 ? -7.716  -11.349 1.417   1.00 21.69 ? 152 TYR A CZ  1 
ATOM   888  O OH  . TYR A 1 108 ? -8.495  -12.132 2.252   1.00 21.65 ? 152 TYR A OH  1 
ATOM   889  N N   . LEU A 1 109 ? -2.663  -10.489 -1.756  1.00 7.65  ? 153 LEU A N   1 
ATOM   890  C CA  . LEU A 1 109 ? -1.798  -11.739 -1.750  1.00 9.27  ? 153 LEU A CA  1 
ATOM   891  C C   . LEU A 1 109 ? -0.503  -11.540 -0.971  1.00 9.27  ? 153 LEU A C   1 
ATOM   892  O O   . LEU A 1 109 ? -0.143  -12.376 -0.142  1.00 9.97  ? 153 LEU A O   1 
ATOM   893  C CB  . LEU A 1 109 ? -1.418  -12.107 -3.219  1.00 6.65  ? 153 LEU A CB  1 
ATOM   894  C CG  . LEU A 1 109 ? -2.528  -12.535 -4.106  1.00 10.24 ? 153 LEU A CG  1 
ATOM   895  C CD1 . LEU A 1 109 ? -1.957  -12.885 -5.481  1.00 8.90  ? 153 LEU A CD1 1 
ATOM   896  C CD2 . LEU A 1 109 ? -3.248  -13.682 -3.460  1.00 12.07 ? 153 LEU A CD2 1 
ATOM   897  N N   . ALA A 1 110 ? 0.056   -10.324 -1.014  1.00 8.00  ? 154 ALA A N   1 
ATOM   898  C CA  . ALA A 1 110 ? 1.377   -10.123 -0.475  1.00 7.93  ? 154 ALA A CA  1 
ATOM   899  C C   . ALA A 1 110 ? 1.450   -9.392  0.825   1.00 9.99  ? 154 ALA A C   1 
ATOM   900  O O   . ALA A 1 110 ? 2.544   -9.314  1.380   1.00 9.62  ? 154 ALA A O   1 
ATOM   901  C CB  . ALA A 1 110 ? 2.269   -9.330  -1.497  1.00 6.67  ? 154 ALA A CB  1 
ATOM   902  N N   . ASP A 1 111 ? 0.347   -8.767  1.234   1.00 11.14 ? 155 ASP A N   1 
ATOM   903  C CA  . ASP A 1 111 ? 0.348   -7.885  2.442   1.00 12.37 ? 155 ASP A CA  1 
ATOM   904  C C   . ASP A 1 111 ? 0.905   -8.602  3.642   1.00 12.51 ? 155 ASP A C   1 
ATOM   905  O O   . ASP A 1 111 ? 0.503   -9.749  3.945   1.00 12.50 ? 155 ASP A O   1 
ATOM   906  C CB  . ASP A 1 111 ? -1.078  -7.456  2.800   1.00 15.02 ? 155 ASP A CB  1 
ATOM   907  C CG  . ASP A 1 111 ? -1.118  -6.258  3.786   1.00 19.85 ? 155 ASP A CG  1 
ATOM   908  O OD1 . ASP A 1 111 ? -2.250  -5.882  4.254   1.00 31.17 ? 155 ASP A OD1 1 
ATOM   909  O OD2 . ASP A 1 111 ? -0.139  -5.558  4.022   1.00 19.62 ? 155 ASP A OD2 1 
ATOM   910  N N   . ASP A 1 112 ? 1.930   -7.962  4.236   1.00 12.89 ? 156 ASP A N   1 
ATOM   911  C CA  . ASP A 1 112 ? 2.653   -8.421  5.439   1.00 14.51 ? 156 ASP A CA  1 
ATOM   912  C C   . ASP A 1 112 ? 3.471   -9.690  5.302   1.00 13.84 ? 156 ASP A C   1 
ATOM   913  O O   . ASP A 1 112 ? 3.811   -10.250 6.343   1.00 16.25 ? 156 ASP A O   1 
ATOM   914  C CB  . ASP A 1 112 ? 1.715   -8.682  6.640   1.00 17.96 ? 156 ASP A CB  1 
ATOM   915  C CG  . ASP A 1 112 ? 1.080   -7.428  7.196   1.00 26.21 ? 156 ASP A CG  1 
ATOM   916  O OD1 . ASP A 1 112 ? 1.788   -6.405  7.399   1.00 34.18 ? 156 ASP A OD1 1 
ATOM   917  O OD2 . ASP A 1 112 ? -0.159  -7.426  7.488   1.00 33.73 ? 156 ASP A OD2 1 
ATOM   918  N N   . LEU A 1 113 ? 3.753   -10.186 4.096   1.00 10.24 ? 157 LEU A N   1 
ATOM   919  C CA  . LEU A 1 113 ? 4.553   -11.399 3.941   1.00 9.93  ? 157 LEU A CA  1 
ATOM   920  C C   . LEU A 1 113 ? 5.941   -10.996 3.465   1.00 7.38  ? 157 LEU A C   1 
ATOM   921  O O   . LEU A 1 113 ? 6.103   -9.860  2.935   1.00 4.62  ? 157 LEU A O   1 
ATOM   922  C CB  . LEU A 1 113 ? 3.878   -12.275 2.814   1.00 6.80  ? 157 LEU A CB  1 
ATOM   923  C CG  . LEU A 1 113 ? 2.444   -12.690 3.157   1.00 10.14 ? 157 LEU A CG  1 
ATOM   924  C CD1 . LEU A 1 113 ? 1.920   -13.670 2.133   1.00 9.48  ? 157 LEU A CD1 1 
ATOM   925  C CD2 . LEU A 1 113 ? 2.334   -13.569 4.428   1.00 7.65  ? 157 LEU A CD2 1 
ATOM   926  N N   . THR A 1 114 ? 6.910   -11.879 3.653   1.00 8.52  ? 158 THR A N   1 
ATOM   927  C CA  . THR A 1 114 ? 8.252   -11.766 3.065   1.00 9.03  ? 158 THR A CA  1 
ATOM   928  C C   . THR A 1 114 ? 8.531   -12.985 2.220   1.00 10.17 ? 158 THR A C   1 
ATOM   929  O O   . THR A 1 114 ? 8.045   -14.086 2.532   1.00 10.33 ? 158 THR A O   1 
ATOM   930  C CB  . THR A 1 114 ? 9.272   -11.749 4.216   1.00 13.67 ? 158 THR A CB  1 
ATOM   931  O OG1 . THR A 1 114 ? 8.975   -10.584 4.981   1.00 13.96 ? 158 THR A OG1 1 
ATOM   932  C CG2 . THR A 1 114 ? 10.702  -11.454 3.657   1.00 13.24 ? 158 THR A CG2 1 
ATOM   933  N N   . TRP A 1 115 ? 9.406   -12.884 1.235   1.00 8.04  ? 159 TRP A N   1 
ATOM   934  C CA  . TRP A 1 115 ? 9.718   -14.069 0.472   1.00 7.95  ? 159 TRP A CA  1 
ATOM   935  C C   . TRP A 1 115 ? 10.994  -13.812 -0.264  1.00 7.45  ? 159 TRP A C   1 
ATOM   936  O O   . TRP A 1 115 ? 11.288  -12.645 -0.659  1.00 5.93  ? 159 TRP A O   1 
ATOM   937  C CB  . TRP A 1 115 ? 8.529   -14.431 -0.467  1.00 6.85  ? 159 TRP A CB  1 
ATOM   938  C CG  . TRP A 1 115 ? 8.221   -13.378 -1.538  1.00 6.83  ? 159 TRP A CG  1 
ATOM   939  C CD1 . TRP A 1 115 ? 8.839   -13.247 -2.750  1.00 4.02  ? 159 TRP A CD1 1 
ATOM   940  C CD2 . TRP A 1 115 ? 7.398   -12.230 -1.391  1.00 2.00  ? 159 TRP A CD2 1 
ATOM   941  N NE1 . TRP A 1 115 ? 8.395   -12.123 -3.418  1.00 7.82  ? 159 TRP A NE1 1 
ATOM   942  C CE2 . TRP A 1 115 ? 7.488   -11.483 -2.640  1.00 5.22  ? 159 TRP A CE2 1 
ATOM   943  C CE3 . TRP A 1 115 ? 6.491   -11.807 -0.407  1.00 5.11  ? 159 TRP A CE3 1 
ATOM   944  C CZ2 . TRP A 1 115 ? 6.774   -10.320 -2.879  1.00 5.13  ? 159 TRP A CZ2 1 
ATOM   945  C CZ3 . TRP A 1 115 ? 5.747   -10.613 -0.624  1.00 6.19  ? 159 TRP A CZ3 1 
ATOM   946  C CH2 . TRP A 1 115 ? 5.895   -9.892  -1.856  1.00 5.81  ? 159 TRP A CH2 1 
ATOM   947  N N   . CYS A 1 116 ? 11.819  -14.851 -0.416  1.00 9.56  ? 160 CYS A N   1 
ATOM   948  C CA  . CYS A 1 116 ? 12.879  -14.845 -1.405  1.00 10.03 ? 160 CYS A CA  1 
ATOM   949  C C   . CYS A 1 116 ? 13.313  -16.270 -1.771  1.00 10.66 ? 160 CYS A C   1 
ATOM   950  O O   . CYS A 1 116 ? 12.983  -17.213 -1.072  1.00 10.81 ? 160 CYS A O   1 
ATOM   951  C CB  . CYS A 1 116 ? 14.178  -14.081 -0.910  1.00 13.01 ? 160 CYS A CB  1 
ATOM   952  S SG  . CYS A 1 116 ? 14.825  -14.793 0.628   1.00 19.58 ? 160 CYS A SG  1 
ATOM   953  N N   . GLY A 1 117 ? 14.079  -16.377 -2.859  1.00 10.84 ? 161 GLY A N   1 
ATOM   954  C CA  . GLY A 1 117 ? 14.653  -17.640 -3.266  1.00 13.54 ? 161 GLY A CA  1 
ATOM   955  C C   . GLY A 1 117 ? 16.169  -17.575 -3.239  1.00 15.42 ? 161 GLY A C   1 
ATOM   956  O O   . GLY A 1 117 ? 16.745  -16.709 -2.566  1.00 13.80 ? 161 GLY A O   1 
ATOM   957  N N   . GLU A 1 118 ? 16.814  -18.446 -4.036  1.00 18.71 ? 162 GLU A N   1 
ATOM   958  C CA  . GLU A 1 118 ? 18.307  -18.538 -4.108  1.00 20.74 ? 162 GLU A CA  1 
ATOM   959  C C   . GLU A 1 118 ? 18.794  -18.715 -5.538  1.00 20.91 ? 162 GLU A C   1 
ATOM   960  O O   . GLU A 1 118 ? 18.128  -19.318 -6.353  1.00 19.60 ? 162 GLU A O   1 
ATOM   961  C CB  . GLU A 1 118 ? 18.818  -19.675 -3.213  1.00 21.84 ? 162 GLU A CB  1 
ATOM   962  C CG  . GLU A 1 118 ? 17.702  -20.107 -2.294  1.00 27.78 ? 162 GLU A CG  1 
ATOM   963  C CD  . GLU A 1 118 ? 18.066  -21.090 -1.228  1.00 34.98 ? 162 GLU A CD  1 
ATOM   964  O OE1 . GLU A 1 118 ? 17.373  -21.060 -0.161  1.00 34.57 ? 162 GLU A OE1 1 
ATOM   965  O OE2 . GLU A 1 118 ? 18.947  -21.944 -1.496  1.00 41.66 ? 162 GLU A OE2 1 
ATOM   966  N N   . PHE A 1 119 ? 19.975  -18.199 -5.841  1.00 20.94 ? 163 PHE A N   1 
ATOM   967  C CA  . PHE A 1 119 ? 20.447  -18.271 -7.198  1.00 24.49 ? 163 PHE A CA  1 
ATOM   968  C C   . PHE A 1 119 ? 20.876  -19.730 -7.501  1.00 26.04 ? 163 PHE A C   1 
ATOM   969  O O   . PHE A 1 119 ? 20.952  -20.105 -8.669  1.00 26.17 ? 163 PHE A O   1 
ATOM   970  C CB  . PHE A 1 119 ? 21.660  -17.359 -7.377  1.00 24.74 ? 163 PHE A CB  1 
ATOM   971  C CG  . PHE A 1 119 ? 22.246  -17.365 -8.787  1.00 29.21 ? 163 PHE A CG  1 
ATOM   972  C CD1 . PHE A 1 119 ? 21.426  -17.164 -9.915  1.00 35.26 ? 163 PHE A CD1 1 
ATOM   973  C CD2 . PHE A 1 119 ? 23.617  -17.577 -8.980  1.00 34.63 ? 163 PHE A CD2 1 
ATOM   974  C CE1 . PHE A 1 119 ? 21.963  -17.191 -11.254 1.00 40.28 ? 163 PHE A CE1 1 
ATOM   975  C CE2 . PHE A 1 119 ? 24.191  -17.578 -10.301 1.00 37.56 ? 163 PHE A CE2 1 
ATOM   976  C CZ  . PHE A 1 119 ? 23.351  -17.402 -11.451 1.00 40.43 ? 163 PHE A CZ  1 
ATOM   977  N N   . ALA A 1 120 ? 21.073  -20.479 -6.394  1.00 25.17 ? 164 ALA A N   1 
ATOM   978  C CA  . ALA A 1 120 ? 21.861  -21.720 -6.175  1.00 28.58 ? 164 ALA A CA  1 
ATOM   979  C C   . ALA A 1 120 ? 20.998  -22.990 -6.475  1.00 27.59 ? 164 ALA A C   1 
ATOM   980  O O   . ALA A 1 120 ? 21.456  -24.096 -6.954  1.00 26.69 ? 164 ALA A O   1 
ATOM   981  C CB  . ALA A 1 120 ? 22.116  -21.610 -4.642  1.00 29.00 ? 164 ALA A CB  1 
ATOM   982  N N   . THR A 1 121 ? 19.708  -22.831 -6.191  1.00 25.96 ? 165 THR A N   1 
ATOM   983  C CA  . THR A 1 121 ? 18.813  -23.959 -6.055  1.00 25.04 ? 165 THR A CA  1 
ATOM   984  C C   . THR A 1 121 ? 17.411  -23.440 -6.309  1.00 23.53 ? 165 THR A C   1 
ATOM   985  O O   . THR A 1 121 ? 17.182  -22.194 -6.367  1.00 21.57 ? 165 THR A O   1 
ATOM   986  C CB  . THR A 1 121 ? 18.891  -24.516 -4.595  1.00 26.52 ? 165 THR A CB  1 
ATOM   987  O OG1 . THR A 1 121 ? 18.217  -25.783 -4.507  1.00 33.39 ? 165 THR A OG1 1 
ATOM   988  C CG2 . THR A 1 121 ? 17.976  -23.680 -3.677  1.00 28.91 ? 165 THR A CG2 1 
ATOM   989  N N   . SER A 1 122 ? 16.477  -24.359 -6.495  1.00 20.11 ? 166 SER A N   1 
ATOM   990  C CA  . SER A 1 122 ? 15.137  -23.984 -6.768  1.00 19.26 ? 166 SER A CA  1 
ATOM   991  C C   . SER A 1 122 ? 14.293  -23.896 -5.499  1.00 18.67 ? 166 SER A C   1 
ATOM   992  O O   . SER A 1 122 ? 13.095  -23.831 -5.584  1.00 18.79 ? 166 SER A O   1 
ATOM   993  C CB  . SER A 1 122 ? 14.553  -24.967 -7.787  1.00 20.62 ? 166 SER A CB  1 
ATOM   994  O OG  . SER A 1 122 ? 14.600  -26.282 -7.219  1.00 20.61 ? 166 SER A OG  1 
ATOM   995  N N   . LYS A 1 123 ? 14.904  -23.771 -4.332  1.00 17.42 ? 167 LYS A N   1 
ATOM   996  C CA  . LYS A 1 123 ? 14.168  -23.858 -3.060  1.00 16.14 ? 167 LYS A CA  1 
ATOM   997  C C   . LYS A 1 123 ? 13.819  -22.396 -2.573  1.00 15.30 ? 167 LYS A C   1 
ATOM   998  O O   . LYS A 1 123 ? 14.496  -21.444 -2.935  1.00 14.14 ? 167 LYS A O   1 
ATOM   999  C CB  . LYS A 1 123 ? 15.070  -24.466 -1.988  1.00 17.35 ? 167 LYS A CB  1 
ATOM   1000 C CG  . LYS A 1 123 ? 14.863  -26.065 -1.835  1.00 21.34 ? 167 LYS A CG  1 
ATOM   1001 C CD  . LYS A 1 123 ? 15.761  -26.536 -0.659  1.00 18.73 ? 167 LYS A CD  1 
ATOM   1002 C CE  . LYS A 1 123 ? 17.197  -26.387 -1.055  1.00 21.80 ? 167 LYS A CE  1 
ATOM   1003 N NZ  . LYS A 1 123 ? 18.142  -27.327 -0.306  1.00 21.26 ? 167 LYS A NZ  1 
ATOM   1004 N N   . ILE A 1 124 ? 12.771  -22.298 -1.786  1.00 13.87 ? 168 ILE A N   1 
ATOM   1005 C CA  . ILE A 1 124 ? 12.421  -21.072 -1.106  1.00 13.87 ? 168 ILE A CA  1 
ATOM   1006 C C   . ILE A 1 124 ? 13.349  -20.876 0.104   1.00 14.54 ? 168 ILE A C   1 
ATOM   1007 O O   . ILE A 1 124 ? 13.640  -21.869 0.796   1.00 13.88 ? 168 ILE A O   1 
ATOM   1008 C CB  . ILE A 1 124 ? 10.956  -21.080 -0.706  1.00 14.71 ? 168 ILE A CB  1 
ATOM   1009 C CG1 . ILE A 1 124 ? 10.101  -20.846 -1.929  1.00 10.77 ? 168 ILE A CG1 1 
ATOM   1010 C CG2 . ILE A 1 124 ? 10.718  -19.880 0.293   1.00 14.00 ? 168 ILE A CG2 1 
ATOM   1011 C CD1 . ILE A 1 124 ? 8.630   -20.827 -1.692  1.00 15.14 ? 168 ILE A CD1 1 
ATOM   1012 N N   . ASN A 1 125 ? 13.860  -19.632 0.357   1.00 11.50 ? 169 ASN A N   1 
ATOM   1013 C CA  . ASN A 1 125 ? 14.711  -19.378 1.537   1.00 12.80 ? 169 ASN A CA  1 
ATOM   1014 C C   . ASN A 1 125 ? 13.876  -18.952 2.715   1.00 11.25 ? 169 ASN A C   1 
ATOM   1015 O O   . ASN A 1 125 ? 13.398  -17.796 2.804   1.00 13.01 ? 169 ASN A O   1 
ATOM   1016 C CB  . ASN A 1 125 ? 15.877  -18.341 1.237   1.00 12.57 ? 169 ASN A CB  1 
ATOM   1017 C CG  . ASN A 1 125 ? 16.972  -18.334 2.327   1.00 16.05 ? 169 ASN A CG  1 
ATOM   1018 O OD1 . ASN A 1 125 ? 16.756  -18.762 3.514   1.00 15.06 ? 169 ASN A OD1 1 
ATOM   1019 N ND2 . ASN A 1 125 ? 18.108  -17.715 1.992   1.00 12.43 ? 169 ASN A ND2 1 
ATOM   1020 N N   . TYR A 1 126 ? 13.691  -19.888 3.662   1.00 12.89 ? 170 TYR A N   1 
ATOM   1021 C CA  . TYR A 1 126 ? 12.902  -19.633 4.870   1.00 13.74 ? 170 TYR A CA  1 
ATOM   1022 C C   . TYR A 1 126 ? 13.850  -19.220 6.009   1.00 14.74 ? 170 TYR A C   1 
ATOM   1023 O O   . TYR A 1 126 ? 13.401  -18.974 7.125   1.00 18.11 ? 170 TYR A O   1 
ATOM   1024 C CB  . TYR A 1 126 ? 12.049  -20.863 5.332   1.00 13.03 ? 170 TYR A CB  1 
ATOM   1025 C CG  . TYR A 1 126 ? 11.024  -21.344 4.356   1.00 14.91 ? 170 TYR A CG  1 
ATOM   1026 C CD1 . TYR A 1 126 ? 11.329  -22.312 3.429   1.00 10.44 ? 170 TYR A CD1 1 
ATOM   1027 C CD2 . TYR A 1 126 ? 9.722   -20.788 4.322   1.00 13.94 ? 170 TYR A CD2 1 
ATOM   1028 C CE1 . TYR A 1 126 ? 10.304  -22.723 2.445   1.00 12.94 ? 170 TYR A CE1 1 
ATOM   1029 C CE2 . TYR A 1 126 ? 8.797   -21.196 3.371   1.00 12.81 ? 170 TYR A CE2 1 
ATOM   1030 C CZ  . TYR A 1 126 ? 9.086   -22.143 2.471   1.00 16.61 ? 170 TYR A CZ  1 
ATOM   1031 O OH  . TYR A 1 126 ? 8.082   -22.566 1.582   1.00 16.46 ? 170 TYR A OH  1 
ATOM   1032 N N   . GLN A 1 127 ? 15.133  -19.074 5.762   1.00 14.80 ? 171 GLN A N   1 
ATOM   1033 C CA  . GLN A 1 127 ? 16.049  -18.623 6.848   1.00 17.05 ? 171 GLN A CA  1 
ATOM   1034 C C   . GLN A 1 127 ? 16.353  -17.127 6.897   1.00 15.48 ? 171 GLN A C   1 
ATOM   1035 O O   . GLN A 1 127 ? 16.374  -16.514 7.970   1.00 15.72 ? 171 GLN A O   1 
ATOM   1036 C CB  . GLN A 1 127 ? 17.371  -19.377 6.817   1.00 17.46 ? 171 GLN A CB  1 
ATOM   1037 C CG  . GLN A 1 127 ? 17.452  -20.740 7.681   1.00 29.58 ? 171 GLN A CG  1 
ATOM   1038 C CD  . GLN A 1 127 ? 16.942  -20.636 9.156   1.00 35.56 ? 171 GLN A CD  1 
ATOM   1039 O OE1 . GLN A 1 127 ? 15.890  -21.210 9.487   1.00 40.84 ? 171 GLN A OE1 1 
ATOM   1040 N NE2 . GLN A 1 127 ? 17.676  -19.915 10.014  1.00 37.33 ? 171 GLN A NE2 1 
ATOM   1041 N N   . SER A 1 128 ? 16.616  -16.504 5.744   1.00 12.91 ? 172 SER A N   1 
ATOM   1042 C CA  . SER A 1 128 ? 16.797  -15.029 5.734   1.00 13.06 ? 172 SER A CA  1 
ATOM   1043 C C   . SER A 1 128 ? 16.593  -14.506 4.285   1.00 12.48 ? 172 SER A C   1 
ATOM   1044 O O   . SER A 1 128 ? 16.596  -15.284 3.386   1.00 12.42 ? 172 SER A O   1 
ATOM   1045 C CB  . SER A 1 128 ? 18.227  -14.705 6.206   1.00 12.02 ? 172 SER A CB  1 
ATOM   1046 O OG  . SER A 1 128 ? 19.192  -15.153 5.230   1.00 12.48 ? 172 SER A OG  1 
ATOM   1047 N N   . CYS A 1 129 ? 16.368  -13.215 4.097   1.00 13.32 ? 173 CYS A N   1 
ATOM   1048 C CA  . CYS A 1 129 ? 16.065  -12.602 2.806   1.00 14.11 ? 173 CYS A CA  1 
ATOM   1049 C C   . CYS A 1 129 ? 16.749  -11.228 2.765   1.00 13.42 ? 173 CYS A C   1 
ATOM   1050 O O   . CYS A 1 129 ? 16.953  -10.602 3.827   1.00 15.42 ? 173 CYS A O   1 
ATOM   1051 C CB  . CYS A 1 129 ? 14.562  -12.383 2.673   1.00 13.96 ? 173 CYS A CB  1 
ATOM   1052 S SG  . CYS A 1 129 ? 13.683  -13.899 2.240   1.00 16.72 ? 173 CYS A SG  1 
ATOM   1053 N N   . PRO A 1 130 ? 17.164  -10.760 1.597   1.00 12.87 ? 174 PRO A N   1 
ATOM   1054 C CA  . PRO A 1 130 ? 17.889  -9.466  1.590   1.00 14.66 ? 174 PRO A CA  1 
ATOM   1055 C C   . PRO A 1 130 ? 17.131  -8.342  2.346   1.00 15.28 ? 174 PRO A C   1 
ATOM   1056 O O   . PRO A 1 130 ? 15.976  -8.079  2.120   1.00 15.52 ? 174 PRO A O   1 
ATOM   1057 C CB  . PRO A 1 130 ? 18.087  -9.150  0.090   1.00 12.39 ? 174 PRO A CB  1 
ATOM   1058 C CG  . PRO A 1 130 ? 18.022  -10.508 -0.660  1.00 11.75 ? 174 PRO A CG  1 
ATOM   1059 C CD  . PRO A 1 130 ? 17.188  -11.400 0.269   1.00 13.38 ? 174 PRO A CD  1 
ATOM   1060 N N   . ASP A 1 131 ? 17.799  -7.647  3.251   1.00 17.40 ? 175 ASP A N   1 
ATOM   1061 C CA  . ASP A 1 131 ? 17.290  -6.341  3.734   1.00 17.12 ? 175 ASP A CA  1 
ATOM   1062 C C   . ASP A 1 131 ? 17.504  -5.173  2.669   1.00 15.48 ? 175 ASP A C   1 
ATOM   1063 O O   . ASP A 1 131 ? 18.602  -5.088  2.058   1.00 16.37 ? 175 ASP A O   1 
ATOM   1064 C CB  . ASP A 1 131 ? 17.985  -6.042  5.072   1.00 19.47 ? 175 ASP A CB  1 
ATOM   1065 C CG  . ASP A 1 131 ? 17.479  -4.784  5.701   1.00 22.14 ? 175 ASP A CG  1 
ATOM   1066 O OD1 . ASP A 1 131 ? 18.232  -3.818  5.756   1.00 22.00 ? 175 ASP A OD1 1 
ATOM   1067 O OD2 . ASP A 1 131 ? 16.312  -4.631  6.072   1.00 27.25 ? 175 ASP A OD2 1 
ATOM   1068 N N   . TRP A 1 132 ? 16.509  -4.323  2.420   1.00 14.41 ? 176 TRP A N   1 
ATOM   1069 C CA  . TRP A 1 132 ? 16.607  -3.259  1.392   1.00 15.36 ? 176 TRP A CA  1 
ATOM   1070 C C   . TRP A 1 132 ? 17.803  -2.385  1.784   1.00 16.47 ? 176 TRP A C   1 
ATOM   1071 O O   . TRP A 1 132 ? 18.465  -1.885  0.902   1.00 13.67 ? 176 TRP A O   1 
ATOM   1072 C CB  . TRP A 1 132 ? 15.375  -2.337  1.324   1.00 16.50 ? 176 TRP A CB  1 
ATOM   1073 C CG  . TRP A 1 132 ? 15.593  -0.864  0.815   1.00 29.36 ? 176 TRP A CG  1 
ATOM   1074 C CD1 . TRP A 1 132 ? 16.230  0.183   1.491   1.00 34.90 ? 176 TRP A CD1 1 
ATOM   1075 C CD2 . TRP A 1 132 ? 15.176  -0.319  -0.436  1.00 36.29 ? 176 TRP A CD2 1 
ATOM   1076 N NE1 . TRP A 1 132 ? 16.239  1.314   0.713   1.00 44.79 ? 176 TRP A NE1 1 
ATOM   1077 C CE2 . TRP A 1 132 ? 15.589  1.046   -0.467  1.00 41.10 ? 176 TRP A CE2 1 
ATOM   1078 C CE3 . TRP A 1 132 ? 14.463  -0.842  -1.538  1.00 37.26 ? 176 TRP A CE3 1 
ATOM   1079 C CZ2 . TRP A 1 132 ? 15.306  1.896   -1.543  1.00 45.01 ? 176 TRP A CZ2 1 
ATOM   1080 C CZ3 . TRP A 1 132 ? 14.175  -0.023  -2.605  1.00 42.29 ? 176 TRP A CZ3 1 
ATOM   1081 C CH2 . TRP A 1 132 ? 14.611  1.336   -2.624  1.00 48.13 ? 176 TRP A CH2 1 
ATOM   1082 N N   . ARG A 1 133 ? 18.037  -2.192  3.092   1.00 16.65 ? 177 ARG A N   1 
ATOM   1083 C CA  . ARG A 1 133 ? 19.206  -1.362  3.501   1.00 20.39 ? 177 ARG A CA  1 
ATOM   1084 C C   . ARG A 1 133 ? 20.576  -2.041  3.536   1.00 21.51 ? 177 ARG A C   1 
ATOM   1085 O O   . ARG A 1 133 ? 21.477  -1.689  2.782   1.00 22.00 ? 177 ARG A O   1 
ATOM   1086 C CB  . ARG A 1 133 ? 18.944  -0.722  4.867   1.00 20.38 ? 177 ARG A CB  1 
ATOM   1087 C CG  . ARG A 1 133 ? 17.888  0.210   4.850   1.00 21.66 ? 177 ARG A CG  1 
ATOM   1088 C CD  . ARG A 1 133 ? 17.789  0.902   6.270   1.00 33.83 ? 177 ARG A CD  1 
ATOM   1089 N NE  . ARG A 1 133 ? 19.064  1.519   6.590   1.00 35.29 ? 177 ARG A NE  1 
ATOM   1090 C CZ  . ARG A 1 133 ? 19.494  1.817   7.831   1.00 43.82 ? 177 ARG A CZ  1 
ATOM   1091 N NH1 . ARG A 1 133 ? 18.762  1.543   8.913   1.00 46.87 ? 177 ARG A NH1 1 
ATOM   1092 N NH2 . ARG A 1 133 ? 20.656  2.413   7.996   1.00 40.91 ? 177 ARG A NH2 1 
ATOM   1093 N N   . LYS A 1 134 ? 20.748  -3.050  4.373   1.00 23.27 ? 178 LYS A N   1 
ATOM   1094 C CA  . LYS A 1 134 ? 22.056  -3.700  4.374   1.00 24.03 ? 178 LYS A CA  1 
ATOM   1095 C C   . LYS A 1 134 ? 22.427  -4.534  3.127   1.00 23.63 ? 178 LYS A C   1 
ATOM   1096 O O   . LYS A 1 134 ? 23.623  -4.644  2.822   1.00 22.96 ? 178 LYS A O   1 
ATOM   1097 C CB  . LYS A 1 134 ? 22.259  -4.482  5.655   1.00 25.62 ? 178 LYS A CB  1 
ATOM   1098 C CG  . LYS A 1 134 ? 21.806  -3.667  6.867   1.00 29.88 ? 178 LYS A CG  1 
ATOM   1099 C CD  . LYS A 1 134 ? 20.516  -4.240  7.444   1.00 35.72 ? 178 LYS A CD  1 
ATOM   1100 C CE  . LYS A 1 134 ? 19.868  -3.294  8.446   1.00 36.36 ? 178 LYS A CE  1 
ATOM   1101 N NZ  . LYS A 1 134 ? 20.312  -3.666  9.832   1.00 39.28 ? 178 LYS A NZ  1 
ATOM   1102 N N   . ASP A 1 135 ? 21.446  -5.061  2.350   1.00 20.65 ? 179 ASP A N   1 
ATOM   1103 C CA  . ASP A 1 135 ? 21.838  -6.033  1.302   1.00 18.85 ? 179 ASP A CA  1 
ATOM   1104 C C   . ASP A 1 135 ? 21.768  -5.482  -0.123  1.00 18.44 ? 179 ASP A C   1 
ATOM   1105 O O   . ASP A 1 135 ? 22.835  -5.229  -0.732  1.00 16.64 ? 179 ASP A O   1 
ATOM   1106 C CB  . ASP A 1 135 ? 21.079  -7.402  1.485   1.00 17.26 ? 179 ASP A CB  1 
ATOM   1107 C CG  . ASP A 1 135 ? 21.297  -8.004  2.882   1.00 18.74 ? 179 ASP A CG  1 
ATOM   1108 O OD1 . ASP A 1 135 ? 22.463  -8.178  3.294   1.00 20.52 ? 179 ASP A OD1 1 
ATOM   1109 O OD2 . ASP A 1 135 ? 20.397  -8.307  3.692   1.00 18.03 ? 179 ASP A OD2 1 
ATOM   1110 N N   . CYS A 1 136 ? 20.527  -5.279  -0.644  1.00 14.91 ? 180 CYS A N   1 
ATOM   1111 C CA  . CYS A 1 136 ? 20.292  -4.707  -1.949  1.00 14.77 ? 180 CYS A CA  1 
ATOM   1112 C C   . CYS A 1 136 ? 18.866  -4.265  -2.021  1.00 12.90 ? 180 CYS A C   1 
ATOM   1113 O O   . CYS A 1 136 ? 17.930  -4.880  -1.410  1.00 13.45 ? 180 CYS A O   1 
ATOM   1114 C CB  . CYS A 1 136 ? 20.464  -5.797  -3.052  1.00 15.11 ? 180 CYS A CB  1 
ATOM   1115 S SG  . CYS A 1 136 ? 19.519  -7.338  -2.622  1.00 24.27 ? 180 CYS A SG  1 
ATOM   1116 N N   . SER A 1 137 ? 18.629  -3.323  -2.894  1.00 10.97 ? 181 SER A N   1 
ATOM   1117 C CA  . SER A 1 137 ? 17.294  -2.868  -3.044  1.00 11.03 ? 181 SER A CA  1 
ATOM   1118 C C   . SER A 1 137 ? 16.588  -3.745  -4.049  1.00 9.07  ? 181 SER A C   1 
ATOM   1119 O O   . SER A 1 137 ? 15.369  -3.748  -4.055  1.00 9.89  ? 181 SER A O   1 
ATOM   1120 C CB  . SER A 1 137 ? 17.319  -1.465  -3.542  1.00 13.93 ? 181 SER A CB  1 
ATOM   1121 O OG  . SER A 1 137 ? 18.211  -1.448  -4.662  1.00 14.85 ? 181 SER A OG  1 
ATOM   1122 N N   . ASN A 1 138 ? 17.293  -4.479  -4.894  1.00 8.13  ? 182 ASN A N   1 
ATOM   1123 C CA  . ASN A 1 138 ? 16.511  -5.192  -6.007  1.00 8.48  ? 182 ASN A CA  1 
ATOM   1124 C C   . ASN A 1 138 ? 16.151  -6.631  -5.577  1.00 7.18  ? 182 ASN A C   1 
ATOM   1125 O O   . ASN A 1 138 ? 16.417  -7.606  -6.343  1.00 9.61  ? 182 ASN A O   1 
ATOM   1126 C CB  . ASN A 1 138 ? 17.295  -5.203  -7.327  1.00 9.72  ? 182 ASN A CB  1 
ATOM   1127 C CG  . ASN A 1 138 ? 17.665  -3.796  -7.862  1.00 16.39 ? 182 ASN A CG  1 
ATOM   1128 O OD1 . ASN A 1 138 ? 16.991  -2.835  -7.620  1.00 23.69 ? 182 ASN A OD1 1 
ATOM   1129 N ND2 . ASN A 1 138 ? 18.767  -3.709  -8.596  1.00 24.28 ? 182 ASN A ND2 1 
ATOM   1130 N N   . ASN A 1 139 ? 15.466  -6.722  -4.435  1.00 6.33  ? 183 ASN A N   1 
ATOM   1131 C CA  . ASN A 1 139 ? 15.124  -7.989  -3.802  1.00 6.38  ? 183 ASN A CA  1 
ATOM   1132 C C   . ASN A 1 139 ? 13.632  -8.255  -4.133  1.00 6.12  ? 183 ASN A C   1 
ATOM   1133 O O   . ASN A 1 139 ? 12.879  -7.301  -4.513  1.00 5.01  ? 183 ASN A O   1 
ATOM   1134 C CB  . ASN A 1 139 ? 15.377  -7.984  -2.265  1.00 7.38  ? 183 ASN A CB  1 
ATOM   1135 C CG  . ASN A 1 139 ? 14.565  -6.908  -1.529  1.00 7.41  ? 183 ASN A CG  1 
ATOM   1136 O OD1 . ASN A 1 139 ? 15.076  -5.793  -1.261  1.00 14.60 ? 183 ASN A OD1 1 
ATOM   1137 N ND2 . ASN A 1 139 ? 13.292  -7.145  -1.345  1.00 9.00  ? 183 ASN A ND2 1 
ATOM   1138 N N   . PRO A 1 140 ? 13.224  -9.505  -3.972  1.00 5.96  ? 184 PRO A N   1 
ATOM   1139 C CA  . PRO A 1 140 ? 11.880  -9.896  -4.388  1.00 7.18  ? 184 PRO A CA  1 
ATOM   1140 C C   . PRO A 1 140 ? 10.769  -9.020  -3.755  1.00 5.72  ? 184 PRO A C   1 
ATOM   1141 O O   . PRO A 1 140 ? 9.812   -8.675  -4.453  1.00 7.01  ? 184 PRO A O   1 
ATOM   1142 C CB  . PRO A 1 140 ? 11.762  -11.410 -4.005  1.00 4.13  ? 184 PRO A CB  1 
ATOM   1143 C CG  . PRO A 1 140 ? 13.304  -11.981 -4.055  1.00 3.34  ? 184 PRO A CG  1 
ATOM   1144 C CD  . PRO A 1 140 ? 14.019  -10.651 -3.439  1.00 5.78  ? 184 PRO A CD  1 
ATOM   1145 N N   . VAL A 1 141 ? 10.863  -8.698  -2.487  1.00 5.46  ? 185 VAL A N   1 
ATOM   1146 C CA  . VAL A 1 141 ? 9.761   -8.029  -1.815  1.00 6.61  ? 185 VAL A CA  1 
ATOM   1147 C C   . VAL A 1 141 ? 9.747   -6.565  -2.289  1.00 6.12  ? 185 VAL A C   1 
ATOM   1148 O O   . VAL A 1 141 ? 8.717   -6.020  -2.642  1.00 7.11  ? 185 VAL A O   1 
ATOM   1149 C CB  . VAL A 1 141 ? 9.937   -8.095  -0.221  1.00 5.59  ? 185 VAL A CB  1 
ATOM   1150 C CG1 . VAL A 1 141 ? 8.826   -7.234  0.409   1.00 8.24  ? 185 VAL A CG1 1 
ATOM   1151 C CG2 . VAL A 1 141 ? 9.634   -9.544  0.292   1.00 7.34  ? 185 VAL A CG2 1 
ATOM   1152 N N   . SER A 1 142 ? 10.910  -5.903  -2.252  1.00 7.32  ? 186 SER A N   1 
ATOM   1153 C CA  . SER A 1 142 ? 10.933  -4.454  -2.534  1.00 7.51  ? 186 SER A CA  1 
ATOM   1154 C C   . SER A 1 142 ? 10.578  -4.232  -3.983  1.00 8.60  ? 186 SER A C   1 
ATOM   1155 O O   . SER A 1 142 ? 9.801   -3.297  -4.299  1.00 6.80  ? 186 SER A O   1 
ATOM   1156 C CB  . SER A 1 142 ? 12.310  -3.785  -2.177  1.00 7.38  ? 186 SER A CB  1 
ATOM   1157 O OG  . SER A 1 142 ? 12.670  -4.096  -0.905  1.00 10.25 ? 186 SER A OG  1 
ATOM   1158 N N   . VAL A 1 143 ? 11.005  -5.158  -4.861  1.00 5.98  ? 187 VAL A N   1 
ATOM   1159 C CA  . VAL A 1 143 ? 10.666  -4.988  -6.280  1.00 6.50  ? 187 VAL A CA  1 
ATOM   1160 C C   . VAL A 1 143 ? 9.199   -5.136  -6.538  1.00 4.54  ? 187 VAL A C   1 
ATOM   1161 O O   . VAL A 1 143 ? 8.632   -4.414  -7.319  1.00 5.25  ? 187 VAL A O   1 
ATOM   1162 C CB  . VAL A 1 143 ? 11.574  -5.886  -7.305  1.00 3.81  ? 187 VAL A CB  1 
ATOM   1163 C CG1 . VAL A 1 143 ? 10.999  -5.928  -8.758  1.00 8.18  ? 187 VAL A CG1 1 
ATOM   1164 C CG2 . VAL A 1 143 ? 13.130  -5.445  -7.255  1.00 4.48  ? 187 VAL A CG2 1 
ATOM   1165 N N   . PHE A 1 144 ? 8.613   -6.074  -5.863  1.00 5.21  ? 188 PHE A N   1 
ATOM   1166 C CA  . PHE A 1 144 ? 7.234   -6.327  -6.047  1.00 5.34  ? 188 PHE A CA  1 
ATOM   1167 C C   . PHE A 1 144 ? 6.436   -5.097  -5.672  1.00 5.72  ? 188 PHE A C   1 
ATOM   1168 O O   . PHE A 1 144 ? 5.543   -4.674  -6.423  1.00 7.09  ? 188 PHE A O   1 
ATOM   1169 C CB  . PHE A 1 144 ? 6.807   -7.525  -5.161  1.00 2.42  ? 188 PHE A CB  1 
ATOM   1170 C CG  . PHE A 1 144 ? 5.301   -7.651  -5.079  1.00 8.07  ? 188 PHE A CG  1 
ATOM   1171 C CD1 . PHE A 1 144 ? 4.595   -8.339  -6.039  1.00 2.96  ? 188 PHE A CD1 1 
ATOM   1172 C CD2 . PHE A 1 144 ? 4.611   -7.056  -4.080  1.00 4.34  ? 188 PHE A CD2 1 
ATOM   1173 C CE1 . PHE A 1 144 ? 3.172   -8.516  -5.943  1.00 4.19  ? 188 PHE A CE1 1 
ATOM   1174 C CE2 . PHE A 1 144 ? 3.222   -7.126  -3.985  1.00 2.32  ? 188 PHE A CE2 1 
ATOM   1175 C CZ  . PHE A 1 144 ? 2.480   -7.930  -4.950  1.00 2.99  ? 188 PHE A CZ  1 
ATOM   1176 N N   . TRP A 1 145 ? 6.678   -4.604  -4.479  1.00 6.47  ? 189 TRP A N   1 
ATOM   1177 C CA  . TRP A 1 145 ? 5.933   -3.417  -4.023  1.00 8.01  ? 189 TRP A CA  1 
ATOM   1178 C C   . TRP A 1 145 ? 6.153   -2.190  -4.874  1.00 5.70  ? 189 TRP A C   1 
ATOM   1179 O O   . TRP A 1 145 ? 5.206   -1.452  -5.104  1.00 6.74  ? 189 TRP A O   1 
ATOM   1180 C CB  . TRP A 1 145 ? 6.237   -3.146  -2.525  1.00 6.96  ? 189 TRP A CB  1 
ATOM   1181 C CG  . TRP A 1 145 ? 5.553   -4.172  -1.626  1.00 8.59  ? 189 TRP A CG  1 
ATOM   1182 C CD1 . TRP A 1 145 ? 6.183   -5.103  -0.786  1.00 6.55  ? 189 TRP A CD1 1 
ATOM   1183 C CD2 . TRP A 1 145 ? 4.157   -4.426  -1.508  1.00 5.40  ? 189 TRP A CD2 1 
ATOM   1184 N NE1 . TRP A 1 145 ? 5.231   -5.893  -0.167  1.00 5.21  ? 189 TRP A NE1 1 
ATOM   1185 C CE2 . TRP A 1 145 ? 3.991   -5.492  -0.568  1.00 4.61  ? 189 TRP A CE2 1 
ATOM   1186 C CE3 . TRP A 1 145 ? 3.018   -3.793  -1.999  1.00 3.88  ? 189 TRP A CE3 1 
ATOM   1187 C CZ2 . TRP A 1 145 ? 2.742   -5.941  -0.149  1.00 9.40  ? 189 TRP A CZ2 1 
ATOM   1188 C CZ3 . TRP A 1 145 ? 1.702   -4.325  -1.628  1.00 6.77  ? 189 TRP A CZ3 1 
ATOM   1189 C CH2 . TRP A 1 145 ? 1.602   -5.363  -0.715  1.00 5.44  ? 189 TRP A CH2 1 
ATOM   1190 N N   . LYS A 1 146 ? 7.380   -1.961  -5.332  1.00 3.29  ? 190 LYS A N   1 
ATOM   1191 C CA  . LYS A 1 146 ? 7.676   -0.803  -6.172  1.00 7.59  ? 190 LYS A CA  1 
ATOM   1192 C C   . LYS A 1 146 ? 6.871   -0.938  -7.452  1.00 8.53  ? 190 LYS A C   1 
ATOM   1193 O O   . LYS A 1 146 ? 6.280   0.051   -7.939  1.00 7.63  ? 190 LYS A O   1 
ATOM   1194 C CB  . LYS A 1 146 ? 9.220   -0.721  -6.472  1.00 8.50  ? 190 LYS A CB  1 
ATOM   1195 C CG  . LYS A 1 146 ? 9.563   0.351   -7.489  1.00 15.07 ? 190 LYS A CG  1 
ATOM   1196 C CD  . LYS A 1 146 ? 11.066  0.348   -7.699  1.00 21.74 ? 190 LYS A CD  1 
ATOM   1197 C CE  . LYS A 1 146 ? 11.461  1.747   -7.478  1.00 32.31 ? 190 LYS A CE  1 
ATOM   1198 N NZ  . LYS A 1 146 ? 11.135  2.519   -8.678  1.00 32.18 ? 190 LYS A NZ  1 
ATOM   1199 N N   . THR A 1 147 ? 6.797   -2.166  -8.003  1.00 9.08  ? 191 THR A N   1 
ATOM   1200 C CA  . THR A 1 147 ? 6.094   -2.309  -9.245  1.00 7.72  ? 191 THR A CA  1 
ATOM   1201 C C   . THR A 1 147 ? 4.627   -2.216  -9.074  1.00 8.54  ? 191 THR A C   1 
ATOM   1202 O O   . THR A 1 147 ? 3.961   -1.608  -9.921  1.00 11.08 ? 191 THR A O   1 
ATOM   1203 C CB  . THR A 1 147 ? 6.359   -3.775  -9.825  1.00 11.87 ? 191 THR A CB  1 
ATOM   1204 O OG1 . THR A 1 147 ? 7.790   -3.960  -9.920  1.00 16.67 ? 191 THR A OG1 1 
ATOM   1205 C CG2 . THR A 1 147 ? 5.983   -3.740  -11.294 1.00 12.04 ? 191 THR A CG2 1 
ATOM   1206 N N   . VAL A 1 148 ? 4.042   -2.890  -8.069  1.00 4.31  ? 192 VAL A N   1 
ATOM   1207 C CA  . VAL A 1 148 ? 2.607   -2.801  -8.034  1.00 6.61  ? 192 VAL A CA  1 
ATOM   1208 C C   . VAL A 1 148 ? 2.147   -1.421  -7.498  1.00 8.59  ? 192 VAL A C   1 
ATOM   1209 O O   . VAL A 1 148 ? 1.055   -0.967  -7.857  1.00 7.35  ? 192 VAL A O   1 
ATOM   1210 C CB  . VAL A 1 148 ? 1.936   -3.940  -7.211  1.00 7.46  ? 192 VAL A CB  1 
ATOM   1211 C CG1 . VAL A 1 148 ? 2.250   -5.295  -7.823  1.00 9.13  ? 192 VAL A CG1 1 
ATOM   1212 C CG2 . VAL A 1 148 ? 2.393   -3.864  -5.744  1.00 12.31 ? 192 VAL A CG2 1 
ATOM   1213 N N   . SER A 1 149 ? 2.962   -0.716  -6.707  1.00 6.16  ? 193 SER A N   1 
ATOM   1214 C CA  . SER A 1 149 ? 2.471   0.576   -6.281  1.00 9.38  ? 193 SER A CA  1 
ATOM   1215 C C   . SER A 1 149 ? 2.557   1.658   -7.475  1.00 10.20 ? 193 SER A C   1 
ATOM   1216 O O   . SER A 1 149 ? 1.732   2.544   -7.582  1.00 8.08  ? 193 SER A O   1 
ATOM   1217 C CB  . SER A 1 149 ? 3.087   0.950   -4.863  1.00 11.17 ? 193 SER A CB  1 
ATOM   1218 O OG  . SER A 1 149 ? 4.318   1.424   -5.196  1.00 23.25 ? 193 SER A OG  1 
ATOM   1219 N N   . ARG A 1 150 ? 3.532   1.530   -8.380  1.00 10.10 ? 194 ARG A N   1 
ATOM   1220 C CA  . ARG A 1 150 ? 3.631   2.421   -9.504  1.00 11.66 ? 194 ARG A CA  1 
ATOM   1221 C C   . ARG A 1 150 ? 2.336   2.242   -10.265 1.00 9.83  ? 194 ARG A C   1 
ATOM   1222 O O   . ARG A 1 150 ? 1.715   3.252   -10.680 1.00 8.28  ? 194 ARG A O   1 
ATOM   1223 C CB  . ARG A 1 150 ? 4.801   2.072   -10.450 1.00 8.72  ? 194 ARG A CB  1 
ATOM   1224 C CG  . ARG A 1 150 ? 5.047   3.175   -11.506 1.00 18.00 ? 194 ARG A CG  1 
ATOM   1225 C CD  . ARG A 1 150 ? 6.179   2.830   -12.487 1.00 24.50 ? 194 ARG A CD  1 
ATOM   1226 N NE  . ARG A 1 150 ? 5.595   1.924   -13.453 1.00 34.63 ? 194 ARG A NE  1 
ATOM   1227 C CZ  . ARG A 1 150 ? 6.107   0.756   -13.729 1.00 41.02 ? 194 ARG A CZ  1 
ATOM   1228 N NH1 . ARG A 1 150 ? 7.239   0.392   -13.113 1.00 38.31 ? 194 ARG A NH1 1 
ATOM   1229 N NH2 . ARG A 1 150 ? 5.505   -0.030  -14.632 1.00 43.80 ? 194 ARG A NH2 1 
ATOM   1230 N N   . ARG A 1 151 ? 1.978   0.984   -10.502 1.00 10.86 ? 195 ARG A N   1 
ATOM   1231 C CA  . ARG A 1 151 ? 0.810   0.674   -11.393 1.00 9.76  ? 195 ARG A CA  1 
ATOM   1232 C C   . ARG A 1 151 ? -0.458  1.137   -10.828 1.00 9.09  ? 195 ARG A C   1 
ATOM   1233 O O   . ARG A 1 151 ? -1.268  1.754   -11.519 1.00 9.81  ? 195 ARG A O   1 
ATOM   1234 C CB  . ARG A 1 151 ? 0.742   -0.818  -11.738 1.00 11.88 ? 195 ARG A CB  1 
ATOM   1235 C CG  . ARG A 1 151 ? 1.992   -0.998  -12.802 1.00 15.57 ? 195 ARG A CG  1 
ATOM   1236 C CD  . ARG A 1 151 ? 2.363   -2.456  -13.136 1.00 28.68 ? 195 ARG A CD  1 
ATOM   1237 N NE  . ARG A 1 151 ? 1.787   -2.890  -14.429 1.00 41.20 ? 195 ARG A NE  1 
ATOM   1238 C CZ  . ARG A 1 151 ? 0.591   -3.447  -14.552 1.00 42.69 ? 195 ARG A CZ  1 
ATOM   1239 N NH1 . ARG A 1 151 ? -0.196  -3.603  -13.485 1.00 46.62 ? 195 ARG A NH1 1 
ATOM   1240 N NH2 . ARG A 1 151 ? 0.172   -3.858  -15.720 1.00 43.26 ? 195 ARG A NH2 1 
ATOM   1241 N N   . PHE A 1 152 ? -0.594  0.979   -9.519  1.00 7.96  ? 196 PHE A N   1 
ATOM   1242 C CA  . PHE A 1 152 ? -1.799  1.436   -8.835  1.00 6.70  ? 196 PHE A CA  1 
ATOM   1243 C C   . PHE A 1 152 ? -1.903  3.007   -8.865  1.00 5.86  ? 196 PHE A C   1 
ATOM   1244 O O   . PHE A 1 152 ? -2.997  3.597   -9.100  1.00 6.20  ? 196 PHE A O   1 
ATOM   1245 C CB  . PHE A 1 152 ? -1.723  0.891   -7.388  1.00 7.07  ? 196 PHE A CB  1 
ATOM   1246 C CG  . PHE A 1 152 ? -2.976  1.067   -6.599  1.00 5.75  ? 196 PHE A CG  1 
ATOM   1247 C CD1 . PHE A 1 152 ? -4.095  0.378   -6.963  1.00 4.51  ? 196 PHE A CD1 1 
ATOM   1248 C CD2 . PHE A 1 152 ? -3.050  1.964   -5.423  1.00 4.86  ? 196 PHE A CD2 1 
ATOM   1249 C CE1 . PHE A 1 152 ? -5.280  0.447   -6.182  1.00 7.02  ? 196 PHE A CE1 1 
ATOM   1250 C CE2 . PHE A 1 152 ? -4.256  2.052   -4.646  1.00 10.32 ? 196 PHE A CE2 1 
ATOM   1251 C CZ  . PHE A 1 152 ? -5.388  1.272   -5.101  1.00 10.80 ? 196 PHE A CZ  1 
ATOM   1252 N N   . ALA A 1 153 ? -0.818  3.711   -8.552  1.00 4.21  ? 197 ALA A N   1 
ATOM   1253 C CA  . ALA A 1 153 ? -0.910  5.172   -8.713  1.00 6.57  ? 197 ALA A CA  1 
ATOM   1254 C C   . ALA A 1 153 ? -1.178  5.620   -10.140 1.00 6.12  ? 197 ALA A C   1 
ATOM   1255 O O   . ALA A 1 153 ? -1.925  6.557   -10.375 1.00 6.62  ? 197 ALA A O   1 
ATOM   1256 C CB  . ALA A 1 153 ? 0.421   5.799   -8.284  1.00 6.95  ? 197 ALA A CB  1 
ATOM   1257 N N   . GLU A 1 154 ? -0.584  4.934   -11.093 1.00 5.92  ? 198 GLU A N   1 
ATOM   1258 C CA  . GLU A 1 154 ? -0.821  5.282   -12.505 1.00 8.18  ? 198 GLU A CA  1 
ATOM   1259 C C   . GLU A 1 154 ? -2.266  5.160   -12.918 1.00 8.75  ? 198 GLU A C   1 
ATOM   1260 O O   . GLU A 1 154 ? -2.677  5.846   -13.867 1.00 9.50  ? 198 GLU A O   1 
ATOM   1261 C CB  . GLU A 1 154 ? 0.067   4.490   -13.473 1.00 10.02 ? 198 GLU A CB  1 
ATOM   1262 C CG  . GLU A 1 154 ? 1.485   5.016   -13.530 1.00 17.23 ? 198 GLU A CG  1 
ATOM   1263 C CD  . GLU A 1 154 ? 2.398   4.029   -14.327 1.00 33.16 ? 198 GLU A CD  1 
ATOM   1264 O OE1 . GLU A 1 154 ? 1.975   2.839   -14.566 1.00 35.31 ? 198 GLU A OE1 1 
ATOM   1265 O OE2 . GLU A 1 154 ? 3.523   4.449   -14.713 1.00 35.88 ? 198 GLU A OE2 1 
ATOM   1266 N N   . ALA A 1 155 ? -2.989  4.259   -12.241 1.00 7.02  ? 199 ALA A N   1 
ATOM   1267 C CA  . ALA A 1 155 ? -4.411  3.999   -12.560 1.00 7.77  ? 199 ALA A CA  1 
ATOM   1268 C C   . ALA A 1 155 ? -5.326  5.071   -11.941 1.00 8.05  ? 199 ALA A C   1 
ATOM   1269 O O   . ALA A 1 155 ? -6.485  5.249   -12.359 1.00 10.66 ? 199 ALA A O   1 
ATOM   1270 C CB  . ALA A 1 155 ? -4.819  2.501   -12.139 1.00 9.01  ? 199 ALA A CB  1 
ATOM   1271 N N   . ALA A 1 156 ? -4.831  5.845   -10.972 1.00 6.80  ? 200 ALA A N   1 
ATOM   1272 C CA  . ALA A 1 156 ? -5.760  6.722   -10.249 1.00 7.73  ? 200 ALA A CA  1 
ATOM   1273 C C   . ALA A 1 156 ? -6.231  7.926   -11.073 1.00 7.80  ? 200 ALA A C   1 
ATOM   1274 O O   . ALA A 1 156 ? -5.525  8.371   -11.942 1.00 10.55 ? 200 ALA A O   1 
ATOM   1275 C CB  . ALA A 1 156 ? -5.026  7.193   -8.877  1.00 6.10  ? 200 ALA A CB  1 
ATOM   1276 N N   . CYS A 1 157 ? -7.423  8.468   -10.774 1.00 7.04  ? 201 CYS A N   1 
ATOM   1277 C CA  . CYS A 1 157 ? -7.982  9.623   -11.404 1.00 8.01  ? 201 CYS A CA  1 
ATOM   1278 C C   . CYS A 1 157 ? -8.857  10.433  -10.485 1.00 7.65  ? 201 CYS A C   1 
ATOM   1279 O O   . CYS A 1 157 ? -9.106  10.025  -9.306  1.00 8.37  ? 201 CYS A O   1 
ATOM   1280 C CB  . CYS A 1 157 ? -8.860  9.183   -12.638 1.00 9.81  ? 201 CYS A CB  1 
ATOM   1281 S SG  . CYS A 1 157 ? -10.429 8.460   -12.158 1.00 20.57 ? 201 CYS A SG  1 
ATOM   1282 N N   . ASP A 1 158 ? -9.237  11.590  -11.002 1.00 6.31  ? 202 ASP A N   1 
ATOM   1283 C CA  . ASP A 1 158 ? -10.144 12.526  -10.337 1.00 7.50  ? 202 ASP A CA  1 
ATOM   1284 C C   . ASP A 1 158 ? -9.520  13.028  -9.035  1.00 6.96  ? 202 ASP A C   1 
ATOM   1285 O O   . ASP A 1 158 ? -8.400  13.538  -9.050  1.00 9.40  ? 202 ASP A O   1 
ATOM   1286 C CB  . ASP A 1 158 ? -11.589 11.900  -10.205 1.00 7.50  ? 202 ASP A CB  1 
ATOM   1287 C CG  . ASP A 1 158 ? -12.198 11.524  -11.566 1.00 14.84 ? 202 ASP A CG  1 
ATOM   1288 O OD1 . ASP A 1 158 ? -11.776 12.116  -12.644 1.00 14.85 ? 202 ASP A OD1 1 
ATOM   1289 O OD2 . ASP A 1 158 ? -13.139 10.667  -11.649 1.00 16.70 ? 202 ASP A OD2 1 
ATOM   1290 N N   . VAL A 1 159 ? -10.177 12.831  -7.877  1.00 6.76  ? 203 VAL A N   1 
ATOM   1291 C CA  . VAL A 1 159 ? -9.638  13.217  -6.615  1.00 6.14  ? 203 VAL A CA  1 
ATOM   1292 C C   . VAL A 1 159 ? -8.986  11.986  -5.936  1.00 8.62  ? 203 VAL A C   1 
ATOM   1293 O O   . VAL A 1 159 ? -9.614  10.992  -5.836  1.00 6.29  ? 203 VAL A O   1 
ATOM   1294 C CB  . VAL A 1 159 ? -10.728 13.807  -5.707  1.00 7.39  ? 203 VAL A CB  1 
ATOM   1295 C CG1 . VAL A 1 159 ? -10.142 14.170  -4.351  1.00 8.64  ? 203 VAL A CG1 1 
ATOM   1296 C CG2 . VAL A 1 159 ? -11.276 15.227  -6.324  1.00 10.42 ? 203 VAL A CG2 1 
ATOM   1297 N N   . VAL A 1 160 ? -7.738  12.090  -5.496  1.00 6.49  ? 204 VAL A N   1 
ATOM   1298 C CA  . VAL A 1 160 ? -6.997  10.902  -4.952  1.00 5.55  ? 204 VAL A CA  1 
ATOM   1299 C C   . VAL A 1 160 ? -6.719  11.292  -3.548  1.00 7.46  ? 204 VAL A C   1 
ATOM   1300 O O   . VAL A 1 160 ? -6.388  12.474  -3.335  1.00 6.35  ? 204 VAL A O   1 
ATOM   1301 C CB  . VAL A 1 160 ? -5.626  10.831  -5.596  1.00 4.90  ? 204 VAL A CB  1 
ATOM   1302 C CG1 . VAL A 1 160 ? -4.845  9.690   -4.936  1.00 5.42  ? 204 VAL A CG1 1 
ATOM   1303 C CG2 . VAL A 1 160 ? -5.901  10.427  -7.122  1.00 8.47  ? 204 VAL A CG2 1 
ATOM   1304 N N   . HIS A 1 161 ? -7.038  10.430  -2.607  1.00 6.43  ? 205 HIS A N   1 
ATOM   1305 C CA  . HIS A 1 161 ? -6.803  10.770  -1.186  1.00 5.97  ? 205 HIS A CA  1 
ATOM   1306 C C   . HIS A 1 161 ? -5.552  10.106  -0.741  1.00 7.31  ? 205 HIS A C   1 
ATOM   1307 O O   . HIS A 1 161 ? -5.190  8.981   -1.216  1.00 6.61  ? 205 HIS A O   1 
ATOM   1308 C CB  . HIS A 1 161 ? -8.002  10.382  -0.294  1.00 8.38  ? 205 HIS A CB  1 
ATOM   1309 C CG  . HIS A 1 161 ? -9.254  11.174  -0.615  1.00 11.25 ? 205 HIS A CG  1 
ATOM   1310 N ND1 . HIS A 1 161 ? -10.095 10.864  -1.687  1.00 10.17 ? 205 HIS A ND1 1 
ATOM   1311 C CD2 . HIS A 1 161 ? -9.768  12.287  -0.029  1.00 10.10 ? 205 HIS A CD2 1 
ATOM   1312 C CE1 . HIS A 1 161 ? -11.069 11.772  -1.737  1.00 12.03 ? 205 HIS A CE1 1 
ATOM   1313 N NE2 . HIS A 1 161 ? -10.895 12.634  -0.728  1.00 7.98  ? 205 HIS A NE2 1 
ATOM   1314 N N   . VAL A 1 162 ? -4.876  10.740  0.230   1.00 5.94  ? 206 VAL A N   1 
ATOM   1315 C CA  . VAL A 1 162 ? -3.739  10.097  0.860   1.00 6.80  ? 206 VAL A CA  1 
ATOM   1316 C C   . VAL A 1 162 ? -3.808  10.264  2.377   1.00 8.16  ? 206 VAL A C   1 
ATOM   1317 O O   . VAL A 1 162 ? -4.005  11.364  2.865   1.00 8.86  ? 206 VAL A O   1 
ATOM   1318 C CB  . VAL A 1 162 ? -2.289  10.608  0.319   1.00 4.64  ? 206 VAL A CB  1 
ATOM   1319 C CG1 . VAL A 1 162 ? -2.111  12.088  0.452   1.00 7.23  ? 206 VAL A CG1 1 
ATOM   1320 C CG2 . VAL A 1 162 ? -1.147  9.715   0.877   1.00 4.54  ? 206 VAL A CG2 1 
ATOM   1321 N N   . MET A 1 163 ? -3.658  9.173   3.120   1.00 8.56  ? 207 MET A N   1 
ATOM   1322 C CA  . MET A 1 163 ? -3.613  9.300   4.594   1.00 11.00 ? 207 MET A CA  1 
ATOM   1323 C C   . MET A 1 163 ? -2.153  9.298   5.055   1.00 11.64 ? 207 MET A C   1 
ATOM   1324 O O   . MET A 1 163 ? -1.407  8.397   4.652   1.00 11.28 ? 207 MET A O   1 
ATOM   1325 C CB  . MET A 1 163 ? -4.285  8.063   5.238   1.00 12.30 ? 207 MET A CB  1 
ATOM   1326 C CG  . MET A 1 163 ? -5.331  8.384   6.229   1.00 18.72 ? 207 MET A CG  1 
ATOM   1327 S SD  . MET A 1 163 ? -5.885  6.822   6.953   1.00 19.85 ? 207 MET A SD  1 
ATOM   1328 C CE  . MET A 1 163 ? -7.557  6.909   6.363   1.00 13.71 ? 207 MET A CE  1 
ATOM   1329 N N   . LEU A 1 164 ? -1.743  10.338  5.822   1.00 11.61 ? 208 LEU A N   1 
ATOM   1330 C CA  . LEU A 1 164 ? -0.368  10.438  6.404   1.00 11.68 ? 208 LEU A CA  1 
ATOM   1331 C C   . LEU A 1 164 ? -0.356  10.430  7.915   1.00 11.96 ? 208 LEU A C   1 
ATOM   1332 O O   . LEU A 1 164 ? -1.210  11.027  8.584   1.00 12.10 ? 208 LEU A O   1 
ATOM   1333 C CB  . LEU A 1 164 ? 0.334   11.747  5.939   1.00 10.10 ? 208 LEU A CB  1 
ATOM   1334 C CG  . LEU A 1 164 ? 0.211   11.947  4.430   1.00 10.44 ? 208 LEU A CG  1 
ATOM   1335 C CD1 . LEU A 1 164 ? 0.662   13.387  4.132   1.00 10.66 ? 208 LEU A CD1 1 
ATOM   1336 C CD2 . LEU A 1 164 ? 1.151   11.003  3.749   1.00 11.98 ? 208 LEU A CD2 1 
ATOM   1337 N N   . ASP A 1 165 ? 0.689   9.800   8.445   1.00 13.19 ? 209 ASP A N   1 
ATOM   1338 C CA  . ASP A 1 165 ? 0.949   9.745   9.875   1.00 16.22 ? 209 ASP A CA  1 
ATOM   1339 C C   . ASP A 1 165 ? 1.565   11.104  10.374  1.00 16.27 ? 209 ASP A C   1 
ATOM   1340 O O   . ASP A 1 165 ? 2.745   11.388  10.152  1.00 17.20 ? 209 ASP A O   1 
ATOM   1341 C CB  . ASP A 1 165 ? 1.922   8.593   10.111  1.00 15.36 ? 209 ASP A CB  1 
ATOM   1342 C CG  . ASP A 1 165 ? 2.304   8.374   11.570  1.00 19.17 ? 209 ASP A CG  1 
ATOM   1343 O OD1 . ASP A 1 165 ? 1.837   9.088   12.485  1.00 19.90 ? 209 ASP A OD1 1 
ATOM   1344 O OD2 . ASP A 1 165 ? 3.122   7.447   11.841  1.00 20.25 ? 209 ASP A OD2 1 
ATOM   1345 N N   . GLY A 1 166 ? 0.746   11.900  10.991  1.00 15.52 ? 210 GLY A N   1 
ATOM   1346 C CA  . GLY A 1 166 ? 1.149   13.205  11.497  1.00 20.36 ? 210 GLY A CA  1 
ATOM   1347 C C   . GLY A 1 166 ? 2.051   13.162  12.757  1.00 23.04 ? 210 GLY A C   1 
ATOM   1348 O O   . GLY A 1 166 ? 2.511   14.178  13.202  1.00 23.36 ? 210 GLY A O   1 
ATOM   1349 N N   . SER A 1 167 ? 2.313   11.972  13.277  1.00 26.13 ? 211 SER A N   1 
ATOM   1350 C CA  . SER A 1 167 ? 3.266   11.728  14.355  1.00 29.49 ? 211 SER A CA  1 
ATOM   1351 C C   . SER A 1 167 ? 4.708   11.678  13.881  1.00 31.72 ? 211 SER A C   1 
ATOM   1352 O O   . SER A 1 167 ? 5.607   11.720  14.721  1.00 33.10 ? 211 SER A O   1 
ATOM   1353 C CB  . SER A 1 167 ? 2.964   10.355  15.001  1.00 29.47 ? 211 SER A CB  1 
ATOM   1354 O OG  . SER A 1 167 ? 1.676   10.326  15.585  1.00 30.07 ? 211 SER A OG  1 
ATOM   1355 N N   . ARG A 1 168 ? 4.937   11.580  12.561  1.00 33.96 ? 212 ARG A N   1 
ATOM   1356 C CA  . ARG A 1 168 ? 6.237   11.102  11.994  1.00 35.96 ? 212 ARG A CA  1 
ATOM   1357 C C   . ARG A 1 168 ? 7.457   12.020  11.924  1.00 36.19 ? 212 ARG A C   1 
ATOM   1358 O O   . ARG A 1 168 ? 8.560   11.536  11.638  1.00 37.71 ? 212 ARG A O   1 
ATOM   1359 C CB  . ARG A 1 168 ? 6.063   10.444  10.607  1.00 35.84 ? 212 ARG A CB  1 
ATOM   1360 C CG  . ARG A 1 168 ? 5.867   8.917   10.639  1.00 40.07 ? 212 ARG A CG  1 
ATOM   1361 C CD  . ARG A 1 168 ? 6.536   8.233   11.809  1.00 44.10 ? 212 ARG A CD  1 
ATOM   1362 N NE  . ARG A 1 168 ? 6.390   6.778   11.772  1.00 52.71 ? 212 ARG A NE  1 
ATOM   1363 C CZ  . ARG A 1 168 ? 7.120   5.965   11.013  1.00 54.17 ? 212 ARG A CZ  1 
ATOM   1364 N NH1 . ARG A 1 168 ? 8.059   6.460   10.206  1.00 55.17 ? 212 ARG A NH1 1 
ATOM   1365 N NH2 . ARG A 1 168 ? 6.912   4.653   11.065  1.00 54.82 ? 212 ARG A NH2 1 
ATOM   1366 N N   . SER A 1 169 ? 7.320   13.315  12.132  1.00 35.90 ? 213 SER A N   1 
ATOM   1367 C CA  . SER A 1 169 ? 8.531   14.186  12.064  1.00 35.08 ? 213 SER A CA  1 
ATOM   1368 C C   . SER A 1 169 ? 8.876   14.529  10.609  1.00 33.14 ? 213 SER A C   1 
ATOM   1369 O O   . SER A 1 169 ? 9.117   15.708  10.293  1.00 35.19 ? 213 SER A O   1 
ATOM   1370 C CB  . SER A 1 169 ? 9.751   13.664  12.871  1.00 36.40 ? 213 SER A CB  1 
ATOM   1371 O OG  . SER A 1 169 ? 10.751  12.977  12.104  1.00 37.12 ? 213 SER A OG  1 
ATOM   1372 N N   . LYS A 1 170 ? 8.793   13.535  9.725   1.00 29.89 ? 214 LYS A N   1 
ATOM   1373 C CA  . LYS A 1 170 ? 8.521   13.810  8.311   1.00 26.29 ? 214 LYS A CA  1 
ATOM   1374 C C   . LYS A 1 170 ? 7.147   13.252  7.926   1.00 24.24 ? 214 LYS A C   1 
ATOM   1375 O O   . LYS A 1 170 ? 7.006   12.070  7.550   1.00 22.03 ? 214 LYS A O   1 
ATOM   1376 C CB  . LYS A 1 170 ? 9.623   13.289  7.375   1.00 27.28 ? 214 LYS A CB  1 
ATOM   1377 C CG  . LYS A 1 170 ? 11.027  13.767  7.800   1.00 28.59 ? 214 LYS A CG  1 
ATOM   1378 C CD  . LYS A 1 170 ? 11.898  14.065  6.579   1.00 36.46 ? 214 LYS A CD  1 
ATOM   1379 C CE  . LYS A 1 170 ? 13.383  13.574  6.769   1.00 39.34 ? 214 LYS A CE  1 
ATOM   1380 N NZ  . LYS A 1 170 ? 14.122  13.320  5.457   1.00 39.38 ? 214 LYS A NZ  1 
ATOM   1381 N N   . ILE A 1 171 ? 6.132   14.105  8.007   1.00 21.10 ? 215 ILE A N   1 
ATOM   1382 C CA  . ILE A 1 171 ? 4.770   13.668  7.747   1.00 19.60 ? 215 ILE A CA  1 
ATOM   1383 C C   . ILE A 1 171 ? 4.699   13.305  6.260   1.00 18.15 ? 215 ILE A C   1 
ATOM   1384 O O   . ILE A 1 171 ? 4.182   12.269  5.976   1.00 19.84 ? 215 ILE A O   1 
ATOM   1385 C CB  . ILE A 1 171 ? 3.765   14.762  8.101   1.00 19.37 ? 215 ILE A CB  1 
ATOM   1386 C CG1 . ILE A 1 171 ? 3.944   15.130  9.578   1.00 20.48 ? 215 ILE A CG1 1 
ATOM   1387 C CG2 . ILE A 1 171 ? 2.353   14.340  7.771   1.00 15.37 ? 215 ILE A CG2 1 
ATOM   1388 C CD1 . ILE A 1 171 ? 3.117   16.346  9.985   1.00 17.00 ? 215 ILE A CD1 1 
ATOM   1389 N N   . PHE A 1 172 ? 5.214   14.160  5.364   1.00 16.43 ? 216 PHE A N   1 
ATOM   1390 C CA  . PHE A 1 172 ? 5.514   13.760  3.988   1.00 17.98 ? 216 PHE A CA  1 
ATOM   1391 C C   . PHE A 1 172 ? 7.013   13.475  3.972   1.00 19.09 ? 216 PHE A C   1 
ATOM   1392 O O   . PHE A 1 172 ? 7.831   14.370  4.282   1.00 18.16 ? 216 PHE A O   1 
ATOM   1393 C CB  . PHE A 1 172 ? 5.214   14.844  2.947   1.00 15.52 ? 216 PHE A CB  1 
ATOM   1394 C CG  . PHE A 1 172 ? 5.731   14.505  1.545   1.00 15.82 ? 216 PHE A CG  1 
ATOM   1395 C CD1 . PHE A 1 172 ? 5.278   13.350  0.878   1.00 18.10 ? 216 PHE A CD1 1 
ATOM   1396 C CD2 . PHE A 1 172 ? 6.648   15.336  0.886   1.00 11.60 ? 216 PHE A CD2 1 
ATOM   1397 C CE1 . PHE A 1 172 ? 5.741   13.056  -0.445  1.00 14.17 ? 216 PHE A CE1 1 
ATOM   1398 C CE2 . PHE A 1 172 ? 7.108   15.088  -0.430  1.00 17.28 ? 216 PHE A CE2 1 
ATOM   1399 C CZ  . PHE A 1 172 ? 6.653   13.891  -1.109  1.00 8.14  ? 216 PHE A CZ  1 
ATOM   1400 N N   . ASP A 1 173 ? 7.322   12.262  3.523   1.00 18.16 ? 217 ASP A N   1 
ATOM   1401 C CA  . ASP A 1 173 ? 8.669   11.776  3.525   1.00 19.31 ? 217 ASP A CA  1 
ATOM   1402 C C   . ASP A 1 173 ? 9.036   11.315  2.161   1.00 18.47 ? 217 ASP A C   1 
ATOM   1403 O O   . ASP A 1 173 ? 8.491   10.298  1.672   1.00 14.21 ? 217 ASP A O   1 
ATOM   1404 C CB  . ASP A 1 173 ? 8.803   10.583  4.458   1.00 20.21 ? 217 ASP A CB  1 
ATOM   1405 C CG  . ASP A 1 173 ? 10.268  10.056  4.529   1.00 26.40 ? 217 ASP A CG  1 
ATOM   1406 O OD1 . ASP A 1 173 ? 11.130  10.479  3.672   1.00 21.36 ? 217 ASP A OD1 1 
ATOM   1407 O OD2 . ASP A 1 173 ? 10.628  9.230   5.423   1.00 30.37 ? 217 ASP A OD2 1 
ATOM   1408 N N   . LYS A 1 174 ? 10.022  12.001  1.596   1.00 16.30 ? 218 LYS A N   1 
ATOM   1409 C CA  . LYS A 1 174 ? 10.426  11.756  0.221   1.00 18.98 ? 218 LYS A CA  1 
ATOM   1410 C C   . LYS A 1 174 ? 10.985  10.349  -0.025  1.00 17.57 ? 218 LYS A C   1 
ATOM   1411 O O   . LYS A 1 174 ? 10.956  9.890   -1.151  1.00 19.31 ? 218 LYS A O   1 
ATOM   1412 C CB  . LYS A 1 174 ? 11.451  12.790  -0.261  1.00 19.25 ? 218 LYS A CB  1 
ATOM   1413 C CG  . LYS A 1 174 ? 12.837  12.446  0.243   1.00 24.78 ? 218 LYS A CG  1 
ATOM   1414 C CD  . LYS A 1 174 ? 13.862  13.601  0.296   1.00 32.78 ? 218 LYS A CD  1 
ATOM   1415 C CE  . LYS A 1 174 ? 15.313  13.039  0.437   1.00 33.80 ? 218 LYS A CE  1 
ATOM   1416 N NZ  . LYS A 1 174 ? 15.647  11.925  -0.532  1.00 35.61 ? 218 LYS A NZ  1 
ATOM   1417 N N   . ASP A 1 175 ? 11.469  9.699   1.025   1.00 17.82 ? 219 ASP A N   1 
ATOM   1418 C CA  . ASP A 1 175 ? 12.040  8.358   1.013   1.00 19.07 ? 219 ASP A CA  1 
ATOM   1419 C C   . ASP A 1 175 ? 11.032  7.238   1.139   1.00 17.22 ? 219 ASP A C   1 
ATOM   1420 O O   . ASP A 1 175 ? 11.395  6.105   0.929   1.00 18.96 ? 219 ASP A O   1 
ATOM   1421 C CB  . ASP A 1 175 ? 13.093  8.247   2.115   1.00 20.85 ? 219 ASP A CB  1 
ATOM   1422 C CG  . ASP A 1 175 ? 14.360  9.042   1.742   1.00 26.12 ? 219 ASP A CG  1 
ATOM   1423 O OD1 . ASP A 1 175 ? 14.560  9.253   0.534   1.00 26.42 ? 219 ASP A OD1 1 
ATOM   1424 O OD2 . ASP A 1 175 ? 15.176  9.559   2.531   1.00 29.33 ? 219 ASP A OD2 1 
ATOM   1425 N N   . SER A 1 176 ? 9.771   7.533   1.438   1.00 15.32 ? 220 SER A N   1 
ATOM   1426 C CA  . SER A 1 176 ? 8.761   6.473   1.614   1.00 14.33 ? 220 SER A CA  1 
ATOM   1427 C C   . SER A 1 176 ? 8.337   6.006   0.242   1.00 13.33 ? 220 SER A C   1 
ATOM   1428 O O   . SER A 1 176 ? 8.629   6.658   -0.782  1.00 9.80  ? 220 SER A O   1 
ATOM   1429 C CB  . SER A 1 176 ? 7.536   6.964   2.422   1.00 15.19 ? 220 SER A CB  1 
ATOM   1430 O OG  . SER A 1 176 ? 6.838   8.012   1.697   1.00 12.46 ? 220 SER A OG  1 
ATOM   1431 N N   . THR A 1 177 ? 7.593   4.907   0.183   1.00 13.62 ? 221 THR A N   1 
ATOM   1432 C CA  . THR A 1 177 ? 7.060   4.528   -1.115  1.00 12.68 ? 221 THR A CA  1 
ATOM   1433 C C   . THR A 1 177 ? 6.092   5.630   -1.642  1.00 13.78 ? 221 THR A C   1 
ATOM   1434 O O   . THR A 1 177 ? 6.137   6.006   -2.789  1.00 12.53 ? 221 THR A O   1 
ATOM   1435 C CB  . THR A 1 177 ? 6.302   3.216   -0.976  1.00 15.09 ? 221 THR A CB  1 
ATOM   1436 O OG1 . THR A 1 177 ? 7.259   2.177   -0.725  1.00 13.79 ? 221 THR A OG1 1 
ATOM   1437 C CG2 . THR A 1 177 ? 5.636   2.864   -2.311  1.00 12.10 ? 221 THR A CG2 1 
ATOM   1438 N N   . PHE A 1 178 ? 5.280   6.209   -0.784  1.00 12.74 ? 222 PHE A N   1 
ATOM   1439 C CA  . PHE A 1 178 ? 4.517   7.305   -1.298  1.00 13.77 ? 222 PHE A CA  1 
ATOM   1440 C C   . PHE A 1 178 ? 5.359   8.476   -1.912  1.00 11.82 ? 222 PHE A C   1 
ATOM   1441 O O   . PHE A 1 178 ? 5.009   8.979   -3.001  1.00 10.97 ? 222 PHE A O   1 
ATOM   1442 C CB  . PHE A 1 178 ? 3.652   7.879   -0.148  1.00 11.24 ? 222 PHE A CB  1 
ATOM   1443 C CG  . PHE A 1 178 ? 2.808   9.011   -0.596  1.00 13.29 ? 222 PHE A CG  1 
ATOM   1444 C CD1 . PHE A 1 178 ? 1.824   8.784   -1.534  1.00 13.19 ? 222 PHE A CD1 1 
ATOM   1445 C CD2 . PHE A 1 178 ? 3.005   10.342  -0.065  1.00 10.11 ? 222 PHE A CD2 1 
ATOM   1446 C CE1 . PHE A 1 178 ? 1.044   9.850   -2.020  1.00 16.38 ? 222 PHE A CE1 1 
ATOM   1447 C CE2 . PHE A 1 178 ? 2.241   11.425  -0.532  1.00 12.94 ? 222 PHE A CE2 1 
ATOM   1448 C CZ  . PHE A 1 178 ? 1.246   11.192  -1.519  1.00 12.63 ? 222 PHE A CZ  1 
ATOM   1449 N N   . GLY A 1 179 ? 6.339   8.991   -1.161  1.00 10.69 ? 223 GLY A N   1 
ATOM   1450 C CA  . GLY A 1 179 ? 7.119   10.085  -1.661  1.00 11.50 ? 223 GLY A CA  1 
ATOM   1451 C C   . GLY A 1 179 ? 8.077   9.809   -2.789  1.00 13.61 ? 223 GLY A C   1 
ATOM   1452 O O   . GLY A 1 179 ? 8.434   10.740  -3.494  1.00 13.53 ? 223 GLY A O   1 
ATOM   1453 N N   . SER A 1 180 ? 8.486   8.536   -2.985  1.00 12.16 ? 224 SER A N   1 
ATOM   1454 C CA  . SER A 1 180 ? 9.485   8.179   -4.012  1.00 15.07 ? 224 SER A CA  1 
ATOM   1455 C C   . SER A 1 180 ? 8.836   7.522   -5.223  1.00 13.74 ? 224 SER A C   1 
ATOM   1456 O O   . SER A 1 180 ? 9.376   7.611   -6.335  1.00 16.11 ? 224 SER A O   1 
ATOM   1457 C CB  . SER A 1 180 ? 10.663  7.289   -3.444  1.00 16.56 ? 224 SER A CB  1 
ATOM   1458 O OG  . SER A 1 180 ? 10.192  5.984   -3.184  1.00 20.77 ? 224 SER A OG  1 
ATOM   1459 N N   . VAL A 1 181 ? 7.686   6.858   -5.057  1.00 11.00 ? 225 VAL A N   1 
ATOM   1460 C CA  . VAL A 1 181 ? 7.030   6.303   -6.209  1.00 11.84 ? 225 VAL A CA  1 
ATOM   1461 C C   . VAL A 1 181 ? 5.649   6.847   -6.555  1.00 11.14 ? 225 VAL A C   1 
ATOM   1462 O O   . VAL A 1 181 ? 5.407   7.304   -7.660  1.00 12.61 ? 225 VAL A O   1 
ATOM   1463 C CB  . VAL A 1 181 ? 7.117   4.709   -6.306  1.00 13.90 ? 225 VAL A CB  1 
ATOM   1464 C CG1 . VAL A 1 181 ? 7.801   4.062   -5.205  1.00 21.27 ? 225 VAL A CG1 1 
ATOM   1465 C CG2 . VAL A 1 181 ? 5.838   3.975   -6.890  1.00 15.87 ? 225 VAL A CG2 1 
ATOM   1466 N N   . GLU A 1 182 ? 4.695   6.737   -5.635  1.00 9.33  ? 226 GLU A N   1 
ATOM   1467 C CA  . GLU A 1 182 ? 3.333   6.992   -5.965  1.00 7.81  ? 226 GLU A CA  1 
ATOM   1468 C C   . GLU A 1 182 ? 3.149   8.441   -6.365  1.00 9.51  ? 226 GLU A C   1 
ATOM   1469 O O   . GLU A 1 182 ? 2.489   8.775   -7.343  1.00 9.86  ? 226 GLU A O   1 
ATOM   1470 C CB  . GLU A 1 182 ? 2.449   6.712   -4.709  1.00 7.91  ? 226 GLU A CB  1 
ATOM   1471 C CG  . GLU A 1 182 ? 2.540   5.242   -4.418  1.00 12.77 ? 226 GLU A CG  1 
ATOM   1472 C CD  . GLU A 1 182 ? 1.783   4.794   -3.169  1.00 27.43 ? 226 GLU A CD  1 
ATOM   1473 O OE1 . GLU A 1 182 ? 1.548   5.623   -2.292  1.00 30.39 ? 226 GLU A OE1 1 
ATOM   1474 O OE2 . GLU A 1 182 ? 1.433   3.594   -3.035  1.00 32.70 ? 226 GLU A OE2 1 
ATOM   1475 N N   . VAL A 1 183 ? 3.836   9.341   -5.712  1.00 9.65  ? 227 VAL A N   1 
ATOM   1476 C CA  . VAL A 1 183 ? 3.494   10.702  -5.988  1.00 11.09 ? 227 VAL A CA  1 
ATOM   1477 C C   . VAL A 1 183 ? 3.976   11.136  -7.378  1.00 11.46 ? 227 VAL A C   1 
ATOM   1478 O O   . VAL A 1 183 ? 3.451   12.122  -7.972  1.00 15.10 ? 227 VAL A O   1 
ATOM   1479 C CB  . VAL A 1 183 ? 3.992   11.536  -4.836  1.00 13.88 ? 227 VAL A CB  1 
ATOM   1480 C CG1 . VAL A 1 183 ? 5.459   11.899  -5.045  1.00 11.80 ? 227 VAL A CG1 1 
ATOM   1481 C CG2 . VAL A 1 183 ? 3.201   12.813  -4.746  1.00 20.35 ? 227 VAL A CG2 1 
ATOM   1482 N N   . HIS A 1 184 ? 5.016   10.482  -7.873  1.00 7.81  ? 228 HIS A N   1 
ATOM   1483 C CA  . HIS A 1 184 ? 5.661   10.785  -9.130  1.00 8.69  ? 228 HIS A CA  1 
ATOM   1484 C C   . HIS A 1 184 ? 5.028   9.894   -10.203 1.00 9.38  ? 228 HIS A C   1 
ATOM   1485 O O   . HIS A 1 184 ? 5.364   10.000  -11.347 1.00 9.10  ? 228 HIS A O   1 
ATOM   1486 C CB  . HIS A 1 184 ? 7.207   10.522  -9.019  1.00 6.69  ? 228 HIS A CB  1 
ATOM   1487 C CG  . HIS A 1 184 ? 7.848   11.568  -8.192  1.00 7.00  ? 228 HIS A CG  1 
ATOM   1488 N ND1 . HIS A 1 184 ? 8.367   11.317  -6.945  1.00 13.79 ? 228 HIS A ND1 1 
ATOM   1489 C CD2 . HIS A 1 184 ? 7.829   12.911  -8.335  1.00 5.58  ? 228 HIS A CD2 1 
ATOM   1490 C CE1 . HIS A 1 184 ? 8.755   12.468  -6.386  1.00 9.90  ? 228 HIS A CE1 1 
ATOM   1491 N NE2 . HIS A 1 184 ? 8.411   13.449  -7.196  1.00 14.12 ? 228 HIS A NE2 1 
ATOM   1492 N N   . ASN A 1 185 ? 4.026   9.139   -9.813  1.00 8.20  ? 229 ASN A N   1 
ATOM   1493 C CA  . ASN A 1 185 ? 3.214   8.362   -10.775 1.00 13.39 ? 229 ASN A CA  1 
ATOM   1494 C C   . ASN A 1 185 ? 1.733   8.743   -10.825 1.00 12.74 ? 229 ASN A C   1 
ATOM   1495 O O   . ASN A 1 185 ? 1.000   8.178   -11.631 1.00 14.83 ? 229 ASN A O   1 
ATOM   1496 C CB  . ASN A 1 185 ? 3.483   6.862   -10.625 1.00 10.63 ? 229 ASN A CB  1 
ATOM   1497 C CG  . ASN A 1 185 ? 4.852   6.529   -11.144 1.00 16.85 ? 229 ASN A CG  1 
ATOM   1498 O OD1 . ASN A 1 185 ? 5.064   6.345   -12.362 1.00 14.95 ? 229 ASN A OD1 1 
ATOM   1499 N ND2 . ASN A 1 185 ? 5.795   6.412   -10.256 1.00 11.72 ? 229 ASN A ND2 1 
ATOM   1500 N N   . LEU A 1 186 ? 1.336   9.790   -10.099 1.00 13.20 ? 230 LEU A N   1 
ATOM   1501 C CA  . LEU A 1 186 ? -0.003  10.346  -10.380 1.00 10.68 ? 230 LEU A CA  1 
ATOM   1502 C C   . LEU A 1 186 ? -0.103  11.035  -11.748 1.00 13.40 ? 230 LEU A C   1 
ATOM   1503 O O   . LEU A 1 186 ? 0.719   11.901  -12.099 1.00 15.43 ? 230 LEU A O   1 
ATOM   1504 C CB  . LEU A 1 186 ? -0.366  11.292  -9.269  1.00 10.01 ? 230 LEU A CB  1 
ATOM   1505 C CG  . LEU A 1 186 ? -0.411  10.454  -7.980  1.00 7.03  ? 230 LEU A CG  1 
ATOM   1506 C CD1 . LEU A 1 186 ? -0.593  11.639  -6.914  1.00 13.32 ? 230 LEU A CD1 1 
ATOM   1507 C CD2 . LEU A 1 186 ? -1.618  9.408   -7.952  1.00 10.91 ? 230 LEU A CD2 1 
ATOM   1508 N N   . GLN A 1 187 ? -1.050  10.634  -12.588 1.00 11.78 ? 231 GLN A N   1 
ATOM   1509 C CA  . GLN A 1 187 ? -0.995  11.166  -13.959 1.00 11.84 ? 231 GLN A CA  1 
ATOM   1510 C C   . GLN A 1 187 ? -1.569  12.556  -14.065 1.00 12.23 ? 231 GLN A C   1 
ATOM   1511 O O   . GLN A 1 187 ? -2.748  12.738  -13.804 1.00 11.69 ? 231 GLN A O   1 
ATOM   1512 C CB  . GLN A 1 187 ? -1.714  10.214  -14.901 1.00 12.62 ? 231 GLN A CB  1 
ATOM   1513 C CG  . GLN A 1 187 ? -1.110  8.814   -14.857 1.00 16.71 ? 231 GLN A CG  1 
ATOM   1514 C CD  . GLN A 1 187 ? 0.304   8.821   -15.327 1.00 27.92 ? 231 GLN A CD  1 
ATOM   1515 O OE1 . GLN A 1 187 ? 0.543   8.963   -16.533 1.00 34.38 ? 231 GLN A OE1 1 
ATOM   1516 N NE2 . GLN A 1 187 ? 1.271   8.699   -14.395 1.00 30.17 ? 231 GLN A NE2 1 
ATOM   1517 N N   . PRO A 1 188 ? -0.801  13.515  -14.593 1.00 14.56 ? 232 PRO A N   1 
ATOM   1518 C CA  . PRO A 1 188 ? -1.340  14.891  -14.765 1.00 14.37 ? 232 PRO A CA  1 
ATOM   1519 C C   . PRO A 1 188 ? -2.538  14.965  -15.724 1.00 16.20 ? 232 PRO A C   1 
ATOM   1520 O O   . PRO A 1 188 ? -3.354  15.856  -15.516 1.00 16.90 ? 232 PRO A O   1 
ATOM   1521 C CB  . PRO A 1 188 ? -0.177  15.646  -15.408 1.00 15.98 ? 232 PRO A CB  1 
ATOM   1522 C CG  . PRO A 1 188 ? 1.064   14.927  -14.879 1.00 16.08 ? 232 PRO A CG  1 
ATOM   1523 C CD  . PRO A 1 188 ? 0.615   13.424  -15.018 1.00 13.82 ? 232 PRO A CD  1 
ATOM   1524 N N   . GLU A 1 189 ? -2.667  14.097  -16.711 1.00 14.38 ? 233 GLU A N   1 
ATOM   1525 C CA  . GLU A 1 189 ? -3.899  14.124  -17.547 1.00 15.86 ? 233 GLU A CA  1 
ATOM   1526 C C   . GLU A 1 189 ? -5.182  13.687  -16.780 1.00 15.94 ? 233 GLU A C   1 
ATOM   1527 O O   . GLU A 1 189 ? -6.282  14.111  -17.115 1.00 16.03 ? 233 GLU A O   1 
ATOM   1528 C CB  . GLU A 1 189 ? -3.764  13.234  -18.794 1.00 19.21 ? 233 GLU A CB  1 
ATOM   1529 C CG  . GLU A 1 189 ? -2.472  13.478  -19.591 1.00 25.79 ? 233 GLU A CG  1 
ATOM   1530 C CD  . GLU A 1 189 ? -1.268  12.658  -19.023 1.00 33.18 ? 233 GLU A CD  1 
ATOM   1531 O OE1 . GLU A 1 189 ? -1.196  12.369  -17.812 1.00 29.72 ? 233 GLU A OE1 1 
ATOM   1532 O OE2 . GLU A 1 189 ? -0.385  12.246  -19.804 1.00 40.24 ? 233 GLU A OE2 1 
ATOM   1533 N N   . LYS A 1 190 ? -5.035  12.916  -15.714 1.00 13.11 ? 234 LYS A N   1 
ATOM   1534 C CA  . LYS A 1 190 ? -6.230  12.314  -15.025 1.00 15.45 ? 234 LYS A CA  1 
ATOM   1535 C C   . LYS A 1 190 ? -6.507  12.805  -13.635 1.00 10.65 ? 234 LYS A C   1 
ATOM   1536 O O   . LYS A 1 190 ? -7.646  12.846  -13.270 1.00 11.01 ? 234 LYS A O   1 
ATOM   1537 C CB  . LYS A 1 190 ? -5.994  10.835  -14.759 1.00 16.24 ? 234 LYS A CB  1 
ATOM   1538 C CG  . LYS A 1 190 ? -6.245  9.928   -15.866 1.00 25.84 ? 234 LYS A CG  1 
ATOM   1539 C CD  . LYS A 1 190 ? -4.970  9.243   -16.186 1.00 33.94 ? 234 LYS A CD  1 
ATOM   1540 C CE  . LYS A 1 190 ? -4.529  8.264   -15.130 1.00 30.96 ? 234 LYS A CE  1 
ATOM   1541 N NZ  . LYS A 1 190 ? -5.396  7.127   -15.005 1.00 38.44 ? 234 LYS A NZ  1 
ATOM   1542 N N   . VAL A 1 191 ? -5.507  13.181  -12.851 1.00 9.60  ? 235 VAL A N   1 
ATOM   1543 C CA  . VAL A 1 191 ? -5.757  13.452  -11.399 1.00 11.47 ? 235 VAL A CA  1 
ATOM   1544 C C   . VAL A 1 191 ? -6.046  14.940  -11.194 1.00 11.44 ? 235 VAL A C   1 
ATOM   1545 O O   . VAL A 1 191 ? -5.139  15.725  -11.452 1.00 8.66  ? 235 VAL A O   1 
ATOM   1546 C CB  . VAL A 1 191 ? -4.548  13.078  -10.514 1.00 10.01 ? 235 VAL A CB  1 
ATOM   1547 C CG1 . VAL A 1 191 ? -4.738  13.417  -8.997  1.00 10.94 ? 235 VAL A CG1 1 
ATOM   1548 C CG2 . VAL A 1 191 ? -4.253  11.490  -10.737 1.00 14.14 ? 235 VAL A CG2 1 
ATOM   1549 N N   . GLN A 1 192 ? -7.200  15.274  -10.596 1.00 9.78  ? 236 GLN A N   1 
ATOM   1550 C CA  . GLN A 1 192 ? -7.693  16.673  -10.511 1.00 10.37 ? 236 GLN A CA  1 
ATOM   1551 C C   . GLN A 1 192 ? -7.014  17.262  -9.246  1.00 9.88  ? 236 GLN A C   1 
ATOM   1552 O O   . GLN A 1 192 ? -6.467  18.374  -9.302  1.00 9.03  ? 236 GLN A O   1 
ATOM   1553 C CB  . GLN A 1 192 ? -9.292  16.698  -10.369 1.00 8.70  ? 236 GLN A CB  1 
ATOM   1554 C CG  . GLN A 1 192 ? -10.019 17.916  -9.306  1.00 17.91 ? 236 GLN A CG  1 
ATOM   1555 C CD  . GLN A 1 192 ? -9.911  19.047  -10.158 1.00 22.91 ? 236 GLN A CD  1 
ATOM   1556 O OE1 . GLN A 1 192 ? -9.228  18.898  -11.201 1.00 31.84 ? 236 GLN A OE1 1 
ATOM   1557 N NE2 . GLN A 1 192 ? -10.526 20.141  -9.866  1.00 19.76 ? 236 GLN A NE2 1 
ATOM   1558 N N   . THR A 1 193 ? -6.981  16.455  -8.173  1.00 8.27  ? 237 THR A N   1 
ATOM   1559 C CA  . THR A 1 193 ? -6.601  16.897  -6.798  1.00 9.94  ? 237 THR A CA  1 
ATOM   1560 C C   . THR A 1 193 ? -6.012  15.730  -6.056  1.00 8.56  ? 237 THR A C   1 
ATOM   1561 O O   . THR A 1 193 ? -6.530  14.600  -6.151  1.00 6.20  ? 237 THR A O   1 
ATOM   1562 C CB  . THR A 1 193 ? -7.910  17.445  -5.985  1.00 11.58 ? 237 THR A CB  1 
ATOM   1563 O OG1 . THR A 1 193 ? -8.459  18.627  -6.608  1.00 14.77 ? 237 THR A OG1 1 
ATOM   1564 C CG2 . THR A 1 193 ? -7.571  17.924  -4.576  1.00 12.48 ? 237 THR A CG2 1 
ATOM   1565 N N   . LEU A 1 194 ? -5.028  16.014  -5.197  1.00 7.91  ? 238 LEU A N   1 
ATOM   1566 C CA  . LEU A 1 194 ? -4.657  15.083  -4.195  1.00 7.71  ? 238 LEU A CA  1 
ATOM   1567 C C   . LEU A 1 194 ? -5.032  15.682  -2.851  1.00 10.90 ? 238 LEU A C   1 
ATOM   1568 O O   . LEU A 1 194 ? -4.707  16.857  -2.613  1.00 10.46 ? 238 LEU A O   1 
ATOM   1569 C CB  . LEU A 1 194 ? -3.142  14.909  -4.312  1.00 7.95  ? 238 LEU A CB  1 
ATOM   1570 C CG  . LEU A 1 194 ? -2.585  14.168  -3.138  1.00 15.35 ? 238 LEU A CG  1 
ATOM   1571 C CD1 . LEU A 1 194 ? -2.809  12.733  -3.461  1.00 11.71 ? 238 LEU A CD1 1 
ATOM   1572 C CD2 . LEU A 1 194 ? -1.088  14.570  -2.868  1.00 15.63 ? 238 LEU A CD2 1 
ATOM   1573 N N   . GLU A 1 195 ? -5.752  14.931  -2.015  1.00 6.26  ? 239 GLU A N   1 
ATOM   1574 C CA  . GLU A 1 195 ? -6.171  15.534  -0.706  1.00 9.31  ? 239 GLU A CA  1 
ATOM   1575 C C   . GLU A 1 195 ? -5.497  14.701  0.319   1.00 7.89  ? 239 GLU A C   1 
ATOM   1576 O O   . GLU A 1 195 ? -5.733  13.456  0.395   1.00 10.22 ? 239 GLU A O   1 
ATOM   1577 C CB  . GLU A 1 195 ? -7.698  15.474  -0.564  1.00 11.52 ? 239 GLU A CB  1 
ATOM   1578 C CG  . GLU A 1 195 ? -8.226  15.744  0.874   1.00 10.83 ? 239 GLU A CG  1 
ATOM   1579 C CD  . GLU A 1 195 ? -9.700  16.073  0.900   1.00 22.57 ? 239 GLU A CD  1 
ATOM   1580 O OE1 . GLU A 1 195 ? -10.524 15.352  1.529   1.00 24.93 ? 239 GLU A OE1 1 
ATOM   1581 O OE2 . GLU A 1 195 ? -10.009 17.079  0.272   1.00 26.55 ? 239 GLU A OE2 1 
ATOM   1582 N N   . ALA A 1 196 ? -4.698  15.343  1.200   1.00 9.72  ? 240 ALA A N   1 
ATOM   1583 C CA  . ALA A 1 196 ? -4.085  14.624  2.274   1.00 7.56  ? 240 ALA A CA  1 
ATOM   1584 C C   . ALA A 1 196 ? -4.973  14.674  3.541   1.00 10.97 ? 240 ALA A C   1 
ATOM   1585 O O   . ALA A 1 196 ? -5.526  15.753  3.901   1.00 10.07 ? 240 ALA A O   1 
ATOM   1586 C CB  . ALA A 1 196 ? -2.642  15.236  2.533   1.00 6.73  ? 240 ALA A CB  1 
ATOM   1587 N N   . TRP A 1 197 ? -5.079  13.537  4.240   1.00 9.83  ? 241 TRP A N   1 
ATOM   1588 C CA  . TRP A 1 197 ? -5.627  13.531  5.566   1.00 10.00 ? 241 TRP A CA  1 
ATOM   1589 C C   . TRP A 1 197 ? -4.456  13.268  6.457   1.00 11.53 ? 241 TRP A C   1 
ATOM   1590 O O   . TRP A 1 197 ? -3.879  12.176  6.392   1.00 11.38 ? 241 TRP A O   1 
ATOM   1591 C CB  . TRP A 1 197 ? -6.645  12.419  5.686   1.00 8.05  ? 241 TRP A CB  1 
ATOM   1592 C CG  . TRP A 1 197 ? -7.850  12.552  4.810   1.00 10.50 ? 241 TRP A CG  1 
ATOM   1593 C CD1 . TRP A 1 197 ? -8.261  13.630  4.111   1.00 12.49 ? 241 TRP A CD1 1 
ATOM   1594 C CD2 . TRP A 1 197 ? -8.755  11.480  4.449   1.00 10.43 ? 241 TRP A CD2 1 
ATOM   1595 N NE1 . TRP A 1 197 ? -9.392  13.332  3.385   1.00 13.49 ? 241 TRP A NE1 1 
ATOM   1596 C CE2 . TRP A 1 197 ? -9.734  12.028  3.617   1.00 12.93 ? 241 TRP A CE2 1 
ATOM   1597 C CE3 . TRP A 1 197 ? -8.905  10.140  4.892   1.00 12.43 ? 241 TRP A CE3 1 
ATOM   1598 C CZ2 . TRP A 1 197 ? -10.852 11.299  3.138   1.00 18.45 ? 241 TRP A CZ2 1 
ATOM   1599 C CZ3 . TRP A 1 197 ? -9.999  9.385   4.358   1.00 15.27 ? 241 TRP A CZ3 1 
ATOM   1600 C CH2 . TRP A 1 197 ? -10.958 9.983   3.510   1.00 18.11 ? 241 TRP A CH2 1 
ATOM   1601 N N   . VAL A 1 198 ? -4.090  14.239  7.310   1.00 10.46 ? 242 VAL A N   1 
ATOM   1602 C CA  . VAL A 1 198 ? -2.961  14.066  8.191   1.00 12.59 ? 242 VAL A CA  1 
ATOM   1603 C C   . VAL A 1 198 ? -3.514  13.547  9.551   1.00 12.60 ? 242 VAL A C   1 
ATOM   1604 O O   . VAL A 1 198 ? -4.330  14.199  10.139  1.00 12.95 ? 242 VAL A O   1 
ATOM   1605 C CB  . VAL A 1 198 ? -2.248  15.420  8.436   1.00 12.37 ? 242 VAL A CB  1 
ATOM   1606 C CG1 . VAL A 1 198 ? -1.084  15.206  9.462   1.00 12.48 ? 242 VAL A CG1 1 
ATOM   1607 C CG2 . VAL A 1 198 ? -1.765  16.000  7.121   1.00 14.46 ? 242 VAL A CG2 1 
ATOM   1608 N N   . ILE A 1 199 ? -3.108  12.356  9.998   1.00 14.28 ? 243 ILE A N   1 
ATOM   1609 C CA  . ILE A 1 199 ? -3.686  11.737  11.169  1.00 15.59 ? 243 ILE A CA  1 
ATOM   1610 C C   . ILE A 1 199 ? -2.858  12.141  12.367  1.00 17.12 ? 243 ILE A C   1 
ATOM   1611 O O   . ILE A 1 199 ? -1.640  11.885  12.408  1.00 15.60 ? 243 ILE A O   1 
ATOM   1612 C CB  . ILE A 1 199 ? -3.663  10.209  11.065  1.00 16.28 ? 243 ILE A CB  1 
ATOM   1613 C CG1 . ILE A 1 199 ? -4.264  9.732   9.732   1.00 12.65 ? 243 ILE A CG1 1 
ATOM   1614 C CG2 . ILE A 1 199 ? -4.522  9.610   12.193  1.00 18.34 ? 243 ILE A CG2 1 
ATOM   1615 C CD1 . ILE A 1 199 ? -5.731  10.291  9.466   1.00 11.53 ? 243 ILE A CD1 1 
ATOM   1616 N N   . HIS A 1 200 ? -3.541  12.733  13.324  1.00 20.31 ? 244 HIS A N   1 
ATOM   1617 C CA  . HIS A 1 200 ? -2.949  13.175  14.591  1.00 26.52 ? 244 HIS A CA  1 
ATOM   1618 C C   . HIS A 1 200 ? -2.819  11.962  15.527  1.00 32.91 ? 244 HIS A C   1 
ATOM   1619 O O   . HIS A 1 200 ? -3.569  11.003  15.462  1.00 31.94 ? 244 HIS A O   1 
ATOM   1620 C CB  . HIS A 1 200 ? -3.804  14.268  15.216  1.00 23.70 ? 244 HIS A CB  1 
ATOM   1621 C CG  . HIS A 1 200 ? -3.592  15.632  14.613  1.00 22.66 ? 244 HIS A CG  1 
ATOM   1622 N ND1 . HIS A 1 200 ? -3.841  15.915  13.282  1.00 18.27 ? 244 HIS A ND1 1 
ATOM   1623 C CD2 . HIS A 1 200 ? -3.131  16.785  15.162  1.00 16.34 ? 244 HIS A CD2 1 
ATOM   1624 C CE1 . HIS A 1 200 ? -3.604  17.195  13.051  1.00 20.18 ? 244 HIS A CE1 1 
ATOM   1625 N NE2 . HIS A 1 200 ? -3.159  17.749  14.178  1.00 17.55 ? 244 HIS A NE2 1 
ATOM   1626 N N   . GLY A 1 201 ? -1.775  11.974  16.332  1.00 43.35 ? 245 GLY A N   1 
ATOM   1627 C CA  . GLY A 1 201 ? -1.530  10.881  17.270  1.00 51.31 ? 245 GLY A CA  1 
ATOM   1628 C C   . GLY A 1 201 ? -2.533  10.877  18.413  1.00 58.22 ? 245 GLY A C   1 
ATOM   1629 O O   . GLY A 1 201 ? -3.806  10.831  18.250  1.00 60.74 ? 245 GLY A O   1 
ATOM   1630 N N   . GLY A 1 202 ? -1.982  10.918  19.613  1.00 63.29 ? 246 GLY A N   1 
ATOM   1631 C CA  . GLY A 1 202 ? -2.833  10.969  20.790  1.00 67.84 ? 246 GLY A CA  1 
ATOM   1632 C C   . GLY A 1 202 ? -3.294  12.359  21.198  1.00 70.74 ? 246 GLY A C   1 
ATOM   1633 O O   . GLY A 1 202 ? -3.784  13.177  20.372  1.00 71.70 ? 246 GLY A O   1 
ATOM   1634 N N   . ARG A 1 203 ? -3.085  12.606  22.495  1.00 73.02 ? 247 ARG A N   1 
ATOM   1635 C CA  . ARG A 1 203 ? -3.719  13.657  23.273  1.00 74.49 ? 247 ARG A CA  1 
ATOM   1636 C C   . ARG A 1 203 ? -3.795  15.026  22.653  1.00 75.02 ? 247 ARG A C   1 
ATOM   1637 O O   . ARG A 1 203 ? -4.894  15.499  22.370  1.00 75.80 ? 247 ARG A O   1 
ATOM   1638 N N   . GLU A 1 204 ? -2.635  15.639  22.439  1.00 75.67 ? 248 GLU A N   1 
ATOM   1639 C CA  . GLU A 1 204 ? -2.507  17.065  22.134  1.00 76.03 ? 248 GLU A CA  1 
ATOM   1640 C C   . GLU A 1 204 ? -3.728  17.892  21.712  1.00 76.10 ? 248 GLU A C   1 
ATOM   1641 O O   . GLU A 1 204 ? -4.751  17.356  21.222  1.00 76.64 ? 248 GLU A O   1 
ATOM   1642 N N   . ASP A 1 205 ? -3.617  19.214  21.910  1.00 75.40 ? 249 ASP A N   1 
ATOM   1643 C CA  . ASP A 1 205 ? -4.621  20.179  21.450  1.00 73.70 ? 249 ASP A CA  1 
ATOM   1644 C C   . ASP A 1 205 ? -4.196  20.510  20.033  1.00 72.11 ? 249 ASP A C   1 
ATOM   1645 O O   . ASP A 1 205 ? -5.008  20.853  19.149  1.00 73.40 ? 249 ASP A O   1 
ATOM   1646 N N   . SER A 1 206 ? -2.884  20.397  19.858  1.00 69.39 ? 250 SER A N   1 
ATOM   1647 C CA  . SER A 1 206 ? -2.232  20.092  18.591  1.00 65.38 ? 250 SER A CA  1 
ATOM   1648 C C   . SER A 1 206 ? -2.257  21.179  17.489  1.00 61.98 ? 250 SER A C   1 
ATOM   1649 O O   . SER A 1 206 ? -3.272  21.804  17.204  1.00 60.58 ? 250 SER A O   1 
ATOM   1650 C CB  . SER A 1 206 ? -2.621  18.684  18.104  1.00 65.80 ? 250 SER A CB  1 
ATOM   1651 O OG  . SER A 1 206 ? -1.572  17.783  18.424  1.00 67.51 ? 250 SER A OG  1 
ATOM   1652 N N   . ARG A 1 207 ? -1.065  21.370  16.935  1.00 59.06 ? 251 ARG A N   1 
ATOM   1653 C CA  . ARG A 1 207 ? -0.743  22.166  15.778  1.00 57.24 ? 251 ARG A CA  1 
ATOM   1654 C C   . ARG A 1 207 ? -1.649  21.841  14.550  1.00 55.19 ? 251 ARG A C   1 
ATOM   1655 O O   . ARG A 1 207 ? -2.199  20.717  14.389  1.00 53.87 ? 251 ARG A O   1 
ATOM   1656 C CB  . ARG A 1 207 ? 0.736   21.895  15.404  1.00 58.57 ? 251 ARG A CB  1 
ATOM   1657 C CG  . ARG A 1 207 ? 1.775   22.271  16.450  1.00 64.19 ? 251 ARG A CG  1 
ATOM   1658 C CD  . ARG A 1 207 ? 3.052   21.355  16.539  1.00 67.26 ? 251 ARG A CD  1 
ATOM   1659 N NE  . ARG A 1 207 ? 3.734   21.061  15.262  1.00 71.82 ? 251 ARG A NE  1 
ATOM   1660 C CZ  . ARG A 1 207 ? 4.210   19.846  14.913  1.00 71.66 ? 251 ARG A CZ  1 
ATOM   1661 N NH1 . ARG A 1 207 ? 4.041   18.792  15.738  1.00 68.99 ? 251 ARG A NH1 1 
ATOM   1662 N NH2 . ARG A 1 207 ? 4.830   19.675  13.722  1.00 70.57 ? 251 ARG A NH2 1 
ATOM   1663 N N   . ASP A 1 208 ? -1.814  22.828  13.678  1.00 52.00 ? 252 ASP A N   1 
ATOM   1664 C CA  . ASP A 1 208 ? -2.477  22.568  12.402  1.00 50.05 ? 252 ASP A CA  1 
ATOM   1665 C C   . ASP A 1 208 ? -1.400  21.985  11.494  1.00 48.06 ? 252 ASP A C   1 
ATOM   1666 O O   . ASP A 1 208 ? -0.563  22.703  10.986  1.00 48.45 ? 252 ASP A O   1 
ATOM   1667 C CB  . ASP A 1 208 ? -3.027  23.905  11.836  1.00 50.55 ? 252 ASP A CB  1 
ATOM   1668 C CG  . ASP A 1 208 ? -3.385  23.819  10.374  1.00 53.00 ? 252 ASP A CG  1 
ATOM   1669 O OD1 . ASP A 1 208 ? -3.475  22.663  9.869   1.00 48.18 ? 252 ASP A OD1 1 
ATOM   1670 O OD2 . ASP A 1 208 ? -3.627  24.859  9.685   1.00 56.77 ? 252 ASP A OD2 1 
ATOM   1671 N N   . LEU A 1 209 ? -1.385  20.671  11.306  1.00 45.62 ? 253 LEU A N   1 
ATOM   1672 C CA  . LEU A 1 209 ? -0.238  20.027  10.658  1.00 44.12 ? 253 LEU A CA  1 
ATOM   1673 C C   . LEU A 1 209 ? -0.308  20.175  9.181   1.00 41.57 ? 253 LEU A C   1 
ATOM   1674 O O   . LEU A 1 209 ? 0.625   19.933  8.520   1.00 41.34 ? 253 LEU A O   1 
ATOM   1675 C CB  . LEU A 1 209 ? -0.180  18.544  11.035  1.00 42.07 ? 253 LEU A CB  1 
ATOM   1676 C CG  . LEU A 1 209 ? 0.108   18.224  12.528  1.00 46.89 ? 253 LEU A CG  1 
ATOM   1677 C CD1 . LEU A 1 209 ? -0.172  16.694  12.880  1.00 41.05 ? 253 LEU A CD1 1 
ATOM   1678 C CD2 . LEU A 1 209 ? 1.555   18.642  12.940  1.00 49.10 ? 253 LEU A CD2 1 
ATOM   1679 N N   . CYS A 1 210 ? -1.427  20.652  8.668   1.00 42.05 ? 254 CYS A N   1 
ATOM   1680 C CA  . CYS A 1 210 ? -1.512  20.979  7.252   1.00 43.11 ? 254 CYS A CA  1 
ATOM   1681 C C   . CYS A 1 210 ? -0.593  22.174  6.936   1.00 44.47 ? 254 CYS A C   1 
ATOM   1682 O O   . CYS A 1 210 ? -0.264  22.419  5.774   1.00 43.26 ? 254 CYS A O   1 
ATOM   1683 C CB  . CYS A 1 210 ? -3.001  21.220  6.835   1.00 44.08 ? 254 CYS A CB  1 
ATOM   1684 S SG  . CYS A 1 210 ? -3.883  19.609  6.798   1.00 44.48 ? 254 CYS A SG  1 
ATOM   1685 N N   . GLN A 1 211 ? -0.080  22.872  7.968   1.00 41.78 ? 255 GLN A N   1 
ATOM   1686 C CA  . GLN A 1 211 ? 0.916   23.922  7.624   1.00 40.03 ? 255 GLN A CA  1 
ATOM   1687 C C   . GLN A 1 211 ? 2.364   23.474  7.819   1.00 37.46 ? 255 GLN A C   1 
ATOM   1688 O O   . GLN A 1 211 ? 3.328   24.253  7.577   1.00 38.57 ? 255 GLN A O   1 
ATOM   1689 C CB  . GLN A 1 211 ? 0.583   25.291  8.296   1.00 44.22 ? 255 GLN A CB  1 
ATOM   1690 C CG  . GLN A 1 211 ? -0.788  25.897  7.736   1.00 47.58 ? 255 GLN A CG  1 
ATOM   1691 C CD  . GLN A 1 211 ? -0.725  26.453  6.234   1.00 52.71 ? 255 GLN A CD  1 
ATOM   1692 O OE1 . GLN A 1 211 ? 0.044   27.501  5.826   1.00 47.58 ? 255 GLN A OE1 1 
ATOM   1693 N NE2 . GLN A 1 211 ? -1.546  25.777  5.400   1.00 52.07 ? 255 GLN A NE2 1 
ATOM   1694 N N   . ASP A 1 212 ? 2.539   22.192  8.128   1.00 29.39 ? 256 ASP A N   1 
ATOM   1695 C CA  . ASP A 1 212 ? 3.870   21.631  8.302   1.00 24.67 ? 256 ASP A CA  1 
ATOM   1696 C C   . ASP A 1 212 ? 4.712   21.847  7.072   1.00 21.27 ? 256 ASP A C   1 
ATOM   1697 O O   . ASP A 1 212 ? 4.176   21.714  5.984   1.00 22.04 ? 256 ASP A O   1 
ATOM   1698 C CB  . ASP A 1 212 ? 3.753   20.136  8.525   1.00 25.73 ? 256 ASP A CB  1 
ATOM   1699 C CG  . ASP A 1 212 ? 5.057   19.513  8.861   1.00 26.69 ? 256 ASP A CG  1 
ATOM   1700 O OD1 . ASP A 1 212 ? 5.763   18.990  7.952   1.00 21.37 ? 256 ASP A OD1 1 
ATOM   1701 O OD2 . ASP A 1 212 ? 5.459   19.534  10.037  1.00 25.64 ? 256 ASP A OD2 1 
ATOM   1702 N N   . PRO A 1 213 ? 5.994   22.195  7.216   1.00 18.92 ? 257 PRO A N   1 
ATOM   1703 C CA  . PRO A 1 213 ? 6.919   22.362  6.059   1.00 18.52 ? 257 PRO A CA  1 
ATOM   1704 C C   . PRO A 1 213 ? 6.920   21.214  5.016   1.00 17.66 ? 257 PRO A C   1 
ATOM   1705 O O   . PRO A 1 213 ? 6.949   21.490  3.801   1.00 16.85 ? 257 PRO A O   1 
ATOM   1706 C CB  . PRO A 1 213 ? 8.297   22.420  6.733   1.00 19.32 ? 257 PRO A CB  1 
ATOM   1707 C CG  . PRO A 1 213 ? 7.973   23.185  8.081   1.00 16.65 ? 257 PRO A CG  1 
ATOM   1708 C CD  . PRO A 1 213 ? 6.646   22.591  8.504   1.00 19.64 ? 257 PRO A CD  1 
ATOM   1709 N N   . THR A 1 214 ? 6.893   19.959  5.463   1.00 17.81 ? 258 THR A N   1 
ATOM   1710 C CA  . THR A 1 214 ? 6.864   18.837  4.489   1.00 17.87 ? 258 THR A CA  1 
ATOM   1711 C C   . THR A 1 214 ? 5.538   18.776  3.711   1.00 17.60 ? 258 THR A C   1 
ATOM   1712 O O   . THR A 1 214 ? 5.523   18.232  2.599   1.00 16.93 ? 258 THR A O   1 
ATOM   1713 C CB  . THR A 1 214 ? 7.162   17.481  5.131   1.00 18.35 ? 258 THR A CB  1 
ATOM   1714 O OG1 . THR A 1 214 ? 6.139   17.144  6.090   1.00 19.48 ? 258 THR A OG1 1 
ATOM   1715 C CG2 . THR A 1 214 ? 8.432   17.551  5.930   1.00 19.12 ? 258 THR A CG2 1 
ATOM   1716 N N   . ILE A 1 215 ? 4.441   19.279  4.313   1.00 15.75 ? 259 ILE A N   1 
ATOM   1717 C CA  . ILE A 1 215 ? 3.164   19.332  3.585   1.00 15.58 ? 259 ILE A CA  1 
ATOM   1718 C C   . ILE A 1 215 ? 3.216   20.410  2.458   1.00 15.41 ? 259 ILE A C   1 
ATOM   1719 O O   . ILE A 1 215 ? 2.695   20.229  1.319   1.00 17.05 ? 259 ILE A O   1 
ATOM   1720 C CB  . ILE A 1 215 ? 1.932   19.514  4.636   1.00 14.93 ? 259 ILE A CB  1 
ATOM   1721 C CG1 . ILE A 1 215 ? 1.803   18.278  5.616   1.00 12.96 ? 259 ILE A CG1 1 
ATOM   1722 C CG2 . ILE A 1 215 ? 0.596   19.759  3.906   1.00 15.94 ? 259 ILE A CG2 1 
ATOM   1723 C CD1 . ILE A 1 215 ? 1.519   16.890  4.733   1.00 19.13 ? 259 ILE A CD1 1 
ATOM   1724 N N   . LYS A 1 216 ? 3.861   21.541  2.774   1.00 15.94 ? 260 LYS A N   1 
ATOM   1725 C CA  . LYS A 1 216 ? 3.952   22.620  1.824   1.00 14.74 ? 260 LYS A CA  1 
ATOM   1726 C C   . LYS A 1 216 ? 4.856   22.160  0.648   1.00 15.52 ? 260 LYS A C   1 
ATOM   1727 O O   . LYS A 1 216 ? 4.662   22.534  -0.488  1.00 17.35 ? 260 LYS A O   1 
ATOM   1728 C CB  . LYS A 1 216 ? 4.410   23.946  2.564   1.00 16.80 ? 260 LYS A CB  1 
ATOM   1729 C CG  . LYS A 1 216 ? 3.586   24.275  3.843   1.00 16.08 ? 260 LYS A CG  1 
ATOM   1730 C CD  . LYS A 1 216 ? 2.200   24.953  3.439   1.00 17.62 ? 260 LYS A CD  1 
ATOM   1731 C CE  . LYS A 1 216 ? 1.106   23.985  3.035   1.00 14.92 ? 260 LYS A CE  1 
ATOM   1732 N NZ  . LYS A 1 216 ? -0.142  24.687  2.667   1.00 15.91 ? 260 LYS A NZ  1 
ATOM   1733 N N   . GLU A 1 217 ? 5.798   21.291  0.932   1.00 14.10 ? 261 GLU A N   1 
ATOM   1734 C CA  . GLU A 1 217 ? 6.662   20.785  -0.038  1.00 16.99 ? 261 GLU A CA  1 
ATOM   1735 C C   . GLU A 1 217 ? 5.870   19.839  -0.985  1.00 15.27 ? 261 GLU A C   1 
ATOM   1736 O O   . GLU A 1 217 ? 5.995   19.898  -2.162  1.00 16.22 ? 261 GLU A O   1 
ATOM   1737 C CB  . GLU A 1 217 ? 7.729   19.942  0.650   1.00 18.36 ? 261 GLU A CB  1 
ATOM   1738 C CG  . GLU A 1 217 ? 8.699   19.449  -0.430  1.00 27.38 ? 261 GLU A CG  1 
ATOM   1739 C CD  . GLU A 1 217 ? 9.199   18.033  -0.211  1.00 40.37 ? 261 GLU A CD  1 
ATOM   1740 O OE1 . GLU A 1 217 ? 10.078  17.852  0.668   1.00 43.69 ? 261 GLU A OE1 1 
ATOM   1741 O OE2 . GLU A 1 217 ? 8.753   17.092  -0.957  1.00 49.18 ? 261 GLU A OE2 1 
ATOM   1742 N N   . LEU A 1 218 ? 5.181   18.900  -0.393  1.00 13.39 ? 262 LEU A N   1 
ATOM   1743 C CA  . LEU A 1 218 ? 4.263   18.014  -1.145  1.00 12.73 ? 262 LEU A CA  1 
ATOM   1744 C C   . LEU A 1 218 ? 3.350   18.810  -2.057  1.00 11.34 ? 262 LEU A C   1 
ATOM   1745 O O   . LEU A 1 218 ? 3.149   18.460  -3.211  1.00 12.59 ? 262 LEU A O   1 
ATOM   1746 C CB  . LEU A 1 218 ? 3.468   17.277  -0.115  1.00 10.22 ? 262 LEU A CB  1 
ATOM   1747 C CG  . LEU A 1 218 ? 2.780   15.950  -0.403  1.00 17.43 ? 262 LEU A CG  1 
ATOM   1748 C CD1 . LEU A 1 218 ? 1.475   15.788  0.239   1.00 13.03 ? 262 LEU A CD1 1 
ATOM   1749 C CD2 . LEU A 1 218 ? 2.889   15.465  -1.843  1.00 10.29 ? 262 LEU A CD2 1 
ATOM   1750 N N   . GLU A 1 219 ? 2.710   19.838  -1.524  1.00 13.06 ? 263 GLU A N   1 
ATOM   1751 C CA  . GLU A 1 219 ? 1.857   20.795  -2.280  1.00 13.85 ? 263 GLU A CA  1 
ATOM   1752 C C   . GLU A 1 219 ? 2.564   21.366  -3.509  1.00 14.85 ? 263 GLU A C   1 
ATOM   1753 O O   . GLU A 1 219 ? 2.049   21.247  -4.639  1.00 16.05 ? 263 GLU A O   1 
ATOM   1754 C CB  . GLU A 1 219 ? 1.426   21.971  -1.355  1.00 14.38 ? 263 GLU A CB  1 
ATOM   1755 C CG  . GLU A 1 219 ? 0.507   22.982  -2.053  1.00 16.14 ? 263 GLU A CG  1 
ATOM   1756 C CD  . GLU A 1 219 ? -0.072  24.077  -1.161  1.00 25.25 ? 263 GLU A CD  1 
ATOM   1757 O OE1 . GLU A 1 219 ? 0.649   24.708  -0.259  1.00 24.52 ? 263 GLU A OE1 1 
ATOM   1758 O OE2 . GLU A 1 219 ? -1.291  24.350  -1.418  1.00 28.15 ? 263 GLU A OE2 1 
ATOM   1759 N N   . SER A 1 220 ? 3.745   21.977  -3.314  1.00 14.13 ? 264 SER A N   1 
ATOM   1760 C CA  . SER A 1 220 ? 4.461   22.531  -4.430  1.00 15.08 ? 264 SER A CA  1 
ATOM   1761 C C   . SER A 1 220 ? 5.010   21.422  -5.313  1.00 12.72 ? 264 SER A C   1 
ATOM   1762 O O   . SER A 1 220 ? 5.031   21.560  -6.496  1.00 11.40 ? 264 SER A O   1 
ATOM   1763 C CB  . SER A 1 220 ? 5.570   23.457  -3.937  1.00 18.25 ? 264 SER A CB  1 
ATOM   1764 O OG  . SER A 1 220 ? 6.571   22.533  -3.450  1.00 27.14 ? 264 SER A OG  1 
ATOM   1765 N N   . ILE A 1 221 ? 5.395   20.301  -4.782  1.00 12.58 ? 265 ILE A N   1 
ATOM   1766 C CA  . ILE A 1 221 ? 5.739   19.222  -5.748  1.00 13.96 ? 265 ILE A CA  1 
ATOM   1767 C C   . ILE A 1 221 ? 4.604   18.817  -6.717  1.00 13.29 ? 265 ILE A C   1 
ATOM   1768 O O   . ILE A 1 221 ? 4.814   18.639  -7.982  1.00 12.60 ? 265 ILE A O   1 
ATOM   1769 C CB  . ILE A 1 221 ? 6.210   17.982  -4.985  1.00 14.65 ? 265 ILE A CB  1 
ATOM   1770 C CG1 . ILE A 1 221 ? 7.629   18.197  -4.454  1.00 19.67 ? 265 ILE A CG1 1 
ATOM   1771 C CG2 . ILE A 1 221 ? 6.263   16.770  -5.908  1.00 15.79 ? 265 ILE A CG2 1 
ATOM   1772 C CD1 . ILE A 1 221 ? 8.157   16.896  -3.930  1.00 23.38 ? 265 ILE A CD1 1 
ATOM   1773 N N   . ILE A 1 222 ? 3.430   18.592  -6.151  1.00 12.65 ? 266 ILE A N   1 
ATOM   1774 C CA  . ILE A 1 222 ? 2.311   18.074  -7.012  1.00 14.72 ? 266 ILE A CA  1 
ATOM   1775 C C   . ILE A 1 222 ? 1.736   19.193  -7.940  1.00 13.31 ? 266 ILE A C   1 
ATOM   1776 O O   . ILE A 1 222 ? 1.286   18.919  -9.073  1.00 9.89  ? 266 ILE A O   1 
ATOM   1777 C CB  . ILE A 1 222 ? 1.239   17.384  -6.241  1.00 14.86 ? 266 ILE A CB  1 
ATOM   1778 C CG1 . ILE A 1 222 ? 0.399   18.327  -5.423  1.00 16.32 ? 266 ILE A CG1 1 
ATOM   1779 C CG2 . ILE A 1 222 ? 1.856   16.358  -5.316  1.00 21.71 ? 266 ILE A CG2 1 
ATOM   1780 C CD1 . ILE A 1 222 ? -0.899  17.773  -5.265  1.00 23.04 ? 266 ILE A CD1 1 
ATOM   1781 N N   . SER A 1 223 ? 1.919   20.456  -7.540  1.00 13.61 ? 267 SER A N   1 
ATOM   1782 C CA  . SER A 1 223 ? 1.614   21.559  -8.514  1.00 15.80 ? 267 SER A CA  1 
ATOM   1783 C C   . SER A 1 223 ? 2.375   21.529  -9.841  1.00 15.56 ? 267 SER A C   1 
ATOM   1784 O O   . SER A 1 223 ? 1.845   21.946  -10.806 1.00 14.69 ? 267 SER A O   1 
ATOM   1785 C CB  . SER A 1 223 ? 1.875   22.955  -7.915  1.00 17.56 ? 267 SER A CB  1 
ATOM   1786 O OG  . SER A 1 223 ? 1.185   22.994  -6.697  1.00 23.76 ? 267 SER A OG  1 
ATOM   1787 N N   . LYS A 1 224 ? 3.657   21.114  -9.895  1.00 15.79 ? 268 LYS A N   1 
ATOM   1788 C CA  . LYS A 1 224 ? 4.286   20.912  -11.207 1.00 17.07 ? 268 LYS A CA  1 
ATOM   1789 C C   . LYS A 1 224 ? 3.535   19.879  -12.118 1.00 17.55 ? 268 LYS A C   1 
ATOM   1790 O O   . LYS A 1 224 ? 3.507   19.966  -13.377 1.00 15.49 ? 268 LYS A O   1 
ATOM   1791 C CB  . LYS A 1 224 ? 5.762   20.461  -11.021 1.00 17.47 ? 268 LYS A CB  1 
ATOM   1792 C CG  . LYS A 1 224 ? 6.700   21.061  -12.139 1.00 25.31 ? 268 LYS A CG  1 
ATOM   1793 C CD  . LYS A 1 224 ? 7.547   19.971  -12.784 1.00 26.15 ? 268 LYS A CD  1 
ATOM   1794 C CE  . LYS A 1 224 ? 8.079   20.376  -14.169 1.00 25.85 ? 268 LYS A CE  1 
ATOM   1795 N NZ  . LYS A 1 224 ? 7.953   19.191  -15.115 1.00 20.93 ? 268 LYS A NZ  1 
ATOM   1796 N N   . ARG A 1 225 ? 2.935   18.864  -11.512 1.00 16.33 ? 269 ARG A N   1 
ATOM   1797 C CA  . ARG A 1 225 ? 2.134   17.902  -12.321 1.00 18.54 ? 269 ARG A CA  1 
ATOM   1798 C C   . ARG A 1 225 ? 0.794   18.436  -12.697 1.00 20.08 ? 269 ARG A C   1 
ATOM   1799 O O   . ARG A 1 225 ? -0.163  17.701  -13.138 1.00 22.32 ? 269 ARG A O   1 
ATOM   1800 C CB  . ARG A 1 225 ? 1.958   16.642  -11.490 1.00 19.58 ? 269 ARG A CB  1 
ATOM   1801 C CG  . ARG A 1 225 ? 3.197   15.796  -11.466 1.00 19.04 ? 269 ARG A CG  1 
ATOM   1802 C CD  . ARG A 1 225 ? 2.994   14.339  -10.874 1.00 22.84 ? 269 ARG A CD  1 
ATOM   1803 N NE  . ARG A 1 225 ? 4.240   13.737  -11.194 1.00 20.06 ? 269 ARG A NE  1 
ATOM   1804 C CZ  . ARG A 1 225 ? 4.443   12.908  -12.201 1.00 26.05 ? 269 ARG A CZ  1 
ATOM   1805 N NH1 . ARG A 1 225 ? 3.409   12.484  -12.943 1.00 18.62 ? 269 ARG A NH1 1 
ATOM   1806 N NH2 . ARG A 1 225 ? 5.697   12.499  -12.455 1.00 24.67 ? 269 ARG A NH2 1 
ATOM   1807 N N   . ASN A 1 226 ? 0.628   19.732  -12.464 1.00 19.95 ? 270 ASN A N   1 
ATOM   1808 C CA  . ASN A 1 226 ? -0.695  20.242  -12.596 1.00 20.03 ? 270 ASN A CA  1 
ATOM   1809 C C   . ASN A 1 226 ? -1.873  19.621  -11.782 1.00 18.51 ? 270 ASN A C   1 
ATOM   1810 O O   . ASN A 1 226 ? -3.046  19.701  -12.196 1.00 18.41 ? 270 ASN A O   1 
ATOM   1811 C CB  . ASN A 1 226 ? -1.023  20.385  -14.070 1.00 23.22 ? 270 ASN A CB  1 
ATOM   1812 C CG  . ASN A 1 226 ? -1.701  21.679  -14.335 1.00 29.86 ? 270 ASN A CG  1 
ATOM   1813 O OD1 . ASN A 1 226 ? -2.899  21.848  -14.019 1.00 32.40 ? 270 ASN A OD1 1 
ATOM   1814 N ND2 . ASN A 1 226 ? -0.944  22.631  -14.888 1.00 36.53 ? 270 ASN A ND2 1 
ATOM   1815 N N   . ILE A 1 227 ? -1.583  19.173  -10.553 1.00 14.33 ? 271 ILE A N   1 
ATOM   1816 C CA  . ILE A 1 227 ? -2.581  18.608  -9.664  1.00 13.08 ? 271 ILE A CA  1 
ATOM   1817 C C   . ILE A 1 227 ? -2.818  19.601  -8.523  1.00 13.46 ? 271 ILE A C   1 
ATOM   1818 O O   . ILE A 1 227 ? -1.854  20.129  -7.908  1.00 13.12 ? 271 ILE A O   1 
ATOM   1819 C CB  . ILE A 1 227 ? -2.058  17.267  -9.121  1.00 13.05 ? 271 ILE A CB  1 
ATOM   1820 C CG1 . ILE A 1 227 ? -1.831  16.316  -10.326 1.00 13.02 ? 271 ILE A CG1 1 
ATOM   1821 C CG2 . ILE A 1 227 ? -2.953  16.781  -8.038  1.00 9.20  ? 271 ILE A CG2 1 
ATOM   1822 C CD1 . ILE A 1 227 ? -1.114  14.952  -9.953  1.00 17.10 ? 271 ILE A CD1 1 
ATOM   1823 N N   . GLN A 1 228 ? -4.091  19.854  -8.263  1.00 11.89 ? 272 GLN A N   1 
ATOM   1824 C CA  . GLN A 1 228 ? -4.428  20.697  -7.116  1.00 14.68 ? 272 GLN A CA  1 
ATOM   1825 C C   . GLN A 1 228 ? -4.200  19.983  -5.762  1.00 14.69 ? 272 GLN A C   1 
ATOM   1826 O O   . GLN A 1 228 ? -4.264  18.746  -5.676  1.00 13.74 ? 272 GLN A O   1 
ATOM   1827 C CB  . GLN A 1 228 ? -5.885  21.150  -7.288  1.00 14.36 ? 272 GLN A CB  1 
ATOM   1828 C CG  . GLN A 1 228 ? -6.077  22.241  -8.350  1.00 17.83 ? 272 GLN A CG  1 
ATOM   1829 C CD  . GLN A 1 228 ? -7.531  22.620  -8.739  1.00 24.38 ? 272 GLN A CD  1 
ATOM   1830 O OE1 . GLN A 1 228 ? -7.769  23.073  -9.911  1.00 31.57 ? 272 GLN A OE1 1 
ATOM   1831 N NE2 . GLN A 1 228 ? -8.467  22.535  -7.788  1.00 28.33 ? 272 GLN A NE2 1 
ATOM   1832 N N   . PHE A 1 229 ? -4.025  20.771  -4.677  1.00 15.70 ? 273 PHE A N   1 
ATOM   1833 C CA  . PHE A 1 229 ? -3.745  20.197  -3.380  1.00 17.69 ? 273 PHE A CA  1 
ATOM   1834 C C   . PHE A 1 229 ? -4.738  20.672  -2.336  1.00 18.91 ? 273 PHE A C   1 
ATOM   1835 O O   . PHE A 1 229 ? -5.143  21.835  -2.305  1.00 17.57 ? 273 PHE A O   1 
ATOM   1836 C CB  . PHE A 1 229 ? -2.315  20.485  -2.913  1.00 20.53 ? 273 PHE A CB  1 
ATOM   1837 C CG  . PHE A 1 229 ? -1.962  19.841  -1.602  1.00 15.58 ? 273 PHE A CG  1 
ATOM   1838 C CD1 . PHE A 1 229 ? -1.773  18.473  -1.553  1.00 17.15 ? 273 PHE A CD1 1 
ATOM   1839 C CD2 . PHE A 1 229 ? -1.933  20.585  -0.416  1.00 16.48 ? 273 PHE A CD2 1 
ATOM   1840 C CE1 . PHE A 1 229 ? -1.452  17.832  -0.417  1.00 22.67 ? 273 PHE A CE1 1 
ATOM   1841 C CE2 . PHE A 1 229 ? -1.621  19.963  0.767   1.00 18.91 ? 273 PHE A CE2 1 
ATOM   1842 C CZ  . PHE A 1 229 ? -1.346  18.572  0.751   1.00 18.07 ? 273 PHE A CZ  1 
ATOM   1843 N N   . SER A 1 230 ? -5.201  19.726  -1.531  1.00 16.20 ? 274 SER A N   1 
ATOM   1844 C CA  . SER A 1 230 ? -6.086  20.037  -0.444  1.00 18.88 ? 274 SER A CA  1 
ATOM   1845 C C   . SER A 1 230 ? -5.576  19.278  0.789   1.00 17.52 ? 274 SER A C   1 
ATOM   1846 O O   . SER A 1 230 ? -4.931  18.191  0.669   1.00 15.01 ? 274 SER A O   1 
ATOM   1847 C CB  . SER A 1 230 ? -7.514  19.575  -0.786  1.00 18.76 ? 274 SER A CB  1 
ATOM   1848 O OG  . SER A 1 230 ? -8.151  19.360  0.459   1.00 29.07 ? 274 SER A OG  1 
ATOM   1849 N N   . CYS A 1 231 ? -5.833  19.797  2.020   1.00 17.87 ? 275 CYS A N   1 
ATOM   1850 C CA  . CYS A 1 231 ? -5.285  19.074  3.187   1.00 17.98 ? 275 CYS A CA  1 
ATOM   1851 C C   . CYS A 1 231 ? -6.242  19.230  4.365   1.00 18.06 ? 275 CYS A C   1 
ATOM   1852 O O   . CYS A 1 231 ? -6.908  20.237  4.444   1.00 18.15 ? 275 CYS A O   1 
ATOM   1853 C CB  . CYS A 1 231 ? -3.855  19.552  3.535   1.00 20.94 ? 275 CYS A CB  1 
ATOM   1854 S SG  . CYS A 1 231 ? -3.080  18.752  4.987   1.00 22.39 ? 275 CYS A SG  1 
ATOM   1855 N N   . LYS A 1 232 ? -6.380  18.220  5.198   1.00 16.53 ? 276 LYS A N   1 
ATOM   1856 C CA  . LYS A 1 232 ? -7.453  18.158  6.219   1.00 20.06 ? 276 LYS A CA  1 
ATOM   1857 C C   . LYS A 1 232 ? -6.713  17.571  7.447   1.00 20.18 ? 276 LYS A C   1 
ATOM   1858 O O   . LYS A 1 232 ? -6.032  16.533  7.289   1.00 19.34 ? 276 LYS A O   1 
ATOM   1859 C CB  . LYS A 1 232 ? -8.532  17.137  5.788   1.00 21.83 ? 276 LYS A CB  1 
ATOM   1860 C CG  . LYS A 1 232 ? -9.968  17.563  5.651   1.00 29.51 ? 276 LYS A CG  1 
ATOM   1861 C CD  . LYS A 1 232 ? -10.955 16.348  5.204   1.00 37.59 ? 276 LYS A CD  1 
ATOM   1862 C CE  . LYS A 1 232 ? -11.532 15.269  6.358   1.00 40.22 ? 276 LYS A CE  1 
ATOM   1863 N NZ  . LYS A 1 232 ? -12.130 13.843  5.799   1.00 29.32 ? 276 LYS A NZ  1 
ATOM   1864 N N   . ASN A 1 233 ? -6.795  18.184  8.632   1.00 18.51 ? 277 ASN A N   1 
ATOM   1865 C CA  . ASN A 1 233 ? -6.237  17.514  9.856   1.00 17.42 ? 277 ASN A CA  1 
ATOM   1866 C C   . ASN A 1 233 ? -7.257  16.458  10.270  1.00 18.62 ? 277 ASN A C   1 
ATOM   1867 O O   . ASN A 1 233 ? -8.457  16.784  10.364  1.00 19.11 ? 277 ASN A O   1 
ATOM   1868 C CB  . ASN A 1 233 ? -6.131  18.508  11.029  1.00 18.81 ? 277 ASN A CB  1 
ATOM   1869 C CG  . ASN A 1 233 ? -4.921  19.409  10.909  1.00 16.98 ? 277 ASN A CG  1 
ATOM   1870 O OD1 . ASN A 1 233 ? -3.805  18.999  11.231  1.00 14.94 ? 277 ASN A OD1 1 
ATOM   1871 N ND2 . ASN A 1 233 ? -5.112  20.586  10.359  1.00 18.91 ? 277 ASN A ND2 1 
ATOM   1872 N N   . ILE A 1 234 ? -6.845  15.235  10.587  1.00 17.57 ? 278 ILE A N   1 
ATOM   1873 C CA  . ILE A 1 234 ? -7.763  14.397  11.376  1.00 18.64 ? 278 ILE A CA  1 
ATOM   1874 C C   . ILE A 1 234 ? -7.305  14.348  12.857  1.00 18.21 ? 278 ILE A C   1 
ATOM   1875 O O   . ILE A 1 234 ? -6.372  13.621  13.274  1.00 19.73 ? 278 ILE A O   1 
ATOM   1876 C CB  . ILE A 1 234 ? -7.998  12.982  10.741  1.00 18.96 ? 278 ILE A CB  1 
ATOM   1877 C CG1 . ILE A 1 234 ? -8.558  13.117  9.314   1.00 16.45 ? 278 ILE A CG1 1 
ATOM   1878 C CG2 . ILE A 1 234 ? -8.889  12.133  11.645  1.00 21.33 ? 278 ILE A CG2 1 
ATOM   1879 C CD1 . ILE A 1 234 ? -8.967  11.744  8.583   1.00 25.86 ? 278 ILE A CD1 1 
ATOM   1880 N N   . TYR A 1 235 ? -7.959  15.157  13.650  1.00 18.36 ? 279 TYR A N   1 
ATOM   1881 C CA  . TYR A 1 235 ? -7.505  15.430  15.011  1.00 20.02 ? 279 TYR A CA  1 
ATOM   1882 C C   . TYR A 1 235 ? -7.753  14.231  15.903  1.00 20.56 ? 279 TYR A C   1 
ATOM   1883 O O   . TYR A 1 235 ? -6.954  13.956  16.858  1.00 21.73 ? 279 TYR A O   1 
ATOM   1884 C CB  . TYR A 1 235 ? -8.242  16.646  15.597  1.00 19.24 ? 279 TYR A CB  1 
ATOM   1885 C CG  . TYR A 1 235 ? -7.618  17.944  15.100  1.00 20.95 ? 279 TYR A CG  1 
ATOM   1886 C CD1 . TYR A 1 235 ? -6.312  18.318  15.490  1.00 21.21 ? 279 TYR A CD1 1 
ATOM   1887 C CD2 . TYR A 1 235 ? -8.311  18.767  14.210  1.00 22.36 ? 279 TYR A CD2 1 
ATOM   1888 C CE1 . TYR A 1 235 ? -5.723  19.507  15.016  1.00 25.25 ? 279 TYR A CE1 1 
ATOM   1889 C CE2 . TYR A 1 235 ? -7.732  19.960  13.711  1.00 25.52 ? 279 TYR A CE2 1 
ATOM   1890 C CZ  . TYR A 1 235 ? -6.434  20.316  14.137  1.00 28.09 ? 279 TYR A CZ  1 
ATOM   1891 O OH  . TYR A 1 235 ? -5.856  21.461  13.664  1.00 32.79 ? 279 TYR A OH  1 
ATOM   1892 N N   . ARG A 1 236 ? -8.867  13.557  15.632  1.00 19.29 ? 280 ARG A N   1 
ATOM   1893 C CA  . ARG A 1 236 ? -9.306  12.442  16.436  1.00 21.54 ? 280 ARG A CA  1 
ATOM   1894 C C   . ARG A 1 236 ? -9.666  11.220  15.640  1.00 21.94 ? 280 ARG A C   1 
ATOM   1895 O O   . ARG A 1 236 ? -10.843 11.017  15.299  1.00 22.07 ? 280 ARG A O   1 
ATOM   1896 N N   . PRO A 1 237 ? -8.655  10.398  15.365  1.00 22.89 ? 281 PRO A N   1 
ATOM   1897 C CA  . PRO A 1 237 ? -8.809  9.234   14.465  1.00 23.82 ? 281 PRO A CA  1 
ATOM   1898 C C   . PRO A 1 237 ? -9.919  8.249   14.935  1.00 23.56 ? 281 PRO A C   1 
ATOM   1899 O O   . PRO A 1 237 ? -10.701 7.733   14.167  1.00 21.79 ? 281 PRO A O   1 
ATOM   1900 C CB  . PRO A 1 237 ? -7.454  8.562   14.503  1.00 23.79 ? 281 PRO A CB  1 
ATOM   1901 C CG  . PRO A 1 237 ? -6.549  9.464   15.264  1.00 23.64 ? 281 PRO A CG  1 
ATOM   1902 C CD  . PRO A 1 237 ? -7.288  10.563  15.900  1.00 23.82 ? 281 PRO A CD  1 
ATOM   1903 N N   . ASP A 1 238 ? -10.030 8.005   16.233  1.00 24.68 ? 282 ASP A N   1 
ATOM   1904 C CA  . ASP A 1 238 ? -11.105 7.096   16.589  1.00 25.24 ? 282 ASP A CA  1 
ATOM   1905 C C   . ASP A 1 238 ? -12.487 7.692   16.510  1.00 23.41 ? 282 ASP A C   1 
ATOM   1906 O O   . ASP A 1 238 ? -13.414 6.959   16.245  1.00 24.15 ? 282 ASP A O   1 
ATOM   1907 C CB  . ASP A 1 238 ? -10.855 6.264   17.841  1.00 29.16 ? 282 ASP A CB  1 
ATOM   1908 C CG  . ASP A 1 238 ? -10.506 7.087   19.009  1.00 32.58 ? 282 ASP A CG  1 
ATOM   1909 O OD1 . ASP A 1 238 ? -11.269 8.065   19.288  1.00 37.81 ? 282 ASP A OD1 1 
ATOM   1910 O OD2 . ASP A 1 238 ? -9.491  6.826   19.724  1.00 43.80 ? 282 ASP A OD2 1 
ATOM   1911 N N   . LYS A 1 239 ? -12.651 8.995   16.683  1.00 23.87 ? 283 LYS A N   1 
ATOM   1912 C CA  . LYS A 1 239 ? -13.967 9.569   16.381  1.00 24.26 ? 283 LYS A CA  1 
ATOM   1913 C C   . LYS A 1 239 ? -14.201 9.666   14.864  1.00 22.76 ? 283 LYS A C   1 
ATOM   1914 O O   . LYS A 1 239 ? -15.329 9.490   14.386  1.00 19.48 ? 283 LYS A O   1 
ATOM   1915 C CB  . LYS A 1 239 ? -14.134 10.926  17.005  1.00 26.76 ? 283 LYS A CB  1 
ATOM   1916 C CG  . LYS A 1 239 ? -15.015 11.871  16.153  1.00 29.75 ? 283 LYS A CG  1 
ATOM   1917 C CD  . LYS A 1 239 ? -15.568 13.010  16.997  1.00 34.15 ? 283 LYS A CD  1 
ATOM   1918 C CE  . LYS A 1 239 ? -14.920 14.368  16.629  1.00 35.43 ? 283 LYS A CE  1 
ATOM   1919 N NZ  . LYS A 1 239 ? -15.905 15.490  16.705  1.00 36.13 ? 283 LYS A NZ  1 
ATOM   1920 N N   . PHE A 1 240 ? -13.125 9.925   14.094  1.00 21.35 ? 284 PHE A N   1 
ATOM   1921 C CA  . PHE A 1 240 ? -13.242 9.797   12.613  1.00 21.53 ? 284 PHE A CA  1 
ATOM   1922 C C   . PHE A 1 240 ? -13.850 8.439   12.252  1.00 20.37 ? 284 PHE A C   1 
ATOM   1923 O O   . PHE A 1 240 ? -14.868 8.358   11.632  1.00 20.08 ? 284 PHE A O   1 
ATOM   1924 C CB  . PHE A 1 240 ? -11.910 9.939   11.938  1.00 20.75 ? 284 PHE A CB  1 
ATOM   1925 C CG  . PHE A 1 240 ? -11.929 9.678   10.413  1.00 24.49 ? 284 PHE A CG  1 
ATOM   1926 C CD1 . PHE A 1 240 ? -12.591 10.535  9.538   1.00 27.22 ? 284 PHE A CD1 1 
ATOM   1927 C CD2 . PHE A 1 240 ? -11.274 8.556   9.874   1.00 26.42 ? 284 PHE A CD2 1 
ATOM   1928 C CE1 . PHE A 1 240 ? -12.573 10.311  8.103   1.00 24.12 ? 284 PHE A CE1 1 
ATOM   1929 C CE2 . PHE A 1 240 ? -11.274 8.314   8.510   1.00 23.05 ? 284 PHE A CE2 1 
ATOM   1930 C CZ  . PHE A 1 240 ? -11.929 9.215   7.608   1.00 25.62 ? 284 PHE A CZ  1 
ATOM   1931 N N   . LEU A 1 241 ? -13.214 7.369   12.655  1.00 21.57 ? 285 LEU A N   1 
ATOM   1932 C CA  . LEU A 1 241 ? -13.687 6.059   12.352  1.00 22.98 ? 285 LEU A CA  1 
ATOM   1933 C C   . LEU A 1 241 ? -15.117 5.858   12.856  1.00 24.67 ? 285 LEU A C   1 
ATOM   1934 O O   . LEU A 1 241 ? -15.946 5.277   12.156  1.00 22.17 ? 285 LEU A O   1 
ATOM   1935 C CB  . LEU A 1 241 ? -12.796 5.040   13.052  1.00 23.11 ? 285 LEU A CB  1 
ATOM   1936 C CG  . LEU A 1 241 ? -11.741 4.221   12.343  1.00 28.41 ? 285 LEU A CG  1 
ATOM   1937 C CD1 . LEU A 1 241 ? -11.375 3.019   13.144  1.00 29.39 ? 285 LEU A CD1 1 
ATOM   1938 C CD2 . LEU A 1 241 ? -12.113 3.858   10.837  1.00 30.38 ? 285 LEU A CD2 1 
ATOM   1939 N N   . GLN A 1 242 ? -15.382 6.316   14.102  1.00 24.60 ? 286 GLN A N   1 
ATOM   1940 C CA  . GLN A 1 242 ? -16.737 6.285   14.596  1.00 26.79 ? 286 GLN A CA  1 
ATOM   1941 C C   . GLN A 1 242 ? -17.767 6.936   13.653  1.00 27.24 ? 286 GLN A C   1 
ATOM   1942 O O   . GLN A 1 242 ? -18.798 6.317   13.318  1.00 26.62 ? 286 GLN A O   1 
ATOM   1943 C CB  . GLN A 1 242 ? -16.786 6.742   16.085  1.00 26.60 ? 286 GLN A CB  1 
ATOM   1944 C CG  . GLN A 1 242 ? -18.060 6.367   16.813  1.00 34.12 ? 286 GLN A CG  1 
ATOM   1945 C CD  . GLN A 1 242 ? -18.502 4.900   16.655  1.00 40.38 ? 286 GLN A CD  1 
ATOM   1946 O OE1 . GLN A 1 242 ? -19.711 4.622   16.733  1.00 45.21 ? 286 GLN A OE1 1 
ATOM   1947 N NE2 . GLN A 1 242 ? -17.536 3.957   16.474  1.00 41.10 ? 286 GLN A NE2 1 
ATOM   1948 N N   . CYS A 1 243 ? -17.441 8.099   13.097  1.00 27.87 ? 287 CYS A N   1 
ATOM   1949 C CA  . CYS A 1 243 ? -18.388 8.786   12.252  1.00 28.85 ? 287 CYS A CA  1 
ATOM   1950 C C   . CYS A 1 243 ? -18.528 8.060   10.930  1.00 29.38 ? 287 CYS A C   1 
ATOM   1951 O O   . CYS A 1 243 ? -19.613 7.972   10.349  1.00 28.85 ? 287 CYS A O   1 
ATOM   1952 C CB  . CYS A 1 243 ? -17.922 10.220  12.071  1.00 29.15 ? 287 CYS A CB  1 
ATOM   1953 S SG  . CYS A 1 243 ? -18.360 11.344  13.429  1.00 39.12 ? 287 CYS A SG  1 
ATOM   1954 N N   . VAL A 1 244 ? -17.431 7.485   10.454  1.00 29.07 ? 288 VAL A N   1 
ATOM   1955 C CA  . VAL A 1 244 ? -17.476 6.729   9.207   1.00 28.66 ? 288 VAL A CA  1 
ATOM   1956 C C   . VAL A 1 244 ? -18.459 5.537   9.383   1.00 29.36 ? 288 VAL A C   1 
ATOM   1957 O O   . VAL A 1 244 ? -19.279 5.308   8.524   1.00 29.23 ? 288 VAL A O   1 
ATOM   1958 C CB  . VAL A 1 244 ? -16.029 6.275   8.754   1.00 28.16 ? 288 VAL A CB  1 
ATOM   1959 C CG1 . VAL A 1 244 ? -16.089 5.226   7.583   1.00 26.07 ? 288 VAL A CG1 1 
ATOM   1960 C CG2 . VAL A 1 244 ? -15.113 7.504   8.449   1.00 22.03 ? 288 VAL A CG2 1 
ATOM   1961 N N   . LYS A 1 245 ? -18.411 4.816   10.498  1.00 29.13 ? 289 LYS A N   1 
ATOM   1962 C CA  . LYS A 1 245 ? -19.316 3.641   10.652  1.00 31.37 ? 289 LYS A CA  1 
ATOM   1963 C C   . LYS A 1 245 ? -20.769 3.997   10.988  1.00 32.40 ? 289 LYS A C   1 
ATOM   1964 O O   . LYS A 1 245 ? -21.680 3.209   10.776  1.00 34.05 ? 289 LYS A O   1 
ATOM   1965 C CB  . LYS A 1 245 ? -18.874 2.666   11.747  1.00 31.82 ? 289 LYS A CB  1 
ATOM   1966 C CG  . LYS A 1 245 ? -17.501 2.739   12.198  1.00 29.68 ? 289 LYS A CG  1 
ATOM   1967 C CD  . LYS A 1 245 ? -16.992 1.404   12.742  1.00 32.91 ? 289 LYS A CD  1 
ATOM   1968 C CE  . LYS A 1 245 ? -15.542 1.555   13.135  1.00 29.29 ? 289 LYS A CE  1 
ATOM   1969 N NZ  . LYS A 1 245 ? -14.996 0.442   13.941  1.00 36.16 ? 289 LYS A NZ  1 
ATOM   1970 N N   . ASN A 1 246 ? -20.967 5.160   11.567  1.00 33.24 ? 290 ASN A N   1 
ATOM   1971 C CA  . ASN A 1 246 ? -22.270 5.584   12.021  1.00 35.17 ? 290 ASN A CA  1 
ATOM   1972 C C   . ASN A 1 246 ? -22.601 6.865   11.246  1.00 36.49 ? 290 ASN A C   1 
ATOM   1973 O O   . ASN A 1 246 ? -22.633 7.958   11.791  1.00 36.01 ? 290 ASN A O   1 
ATOM   1974 C CB  . ASN A 1 246 ? -22.272 5.756   13.582  1.00 33.71 ? 290 ASN A CB  1 
ATOM   1975 N N   . PRO A 1 247 ? -22.795 6.668   9.931   1.00 39.63 ? 291 PRO A N   1 
ATOM   1976 C CA  . PRO A 1 247 ? -23.075 7.715   8.972   1.00 42.50 ? 291 PRO A CA  1 
ATOM   1977 C C   . PRO A 1 247 ? -24.499 8.091   9.208   1.00 45.21 ? 291 PRO A C   1 
ATOM   1978 O O   . PRO A 1 247 ? -25.381 7.219   9.138   1.00 46.46 ? 291 PRO A O   1 
ATOM   1979 N N   . GLU A 1 248 ? -24.732 9.378   9.469   1.00 46.53 ? 292 GLU A N   1 
ATOM   1980 C CA  . GLU A 1 248 ? -25.946 9.810   10.142  1.00 48.91 ? 292 GLU A CA  1 
ATOM   1981 C C   . GLU A 1 248 ? -25.574 9.880   11.610  1.00 50.00 ? 292 GLU A C   1 
ATOM   1982 O O   . GLU A 1 248 ? -24.455 9.534   11.976  1.00 50.58 ? 292 GLU A O   1 
ATOM   1983 N N   . ASP A 1 249 ? -26.489 10.313  12.464  1.00 51.32 ? 293 ASP A N   1 
ATOM   1984 C CA  . ASP A 1 249 ? -26.119 10.549  13.853  1.00 52.55 ? 293 ASP A CA  1 
ATOM   1985 C C   . ASP A 1 249 ? -24.946 11.516  13.893  1.00 53.01 ? 293 ASP A C   1 
ATOM   1986 O O   . ASP A 1 249 ? -23.968 11.315  14.622  1.00 52.97 ? 293 ASP A O   1 
ATOM   1987 N N   . SER A 1 250 ? -25.071 12.571  13.091  1.00 53.63 ? 294 SER A N   1 
ATOM   1988 C CA  . SER A 1 250 ? -23.996 13.497  12.808  1.00 54.56 ? 294 SER A CA  1 
ATOM   1989 C C   . SER A 1 250 ? -23.823 14.541  13.879  1.00 55.03 ? 294 SER A C   1 
ATOM   1990 O O   . SER A 1 250 ? -24.083 15.727  13.666  1.00 54.89 ? 294 SER A O   1 
ATOM   1991 N N   . SER A 1 251 ? -23.413 14.069  15.049  1.00 55.79 ? 295 SER A N   1 
ATOM   1992 C CA  . SER A 1 251 ? -22.764 14.910  16.023  1.00 56.14 ? 295 SER A CA  1 
ATOM   1993 C C   . SER A 1 251 ? -21.509 15.466  15.386  1.00 56.57 ? 295 SER A C   1 
ATOM   1994 O O   . SER A 1 251 ? -21.379 16.666  15.243  1.00 56.87 ? 295 SER A O   1 
ATOM   1995 N N   . CYS A 1 252 ? -20.600 14.597  14.958  1.00 56.81 ? 296 CYS A N   1 
ATOM   1996 C CA  . CYS A 1 252 ? -19.307 15.048  14.448  1.00 57.33 ? 296 CYS A CA  1 
ATOM   1997 C C   . CYS A 1 252 ? -18.675 16.194  15.244  1.00 56.75 ? 296 CYS A C   1 
ATOM   1998 O O   . CYS A 1 252 ? -18.549 16.150  16.463  1.00 55.91 ? 296 CYS A O   1 
ATOM   1999 C CB  . CYS A 1 252 ? -19.436 15.473  12.980  1.00 57.84 ? 296 CYS A CB  1 
ATOM   2000 S SG  . CYS A 1 252 ? -19.906 14.107  11.932  1.00 61.29 ? 296 CYS A SG  1 
ATOM   2001 N N   . ARG B 1 1   ? -14.959 15.762  3.638   1.00 25.66 ? 45  ARG B N   1 
ATOM   2002 C CA  . ARG B 1 1   ? -15.601 14.422  3.767   1.00 25.04 ? 45  ARG B CA  1 
ATOM   2003 C C   . ARG B 1 1   ? -15.000 13.154  3.036   1.00 22.75 ? 45  ARG B C   1 
ATOM   2004 O O   . ARG B 1 1   ? -14.251 13.153  1.984   1.00 20.93 ? 45  ARG B O   1 
ATOM   2005 C CB  . ARG B 1 1   ? -17.106 14.474  3.661   1.00 24.95 ? 45  ARG B CB  1 
ATOM   2006 C CG  . ARG B 1 1   ? -17.762 13.672  4.782   1.00 34.03 ? 45  ARG B CG  1 
ATOM   2007 C CD  . ARG B 1 1   ? -19.189 13.116  4.582   1.00 41.54 ? 45  ARG B CD  1 
ATOM   2008 N NE  . ARG B 1 1   ? -19.979 13.181  5.828   1.00 47.59 ? 45  ARG B NE  1 
ATOM   2009 C CZ  . ARG B 1 1   ? -21.111 12.497  6.090   1.00 51.04 ? 45  ARG B CZ  1 
ATOM   2010 N NH1 . ARG B 1 1   ? -21.619 11.648  5.211   1.00 53.00 ? 45  ARG B NH1 1 
ATOM   2011 N NH2 . ARG B 1 1   ? -21.741 12.654  7.262   1.00 55.06 ? 45  ARG B NH2 1 
ATOM   2012 N N   . TRP B 1 2   ? -15.330 12.056  3.677   1.00 20.59 ? 46  TRP B N   1 
ATOM   2013 C CA  . TRP B 1 2   ? -14.721 10.781  3.350   1.00 22.07 ? 46  TRP B CA  1 
ATOM   2014 C C   . TRP B 1 2   ? -15.630 9.954   2.396   1.00 21.06 ? 46  TRP B C   1 
ATOM   2015 O O   . TRP B 1 2   ? -15.278 8.862   2.014   1.00 21.26 ? 46  TRP B O   1 
ATOM   2016 C CB  . TRP B 1 2   ? -14.431 10.046  4.674   1.00 20.03 ? 46  TRP B CB  1 
ATOM   2017 C CG  . TRP B 1 2   ? -15.671 9.982   5.500   1.00 22.63 ? 46  TRP B CG  1 
ATOM   2018 C CD1 . TRP B 1 2   ? -16.675 9.053   5.396   1.00 21.63 ? 46  TRP B CD1 1 
ATOM   2019 C CD2 . TRP B 1 2   ? -16.089 10.917  6.502   1.00 24.91 ? 46  TRP B CD2 1 
ATOM   2020 N NE1 . TRP B 1 2   ? -17.694 9.357   6.262   1.00 21.33 ? 46  TRP B NE1 1 
ATOM   2021 C CE2 . TRP B 1 2   ? -17.350 10.493  6.968   1.00 27.63 ? 46  TRP B CE2 1 
ATOM   2022 C CE3 . TRP B 1 2   ? -15.529 12.086  7.032   1.00 27.55 ? 46  TRP B CE3 1 
ATOM   2023 C CZ2 . TRP B 1 2   ? -18.054 11.178  7.979   1.00 30.30 ? 46  TRP B CZ2 1 
ATOM   2024 C CZ3 . TRP B 1 2   ? -16.227 12.772  8.076   1.00 31.91 ? 46  TRP B CZ3 1 
ATOM   2025 C CH2 . TRP B 1 2   ? -17.469 12.305  8.526   1.00 31.89 ? 46  TRP B CH2 1 
ATOM   2026 N N   . ARG B 1 3   ? -16.820 10.450  2.080   1.00 22.79 ? 47  ARG B N   1 
ATOM   2027 C CA  . ARG B 1 3   ? -17.752 9.688   1.260   1.00 23.34 ? 47  ARG B CA  1 
ATOM   2028 C C   . ARG B 1 3   ? -18.153 10.366  -0.037  1.00 22.54 ? 47  ARG B C   1 
ATOM   2029 O O   . ARG B 1 3   ? -18.393 11.577  -0.115  1.00 26.32 ? 47  ARG B O   1 
ATOM   2030 C CB  . ARG B 1 3   ? -19.022 9.211   2.040   1.00 25.34 ? 47  ARG B CB  1 
ATOM   2031 C CG  . ARG B 1 3   ? -19.929 10.304  2.595   1.00 31.42 ? 47  ARG B CG  1 
ATOM   2032 C CD  . ARG B 1 3   ? -20.776 9.878   3.846   1.00 38.16 ? 47  ARG B CD  1 
ATOM   2033 N NE  . ARG B 1 3   ? -21.744 8.786   3.614   1.00 45.10 ? 47  ARG B NE  1 
ATOM   2034 C CZ  . ARG B 1 3   ? -23.084 8.855   3.832   1.00 48.02 ? 47  ARG B CZ  1 
ATOM   2035 N NH1 . ARG B 1 3   ? -23.679 9.964   4.282   1.00 49.06 ? 47  ARG B NH1 1 
ATOM   2036 N NH2 . ARG B 1 3   ? -23.843 7.799   3.589   1.00 48.19 ? 47  ARG B NH2 1 
ATOM   2037 N N   . GLN B 1 4   ? -18.235 9.588   -1.074  1.00 19.63 ? 48  GLN B N   1 
ATOM   2038 C CA  . GLN B 1 4   ? -18.555 10.224  -2.370  1.00 18.37 ? 48  GLN B CA  1 
ATOM   2039 C C   . GLN B 1 4   ? -19.998 10.090  -2.599  1.00 17.40 ? 48  GLN B C   1 
ATOM   2040 O O   . GLN B 1 4   ? -20.581 9.114   -2.182  1.00 17.45 ? 48  GLN B O   1 
ATOM   2041 C CB  . GLN B 1 4   ? -17.715 9.572   -3.462  1.00 18.26 ? 48  GLN B CB  1 
ATOM   2042 C CG  . GLN B 1 4   ? -16.237 10.002  -3.211  1.00 18.53 ? 48  GLN B CG  1 
ATOM   2043 C CD  . GLN B 1 4   ? -15.292 9.475   -4.214  1.00 24.69 ? 48  GLN B CD  1 
ATOM   2044 O OE1 . GLN B 1 4   ? -15.706 9.037   -5.297  1.00 19.38 ? 48  GLN B OE1 1 
ATOM   2045 N NE2 . GLN B 1 4   ? -14.006 9.421   -3.842  1.00 28.40 ? 48  GLN B NE2 1 
ATOM   2046 N N   . THR B 1 5   ? -20.579 11.067  -3.254  1.00 17.68 ? 49  THR B N   1 
ATOM   2047 C CA  . THR B 1 5   ? -22.004 11.017  -3.589  1.00 19.52 ? 49  THR B CA  1 
ATOM   2048 C C   . THR B 1 5   ? -22.430 9.885   -4.514  1.00 17.90 ? 49  THR B C   1 
ATOM   2049 O O   . THR B 1 5   ? -23.452 9.255   -4.276  1.00 18.80 ? 49  THR B O   1 
ATOM   2050 C CB  . THR B 1 5   ? -22.418 12.341  -4.161  1.00 20.75 ? 49  THR B CB  1 
ATOM   2051 O OG1 . THR B 1 5   ? -21.788 13.379  -3.374  1.00 28.22 ? 49  THR B OG1 1 
ATOM   2052 C CG2 . THR B 1 5   ? -23.831 12.549  -3.863  1.00 23.63 ? 49  THR B CG2 1 
ATOM   2053 N N   . TRP B 1 6   ? -21.636 9.592   -5.544  1.00 14.87 ? 50  TRP B N   1 
ATOM   2054 C CA  . TRP B 1 6   ? -22.068 8.710   -6.602  1.00 10.80 ? 50  TRP B CA  1 
ATOM   2055 C C   . TRP B 1 6   ? -21.016 7.644   -6.818  1.00 13.46 ? 50  TRP B C   1 
ATOM   2056 O O   . TRP B 1 6   ? -19.930 7.707   -6.249  1.00 10.58 ? 50  TRP B O   1 
ATOM   2057 C CB  . TRP B 1 6   ? -22.128 9.491   -7.953  1.00 9.46  ? 50  TRP B CB  1 
ATOM   2058 C CG  . TRP B 1 6   ? -23.008 10.786  -7.771  1.00 10.26 ? 50  TRP B CG  1 
ATOM   2059 C CD1 . TRP B 1 6   ? -22.616 12.084  -7.786  1.00 8.49  ? 50  TRP B CD1 1 
ATOM   2060 C CD2 . TRP B 1 6   ? -24.400 10.780  -7.525  1.00 6.57  ? 50  TRP B CD2 1 
ATOM   2061 N NE1 . TRP B 1 6   ? -23.711 12.907  -7.644  1.00 6.88  ? 50  TRP B NE1 1 
ATOM   2062 C CE2 . TRP B 1 6   ? -24.817 12.121  -7.405  1.00 9.07  ? 50  TRP B CE2 1 
ATOM   2063 C CE3 . TRP B 1 6   ? -25.335 9.760   -7.310  1.00 11.11 ? 50  TRP B CE3 1 
ATOM   2064 C CZ2 . TRP B 1 6   ? -26.143 12.481  -7.126  1.00 14.22 ? 50  TRP B CZ2 1 
ATOM   2065 C CZ3 . TRP B 1 6   ? -26.695 10.107  -7.041  1.00 19.21 ? 50  TRP B CZ3 1 
ATOM   2066 C CH2 . TRP B 1 6   ? -27.090 11.461  -6.992  1.00 13.79 ? 50  TRP B CH2 1 
ATOM   2067 N N   . SER B 1 7   ? -21.387 6.710   -7.679  1.00 10.07 ? 51  SER B N   1 
ATOM   2068 C CA  . SER B 1 7   ? -20.535 5.577   -8.047  1.00 14.98 ? 51  SER B CA  1 
ATOM   2069 C C   . SER B 1 7   ? -19.675 5.732   -9.266  1.00 11.57 ? 51  SER B C   1 
ATOM   2070 O O   . SER B 1 7   ? -18.746 4.936   -9.440  1.00 12.48 ? 51  SER B O   1 
ATOM   2071 C CB  . SER B 1 7   ? -21.409 4.338   -8.320  1.00 12.98 ? 51  SER B CB  1 
ATOM   2072 O OG  . SER B 1 7   ? -21.718 3.998   -7.005  1.00 17.10 ? 51  SER B OG  1 
ATOM   2073 N N   . GLY B 1 8   ? -19.998 6.686   -10.135 1.00 10.72 ? 52  GLY B N   1 
ATOM   2074 C CA  . GLY B 1 8   ? -19.295 6.773   -11.394 1.00 9.10  ? 52  GLY B CA  1 
ATOM   2075 C C   . GLY B 1 8   ? -18.137 7.780   -11.347 1.00 10.40 ? 52  GLY B C   1 
ATOM   2076 O O   . GLY B 1 8   ? -18.052 8.543   -10.349 1.00 11.89 ? 52  GLY B O   1 
ATOM   2077 N N   . PRO B 1 9   ? -17.303 7.845   -12.416 1.00 11.87 ? 53  PRO B N   1 
ATOM   2078 C CA  . PRO B 1 9   ? -16.161 8.782   -12.479 1.00 10.94 ? 53  PRO B CA  1 
ATOM   2079 C C   . PRO B 1 9   ? -16.665 10.220  -12.311 1.00 12.01 ? 53  PRO B C   1 
ATOM   2080 O O   . PRO B 1 9   ? -17.834 10.553  -12.744 1.00 12.31 ? 53  PRO B O   1 
ATOM   2081 C CB  . PRO B 1 9   ? -15.573 8.592   -13.892 1.00 13.43 ? 53  PRO B CB  1 
ATOM   2082 C CG  . PRO B 1 9   ? -16.363 7.375   -14.526 1.00 18.24 ? 53  PRO B CG  1 
ATOM   2083 C CD  . PRO B 1 9   ? -17.335 6.829   -13.526 1.00 14.35 ? 53  PRO B CD  1 
ATOM   2084 N N   . GLY B 1 10  ? -15.848 11.038  -11.696 1.00 8.78  ? 54  GLY B N   1 
ATOM   2085 C CA  . GLY B 1 10  ? -16.221 12.455  -11.589 1.00 9.63  ? 54  GLY B CA  1 
ATOM   2086 C C   . GLY B 1 10  ? -16.003 13.259  -12.887 1.00 8.96  ? 54  GLY B C   1 
ATOM   2087 O O   . GLY B 1 10  ? -15.549 12.676  -13.843 1.00 10.34 ? 54  GLY B O   1 
ATOM   2088 N N   . THR B 1 11  ? -16.397 14.547  -12.899 1.00 9.03  ? 55  THR B N   1 
ATOM   2089 C CA  . THR B 1 11  ? -16.170 15.453  -13.994 1.00 8.91  ? 55  THR B CA  1 
ATOM   2090 C C   . THR B 1 11  ? -14.652 15.446  -14.388 1.00 9.01  ? 55  THR B C   1 
ATOM   2091 O O   . THR B 1 11  ? -13.804 15.467  -13.554 1.00 8.46  ? 55  THR B O   1 
ATOM   2092 C CB  . THR B 1 11  ? -16.623 16.885  -13.728 1.00 10.03 ? 55  THR B CB  1 
ATOM   2093 O OG1 . THR B 1 11  ? -17.989 16.961  -13.309 1.00 11.33 ? 55  THR B OG1 1 
ATOM   2094 C CG2 . THR B 1 11  ? -16.470 17.738  -15.036 1.00 7.68  ? 55  THR B CG2 1 
ATOM   2095 N N   . THR B 1 12  ? -14.364 15.396  -15.667 1.00 10.75 ? 56  THR B N   1 
ATOM   2096 C CA  . THR B 1 12  ? -12.963 15.327  -16.185 1.00 11.23 ? 56  THR B CA  1 
ATOM   2097 C C   . THR B 1 12  ? -12.193 16.569  -15.690 1.00 11.42 ? 56  THR B C   1 
ATOM   2098 O O   . THR B 1 12  ? -12.739 17.674  -15.703 1.00 10.79 ? 56  THR B O   1 
ATOM   2099 C CB  . THR B 1 12  ? -13.081 15.386  -17.661 1.00 11.66 ? 56  THR B CB  1 
ATOM   2100 O OG1 . THR B 1 12  ? -13.958 14.336  -18.125 1.00 12.66 ? 56  THR B OG1 1 
ATOM   2101 C CG2 . THR B 1 12  ? -11.675 15.235  -18.370 1.00 13.14 ? 56  THR B CG2 1 
ATOM   2102 N N   . LYS B 1 13  ? -10.982 16.359  -15.215 1.00 9.31  ? 57  LYS B N   1 
ATOM   2103 C CA  . LYS B 1 13  ? -10.108 17.414  -14.773 1.00 14.56 ? 57  LYS B CA  1 
ATOM   2104 C C   . LYS B 1 13  ? -10.255 18.621  -15.701 1.00 15.23 ? 57  LYS B C   1 
ATOM   2105 O O   . LYS B 1 13  ? -10.205 18.431  -16.912 1.00 15.81 ? 57  LYS B O   1 
ATOM   2106 C CB  . LYS B 1 13  ? -8.689  16.899  -14.997 1.00 14.82 ? 57  LYS B CB  1 
ATOM   2107 C CG  . LYS B 1 13  ? -7.767  17.567  -14.159 1.00 21.85 ? 57  LYS B CG  1 
ATOM   2108 C CD  . LYS B 1 13  ? -6.420  16.891  -14.197 1.00 12.61 ? 57  LYS B CD  1 
ATOM   2109 C CE  . LYS B 1 13  ? -5.462  17.973  -14.118 1.00 11.69 ? 57  LYS B CE  1 
ATOM   2110 N NZ  . LYS B 1 13  ? -4.224  17.427  -13.718 1.00 12.19 ? 57  LYS B NZ  1 
ATOM   2111 N N   . ARG B 1 14  ? -10.350 19.827  -15.181 1.00 17.06 ? 58  ARG B N   1 
ATOM   2112 C CA  . ARG B 1 14  ? -10.370 21.034  -16.054 1.00 19.65 ? 58  ARG B CA  1 
ATOM   2113 C C   . ARG B 1 14  ? -11.371 21.032  -17.195 1.00 21.03 ? 58  ARG B C   1 
ATOM   2114 O O   . ARG B 1 14  ? -11.146 21.614  -18.255 1.00 20.16 ? 58  ARG B O   1 
ATOM   2115 C CB  . ARG B 1 14  ? -8.951  21.309  -16.565 1.00 22.76 ? 58  ARG B CB  1 
ATOM   2116 C CG  . ARG B 1 14  ? -7.970  21.281  -15.497 1.00 26.28 ? 58  ARG B CG  1 
ATOM   2117 C CD  . ARG B 1 14  ? -6.571  21.029  -16.010 1.00 38.32 ? 58  ARG B CD  1 
ATOM   2118 N NE  . ARG B 1 14  ? -6.332  21.884  -17.160 1.00 42.40 ? 58  ARG B NE  1 
ATOM   2119 C CZ  . ARG B 1 14  ? -6.154  23.195  -17.074 1.00 48.33 ? 58  ARG B CZ  1 
ATOM   2120 N NH1 . ARG B 1 14  ? -6.160  23.804  -15.872 1.00 48.96 ? 58  ARG B NH1 1 
ATOM   2121 N NH2 . ARG B 1 14  ? -5.950  23.891  -18.193 1.00 49.36 ? 58  ARG B NH2 1 
ATOM   2122 N N   . PHE B 1 15  ? -12.526 20.357  -16.984 1.00 19.54 ? 59  PHE B N   1 
ATOM   2123 C CA  . PHE B 1 15  ? -13.601 20.282  -17.974 1.00 18.04 ? 59  PHE B CA  1 
ATOM   2124 C C   . PHE B 1 15  ? -13.968 21.664  -18.633 1.00 18.56 ? 59  PHE B C   1 
ATOM   2125 O O   . PHE B 1 15  ? -14.082 21.729  -19.873 1.00 17.80 ? 59  PHE B O   1 
ATOM   2126 C CB  . PHE B 1 15  ? -14.872 19.604  -17.311 1.00 15.62 ? 59  PHE B CB  1 
ATOM   2127 C CG  . PHE B 1 15  ? -16.062 19.435  -18.262 1.00 17.71 ? 59  PHE B CG  1 
ATOM   2128 C CD1 . PHE B 1 15  ? -16.042 18.471  -19.261 1.00 18.13 ? 59  PHE B CD1 1 
ATOM   2129 C CD2 . PHE B 1 15  ? -17.242 20.183  -18.087 1.00 18.14 ? 59  PHE B CD2 1 
ATOM   2130 C CE1 . PHE B 1 15  ? -17.148 18.294  -20.126 1.00 17.07 ? 59  PHE B CE1 1 
ATOM   2131 C CE2 . PHE B 1 15  ? -18.344 19.958  -18.868 1.00 15.49 ? 59  PHE B CE2 1 
ATOM   2132 C CZ  . PHE B 1 15  ? -18.283 19.058  -19.954 1.00 18.67 ? 59  PHE B CZ  1 
ATOM   2133 N N   . PRO B 1 16  ? -14.123 22.741  -17.871 1.00 19.32 ? 60  PRO B N   1 
ATOM   2134 C CA  . PRO B 1 16  ? -14.463 24.057  -18.473 1.00 22.19 ? 60  PRO B CA  1 
ATOM   2135 C C   . PRO B 1 16  ? -13.371 24.600  -19.418 1.00 22.98 ? 60  PRO B C   1 
ATOM   2136 O O   . PRO B 1 16  ? -13.733 24.965  -20.535 1.00 24.61 ? 60  PRO B O   1 
ATOM   2137 C CB  . PRO B 1 16  ? -14.587 24.960  -17.250 1.00 21.62 ? 60  PRO B CB  1 
ATOM   2138 C CG  . PRO B 1 16  ? -14.991 24.014  -16.211 1.00 19.65 ? 60  PRO B CG  1 
ATOM   2139 C CD  . PRO B 1 16  ? -14.033 22.891  -16.421 1.00 20.26 ? 60  PRO B CD  1 
ATOM   2140 N N   . GLU B 1 17  ? -12.099 24.623  -19.014 1.00 23.67 ? 61  GLU B N   1 
ATOM   2141 C CA  . GLU B 1 17  ? -11.004 24.996  -19.989 1.00 25.16 ? 61  GLU B CA  1 
ATOM   2142 C C   . GLU B 1 17  ? -11.058 24.092  -21.223 1.00 24.68 ? 61  GLU B C   1 
ATOM   2143 O O   . GLU B 1 17  ? -11.003 24.557  -22.372 1.00 24.41 ? 61  GLU B O   1 
ATOM   2144 C CB  . GLU B 1 17  ? -9.635  25.021  -19.322 1.00 25.72 ? 61  GLU B CB  1 
ATOM   2145 C CG  . GLU B 1 17  ? -9.736  25.803  -17.990 1.00 30.53 ? 61  GLU B CG  1 
ATOM   2146 C CD  . GLU B 1 17  ? -9.715  24.946  -16.697 1.00 35.90 ? 61  GLU B CD  1 
ATOM   2147 O OE1 . GLU B 1 17  ? -10.811 24.449  -16.126 1.00 26.90 ? 61  GLU B OE1 1 
ATOM   2148 O OE2 . GLU B 1 17  ? -8.544  24.811  -16.224 1.00 38.23 ? 61  GLU B OE2 1 
ATOM   2149 N N   . THR B 1 18  ? -11.310 22.814  -20.992 1.00 24.43 ? 62  THR B N   1 
ATOM   2150 C CA  . THR B 1 18  ? -11.305 21.843  -22.061 1.00 24.53 ? 62  THR B CA  1 
ATOM   2151 C C   . THR B 1 18  ? -12.354 22.036  -23.117 1.00 25.23 ? 62  THR B C   1 
ATOM   2152 O O   . THR B 1 18  ? -12.018 22.005  -24.300 1.00 24.64 ? 62  THR B O   1 
ATOM   2153 C CB  . THR B 1 18  ? -11.398 20.406  -21.526 1.00 23.99 ? 62  THR B CB  1 
ATOM   2154 O OG1 . THR B 1 18  ? -10.177 20.068  -20.881 1.00 24.14 ? 62  THR B OG1 1 
ATOM   2155 C CG2 . THR B 1 18  ? -11.423 19.455  -22.718 1.00 23.41 ? 62  THR B CG2 1 
ATOM   2156 N N   . VAL B 1 19  ? -13.628 22.127  -22.732 1.00 26.48 ? 63  VAL B N   1 
ATOM   2157 C CA  . VAL B 1 19  ? -14.722 22.310  -23.723 1.00 27.72 ? 63  VAL B CA  1 
ATOM   2158 C C   . VAL B 1 19  ? -14.563 23.616  -24.525 1.00 29.64 ? 63  VAL B C   1 
ATOM   2159 O O   . VAL B 1 19  ? -14.867 23.720  -25.798 1.00 28.56 ? 63  VAL B O   1 
ATOM   2160 C CB  . VAL B 1 19  ? -16.114 22.310  -23.014 1.00 29.33 ? 63  VAL B CB  1 
ATOM   2161 C CG1 . VAL B 1 19  ? -17.202 22.689  -24.030 1.00 30.38 ? 63  VAL B CG1 1 
ATOM   2162 C CG2 . VAL B 1 19  ? -16.393 20.938  -22.361 1.00 25.96 ? 63  VAL B CG2 1 
ATOM   2163 N N   . LEU B 1 20  ? -14.095 24.647  -23.825 1.00 27.83 ? 64  LEU B N   1 
ATOM   2164 C CA  . LEU B 1 20  ? -13.869 25.911  -24.507 1.00 30.52 ? 64  LEU B CA  1 
ATOM   2165 C C   . LEU B 1 20  ? -12.752 25.815  -25.593 1.00 31.15 ? 64  LEU B C   1 
ATOM   2166 O O   . LEU B 1 20  ? -12.940 26.310  -26.713 1.00 33.60 ? 64  LEU B O   1 
ATOM   2167 C CB  . LEU B 1 20  ? -13.613 27.040  -23.518 1.00 28.09 ? 64  LEU B CB  1 
ATOM   2168 C CG  . LEU B 1 20  ? -13.582 28.421  -24.204 1.00 32.89 ? 64  LEU B CG  1 
ATOM   2169 C CD1 . LEU B 1 20  ? -14.833 28.663  -25.059 1.00 30.97 ? 64  LEU B CD1 1 
ATOM   2170 C CD2 . LEU B 1 20  ? -13.402 29.520  -23.213 1.00 32.99 ? 64  LEU B CD2 1 
ATOM   2171 N N   . ALA B 1 21  ? -11.629 25.162  -25.278 1.00 32.81 ? 65  ALA B N   1 
ATOM   2172 C CA  . ALA B 1 21  ? -10.511 24.966  -26.223 1.00 32.70 ? 65  ALA B CA  1 
ATOM   2173 C C   . ALA B 1 21  ? -10.955 24.088  -27.417 1.00 33.79 ? 65  ALA B C   1 
ATOM   2174 O O   . ALA B 1 21  ? -10.600 24.361  -28.613 1.00 30.60 ? 65  ALA B O   1 
ATOM   2175 C CB  . ALA B 1 21  ? -9.350  24.332  -25.507 1.00 33.09 ? 65  ALA B CB  1 
ATOM   2176 N N   . ARG B 1 22  ? -11.748 23.055  -27.127 1.00 32.14 ? 66  ARG B N   1 
ATOM   2177 C CA  . ARG B 1 22  ? -12.326 22.279  -28.197 1.00 33.81 ? 66  ARG B CA  1 
ATOM   2178 C C   . ARG B 1 22  ? -13.188 23.258  -29.072 1.00 35.97 ? 66  ARG B C   1 
ATOM   2179 O O   . ARG B 1 22  ? -13.288 23.047  -30.251 1.00 34.10 ? 66  ARG B O   1 
ATOM   2180 C CB  . ARG B 1 22  ? -13.169 21.094  -27.677 1.00 31.92 ? 66  ARG B CB  1 
ATOM   2181 C CG  . ARG B 1 22  ? -12.317 19.879  -27.119 1.00 31.55 ? 66  ARG B CG  1 
ATOM   2182 C CD  . ARG B 1 22  ? -13.156 18.808  -26.361 1.00 28.35 ? 66  ARG B CD  1 
ATOM   2183 N NE  . ARG B 1 22  ? -12.297 17.687  -25.953 1.00 27.35 ? 66  ARG B NE  1 
ATOM   2184 C CZ  . ARG B 1 22  ? -12.672 16.403  -25.863 1.00 24.28 ? 66  ARG B CZ  1 
ATOM   2185 N NH1 . ARG B 1 22  ? -13.895 16.034  -26.182 1.00 22.78 ? 66  ARG B NH1 1 
ATOM   2186 N NH2 . ARG B 1 22  ? -11.787 15.491  -25.519 1.00 22.26 ? 66  ARG B NH2 1 
ATOM   2187 N N   . CYS B 1 23  ? -13.890 24.248  -28.469 1.00 40.40 ? 67  CYS B N   1 
ATOM   2188 C CA  . CYS B 1 23  ? -14.901 24.914  -29.338 1.00 40.14 ? 67  CYS B CA  1 
ATOM   2189 C C   . CYS B 1 23  ? -14.169 25.824  -30.334 1.00 43.32 ? 67  CYS B C   1 
ATOM   2190 O O   . CYS B 1 23  ? -14.475 25.832  -31.532 1.00 42.40 ? 67  CYS B O   1 
ATOM   2191 C CB  . CYS B 1 23  ? -15.932 25.650  -28.485 1.00 42.52 ? 67  CYS B CB  1 
ATOM   2192 S SG  . CYS B 1 23  ? -17.194 26.513  -29.455 1.00 42.80 ? 67  CYS B SG  1 
ATOM   2193 N N   . VAL B 1 24  ? -13.142 26.523  -29.842 1.00 42.73 ? 68  VAL B N   1 
ATOM   2194 C CA  . VAL B 1 24  ? -12.269 27.266  -30.716 1.00 45.48 ? 68  VAL B CA  1 
ATOM   2195 C C   . VAL B 1 24  ? -11.678 26.363  -31.835 1.00 46.13 ? 68  VAL B C   1 
ATOM   2196 O O   . VAL B 1 24  ? -11.746 26.753  -32.991 1.00 46.01 ? 68  VAL B O   1 
ATOM   2197 C CB  . VAL B 1 24  ? -11.114 27.932  -29.943 1.00 44.40 ? 68  VAL B CB  1 
ATOM   2198 C CG1 . VAL B 1 24  ? -10.062 28.425  -30.931 1.00 45.78 ? 68  VAL B CG1 1 
ATOM   2199 C CG2 . VAL B 1 24  ? -11.665 29.123  -29.053 1.00 45.55 ? 68  VAL B CG2 1 
ATOM   2200 N N   . LYS B 1 25  ? -11.151 25.156  -31.484 1.00 47.18 ? 69  LYS B N   1 
ATOM   2201 C CA  . LYS B 1 25  ? -10.566 24.193  -32.440 1.00 48.58 ? 69  LYS B CA  1 
ATOM   2202 C C   . LYS B 1 25  ? -11.562 23.651  -33.506 1.00 50.06 ? 69  LYS B C   1 
ATOM   2203 O O   . LYS B 1 25  ? -11.167 23.457  -34.664 1.00 49.25 ? 69  LYS B O   1 
ATOM   2204 C CB  . LYS B 1 25  ? -9.986  23.001  -31.657 1.00 49.08 ? 69  LYS B CB  1 
ATOM   2205 C CG  . LYS B 1 25  ? -8.497  22.755  -31.820 1.00 50.30 ? 69  LYS B CG  1 
ATOM   2206 C CD  . LYS B 1 25  ? -8.260  21.625  -32.824 1.00 52.80 ? 69  LYS B CD  1 
ATOM   2207 C CE  . LYS B 1 25  ? -6.830  21.564  -33.293 1.00 52.30 ? 69  LYS B CE  1 
ATOM   2208 N NZ  . LYS B 1 25  ? -6.010  20.828  -32.302 1.00 53.62 ? 69  LYS B NZ  1 
ATOM   2209 N N   . TYR B 1 26  ? -12.827 23.351  -33.087 1.00 51.66 ? 70  TYR B N   1 
ATOM   2210 C CA  . TYR B 1 26  ? -13.957 22.871  -33.980 1.00 53.93 ? 70  TYR B CA  1 
ATOM   2211 C C   . TYR B 1 26  ? -14.253 23.981  -35.017 1.00 53.54 ? 70  TYR B C   1 
ATOM   2212 O O   . TYR B 1 26  ? -14.108 23.781  -36.260 1.00 55.22 ? 70  TYR B O   1 
ATOM   2213 C CB  . TYR B 1 26  ? -15.246 22.431  -33.122 1.00 55.65 ? 70  TYR B CB  1 
ATOM   2214 C CG  . TYR B 1 26  ? -16.311 21.596  -33.907 1.00 61.42 ? 70  TYR B CG  1 
ATOM   2215 C CD1 . TYR B 1 26  ? -16.263 20.203  -33.901 1.00 63.90 ? 70  TYR B CD1 1 
ATOM   2216 C CD2 . TYR B 1 26  ? -17.280 22.212  -34.713 1.00 66.97 ? 70  TYR B CD2 1 
ATOM   2217 C CE1 . TYR B 1 26  ? -17.168 19.450  -34.672 1.00 68.62 ? 70  TYR B CE1 1 
ATOM   2218 C CE2 . TYR B 1 26  ? -18.200 21.468  -35.463 1.00 71.09 ? 70  TYR B CE2 1 
ATOM   2219 C CZ  . TYR B 1 26  ? -18.144 20.096  -35.432 1.00 71.08 ? 70  TYR B CZ  1 
ATOM   2220 O OH  . TYR B 1 26  ? -19.040 19.358  -36.169 1.00 73.94 ? 70  TYR B OH  1 
ATOM   2221 N N   . THR B 1 27  ? -14.530 25.172  -34.479 1.00 52.72 ? 71  THR B N   1 
ATOM   2222 C CA  . THR B 1 27  ? -14.767 26.421  -35.315 1.00 52.33 ? 71  THR B CA  1 
ATOM   2223 C C   . THR B 1 27  ? -13.694 26.751  -36.367 1.00 52.24 ? 71  THR B C   1 
ATOM   2224 O O   . THR B 1 27  ? -14.042 27.032  -37.513 1.00 52.75 ? 71  THR B O   1 
ATOM   2225 C CB  . THR B 1 27  ? -15.049 27.677  -34.426 1.00 52.00 ? 71  THR B CB  1 
ATOM   2226 O OG1 . THR B 1 27  ? -14.085 27.799  -33.376 1.00 52.95 ? 71  THR B OG1 1 
ATOM   2227 C CG2 . THR B 1 27  ? -16.308 27.531  -33.686 1.00 49.96 ? 71  THR B CG2 1 
ATOM   2228 N N   . GLU B 1 28  ? -12.419 26.694  -35.961 1.00 52.34 ? 72  GLU B N   1 
ATOM   2229 C CA  . GLU B 1 28  ? -11.252 27.066  -36.810 1.00 52.45 ? 72  GLU B CA  1 
ATOM   2230 C C   . GLU B 1 28  ? -10.757 25.946  -37.750 1.00 52.75 ? 72  GLU B C   1 
ATOM   2231 O O   . GLU B 1 28  ? -9.794  26.142  -38.507 1.00 52.96 ? 72  GLU B O   1 
ATOM   2232 C CB  . GLU B 1 28  ? -10.075 27.505  -35.931 1.00 52.32 ? 72  GLU B CB  1 
ATOM   2233 C CG  . GLU B 1 28  ? -9.279  26.325  -35.358 1.00 50.94 ? 72  GLU B CG  1 
ATOM   2234 C CD  . GLU B 1 28  ? -7.754  26.478  -35.484 1.00 53.91 ? 72  GLU B CD  1 
ATOM   2235 O OE1 . GLU B 1 28  ? -7.275  27.108  -36.475 1.00 52.61 ? 72  GLU B OE1 1 
ATOM   2236 O OE2 . GLU B 1 28  ? -7.029  25.960  -34.579 1.00 53.03 ? 72  GLU B OE2 1 
ATOM   2237 N N   . ILE B 1 29  ? -11.385 24.769  -37.668 1.00 52.61 ? 73  ILE B N   1 
ATOM   2238 C CA  . ILE B 1 29  ? -11.104 23.700  -38.637 1.00 52.87 ? 73  ILE B CA  1 
ATOM   2239 C C   . ILE B 1 29  ? -12.293 23.509  -39.597 1.00 53.49 ? 73  ILE B C   1 
ATOM   2240 O O   . ILE B 1 29  ? -12.084 23.322  -40.800 1.00 53.36 ? 73  ILE B O   1 
ATOM   2241 C CB  . ILE B 1 29  ? -10.665 22.380  -37.918 1.00 53.18 ? 73  ILE B CB  1 
ATOM   2242 C CG1 . ILE B 1 29  ? -9.183  22.478  -37.512 1.00 53.00 ? 73  ILE B CG1 1 
ATOM   2243 C CG2 . ILE B 1 29  ? -11.002 21.108  -38.738 1.00 53.11 ? 73  ILE B CG2 1 
ATOM   2244 C CD1 . ILE B 1 29  ? -8.617  21.254  -36.819 1.00 53.99 ? 73  ILE B CD1 1 
ATOM   2245 N N   . HIS B 1 30  ? -13.517 23.623  -39.074 1.00 53.83 ? 74  HIS B N   1 
ATOM   2246 C CA  . HIS B 1 30  ? -14.762 23.429  -39.832 1.00 54.84 ? 74  HIS B CA  1 
ATOM   2247 C C   . HIS B 1 30  ? -15.340 24.804  -40.269 1.00 55.21 ? 74  HIS B C   1 
ATOM   2248 O O   . HIS B 1 30  ? -16.240 25.309  -39.602 1.00 55.39 ? 74  HIS B O   1 
ATOM   2249 C CB  . HIS B 1 30  ? -15.811 22.711  -38.935 1.00 54.88 ? 74  HIS B CB  1 
ATOM   2250 C CG  . HIS B 1 30  ? -15.592 21.238  -38.753 1.00 56.36 ? 74  HIS B CG  1 
ATOM   2251 N ND1 . HIS B 1 30  ? -14.309 20.690  -38.620 1.00 56.38 ? 74  HIS B ND1 1 
ATOM   2252 C CD2 . HIS B 1 30  ? -16.499 20.202  -38.638 1.00 57.29 ? 74  HIS B CD2 1 
ATOM   2253 C CE1 . HIS B 1 30  ? -14.439 19.380  -38.433 1.00 57.56 ? 74  HIS B CE1 1 
ATOM   2254 N NE2 . HIS B 1 30  ? -15.760 19.058  -38.436 1.00 58.41 ? 74  HIS B NE2 1 
ATOM   2255 N N   . PRO B 1 31  ? -14.854 25.406  -41.367 1.00 55.75 ? 75  PRO B N   1 
ATOM   2256 C CA  . PRO B 1 31  ? -15.191 26.815  -41.738 1.00 56.41 ? 75  PRO B CA  1 
ATOM   2257 C C   . PRO B 1 31  ? -16.720 27.155  -41.936 1.00 57.00 ? 75  PRO B C   1 
ATOM   2258 O O   . PRO B 1 31  ? -17.230 28.385  -42.092 1.00 56.77 ? 75  PRO B O   1 
ATOM   2259 C CB  . PRO B 1 31  ? -14.482 27.004  -43.122 1.00 55.75 ? 75  PRO B CB  1 
ATOM   2260 C CG  . PRO B 1 31  ? -13.349 26.036  -43.057 1.00 55.83 ? 75  PRO B CG  1 
ATOM   2261 C CD  . PRO B 1 31  ? -13.936 24.798  -42.352 1.00 55.59 ? 75  PRO B CD  1 
ATOM   2262 N N   . GLU B 1 32  ? -17.435 26.021  -41.960 1.00 57.71 ? 76  GLU B N   1 
ATOM   2263 C CA  . GLU B 1 32  ? -18.878 25.988  -42.044 1.00 58.45 ? 76  GLU B CA  1 
ATOM   2264 C C   . GLU B 1 32  ? -19.484 26.686  -40.807 1.00 58.09 ? 76  GLU B C   1 
ATOM   2265 O O   . GLU B 1 32  ? -20.580 27.247  -40.880 1.00 59.00 ? 76  GLU B O   1 
ATOM   2266 C CB  . GLU B 1 32  ? -19.265 24.496  -42.138 1.00 58.68 ? 76  GLU B CB  1 
ATOM   2267 C CG  . GLU B 1 32  ? -18.030 23.661  -42.616 1.00 60.19 ? 76  GLU B CG  1 
ATOM   2268 C CD  . GLU B 1 32  ? -18.104 22.211  -42.170 1.00 63.34 ? 76  GLU B CD  1 
ATOM   2269 O OE1 . GLU B 1 32  ? -18.484 21.361  -42.998 1.00 65.19 ? 76  GLU B OE1 1 
ATOM   2270 O OE2 . GLU B 1 32  ? -17.814 21.915  -40.988 1.00 65.17 ? 76  GLU B OE2 1 
ATOM   2271 N N   . MET B 1 33  ? -18.737 26.699  -39.695 1.00 57.71 ? 77  MET B N   1 
ATOM   2272 C CA  . MET B 1 33  ? -19.269 27.079  -38.357 1.00 56.80 ? 77  MET B CA  1 
ATOM   2273 C C   . MET B 1 33  ? -18.581 28.343  -37.745 1.00 56.22 ? 77  MET B C   1 
ATOM   2274 O O   . MET B 1 33  ? -18.665 28.610  -36.549 1.00 55.76 ? 77  MET B O   1 
ATOM   2275 C CB  . MET B 1 33  ? -19.167 25.874  -37.417 1.00 56.32 ? 77  MET B CB  1 
ATOM   2276 C CG  . MET B 1 33  ? -19.979 24.684  -37.874 1.00 56.56 ? 77  MET B CG  1 
ATOM   2277 S SD  . MET B 1 33  ? -21.778 24.823  -37.401 1.00 60.12 ? 77  MET B SD  1 
ATOM   2278 C CE  . MET B 1 33  ? -21.679 25.034  -35.640 1.00 55.36 ? 77  MET B CE  1 
ATOM   2279 N N   . ARG B 1 34  ? -17.929 29.153  -38.602 1.00 56.44 ? 78  ARG B N   1 
ATOM   2280 C CA  . ARG B 1 34  ? -17.391 30.492  -38.183 1.00 56.39 ? 78  ARG B CA  1 
ATOM   2281 C C   . ARG B 1 34  ? -18.480 31.495  -37.737 1.00 56.44 ? 78  ARG B C   1 
ATOM   2282 O O   . ARG B 1 34  ? -18.171 32.721  -37.408 1.00 55.52 ? 78  ARG B O   1 
ATOM   2283 C CB  . ARG B 1 34  ? -16.540 31.136  -39.294 1.00 56.96 ? 78  ARG B CB  1 
ATOM   2284 C CG  . ARG B 1 34  ? -15.428 30.247  -39.879 1.00 57.00 ? 78  ARG B CG  1 
ATOM   2285 C CD  . ARG B 1 34  ? -14.140 30.237  -39.008 1.00 58.35 ? 78  ARG B CD  1 
ATOM   2286 N NE  . ARG B 1 34  ? -13.111 29.250  -39.400 1.00 56.45 ? 78  ARG B NE  1 
ATOM   2287 C CZ  . ARG B 1 34  ? -12.088 29.524  -40.218 1.00 56.29 ? 78  ARG B CZ  1 
ATOM   2288 N NH1 . ARG B 1 34  ? -11.957 30.743  -40.741 1.00 55.02 ? 78  ARG B NH1 1 
ATOM   2289 N NH2 . ARG B 1 34  ? -11.193 28.585  -40.521 1.00 56.64 ? 78  ARG B NH2 1 
ATOM   2290 N N   . HIS B 1 35  ? -19.744 30.922  -37.713 1.00 56.57 ? 79  HIS B N   1 
ATOM   2291 C CA  . HIS B 1 35  ? -20.948 31.525  -37.134 1.00 56.27 ? 79  HIS B CA  1 
ATOM   2292 C C   . HIS B 1 35  ? -21.296 31.043  -35.709 1.00 55.85 ? 79  HIS B C   1 
ATOM   2293 O O   . HIS B 1 35  ? -22.464 30.738  -35.428 1.00 56.11 ? 79  HIS B O   1 
ATOM   2294 C CB  . HIS B 1 35  ? -22.129 31.284  -38.084 1.00 56.18 ? 79  HIS B CB  1 
ATOM   2295 C CG  . HIS B 1 35  ? -22.803 29.943  -37.937 1.00 57.74 ? 79  HIS B CG  1 
ATOM   2296 N ND1 . HIS B 1 35  ? -22.555 28.888  -38.819 1.00 58.75 ? 79  HIS B ND1 1 
ATOM   2297 C CD2 . HIS B 1 35  ? -23.762 29.506  -37.031 1.00 57.09 ? 79  HIS B CD2 1 
ATOM   2298 C CE1 . HIS B 1 35  ? -23.303 27.850  -38.453 1.00 59.19 ? 79  HIS B CE1 1 
ATOM   2299 N NE2 . HIS B 1 35  ? -24.047 28.200  -37.371 1.00 57.04 ? 79  HIS B NE2 1 
ATOM   2300 N N   . VAL B 1 36  ? -20.300 30.991  -34.814 1.00 55.67 ? 80  VAL B N   1 
ATOM   2301 C CA  . VAL B 1 36  ? -20.506 30.511  -33.430 1.00 55.59 ? 80  VAL B CA  1 
ATOM   2302 C C   . VAL B 1 36  ? -19.694 31.409  -32.450 1.00 55.38 ? 80  VAL B C   1 
ATOM   2303 O O   . VAL B 1 36  ? -18.482 31.518  -32.585 1.00 55.99 ? 80  VAL B O   1 
ATOM   2304 C CB  . VAL B 1 36  ? -20.027 29.002  -33.349 1.00 55.24 ? 80  VAL B CB  1 
ATOM   2305 C CG1 . VAL B 1 36  ? -19.511 28.635  -31.941 1.00 55.57 ? 80  VAL B CG1 1 
ATOM   2306 C CG2 . VAL B 1 36  ? -21.141 28.063  -33.877 1.00 56.55 ? 80  VAL B CG2 1 
ATOM   2307 N N   . ASP B 1 37  ? -20.346 32.085  -31.486 1.00 55.44 ? 81  ASP B N   1 
ATOM   2308 C CA  . ASP B 1 37  ? -19.504 32.539  -30.307 1.00 54.31 ? 81  ASP B CA  1 
ATOM   2309 C C   . ASP B 1 37  ? -19.313 31.350  -29.259 1.00 52.67 ? 81  ASP B C   1 
ATOM   2310 O O   . ASP B 1 37  ? -20.304 30.862  -28.667 1.00 53.05 ? 81  ASP B O   1 
ATOM   2311 C CB  . ASP B 1 37  ? -20.182 33.776  -29.638 1.00 54.50 ? 81  ASP B CB  1 
ATOM   2312 C CG  . ASP B 1 37  ? -19.286 34.283  -28.424 1.00 53.80 ? 81  ASP B CG  1 
ATOM   2313 O OD1 . ASP B 1 37  ? -18.309 33.615  -28.018 1.00 55.03 ? 81  ASP B OD1 1 
ATOM   2314 O OD2 . ASP B 1 37  ? -19.517 35.392  -27.767 1.00 54.16 ? 81  ASP B OD2 1 
ATOM   2315 N N   . CYS B 1 38  ? -18.023 30.960  -29.040 1.00 50.74 ? 82  CYS B N   1 
ATOM   2316 C CA  . CYS B 1 38  ? -17.615 29.834  -28.187 1.00 49.35 ? 82  CYS B CA  1 
ATOM   2317 C C   . CYS B 1 38  ? -17.793 30.056  -26.672 1.00 47.47 ? 82  CYS B C   1 
ATOM   2318 O O   . CYS B 1 38  ? -18.020 29.095  -25.912 1.00 45.02 ? 82  CYS B O   1 
ATOM   2319 C CB  . CYS B 1 38  ? -16.186 29.446  -28.551 1.00 50.16 ? 82  CYS B CB  1 
ATOM   2320 S SG  . CYS B 1 38  ? -16.222 28.269  -29.923 1.00 54.10 ? 82  CYS B SG  1 
ATOM   2321 N N   . GLN B 1 39  ? -17.737 31.319  -26.226 1.00 45.30 ? 83  GLN B N   1 
ATOM   2322 C CA  . GLN B 1 39  ? -18.123 31.581  -24.836 1.00 43.66 ? 83  GLN B CA  1 
ATOM   2323 C C   . GLN B 1 39  ? -19.608 31.246  -24.595 1.00 42.48 ? 83  GLN B C   1 
ATOM   2324 O O   . GLN B 1 39  ? -19.955 30.570  -23.625 1.00 41.83 ? 83  GLN B O   1 
ATOM   2325 C CB  . GLN B 1 39  ? -17.768 32.995  -24.377 1.00 43.65 ? 83  GLN B CB  1 
ATOM   2326 C CG  . GLN B 1 39  ? -18.178 33.279  -22.921 1.00 42.45 ? 83  GLN B CG  1 
ATOM   2327 C CD  . GLN B 1 39  ? -17.797 32.159  -21.975 1.00 42.16 ? 83  GLN B CD  1 
ATOM   2328 O OE1 . GLN B 1 39  ? -18.666 31.452  -21.408 1.00 37.26 ? 83  GLN B OE1 1 
ATOM   2329 N NE2 . GLN B 1 39  ? -16.499 31.991  -21.786 1.00 42.44 ? 83  GLN B NE2 1 
ATOM   2330 N N   . SER B 1 40  ? -20.473 31.670  -25.510 1.00 41.18 ? 84  SER B N   1 
ATOM   2331 C CA  . SER B 1 40  ? -21.903 31.336  -25.433 1.00 39.28 ? 84  SER B CA  1 
ATOM   2332 C C   . SER B 1 40  ? -22.135 29.799  -25.432 1.00 38.67 ? 84  SER B C   1 
ATOM   2333 O O   . SER B 1 40  ? -22.978 29.283  -24.692 1.00 36.45 ? 84  SER B O   1 
ATOM   2334 C CB  . SER B 1 40  ? -22.699 32.003  -26.551 1.00 38.87 ? 84  SER B CB  1 
ATOM   2335 O OG  . SER B 1 40  ? -22.423 33.395  -26.613 1.00 39.14 ? 84  SER B OG  1 
ATOM   2336 N N   . VAL B 1 41  ? -21.409 29.088  -26.291 1.00 37.66 ? 85  VAL B N   1 
ATOM   2337 C CA  . VAL B 1 41  ? -21.511 27.624  -26.298 1.00 36.88 ? 85  VAL B CA  1 
ATOM   2338 C C   . VAL B 1 41  ? -21.192 27.090  -24.917 1.00 35.36 ? 85  VAL B C   1 
ATOM   2339 O O   . VAL B 1 41  ? -21.952 26.279  -24.382 1.00 35.60 ? 85  VAL B O   1 
ATOM   2340 C CB  . VAL B 1 41  ? -20.650 26.990  -27.443 1.00 36.26 ? 85  VAL B CB  1 
ATOM   2341 C CG1 . VAL B 1 41  ? -20.635 25.480  -27.327 1.00 36.88 ? 85  VAL B CG1 1 
ATOM   2342 C CG2 . VAL B 1 41  ? -21.218 27.373  -28.759 1.00 35.60 ? 85  VAL B CG2 1 
ATOM   2343 N N   . TRP B 1 42  ? -20.150 27.597  -24.271 1.00 34.07 ? 86  TRP B N   1 
ATOM   2344 C CA  . TRP B 1 42  ? -19.827 27.072  -22.922 1.00 33.79 ? 86  TRP B CA  1 
ATOM   2345 C C   . TRP B 1 42  ? -20.930 27.384  -21.886 1.00 33.50 ? 86  TRP B C   1 
ATOM   2346 O O   . TRP B 1 42  ? -21.364 26.513  -21.109 1.00 32.98 ? 86  TRP B O   1 
ATOM   2347 C CB  . TRP B 1 42  ? -18.394 27.457  -22.433 1.00 33.42 ? 86  TRP B CB  1 
ATOM   2348 C CG  . TRP B 1 42  ? -18.162 27.146  -20.930 1.00 32.86 ? 86  TRP B CG  1 
ATOM   2349 C CD1 . TRP B 1 42  ? -17.918 28.040  -19.931 1.00 29.89 ? 86  TRP B CD1 1 
ATOM   2350 C CD2 . TRP B 1 42  ? -18.225 25.845  -20.283 1.00 31.62 ? 86  TRP B CD2 1 
ATOM   2351 N NE1 . TRP B 1 42  ? -17.843 27.393  -18.712 1.00 29.39 ? 86  TRP B NE1 1 
ATOM   2352 C CE2 . TRP B 1 42  ? -18.027 26.049  -18.907 1.00 30.91 ? 86  TRP B CE2 1 
ATOM   2353 C CE3 . TRP B 1 42  ? -18.462 24.540  -20.735 1.00 32.50 ? 86  TRP B CE3 1 
ATOM   2354 C CZ2 . TRP B 1 42  ? -18.049 25.005  -17.985 1.00 31.59 ? 86  TRP B CZ2 1 
ATOM   2355 C CZ3 . TRP B 1 42  ? -18.467 23.500  -19.813 1.00 28.42 ? 86  TRP B CZ3 1 
ATOM   2356 C CH2 . TRP B 1 42  ? -18.256 23.735  -18.466 1.00 31.74 ? 86  TRP B CH2 1 
ATOM   2357 N N   . ASP B 1 43  ? -21.340 28.648  -21.850 1.00 33.50 ? 87  ASP B N   1 
ATOM   2358 C CA  . ASP B 1 43  ? -22.434 29.143  -21.015 1.00 33.49 ? 87  ASP B CA  1 
ATOM   2359 C C   . ASP B 1 43  ? -23.676 28.261  -21.068 1.00 31.72 ? 87  ASP B C   1 
ATOM   2360 O O   . ASP B 1 43  ? -24.240 27.888  -20.020 1.00 32.59 ? 87  ASP B O   1 
ATOM   2361 C CB  . ASP B 1 43  ? -22.857 30.515  -21.573 1.00 35.81 ? 87  ASP B CB  1 
ATOM   2362 C CG  . ASP B 1 43  ? -21.999 31.678  -21.054 1.00 40.67 ? 87  ASP B CG  1 
ATOM   2363 O OD1 . ASP B 1 43  ? -21.437 31.574  -19.921 1.00 46.78 ? 87  ASP B OD1 1 
ATOM   2364 O OD2 . ASP B 1 43  ? -21.881 32.756  -21.713 1.00 46.27 ? 87  ASP B OD2 1 
ATOM   2365 N N   . ALA B 1 44  ? -24.155 28.012  -22.291 1.00 30.48 ? 88  ALA B N   1 
ATOM   2366 C CA  . ALA B 1 44  ? -25.297 27.111  -22.564 1.00 29.00 ? 88  ALA B CA  1 
ATOM   2367 C C   . ALA B 1 44  ? -25.048 25.609  -22.195 1.00 27.17 ? 88  ALA B C   1 
ATOM   2368 O O   . ALA B 1 44  ? -26.016 24.917  -21.798 1.00 27.65 ? 88  ALA B O   1 
ATOM   2369 C CB  . ALA B 1 44  ? -25.710 27.216  -24.031 1.00 30.19 ? 88  ALA B CB  1 
ATOM   2370 N N   . PHE B 1 45  ? -23.797 25.143  -22.233 1.00 25.60 ? 89  PHE B N   1 
ATOM   2371 C CA  . PHE B 1 45  ? -23.478 23.722  -21.921 1.00 24.75 ? 89  PHE B CA  1 
ATOM   2372 C C   . PHE B 1 45  ? -23.521 23.628  -20.417 1.00 24.59 ? 89  PHE B C   1 
ATOM   2373 O O   . PHE B 1 45  ? -24.245 22.828  -19.852 1.00 23.78 ? 89  PHE B O   1 
ATOM   2374 C CB  . PHE B 1 45  ? -22.084 23.357  -22.425 1.00 24.66 ? 89  PHE B CB  1 
ATOM   2375 C CG  . PHE B 1 45  ? -21.796 21.880  -22.477 1.00 25.40 ? 89  PHE B CG  1 
ATOM   2376 C CD1 . PHE B 1 45  ? -22.274 21.007  -21.491 1.00 25.85 ? 89  PHE B CD1 1 
ATOM   2377 C CD2 . PHE B 1 45  ? -21.027 21.363  -23.518 1.00 25.29 ? 89  PHE B CD2 1 
ATOM   2378 C CE1 . PHE B 1 45  ? -21.986 19.657  -21.547 1.00 24.48 ? 89  PHE B CE1 1 
ATOM   2379 C CE2 . PHE B 1 45  ? -20.771 20.064  -23.625 1.00 23.66 ? 89  PHE B CE2 1 
ATOM   2380 C CZ  . PHE B 1 45  ? -21.219 19.167  -22.637 1.00 24.40 ? 89  PHE B CZ  1 
ATOM   2381 N N   . LYS B 1 46  ? -22.761 24.487  -19.769 1.00 23.29 ? 90  LYS B N   1 
ATOM   2382 C CA  . LYS B 1 46  ? -22.774 24.599  -18.327 1.00 23.00 ? 90  LYS B CA  1 
ATOM   2383 C C   . LYS B 1 46  ? -24.161 24.939  -17.679 1.00 23.23 ? 90  LYS B C   1 
ATOM   2384 O O   . LYS B 1 46  ? -24.521 24.395  -16.577 1.00 23.58 ? 90  LYS B O   1 
ATOM   2385 C CB  . LYS B 1 46  ? -21.708 25.598  -17.934 1.00 23.58 ? 90  LYS B CB  1 
ATOM   2386 C CG  . LYS B 1 46  ? -22.006 26.508  -16.789 1.00 27.16 ? 90  LYS B CG  1 
ATOM   2387 C CD  . LYS B 1 46  ? -20.717 27.276  -16.331 1.00 29.05 ? 90  LYS B CD  1 
ATOM   2388 C CE  . LYS B 1 46  ? -21.013 28.740  -15.914 1.00 34.83 ? 90  LYS B CE  1 
ATOM   2389 N NZ  . LYS B 1 46  ? -21.546 28.790  -14.477 1.00 35.98 ? 90  LYS B NZ  1 
ATOM   2390 N N   . GLY B 1 47  ? -24.925 25.802  -18.333 1.00 20.35 ? 91  GLY B N   1 
ATOM   2391 C CA  . GLY B 1 47  ? -26.273 26.131  -17.873 1.00 20.54 ? 91  GLY B CA  1 
ATOM   2392 C C   . GLY B 1 47  ? -27.125 24.879  -17.755 1.00 19.02 ? 91  GLY B C   1 
ATOM   2393 O O   . GLY B 1 47  ? -28.031 24.874  -16.974 1.00 17.26 ? 91  GLY B O   1 
ATOM   2394 N N   . ALA B 1 48  ? -26.855 23.843  -18.559 1.00 19.29 ? 92  ALA B N   1 
ATOM   2395 C CA  . ALA B 1 48  ? -27.711 22.683  -18.600 1.00 19.13 ? 92  ALA B CA  1 
ATOM   2396 C C   . ALA B 1 48  ? -27.607 21.795  -17.367 1.00 19.34 ? 92  ALA B C   1 
ATOM   2397 O O   . ALA B 1 48  ? -28.564 21.071  -17.112 1.00 19.23 ? 92  ALA B O   1 
ATOM   2398 C CB  . ALA B 1 48  ? -27.402 21.824  -19.822 1.00 21.02 ? 92  ALA B CB  1 
ATOM   2399 N N   . PHE B 1 49  ? -26.467 21.785  -16.652 1.00 17.26 ? 93  PHE B N   1 
ATOM   2400 C CA  . PHE B 1 49  ? -26.311 20.864  -15.534 1.00 15.22 ? 93  PHE B CA  1 
ATOM   2401 C C   . PHE B 1 49  ? -25.883 21.470  -14.169 1.00 16.21 ? 93  PHE B C   1 
ATOM   2402 O O   . PHE B 1 49  ? -25.933 20.778  -13.117 1.00 14.74 ? 93  PHE B O   1 
ATOM   2403 C CB  . PHE B 1 49  ? -25.323 19.731  -15.945 1.00 14.96 ? 93  PHE B CB  1 
ATOM   2404 C CG  . PHE B 1 49  ? -23.909 20.168  -16.054 1.00 15.87 ? 93  PHE B CG  1 
ATOM   2405 C CD1 . PHE B 1 49  ? -23.062 20.036  -15.013 1.00 11.69 ? 93  PHE B CD1 1 
ATOM   2406 C CD2 . PHE B 1 49  ? -23.415 20.691  -17.270 1.00 17.89 ? 93  PHE B CD2 1 
ATOM   2407 C CE1 . PHE B 1 49  ? -21.691 20.479  -15.126 1.00 23.10 ? 93  PHE B CE1 1 
ATOM   2408 C CE2 . PHE B 1 49  ? -22.094 21.086  -17.433 1.00 16.81 ? 93  PHE B CE2 1 
ATOM   2409 C CZ  . PHE B 1 49  ? -21.189 21.009  -16.347 1.00 19.03 ? 93  PHE B CZ  1 
ATOM   2410 N N   . ILE B 1 50  ? -25.392 22.728  -14.157 1.00 16.34 ? 94  ILE B N   1 
ATOM   2411 C CA  . ILE B 1 50  ? -24.934 23.275  -12.909 1.00 17.04 ? 94  ILE B CA  1 
ATOM   2412 C C   . ILE B 1 50  ? -26.159 23.678  -12.057 1.00 16.16 ? 94  ILE B C   1 
ATOM   2413 O O   . ILE B 1 50  ? -27.171 24.037  -12.596 1.00 14.32 ? 94  ILE B O   1 
ATOM   2414 C CB  . ILE B 1 50  ? -23.963 24.458  -13.188 1.00 19.91 ? 94  ILE B CB  1 
ATOM   2415 C CG1 . ILE B 1 50  ? -22.615 23.895  -13.675 1.00 20.27 ? 94  ILE B CG1 1 
ATOM   2416 C CG2 . ILE B 1 50  ? -23.733 25.302  -11.989 1.00 21.82 ? 94  ILE B CG2 1 
ATOM   2417 C CD1 . ILE B 1 50  ? -21.586 23.818  -12.550 1.00 31.01 ? 94  ILE B CD1 1 
ATOM   2418 N N   . SER B 1 51  ? -26.023 23.594  -10.737 1.00 17.12 ? 95  SER B N   1 
ATOM   2419 C CA  . SER B 1 51  ? -27.052 23.899  -9.722  1.00 17.43 ? 95  SER B CA  1 
ATOM   2420 C C   . SER B 1 51  ? -28.347 23.134  -9.976  1.00 19.45 ? 95  SER B C   1 
ATOM   2421 O O   . SER B 1 51  ? -29.454 23.707  -9.811  1.00 21.40 ? 95  SER B O   1 
ATOM   2422 C CB  . SER B 1 51  ? -27.375 25.430  -9.692  1.00 19.15 ? 95  SER B CB  1 
ATOM   2423 O OG  . SER B 1 51  ? -26.220 26.244  -9.407  1.00 15.67 ? 95  SER B OG  1 
ATOM   2424 N N   . LYS B 1 52  ? -28.198 21.920  -10.474 1.00 14.53 ? 96  LYS B N   1 
ATOM   2425 C CA  . LYS B 1 52  ? -29.287 21.048  -10.906 1.00 15.08 ? 96  LYS B CA  1 
ATOM   2426 C C   . LYS B 1 52  ? -28.977 19.679  -10.350 1.00 14.45 ? 96  LYS B C   1 
ATOM   2427 O O   . LYS B 1 52  ? -27.749 19.263  -10.298 1.00 12.70 ? 96  LYS B O   1 
ATOM   2428 C CB  . LYS B 1 52  ? -29.332 20.998  -12.426 1.00 16.59 ? 96  LYS B CB  1 
ATOM   2429 C CG  . LYS B 1 52  ? -30.097 22.200  -12.999 1.00 16.21 ? 96  LYS B CG  1 
ATOM   2430 C CD  . LYS B 1 52  ? -30.063 22.252  -14.496 1.00 19.26 ? 96  LYS B CD  1 
ATOM   2431 C CE  . LYS B 1 52  ? -30.628 23.668  -14.877 1.00 21.57 ? 96  LYS B CE  1 
ATOM   2432 N NZ  . LYS B 1 52  ? -31.000 23.759  -16.296 1.00 24.77 ? 96  LYS B NZ  1 
ATOM   2433 N N   . HIS B 1 53  ? -30.037 18.980  -9.870  1.00 13.15 ? 97  HIS B N   1 
ATOM   2434 C CA  . HIS B 1 53  ? -29.821 17.579  -9.440  1.00 11.31 ? 97  HIS B CA  1 
ATOM   2435 C C   . HIS B 1 53  ? -29.434 16.672  -10.566 1.00 12.56 ? 97  HIS B C   1 
ATOM   2436 O O   . HIS B 1 53  ? -30.110 16.677  -11.586 1.00 13.03 ? 97  HIS B O   1 
ATOM   2437 C CB  . HIS B 1 53  ? -31.037 17.029  -8.724  1.00 11.13 ? 97  HIS B CB  1 
ATOM   2438 C CG  . HIS B 1 53  ? -30.697 15.861  -7.871  1.00 11.15 ? 97  HIS B CG  1 
ATOM   2439 N ND1 . HIS B 1 53  ? -30.521 14.612  -8.425  1.00 9.70  ? 97  HIS B ND1 1 
ATOM   2440 C CD2 . HIS B 1 53  ? -30.511 15.717  -6.532  1.00 13.61 ? 97  HIS B CD2 1 
ATOM   2441 C CE1 . HIS B 1 53  ? -30.181 13.760  -7.484  1.00 7.35  ? 97  HIS B CE1 1 
ATOM   2442 N NE2 . HIS B 1 53  ? -30.239 14.376  -6.321  1.00 11.10 ? 97  HIS B NE2 1 
ATOM   2443 N N   . PRO B 1 54  ? -28.328 15.935  -10.446 1.00 12.29 ? 98  PRO B N   1 
ATOM   2444 C CA  . PRO B 1 54  ? -27.827 15.243  -11.627 1.00 13.94 ? 98  PRO B CA  1 
ATOM   2445 C C   . PRO B 1 54  ? -28.602 13.920  -11.902 1.00 13.05 ? 98  PRO B C   1 
ATOM   2446 O O   . PRO B 1 54  ? -28.092 13.041  -12.655 1.00 14.66 ? 98  PRO B O   1 
ATOM   2447 C CB  . PRO B 1 54  ? -26.368 15.006  -11.277 1.00 13.07 ? 98  PRO B CB  1 
ATOM   2448 C CG  . PRO B 1 54  ? -26.345 14.789  -9.903  1.00 13.88 ? 98  PRO B CG  1 
ATOM   2449 C CD  . PRO B 1 54  ? -27.387 15.873  -9.315  1.00 12.76 ? 98  PRO B CD  1 
ATOM   2450 N N   . CYS B 1 55  ? -29.684 13.673  -11.154 1.00 9.44  ? 99  CYS B N   1 
ATOM   2451 C CA  . CYS B 1 55  ? -30.628 12.571  -11.553 1.00 11.25 ? 99  CYS B CA  1 
ATOM   2452 C C   . CYS B 1 55  ? -31.892 13.102  -12.175 1.00 11.27 ? 99  CYS B C   1 
ATOM   2453 O O   . CYS B 1 55  ? -32.724 12.322  -12.611 1.00 12.03 ? 99  CYS B O   1 
ATOM   2454 C CB  . CYS B 1 55  ? -30.995 11.608  -10.396 1.00 11.86 ? 99  CYS B CB  1 
ATOM   2455 S SG  . CYS B 1 55  ? -29.468 10.855  -9.847  1.00 15.20 ? 99  CYS B SG  1 
ATOM   2456 N N   . ASP B 1 56  ? -32.017 14.394  -12.377 1.00 10.41 ? 100 ASP B N   1 
ATOM   2457 C CA  . ASP B 1 56  ? -33.240 14.959  -12.907 1.00 12.25 ? 100 ASP B CA  1 
ATOM   2458 C C   . ASP B 1 56  ? -33.028 15.808  -14.165 1.00 11.48 ? 100 ASP B C   1 
ATOM   2459 O O   . ASP B 1 56  ? -33.861 16.678  -14.499 1.00 10.14 ? 100 ASP B O   1 
ATOM   2460 C CB  . ASP B 1 56  ? -33.850 15.913  -11.857 1.00 13.51 ? 100 ASP B CB  1 
ATOM   2461 C CG  . ASP B 1 56  ? -34.270 15.204  -10.598 1.00 17.14 ? 100 ASP B CG  1 
ATOM   2462 O OD1 . ASP B 1 56  ? -34.249 15.809  -9.479  1.00 15.48 ? 100 ASP B OD1 1 
ATOM   2463 O OD2 . ASP B 1 56  ? -34.661 14.042  -10.639 1.00 14.32 ? 100 ASP B OD2 1 
ATOM   2464 N N   . ILE B 1 57  ? -31.950 15.548  -14.901 1.00 13.77 ? 101 ILE B N   1 
ATOM   2465 C CA  . ILE B 1 57  ? -31.681 16.295  -16.147 1.00 12.90 ? 101 ILE B CA  1 
ATOM   2466 C C   . ILE B 1 57  ? -32.596 15.852  -17.293 1.00 14.34 ? 101 ILE B C   1 
ATOM   2467 O O   . ILE B 1 57  ? -32.982 14.670  -17.357 1.00 14.94 ? 101 ILE B O   1 
ATOM   2468 C CB  . ILE B 1 57  ? -30.205 16.038  -16.528 1.00 13.78 ? 101 ILE B CB  1 
ATOM   2469 C CG1 . ILE B 1 57  ? -29.256 16.322  -15.337 1.00 14.36 ? 101 ILE B CG1 1 
ATOM   2470 C CG2 . ILE B 1 57  ? -29.832 16.842  -17.843 1.00 12.31 ? 101 ILE B CG2 1 
ATOM   2471 C CD1 . ILE B 1 57  ? -29.253 17.749  -14.771 1.00 18.11 ? 101 ILE B CD1 1 
ATOM   2472 N N   . THR B 1 58  ? -33.004 16.772  -18.182 1.00 14.29 ? 102 THR B N   1 
ATOM   2473 C CA  . THR B 1 58  ? -33.864 16.359  -19.296 1.00 17.49 ? 102 THR B CA  1 
ATOM   2474 C C   . THR B 1 58  ? -33.316 16.967  -20.552 1.00 17.47 ? 102 THR B C   1 
ATOM   2475 O O   . THR B 1 58  ? -32.415 17.823  -20.507 1.00 16.51 ? 102 THR B O   1 
ATOM   2476 C CB  . THR B 1 58  ? -35.339 16.849  -19.152 1.00 18.12 ? 102 THR B CB  1 
ATOM   2477 O OG1 . THR B 1 58  ? -35.288 18.276  -19.108 1.00 20.21 ? 102 THR B OG1 1 
ATOM   2478 C CG2 . THR B 1 58  ? -36.032 16.380  -17.829 1.00 19.98 ? 102 THR B CG2 1 
ATOM   2479 N N   . GLU B 1 59  ? -33.880 16.514  -21.677 1.00 19.60 ? 103 GLU B N   1 
ATOM   2480 C CA  . GLU B 1 59  ? -33.518 17.049  -23.004 1.00 21.80 ? 103 GLU B CA  1 
ATOM   2481 C C   . GLU B 1 59  ? -33.743 18.573  -22.982 1.00 22.21 ? 103 GLU B C   1 
ATOM   2482 O O   . GLU B 1 59  ? -32.981 19.325  -23.580 1.00 24.15 ? 103 GLU B O   1 
ATOM   2483 C CB  . GLU B 1 59  ? -34.379 16.411  -24.106 1.00 22.22 ? 103 GLU B CB  1 
ATOM   2484 C CG  . GLU B 1 59  ? -34.427 17.229  -25.393 1.00 28.78 ? 103 GLU B CG  1 
ATOM   2485 C CD  . GLU B 1 59  ? -34.868 16.424  -26.612 1.00 39.37 ? 103 GLU B CD  1 
ATOM   2486 O OE1 . GLU B 1 59  ? -34.553 16.857  -27.776 1.00 41.76 ? 103 GLU B OE1 1 
ATOM   2487 O OE2 . GLU B 1 59  ? -35.548 15.365  -26.413 1.00 42.89 ? 103 GLU B OE2 1 
ATOM   2488 N N   . GLU B 1 60  ? -34.767 19.028  -22.273 1.00 21.40 ? 104 GLU B N   1 
ATOM   2489 C CA  . GLU B 1 60  ? -35.065 20.464  -22.173 1.00 21.84 ? 104 GLU B CA  1 
ATOM   2490 C C   . GLU B 1 60  ? -33.926 21.273  -21.592 1.00 20.91 ? 104 GLU B C   1 
ATOM   2491 O O   . GLU B 1 60  ? -33.683 22.418  -22.034 1.00 21.21 ? 104 GLU B O   1 
ATOM   2492 C CB  . GLU B 1 60  ? -36.374 20.728  -21.409 1.00 24.30 ? 104 GLU B CB  1 
ATOM   2493 C CG  . GLU B 1 60  ? -36.729 22.186  -21.315 1.00 28.26 ? 104 GLU B CG  1 
ATOM   2494 C CD  . GLU B 1 60  ? -38.236 22.418  -21.203 1.00 40.74 ? 104 GLU B CD  1 
ATOM   2495 O OE1 . GLU B 1 60  ? -39.045 21.766  -21.949 1.00 43.93 ? 104 GLU B OE1 1 
ATOM   2496 O OE2 . GLU B 1 60  ? -38.620 23.276  -20.364 1.00 41.66 ? 104 GLU B OE2 1 
ATOM   2497 N N   . ASP B 1 61  ? -33.196 20.698  -20.655 1.00 17.67 ? 105 ASP B N   1 
ATOM   2498 C CA  . ASP B 1 61  ? -31.996 21.334  -20.106 1.00 18.24 ? 105 ASP B CA  1 
ATOM   2499 C C   . ASP B 1 61  ? -30.917 21.590  -21.196 1.00 17.61 ? 105 ASP B C   1 
ATOM   2500 O O   . ASP B 1 61  ? -30.138 22.553  -21.054 1.00 17.85 ? 105 ASP B O   1 
ATOM   2501 C CB  . ASP B 1 61  ? -31.328 20.467  -18.993 1.00 18.10 ? 105 ASP B CB  1 
ATOM   2502 C CG  . ASP B 1 61  ? -32.110 20.459  -17.640 1.00 20.29 ? 105 ASP B CG  1 
ATOM   2503 O OD1 . ASP B 1 61  ? -32.451 21.561  -17.133 1.00 22.95 ? 105 ASP B OD1 1 
ATOM   2504 O OD2 . ASP B 1 61  ? -32.379 19.394  -16.993 1.00 19.85 ? 105 ASP B OD2 1 
ATOM   2505 N N   . TYR B 1 62  ? -30.837 20.729  -22.227 1.00 17.03 ? 106 TYR B N   1 
ATOM   2506 C CA  . TYR B 1 62  ? -29.829 20.887  -23.323 1.00 18.80 ? 106 TYR B CA  1 
ATOM   2507 C C   . TYR B 1 62  ? -30.348 21.638  -24.557 1.00 21.97 ? 106 TYR B C   1 
ATOM   2508 O O   . TYR B 1 62  ? -29.623 21.851  -25.537 1.00 20.90 ? 106 TYR B O   1 
ATOM   2509 C CB  . TYR B 1 62  ? -29.291 19.555  -23.779 1.00 18.37 ? 106 TYR B CB  1 
ATOM   2510 C CG  . TYR B 1 62  ? -28.355 18.972  -22.777 1.00 17.71 ? 106 TYR B CG  1 
ATOM   2511 C CD1 . TYR B 1 62  ? -28.781 17.914  -21.914 1.00 15.70 ? 106 TYR B CD1 1 
ATOM   2512 C CD2 . TYR B 1 62  ? -27.030 19.468  -22.664 1.00 14.47 ? 106 TYR B CD2 1 
ATOM   2513 C CE1 . TYR B 1 62  ? -27.876 17.346  -20.959 1.00 16.01 ? 106 TYR B CE1 1 
ATOM   2514 C CE2 . TYR B 1 62  ? -26.114 18.922  -21.689 1.00 14.08 ? 106 TYR B CE2 1 
ATOM   2515 C CZ  . TYR B 1 62  ? -26.573 17.885  -20.830 1.00 16.66 ? 106 TYR B CZ  1 
ATOM   2516 O OH  . TYR B 1 62  ? -25.707 17.327  -19.887 1.00 15.32 ? 106 TYR B OH  1 
ATOM   2517 N N   . GLN B 1 63  ? -31.599 22.036  -24.509 1.00 22.38 ? 107 GLN B N   1 
ATOM   2518 C CA  . GLN B 1 63  ? -32.177 22.787  -25.634 1.00 25.84 ? 107 GLN B CA  1 
ATOM   2519 C C   . GLN B 1 63  ? -31.373 24.053  -26.050 1.00 27.07 ? 107 GLN B C   1 
ATOM   2520 O O   . GLN B 1 63  ? -30.958 24.125  -27.210 1.00 29.18 ? 107 GLN B O   1 
ATOM   2521 C CB  . GLN B 1 63  ? -33.660 23.123  -25.333 1.00 25.50 ? 107 GLN B CB  1 
ATOM   2522 C CG  . GLN B 1 63  ? -34.635 22.987  -26.485 1.00 30.94 ? 107 GLN B CG  1 
ATOM   2523 C CD  . GLN B 1 63  ? -34.332 21.849  -27.491 1.00 36.03 ? 107 GLN B CD  1 
ATOM   2524 O OE1 . GLN B 1 63  ? -33.478 21.984  -28.357 1.00 32.93 ? 107 GLN B OE1 1 
ATOM   2525 N NE2 . GLN B 1 63  ? -35.110 20.756  -27.406 1.00 42.54 ? 107 GLN B NE2 1 
ATOM   2526 N N   . PRO B 1 64  ? -31.123 25.026  -25.144 1.00 27.07 ? 108 PRO B N   1 
ATOM   2527 C CA  . PRO B 1 64  ? -30.361 26.243  -25.494 1.00 26.46 ? 108 PRO B CA  1 
ATOM   2528 C C   . PRO B 1 64  ? -28.984 25.931  -26.119 1.00 28.38 ? 108 PRO B C   1 
ATOM   2529 O O   . PRO B 1 64  ? -28.570 26.699  -27.034 1.00 27.16 ? 108 PRO B O   1 
ATOM   2530 C CB  . PRO B 1 64  ? -30.160 26.961  -24.143 1.00 25.48 ? 108 PRO B CB  1 
ATOM   2531 C CG  . PRO B 1 64  ? -31.254 26.432  -23.264 1.00 27.19 ? 108 PRO B CG  1 
ATOM   2532 C CD  . PRO B 1 64  ? -31.482 24.989  -23.706 1.00 27.80 ? 108 PRO B CD  1 
ATOM   2533 N N   . LEU B 1 65  ? -28.328 24.850  -25.695 1.00 26.48 ? 109 LEU B N   1 
ATOM   2534 C CA  . LEU B 1 65  ? -27.123 24.408  -26.341 1.00 28.60 ? 109 LEU B CA  1 
ATOM   2535 C C   . LEU B 1 65  ? -27.436 23.946  -27.787 1.00 30.04 ? 109 LEU B C   1 
ATOM   2536 O O   . LEU B 1 65  ? -26.552 24.120  -28.659 1.00 30.34 ? 109 LEU B O   1 
ATOM   2537 C CB  . LEU B 1 65  ? -26.394 23.299  -25.492 1.00 25.49 ? 109 LEU B CB  1 
ATOM   2538 C CG  . LEU B 1 65  ? -25.074 22.624  -25.939 1.00 26.36 ? 109 LEU B CG  1 
ATOM   2539 C CD1 . LEU B 1 65  ? -23.978 23.625  -26.368 1.00 25.43 ? 109 LEU B CD1 1 
ATOM   2540 C CD2 . LEU B 1 65  ? -24.443 21.604  -24.889 1.00 19.32 ? 109 LEU B CD2 1 
ATOM   2541 N N   . MET B 1 66  ? -28.586 23.306  -28.021 1.00 30.63 ? 110 MET B N   1 
ATOM   2542 C CA  . MET B 1 66  ? -28.652 22.472  -29.281 1.00 30.55 ? 110 MET B CA  1 
ATOM   2543 C C   . MET B 1 66  ? -28.840 23.490  -30.383 1.00 32.51 ? 110 MET B C   1 
ATOM   2544 O O   . MET B 1 66  ? -28.340 23.352  -31.525 1.00 29.77 ? 110 MET B O   1 
ATOM   2545 C CB  . MET B 1 66  ? -29.812 21.526  -29.212 1.00 30.94 ? 110 MET B CB  1 
ATOM   2546 C CG  . MET B 1 66  ? -29.776 20.728  -27.849 1.00 32.84 ? 110 MET B CG  1 
ATOM   2547 S SD  . MET B 1 66  ? -30.249 19.081  -28.026 1.00 45.44 ? 110 MET B SD  1 
ATOM   2548 C CE  . MET B 1 66  ? -28.774 18.476  -28.720 1.00 33.92 ? 110 MET B CE  1 
ATOM   2549 N N   . LYS B 1 67  ? -29.525 24.550  -29.964 1.00 33.08 ? 111 LYS B N   1 
ATOM   2550 C CA  . LYS B 1 67  ? -29.750 25.655  -30.879 1.00 34.83 ? 111 LYS B CA  1 
ATOM   2551 C C   . LYS B 1 67  ? -28.464 26.412  -31.159 1.00 34.95 ? 111 LYS B C   1 
ATOM   2552 O O   . LYS B 1 67  ? -28.284 26.832  -32.276 1.00 34.31 ? 111 LYS B O   1 
ATOM   2553 C CB  . LYS B 1 67  ? -30.838 26.560  -30.363 1.00 35.09 ? 111 LYS B CB  1 
ATOM   2554 C CG  . LYS B 1 67  ? -32.173 25.792  -30.121 1.00 38.56 ? 111 LYS B CG  1 
ATOM   2555 C CD  . LYS B 1 67  ? -33.252 26.665  -29.358 1.00 42.76 ? 111 LYS B CD  1 
ATOM   2556 C CE  . LYS B 1 67  ? -34.722 26.238  -29.659 1.00 44.47 ? 111 LYS B CE  1 
ATOM   2557 N NZ  . LYS B 1 67  ? -35.533 25.824  -28.451 1.00 47.37 ? 111 LYS B NZ  1 
ATOM   2558 N N   . LEU B 1 68  ? -27.561 26.590  -30.198 1.00 36.30 ? 112 LEU B N   1 
ATOM   2559 C CA  . LEU B 1 68  ? -26.248 27.171  -30.536 1.00 37.65 ? 112 LEU B CA  1 
ATOM   2560 C C   . LEU B 1 68  ? -25.370 26.226  -31.380 1.00 38.98 ? 112 LEU B C   1 
ATOM   2561 O O   . LEU B 1 68  ? -24.735 26.653  -32.312 1.00 36.45 ? 112 LEU B O   1 
ATOM   2562 C CB  . LEU B 1 68  ? -25.474 27.666  -29.309 1.00 38.60 ? 112 LEU B CB  1 
ATOM   2563 C CG  . LEU B 1 68  ? -26.057 28.852  -28.532 1.00 37.11 ? 112 LEU B CG  1 
ATOM   2564 C CD1 . LEU B 1 68  ? -25.314 29.145  -27.196 1.00 39.52 ? 112 LEU B CD1 1 
ATOM   2565 C CD2 . LEU B 1 68  ? -26.108 30.117  -29.435 1.00 39.47 ? 112 LEU B CD2 1 
ATOM   2566 N N   . GLY B 1 69  ? -25.327 24.942  -31.035 1.00 40.29 ? 113 GLY B N   1 
ATOM   2567 C CA  . GLY B 1 69  ? -24.697 23.964  -31.914 1.00 42.67 ? 113 GLY B CA  1 
ATOM   2568 C C   . GLY B 1 69  ? -25.682 23.260  -32.928 1.00 45.17 ? 113 GLY B C   1 
ATOM   2569 O O   . GLY B 1 69  ? -25.376 22.122  -33.382 1.00 47.44 ? 113 GLY B O   1 
ATOM   2570 N N   . THR B 1 70  ? -26.801 23.922  -33.306 1.00 46.40 ? 114 THR B N   1 
ATOM   2571 C CA  . THR B 1 70  ? -27.403 23.618  -34.644 1.00 47.23 ? 114 THR B CA  1 
ATOM   2572 C C   . THR B 1 70  ? -26.203 23.553  -35.645 1.00 46.54 ? 114 THR B C   1 
ATOM   2573 O O   . THR B 1 70  ? -25.472 24.546  -35.852 1.00 49.16 ? 114 THR B O   1 
ATOM   2574 C CB  . THR B 1 70  ? -28.454 24.709  -35.182 1.00 47.32 ? 114 THR B CB  1 
ATOM   2575 O OG1 . THR B 1 70  ? -29.362 25.125  -34.135 1.00 47.87 ? 114 THR B OG1 1 
ATOM   2576 C CG2 . THR B 1 70  ? -29.434 24.097  -36.218 1.00 48.64 ? 114 THR B CG2 1 
ATOM   2577 N N   . GLN B 1 71  ? -26.087 22.379  -36.287 1.00 46.42 ? 115 GLN B N   1 
ATOM   2578 C CA  . GLN B 1 71  ? -25.239 22.163  -37.498 1.00 47.48 ? 115 GLN B CA  1 
ATOM   2579 C C   . GLN B 1 71  ? -25.913 21.272  -38.611 1.00 48.13 ? 115 GLN B C   1 
ATOM   2580 O O   . GLN B 1 71  ? -26.561 20.266  -38.285 1.00 49.22 ? 115 GLN B O   1 
ATOM   2581 C CB  . GLN B 1 71  ? -23.905 21.550  -37.062 1.00 46.71 ? 115 GLN B CB  1 
ATOM   2582 C CG  . GLN B 1 71  ? -22.887 21.424  -38.179 1.00 44.83 ? 115 GLN B CG  1 
ATOM   2583 C CD  . GLN B 1 71  ? -21.662 20.649  -37.763 1.00 46.29 ? 115 GLN B CD  1 
ATOM   2584 O OE1 . GLN B 1 71  ? -20.880 20.217  -38.628 1.00 41.50 ? 115 GLN B OE1 1 
ATOM   2585 N NE2 . GLN B 1 71  ? -21.498 20.429  -36.436 1.00 39.45 ? 115 GLN B NE2 1 
ATOM   2586 N N   . THR B 1 72  ? -25.777 21.626  -39.894 1.00 47.40 ? 116 THR B N   1 
ATOM   2587 C CA  . THR B 1 72  ? -26.341 20.803  -40.960 1.00 47.18 ? 116 THR B CA  1 
ATOM   2588 C C   . THR B 1 72  ? -25.256 19.957  -41.636 1.00 46.25 ? 116 THR B C   1 
ATOM   2589 O O   . THR B 1 72  ? -24.363 20.498  -42.266 1.00 46.53 ? 116 THR B O   1 
ATOM   2590 C CB  . THR B 1 72  ? -27.023 21.690  -42.029 1.00 47.37 ? 116 THR B CB  1 
ATOM   2591 O OG1 . THR B 1 72  ? -27.768 22.740  -41.392 1.00 49.51 ? 116 THR B OG1 1 
ATOM   2592 C CG2 . THR B 1 72  ? -28.080 20.896  -42.787 1.00 47.59 ? 116 THR B CG2 1 
ATOM   2593 N N   . VAL B 1 73  ? -25.342 18.637  -41.516 1.00 44.40 ? 117 VAL B N   1 
ATOM   2594 C CA  . VAL B 1 73  ? -24.416 17.780  -42.237 1.00 43.63 ? 117 VAL B CA  1 
ATOM   2595 C C   . VAL B 1 73  ? -25.095 17.191  -43.466 1.00 42.74 ? 117 VAL B C   1 
ATOM   2596 O O   . VAL B 1 73  ? -26.319 17.011  -43.461 1.00 43.46 ? 117 VAL B O   1 
ATOM   2597 C CB  . VAL B 1 73  ? -23.756 16.673  -41.321 1.00 43.14 ? 117 VAL B CB  1 
ATOM   2598 C CG1 . VAL B 1 73  ? -22.848 17.314  -40.287 1.00 42.82 ? 117 VAL B CG1 1 
ATOM   2599 C CG2 . VAL B 1 73  ? -24.798 15.774  -40.672 1.00 43.63 ? 117 VAL B CG2 1 
ATOM   2600 N N   . PRO B 1 74  ? -24.350 16.938  -44.542 1.00 41.75 ? 118 PRO B N   1 
ATOM   2601 C CA  . PRO B 1 74  ? -24.965 16.273  -45.699 1.00 41.95 ? 118 PRO B CA  1 
ATOM   2602 C C   . PRO B 1 74  ? -25.600 14.964  -45.270 1.00 41.46 ? 118 PRO B C   1 
ATOM   2603 O O   . PRO B 1 74  ? -24.882 13.994  -44.972 1.00 42.08 ? 118 PRO B O   1 
ATOM   2604 C CB  . PRO B 1 74  ? -23.790 16.061  -46.669 1.00 41.35 ? 118 PRO B CB  1 
ATOM   2605 C CG  . PRO B 1 74  ? -22.866 17.157  -46.317 1.00 42.28 ? 118 PRO B CG  1 
ATOM   2606 C CD  . PRO B 1 74  ? -22.944 17.305  -44.803 1.00 40.82 ? 118 PRO B CD  1 
ATOM   2607 N N   . CYS B 1 75  ? -26.932 14.959  -45.223 1.00 40.86 ? 119 CYS B N   1 
ATOM   2608 C CA  . CYS B 1 75  ? -27.676 13.899  -44.556 1.00 40.93 ? 119 CYS B CA  1 
ATOM   2609 C C   . CYS B 1 75  ? -27.444 12.505  -45.125 1.00 40.22 ? 119 CYS B C   1 
ATOM   2610 O O   . CYS B 1 75  ? -27.747 11.517  -44.462 1.00 39.34 ? 119 CYS B O   1 
ATOM   2611 C CB  . CYS B 1 75  ? -29.185 14.217  -44.518 1.00 42.16 ? 119 CYS B CB  1 
ATOM   2612 S SG  . CYS B 1 75  ? -29.998 14.239  -46.149 1.00 44.39 ? 119 CYS B SG  1 
ATOM   2613 N N   . ASN B 1 76  ? -26.943 12.439  -46.359 1.00 38.44 ? 120 ASN B N   1 
ATOM   2614 C CA  . ASN B 1 76  ? -26.674 11.190  -47.052 1.00 37.94 ? 120 ASN B CA  1 
ATOM   2615 C C   . ASN B 1 76  ? -25.302 10.625  -46.750 1.00 36.26 ? 120 ASN B C   1 
ATOM   2616 O O   . ASN B 1 76  ? -24.918 9.626   -47.371 1.00 37.79 ? 120 ASN B O   1 
ATOM   2617 C CB  . ASN B 1 76  ? -26.622 11.479  -48.539 1.00 38.43 ? 120 ASN B CB  1 
ATOM   2618 C CG  . ASN B 1 76  ? -25.803 12.725  -48.841 1.00 41.35 ? 120 ASN B CG  1 
ATOM   2619 O OD1 . ASN B 1 76  ? -26.008 13.802  -48.224 1.00 43.12 ? 120 ASN B OD1 1 
ATOM   2620 N ND2 . ASN B 1 76  ? -24.888 12.595  -49.827 1.00 47.32 ? 120 ASN B ND2 1 
ATOM   2621 N N   . LYS B 1 77  ? -24.527 11.313  -45.916 1.00 34.18 ? 121 LYS B N   1 
ATOM   2622 C CA  . LYS B 1 77  ? -23.178 10.876  -45.548 1.00 31.52 ? 121 LYS B CA  1 
ATOM   2623 C C   . LYS B 1 77  ? -22.976 10.589  -44.080 1.00 32.02 ? 121 LYS B C   1 
ATOM   2624 O O   . LYS B 1 77  ? -21.942 10.948  -43.510 1.00 30.58 ? 121 LYS B O   1 
ATOM   2625 C CB  . LYS B 1 77  ? -22.161 11.915  -45.915 1.00 32.35 ? 121 LYS B CB  1 
ATOM   2626 C CG  . LYS B 1 77  ? -21.685 11.762  -47.405 1.00 34.30 ? 121 LYS B CG  1 
ATOM   2627 C CD  . LYS B 1 77  ? -22.258 12.841  -48.146 1.00 36.03 ? 121 LYS B CD  1 
ATOM   2628 C CE  . LYS B 1 77  ? -21.409 13.131  -49.398 1.00 38.66 ? 121 LYS B CE  1 
ATOM   2629 N NZ  . LYS B 1 77  ? -22.095 14.213  -50.116 1.00 36.61 ? 121 LYS B NZ  1 
ATOM   2630 N N   . ILE B 1 78  ? -23.939 9.916   -43.494 1.00 29.31 ? 122 ILE B N   1 
ATOM   2631 C CA  . ILE B 1 78  ? -23.856 9.597   -42.084 1.00 29.34 ? 122 ILE B CA  1 
ATOM   2632 C C   . ILE B 1 78  ? -23.443 8.175   -41.812 1.00 29.10 ? 122 ILE B C   1 
ATOM   2633 O O   . ILE B 1 78  ? -24.003 7.227   -42.379 1.00 31.14 ? 122 ILE B O   1 
ATOM   2634 C CB  . ILE B 1 78  ? -25.136 9.943   -41.412 1.00 27.95 ? 122 ILE B CB  1 
ATOM   2635 C CG1 . ILE B 1 78  ? -25.211 11.473  -41.364 1.00 25.84 ? 122 ILE B CG1 1 
ATOM   2636 C CG2 . ILE B 1 78  ? -25.212 9.232   -40.007 1.00 28.51 ? 122 ILE B CG2 1 
ATOM   2637 C CD1 . ILE B 1 78  ? -26.572 11.968  -41.379 1.00 30.82 ? 122 ILE B CD1 1 
ATOM   2638 N N   . LEU B 1 79  ? -22.417 8.050   -40.975 1.00 29.97 ? 123 LEU B N   1 
ATOM   2639 C CA  . LEU B 1 79  ? -22.006 6.753   -40.437 1.00 26.93 ? 123 LEU B CA  1 
ATOM   2640 C C   . LEU B 1 79  ? -22.316 6.654   -38.911 1.00 28.29 ? 123 LEU B C   1 
ATOM   2641 O O   . LEU B 1 79  ? -21.816 7.404   -38.061 1.00 27.99 ? 123 LEU B O   1 
ATOM   2642 C CB  . LEU B 1 79  ? -20.555 6.465   -40.758 1.00 28.02 ? 123 LEU B CB  1 
ATOM   2643 C CG  . LEU B 1 79  ? -19.834 5.341   -40.003 1.00 29.85 ? 123 LEU B CG  1 
ATOM   2644 C CD1 . LEU B 1 79  ? -20.304 3.959   -40.513 1.00 35.92 ? 123 LEU B CD1 1 
ATOM   2645 C CD2 . LEU B 1 79  ? -18.321 5.472   -40.061 1.00 31.66 ? 123 LEU B CD2 1 
ATOM   2646 N N   . LEU B 1 80  ? -23.143 5.698   -38.584 1.00 25.82 ? 124 LEU B N   1 
ATOM   2647 C CA  . LEU B 1 80  ? -23.423 5.404   -37.228 1.00 26.27 ? 124 LEU B CA  1 
ATOM   2648 C C   . LEU B 1 80  ? -22.435 4.296   -36.879 1.00 26.17 ? 124 LEU B C   1 
ATOM   2649 O O   . LEU B 1 80  ? -21.858 3.643   -37.773 1.00 22.56 ? 124 LEU B O   1 
ATOM   2650 C CB  . LEU B 1 80  ? -24.878 4.949   -37.053 1.00 26.35 ? 124 LEU B CB  1 
ATOM   2651 C CG  . LEU B 1 80  ? -25.996 5.917   -37.543 1.00 27.34 ? 124 LEU B CG  1 
ATOM   2652 C CD1 . LEU B 1 80  ? -27.437 5.364   -37.349 1.00 25.03 ? 124 LEU B CD1 1 
ATOM   2653 C CD2 . LEU B 1 80  ? -25.871 7.301   -36.918 1.00 25.92 ? 124 LEU B CD2 1 
ATOM   2654 N N   . TRP B 1 81  ? -22.261 4.084   -35.589 1.00 25.64 ? 125 TRP B N   1 
ATOM   2655 C CA  . TRP B 1 81  ? -21.320 3.072   -35.132 1.00 27.86 ? 125 TRP B CA  1 
ATOM   2656 C C   . TRP B 1 81  ? -21.755 2.596   -33.756 1.00 28.71 ? 125 TRP B C   1 
ATOM   2657 O O   . TRP B 1 81  ? -22.418 3.328   -33.024 1.00 27.39 ? 125 TRP B O   1 
ATOM   2658 C CB  . TRP B 1 81  ? -19.879 3.612   -35.051 1.00 27.84 ? 125 TRP B CB  1 
ATOM   2659 C CG  . TRP B 1 81  ? -19.654 4.817   -34.096 1.00 29.39 ? 125 TRP B CG  1 
ATOM   2660 C CD1 . TRP B 1 81  ? -19.854 6.151   -34.385 1.00 29.08 ? 125 TRP B CD1 1 
ATOM   2661 C CD2 . TRP B 1 81  ? -19.199 4.782   -32.708 1.00 32.98 ? 125 TRP B CD2 1 
ATOM   2662 N NE1 . TRP B 1 81  ? -19.550 6.931   -33.293 1.00 30.12 ? 125 TRP B NE1 1 
ATOM   2663 C CE2 . TRP B 1 81  ? -19.139 6.127   -32.252 1.00 30.74 ? 125 TRP B CE2 1 
ATOM   2664 C CE3 . TRP B 1 81  ? -18.805 3.750   -31.822 1.00 30.00 ? 125 TRP B CE3 1 
ATOM   2665 C CZ2 . TRP B 1 81  ? -18.706 6.476   -30.932 1.00 34.28 ? 125 TRP B CZ2 1 
ATOM   2666 C CZ3 . TRP B 1 81  ? -18.369 4.091   -30.508 1.00 35.42 ? 125 TRP B CZ3 1 
ATOM   2667 C CH2 . TRP B 1 81  ? -18.343 5.449   -30.083 1.00 36.49 ? 125 TRP B CH2 1 
ATOM   2668 N N   . SER B 1 82  ? -21.414 1.363   -33.438 1.00 29.94 ? 126 SER B N   1 
ATOM   2669 C CA  . SER B 1 82  ? -21.718 0.849   -32.118 1.00 32.95 ? 126 SER B CA  1 
ATOM   2670 C C   . SER B 1 82  ? -20.575 -0.018  -31.721 1.00 34.03 ? 126 SER B C   1 
ATOM   2671 O O   . SER B 1 82  ? -20.286 -1.023  -32.393 1.00 35.03 ? 126 SER B O   1 
ATOM   2672 C CB  . SER B 1 82  ? -23.013 0.040   -32.103 1.00 32.44 ? 126 SER B CB  1 
ATOM   2673 O OG  . SER B 1 82  ? -23.385 -0.266  -30.748 1.00 36.33 ? 126 SER B OG  1 
ATOM   2674 N N   . ARG B 1 83  ? -19.902 0.402   -30.664 1.00 36.47 ? 127 ARG B N   1 
ATOM   2675 C CA  . ARG B 1 83  ? -18.869 -0.390  -29.978 1.00 38.23 ? 127 ARG B CA  1 
ATOM   2676 C C   . ARG B 1 83  ? -17.555 -0.566  -30.746 1.00 39.43 ? 127 ARG B C   1 
ATOM   2677 O O   . ARG B 1 83  ? -16.746 -1.436  -30.408 1.00 41.69 ? 127 ARG B O   1 
ATOM   2678 C CB  . ARG B 1 83  ? -19.429 -1.765  -29.607 1.00 38.16 ? 127 ARG B CB  1 
ATOM   2679 C CG  . ARG B 1 83  ? -20.076 -1.864  -28.233 1.00 40.30 ? 127 ARG B CG  1 
ATOM   2680 C CD  . ARG B 1 83  ? -21.469 -1.275  -28.084 1.00 44.06 ? 127 ARG B CD  1 
ATOM   2681 N NE  . ARG B 1 83  ? -21.970 -1.366  -26.683 1.00 46.48 ? 127 ARG B NE  1 
ATOM   2682 C CZ  . ARG B 1 83  ? -22.822 -2.301  -26.253 1.00 47.63 ? 127 ARG B CZ  1 
ATOM   2683 N NH1 . ARG B 1 83  ? -23.268 -3.239  -27.078 1.00 48.83 ? 127 ARG B NH1 1 
ATOM   2684 N NH2 . ARG B 1 83  ? -23.239 -2.312  -25.001 1.00 49.74 ? 127 ARG B NH2 1 
ATOM   2685 N N   . ILE B 1 84  ? -17.336 0.222   -31.786 1.00 39.55 ? 128 ILE B N   1 
ATOM   2686 C CA  . ILE B 1 84  ? -16.115 0.113   -32.577 1.00 39.47 ? 128 ILE B CA  1 
ATOM   2687 C C   . ILE B 1 84  ? -15.645 1.538   -32.916 1.00 40.35 ? 128 ILE B C   1 
ATOM   2688 O O   . ILE B 1 84  ? -15.524 1.955   -34.118 1.00 40.53 ? 128 ILE B O   1 
ATOM   2689 C CB  . ILE B 1 84  ? -16.376 -0.817  -33.812 1.00 39.98 ? 128 ILE B CB  1 
ATOM   2690 C CG1 . ILE B 1 84  ? -15.098 -1.091  -34.561 1.00 38.97 ? 128 ILE B CG1 1 
ATOM   2691 C CG2 . ILE B 1 84  ? -17.577 -0.322  -34.680 1.00 37.18 ? 128 ILE B CG2 1 
ATOM   2692 C CD1 . ILE B 1 84  ? -14.606 -2.497  -34.314 1.00 44.49 ? 128 ILE B CD1 1 
ATOM   2693 N N   . LYS B 1 85  ? -15.394 2.277   -31.826 1.00 41.29 ? 129 LYS B N   1 
ATOM   2694 C CA  . LYS B 1 85  ? -15.147 3.718   -31.841 1.00 41.73 ? 129 LYS B CA  1 
ATOM   2695 C C   . LYS B 1 85  ? -13.999 4.049   -32.785 1.00 41.95 ? 129 LYS B C   1 
ATOM   2696 O O   . LYS B 1 85  ? -14.168 4.848   -33.720 1.00 41.01 ? 129 LYS B O   1 
ATOM   2697 C CB  . LYS B 1 85  ? -14.782 4.189   -30.446 1.00 43.42 ? 129 LYS B CB  1 
ATOM   2698 C CG  . LYS B 1 85  ? -14.947 5.687   -30.212 1.00 46.34 ? 129 LYS B CG  1 
ATOM   2699 C CD  . LYS B 1 85  ? -14.375 6.136   -28.853 1.00 47.07 ? 129 LYS B CD  1 
ATOM   2700 C CE  . LYS B 1 85  ? -14.394 7.682   -28.786 1.00 52.09 ? 129 LYS B CE  1 
ATOM   2701 N NZ  . LYS B 1 85  ? -15.476 8.238   -27.932 1.00 51.52 ? 129 LYS B NZ  1 
ATOM   2702 N N   . ASP B 1 86  ? -12.854 3.400   -32.539 1.00 40.91 ? 130 ASP B N   1 
ATOM   2703 C CA  . ASP B 1 86  ? -11.613 3.676   -33.252 1.00 39.80 ? 130 ASP B CA  1 
ATOM   2704 C C   . ASP B 1 86  ? -11.675 3.546   -34.796 1.00 38.10 ? 130 ASP B C   1 
ATOM   2705 O O   . ASP B 1 86  ? -11.320 4.493   -35.460 1.00 36.65 ? 130 ASP B O   1 
ATOM   2706 C CB  . ASP B 1 86  ? -10.436 2.886   -32.640 1.00 41.23 ? 130 ASP B CB  1 
ATOM   2707 C CG  . ASP B 1 86  ? -10.046 3.390   -31.238 1.00 44.33 ? 130 ASP B CG  1 
ATOM   2708 O OD1 . ASP B 1 86  ? -10.888 4.047   -30.580 1.00 46.83 ? 130 ASP B OD1 1 
ATOM   2709 O OD2 . ASP B 1 86  ? -8.913  3.173   -30.716 1.00 47.40 ? 130 ASP B OD2 1 
ATOM   2710 N N   . LEU B 1 87  ? -12.115 2.398   -35.337 1.00 36.73 ? 131 LEU B N   1 
ATOM   2711 C CA  . LEU B 1 87  ? -12.340 2.215   -36.791 1.00 37.10 ? 131 LEU B CA  1 
ATOM   2712 C C   . LEU B 1 87  ? -13.330 3.208   -37.377 1.00 35.61 ? 131 LEU B C   1 
ATOM   2713 O O   . LEU B 1 87  ? -13.118 3.672   -38.491 1.00 35.50 ? 131 LEU B O   1 
ATOM   2714 C CB  . LEU B 1 87  ? -12.803 0.797   -37.109 1.00 36.98 ? 131 LEU B CB  1 
ATOM   2715 C CG  . LEU B 1 87  ? -12.398 0.016   -38.354 1.00 40.15 ? 131 LEU B CG  1 
ATOM   2716 C CD1 . LEU B 1 87  ? -13.552 -0.883  -38.685 1.00 41.23 ? 131 LEU B CD1 1 
ATOM   2717 C CD2 . LEU B 1 87  ? -12.084 0.841   -39.576 1.00 41.80 ? 131 LEU B CD2 1 
ATOM   2718 N N   . ALA B 1 88  ? -14.377 3.576   -36.641 1.00 34.04 ? 132 ALA B N   1 
ATOM   2719 C CA  . ALA B 1 88  ? -15.311 4.548   -37.158 1.00 33.96 ? 132 ALA B CA  1 
ATOM   2720 C C   . ALA B 1 88  ? -14.638 5.865   -37.391 1.00 33.96 ? 132 ALA B C   1 
ATOM   2721 O O   . ALA B 1 88  ? -14.800 6.462   -38.448 1.00 33.08 ? 132 ALA B O   1 
ATOM   2722 C CB  . ALA B 1 88  ? -16.554 4.733   -36.254 1.00 34.98 ? 132 ALA B CB  1 
ATOM   2723 N N   . HIS B 1 89  ? -13.911 6.352   -36.397 1.00 34.59 ? 133 HIS B N   1 
ATOM   2724 C CA  . HIS B 1 89  ? -13.341 7.691   -36.524 1.00 35.46 ? 133 HIS B CA  1 
ATOM   2725 C C   . HIS B 1 89  ? -12.099 7.741   -37.393 1.00 35.80 ? 133 HIS B C   1 
ATOM   2726 O O   . HIS B 1 89  ? -11.875 8.738   -38.059 1.00 35.13 ? 133 HIS B O   1 
ATOM   2727 C CB  . HIS B 1 89  ? -13.084 8.341   -35.186 1.00 35.79 ? 133 HIS B CB  1 
ATOM   2728 C CG  . HIS B 1 89  ? -14.283 8.332   -34.312 1.00 38.87 ? 133 HIS B CG  1 
ATOM   2729 N ND1 . HIS B 1 89  ? -15.401 9.078   -34.602 1.00 40.06 ? 133 HIS B ND1 1 
ATOM   2730 C CD2 . HIS B 1 89  ? -14.582 7.596   -33.219 1.00 39.73 ? 133 HIS B CD2 1 
ATOM   2731 C CE1 . HIS B 1 89  ? -16.327 8.844   -33.688 1.00 41.80 ? 133 HIS B CE1 1 
ATOM   2732 N NE2 . HIS B 1 89  ? -15.859 7.940   -32.844 1.00 45.05 ? 133 HIS B NE2 1 
ATOM   2733 N N   . GLN B 1 90  ? -11.289 6.686   -37.386 1.00 36.36 ? 134 GLN B N   1 
ATOM   2734 C CA  . GLN B 1 90  ? -10.210 6.620   -38.381 1.00 36.45 ? 134 GLN B CA  1 
ATOM   2735 C C   . GLN B 1 90  ? -10.800 6.705   -39.824 1.00 36.38 ? 134 GLN B C   1 
ATOM   2736 O O   . GLN B 1 90  ? -10.188 7.262   -40.750 1.00 36.29 ? 134 GLN B O   1 
ATOM   2737 C CB  . GLN B 1 90  ? -9.386  5.350   -38.189 1.00 37.03 ? 134 GLN B CB  1 
ATOM   2738 C CG  . GLN B 1 90  ? -8.554  5.294   -36.913 1.00 38.98 ? 134 GLN B CG  1 
ATOM   2739 C CD  . GLN B 1 90  ? -8.054  3.866   -36.623 1.00 43.69 ? 134 GLN B CD  1 
ATOM   2740 O OE1 . GLN B 1 90  ? -8.453  2.911   -37.288 1.00 46.31 ? 134 GLN B OE1 1 
ATOM   2741 N NE2 . GLN B 1 90  ? -7.220  3.725   -35.623 1.00 44.85 ? 134 GLN B NE2 1 
ATOM   2742 N N   . PHE B 1 91  ? -12.001 6.156   -40.004 1.00 36.08 ? 135 PHE B N   1 
ATOM   2743 C CA  . PHE B 1 91  ? -12.638 6.102   -41.306 1.00 36.46 ? 135 PHE B CA  1 
ATOM   2744 C C   . PHE B 1 91  ? -12.986 7.512   -41.765 1.00 36.25 ? 135 PHE B C   1 
ATOM   2745 O O   . PHE B 1 91  ? -12.704 7.865   -42.889 1.00 34.97 ? 135 PHE B O   1 
ATOM   2746 C CB  . PHE B 1 91  ? -13.892 5.196   -41.318 1.00 35.06 ? 135 PHE B CB  1 
ATOM   2747 C CG  . PHE B 1 91  ? -14.564 5.136   -42.674 1.00 36.71 ? 135 PHE B CG  1 
ATOM   2748 C CD1 . PHE B 1 91  ? -15.703 5.906   -42.928 1.00 35.12 ? 135 PHE B CD1 1 
ATOM   2749 C CD2 . PHE B 1 91  ? -14.037 4.355   -43.687 1.00 31.66 ? 135 PHE B CD2 1 
ATOM   2750 C CE1 . PHE B 1 91  ? -16.307 5.895   -44.129 1.00 36.08 ? 135 PHE B CE1 1 
ATOM   2751 C CE2 . PHE B 1 91  ? -14.663 4.305   -44.938 1.00 34.86 ? 135 PHE B CE2 1 
ATOM   2752 C CZ  . PHE B 1 91  ? -15.788 5.087   -45.168 1.00 37.12 ? 135 PHE B CZ  1 
ATOM   2753 N N   . THR B 1 92  ? -13.608 8.303   -40.891 1.00 36.24 ? 136 THR B N   1 
ATOM   2754 C CA  . THR B 1 92  ? -14.023 9.658   -41.274 1.00 37.36 ? 136 THR B CA  1 
ATOM   2755 C C   . THR B 1 92  ? -12.887 10.648  -41.185 1.00 37.84 ? 136 THR B C   1 
ATOM   2756 O O   . THR B 1 92  ? -13.028 11.828  -41.549 1.00 38.05 ? 136 THR B O   1 
ATOM   2757 C CB  . THR B 1 92  ? -15.158 10.165  -40.396 1.00 36.62 ? 136 THR B CB  1 
ATOM   2758 O OG1 . THR B 1 92  ? -14.675 10.189  -39.064 1.00 39.36 ? 136 THR B OG1 1 
ATOM   2759 C CG2 . THR B 1 92  ? -16.303 9.192   -40.376 1.00 34.88 ? 136 THR B CG2 1 
ATOM   2760 N N   . GLN B 1 93  ? -11.766 10.175  -40.677 1.00 38.90 ? 137 GLN B N   1 
ATOM   2761 C CA  . GLN B 1 93  ? -10.555 10.944  -40.760 1.00 41.23 ? 137 GLN B CA  1 
ATOM   2762 C C   . GLN B 1 93  ? -10.013 10.839  -42.214 1.00 41.84 ? 137 GLN B C   1 
ATOM   2763 O O   . GLN B 1 93  ? -9.553  11.820  -42.792 1.00 41.53 ? 137 GLN B O   1 
ATOM   2764 C CB  . GLN B 1 93  ? -9.572  10.516  -39.681 1.00 41.60 ? 137 GLN B CB  1 
ATOM   2765 C CG  . GLN B 1 93  ? -9.996  10.980  -38.251 1.00 45.27 ? 137 GLN B CG  1 
ATOM   2766 C CD  . GLN B 1 93  ? -9.372  12.311  -37.800 1.00 48.92 ? 137 GLN B CD  1 
ATOM   2767 O OE1 . GLN B 1 93  ? -9.272  13.282  -38.589 1.00 49.53 ? 137 GLN B OE1 1 
ATOM   2768 N NE2 . GLN B 1 93  ? -8.923  12.350  -36.537 1.00 47.94 ? 137 GLN B NE2 1 
ATOM   2769 N N   . VAL B 1 94  ? -10.154 9.677   -42.839 1.00 42.48 ? 138 VAL B N   1 
ATOM   2770 C CA  . VAL B 1 94  ? -9.771  9.571   -44.233 1.00 43.11 ? 138 VAL B CA  1 
ATOM   2771 C C   . VAL B 1 94  ? -10.854 10.053  -45.193 1.00 44.20 ? 138 VAL B C   1 
ATOM   2772 O O   . VAL B 1 94  ? -10.604 10.949  -46.005 1.00 44.12 ? 138 VAL B O   1 
ATOM   2773 C CB  . VAL B 1 94  ? -9.349  8.162   -44.643 1.00 43.09 ? 138 VAL B CB  1 
ATOM   2774 C CG1 . VAL B 1 94  ? -8.819  8.213   -46.083 1.00 42.83 ? 138 VAL B CG1 1 
ATOM   2775 C CG2 . VAL B 1 94  ? -8.301  7.614   -43.686 1.00 43.02 ? 138 VAL B CG2 1 
ATOM   2776 N N   . GLN B 1 95  ? -12.032 9.427   -45.136 1.00 44.35 ? 139 GLN B N   1 
ATOM   2777 C CA  . GLN B 1 95  ? -13.104 9.726   -46.063 1.00 45.48 ? 139 GLN B CA  1 
ATOM   2778 C C   . GLN B 1 95  ? -13.779 10.947  -45.502 1.00 46.70 ? 139 GLN B C   1 
ATOM   2779 O O   . GLN B 1 95  ? -14.944 10.867  -45.079 1.00 47.12 ? 139 GLN B O   1 
ATOM   2780 N N   . ARG B 1 96  ? -13.046 12.073  -45.491 1.00 47.18 ? 140 ARG B N   1 
ATOM   2781 C CA  . ARG B 1 96  ? -13.439 13.288  -44.765 1.00 47.04 ? 140 ARG B CA  1 
ATOM   2782 C C   . ARG B 1 96  ? -14.823 13.894  -44.996 1.00 46.95 ? 140 ARG B C   1 
ATOM   2783 O O   . ARG B 1 96  ? -15.299 14.674  -44.141 1.00 47.76 ? 140 ARG B O   1 
ATOM   2784 N N   . ASP B 1 97  ? -15.470 13.549  -46.122 1.00 45.66 ? 141 ASP B N   1 
ATOM   2785 C CA  . ASP B 1 97  ? -16.835 13.987  -46.430 1.00 44.05 ? 141 ASP B CA  1 
ATOM   2786 C C   . ASP B 1 97  ? -17.912 13.252  -45.616 1.00 42.82 ? 141 ASP B C   1 
ATOM   2787 O O   . ASP B 1 97  ? -19.132 13.500  -45.758 1.00 41.77 ? 141 ASP B O   1 
ATOM   2788 N N   . MET B 1 98  ? -17.465 12.331  -44.755 1.00 41.03 ? 142 MET B N   1 
ATOM   2789 C CA  . MET B 1 98  ? -18.382 11.513  -43.995 1.00 39.38 ? 142 MET B CA  1 
ATOM   2790 C C   . MET B 1 98  ? -18.315 11.898  -42.535 1.00 36.72 ? 142 MET B C   1 
ATOM   2791 O O   . MET B 1 98  ? -17.276 12.421  -42.101 1.00 34.84 ? 142 MET B O   1 
ATOM   2792 C CB  . MET B 1 98  ? -18.120 10.032  -44.263 1.00 41.42 ? 142 MET B CB  1 
ATOM   2793 C CG  . MET B 1 98  ? -19.000 9.516   -45.408 1.00 44.50 ? 142 MET B CG  1 
ATOM   2794 S SD  . MET B 1 98  ? -19.997 8.046   -44.921 1.00 57.22 ? 142 MET B SD  1 
ATOM   2795 C CE  . MET B 1 98  ? -19.833 7.153   -46.619 1.00 54.83 ? 142 MET B CE  1 
ATOM   2796 N N   . PHE B 1 99  ? -19.452 11.704  -41.833 1.00 33.22 ? 143 PHE B N   1 
ATOM   2797 C CA  . PHE B 1 99  ? -19.703 12.216  -40.500 1.00 31.88 ? 143 PHE B CA  1 
ATOM   2798 C C   . PHE B 1 99  ? -20.268 11.151  -39.519 1.00 27.77 ? 143 PHE B C   1 
ATOM   2799 O O   . PHE B 1 99  ? -21.302 10.519  -39.782 1.00 27.81 ? 143 PHE B O   1 
ATOM   2800 C CB  . PHE B 1 99  ? -20.710 13.395  -40.545 1.00 32.73 ? 143 PHE B CB  1 
ATOM   2801 C CG  . PHE B 1 99  ? -20.079 14.716  -40.906 1.00 37.45 ? 143 PHE B CG  1 
ATOM   2802 C CD1 . PHE B 1 99  ? -19.672 15.605  -39.919 1.00 38.59 ? 143 PHE B CD1 1 
ATOM   2803 C CD2 . PHE B 1 99  ? -19.891 15.064  -42.243 1.00 39.59 ? 143 PHE B CD2 1 
ATOM   2804 C CE1 . PHE B 1 99  ? -19.074 16.835  -40.270 1.00 41.85 ? 143 PHE B CE1 1 
ATOM   2805 C CE2 . PHE B 1 99  ? -19.291 16.289  -42.616 1.00 43.69 ? 143 PHE B CE2 1 
ATOM   2806 C CZ  . PHE B 1 99  ? -18.883 17.179  -41.621 1.00 44.57 ? 143 PHE B CZ  1 
ATOM   2807 N N   . THR B 1 100 ? -19.568 10.977  -38.406 1.00 26.68 ? 144 THR B N   1 
ATOM   2808 C CA  . THR B 1 100 ? -20.144 10.329  -37.221 1.00 24.87 ? 144 THR B CA  1 
ATOM   2809 C C   . THR B 1 100 ? -20.574 11.454  -36.325 1.00 24.27 ? 144 THR B C   1 
ATOM   2810 O O   . THR B 1 100 ? -20.103 12.618  -36.462 1.00 23.80 ? 144 THR B O   1 
ATOM   2811 C CB  . THR B 1 100 ? -19.116 9.537   -36.432 1.00 24.02 ? 144 THR B CB  1 
ATOM   2812 O OG1 . THR B 1 100 ? -18.124 10.422  -35.871 1.00 23.90 ? 144 THR B OG1 1 
ATOM   2813 C CG2 . THR B 1 100 ? -18.365 8.628   -37.313 1.00 25.30 ? 144 THR B CG2 1 
ATOM   2814 N N   . LEU B 1 101 ? -21.406 11.097  -35.343 1.00 21.90 ? 145 LEU B N   1 
ATOM   2815 C CA  . LEU B 1 101 ? -21.856 12.066  -34.348 1.00 21.48 ? 145 LEU B CA  1 
ATOM   2816 C C   . LEU B 1 101 ? -20.742 12.965  -33.788 1.00 20.24 ? 145 LEU B C   1 
ATOM   2817 O O   . LEU B 1 101 ? -20.905 14.168  -33.610 1.00 19.56 ? 145 LEU B O   1 
ATOM   2818 C CB  . LEU B 1 101 ? -22.556 11.275  -33.205 1.00 20.15 ? 145 LEU B CB  1 
ATOM   2819 C CG  . LEU B 1 101 ? -23.220 12.073  -32.134 1.00 20.76 ? 145 LEU B CG  1 
ATOM   2820 C CD1 . LEU B 1 101 ? -24.241 13.048  -32.663 1.00 22.57 ? 145 LEU B CD1 1 
ATOM   2821 C CD2 . LEU B 1 101 ? -23.914 11.077  -31.191 1.00 20.67 ? 145 LEU B CD2 1 
ATOM   2822 N N   . GLU B 1 102 ? -19.627 12.360  -33.452 1.00 21.57 ? 146 GLU B N   1 
ATOM   2823 C CA  . GLU B 1 102 ? -18.519 13.045  -32.846 1.00 25.60 ? 146 GLU B CA  1 
ATOM   2824 C C   . GLU B 1 102 ? -17.731 13.942  -33.818 1.00 27.08 ? 146 GLU B C   1 
ATOM   2825 O O   . GLU B 1 102 ? -16.850 14.704  -33.413 1.00 28.45 ? 146 GLU B O   1 
ATOM   2826 C CB  . GLU B 1 102 ? -17.580 11.963  -32.255 1.00 27.65 ? 146 GLU B CB  1 
ATOM   2827 C CG  . GLU B 1 102 ? -18.278 11.051  -31.203 1.00 30.40 ? 146 GLU B CG  1 
ATOM   2828 C CD  . GLU B 1 102 ? -19.194 9.940   -31.769 1.00 35.63 ? 146 GLU B CD  1 
ATOM   2829 O OE1 . GLU B 1 102 ? -18.985 9.439   -32.920 1.00 27.95 ? 146 GLU B OE1 1 
ATOM   2830 O OE2 . GLU B 1 102 ? -20.128 9.526   -31.012 1.00 36.50 ? 146 GLU B OE2 1 
ATOM   2831 N N   . ASP B 1 103 ? -18.061 13.854  -35.101 1.00 27.71 ? 147 ASP B N   1 
ATOM   2832 C CA  . ASP B 1 103 ? -17.490 14.775  -36.073 1.00 28.55 ? 147 ASP B CA  1 
ATOM   2833 C C   . ASP B 1 103 ? -18.324 16.049  -36.158 1.00 28.32 ? 147 ASP B C   1 
ATOM   2834 O O   . ASP B 1 103 ? -17.856 17.054  -36.705 1.00 28.93 ? 147 ASP B O   1 
ATOM   2835 C CB  . ASP B 1 103 ? -17.357 14.088  -37.441 1.00 29.37 ? 147 ASP B CB  1 
ATOM   2836 C CG  . ASP B 1 103 ? -16.351 12.927  -37.415 1.00 27.62 ? 147 ASP B CG  1 
ATOM   2837 O OD1 . ASP B 1 103 ? -16.694 11.811  -37.839 1.00 27.00 ? 147 ASP B OD1 1 
ATOM   2838 O OD2 . ASP B 1 103 ? -15.193 13.035  -36.977 1.00 31.69 ? 147 ASP B OD2 1 
ATOM   2839 N N   . THR B 1 104 ? -19.555 16.016  -35.621 1.00 27.78 ? 148 THR B N   1 
ATOM   2840 C CA  . THR B 1 104 ? -20.370 17.263  -35.536 1.00 27.17 ? 148 THR B CA  1 
ATOM   2841 C C   . THR B 1 104 ? -19.794 18.064  -34.392 1.00 25.62 ? 148 THR B C   1 
ATOM   2842 O O   . THR B 1 104 ? -19.100 17.462  -33.584 1.00 27.28 ? 148 THR B O   1 
ATOM   2843 C CB  . THR B 1 104 ? -21.877 17.024  -35.360 1.00 27.10 ? 148 THR B CB  1 
ATOM   2844 O OG1 . THR B 1 104 ? -22.168 16.366  -34.074 1.00 29.71 ? 148 THR B OG1 1 
ATOM   2845 C CG2 . THR B 1 104 ? -22.396 16.102  -36.449 1.00 25.66 ? 148 THR B CG2 1 
ATOM   2846 N N   . LEU B 1 105 ? -20.087 19.354  -34.268 1.00 24.09 ? 149 LEU B N   1 
ATOM   2847 C CA  . LEU B 1 105 ? -19.504 20.162  -33.191 1.00 23.82 ? 149 LEU B CA  1 
ATOM   2848 C C   . LEU B 1 105 ? -19.872 19.703  -31.735 1.00 23.80 ? 149 LEU B C   1 
ATOM   2849 O O   . LEU B 1 105 ? -19.001 19.524  -30.877 1.00 22.52 ? 149 LEU B O   1 
ATOM   2850 C CB  . LEU B 1 105 ? -19.906 21.614  -33.339 1.00 25.18 ? 149 LEU B CB  1 
ATOM   2851 C CG  . LEU B 1 105 ? -19.915 22.506  -32.093 1.00 21.55 ? 149 LEU B CG  1 
ATOM   2852 C CD1 . LEU B 1 105 ? -18.579 23.074  -31.804 1.00 25.95 ? 149 LEU B CD1 1 
ATOM   2853 C CD2 . LEU B 1 105 ? -20.868 23.610  -32.309 1.00 25.75 ? 149 LEU B CD2 1 
ATOM   2854 N N   . LEU B 1 106 ? -21.169 19.597  -31.478 1.00 24.02 ? 150 LEU B N   1 
ATOM   2855 C CA  . LEU B 1 106 ? -21.683 19.164  -30.192 1.00 24.03 ? 150 LEU B CA  1 
ATOM   2856 C C   . LEU B 1 106 ? -21.074 17.874  -29.717 1.00 22.67 ? 150 LEU B C   1 
ATOM   2857 O O   . LEU B 1 106 ? -20.635 17.783  -28.574 1.00 23.34 ? 150 LEU B O   1 
ATOM   2858 C CB  . LEU B 1 106 ? -23.203 19.027  -30.273 1.00 24.27 ? 150 LEU B CB  1 
ATOM   2859 C CG  . LEU B 1 106 ? -23.976 20.359  -30.429 1.00 25.97 ? 150 LEU B CG  1 
ATOM   2860 C CD1 . LEU B 1 106 ? -25.487 20.111  -30.441 1.00 27.47 ? 150 LEU B CD1 1 
ATOM   2861 C CD2 . LEU B 1 106 ? -23.563 21.331  -29.308 1.00 26.97 ? 150 LEU B CD2 1 
ATOM   2862 N N   . GLY B 1 107 ? -20.995 16.885  -30.600 1.00 22.84 ? 151 GLY B N   1 
ATOM   2863 C CA  . GLY B 1 107 ? -20.423 15.569  -30.289 1.00 21.48 ? 151 GLY B CA  1 
ATOM   2864 C C   . GLY B 1 107 ? -18.909 15.623  -30.101 1.00 21.65 ? 151 GLY B C   1 
ATOM   2865 O O   . GLY B 1 107 ? -18.326 14.868  -29.328 1.00 19.70 ? 151 GLY B O   1 
ATOM   2866 N N   . TYR B 1 108 ? -18.268 16.548  -30.811 1.00 20.01 ? 152 TYR B N   1 
ATOM   2867 C CA  . TYR B 1 108 ? -16.864 16.783  -30.653 1.00 19.60 ? 152 TYR B CA  1 
ATOM   2868 C C   . TYR B 1 108 ? -16.552 17.514  -29.322 1.00 17.05 ? 152 TYR B C   1 
ATOM   2869 O O   . TYR B 1 108 ? -15.519 17.301  -28.720 1.00 18.05 ? 152 TYR B O   1 
ATOM   2870 C CB  . TYR B 1 108 ? -16.424 17.620  -31.865 1.00 20.12 ? 152 TYR B CB  1 
ATOM   2871 C CG  . TYR B 1 108 ? -14.975 18.023  -31.864 1.00 23.67 ? 152 TYR B CG  1 
ATOM   2872 C CD1 . TYR B 1 108 ? -14.558 19.176  -31.222 1.00 25.37 ? 152 TYR B CD1 1 
ATOM   2873 C CD2 . TYR B 1 108 ? -14.016 17.244  -32.522 1.00 28.09 ? 152 TYR B CD2 1 
ATOM   2874 C CE1 . TYR B 1 108 ? -13.202 19.535  -31.206 1.00 30.37 ? 152 TYR B CE1 1 
ATOM   2875 C CE2 . TYR B 1 108 ? -12.645 17.619  -32.565 1.00 32.62 ? 152 TYR B CE2 1 
ATOM   2876 C CZ  . TYR B 1 108 ? -12.253 18.777  -31.898 1.00 33.05 ? 152 TYR B CZ  1 
ATOM   2877 O OH  . TYR B 1 108 ? -10.916 19.191  -31.879 1.00 36.57 ? 152 TYR B OH  1 
ATOM   2878 N N   . LEU B 1 109 ? -17.429 18.372  -28.853 1.00 15.72 ? 153 LEU B N   1 
ATOM   2879 C CA  . LEU B 1 109 ? -17.145 19.068  -27.595 1.00 17.63 ? 153 LEU B CA  1 
ATOM   2880 C C   . LEU B 1 109 ? -17.140 18.024  -26.410 1.00 17.47 ? 153 LEU B C   1 
ATOM   2881 O O   . LEU B 1 109 ? -16.331 18.122  -25.536 1.00 18.90 ? 153 LEU B O   1 
ATOM   2882 C CB  . LEU B 1 109 ? -18.225 20.052  -27.224 1.00 17.09 ? 153 LEU B CB  1 
ATOM   2883 C CG  . LEU B 1 109 ? -18.373 21.291  -28.104 1.00 21.08 ? 153 LEU B CG  1 
ATOM   2884 C CD1 . LEU B 1 109 ? -19.516 22.075  -27.553 1.00 20.64 ? 153 LEU B CD1 1 
ATOM   2885 C CD2 . LEU B 1 109 ? -17.061 22.046  -28.130 1.00 21.17 ? 153 LEU B CD2 1 
ATOM   2886 N N   . ALA B 1 110 ? -18.058 17.075  -26.437 1.00 17.58 ? 154 ALA B N   1 
ATOM   2887 C CA  . ALA B 1 110 ? -18.259 16.176  -25.311 1.00 18.68 ? 154 ALA B CA  1 
ATOM   2888 C C   . ALA B 1 110 ? -17.620 14.793  -25.406 1.00 17.76 ? 154 ALA B C   1 
ATOM   2889 O O   . ALA B 1 110 ? -17.640 14.035  -24.489 1.00 19.79 ? 154 ALA B O   1 
ATOM   2890 C CB  . ALA B 1 110 ? -19.754 16.093  -25.066 1.00 17.35 ? 154 ALA B CB  1 
ATOM   2891 N N   . ASP B 1 111 ? -17.059 14.430  -26.531 1.00 17.77 ? 155 ASP B N   1 
ATOM   2892 C CA  . ASP B 1 111 ? -16.388 13.162  -26.693 1.00 19.26 ? 155 ASP B CA  1 
ATOM   2893 C C   . ASP B 1 111 ? -15.386 12.804  -25.573 1.00 17.65 ? 155 ASP B C   1 
ATOM   2894 O O   . ASP B 1 111 ? -14.462 13.536  -25.302 1.00 18.04 ? 155 ASP B O   1 
ATOM   2895 C CB  . ASP B 1 111 ? -15.676 13.152  -28.058 1.00 21.42 ? 155 ASP B CB  1 
ATOM   2896 C CG  . ASP B 1 111 ? -15.360 11.754  -28.524 1.00 26.21 ? 155 ASP B CG  1 
ATOM   2897 O OD1 . ASP B 1 111 ? -14.273 11.624  -29.109 1.00 33.36 ? 155 ASP B OD1 1 
ATOM   2898 O OD2 . ASP B 1 111 ? -16.101 10.748  -28.321 1.00 26.36 ? 155 ASP B OD2 1 
ATOM   2899 N N   . ASP B 1 112 ? -15.601 11.667  -24.941 1.00 18.57 ? 156 ASP B N   1 
ATOM   2900 C CA  . ASP B 1 112 ? -14.699 11.126  -23.884 1.00 18.90 ? 156 ASP B CA  1 
ATOM   2901 C C   . ASP B 1 112 ? -14.711 11.893  -22.573 1.00 18.44 ? 156 ASP B C   1 
ATOM   2902 O O   . ASP B 1 112 ? -13.875 11.622  -21.718 1.00 19.72 ? 156 ASP B O   1 
ATOM   2903 C CB  . ASP B 1 112 ? -13.215 10.979  -24.351 1.00 21.02 ? 156 ASP B CB  1 
ATOM   2904 C CG  . ASP B 1 112 ? -13.037 9.935   -25.511 1.00 27.63 ? 156 ASP B CG  1 
ATOM   2905 O OD1 . ASP B 1 112 ? -13.833 8.943   -25.587 1.00 33.69 ? 156 ASP B OD1 1 
ATOM   2906 O OD2 . ASP B 1 112 ? -12.110 10.029  -26.382 1.00 36.12 ? 156 ASP B OD2 1 
ATOM   2907 N N   . LEU B 1 113 ? -15.597 12.871  -22.405 1.00 16.45 ? 157 LEU B N   1 
ATOM   2908 C CA  . LEU B 1 113 ? -15.593 13.658  -21.155 1.00 14.09 ? 157 LEU B CA  1 
ATOM   2909 C C   . LEU B 1 113 ? -16.767 13.198  -20.281 1.00 15.57 ? 157 LEU B C   1 
ATOM   2910 O O   . LEU B 1 113 ? -17.740 12.622  -20.788 1.00 16.23 ? 157 LEU B O   1 
ATOM   2911 C CB  . LEU B 1 113 ? -15.770 15.133  -21.440 1.00 14.85 ? 157 LEU B CB  1 
ATOM   2912 C CG  . LEU B 1 113 ? -14.605 15.776  -22.276 1.00 15.63 ? 157 LEU B CG  1 
ATOM   2913 C CD1 . LEU B 1 113 ? -14.745 17.235  -22.516 1.00 10.95 ? 157 LEU B CD1 1 
ATOM   2914 C CD2 . LEU B 1 113 ? -13.261 15.487  -21.670 1.00 12.28 ? 157 LEU B CD2 1 
ATOM   2915 N N   . THR B 1 114 ? -16.688 13.489  -19.005 1.00 13.00 ? 158 THR B N   1 
ATOM   2916 C CA  . THR B 1 114 ? -17.784 13.230  -18.076 1.00 14.28 ? 158 THR B CA  1 
ATOM   2917 C C   . THR B 1 114 ? -17.998 14.500  -17.308 1.00 11.83 ? 158 THR B C   1 
ATOM   2918 O O   . THR B 1 114 ? -17.032 15.257  -17.100 1.00 11.84 ? 158 THR B O   1 
ATOM   2919 C CB  . THR B 1 114 ? -17.299 12.159  -17.050 1.00 14.64 ? 158 THR B CB  1 
ATOM   2920 O OG1 . THR B 1 114 ? -17.077 10.935  -17.758 1.00 18.40 ? 158 THR B OG1 1 
ATOM   2921 C CG2 . THR B 1 114 ? -18.415 11.827  -16.079 1.00 16.77 ? 158 THR B CG2 1 
ATOM   2922 N N   . TRP B 1 115 ? -19.219 14.750  -16.856 1.00 9.67  ? 159 TRP B N   1 
ATOM   2923 C CA  . TRP B 1 115 ? -19.511 15.976  -16.161 1.00 10.21 ? 159 TRP B CA  1 
ATOM   2924 C C   . TRP B 1 115 ? -20.761 15.818  -15.304 1.00 11.06 ? 159 TRP B C   1 
ATOM   2925 O O   . TRP B 1 115 ? -21.610 15.059  -15.632 1.00 10.21 ? 159 TRP B O   1 
ATOM   2926 C CB  . TRP B 1 115 ? -19.638 17.214  -17.145 1.00 11.99 ? 159 TRP B CB  1 
ATOM   2927 C CG  . TRP B 1 115 ? -20.778 17.073  -18.135 1.00 10.88 ? 159 TRP B CG  1 
ATOM   2928 C CD1 . TRP B 1 115 ? -22.051 17.549  -18.019 1.00 9.38  ? 159 TRP B CD1 1 
ATOM   2929 C CD2 . TRP B 1 115 ? -20.714 16.386  -19.371 1.00 10.49 ? 159 TRP B CD2 1 
ATOM   2930 N NE1 . TRP B 1 115 ? -22.806 17.159  -19.109 1.00 12.54 ? 159 TRP B NE1 1 
ATOM   2931 C CE2 . TRP B 1 115 ? -22.000 16.462  -19.968 1.00 12.38 ? 159 TRP B CE2 1 
ATOM   2932 C CE3 . TRP B 1 115 ? -19.675 15.776  -20.087 1.00 11.78 ? 159 TRP B CE3 1 
ATOM   2933 C CZ2 . TRP B 1 115 ? -22.288 15.893  -21.213 1.00 13.83 ? 159 TRP B CZ2 1 
ATOM   2934 C CZ3 . TRP B 1 115 ? -19.956 15.200  -21.322 1.00 14.85 ? 159 TRP B CZ3 1 
ATOM   2935 C CH2 . TRP B 1 115 ? -21.245 15.266  -21.886 1.00 12.44 ? 159 TRP B CH2 1 
ATOM   2936 N N   . CYS B 1 116 ? -20.845 16.558  -14.202 1.00 12.26 ? 160 CYS B N   1 
ATOM   2937 C CA  . CYS B 1 116 ? -22.091 16.711  -13.418 1.00 12.04 ? 160 CYS B CA  1 
ATOM   2938 C C   . CYS B 1 116 ? -21.894 17.822  -12.395 1.00 11.47 ? 160 CYS B C   1 
ATOM   2939 O O   . CYS B 1 116 ? -20.754 18.222  -12.100 1.00 10.00 ? 160 CYS B O   1 
ATOM   2940 C CB  . CYS B 1 116 ? -22.619 15.382  -12.692 1.00 14.08 ? 160 CYS B CB  1 
ATOM   2941 S SG  . CYS B 1 116 ? -21.377 14.808  -11.571 1.00 18.01 ? 160 CYS B SG  1 
ATOM   2942 N N   . GLY B 1 117 ? -22.994 18.364  -11.927 1.00 10.97 ? 161 GLY B N   1 
ATOM   2943 C CA  . GLY B 1 117 ? -22.997 19.337  -10.819 1.00 11.50 ? 161 GLY B CA  1 
ATOM   2944 C C   . GLY B 1 117 ? -23.722 18.814  -9.627  1.00 14.57 ? 161 GLY B C   1 
ATOM   2945 O O   . GLY B 1 117 ? -23.735 17.614  -9.359  1.00 14.71 ? 161 GLY B O   1 
ATOM   2946 N N   . GLU B 1 118 ? -24.416 19.699  -8.911  1.00 14.75 ? 162 GLU B N   1 
ATOM   2947 C CA  . GLU B 1 118 ? -25.140 19.258  -7.770  1.00 16.22 ? 162 GLU B CA  1 
ATOM   2948 C C   . GLU B 1 118 ? -26.243 20.250  -7.463  1.00 17.23 ? 162 GLU B C   1 
ATOM   2949 O O   . GLU B 1 118 ? -26.188 21.372  -7.961  1.00 14.03 ? 162 GLU B O   1 
ATOM   2950 C CB  . GLU B 1 118 ? -24.213 19.015  -6.580  1.00 18.71 ? 162 GLU B CB  1 
ATOM   2951 C CG  . GLU B 1 118 ? -23.647 20.214  -5.842  1.00 22.73 ? 162 GLU B CG  1 
ATOM   2952 C CD  . GLU B 1 118 ? -23.220 19.796  -4.402  1.00 36.39 ? 162 GLU B CD  1 
ATOM   2953 O OE1 . GLU B 1 118 ? -22.049 20.100  -3.997  1.00 40.15 ? 162 GLU B OE1 1 
ATOM   2954 O OE2 . GLU B 1 118 ? -24.047 19.153  -3.661  1.00 39.28 ? 162 GLU B OE2 1 
ATOM   2955 N N   . PHE B 1 119 ? -27.237 19.823  -6.662  1.00 15.83 ? 163 PHE B N   1 
ATOM   2956 C CA  . PHE B 1 119 ? -28.403 20.643  -6.429  1.00 16.88 ? 163 PHE B CA  1 
ATOM   2957 C C   . PHE B 1 119 ? -28.077 21.777  -5.494  1.00 18.21 ? 163 PHE B C   1 
ATOM   2958 O O   . PHE B 1 119 ? -28.584 22.934  -5.684  1.00 18.72 ? 163 PHE B O   1 
ATOM   2959 C CB  . PHE B 1 119 ? -29.518 19.757  -5.823  1.00 16.83 ? 163 PHE B CB  1 
ATOM   2960 C CG  . PHE B 1 119 ? -30.829 20.515  -5.519  1.00 20.57 ? 163 PHE B CG  1 
ATOM   2961 C CD1 . PHE B 1 119 ? -31.742 20.798  -6.530  1.00 15.71 ? 163 PHE B CD1 1 
ATOM   2962 C CD2 . PHE B 1 119 ? -31.138 20.928  -4.220  1.00 22.35 ? 163 PHE B CD2 1 
ATOM   2963 C CE1 . PHE B 1 119 ? -32.926 21.484  -6.290  1.00 20.28 ? 163 PHE B CE1 1 
ATOM   2964 C CE2 . PHE B 1 119 ? -32.307 21.669  -3.964  1.00 22.95 ? 163 PHE B CE2 1 
ATOM   2965 C CZ  . PHE B 1 119 ? -33.232 21.922  -4.989  1.00 22.82 ? 163 PHE B CZ  1 
ATOM   2966 N N   . ALA B 1 120 ? -27.228 21.515  -4.504  1.00 18.36 ? 164 ALA B N   1 
ATOM   2967 C CA  . ALA B 1 120 ? -27.100 22.552  -3.421  1.00 23.37 ? 164 ALA B CA  1 
ATOM   2968 C C   . ALA B 1 120 ? -26.062 23.684  -3.722  1.00 23.22 ? 164 ALA B C   1 
ATOM   2969 O O   . ALA B 1 120 ? -25.820 24.518  -2.847  1.00 23.53 ? 164 ALA B O   1 
ATOM   2970 C CB  . ALA B 1 120 ? -26.692 21.901  -2.080  1.00 23.86 ? 164 ALA B CB  1 
ATOM   2971 N N   . THR B 1 121 ? -25.425 23.676  -4.898  1.00 23.00 ? 165 THR B N   1 
ATOM   2972 C CA  . THR B 1 121 ? -24.394 24.672  -5.265  1.00 22.71 ? 165 THR B CA  1 
ATOM   2973 C C   . THR B 1 121 ? -24.235 24.871  -6.713  1.00 20.05 ? 165 THR B C   1 
ATOM   2974 O O   . THR B 1 121 ? -24.758 24.121  -7.469  1.00 20.32 ? 165 THR B O   1 
ATOM   2975 C CB  . THR B 1 121 ? -22.950 24.319  -4.736  1.00 24.10 ? 165 THR B CB  1 
ATOM   2976 O OG1 . THR B 1 121 ? -22.405 23.253  -5.530  1.00 21.45 ? 165 THR B OG1 1 
ATOM   2977 C CG2 . THR B 1 121 ? -22.952 23.824  -3.274  1.00 25.39 ? 165 THR B CG2 1 
ATOM   2978 N N   . SER B 1 122 ? -23.382 25.818  -7.113  1.00 17.87 ? 166 SER B N   1 
ATOM   2979 C CA  . SER B 1 122 ? -23.039 25.926  -8.538  1.00 16.40 ? 166 SER B CA  1 
ATOM   2980 C C   . SER B 1 122 ? -21.695 25.231  -8.842  1.00 16.92 ? 166 SER B C   1 
ATOM   2981 O O   . SER B 1 122 ? -21.104 25.411  -9.930  1.00 16.17 ? 166 SER B O   1 
ATOM   2982 C CB  . SER B 1 122 ? -23.036 27.374  -9.027  1.00 19.16 ? 166 SER B CB  1 
ATOM   2983 O OG  . SER B 1 122 ? -22.137 28.192  -8.227  1.00 16.86 ? 166 SER B OG  1 
ATOM   2984 N N   . LYS B 1 123 ? -21.231 24.423  -7.922  1.00 14.67 ? 167 LYS B N   1 
ATOM   2985 C CA  . LYS B 1 123 ? -19.901 23.822  -8.154  1.00 17.41 ? 167 LYS B CA  1 
ATOM   2986 C C   . LYS B 1 123 ? -19.979 22.611  -9.100  1.00 16.19 ? 167 LYS B C   1 
ATOM   2987 O O   . LYS B 1 123 ? -20.924 21.799  -8.986  1.00 14.16 ? 167 LYS B O   1 
ATOM   2988 C CB  . LYS B 1 123 ? -19.265 23.398  -6.821  1.00 17.64 ? 167 LYS B CB  1 
ATOM   2989 C CG  . LYS B 1 123 ? -18.871 24.661  -6.008  1.00 25.18 ? 167 LYS B CG  1 
ATOM   2990 C CD  . LYS B 1 123 ? -17.562 24.551  -5.235  1.00 30.12 ? 167 LYS B CD  1 
ATOM   2991 C CE  . LYS B 1 123 ? -17.885 24.464  -3.738  1.00 36.02 ? 167 LYS B CE  1 
ATOM   2992 N NZ  . LYS B 1 123 ? -18.732 23.248  -3.410  1.00 37.80 ? 167 LYS B NZ  1 
ATOM   2993 N N   . ILE B 1 124 ? -18.990 22.496  -9.992  1.00 13.30 ? 168 ILE B N   1 
ATOM   2994 C CA  . ILE B 1 124 ? -18.793 21.233  -10.717 1.00 13.50 ? 168 ILE B CA  1 
ATOM   2995 C C   . ILE B 1 124 ? -18.332 20.087  -9.755  1.00 13.25 ? 168 ILE B C   1 
ATOM   2996 O O   . ILE B 1 124 ? -17.417 20.335  -8.890  1.00 13.05 ? 168 ILE B O   1 
ATOM   2997 C CB  . ILE B 1 124 ? -17.783 21.516  -11.872 1.00 13.32 ? 168 ILE B CB  1 
ATOM   2998 C CG1 . ILE B 1 124 ? -18.517 22.330  -12.947 1.00 14.72 ? 168 ILE B CG1 1 
ATOM   2999 C CG2 . ILE B 1 124 ? -17.349 20.149  -12.590 1.00 11.25 ? 168 ILE B CG2 1 
ATOM   3000 C CD1 . ILE B 1 124 ? -17.610 23.107  -13.922 1.00 13.07 ? 168 ILE B CD1 1 
ATOM   3001 N N   . ASN B 1 125 ? -18.862 18.849  -9.882  1.00 10.81 ? 169 ASN B N   1 
ATOM   3002 C CA  . ASN B 1 125 ? -18.422 17.753  -8.984  1.00 11.47 ? 169 ASN B CA  1 
ATOM   3003 C C   . ASN B 1 125 ? -17.247 16.962  -9.669  1.00 11.56 ? 169 ASN B C   1 
ATOM   3004 O O   . ASN B 1 125 ? -17.470 16.251  -10.684 1.00 10.35 ? 169 ASN B O   1 
ATOM   3005 C CB  . ASN B 1 125 ? -19.647 16.796  -8.696  1.00 10.27 ? 169 ASN B CB  1 
ATOM   3006 C CG  . ASN B 1 125 ? -19.352 15.773  -7.683  1.00 10.99 ? 169 ASN B CG  1 
ATOM   3007 O OD1 . ASN B 1 125 ? -18.202 15.401  -7.502  1.00 10.37 ? 169 ASN B OD1 1 
ATOM   3008 N ND2 . ASN B 1 125 ? -20.385 15.282  -6.987  1.00 10.70 ? 169 ASN B ND2 1 
ATOM   3009 N N   . TYR B 1 126 ? -16.020 17.167  -9.182  1.00 9.34  ? 170 TYR B N   1 
ATOM   3010 C CA  . TYR B 1 126 ? -14.900 16.515  -9.852  1.00 10.81 ? 170 TYR B CA  1 
ATOM   3011 C C   . TYR B 1 126 ? -14.600 15.182  -9.205  1.00 10.26 ? 170 TYR B C   1 
ATOM   3012 O O   . TYR B 1 126 ? -13.623 14.511  -9.587  1.00 9.66  ? 170 TYR B O   1 
ATOM   3013 C CB  . TYR B 1 126 ? -13.625 17.395  -9.751  1.00 11.96 ? 170 TYR B CB  1 
ATOM   3014 C CG  . TYR B 1 126 ? -13.737 18.645  -10.621 1.00 10.87 ? 170 TYR B CG  1 
ATOM   3015 C CD1 . TYR B 1 126 ? -14.034 19.917  -10.090 1.00 10.88 ? 170 TYR B CD1 1 
ATOM   3016 C CD2 . TYR B 1 126 ? -13.528 18.547  -12.022 1.00 12.14 ? 170 TYR B CD2 1 
ATOM   3017 C CE1 . TYR B 1 126 ? -14.123 21.023  -10.920 1.00 7.13  ? 170 TYR B CE1 1 
ATOM   3018 C CE2 . TYR B 1 126 ? -13.669 19.671  -12.839 1.00 7.43  ? 170 TYR B CE2 1 
ATOM   3019 C CZ  . TYR B 1 126 ? -13.865 20.895  -12.300 1.00 13.73 ? 170 TYR B CZ  1 
ATOM   3020 O OH  . TYR B 1 126 ? -13.955 21.975  -13.198 1.00 11.22 ? 170 TYR B OH  1 
ATOM   3021 N N   . GLN B 1 127 ? -15.369 14.855  -8.187  1.00 10.98 ? 171 GLN B N   1 
ATOM   3022 C CA  . GLN B 1 127 ? -15.080 13.655  -7.356  1.00 11.29 ? 171 GLN B CA  1 
ATOM   3023 C C   . GLN B 1 127 ? -15.853 12.421  -7.927  1.00 8.33  ? 171 GLN B C   1 
ATOM   3024 O O   . GLN B 1 127 ? -15.243 11.432  -8.009  1.00 6.39  ? 171 GLN B O   1 
ATOM   3025 C CB  . GLN B 1 127 ? -15.381 13.761  -5.851  1.00 11.98 ? 171 GLN B CB  1 
ATOM   3026 C CG  . GLN B 1 127 ? -14.361 14.646  -4.982  1.00 23.10 ? 171 GLN B CG  1 
ATOM   3027 C CD  . GLN B 1 127 ? -13.972 14.069  -3.519  1.00 25.43 ? 171 GLN B CD  1 
ATOM   3028 O OE1 . GLN B 1 127 ? -13.790 14.872  -2.606  1.00 29.79 ? 171 GLN B OE1 1 
ATOM   3029 N NE2 . GLN B 1 127 ? -13.824 12.744  -3.351  1.00 24.20 ? 171 GLN B NE2 1 
ATOM   3030 N N   . SER B 1 128 ? -17.161 12.508  -8.240  1.00 7.57  ? 172 SER B N   1 
ATOM   3031 C CA  . SER B 1 128 ? -17.925 11.309  -8.705  1.00 6.01  ? 172 SER B CA  1 
ATOM   3032 C C   . SER B 1 128 ? -19.154 11.903  -9.411  1.00 8.05  ? 172 SER B C   1 
ATOM   3033 O O   . SER B 1 128 ? -19.531 13.143  -9.201  1.00 10.87 ? 172 SER B O   1 
ATOM   3034 C CB  . SER B 1 128 ? -18.367 10.436  -7.467  1.00 7.12  ? 172 SER B CB  1 
ATOM   3035 O OG  . SER B 1 128 ? -19.246 11.247  -6.646  1.00 8.93  ? 172 SER B OG  1 
ATOM   3036 N N   . CYS B 1 129 ? -19.719 11.129  -10.374 1.00 7.02  ? 173 CYS B N   1 
ATOM   3037 C CA  . CYS B 1 129 ? -20.992 11.544  -11.035 1.00 8.83  ? 173 CYS B CA  1 
ATOM   3038 C C   . CYS B 1 129 ? -21.817 10.267  -11.137 1.00 7.95  ? 173 CYS B C   1 
ATOM   3039 O O   . CYS B 1 129 ? -21.315 9.147   -10.968 1.00 10.88 ? 173 CYS B O   1 
ATOM   3040 C CB  . CYS B 1 129 ? -20.806 12.096  -12.513 1.00 8.84  ? 173 CYS B CB  1 
ATOM   3041 S SG  . CYS B 1 129 ? -19.825 13.627  -12.513 1.00 15.03 ? 173 CYS B SG  1 
ATOM   3042 N N   . PRO B 1 130 ? -23.121 10.417  -11.318 1.00 9.99  ? 174 PRO B N   1 
ATOM   3043 C CA  . PRO B 1 130 ? -24.002 9.261   -11.323 1.00 10.10 ? 174 PRO B CA  1 
ATOM   3044 C C   . PRO B 1 130 ? -23.643 8.196   -12.358 1.00 12.63 ? 174 PRO B C   1 
ATOM   3045 O O   . PRO B 1 130 ? -23.499 8.388   -13.586 1.00 14.23 ? 174 PRO B O   1 
ATOM   3046 C CB  . PRO B 1 130 ? -25.392 9.871   -11.626 1.00 11.98 ? 174 PRO B CB  1 
ATOM   3047 C CG  . PRO B 1 130 ? -25.291 11.236  -11.002 1.00 9.91  ? 174 PRO B CG  1 
ATOM   3048 C CD  . PRO B 1 130 ? -23.858 11.703  -11.446 1.00 8.47  ? 174 PRO B CD  1 
ATOM   3049 N N   . ASP B 1 131 ? -23.566 6.960   -11.855 1.00 13.91 ? 175 ASP B N   1 
ATOM   3050 C CA  . ASP B 1 131 ? -23.365 5.860   -12.811 1.00 16.55 ? 175 ASP B CA  1 
ATOM   3051 C C   . ASP B 1 131 ? -24.774 5.415   -13.346 1.00 18.28 ? 175 ASP B C   1 
ATOM   3052 O O   . ASP B 1 131 ? -25.711 5.305   -12.580 1.00 16.77 ? 175 ASP B O   1 
ATOM   3053 C CB  . ASP B 1 131 ? -22.731 4.646   -12.100 1.00 18.08 ? 175 ASP B CB  1 
ATOM   3054 C CG  . ASP B 1 131 ? -22.709 3.424   -13.014 1.00 24.02 ? 175 ASP B CG  1 
ATOM   3055 O OD1 . ASP B 1 131 ? -23.506 2.493   -12.819 1.00 25.31 ? 175 ASP B OD1 1 
ATOM   3056 O OD2 . ASP B 1 131 ? -22.012 3.393   -14.040 1.00 30.93 ? 175 ASP B OD2 1 
ATOM   3057 N N   . TRP B 1 132 ? -24.883 5.228   -14.645 1.00 17.38 ? 176 TRP B N   1 
ATOM   3058 C CA  . TRP B 1 132 ? -26.122 4.953   -15.363 1.00 21.98 ? 176 TRP B CA  1 
ATOM   3059 C C   . TRP B 1 132 ? -26.925 3.880   -14.683 1.00 20.43 ? 176 TRP B C   1 
ATOM   3060 O O   . TRP B 1 132 ? -28.107 4.061   -14.493 1.00 19.93 ? 176 TRP B O   1 
ATOM   3061 C CB  . TRP B 1 132 ? -25.808 4.506   -16.807 1.00 24.30 ? 176 TRP B CB  1 
ATOM   3062 C CG  . TRP B 1 132 ? -26.881 3.626   -17.447 1.00 33.69 ? 176 TRP B CG  1 
ATOM   3063 C CD1 . TRP B 1 132 ? -26.957 2.213   -17.425 1.00 41.66 ? 176 TRP B CD1 1 
ATOM   3064 C CD2 . TRP B 1 132 ? -28.020 4.064   -18.195 1.00 36.83 ? 176 TRP B CD2 1 
ATOM   3065 N NE1 . TRP B 1 132 ? -28.088 1.787   -18.085 1.00 43.84 ? 176 TRP B NE1 1 
ATOM   3066 C CE2 . TRP B 1 132 ? -28.752 2.886   -18.590 1.00 43.04 ? 176 TRP B CE2 1 
ATOM   3067 C CE3 . TRP B 1 132 ? -28.492 5.325   -18.602 1.00 34.07 ? 176 TRP B CE3 1 
ATOM   3068 C CZ2 . TRP B 1 132 ? -29.948 2.948   -19.350 1.00 45.36 ? 176 TRP B CZ2 1 
ATOM   3069 C CZ3 . TRP B 1 132 ? -29.666 5.399   -19.324 1.00 41.41 ? 176 TRP B CZ3 1 
ATOM   3070 C CH2 . TRP B 1 132 ? -30.396 4.206   -19.709 1.00 45.96 ? 176 TRP B CH2 1 
ATOM   3071 N N   . ARG B 1 133 ? -26.310 2.784   -14.269 1.00 21.12 ? 177 ARG B N   1 
ATOM   3072 C CA  . ARG B 1 133 ? -27.095 1.716   -13.699 1.00 21.39 ? 177 ARG B CA  1 
ATOM   3073 C C   . ARG B 1 133 ? -27.141 1.701   -12.234 1.00 19.64 ? 177 ARG B C   1 
ATOM   3074 O O   . ARG B 1 133 ? -28.160 1.364   -11.636 1.00 18.26 ? 177 ARG B O   1 
ATOM   3075 C CB  . ARG B 1 133 ? -26.713 0.272   -14.181 1.00 23.30 ? 177 ARG B CB  1 
ATOM   3076 C CG  . ARG B 1 133 ? -25.500 0.112   -15.004 1.00 27.10 ? 177 ARG B CG  1 
ATOM   3077 C CD  . ARG B 1 133 ? -25.587 -1.263  -15.849 1.00 37.04 ? 177 ARG B CD  1 
ATOM   3078 N NE  . ARG B 1 133 ? -26.591 -2.170  -15.267 1.00 37.67 ? 177 ARG B NE  1 
ATOM   3079 C CZ  . ARG B 1 133 ? -27.362 -3.052  -15.941 1.00 36.57 ? 177 ARG B CZ  1 
ATOM   3080 N NH1 . ARG B 1 133 ? -27.274 -3.186  -17.250 1.00 35.20 ? 177 ARG B NH1 1 
ATOM   3081 N NH2 . ARG B 1 133 ? -28.257 -3.774  -15.284 1.00 35.32 ? 177 ARG B NH2 1 
ATOM   3082 N N   . LYS B 1 134 ? -26.024 1.992   -11.610 1.00 20.10 ? 178 LYS B N   1 
ATOM   3083 C CA  . LYS B 1 134 ? -26.008 1.911   -10.161 1.00 17.86 ? 178 LYS B CA  1 
ATOM   3084 C C   . LYS B 1 134 ? -26.676 3.117   -9.464  1.00 17.23 ? 178 LYS B C   1 
ATOM   3085 O O   . LYS B 1 134 ? -27.035 3.047   -8.266  1.00 14.61 ? 178 LYS B O   1 
ATOM   3086 C CB  . LYS B 1 134 ? -24.573 1.783   -9.694  1.00 20.82 ? 178 LYS B CB  1 
ATOM   3087 C CG  . LYS B 1 134 ? -23.884 0.477   -10.172 1.00 25.29 ? 178 LYS B CG  1 
ATOM   3088 C CD  . LYS B 1 134 ? -22.437 0.350   -9.682  1.00 29.95 ? 178 LYS B CD  1 
ATOM   3089 C CE  . LYS B 1 134 ? -22.313 -0.764  -8.608  1.00 32.92 ? 178 LYS B CE  1 
ATOM   3090 N NZ  . LYS B 1 134 ? -21.774 -0.308  -7.254  1.00 37.11 ? 178 LYS B NZ  1 
ATOM   3091 N N   . ASP B 1 135 ? -26.747 4.242   -10.148 1.00 14.78 ? 179 ASP B N   1 
ATOM   3092 C CA  . ASP B 1 135 ? -27.270 5.486   -9.529  1.00 15.24 ? 179 ASP B CA  1 
ATOM   3093 C C   . ASP B 1 135 ? -28.559 5.924   -10.200 1.00 16.76 ? 179 ASP B C   1 
ATOM   3094 O O   . ASP B 1 135 ? -29.593 5.911   -9.567  1.00 20.08 ? 179 ASP B O   1 
ATOM   3095 C CB  . ASP B 1 135 ? -26.223 6.642   -9.636  1.00 11.69 ? 179 ASP B CB  1 
ATOM   3096 C CG  . ASP B 1 135 ? -24.986 6.354   -8.754  1.00 11.26 ? 179 ASP B CG  1 
ATOM   3097 O OD1 . ASP B 1 135 ? -25.171 5.850   -7.648  1.00 13.00 ? 179 ASP B OD1 1 
ATOM   3098 O OD2 . ASP B 1 135 ? -23.859 6.499   -9.150  1.00 13.18 ? 179 ASP B OD2 1 
ATOM   3099 N N   . CYS B 1 136 ? -28.504 6.392   -11.425 1.00 16.10 ? 180 CYS B N   1 
ATOM   3100 C CA  . CYS B 1 136 ? -29.695 6.899   -12.130 1.00 17.99 ? 180 CYS B CA  1 
ATOM   3101 C C   . CYS B 1 136 ? -29.411 7.064   -13.607 1.00 17.95 ? 180 CYS B C   1 
ATOM   3102 O O   . CYS B 1 136 ? -28.327 7.513   -13.972 1.00 16.99 ? 180 CYS B O   1 
ATOM   3103 C CB  . CYS B 1 136 ? -30.238 8.258   -11.575 1.00 18.20 ? 180 CYS B CB  1 
ATOM   3104 S SG  . CYS B 1 136 ? -29.035 9.600   -11.448 1.00 25.79 ? 180 CYS B SG  1 
ATOM   3105 N N   . SER B 1 137 ? -30.433 6.817   -14.440 1.00 17.87 ? 181 SER B N   1 
ATOM   3106 C CA  . SER B 1 137 ? -30.266 6.865   -15.917 1.00 18.87 ? 181 SER B CA  1 
ATOM   3107 C C   . SER B 1 137 ? -30.299 8.254   -16.382 1.00 17.63 ? 181 SER B C   1 
ATOM   3108 O O   . SER B 1 137 ? -29.675 8.557   -17.384 1.00 18.52 ? 181 SER B O   1 
ATOM   3109 C CB  . SER B 1 137 ? -31.440 6.132   -16.640 1.00 20.29 ? 181 SER B CB  1 
ATOM   3110 O OG  . SER B 1 137 ? -32.701 6.641   -16.129 1.00 22.22 ? 181 SER B OG  1 
ATOM   3111 N N   . ASN B 1 138 ? -31.059 9.128   -15.741 1.00 16.14 ? 182 ASN B N   1 
ATOM   3112 C CA  . ASN B 1 138 ? -31.125 10.473  -16.284 1.00 15.84 ? 182 ASN B CA  1 
ATOM   3113 C C   . ASN B 1 138 ? -30.052 11.451  -15.734 1.00 15.21 ? 182 ASN B C   1 
ATOM   3114 O O   . ASN B 1 138 ? -30.417 12.516  -15.159 1.00 14.53 ? 182 ASN B O   1 
ATOM   3115 C CB  . ASN B 1 138 ? -32.519 11.081  -16.068 1.00 17.11 ? 182 ASN B CB  1 
ATOM   3116 C CG  . ASN B 1 138 ? -33.609 10.276  -16.810 1.00 22.07 ? 182 ASN B CG  1 
ATOM   3117 O OD1 . ASN B 1 138 ? -33.449 9.975   -18.005 1.00 27.95 ? 182 ASN B OD1 1 
ATOM   3118 N ND2 . ASN B 1 138 ? -34.728 10.007  -16.139 1.00 25.72 ? 182 ASN B ND2 1 
ATOM   3119 N N   . ASN B 1 139 ? -28.791 11.181  -16.080 1.00 11.63 ? 183 ASN B N   1 
ATOM   3120 C CA  . ASN B 1 139 ? -27.742 11.970  -15.568 1.00 12.73 ? 183 ASN B CA  1 
ATOM   3121 C C   . ASN B 1 139 ? -27.217 12.945  -16.670 1.00 11.91 ? 183 ASN B C   1 
ATOM   3122 O O   . ASN B 1 139 ? -27.643 12.879  -17.783 1.00 12.28 ? 183 ASN B O   1 
ATOM   3123 C CB  . ASN B 1 139 ? -26.652 11.075  -14.946 1.00 11.25 ? 183 ASN B CB  1 
ATOM   3124 C CG  . ASN B 1 139 ? -26.075 10.141  -15.950 1.00 12.49 ? 183 ASN B CG  1 
ATOM   3125 O OD1 . ASN B 1 139 ? -26.407 8.902   -15.943 1.00 18.57 ? 183 ASN B OD1 1 
ATOM   3126 N ND2 . ASN B 1 139 ? -25.387 10.678  -16.905 1.00 8.36  ? 183 ASN B ND2 1 
ATOM   3127 N N   . PRO B 1 140 ? -26.373 13.894  -16.309 1.00 11.49 ? 184 PRO B N   1 
ATOM   3128 C CA  . PRO B 1 140 ? -25.971 14.924  -17.291 1.00 12.06 ? 184 PRO B CA  1 
ATOM   3129 C C   . PRO B 1 140 ? -25.385 14.322  -18.570 1.00 12.45 ? 184 PRO B C   1 
ATOM   3130 O O   . PRO B 1 140 ? -25.788 14.664  -19.673 1.00 12.98 ? 184 PRO B O   1 
ATOM   3131 C CB  . PRO B 1 140 ? -25.027 15.867  -16.503 1.00 9.77  ? 184 PRO B CB  1 
ATOM   3132 C CG  . PRO B 1 140 ? -25.544 15.748  -15.096 1.00 9.71  ? 184 PRO B CG  1 
ATOM   3133 C CD  . PRO B 1 140 ? -26.011 14.230  -14.911 1.00 9.87  ? 184 PRO B CD  1 
ATOM   3134 N N   . VAL B 1 141 ? -24.473 13.379  -18.424 1.00 14.86 ? 185 VAL B N   1 
ATOM   3135 C CA  . VAL B 1 141 ? -23.869 12.741  -19.580 1.00 13.42 ? 185 VAL B CA  1 
ATOM   3136 C C   . VAL B 1 141 ? -24.819 11.893  -20.392 1.00 14.10 ? 185 VAL B C   1 
ATOM   3137 O O   . VAL B 1 141 ? -24.838 12.033  -21.643 1.00 14.85 ? 185 VAL B O   1 
ATOM   3138 C CB  . VAL B 1 141 ? -22.654 11.912  -19.140 1.00 14.16 ? 185 VAL B CB  1 
ATOM   3139 C CG1 . VAL B 1 141 ? -22.113 10.991  -20.301 1.00 14.72 ? 185 VAL B CG1 1 
ATOM   3140 C CG2 . VAL B 1 141 ? -21.548 12.842  -18.421 1.00 14.51 ? 185 VAL B CG2 1 
ATOM   3141 N N   . SER B 1 142 ? -25.564 10.971  -19.756 1.00 14.17 ? 186 SER B N   1 
ATOM   3142 C CA  . SER B 1 142 ? -26.382 10.042  -20.510 1.00 15.23 ? 186 SER B CA  1 
ATOM   3143 C C   . SER B 1 142 ? -27.515 10.815  -21.213 1.00 16.99 ? 186 SER B C   1 
ATOM   3144 O O   . SER B 1 142 ? -27.898 10.467  -22.365 1.00 17.28 ? 186 SER B O   1 
ATOM   3145 C CB  . SER B 1 142 ? -26.989 8.936   -19.673 1.00 15.90 ? 186 SER B CB  1 
ATOM   3146 O OG  . SER B 1 142 ? -26.087 8.273   -18.728 1.00 19.28 ? 186 SER B OG  1 
ATOM   3147 N N   . VAL B 1 143 ? -28.050 11.841  -20.571 1.00 16.22 ? 187 VAL B N   1 
ATOM   3148 C CA  . VAL B 1 143 ? -29.130 12.612  -21.224 1.00 15.79 ? 187 VAL B CA  1 
ATOM   3149 C C   . VAL B 1 143 ? -28.631 13.380  -22.432 1.00 16.95 ? 187 VAL B C   1 
ATOM   3150 O O   . VAL B 1 143 ? -29.314 13.422  -23.466 1.00 16.28 ? 187 VAL B O   1 
ATOM   3151 C CB  . VAL B 1 143 ? -29.873 13.521  -20.236 1.00 16.26 ? 187 VAL B CB  1 
ATOM   3152 C CG1 . VAL B 1 143 ? -30.771 14.529  -20.972 1.00 16.55 ? 187 VAL B CG1 1 
ATOM   3153 C CG2 . VAL B 1 143 ? -30.658 12.649  -19.249 1.00 10.79 ? 187 VAL B CG2 1 
ATOM   3154 N N   . PHE B 1 144 ? -27.441 13.969  -22.296 1.00 14.78 ? 188 PHE B N   1 
ATOM   3155 C CA  . PHE B 1 144 ? -26.775 14.628  -23.411 1.00 15.50 ? 188 PHE B CA  1 
ATOM   3156 C C   . PHE B 1 144 ? -26.612 13.684  -24.578 1.00 16.70 ? 188 PHE B C   1 
ATOM   3157 O O   . PHE B 1 144 ? -27.067 14.012  -25.688 1.00 18.86 ? 188 PHE B O   1 
ATOM   3158 C CB  . PHE B 1 144 ? -25.433 15.213  -22.995 1.00 14.09 ? 188 PHE B CB  1 
ATOM   3159 C CG  . PHE B 1 144 ? -24.613 15.721  -24.160 1.00 16.90 ? 188 PHE B CG  1 
ATOM   3160 C CD1 . PHE B 1 144 ? -24.713 17.049  -24.561 1.00 18.11 ? 188 PHE B CD1 1 
ATOM   3161 C CD2 . PHE B 1 144 ? -23.785 14.857  -24.847 1.00 14.61 ? 188 PHE B CD2 1 
ATOM   3162 C CE1 . PHE B 1 144 ? -23.903 17.547  -25.651 1.00 18.80 ? 188 PHE B CE1 1 
ATOM   3163 C CE2 . PHE B 1 144 ? -23.034 15.339  -25.955 1.00 18.88 ? 188 PHE B CE2 1 
ATOM   3164 C CZ  . PHE B 1 144 ? -23.135 16.707  -26.331 1.00 13.91 ? 188 PHE B CZ  1 
ATOM   3165 N N   . TRP B 1 145 ? -25.991 12.525  -24.396 1.00 15.69 ? 189 TRP B N   1 
ATOM   3166 C CA  . TRP B 1 145 ? -25.763 11.652  -25.588 1.00 17.01 ? 189 TRP B CA  1 
ATOM   3167 C C   . TRP B 1 145 ? -27.061 11.060  -26.207 1.00 17.77 ? 189 TRP B C   1 
ATOM   3168 O O   . TRP B 1 145 ? -27.153 10.817  -27.446 1.00 16.95 ? 189 TRP B O   1 
ATOM   3169 C CB  . TRP B 1 145 ? -24.817 10.537  -25.249 1.00 17.37 ? 189 TRP B CB  1 
ATOM   3170 C CG  . TRP B 1 145 ? -23.456 11.043  -25.028 1.00 20.82 ? 189 TRP B CG  1 
ATOM   3171 C CD1 . TRP B 1 145 ? -22.722 11.080  -23.835 1.00 20.43 ? 189 TRP B CD1 1 
ATOM   3172 C CD2 . TRP B 1 145 ? -22.610 11.580  -26.039 1.00 16.05 ? 189 TRP B CD2 1 
ATOM   3173 N NE1 . TRP B 1 145 ? -21.469 11.629  -24.078 1.00 17.56 ? 189 TRP B NE1 1 
ATOM   3174 C CE2 . TRP B 1 145 ? -21.399 11.974  -25.421 1.00 17.35 ? 189 TRP B CE2 1 
ATOM   3175 C CE3 . TRP B 1 145 ? -22.767 11.802  -27.428 1.00 24.06 ? 189 TRP B CE3 1 
ATOM   3176 C CZ2 . TRP B 1 145 ? -20.335 12.506  -26.149 1.00 15.29 ? 189 TRP B CZ2 1 
ATOM   3177 C CZ3 . TRP B 1 145 ? -21.728 12.415  -28.123 1.00 20.83 ? 189 TRP B CZ3 1 
ATOM   3178 C CH2 . TRP B 1 145 ? -20.543 12.766  -27.476 1.00 18.77 ? 189 TRP B CH2 1 
ATOM   3179 N N   . LYS B 1 146 ? -28.065 10.858  -25.369 1.00 17.81 ? 190 LYS B N   1 
ATOM   3180 C CA  . LYS B 1 146 ? -29.347 10.408  -25.840 1.00 20.33 ? 190 LYS B CA  1 
ATOM   3181 C C   . LYS B 1 146 ? -30.021 11.496  -26.668 1.00 21.66 ? 190 LYS B C   1 
ATOM   3182 O O   . LYS B 1 146 ? -30.684 11.217  -27.642 1.00 23.85 ? 190 LYS B O   1 
ATOM   3183 C CB  . LYS B 1 146 ? -30.282 10.056  -24.695 1.00 20.60 ? 190 LYS B CB  1 
ATOM   3184 C CG  . LYS B 1 146 ? -30.959 8.795   -25.016 1.00 24.49 ? 190 LYS B CG  1 
ATOM   3185 C CD  . LYS B 1 146 ? -32.264 8.525   -24.215 1.00 33.17 ? 190 LYS B CD  1 
ATOM   3186 C CE  . LYS B 1 146 ? -32.810 7.084   -24.583 1.00 33.63 ? 190 LYS B CE  1 
ATOM   3187 N NZ  . LYS B 1 146 ? -34.276 6.807   -24.366 1.00 28.80 ? 190 LYS B NZ  1 
ATOM   3188 N N   . THR B 1 147 ? -29.891 12.746  -26.265 1.00 22.52 ? 191 THR B N   1 
ATOM   3189 C CA  . THR B 1 147 ? -30.481 13.773  -27.045 1.00 20.94 ? 191 THR B CA  1 
ATOM   3190 C C   . THR B 1 147 ? -29.837 13.945  -28.408 1.00 20.77 ? 191 THR B C   1 
ATOM   3191 O O   . THR B 1 147 ? -30.552 13.917  -29.453 1.00 17.25 ? 191 THR B O   1 
ATOM   3192 C CB  . THR B 1 147 ? -30.419 15.056  -26.295 1.00 22.60 ? 191 THR B CB  1 
ATOM   3193 O OG1 . THR B 1 147 ? -31.015 14.870  -24.994 1.00 24.73 ? 191 THR B OG1 1 
ATOM   3194 C CG2 . THR B 1 147 ? -31.428 15.973  -26.927 1.00 22.33 ? 191 THR B CG2 1 
ATOM   3195 N N   . VAL B 1 148 ? -28.513 14.112  -28.422 1.00 19.63 ? 192 VAL B N   1 
ATOM   3196 C CA  . VAL B 1 148 ? -27.812 14.426  -29.671 1.00 19.75 ? 192 VAL B CA  1 
ATOM   3197 C C   . VAL B 1 148 ? -27.825 13.283  -30.647 1.00 21.49 ? 192 VAL B C   1 
ATOM   3198 O O   . VAL B 1 148 ? -27.897 13.517  -31.888 1.00 21.54 ? 192 VAL B O   1 
ATOM   3199 C CB  . VAL B 1 148 ? -26.415 14.935  -29.440 1.00 21.24 ? 192 VAL B CB  1 
ATOM   3200 C CG1 . VAL B 1 148 ? -26.391 16.337  -28.712 1.00 19.18 ? 192 VAL B CG1 1 
ATOM   3201 C CG2 . VAL B 1 148 ? -25.582 13.940  -28.704 1.00 18.91 ? 192 VAL B CG2 1 
ATOM   3202 N N   . SER B 1 149 ? -27.813 12.054  -30.126 1.00 20.91 ? 193 SER B N   1 
ATOM   3203 C CA  . SER B 1 149 ? -27.888 10.858  -30.923 1.00 23.42 ? 193 SER B CA  1 
ATOM   3204 C C   . SER B 1 149 ? -29.208 10.699  -31.698 1.00 24.69 ? 193 SER B C   1 
ATOM   3205 O O   . SER B 1 149 ? -29.183 10.252  -32.842 1.00 22.77 ? 193 SER B O   1 
ATOM   3206 C CB  . SER B 1 149 ? -27.670 9.616   -30.063 1.00 24.11 ? 193 SER B CB  1 
ATOM   3207 O OG  . SER B 1 149 ? -26.336 9.591   -29.533 1.00 29.50 ? 193 SER B OG  1 
ATOM   3208 N N   . ARG B 1 150 ? -30.333 10.956  -31.005 1.00 26.09 ? 194 ARG B N   1 
ATOM   3209 C CA  . ARG B 1 150 ? -31.702 10.907  -31.533 1.00 27.63 ? 194 ARG B CA  1 
ATOM   3210 C C   . ARG B 1 150 ? -31.869 11.958  -32.652 1.00 28.33 ? 194 ARG B C   1 
ATOM   3211 O O   . ARG B 1 150 ? -32.317 11.649  -33.775 1.00 27.98 ? 194 ARG B O   1 
ATOM   3212 C CB  . ARG B 1 150 ? -32.707 11.178  -30.357 1.00 28.29 ? 194 ARG B CB  1 
ATOM   3213 C CG  . ARG B 1 150 ? -34.145 10.633  -30.631 1.00 32.40 ? 194 ARG B CG  1 
ATOM   3214 C CD  . ARG B 1 150 ? -35.241 11.191  -29.699 1.00 34.14 ? 194 ARG B CD  1 
ATOM   3215 N NE  . ARG B 1 150 ? -35.279 12.637  -29.865 1.00 35.22 ? 194 ARG B NE  1 
ATOM   3216 C CZ  . ARG B 1 150 ? -34.921 13.533  -28.970 1.00 36.98 ? 194 ARG B CZ  1 
ATOM   3217 N NH1 . ARG B 1 150 ? -34.528 13.182  -27.729 1.00 38.84 ? 194 ARG B NH1 1 
ATOM   3218 N NH2 . ARG B 1 150 ? -34.965 14.807  -29.341 1.00 40.89 ? 194 ARG B NH2 1 
ATOM   3219 N N   . ARG B 1 151 ? -31.513 13.201  -32.343 1.00 29.07 ? 195 ARG B N   1 
ATOM   3220 C CA  . ARG B 1 151 ? -31.423 14.232  -33.394 1.00 29.74 ? 195 ARG B CA  1 
ATOM   3221 C C   . ARG B 1 151 ? -30.555 13.816  -34.634 1.00 29.58 ? 195 ARG B C   1 
ATOM   3222 O O   . ARG B 1 151 ? -30.958 13.926  -35.788 1.00 29.94 ? 195 ARG B O   1 
ATOM   3223 C CB  . ARG B 1 151 ? -31.048 15.547  -32.704 1.00 29.76 ? 195 ARG B CB  1 
ATOM   3224 C CG  . ARG B 1 151 ? -32.139 15.812  -31.628 1.00 33.67 ? 195 ARG B CG  1 
ATOM   3225 C CD  . ARG B 1 151 ? -32.050 17.103  -30.768 1.00 42.32 ? 195 ARG B CD  1 
ATOM   3226 N NE  . ARG B 1 151 ? -33.338 17.809  -30.667 1.00 46.37 ? 195 ARG B NE  1 
ATOM   3227 C CZ  . ARG B 1 151 ? -33.588 19.036  -31.161 1.00 49.25 ? 195 ARG B CZ  1 
ATOM   3228 N NH1 . ARG B 1 151 ? -32.646 19.748  -31.795 1.00 49.11 ? 195 ARG B NH1 1 
ATOM   3229 N NH2 . ARG B 1 151 ? -34.804 19.556  -31.037 1.00 51.48 ? 195 ARG B NH2 1 
ATOM   3230 N N   . PHE B 1 152 ? -29.380 13.288  -34.410 1.00 29.09 ? 196 PHE B N   1 
ATOM   3231 C CA  . PHE B 1 152 ? -28.526 12.819  -35.498 1.00 29.36 ? 196 PHE B CA  1 
ATOM   3232 C C   . PHE B 1 152 ? -29.226 11.759  -36.387 1.00 29.55 ? 196 PHE B C   1 
ATOM   3233 O O   . PHE B 1 152 ? -29.307 11.894  -37.628 1.00 30.55 ? 196 PHE B O   1 
ATOM   3234 C CB  . PHE B 1 152 ? -27.224 12.293  -34.852 1.00 29.01 ? 196 PHE B CB  1 
ATOM   3235 C CG  . PHE B 1 152 ? -25.987 12.298  -35.782 1.00 29.73 ? 196 PHE B CG  1 
ATOM   3236 C CD1 . PHE B 1 152 ? -25.426 13.496  -36.256 1.00 30.98 ? 196 PHE B CD1 1 
ATOM   3237 C CD2 . PHE B 1 152 ? -25.417 11.098  -36.155 1.00 26.10 ? 196 PHE B CD2 1 
ATOM   3238 C CE1 . PHE B 1 152 ? -24.281 13.480  -37.110 1.00 29.58 ? 196 PHE B CE1 1 
ATOM   3239 C CE2 . PHE B 1 152 ? -24.290 11.054  -36.937 1.00 27.52 ? 196 PHE B CE2 1 
ATOM   3240 C CZ  . PHE B 1 152 ? -23.712 12.262  -37.431 1.00 29.49 ? 196 PHE B CZ  1 
ATOM   3241 N N   . ALA B 1 153 ? -29.770 10.734  -35.760 1.00 29.57 ? 197 ALA B N   1 
ATOM   3242 C CA  . ALA B 1 153 ? -30.392 9.656   -36.494 1.00 31.17 ? 197 ALA B CA  1 
ATOM   3243 C C   . ALA B 1 153 ? -31.564 10.244  -37.327 1.00 32.07 ? 197 ALA B C   1 
ATOM   3244 O O   . ALA B 1 153 ? -31.683 9.927   -38.516 1.00 30.95 ? 197 ALA B O   1 
ATOM   3245 C CB  . ALA B 1 153 ? -30.835 8.531   -35.540 1.00 31.56 ? 197 ALA B CB  1 
ATOM   3246 N N   . GLU B 1 154 ? -32.345 11.125  -36.693 1.00 32.71 ? 198 GLU B N   1 
ATOM   3247 C CA  . GLU B 1 154 ? -33.508 11.807  -37.282 1.00 35.06 ? 198 GLU B CA  1 
ATOM   3248 C C   . GLU B 1 154 ? -33.190 12.593  -38.563 1.00 35.61 ? 198 GLU B C   1 
ATOM   3249 O O   . GLU B 1 154 ? -34.008 12.640  -39.484 1.00 35.13 ? 198 GLU B O   1 
ATOM   3250 C CB  . GLU B 1 154 ? -34.176 12.749  -36.261 1.00 35.47 ? 198 GLU B CB  1 
ATOM   3251 C CG  . GLU B 1 154 ? -35.112 12.032  -35.278 1.00 37.05 ? 198 GLU B CG  1 
ATOM   3252 C CD  . GLU B 1 154 ? -35.683 12.922  -34.163 1.00 40.56 ? 198 GLU B CD  1 
ATOM   3253 O OE1 . GLU B 1 154 ? -35.244 14.096  -33.976 1.00 37.65 ? 198 GLU B OE1 1 
ATOM   3254 O OE2 . GLU B 1 154 ? -36.623 12.439  -33.482 1.00 39.59 ? 198 GLU B OE2 1 
ATOM   3255 N N   . ALA B 1 155 ? -32.017 13.228  -38.614 1.00 36.46 ? 199 ALA B N   1 
ATOM   3256 C CA  . ALA B 1 155 ? -31.646 14.006  -39.809 1.00 36.40 ? 199 ALA B CA  1 
ATOM   3257 C C   . ALA B 1 155 ? -31.086 13.166  -40.961 1.00 37.26 ? 199 ALA B C   1 
ATOM   3258 O O   . ALA B 1 155 ? -31.055 13.633  -42.105 1.00 36.52 ? 199 ALA B O   1 
ATOM   3259 C CB  . ALA B 1 155 ? -30.682 15.091  -39.460 1.00 37.15 ? 199 ALA B CB  1 
ATOM   3260 N N   . ALA B 1 156 ? -30.670 11.933  -40.676 1.00 36.38 ? 200 ALA B N   1 
ATOM   3261 C CA  . ALA B 1 156 ? -30.058 11.124  -41.719 1.00 37.74 ? 200 ALA B CA  1 
ATOM   3262 C C   . ALA B 1 156 ? -31.041 10.742  -42.854 1.00 37.31 ? 200 ALA B C   1 
ATOM   3263 O O   . ALA B 1 156 ? -32.221 10.532  -42.642 1.00 37.34 ? 200 ALA B O   1 
ATOM   3264 C CB  . ALA B 1 156 ? -29.326 9.853   -41.091 1.00 36.83 ? 200 ALA B CB  1 
ATOM   3265 N N   . CYS B 1 157 ? -30.537 10.634  -44.079 1.00 39.60 ? 201 CYS B N   1 
ATOM   3266 C CA  . CYS B 1 157 ? -31.384 10.298  -45.240 1.00 40.63 ? 201 CYS B CA  1 
ATOM   3267 C C   . CYS B 1 157 ? -30.580 9.431   -46.227 1.00 40.58 ? 201 CYS B C   1 
ATOM   3268 O O   . CYS B 1 157 ? -29.356 9.314   -46.081 1.00 41.38 ? 201 CYS B O   1 
ATOM   3269 C CB  . CYS B 1 157 ? -31.834 11.587  -45.927 1.00 41.42 ? 201 CYS B CB  1 
ATOM   3270 S SG  . CYS B 1 157 ? -30.461 12.350  -46.847 1.00 46.26 ? 201 CYS B SG  1 
ATOM   3271 N N   . ASP B 1 158 ? -31.232 8.806   -47.203 1.00 40.47 ? 202 ASP B N   1 
ATOM   3272 C CA  . ASP B 1 158 ? -30.481 8.141   -48.289 1.00 40.27 ? 202 ASP B CA  1 
ATOM   3273 C C   . ASP B 1 158 ? -30.064 6.716   -47.819 1.00 38.71 ? 202 ASP B C   1 
ATOM   3274 O O   . ASP B 1 158 ? -30.911 5.920   -47.385 1.00 38.71 ? 202 ASP B O   1 
ATOM   3275 C CB  . ASP B 1 158 ? -29.223 8.983   -48.672 1.00 40.55 ? 202 ASP B CB  1 
ATOM   3276 C CG  . ASP B 1 158 ? -29.184 9.433   -50.127 1.00 45.59 ? 202 ASP B CG  1 
ATOM   3277 O OD1 . ASP B 1 158 ? -29.900 10.439  -50.416 1.00 48.36 ? 202 ASP B OD1 1 
ATOM   3278 O OD2 . ASP B 1 158 ? -28.427 8.904   -51.029 1.00 46.28 ? 202 ASP B OD2 1 
ATOM   3279 N N   . VAL B 1 159 ? -28.775 6.399   -47.963 1.00 36.13 ? 203 VAL B N   1 
ATOM   3280 C CA  . VAL B 1 159 ? -28.176 5.249   -47.341 1.00 34.82 ? 203 VAL B CA  1 
ATOM   3281 C C   . VAL B 1 159 ? -27.483 5.749   -46.049 1.00 32.22 ? 203 VAL B C   1 
ATOM   3282 O O   . VAL B 1 159 ? -26.713 6.730   -46.032 1.00 31.84 ? 203 VAL B O   1 
ATOM   3283 C CB  . VAL B 1 159 ? -27.136 4.511   -48.250 1.00 34.62 ? 203 VAL B CB  1 
ATOM   3284 C CG1 . VAL B 1 159 ? -26.622 3.291   -47.524 1.00 36.23 ? 203 VAL B CG1 1 
ATOM   3285 C CG2 . VAL B 1 159 ? -27.732 4.122   -49.597 1.00 34.95 ? 203 VAL B CG2 1 
ATOM   3286 N N   . VAL B 1 160 ? -27.795 5.102   -44.950 1.00 30.82 ? 204 VAL B N   1 
ATOM   3287 C CA  . VAL B 1 160 ? -27.099 5.439   -43.733 1.00 27.74 ? 204 VAL B CA  1 
ATOM   3288 C C   . VAL B 1 160 ? -26.302 4.172   -43.515 1.00 28.13 ? 204 VAL B C   1 
ATOM   3289 O O   . VAL B 1 160 ? -26.832 3.087   -43.735 1.00 27.67 ? 204 VAL B O   1 
ATOM   3290 C CB  . VAL B 1 160 ? -28.159 5.689   -42.678 1.00 28.97 ? 204 VAL B CB  1 
ATOM   3291 C CG1 . VAL B 1 160 ? -27.625 5.633   -41.265 1.00 26.71 ? 204 VAL B CG1 1 
ATOM   3292 C CG2 . VAL B 1 160 ? -28.867 7.013   -42.983 1.00 29.17 ? 204 VAL B CG2 1 
ATOM   3293 N N   . HIS B 1 161 ? -25.038 4.298   -43.099 1.00 26.70 ? 205 HIS B N   1 
ATOM   3294 C CA  . HIS B 1 161 ? -24.241 3.130   -42.794 1.00 26.16 ? 205 HIS B CA  1 
ATOM   3295 C C   . HIS B 1 161 ? -24.002 3.114   -41.281 1.00 26.47 ? 205 HIS B C   1 
ATOM   3296 O O   . HIS B 1 161 ? -24.115 4.158   -40.628 1.00 25.03 ? 205 HIS B O   1 
ATOM   3297 C CB  . HIS B 1 161 ? -22.889 3.205   -43.517 1.00 27.16 ? 205 HIS B CB  1 
ATOM   3298 C CG  . HIS B 1 161 ? -22.972 3.406   -45.009 1.00 29.06 ? 205 HIS B CG  1 
ATOM   3299 N ND1 . HIS B 1 161 ? -22.911 4.652   -45.607 1.00 32.84 ? 205 HIS B ND1 1 
ATOM   3300 C CD2 . HIS B 1 161 ? -23.021 2.505   -46.021 1.00 33.96 ? 205 HIS B CD2 1 
ATOM   3301 C CE1 . HIS B 1 161 ? -22.954 4.509   -46.922 1.00 33.94 ? 205 HIS B CE1 1 
ATOM   3302 N NE2 . HIS B 1 161 ? -23.013 3.217   -47.198 1.00 35.50 ? 205 HIS B NE2 1 
ATOM   3303 N N   . VAL B 1 162 ? -23.708 1.925   -40.740 1.00 25.99 ? 206 VAL B N   1 
ATOM   3304 C CA  . VAL B 1 162 ? -23.482 1.769   -39.302 1.00 27.33 ? 206 VAL B CA  1 
ATOM   3305 C C   . VAL B 1 162 ? -22.350 0.749   -39.147 1.00 28.22 ? 206 VAL B C   1 
ATOM   3306 O O   . VAL B 1 162 ? -22.428 -0.362  -39.700 1.00 30.96 ? 206 VAL B O   1 
ATOM   3307 C CB  . VAL B 1 162 ? -24.771 1.283   -38.513 1.00 27.70 ? 206 VAL B CB  1 
ATOM   3308 C CG1 . VAL B 1 162 ? -25.420 0.047   -39.128 1.00 25.39 ? 206 VAL B CG1 1 
ATOM   3309 C CG2 . VAL B 1 162 ? -24.427 1.037   -37.037 1.00 25.55 ? 206 VAL B CG2 1 
ATOM   3310 N N   . MET B 1 163 ? -21.272 1.120   -38.483 1.00 28.65 ? 207 MET B N   1 
ATOM   3311 C CA  . MET B 1 163 ? -20.235 0.118   -38.226 1.00 30.62 ? 207 MET B CA  1 
ATOM   3312 C C   . MET B 1 163 ? -20.542 -0.742  -36.943 1.00 31.12 ? 207 MET B C   1 
ATOM   3313 O O   . MET B 1 163 ? -20.865 -0.182  -35.924 1.00 29.63 ? 207 MET B O   1 
ATOM   3314 C CB  . MET B 1 163 ? -18.904 0.813   -38.052 1.00 30.31 ? 207 MET B CB  1 
ATOM   3315 C CG  . MET B 1 163 ? -18.201 1.119   -39.348 1.00 36.60 ? 207 MET B CG  1 
ATOM   3316 S SD  . MET B 1 163 ? -16.497 1.415   -38.884 1.00 47.90 ? 207 MET B SD  1 
ATOM   3317 C CE  . MET B 1 163 ? -15.790 1.384   -40.629 1.00 39.93 ? 207 MET B CE  1 
ATOM   3318 N N   . LEU B 1 164 ? -20.420 -2.077  -37.016 1.00 31.08 ? 208 LEU B N   1 
ATOM   3319 C CA  . LEU B 1 164 ? -20.658 -2.949  -35.837 1.00 31.67 ? 208 LEU B CA  1 
ATOM   3320 C C   . LEU B 1 164 ? -19.484 -3.864  -35.518 1.00 31.65 ? 208 LEU B C   1 
ATOM   3321 O O   . LEU B 1 164 ? -18.805 -4.407  -36.389 1.00 31.26 ? 208 LEU B O   1 
ATOM   3322 C CB  . LEU B 1 164 ? -21.945 -3.778  -36.001 1.00 30.29 ? 208 LEU B CB  1 
ATOM   3323 C CG  . LEU B 1 164 ? -23.227 -2.970  -36.307 1.00 30.66 ? 208 LEU B CG  1 
ATOM   3324 C CD1 . LEU B 1 164 ? -24.418 -3.878  -36.597 1.00 30.38 ? 208 LEU B CD1 1 
ATOM   3325 C CD2 . LEU B 1 164 ? -23.543 -2.042  -35.160 1.00 35.04 ? 208 LEU B CD2 1 
ATOM   3326 N N   . ASP B 1 165 ? -19.238 -4.045  -34.238 1.00 33.42 ? 209 ASP B N   1 
ATOM   3327 C CA  . ASP B 1 165 ? -18.131 -4.890  -33.807 1.00 34.22 ? 209 ASP B CA  1 
ATOM   3328 C C   . ASP B 1 165 ? -18.490 -6.374  -33.927 1.00 34.99 ? 209 ASP B C   1 
ATOM   3329 O O   . ASP B 1 165 ? -19.297 -6.896  -33.145 1.00 35.64 ? 209 ASP B O   1 
ATOM   3330 C CB  . ASP B 1 165 ? -17.835 -4.510  -32.361 1.00 36.41 ? 209 ASP B CB  1 
ATOM   3331 C CG  . ASP B 1 165 ? -16.485 -4.930  -31.915 1.00 37.64 ? 209 ASP B CG  1 
ATOM   3332 O OD1 . ASP B 1 165 ? -15.679 -5.446  -32.722 1.00 40.76 ? 209 ASP B OD1 1 
ATOM   3333 O OD2 . ASP B 1 165 ? -16.168 -4.773  -30.732 1.00 42.93 ? 209 ASP B OD2 1 
ATOM   3334 N N   . GLY B 1 166 ? -17.877 -7.059  -34.885 1.00 35.74 ? 210 GLY B N   1 
ATOM   3335 C CA  . GLY B 1 166 ? -18.171 -8.447  -35.175 1.00 38.47 ? 210 GLY B CA  1 
ATOM   3336 C C   . GLY B 1 166 ? -17.534 -9.424  -34.182 1.00 41.39 ? 210 GLY B C   1 
ATOM   3337 O O   . GLY B 1 166 ? -17.717 -10.658 -34.289 1.00 40.06 ? 210 GLY B O   1 
ATOM   3338 N N   . SER B 1 167 ? -16.782 -8.867  -33.234 1.00 42.77 ? 211 SER B N   1 
ATOM   3339 C CA  . SER B 1 167 ? -16.092 -9.680  -32.245 1.00 46.14 ? 211 SER B CA  1 
ATOM   3340 C C   . SER B 1 167 ? -16.903 -9.926  -31.012 1.00 47.56 ? 211 SER B C   1 
ATOM   3341 O O   . SER B 1 167 ? -16.613 -10.864 -30.281 1.00 48.06 ? 211 SER B O   1 
ATOM   3342 C CB  . SER B 1 167 ? -14.766 -9.040  -31.855 1.00 46.22 ? 211 SER B CB  1 
ATOM   3343 O OG  . SER B 1 167 ? -13.869 -9.216  -32.933 1.00 46.11 ? 211 SER B OG  1 
ATOM   3344 N N   . ARG B 1 168 ? -17.935 -9.109  -30.810 1.00 50.02 ? 212 ARG B N   1 
ATOM   3345 C CA  . ARG B 1 168 ? -18.598 -8.967  -29.504 1.00 52.29 ? 212 ARG B CA  1 
ATOM   3346 C C   . ARG B 1 168 ? -19.815 -9.890  -29.323 1.00 52.93 ? 212 ARG B C   1 
ATOM   3347 O O   . ARG B 1 168 ? -20.563 -9.770  -28.324 1.00 52.34 ? 212 ARG B O   1 
ATOM   3348 C CB  . ARG B 1 168 ? -18.989 -7.489  -29.251 1.00 52.64 ? 212 ARG B CB  1 
ATOM   3349 C CG  . ARG B 1 168 ? -18.181 -6.776  -28.103 1.00 55.59 ? 212 ARG B CG  1 
ATOM   3350 C CD  . ARG B 1 168 ? -18.327 -7.379  -26.662 1.00 59.01 ? 212 ARG B CD  1 
ATOM   3351 N NE  . ARG B 1 168 ? -17.105 -7.267  -25.846 1.00 60.57 ? 212 ARG B NE  1 
ATOM   3352 C CZ  . ARG B 1 168 ? -15.949 -7.921  -26.066 1.00 62.16 ? 212 ARG B CZ  1 
ATOM   3353 N NH1 . ARG B 1 168 ? -15.812 -8.777  -27.079 1.00 61.90 ? 212 ARG B NH1 1 
ATOM   3354 N NH2 . ARG B 1 168 ? -14.912 -7.716  -25.259 1.00 63.40 ? 212 ARG B NH2 1 
ATOM   3355 N N   . SER B 1 169 ? -20.016 -10.808 -30.278 1.00 52.80 ? 213 SER B N   1 
ATOM   3356 C CA  . SER B 1 169 ? -21.150 -11.757 -30.221 1.00 52.63 ? 213 SER B CA  1 
ATOM   3357 C C   . SER B 1 169 ? -22.526 -11.043 -30.192 1.00 51.41 ? 213 SER B C   1 
ATOM   3358 O O   . SER B 1 169 ? -23.346 -11.217 -31.153 1.00 52.29 ? 213 SER B O   1 
ATOM   3359 C CB  . SER B 1 169 ? -20.982 -12.794 -29.083 1.00 53.09 ? 213 SER B CB  1 
ATOM   3360 O OG  . SER B 1 169 ? -21.266 -12.238 -27.801 1.00 55.13 ? 213 SER B OG  1 
ATOM   3361 N N   . LYS B 1 170 ? -22.784 -10.218 -29.159 1.00 48.41 ? 214 LYS B N   1 
ATOM   3362 C CA  . LYS B 1 170 ? -23.837 -9.189  -29.289 1.00 45.47 ? 214 LYS B CA  1 
ATOM   3363 C C   . LYS B 1 170 ? -23.411 -8.097  -30.287 1.00 43.54 ? 214 LYS B C   1 
ATOM   3364 O O   . LYS B 1 170 ? -23.305 -6.916  -29.939 1.00 44.00 ? 214 LYS B O   1 
ATOM   3365 C CB  . LYS B 1 170 ? -24.244 -8.590  -27.942 1.00 45.85 ? 214 LYS B CB  1 
ATOM   3366 C CG  . LYS B 1 170 ? -25.476 -9.277  -27.334 1.00 44.72 ? 214 LYS B CG  1 
ATOM   3367 C CD  . LYS B 1 170 ? -25.954 -8.597  -26.068 1.00 45.84 ? 214 LYS B CD  1 
ATOM   3368 C CE  . LYS B 1 170 ? -26.231 -9.643  -24.975 1.00 45.24 ? 214 LYS B CE  1 
ATOM   3369 N NZ  . LYS B 1 170 ? -27.701 -9.907  -24.798 1.00 44.36 ? 214 LYS B NZ  1 
ATOM   3370 N N   . ILE B 1 171 ? -23.143 -8.537  -31.516 1.00 40.62 ? 215 ILE B N   1 
ATOM   3371 C CA  . ILE B 1 171 ? -22.768 -7.701  -32.674 1.00 37.26 ? 215 ILE B CA  1 
ATOM   3372 C C   . ILE B 1 171 ? -23.698 -6.503  -32.739 1.00 35.92 ? 215 ILE B C   1 
ATOM   3373 O O   . ILE B 1 171 ? -23.240 -5.383  -32.829 1.00 35.23 ? 215 ILE B O   1 
ATOM   3374 C CB  . ILE B 1 171 ? -22.939 -8.514  -33.998 1.00 37.70 ? 215 ILE B CB  1 
ATOM   3375 C CG1 . ILE B 1 171 ? -22.431 -9.962  -33.836 1.00 35.03 ? 215 ILE B CG1 1 
ATOM   3376 C CG2 . ILE B 1 171 ? -22.425 -7.700  -35.250 1.00 33.81 ? 215 ILE B CG2 1 
ATOM   3377 C CD1 . ILE B 1 171 ? -21.269 -10.354 -34.551 1.00 31.71 ? 215 ILE B CD1 1 
ATOM   3378 N N   . PHE B 1 172 ? -25.003 -6.780  -32.736 1.00 35.04 ? 216 PHE B N   1 
ATOM   3379 C CA  . PHE B 1 172 ? -26.025 -5.780  -32.521 1.00 34.10 ? 216 PHE B CA  1 
ATOM   3380 C C   . PHE B 1 172 ? -26.625 -5.944  -31.122 1.00 34.13 ? 216 PHE B C   1 
ATOM   3381 O O   . PHE B 1 172 ? -27.157 -6.993  -30.796 1.00 33.89 ? 216 PHE B O   1 
ATOM   3382 C CB  . PHE B 1 172 ? -27.149 -5.902  -33.548 1.00 34.00 ? 216 PHE B CB  1 
ATOM   3383 C CG  . PHE B 1 172 ? -28.327 -5.024  -33.233 1.00 35.37 ? 216 PHE B CG  1 
ATOM   3384 C CD1 . PHE B 1 172 ? -28.215 -3.637  -33.298 1.00 36.06 ? 216 PHE B CD1 1 
ATOM   3385 C CD2 . PHE B 1 172 ? -29.539 -5.567  -32.858 1.00 35.20 ? 216 PHE B CD2 1 
ATOM   3386 C CE1 . PHE B 1 172 ? -29.313 -2.796  -32.994 1.00 34.51 ? 216 PHE B CE1 1 
ATOM   3387 C CE2 . PHE B 1 172 ? -30.645 -4.725  -32.579 1.00 38.64 ? 216 PHE B CE2 1 
ATOM   3388 C CZ  . PHE B 1 172 ? -30.518 -3.335  -32.644 1.00 34.64 ? 216 PHE B CZ  1 
ATOM   3389 N N   . ASP B 1 173 ? -26.586 -4.885  -30.330 1.00 33.29 ? 217 ASP B N   1 
ATOM   3390 C CA  . ASP B 1 173 ? -27.086 -4.914  -28.964 1.00 33.92 ? 217 ASP B CA  1 
ATOM   3391 C C   . ASP B 1 173 ? -28.214 -3.908  -28.860 1.00 33.74 ? 217 ASP B C   1 
ATOM   3392 O O   . ASP B 1 173 ? -28.001 -2.688  -28.920 1.00 33.39 ? 217 ASP B O   1 
ATOM   3393 C CB  . ASP B 1 173 ? -25.954 -4.607  -28.007 1.00 33.67 ? 217 ASP B CB  1 
ATOM   3394 C CG  . ASP B 1 173 ? -26.385 -4.636  -26.529 1.00 35.68 ? 217 ASP B CG  1 
ATOM   3395 O OD1 . ASP B 1 173 ? -27.479 -5.119  -26.148 1.00 37.25 ? 217 ASP B OD1 1 
ATOM   3396 O OD2 . ASP B 1 173 ? -25.651 -4.160  -25.668 1.00 41.78 ? 217 ASP B OD2 1 
ATOM   3397 N N   . LYS B 1 174 ? -29.426 -4.443  -28.756 1.00 33.25 ? 218 LYS B N   1 
ATOM   3398 C CA  . LYS B 1 174 ? -30.623 -3.632  -28.721 1.00 34.18 ? 218 LYS B CA  1 
ATOM   3399 C C   . LYS B 1 174 ? -30.625 -2.715  -27.491 1.00 33.92 ? 218 LYS B C   1 
ATOM   3400 O O   . LYS B 1 174 ? -31.488 -1.848  -27.372 1.00 34.84 ? 218 LYS B O   1 
ATOM   3401 C CB  . LYS B 1 174 ? -31.891 -4.516  -28.799 1.00 34.53 ? 218 LYS B CB  1 
ATOM   3402 C CG  . LYS B 1 174 ? -32.560 -4.808  -27.441 1.00 38.10 ? 218 LYS B CG  1 
ATOM   3403 C CD  . LYS B 1 174 ? -32.620 -6.278  -27.064 1.00 40.69 ? 218 LYS B CD  1 
ATOM   3404 C CE  . LYS B 1 174 ? -32.903 -6.436  -25.562 1.00 43.38 ? 218 LYS B CE  1 
ATOM   3405 N NZ  . LYS B 1 174 ? -32.277 -7.680  -25.030 1.00 45.42 ? 218 LYS B NZ  1 
ATOM   3406 N N   . ASP B 1 175 ? -29.655 -2.887  -26.597 1.00 32.99 ? 219 ASP B N   1 
ATOM   3407 C CA  . ASP B 1 175 ? -29.554 -2.013  -25.417 1.00 33.42 ? 219 ASP B CA  1 
ATOM   3408 C C   . ASP B 1 175 ? -28.551 -0.879  -25.543 1.00 32.96 ? 219 ASP B C   1 
ATOM   3409 O O   . ASP B 1 175 ? -28.404 -0.010  -24.659 1.00 33.16 ? 219 ASP B O   1 
ATOM   3410 C CB  . ASP B 1 175 ? -29.227 -2.875  -24.219 1.00 33.80 ? 219 ASP B CB  1 
ATOM   3411 C CG  . ASP B 1 175 ? -30.441 -3.656  -23.757 1.00 39.02 ? 219 ASP B CG  1 
ATOM   3412 O OD1 . ASP B 1 175 ? -31.579 -3.113  -23.915 1.00 38.79 ? 219 ASP B OD1 1 
ATOM   3413 O OD2 . ASP B 1 175 ? -30.353 -4.799  -23.247 1.00 44.04 ? 219 ASP B OD2 1 
ATOM   3414 N N   . SER B 1 176 ? -27.813 -0.892  -26.629 1.00 31.72 ? 220 SER B N   1 
ATOM   3415 C CA  . SER B 1 176 ? -26.877 0.192   -26.851 1.00 30.89 ? 220 SER B CA  1 
ATOM   3416 C C   . SER B 1 176 ? -27.697 1.418   -27.315 1.00 30.63 ? 220 SER B C   1 
ATOM   3417 O O   . SER B 1 176 ? -28.887 1.284   -27.625 1.00 30.74 ? 220 SER B O   1 
ATOM   3418 C CB  . SER B 1 176 ? -25.873 -0.242  -27.899 1.00 31.81 ? 220 SER B CB  1 
ATOM   3419 O OG  . SER B 1 176 ? -26.446 -0.228  -29.225 1.00 29.87 ? 220 SER B OG  1 
ATOM   3420 N N   . THR B 1 177 ? -27.066 2.590   -27.356 1.00 28.44 ? 221 THR B N   1 
ATOM   3421 C CA  . THR B 1 177 ? -27.685 3.778   -27.919 1.00 27.10 ? 221 THR B CA  1 
ATOM   3422 C C   . THR B 1 177 ? -28.101 3.552   -29.372 1.00 27.11 ? 221 THR B C   1 
ATOM   3423 O O   . THR B 1 177 ? -29.157 3.937   -29.748 1.00 26.12 ? 221 THR B O   1 
ATOM   3424 C CB  . THR B 1 177 ? -26.705 4.920   -27.855 1.00 27.50 ? 221 THR B CB  1 
ATOM   3425 O OG1 . THR B 1 177 ? -26.349 5.120   -26.469 1.00 24.52 ? 221 THR B OG1 1 
ATOM   3426 C CG2 . THR B 1 177 ? -27.381 6.240   -28.270 1.00 27.10 ? 221 THR B CG2 1 
ATOM   3427 N N   . PHE B 1 178 ? -27.236 2.972   -30.189 1.00 28.19 ? 222 PHE B N   1 
ATOM   3428 C CA  . PHE B 1 178 ? -27.642 2.671   -31.580 1.00 28.23 ? 222 PHE B CA  1 
ATOM   3429 C C   . PHE B 1 178 ? -28.894 1.788   -31.519 1.00 29.67 ? 222 PHE B C   1 
ATOM   3430 O O   . PHE B 1 178 ? -29.869 2.047   -32.179 1.00 28.52 ? 222 PHE B O   1 
ATOM   3431 C CB  . PHE B 1 178 ? -26.536 1.975   -32.369 1.00 26.87 ? 222 PHE B CB  1 
ATOM   3432 C CG  . PHE B 1 178 ? -27.039 1.412   -33.710 1.00 26.44 ? 222 PHE B CG  1 
ATOM   3433 C CD1 . PHE B 1 178 ? -27.459 2.280   -34.712 1.00 22.82 ? 222 PHE B CD1 1 
ATOM   3434 C CD2 . PHE B 1 178 ? -27.146 0.029   -33.924 1.00 26.86 ? 222 PHE B CD2 1 
ATOM   3435 C CE1 . PHE B 1 178 ? -27.988 1.788   -35.957 1.00 29.16 ? 222 PHE B CE1 1 
ATOM   3436 C CE2 . PHE B 1 178 ? -27.655 -0.497  -35.164 1.00 27.32 ? 222 PHE B CE2 1 
ATOM   3437 C CZ  . PHE B 1 178 ? -28.078 0.403   -36.194 1.00 26.74 ? 222 PHE B CZ  1 
ATOM   3438 N N   . GLY B 1 179 ? -28.877 0.763   -30.657 1.00 30.06 ? 223 GLY B N   1 
ATOM   3439 C CA  . GLY B 1 179 ? -29.916 -0.236  -30.688 1.00 30.78 ? 223 GLY B CA  1 
ATOM   3440 C C   . GLY B 1 179 ? -31.211 0.241   -30.121 1.00 32.44 ? 223 GLY B C   1 
ATOM   3441 O O   . GLY B 1 179 ? -32.238 -0.332  -30.403 1.00 33.34 ? 223 GLY B O   1 
ATOM   3442 N N   . SER B 1 180 ? -31.169 1.273   -29.283 1.00 32.13 ? 224 SER B N   1 
ATOM   3443 C CA  . SER B 1 180 ? -32.376 1.749   -28.664 1.00 32.88 ? 224 SER B CA  1 
ATOM   3444 C C   . SER B 1 180 ? -32.758 3.230   -28.852 1.00 32.33 ? 224 SER B C   1 
ATOM   3445 O O   . SER B 1 180 ? -33.812 3.622   -28.362 1.00 34.00 ? 224 SER B O   1 
ATOM   3446 C CB  . SER B 1 180 ? -32.281 1.487   -27.153 1.00 33.53 ? 224 SER B CB  1 
ATOM   3447 O OG  . SER B 1 180 ? -31.166 2.169   -26.634 1.00 35.45 ? 224 SER B OG  1 
ATOM   3448 N N   . VAL B 1 181 ? -31.883 4.075   -29.408 1.00 31.05 ? 225 VAL B N   1 
ATOM   3449 C CA  . VAL B 1 181 ? -32.329 5.396   -29.838 1.00 30.62 ? 225 VAL B CA  1 
ATOM   3450 C C   . VAL B 1 181 ? -32.193 5.552   -31.362 1.00 30.59 ? 225 VAL B C   1 
ATOM   3451 O O   . VAL B 1 181 ? -33.151 5.883   -32.052 1.00 30.18 ? 225 VAL B O   1 
ATOM   3452 C CB  . VAL B 1 181 ? -31.865 6.606   -28.912 1.00 31.99 ? 225 VAL B CB  1 
ATOM   3453 C CG1 . VAL B 1 181 ? -31.051 6.139   -27.696 1.00 34.50 ? 225 VAL B CG1 1 
ATOM   3454 C CG2 . VAL B 1 181 ? -31.192 7.748   -29.623 1.00 31.28 ? 225 VAL B CG2 1 
ATOM   3455 N N   . GLU B 1 182 ? -31.037 5.214   -31.891 1.00 28.63 ? 226 GLU B N   1 
ATOM   3456 C CA  . GLU B 1 182 ? -30.776 5.624   -33.229 1.00 29.27 ? 226 GLU B CA  1 
ATOM   3457 C C   . GLU B 1 182 ? -31.642 4.822   -34.192 1.00 29.26 ? 226 GLU B C   1 
ATOM   3458 O O   . GLU B 1 182 ? -32.291 5.427   -35.068 1.00 28.49 ? 226 GLU B O   1 
ATOM   3459 C CB  . GLU B 1 182 ? -29.276 5.544   -33.549 1.00 29.43 ? 226 GLU B CB  1 
ATOM   3460 C CG  . GLU B 1 182 ? -28.406 6.579   -32.800 1.00 32.64 ? 226 GLU B CG  1 
ATOM   3461 C CD  . GLU B 1 182 ? -26.874 6.312   -32.934 1.00 42.76 ? 226 GLU B CD  1 
ATOM   3462 O OE1 . GLU B 1 182 ? -26.463 5.334   -33.649 1.00 42.96 ? 226 GLU B OE1 1 
ATOM   3463 O OE2 . GLU B 1 182 ? -26.049 7.042   -32.274 1.00 44.92 ? 226 GLU B OE2 1 
ATOM   3464 N N   . VAL B 1 183 ? -31.697 3.498   -34.006 1.00 28.46 ? 227 VAL B N   1 
ATOM   3465 C CA  . VAL B 1 183 ? -32.324 2.629   -35.039 1.00 33.33 ? 227 VAL B CA  1 
ATOM   3466 C C   . VAL B 1 183 ? -33.835 2.940   -35.232 1.00 33.44 ? 227 VAL B C   1 
ATOM   3467 O O   . VAL B 1 183 ? -34.387 2.891   -36.358 1.00 34.88 ? 227 VAL B O   1 
ATOM   3468 C CB  . VAL B 1 183 ? -32.031 1.132   -34.722 1.00 33.60 ? 227 VAL B CB  1 
ATOM   3469 C CG1 . VAL B 1 183 ? -33.106 0.527   -33.808 1.00 31.99 ? 227 VAL B CG1 1 
ATOM   3470 C CG2 . VAL B 1 183 ? -31.774 0.334   -35.948 1.00 34.80 ? 227 VAL B CG2 1 
ATOM   3471 N N   . HIS B 1 184 ? -34.458 3.339   -34.130 1.00 33.32 ? 228 HIS B N   1 
ATOM   3472 C CA  . HIS B 1 184 ? -35.861 3.659   -34.095 1.00 33.72 ? 228 HIS B CA  1 
ATOM   3473 C C   . HIS B 1 184 ? -36.117 5.093   -34.468 1.00 32.83 ? 228 HIS B C   1 
ATOM   3474 O O   . HIS B 1 184 ? -37.266 5.477   -34.601 1.00 34.94 ? 228 HIS B O   1 
ATOM   3475 C CB  . HIS B 1 184 ? -36.431 3.364   -32.705 1.00 34.82 ? 228 HIS B CB  1 
ATOM   3476 C CG  . HIS B 1 184 ? -36.399 1.911   -32.352 1.00 37.74 ? 228 HIS B CG  1 
ATOM   3477 N ND1 . HIS B 1 184 ? -35.594 1.405   -31.348 1.00 39.83 ? 228 HIS B ND1 1 
ATOM   3478 C CD2 . HIS B 1 184 ? -37.040 0.846   -32.900 1.00 38.23 ? 228 HIS B CD2 1 
ATOM   3479 C CE1 . HIS B 1 184 ? -35.769 0.094   -31.267 1.00 41.52 ? 228 HIS B CE1 1 
ATOM   3480 N NE2 . HIS B 1 184 ? -36.635 -0.272  -32.202 1.00 42.45 ? 228 HIS B NE2 1 
ATOM   3481 N N   . ASN B 1 185 ? -35.086 5.901   -34.643 1.00 31.83 ? 229 ASN B N   1 
ATOM   3482 C CA  . ASN B 1 185 ? -35.335 7.278   -35.087 1.00 31.78 ? 229 ASN B CA  1 
ATOM   3483 C C   . ASN B 1 185 ? -34.926 7.580   -36.531 1.00 31.27 ? 229 ASN B C   1 
ATOM   3484 O O   . ASN B 1 185 ? -34.902 8.718   -36.959 1.00 31.90 ? 229 ASN B O   1 
ATOM   3485 C CB  . ASN B 1 185 ? -34.750 8.251   -34.107 1.00 31.84 ? 229 ASN B CB  1 
ATOM   3486 C CG  . ASN B 1 185 ? -35.583 8.324   -32.836 1.00 33.32 ? 229 ASN B CG  1 
ATOM   3487 O OD1 . ASN B 1 185 ? -36.596 8.984   -32.822 1.00 37.07 ? 229 ASN B OD1 1 
ATOM   3488 N ND2 . ASN B 1 185 ? -35.165 7.614   -31.766 1.00 34.67 ? 229 ASN B ND2 1 
ATOM   3489 N N   . LEU B 1 186 ? -34.627 6.539   -37.279 1.00 30.33 ? 230 LEU B N   1 
ATOM   3490 C CA  . LEU B 1 186 ? -34.317 6.683   -38.705 1.00 30.24 ? 230 LEU B CA  1 
ATOM   3491 C C   . LEU B 1 186 ? -35.646 6.773   -39.510 1.00 31.96 ? 230 LEU B C   1 
ATOM   3492 O O   . LEU B 1 186 ? -36.399 5.796   -39.586 1.00 33.17 ? 230 LEU B O   1 
ATOM   3493 C CB  . LEU B 1 186 ? -33.513 5.486   -39.127 1.00 28.88 ? 230 LEU B CB  1 
ATOM   3494 C CG  . LEU B 1 186 ? -32.076 5.330   -38.718 1.00 26.51 ? 230 LEU B CG  1 
ATOM   3495 C CD1 . LEU B 1 186 ? -31.551 3.944   -39.124 1.00 28.94 ? 230 LEU B CD1 1 
ATOM   3496 C CD2 . LEU B 1 186 ? -31.237 6.370   -39.373 1.00 28.62 ? 230 LEU B CD2 1 
ATOM   3497 N N   . GLN B 1 187 ? -35.960 7.938   -40.082 1.00 32.25 ? 231 GLN B N   1 
ATOM   3498 C CA  . GLN B 1 187 ? -37.270 8.151   -40.721 1.00 33.97 ? 231 GLN B CA  1 
ATOM   3499 C C   . GLN B 1 187 ? -37.373 7.532   -42.149 1.00 34.30 ? 231 GLN B C   1 
ATOM   3500 O O   . GLN B 1 187 ? -36.573 7.893   -43.006 1.00 33.27 ? 231 GLN B O   1 
ATOM   3501 C CB  . GLN B 1 187 ? -37.524 9.643   -40.796 1.00 34.35 ? 231 GLN B CB  1 
ATOM   3502 C CG  . GLN B 1 187 ? -37.087 10.333  -39.536 1.00 36.91 ? 231 GLN B CG  1 
ATOM   3503 C CD  . GLN B 1 187 ? -37.703 11.683  -39.408 1.00 45.21 ? 231 GLN B CD  1 
ATOM   3504 O OE1 . GLN B 1 187 ? -37.160 12.666  -39.928 1.00 46.74 ? 231 GLN B OE1 1 
ATOM   3505 N NE2 . GLN B 1 187 ? -38.846 11.757  -38.708 1.00 47.41 ? 231 GLN B NE2 1 
ATOM   3506 N N   . PRO B 1 188 ? -38.310 6.600   -42.387 1.00 35.28 ? 232 PRO B N   1 
ATOM   3507 C CA  . PRO B 1 188 ? -38.445 5.951   -43.710 1.00 35.96 ? 232 PRO B CA  1 
ATOM   3508 C C   . PRO B 1 188 ? -38.799 6.848   -44.902 1.00 36.68 ? 232 PRO B C   1 
ATOM   3509 O O   . PRO B 1 188 ? -38.483 6.464   -46.075 1.00 35.76 ? 232 PRO B O   1 
ATOM   3510 C CB  . PRO B 1 188 ? -39.547 4.911   -43.493 1.00 36.38 ? 232 PRO B CB  1 
ATOM   3511 C CG  . PRO B 1 188 ? -40.285 5.383   -42.327 1.00 36.54 ? 232 PRO B CG  1 
ATOM   3512 C CD  . PRO B 1 188 ? -39.254 6.014   -41.407 1.00 35.79 ? 232 PRO B CD  1 
ATOM   3513 N N   . GLU B 1 189 ? -39.423 7.997   -44.621 1.00 37.05 ? 233 GLU B N   1 
ATOM   3514 C CA  . GLU B 1 189 ? -39.821 8.930   -45.664 1.00 38.34 ? 233 GLU B CA  1 
ATOM   3515 C C   . GLU B 1 189 ? -38.536 9.558   -46.234 1.00 37.94 ? 233 GLU B C   1 
ATOM   3516 O O   . GLU B 1 189 ? -38.541 10.103  -47.351 1.00 39.10 ? 233 GLU B O   1 
ATOM   3517 C CB  . GLU B 1 189 ? -40.832 9.994   -45.141 1.00 38.54 ? 233 GLU B CB  1 
ATOM   3518 C CG  . GLU B 1 189 ? -42.334 9.597   -45.186 1.00 42.16 ? 233 GLU B CG  1 
ATOM   3519 C CD  . GLU B 1 189 ? -43.065 9.792   -46.557 1.00 48.83 ? 233 GLU B CD  1 
ATOM   3520 O OE1 . GLU B 1 189 ? -42.445 9.580   -47.653 1.00 50.44 ? 233 GLU B OE1 1 
ATOM   3521 O OE2 . GLU B 1 189 ? -44.308 10.121  -46.564 1.00 47.21 ? 233 GLU B OE2 1 
ATOM   3522 N N   . LYS B 1 190 ? -37.455 9.414   -45.468 1.00 36.59 ? 234 LYS B N   1 
ATOM   3523 C CA  . LYS B 1 190 ? -36.119 10.007  -45.670 1.00 36.05 ? 234 LYS B CA  1 
ATOM   3524 C C   . LYS B 1 190 ? -34.993 8.964   -45.965 1.00 34.66 ? 234 LYS B C   1 
ATOM   3525 O O   . LYS B 1 190 ? -34.072 9.224   -46.765 1.00 33.56 ? 234 LYS B O   1 
ATOM   3526 C CB  . LYS B 1 190 ? -35.714 10.749  -44.369 1.00 36.32 ? 234 LYS B CB  1 
ATOM   3527 C CG  . LYS B 1 190 ? -35.921 12.236  -44.357 1.00 38.99 ? 234 LYS B CG  1 
ATOM   3528 C CD  . LYS B 1 190 ? -35.382 12.839  -43.058 1.00 44.41 ? 234 LYS B CD  1 
ATOM   3529 C CE  . LYS B 1 190 ? -34.465 14.027  -43.333 1.00 46.83 ? 234 LYS B CE  1 
ATOM   3530 N NZ  . LYS B 1 190 ? -34.829 15.166  -42.447 1.00 47.14 ? 234 LYS B NZ  1 
ATOM   3531 N N   . VAL B 1 191 ? -35.054 7.818   -45.281 1.00 32.56 ? 235 VAL B N   1 
ATOM   3532 C CA  . VAL B 1 191 ? -33.978 6.814   -45.313 1.00 31.08 ? 235 VAL B CA  1 
ATOM   3533 C C   . VAL B 1 191 ? -34.442 5.668   -46.223 1.00 31.83 ? 235 VAL B C   1 
ATOM   3534 O O   . VAL B 1 191 ? -35.542 5.112   -46.050 1.00 32.27 ? 235 VAL B O   1 
ATOM   3535 C CB  . VAL B 1 191 ? -33.679 6.250   -43.910 1.00 31.59 ? 235 VAL B CB  1 
ATOM   3536 C CG1 . VAL B 1 191 ? -32.675 5.077   -43.957 1.00 27.71 ? 235 VAL B CG1 1 
ATOM   3537 C CG2 . VAL B 1 191 ? -33.212 7.346   -42.934 1.00 28.81 ? 235 VAL B CG2 1 
ATOM   3538 N N   . GLN B 1 192 ? -33.638 5.315   -47.213 1.00 30.07 ? 236 GLN B N   1 
ATOM   3539 C CA  . GLN B 1 192 ? -34.091 4.214   -48.014 1.00 31.16 ? 236 GLN B CA  1 
ATOM   3540 C C   . GLN B 1 192 ? -33.448 2.936   -47.548 1.00 30.73 ? 236 GLN B C   1 
ATOM   3541 O O   . GLN B 1 192 ? -34.135 1.905   -47.513 1.00 28.66 ? 236 GLN B O   1 
ATOM   3542 C CB  . GLN B 1 192 ? -33.925 4.483   -49.495 1.00 30.16 ? 236 GLN B CB  1 
ATOM   3543 C CG  . GLN B 1 192 ? -34.742 5.756   -49.926 1.00 35.62 ? 236 GLN B CG  1 
ATOM   3544 C CD  . GLN B 1 192 ? -34.461 6.184   -51.365 1.00 43.69 ? 236 GLN B CD  1 
ATOM   3545 O OE1 . GLN B 1 192 ? -33.566 5.614   -52.028 1.00 45.05 ? 236 GLN B OE1 1 
ATOM   3546 N NE2 . GLN B 1 192 ? -35.244 7.156   -51.877 1.00 46.70 ? 236 GLN B NE2 1 
ATOM   3547 N N   . THR B 1 193 ? -32.191 3.061   -47.069 1.00 31.81 ? 237 THR B N   1 
ATOM   3548 C CA  . THR B 1 193 ? -31.337 1.938   -46.704 1.00 32.23 ? 237 THR B CA  1 
ATOM   3549 C C   . THR B 1 193 ? -30.520 2.161   -45.452 1.00 32.26 ? 237 THR B C   1 
ATOM   3550 O O   . THR B 1 193 ? -29.963 3.264   -45.182 1.00 30.78 ? 237 THR B O   1 
ATOM   3551 C CB  . THR B 1 193 ? -30.353 1.566   -47.921 1.00 33.39 ? 237 THR B CB  1 
ATOM   3552 O OG1 . THR B 1 193 ? -31.094 0.981   -49.006 1.00 36.00 ? 237 THR B OG1 1 
ATOM   3553 C CG2 . THR B 1 193 ? -29.361 0.455   -47.540 1.00 34.12 ? 237 THR B CG2 1 
ATOM   3554 N N   . LEU B 1 194 ? -30.443 1.098   -44.657 1.00 31.65 ? 238 LEU B N   1 
ATOM   3555 C CA  . LEU B 1 194 ? -29.430 1.096   -43.649 1.00 32.01 ? 238 LEU B CA  1 
ATOM   3556 C C   . LEU B 1 194 ? -28.475 -0.027  -43.916 1.00 31.49 ? 238 LEU B C   1 
ATOM   3557 O O   . LEU B 1 194 ? -28.856 -1.180  -43.887 1.00 33.00 ? 238 LEU B O   1 
ATOM   3558 C CB  . LEU B 1 194 ? -30.038 0.965   -42.253 1.00 32.01 ? 238 LEU B CB  1 
ATOM   3559 C CG  . LEU B 1 194 ? -29.023 0.587   -41.179 1.00 32.51 ? 238 LEU B CG  1 
ATOM   3560 C CD1 . LEU B 1 194 ? -28.511 1.843   -40.488 1.00 31.76 ? 238 LEU B CD1 1 
ATOM   3561 C CD2 . LEU B 1 194 ? -29.718 -0.322  -40.239 1.00 32.06 ? 238 LEU B CD2 1 
ATOM   3562 N N   . GLU B 1 195 ? -27.227 0.321   -44.153 1.00 31.18 ? 239 GLU B N   1 
ATOM   3563 C CA  . GLU B 1 195 ? -26.236 -0.659  -44.457 1.00 31.70 ? 239 GLU B CA  1 
ATOM   3564 C C   . GLU B 1 195 ? -25.338 -0.879  -43.229 1.00 32.02 ? 239 GLU B C   1 
ATOM   3565 O O   . GLU B 1 195 ? -24.745 0.067   -42.713 1.00 31.91 ? 239 GLU B O   1 
ATOM   3566 C CB  . GLU B 1 195 ? -25.439 -0.231  -45.737 1.00 31.34 ? 239 GLU B CB  1 
ATOM   3567 C CG  . GLU B 1 195 ? -24.145 -1.029  -45.911 1.00 35.47 ? 239 GLU B CG  1 
ATOM   3568 C CD  . GLU B 1 195 ? -23.587 -1.091  -47.315 1.00 36.66 ? 239 GLU B CD  1 
ATOM   3569 O OE1 . GLU B 1 195 ? -22.383 -0.848  -47.450 1.00 39.03 ? 239 GLU B OE1 1 
ATOM   3570 O OE2 . GLU B 1 195 ? -24.320 -1.386  -48.279 1.00 38.64 ? 239 GLU B OE2 1 
ATOM   3571 N N   . ALA B 1 196 ? -25.289 -2.126  -42.755 1.00 32.12 ? 240 ALA B N   1 
ATOM   3572 C CA  . ALA B 1 196 ? -24.340 -2.551  -41.701 1.00 31.62 ? 240 ALA B CA  1 
ATOM   3573 C C   . ALA B 1 196 ? -23.005 -3.120  -42.223 1.00 31.36 ? 240 ALA B C   1 
ATOM   3574 O O   . ALA B 1 196 ? -22.987 -3.968  -43.146 1.00 31.70 ? 240 ALA B O   1 
ATOM   3575 C CB  . ALA B 1 196 ? -25.004 -3.553  -40.781 1.00 33.22 ? 240 ALA B CB  1 
ATOM   3576 N N   . TRP B 1 197 ? -21.894 -2.628  -41.657 1.00 29.97 ? 241 TRP B N   1 
ATOM   3577 C CA  . TRP B 1 197 ? -20.584 -3.209  -41.893 1.00 30.81 ? 241 TRP B CA  1 
ATOM   3578 C C   . TRP B 1 197 ? -20.210 -3.949  -40.639 1.00 30.75 ? 241 TRP B C   1 
ATOM   3579 O O   . TRP B 1 197 ? -19.915 -3.328  -39.657 1.00 30.03 ? 241 TRP B O   1 
ATOM   3580 C CB  . TRP B 1 197 ? -19.527 -2.129  -42.177 1.00 29.63 ? 241 TRP B CB  1 
ATOM   3581 C CG  . TRP B 1 197 ? -19.823 -1.260  -43.398 1.00 33.60 ? 241 TRP B CG  1 
ATOM   3582 C CD1 . TRP B 1 197 ? -20.694 -1.534  -44.425 1.00 32.59 ? 241 TRP B CD1 1 
ATOM   3583 C CD2 . TRP B 1 197 ? -19.253 0.024   -43.699 1.00 35.48 ? 241 TRP B CD2 1 
ATOM   3584 N NE1 . TRP B 1 197 ? -20.686 -0.514  -45.350 1.00 29.25 ? 241 TRP B NE1 1 
ATOM   3585 C CE2 . TRP B 1 197 ? -19.814 0.458   -44.929 1.00 35.70 ? 241 TRP B CE2 1 
ATOM   3586 C CE3 . TRP B 1 197 ? -18.306 0.848   -43.067 1.00 39.14 ? 241 TRP B CE3 1 
ATOM   3587 C CZ2 . TRP B 1 197 ? -19.477 1.691   -45.519 1.00 37.92 ? 241 TRP B CZ2 1 
ATOM   3588 C CZ3 . TRP B 1 197 ? -17.957 2.085   -43.682 1.00 41.11 ? 241 TRP B CZ3 1 
ATOM   3589 C CH2 . TRP B 1 197 ? -18.543 2.476   -44.887 1.00 41.94 ? 241 TRP B CH2 1 
ATOM   3590 N N   . VAL B 1 198 ? -20.212 -5.275  -40.686 1.00 31.26 ? 242 VAL B N   1 
ATOM   3591 C CA  . VAL B 1 198 ? -19.841 -6.057  -39.549 1.00 30.83 ? 242 VAL B CA  1 
ATOM   3592 C C   . VAL B 1 198 ? -18.340 -6.280  -39.625 1.00 31.71 ? 242 VAL B C   1 
ATOM   3593 O O   . VAL B 1 198 ? -17.846 -7.077  -40.446 1.00 32.49 ? 242 VAL B O   1 
ATOM   3594 C CB  . VAL B 1 198 ? -20.565 -7.431  -39.494 1.00 30.94 ? 242 VAL B CB  1 
ATOM   3595 C CG1 . VAL B 1 198 ? -20.114 -8.170  -38.224 1.00 31.90 ? 242 VAL B CG1 1 
ATOM   3596 C CG2 . VAL B 1 198 ? -22.098 -7.235  -39.496 1.00 31.63 ? 242 VAL B CG2 1 
ATOM   3597 N N   . ILE B 1 199 ? -17.640 -5.609  -38.718 1.00 31.78 ? 243 ILE B N   1 
ATOM   3598 C CA  . ILE B 1 199 ? -16.194 -5.594  -38.649 1.00 32.02 ? 243 ILE B CA  1 
ATOM   3599 C C   . ILE B 1 199 ? -15.670 -6.827  -37.874 1.00 33.33 ? 243 ILE B C   1 
ATOM   3600 O O   . ILE B 1 199 ? -15.834 -6.905  -36.673 1.00 31.98 ? 243 ILE B O   1 
ATOM   3601 C CB  . ILE B 1 199 ? -15.750 -4.364  -37.850 1.00 31.72 ? 243 ILE B CB  1 
ATOM   3602 C CG1 . ILE B 1 199 ? -16.413 -3.049  -38.337 1.00 32.08 ? 243 ILE B CG1 1 
ATOM   3603 C CG2 . ILE B 1 199 ? -14.207 -4.395  -37.616 1.00 32.02 ? 243 ILE B CG2 1 
ATOM   3604 C CD1 . ILE B 1 199 ? -16.543 -2.809  -39.908 1.00 34.42 ? 243 ILE B CD1 1 
ATOM   3605 N N   . HIS B 1 200 ? -15.006 -7.741  -38.571 1.00 35.85 ? 244 HIS B N   1 
ATOM   3606 C CA  . HIS B 1 200 ? -14.434 -8.934  -37.909 1.00 36.61 ? 244 HIS B CA  1 
ATOM   3607 C C   . HIS B 1 200 ? -13.310 -8.644  -36.887 1.00 38.66 ? 244 HIS B C   1 
ATOM   3608 O O   . HIS B 1 200 ? -12.594 -7.656  -36.984 1.00 38.70 ? 244 HIS B O   1 
ATOM   3609 C CB  . HIS B 1 200 ? -14.008 -9.992  -38.939 1.00 36.27 ? 244 HIS B CB  1 
ATOM   3610 C CG  . HIS B 1 200 ? -15.156 -10.628 -39.683 1.00 35.15 ? 244 HIS B CG  1 
ATOM   3611 N ND1 . HIS B 1 200 ? -16.263 -9.929  -40.096 1.00 33.88 ? 244 HIS B ND1 1 
ATOM   3612 C CD2 . HIS B 1 200 ? -15.371 -11.911 -40.059 1.00 35.23 ? 244 HIS B CD2 1 
ATOM   3613 C CE1 . HIS B 1 200 ? -17.105 -10.746 -40.705 1.00 34.57 ? 244 HIS B CE1 1 
ATOM   3614 N NE2 . HIS B 1 200 ? -16.582 -11.960 -40.698 1.00 33.31 ? 244 HIS B NE2 1 
ATOM   3615 N N   . GLY B 1 201 ? -13.190 -9.524  -35.885 1.00 40.67 ? 245 GLY B N   1 
ATOM   3616 C CA  . GLY B 1 201 ? -12.229 -9.353  -34.813 1.00 42.92 ? 245 GLY B CA  1 
ATOM   3617 C C   . GLY B 1 201 ? -10.925 -10.011 -35.164 1.00 44.67 ? 245 GLY B C   1 
ATOM   3618 O O   . GLY B 1 201 ? -10.390 -9.766  -36.251 1.00 45.61 ? 245 GLY B O   1 
ATOM   3619 N N   . GLY B 1 202 ? -10.434 -10.871 -34.276 1.00 45.89 ? 246 GLY B N   1 
ATOM   3620 C CA  . GLY B 1 202 ? -9.108  -11.425 -34.430 1.00 47.41 ? 246 GLY B CA  1 
ATOM   3621 C C   . GLY B 1 202 ? -8.903  -12.850 -34.927 1.00 48.44 ? 246 GLY B C   1 
ATOM   3622 O O   . GLY B 1 202 ? -8.992  -13.841 -34.162 1.00 48.35 ? 246 GLY B O   1 
ATOM   3623 N N   . ARG B 1 203 ? -8.599  -12.937 -36.225 1.00 49.00 ? 247 ARG B N   1 
ATOM   3624 C CA  . ARG B 1 203 ? -7.875  -14.071 -36.776 1.00 49.08 ? 247 ARG B CA  1 
ATOM   3625 C C   . ARG B 1 203 ? -8.589  -14.801 -37.885 1.00 49.03 ? 247 ARG B C   1 
ATOM   3626 O O   . ARG B 1 203 ? -8.433  -14.506 -39.084 1.00 50.16 ? 247 ARG B O   1 
ATOM   3627 N N   . GLU B 1 204 ? -9.337  -15.808 -37.460 1.00 48.73 ? 248 GLU B N   1 
ATOM   3628 C CA  . GLU B 1 204 ? -10.321 -16.453 -38.281 1.00 47.90 ? 248 GLU B CA  1 
ATOM   3629 C C   . GLU B 1 204 ? -11.339 -15.365 -38.383 1.00 47.69 ? 248 GLU B C   1 
ATOM   3630 O O   . GLU B 1 204 ? -10.997 -14.188 -38.499 1.00 47.68 ? 248 GLU B O   1 
ATOM   3631 N N   . ASP B 1 205 ? -12.593 -15.746 -38.264 1.00 47.12 ? 249 ASP B N   1 
ATOM   3632 C CA  . ASP B 1 205 ? -13.642 -14.845 -38.637 1.00 46.25 ? 249 ASP B CA  1 
ATOM   3633 C C   . ASP B 1 205 ? -13.779 -15.053 -40.136 1.00 45.44 ? 249 ASP B C   1 
ATOM   3634 O O   . ASP B 1 205 ? -13.878 -14.091 -40.875 1.00 45.26 ? 249 ASP B O   1 
ATOM   3635 N N   . SER B 1 206 ? -13.756 -16.313 -40.578 1.00 44.71 ? 250 SER B N   1 
ATOM   3636 C CA  . SER B 1 206 ? -14.088 -16.653 -41.963 1.00 44.57 ? 250 SER B CA  1 
ATOM   3637 C C   . SER B 1 206 ? -15.599 -16.676 -42.139 1.00 44.42 ? 250 SER B C   1 
ATOM   3638 O O   . SER B 1 206 ? -16.119 -16.560 -43.259 1.00 44.69 ? 250 SER B O   1 
ATOM   3639 N N   . ARG B 1 207 ? -16.301 -16.793 -41.012 1.00 43.73 ? 251 ARG B N   1 
ATOM   3640 C CA  . ARG B 1 207 ? -17.751 -16.938 -40.976 1.00 43.87 ? 251 ARG B CA  1 
ATOM   3641 C C   . ARG B 1 207 ? -18.534 -15.713 -41.453 1.00 43.17 ? 251 ARG B C   1 
ATOM   3642 O O   . ARG B 1 207 ? -18.093 -14.569 -41.385 1.00 41.87 ? 251 ARG B O   1 
ATOM   3643 C CB  . ARG B 1 207 ? -18.223 -17.345 -39.594 1.00 43.57 ? 251 ARG B CB  1 
ATOM   3644 C CG  . ARG B 1 207 ? -17.204 -17.067 -38.500 1.00 45.85 ? 251 ARG B CG  1 
ATOM   3645 C CD  . ARG B 1 207 ? -17.471 -17.815 -37.182 1.00 45.91 ? 251 ARG B CD  1 
ATOM   3646 N NE  . ARG B 1 207 ? -18.638 -17.334 -36.444 1.00 46.20 ? 251 ARG B NE  1 
ATOM   3647 C CZ  . ARG B 1 207 ? -18.586 -16.586 -35.331 1.00 48.22 ? 251 ARG B CZ  1 
ATOM   3648 N NH1 . ARG B 1 207 ? -17.424 -16.201 -34.833 1.00 45.77 ? 251 ARG B NH1 1 
ATOM   3649 N NH2 . ARG B 1 207 ? -19.711 -16.201 -34.728 1.00 47.89 ? 251 ARG B NH2 1 
ATOM   3650 N N   . ASP B 1 208 ? -19.706 -16.011 -41.977 1.00 43.12 ? 252 ASP B N   1 
ATOM   3651 C CA  . ASP B 1 208 ? -20.605 -15.002 -42.446 1.00 43.16 ? 252 ASP B CA  1 
ATOM   3652 C C   . ASP B 1 208 ? -21.368 -14.443 -41.225 1.00 42.27 ? 252 ASP B C   1 
ATOM   3653 O O   . ASP B 1 208 ? -22.351 -15.057 -40.785 1.00 41.64 ? 252 ASP B O   1 
ATOM   3654 C CB  . ASP B 1 208 ? -21.547 -15.657 -43.462 1.00 43.75 ? 252 ASP B CB  1 
ATOM   3655 C CG  . ASP B 1 208 ? -22.606 -14.710 -43.988 1.00 46.34 ? 252 ASP B CG  1 
ATOM   3656 O OD1 . ASP B 1 208 ? -22.520 -13.468 -43.782 1.00 49.11 ? 252 ASP B OD1 1 
ATOM   3657 O OD2 . ASP B 1 208 ? -23.579 -15.143 -44.642 1.00 50.04 ? 252 ASP B OD2 1 
ATOM   3658 N N   . LEU B 1 209 ? -20.941 -13.282 -40.711 1.00 41.37 ? 253 LEU B N   1 
ATOM   3659 C CA  . LEU B 1 209 ? -21.584 -12.692 -39.515 1.00 42.07 ? 253 LEU B CA  1 
ATOM   3660 C C   . LEU B 1 209 ? -22.870 -11.930 -39.844 1.00 42.01 ? 253 LEU B C   1 
ATOM   3661 O O   . LEU B 1 209 ? -23.653 -11.568 -38.957 1.00 41.71 ? 253 LEU B O   1 
ATOM   3662 C CB  . LEU B 1 209 ? -20.605 -11.867 -38.646 1.00 41.33 ? 253 LEU B CB  1 
ATOM   3663 C CG  . LEU B 1 209 ? -19.456 -12.720 -38.083 1.00 40.82 ? 253 LEU B CG  1 
ATOM   3664 C CD1 . LEU B 1 209 ? -18.523 -11.946 -37.177 1.00 41.95 ? 253 LEU B CD1 1 
ATOM   3665 C CD2 . LEU B 1 209 ? -19.921 -13.982 -37.355 1.00 38.67 ? 253 LEU B CD2 1 
ATOM   3666 N N   . CYS B 1 210 ? -23.108 -11.736 -41.128 1.00 42.47 ? 254 CYS B N   1 
ATOM   3667 C CA  . CYS B 1 210 ? -24.394 -11.224 -41.538 1.00 43.32 ? 254 CYS B CA  1 
ATOM   3668 C C   . CYS B 1 210 ? -25.507 -12.242 -41.208 1.00 42.66 ? 254 CYS B C   1 
ATOM   3669 O O   . CYS B 1 210 ? -26.677 -11.872 -41.108 1.00 41.98 ? 254 CYS B O   1 
ATOM   3670 C CB  . CYS B 1 210 ? -24.344 -10.831 -42.997 1.00 43.63 ? 254 CYS B CB  1 
ATOM   3671 S SG  . CYS B 1 210 ? -23.453 -9.250  -43.179 1.00 49.46 ? 254 CYS B SG  1 
ATOM   3672 N N   . GLN B 1 211 ? -25.129 -13.506 -40.974 1.00 42.49 ? 255 GLN B N   1 
ATOM   3673 C CA  . GLN B 1 211 ? -26.111 -14.542 -40.592 1.00 42.92 ? 255 GLN B CA  1 
ATOM   3674 C C   . GLN B 1 211 ? -26.244 -14.715 -39.088 1.00 42.36 ? 255 GLN B C   1 
ATOM   3675 O O   . GLN B 1 211 ? -27.023 -15.565 -38.615 1.00 42.87 ? 255 GLN B O   1 
ATOM   3676 C CB  . GLN B 1 211 ? -25.836 -15.910 -41.253 1.00 43.94 ? 255 GLN B CB  1 
ATOM   3677 C CG  . GLN B 1 211 ? -25.547 -15.873 -42.766 1.00 44.74 ? 255 GLN B CG  1 
ATOM   3678 C CD  . GLN B 1 211 ? -26.664 -15.241 -43.593 1.00 48.32 ? 255 GLN B CD  1 
ATOM   3679 O OE1 . GLN B 1 211 ? -27.852 -15.292 -43.220 1.00 49.59 ? 255 GLN B OE1 1 
ATOM   3680 N NE2 . GLN B 1 211 ? -26.283 -14.619 -44.702 1.00 44.46 ? 255 GLN B NE2 1 
ATOM   3681 N N   . ASP B 1 212 ? -25.487 -13.906 -38.347 1.00 41.18 ? 256 ASP B N   1 
ATOM   3682 C CA  . ASP B 1 212 ? -25.620 -13.822 -36.891 1.00 39.75 ? 256 ASP B CA  1 
ATOM   3683 C C   . ASP B 1 212 ? -27.049 -13.438 -36.425 1.00 38.83 ? 256 ASP B C   1 
ATOM   3684 O O   . ASP B 1 212 ? -27.668 -12.468 -36.922 1.00 37.45 ? 256 ASP B O   1 
ATOM   3685 C CB  . ASP B 1 212 ? -24.601 -12.847 -36.327 1.00 40.78 ? 256 ASP B CB  1 
ATOM   3686 C CG  . ASP B 1 212 ? -24.768 -12.637 -34.839 1.00 43.25 ? 256 ASP B CG  1 
ATOM   3687 O OD1 . ASP B 1 212 ? -25.582 -11.737 -34.478 1.00 47.33 ? 256 ASP B OD1 1 
ATOM   3688 O OD2 . ASP B 1 212 ? -24.170 -13.338 -33.977 1.00 44.02 ? 256 ASP B OD2 1 
ATOM   3689 N N   . PRO B 1 213 ? -27.568 -14.204 -35.472 1.00 37.68 ? 257 PRO B N   1 
ATOM   3690 C CA  . PRO B 1 213 ? -28.902 -13.944 -34.902 1.00 37.29 ? 257 PRO B CA  1 
ATOM   3691 C C   . PRO B 1 213 ? -29.257 -12.477 -34.484 1.00 37.01 ? 257 PRO B C   1 
ATOM   3692 O O   . PRO B 1 213 ? -30.448 -12.097 -34.586 1.00 36.82 ? 257 PRO B O   1 
ATOM   3693 C CB  . PRO B 1 213 ? -28.950 -14.884 -33.677 1.00 37.26 ? 257 PRO B CB  1 
ATOM   3694 C CG  . PRO B 1 213 ? -27.959 -15.988 -33.955 1.00 37.70 ? 257 PRO B CG  1 
ATOM   3695 C CD  . PRO B 1 213 ? -26.924 -15.413 -34.903 1.00 37.96 ? 257 PRO B CD  1 
ATOM   3696 N N   . THR B 1 214 ? -28.298 -11.699 -33.959 1.00 36.04 ? 258 THR B N   1 
ATOM   3697 C CA  . THR B 1 214 ? -28.604 -10.309 -33.570 1.00 35.55 ? 258 THR B CA  1 
ATOM   3698 C C   . THR B 1 214 ? -28.644 -9.431  -34.811 1.00 35.67 ? 258 THR B C   1 
ATOM   3699 O O   . THR B 1 214 ? -29.274 -8.371  -34.853 1.00 35.00 ? 258 THR B O   1 
ATOM   3700 C CB  . THR B 1 214 ? -27.591 -9.729  -32.577 1.00 34.52 ? 258 THR B CB  1 
ATOM   3701 O OG1 . THR B 1 214 ? -26.281 -9.767  -33.146 1.00 34.10 ? 258 THR B OG1 1 
ATOM   3702 C CG2 . THR B 1 214 ? -27.471 -10.572 -31.311 1.00 37.63 ? 258 THR B CG2 1 
ATOM   3703 N N   . ILE B 1 215 ? -27.968 -9.898  -35.836 1.00 36.29 ? 259 ILE B N   1 
ATOM   3704 C CA  . ILE B 1 215 ? -28.033 -9.225  -37.108 1.00 37.68 ? 259 ILE B CA  1 
ATOM   3705 C C   . ILE B 1 215 ? -29.428 -9.380  -37.719 1.00 38.86 ? 259 ILE B C   1 
ATOM   3706 O O   . ILE B 1 215 ? -30.079 -8.373  -38.048 1.00 39.10 ? 259 ILE B O   1 
ATOM   3707 C CB  . ILE B 1 215 ? -26.849 -9.675  -38.027 1.00 37.70 ? 259 ILE B CB  1 
ATOM   3708 C CG1 . ILE B 1 215 ? -25.536 -9.246  -37.379 1.00 35.88 ? 259 ILE B CG1 1 
ATOM   3709 C CG2 . ILE B 1 215 ? -26.934 -8.996  -39.452 1.00 38.30 ? 259 ILE B CG2 1 
ATOM   3710 C CD1 . ILE B 1 215 ? -25.528 -7.752  -37.020 1.00 32.65 ? 259 ILE B CD1 1 
ATOM   3711 N N   . LYS B 1 216 ? -29.906 -10.627 -37.812 1.00 39.84 ? 260 LYS B N   1 
ATOM   3712 C CA  . LYS B 1 216 ? -31.247 -10.935 -38.340 1.00 39.65 ? 260 LYS B CA  1 
ATOM   3713 C C   . LYS B 1 216 ? -32.370 -10.252 -37.516 1.00 39.88 ? 260 LYS B C   1 
ATOM   3714 O O   . LYS B 1 216 ? -33.425 -9.879  -38.058 1.00 38.98 ? 260 LYS B O   1 
ATOM   3715 C CB  . LYS B 1 216 ? -31.439 -12.452 -38.445 1.00 40.30 ? 260 LYS B CB  1 
ATOM   3716 C CG  . LYS B 1 216 ? -30.722 -13.168 -39.657 1.00 41.82 ? 260 LYS B CG  1 
ATOM   3717 C CD  . LYS B 1 216 ? -31.008 -12.583 -41.096 1.00 44.56 ? 260 LYS B CD  1 
ATOM   3718 C CE  . LYS B 1 216 ? -30.239 -13.397 -42.188 1.00 47.54 ? 260 LYS B CE  1 
ATOM   3719 N NZ  . LYS B 1 216 ? -30.405 -12.930 -43.648 1.00 45.49 ? 260 LYS B NZ  1 
ATOM   3720 N N   . GLU B 1 217 ? -32.122 -10.075 -36.219 1.00 39.75 ? 261 GLU B N   1 
ATOM   3721 C CA  . GLU B 1 217 ? -32.952 -9.231  -35.350 1.00 40.89 ? 261 GLU B CA  1 
ATOM   3722 C C   . GLU B 1 217 ? -32.902 -7.756  -35.753 1.00 40.49 ? 261 GLU B C   1 
ATOM   3723 O O   . GLU B 1 217 ? -33.913 -7.042  -35.700 1.00 40.43 ? 261 GLU B O   1 
ATOM   3724 C CB  . GLU B 1 217 ? -32.457 -9.313  -33.904 1.00 41.10 ? 261 GLU B CB  1 
ATOM   3725 C CG  . GLU B 1 217 ? -33.502 -8.847  -32.897 1.00 45.91 ? 261 GLU B CG  1 
ATOM   3726 C CD  . GLU B 1 217 ? -32.945 -7.970  -31.765 1.00 53.45 ? 261 GLU B CD  1 
ATOM   3727 O OE1 . GLU B 1 217 ? -31.903 -8.339  -31.131 1.00 55.71 ? 261 GLU B OE1 1 
ATOM   3728 O OE2 . GLU B 1 217 ? -33.577 -6.910  -31.479 1.00 56.15 ? 261 GLU B OE2 1 
ATOM   3729 N N   . LEU B 1 218 ? -31.708 -7.288  -36.105 1.00 40.20 ? 262 LEU B N   1 
ATOM   3730 C CA  . LEU B 1 218 ? -31.571 -5.949  -36.606 1.00 39.43 ? 262 LEU B CA  1 
ATOM   3731 C C   . LEU B 1 218 ? -32.322 -5.861  -37.938 1.00 40.01 ? 262 LEU B C   1 
ATOM   3732 O O   . LEU B 1 218 ? -33.054 -4.902  -38.152 1.00 40.14 ? 262 LEU B O   1 
ATOM   3733 C CB  . LEU B 1 218 ? -30.096 -5.583  -36.759 1.00 39.66 ? 262 LEU B CB  1 
ATOM   3734 C CG  . LEU B 1 218 ? -29.559 -4.141  -36.842 1.00 37.89 ? 262 LEU B CG  1 
ATOM   3735 C CD1 . LEU B 1 218 ? -28.481 -4.042  -37.877 1.00 38.63 ? 262 LEU B CD1 1 
ATOM   3736 C CD2 . LEU B 1 218 ? -30.583 -3.035  -37.051 1.00 30.49 ? 262 LEU B CD2 1 
ATOM   3737 N N   . GLU B 1 219 ? -32.182 -6.855  -38.816 1.00 39.99 ? 263 GLU B N   1 
ATOM   3738 C CA  . GLU B 1 219 ? -32.874 -6.819  -40.112 1.00 40.73 ? 263 GLU B CA  1 
ATOM   3739 C C   . GLU B 1 219 ? -34.395 -6.782  -39.942 1.00 39.92 ? 263 GLU B C   1 
ATOM   3740 O O   . GLU B 1 219 ? -35.132 -6.192  -40.772 1.00 39.40 ? 263 GLU B O   1 
ATOM   3741 C CB  . GLU B 1 219 ? -32.489 -8.025  -40.978 1.00 41.12 ? 263 GLU B CB  1 
ATOM   3742 C CG  . GLU B 1 219 ? -33.216 -8.083  -42.322 1.00 45.59 ? 263 GLU B CG  1 
ATOM   3743 C CD  . GLU B 1 219 ? -33.372 -9.502  -42.899 1.00 52.55 ? 263 GLU B CD  1 
ATOM   3744 O OE1 . GLU B 1 219 ? -33.492 -10.483 -42.104 1.00 56.65 ? 263 GLU B OE1 1 
ATOM   3745 O OE2 . GLU B 1 219 ? -33.410 -9.642  -44.158 1.00 52.04 ? 263 GLU B OE2 1 
ATOM   3746 N N   . SER B 1 220 ? -34.858 -7.425  -38.885 1.00 38.57 ? 264 SER B N   1 
ATOM   3747 C CA  . SER B 1 220 ? -36.279 -7.478  -38.596 1.00 39.03 ? 264 SER B CA  1 
ATOM   3748 C C   . SER B 1 220 ? -36.784 -6.103  -38.181 1.00 38.64 ? 264 SER B C   1 
ATOM   3749 O O   . SER B 1 220 ? -37.834 -5.656  -38.628 1.00 38.43 ? 264 SER B O   1 
ATOM   3750 C CB  . SER B 1 220 ? -36.600 -8.553  -37.553 1.00 38.46 ? 264 SER B CB  1 
ATOM   3751 O OG  . SER B 1 220 ? -37.991 -8.561  -37.265 1.00 40.11 ? 264 SER B OG  1 
ATOM   3752 N N   . ILE B 1 221 ? -36.017 -5.410  -37.351 1.00 39.32 ? 265 ILE B N   1 
ATOM   3753 C CA  . ILE B 1 221 ? -36.489 -4.120  -36.853 1.00 38.73 ? 265 ILE B CA  1 
ATOM   3754 C C   . ILE B 1 221 ? -36.708 -3.169  -38.022 1.00 38.51 ? 265 ILE B C   1 
ATOM   3755 O O   . ILE B 1 221 ? -37.761 -2.539  -38.109 1.00 39.07 ? 265 ILE B O   1 
ATOM   3756 C CB  . ILE B 1 221 ? -35.506 -3.474  -35.865 1.00 37.48 ? 265 ILE B CB  1 
ATOM   3757 C CG1 . ILE B 1 221 ? -35.575 -4.127  -34.503 1.00 38.33 ? 265 ILE B CG1 1 
ATOM   3758 C CG2 . ILE B 1 221 ? -35.844 -2.010  -35.631 1.00 36.89 ? 265 ILE B CG2 1 
ATOM   3759 C CD1 . ILE B 1 221 ? -34.560 -3.530  -33.620 1.00 34.57 ? 265 ILE B CD1 1 
ATOM   3760 N N   . ILE B 1 222 ? -35.700 -3.032  -38.881 1.00 38.08 ? 266 ILE B N   1 
ATOM   3761 C CA  . ILE B 1 222 ? -35.713 -1.959  -39.879 1.00 38.63 ? 266 ILE B CA  1 
ATOM   3762 C C   . ILE B 1 222 ? -36.582 -2.315  -41.074 1.00 37.22 ? 266 ILE B C   1 
ATOM   3763 O O   . ILE B 1 222 ? -37.105 -1.435  -41.752 1.00 37.23 ? 266 ILE B O   1 
ATOM   3764 C CB  . ILE B 1 222 ? -34.288 -1.554  -40.276 1.00 39.78 ? 266 ILE B CB  1 
ATOM   3765 C CG1 . ILE B 1 222 ? -33.424 -2.792  -40.317 1.00 39.95 ? 266 ILE B CG1 1 
ATOM   3766 C CG2 . ILE B 1 222 ? -33.697 -0.475  -39.244 1.00 40.02 ? 266 ILE B CG2 1 
ATOM   3767 C CD1 . ILE B 1 222 ? -32.053 -2.554  -39.867 1.00 43.28 ? 266 ILE B CD1 1 
ATOM   3768 N N   . SER B 1 223 ? -36.783 -3.609  -41.301 1.00 37.11 ? 267 SER B N   1 
ATOM   3769 C CA  . SER B 1 223 ? -37.793 -4.061  -42.272 1.00 36.59 ? 267 SER B CA  1 
ATOM   3770 C C   . SER B 1 223 ? -39.178 -3.526  -41.858 1.00 37.84 ? 267 SER B C   1 
ATOM   3771 O O   . SER B 1 223 ? -39.973 -3.078  -42.707 1.00 37.86 ? 267 SER B O   1 
ATOM   3772 C CB  . SER B 1 223 ? -37.807 -5.598  -42.408 1.00 36.47 ? 267 SER B CB  1 
ATOM   3773 O OG  . SER B 1 223 ? -36.628 -6.124  -43.029 1.00 32.31 ? 267 SER B OG  1 
ATOM   3774 N N   . LYS B 1 224 ? -39.441 -3.569  -40.546 1.00 38.37 ? 268 LYS B N   1 
ATOM   3775 C CA  . LYS B 1 224 ? -40.680 -3.100  -39.939 1.00 39.58 ? 268 LYS B CA  1 
ATOM   3776 C C   . LYS B 1 224 ? -40.907 -1.595  -40.051 1.00 39.51 ? 268 LYS B C   1 
ATOM   3777 O O   . LYS B 1 224 ? -42.047 -1.112  -39.865 1.00 40.02 ? 268 LYS B O   1 
ATOM   3778 C CB  . LYS B 1 224 ? -40.701 -3.483  -38.453 1.00 40.30 ? 268 LYS B CB  1 
ATOM   3779 C CG  . LYS B 1 224 ? -41.655 -4.600  -38.128 1.00 43.18 ? 268 LYS B CG  1 
ATOM   3780 C CD  . LYS B 1 224 ? -40.893 -5.738  -37.519 1.00 48.26 ? 268 LYS B CD  1 
ATOM   3781 C CE  . LYS B 1 224 ? -41.227 -7.038  -38.198 1.00 49.77 ? 268 LYS B CE  1 
ATOM   3782 N NZ  . LYS B 1 224 ? -41.220 -8.062  -37.127 1.00 53.53 ? 268 LYS B NZ  1 
ATOM   3783 N N   . ARG B 1 225 ? -39.832 -0.860  -40.310 1.00 38.53 ? 269 ARG B N   1 
ATOM   3784 C CA  . ARG B 1 225 ? -39.885 0.583   -40.496 1.00 38.40 ? 269 ARG B CA  1 
ATOM   3785 C C   . ARG B 1 225 ? -39.908 0.896   -41.991 1.00 38.06 ? 269 ARG B C   1 
ATOM   3786 O O   . ARG B 1 225 ? -39.797 2.050   -42.413 1.00 38.10 ? 269 ARG B O   1 
ATOM   3787 C CB  . ARG B 1 225 ? -38.677 1.236   -39.819 1.00 38.46 ? 269 ARG B CB  1 
ATOM   3788 C CG  . ARG B 1 225 ? -38.518 0.856   -38.380 1.00 38.39 ? 269 ARG B CG  1 
ATOM   3789 C CD  . ARG B 1 225 ? -37.706 1.827   -37.556 1.00 40.39 ? 269 ARG B CD  1 
ATOM   3790 N NE  . ARG B 1 225 ? -38.500 2.999   -37.169 1.00 42.36 ? 269 ARG B NE  1 
ATOM   3791 C CZ  . ARG B 1 225 ? -38.132 4.230   -37.470 1.00 42.80 ? 269 ARG B CZ  1 
ATOM   3792 N NH1 . ARG B 1 225 ? -37.000 4.403   -38.125 1.00 42.11 ? 269 ARG B NH1 1 
ATOM   3793 N NH2 . ARG B 1 225 ? -38.858 5.279   -37.120 1.00 39.58 ? 269 ARG B NH2 1 
ATOM   3794 N N   . ASN B 1 226 ? -40.070 -0.158  -42.782 1.00 37.58 ? 270 ASN B N   1 
ATOM   3795 C CA  . ASN B 1 226 ? -40.079 -0.074  -44.244 1.00 37.48 ? 270 ASN B CA  1 
ATOM   3796 C C   . ASN B 1 226 ? -38.812 0.556   -44.763 1.00 37.29 ? 270 ASN B C   1 
ATOM   3797 O O   . ASN B 1 226 ? -38.866 1.429   -45.650 1.00 37.67 ? 270 ASN B O   1 
ATOM   3798 C CB  . ASN B 1 226 ? -41.291 0.705   -44.762 1.00 37.11 ? 270 ASN B CB  1 
ATOM   3799 C CG  . ASN B 1 226 ? -41.402 0.727   -46.323 1.00 38.88 ? 270 ASN B CG  1 
ATOM   3800 O OD1 . ASN B 1 226 ? -42.180 1.525   -46.874 1.00 40.31 ? 270 ASN B OD1 1 
ATOM   3801 N ND2 . ASN B 1 226 ? -40.639 -0.129  -47.019 1.00 37.94 ? 270 ASN B ND2 1 
ATOM   3802 N N   . ILE B 1 227 ? -37.685 0.142   -44.190 1.00 35.89 ? 271 ILE B N   1 
ATOM   3803 C CA  . ILE B 1 227 ? -36.396 0.569   -44.661 1.00 34.29 ? 271 ILE B CA  1 
ATOM   3804 C C   . ILE B 1 227 ? -35.712 -0.691  -45.127 1.00 34.21 ? 271 ILE B C   1 
ATOM   3805 O O   . ILE B 1 227 ? -35.917 -1.766  -44.567 1.00 33.87 ? 271 ILE B O   1 
ATOM   3806 C CB  . ILE B 1 227 ? -35.597 1.236   -43.530 1.00 33.77 ? 271 ILE B CB  1 
ATOM   3807 C CG1 . ILE B 1 227 ? -36.227 2.590   -43.203 1.00 33.72 ? 271 ILE B CG1 1 
ATOM   3808 C CG2 . ILE B 1 227 ? -34.136 1.473   -43.943 1.00 30.96 ? 271 ILE B CG2 1 
ATOM   3809 C CD1 . ILE B 1 227 ? -35.844 3.238   -41.832 1.00 31.80 ? 271 ILE B CD1 1 
ATOM   3810 N N   . GLN B 1 228 ? -34.872 -0.546  -46.123 1.00 33.68 ? 272 GLN B N   1 
ATOM   3811 C CA  . GLN B 1 228 ? -34.069 -1.655  -46.557 1.00 36.07 ? 272 GLN B CA  1 
ATOM   3812 C C   . GLN B 1 228 ? -32.851 -1.897  -45.677 1.00 36.06 ? 272 GLN B C   1 
ATOM   3813 O O   . GLN B 1 228 ? -32.132 -0.971  -45.285 1.00 36.35 ? 272 GLN B O   1 
ATOM   3814 C CB  . GLN B 1 228 ? -33.571 -1.408  -47.960 1.00 36.59 ? 272 GLN B CB  1 
ATOM   3815 C CG  . GLN B 1 228 ? -34.546 -1.785  -48.974 1.00 41.18 ? 272 GLN B CG  1 
ATOM   3816 C CD  . GLN B 1 228 ? -33.938 -1.638  -50.321 1.00 50.44 ? 272 GLN B CD  1 
ATOM   3817 O OE1 . GLN B 1 228 ? -33.826 -0.500  -50.830 1.00 53.66 ? 272 GLN B OE1 1 
ATOM   3818 N NE2 . GLN B 1 228 ? -33.492 -2.772  -50.919 1.00 50.93 ? 272 GLN B NE2 1 
ATOM   3819 N N   . PHE B 1 229 ? -32.608 -3.168  -45.402 1.00 37.06 ? 273 PHE B N   1 
ATOM   3820 C CA  . PHE B 1 229 ? -31.410 -3.579  -44.697 1.00 37.19 ? 273 PHE B CA  1 
ATOM   3821 C C   . PHE B 1 229 ? -30.422 -4.184  -45.699 1.00 37.50 ? 273 PHE B C   1 
ATOM   3822 O O   . PHE B 1 229 ? -30.791 -5.018  -46.532 1.00 37.96 ? 273 PHE B O   1 
ATOM   3823 C CB  . PHE B 1 229 ? -31.769 -4.597  -43.596 1.00 36.76 ? 273 PHE B CB  1 
ATOM   3824 C CG  . PHE B 1 229 ? -30.597 -4.990  -42.733 1.00 40.30 ? 273 PHE B CG  1 
ATOM   3825 C CD1 . PHE B 1 229 ? -29.889 -4.025  -42.009 1.00 38.81 ? 273 PHE B CD1 1 
ATOM   3826 C CD2 . PHE B 1 229 ? -30.176 -6.324  -42.658 1.00 42.33 ? 273 PHE B CD2 1 
ATOM   3827 C CE1 . PHE B 1 229 ? -28.794 -4.384  -41.216 1.00 39.64 ? 273 PHE B CE1 1 
ATOM   3828 C CE2 . PHE B 1 229 ? -29.073 -6.683  -41.868 1.00 39.91 ? 273 PHE B CE2 1 
ATOM   3829 C CZ  . PHE B 1 229 ? -28.386 -5.711  -41.150 1.00 40.46 ? 273 PHE B CZ  1 
ATOM   3830 N N   . SER B 1 230 ? -29.182 -3.731  -45.609 1.00 37.48 ? 274 SER B N   1 
ATOM   3831 C CA  . SER B 1 230 ? -28.040 -4.224  -46.338 1.00 37.75 ? 274 SER B CA  1 
ATOM   3832 C C   . SER B 1 230 ? -27.028 -4.635  -45.243 1.00 38.24 ? 274 SER B C   1 
ATOM   3833 O O   . SER B 1 230 ? -26.981 -4.001  -44.181 1.00 36.70 ? 274 SER B O   1 
ATOM   3834 C CB  . SER B 1 230 ? -27.469 -3.053  -47.128 1.00 38.10 ? 274 SER B CB  1 
ATOM   3835 O OG  . SER B 1 230 ? -26.301 -3.400  -47.845 1.00 41.79 ? 274 SER B OG  1 
ATOM   3836 N N   . CYS B 1 231 ? -26.229 -5.680  -45.486 1.00 38.53 ? 275 CYS B N   1 
ATOM   3837 C CA  . CYS B 1 231 ? -25.197 -6.075  -44.510 1.00 39.58 ? 275 CYS B CA  1 
ATOM   3838 C C   . CYS B 1 231 ? -23.939 -6.520  -45.271 1.00 40.05 ? 275 CYS B C   1 
ATOM   3839 O O   . CYS B 1 231 ? -24.046 -7.285  -46.274 1.00 40.02 ? 275 CYS B O   1 
ATOM   3840 C CB  . CYS B 1 231 ? -25.723 -7.178  -43.584 1.00 39.18 ? 275 CYS B CB  1 
ATOM   3841 S SG  . CYS B 1 231 ? -24.526 -7.703  -42.323 1.00 43.31 ? 275 CYS B SG  1 
ATOM   3842 N N   . LYS B 1 232 ? -22.782 -5.996  -44.845 1.00 39.99 ? 276 LYS B N   1 
ATOM   3843 C CA  . LYS B 1 232 ? -21.461 -6.274  -45.459 1.00 40.74 ? 276 LYS B CA  1 
ATOM   3844 C C   . LYS B 1 232 ? -20.492 -6.830  -44.414 1.00 41.03 ? 276 LYS B C   1 
ATOM   3845 O O   . LYS B 1 232 ? -20.202 -6.143  -43.450 1.00 41.77 ? 276 LYS B O   1 
ATOM   3846 C CB  . LYS B 1 232 ? -20.815 -4.966  -45.930 1.00 41.20 ? 276 LYS B CB  1 
ATOM   3847 C CG  . LYS B 1 232 ? -21.041 -4.504  -47.387 1.00 41.13 ? 276 LYS B CG  1 
ATOM   3848 C CD  . LYS B 1 232 ? -22.345 -4.952  -47.911 1.00 44.94 ? 276 LYS B CD  1 
ATOM   3849 C CE  . LYS B 1 232 ? -22.184 -5.700  -49.205 1.00 43.38 ? 276 LYS B CE  1 
ATOM   3850 N NZ  . LYS B 1 232 ? -23.129 -5.083  -50.147 1.00 42.45 ? 276 LYS B NZ  1 
ATOM   3851 N N   . ASN B 1 233 ? -19.974 -8.045  -44.594 1.00 40.66 ? 277 ASN B N   1 
ATOM   3852 C CA  . ASN B 1 233 ? -18.870 -8.535  -43.757 1.00 40.78 ? 277 ASN B CA  1 
ATOM   3853 C C   . ASN B 1 233 ? -17.600 -7.793  -44.105 1.00 40.83 ? 277 ASN B C   1 
ATOM   3854 O O   . ASN B 1 233 ? -17.262 -7.677  -45.292 1.00 41.73 ? 277 ASN B O   1 
ATOM   3855 C CB  . ASN B 1 233 ? -18.606 -10.017 -44.016 1.00 41.48 ? 277 ASN B CB  1 
ATOM   3856 C CG  . ASN B 1 233 ? -19.563 -10.926 -43.298 1.00 40.58 ? 277 ASN B CG  1 
ATOM   3857 O OD1 . ASN B 1 233 ? -19.507 -11.070 -42.071 1.00 38.68 ? 277 ASN B OD1 1 
ATOM   3858 N ND2 . ASN B 1 233 ? -20.423 -11.591 -44.066 1.00 36.00 ? 277 ASN B ND2 1 
ATOM   3859 N N   . ILE B 1 234 ? -16.886 -7.269  -43.126 1.00 40.06 ? 278 ILE B N   1 
ATOM   3860 C CA  . ILE B 1 234 ? -15.542 -6.778  -43.408 1.00 39.71 ? 278 ILE B CA  1 
ATOM   3861 C C   . ILE B 1 234 ? -14.548 -7.763  -42.752 1.00 40.19 ? 278 ILE B C   1 
ATOM   3862 O O   . ILE B 1 234 ? -14.270 -7.691  -41.569 1.00 39.28 ? 278 ILE B O   1 
ATOM   3863 C CB  . ILE B 1 234 ? -15.354 -5.322  -42.936 1.00 39.82 ? 278 ILE B CB  1 
ATOM   3864 C CG1 . ILE B 1 234 ? -16.336 -4.403  -43.687 1.00 38.86 ? 278 ILE B CG1 1 
ATOM   3865 C CG2 . ILE B 1 234 ? -13.916 -4.847  -43.186 1.00 36.64 ? 278 ILE B CG2 1 
ATOM   3866 C CD1 . ILE B 1 234 ? -16.083 -2.954  -43.417 1.00 36.05 ? 278 ILE B CD1 1 
ATOM   3867 N N   . TYR B 1 235 ? -14.037 -8.687  -43.562 1.00 41.06 ? 279 TYR B N   1 
ATOM   3868 C CA  . TYR B 1 235 ? -13.325 -9.842  -43.023 1.00 41.95 ? 279 TYR B CA  1 
ATOM   3869 C C   . TYR B 1 235 ? -11.918 -9.501  -42.494 1.00 42.06 ? 279 TYR B C   1 
ATOM   3870 O O   . TYR B 1 235 ? -11.405 -10.197 -41.611 1.00 42.65 ? 279 TYR B O   1 
ATOM   3871 C CB  . TYR B 1 235 ? -13.285 -10.963 -44.053 1.00 41.50 ? 279 TYR B CB  1 
ATOM   3872 C CG  . TYR B 1 235 ? -14.621 -11.614 -44.395 1.00 42.04 ? 279 TYR B CG  1 
ATOM   3873 C CD1 . TYR B 1 235 ? -15.257 -12.505 -43.508 1.00 41.42 ? 279 TYR B CD1 1 
ATOM   3874 C CD2 . TYR B 1 235 ? -15.223 -11.378 -45.642 1.00 42.36 ? 279 TYR B CD2 1 
ATOM   3875 C CE1 . TYR B 1 235 ? -16.468 -13.130 -43.855 1.00 43.78 ? 279 TYR B CE1 1 
ATOM   3876 C CE2 . TYR B 1 235 ? -16.436 -11.987 -46.007 1.00 42.08 ? 279 TYR B CE2 1 
ATOM   3877 C CZ  . TYR B 1 235 ? -17.053 -12.860 -45.129 1.00 44.95 ? 279 TYR B CZ  1 
ATOM   3878 O OH  . TYR B 1 235 ? -18.250 -13.447 -45.513 1.00 45.50 ? 279 TYR B OH  1 
ATOM   3879 N N   . ARG B 1 236 ? -11.321 -8.423  -43.013 1.00 42.89 ? 280 ARG B N   1 
ATOM   3880 C CA  . ARG B 1 236 ? -9.994  -7.969  -42.599 1.00 43.47 ? 280 ARG B CA  1 
ATOM   3881 C C   . ARG B 1 236 ? -9.884  -6.450  -42.551 1.00 44.22 ? 280 ARG B C   1 
ATOM   3882 O O   . ARG B 1 236 ? -9.656  -5.807  -43.571 1.00 43.95 ? 280 ARG B O   1 
ATOM   3883 N N   . PRO B 1 237 ? -10.058 -5.889  -41.353 1.00 44.70 ? 281 PRO B N   1 
ATOM   3884 C CA  . PRO B 1 237 ? -10.226 -4.439  -41.119 1.00 44.72 ? 281 PRO B CA  1 
ATOM   3885 C C   . PRO B 1 237 ? -9.044  -3.424  -41.107 1.00 44.88 ? 281 PRO B C   1 
ATOM   3886 O O   . PRO B 1 237 ? -9.341  -2.212  -41.043 1.00 44.45 ? 281 PRO B O   1 
ATOM   3887 C CB  . PRO B 1 237 ? -10.913 -4.391  -39.750 1.00 43.24 ? 281 PRO B CB  1 
ATOM   3888 C CG  . PRO B 1 237 ? -10.524 -5.595  -39.094 1.00 44.16 ? 281 PRO B CG  1 
ATOM   3889 C CD  . PRO B 1 237 ? -10.213 -6.665  -40.115 1.00 44.79 ? 281 PRO B CD  1 
ATOM   3890 N N   . ASP B 1 238 ? -7.785  -3.843  -41.124 1.00 44.93 ? 282 ASP B N   1 
ATOM   3891 C CA  . ASP B 1 238 ? -6.705  -2.854  -41.219 1.00 45.30 ? 282 ASP B CA  1 
ATOM   3892 C C   . ASP B 1 238 ? -6.331  -2.660  -42.671 1.00 45.18 ? 282 ASP B C   1 
ATOM   3893 O O   . ASP B 1 238 ? -5.926  -1.565  -43.099 1.00 44.58 ? 282 ASP B O   1 
ATOM   3894 C CB  . ASP B 1 238 ? -5.470  -3.273  -40.433 1.00 46.33 ? 282 ASP B CB  1 
ATOM   3895 C CG  . ASP B 1 238 ? -5.157  -4.762  -40.567 1.00 50.15 ? 282 ASP B CG  1 
ATOM   3896 O OD1 . ASP B 1 238 ? -5.958  -5.510  -41.207 1.00 51.49 ? 282 ASP B OD1 1 
ATOM   3897 O OD2 . ASP B 1 238 ? -4.135  -5.278  -40.025 1.00 54.59 ? 282 ASP B OD2 1 
ATOM   3898 N N   . LYS B 1 239 ? -6.445  -3.751  -43.416 1.00 44.29 ? 283 LYS B N   1 
ATOM   3899 C CA  . LYS B 1 239 ? -6.357  -3.698  -44.860 1.00 44.44 ? 283 LYS B CA  1 
ATOM   3900 C C   . LYS B 1 239 ? -7.450  -2.748  -45.365 1.00 43.32 ? 283 LYS B C   1 
ATOM   3901 O O   . LYS B 1 239 ? -7.207  -1.938  -46.267 1.00 42.91 ? 283 LYS B O   1 
ATOM   3902 C CB  . LYS B 1 239 ? -6.513  -5.114  -45.421 1.00 44.90 ? 283 LYS B CB  1 
ATOM   3903 C CG  . LYS B 1 239 ? -6.748  -5.251  -46.935 1.00 48.02 ? 283 LYS B CG  1 
ATOM   3904 C CD  . LYS B 1 239 ? -7.012  -6.740  -47.297 1.00 52.87 ? 283 LYS B CD  1 
ATOM   3905 C CE  . LYS B 1 239 ? -8.468  -7.017  -47.766 1.00 55.63 ? 283 LYS B CE  1 
ATOM   3906 N NZ  . LYS B 1 239 ? -8.579  -7.465  -49.222 1.00 56.73 ? 283 LYS B NZ  1 
ATOM   3907 N N   . PHE B 1 240 ? -8.638  -2.833  -44.756 1.00 41.78 ? 284 PHE B N   1 
ATOM   3908 C CA  . PHE B 1 240 ? -9.796  -2.018  -45.136 1.00 41.44 ? 284 PHE B CA  1 
ATOM   3909 C C   . PHE B 1 240 ? -9.450  -0.548  -45.043 1.00 40.93 ? 284 PHE B C   1 
ATOM   3910 O O   . PHE B 1 240 ? -9.610  0.195   -46.023 1.00 41.39 ? 284 PHE B O   1 
ATOM   3911 C CB  . PHE B 1 240 ? -11.007 -2.369  -44.231 1.00 41.72 ? 284 PHE B CB  1 
ATOM   3912 C CG  . PHE B 1 240 ? -12.148 -1.401  -44.320 1.00 43.08 ? 284 PHE B CG  1 
ATOM   3913 C CD1 . PHE B 1 240 ? -13.021 -1.445  -45.394 1.00 44.67 ? 284 PHE B CD1 1 
ATOM   3914 C CD2 . PHE B 1 240 ? -12.357 -0.456  -43.318 1.00 42.57 ? 284 PHE B CD2 1 
ATOM   3915 C CE1 . PHE B 1 240 ? -14.084 -0.541  -45.457 1.00 48.11 ? 284 PHE B CE1 1 
ATOM   3916 C CE2 . PHE B 1 240 ? -13.403 0.445   -43.375 1.00 43.23 ? 284 PHE B CE2 1 
ATOM   3917 C CZ  . PHE B 1 240 ? -14.272 0.408   -44.436 1.00 46.24 ? 284 PHE B CZ  1 
ATOM   3918 N N   . LEU B 1 241 ? -8.938  -0.162  -43.867 1.00 40.48 ? 285 LEU B N   1 
ATOM   3919 C CA  . LEU B 1 241 ? -8.478  1.192   -43.573 1.00 40.74 ? 285 LEU B CA  1 
ATOM   3920 C C   . LEU B 1 241 ? -7.294  1.666   -44.450 1.00 40.22 ? 285 LEU B C   1 
ATOM   3921 O O   . LEU B 1 241 ? -7.175  2.861   -44.740 1.00 39.63 ? 285 LEU B O   1 
ATOM   3922 C CB  . LEU B 1 241 ? -8.095  1.310   -42.094 1.00 40.92 ? 285 LEU B CB  1 
ATOM   3923 C CG  . LEU B 1 241 ? -8.535  2.601   -41.365 1.00 43.03 ? 285 LEU B CG  1 
ATOM   3924 C CD1 . LEU B 1 241 ? -7.474  3.671   -41.435 1.00 45.70 ? 285 LEU B CD1 1 
ATOM   3925 C CD2 . LEU B 1 241 ? -9.850  3.173   -41.880 1.00 42.69 ? 285 LEU B CD2 1 
ATOM   3926 N N   . GLN B 1 242 ? -6.425  0.724   -44.813 1.00 40.50 ? 286 GLN B N   1 
ATOM   3927 C CA  . GLN B 1 242 ? -5.335  0.959   -45.760 1.00 41.34 ? 286 GLN B CA  1 
ATOM   3928 C C   . GLN B 1 242 ? -5.948  1.336   -47.081 1.00 40.76 ? 286 GLN B C   1 
ATOM   3929 O O   . GLN B 1 242 ? -5.609  2.368   -47.644 1.00 41.51 ? 286 GLN B O   1 
ATOM   3930 C CB  . GLN B 1 242 ? -4.495  -0.301  -45.926 1.00 41.91 ? 286 GLN B CB  1 
ATOM   3931 C CG  . GLN B 1 242 ? -2.969  -0.099  -45.799 1.00 45.24 ? 286 GLN B CG  1 
ATOM   3932 C CD  . GLN B 1 242 ? -2.414  -0.560  -44.436 1.00 51.01 ? 286 GLN B CD  1 
ATOM   3933 O OE1 . GLN B 1 242 ? -1.488  0.056   -43.901 1.00 51.86 ? 286 GLN B OE1 1 
ATOM   3934 N NE2 . GLN B 1 242 ? -2.981  -1.638  -43.877 1.00 52.24 ? 286 GLN B NE2 1 
ATOM   3935 N N   . CYS B 1 243 ? -6.870  0.506   -47.563 1.00 40.91 ? 287 CYS B N   1 
ATOM   3936 C CA  . CYS B 1 243 ? -7.594  0.762   -48.811 1.00 40.88 ? 287 CYS B CA  1 
ATOM   3937 C C   . CYS B 1 243 ? -8.318  2.119   -48.853 1.00 40.98 ? 287 CYS B C   1 
ATOM   3938 O O   . CYS B 1 243 ? -8.101  2.898   -49.768 1.00 41.60 ? 287 CYS B O   1 
ATOM   3939 C CB  . CYS B 1 243 ? -8.549  -0.389  -49.167 1.00 40.44 ? 287 CYS B CB  1 
ATOM   3940 S SG  . CYS B 1 243 ? -7.745  -1.916  -49.749 1.00 44.82 ? 287 CYS B SG  1 
ATOM   3941 N N   . VAL B 1 244 ? -9.177  2.411   -47.876 1.00 41.61 ? 288 VAL B N   1 
ATOM   3942 C CA  . VAL B 1 244 ? -9.868  3.706   -47.833 1.00 41.46 ? 288 VAL B CA  1 
ATOM   3943 C C   . VAL B 1 244 ? -8.864  4.834   -47.964 1.00 42.73 ? 288 VAL B C   1 
ATOM   3944 O O   . VAL B 1 244 ? -9.034  5.731   -48.792 1.00 42.75 ? 288 VAL B O   1 
ATOM   3945 C CB  . VAL B 1 244 ? -10.663 3.901   -46.529 1.00 41.59 ? 288 VAL B CB  1 
ATOM   3946 C CG1 . VAL B 1 244 ? -11.202 5.346   -46.424 1.00 39.43 ? 288 VAL B CG1 1 
ATOM   3947 C CG2 . VAL B 1 244 ? -11.784 2.868   -46.447 1.00 40.71 ? 288 VAL B CG2 1 
ATOM   3948 N N   . LYS B 1 245 ? -7.801  4.740   -47.158 1.00 44.22 ? 289 LYS B N   1 
ATOM   3949 C CA  . LYS B 1 245 ? -6.723  5.728   -47.107 1.00 45.62 ? 289 LYS B CA  1 
ATOM   3950 C C   . LYS B 1 245 ? -5.976  5.863   -48.451 1.00 46.46 ? 289 LYS B C   1 
ATOM   3951 O O   . LYS B 1 245 ? -5.842  6.969   -48.994 1.00 47.20 ? 289 LYS B O   1 
ATOM   3952 C CB  . LYS B 1 245 ? -5.772  5.416   -45.947 1.00 45.33 ? 289 LYS B CB  1 
ATOM   3953 C CG  . LYS B 1 245 ? -4.660  6.430   -45.765 1.00 46.15 ? 289 LYS B CG  1 
ATOM   3954 C CD  . LYS B 1 245 ? -4.431  6.757   -44.316 1.00 47.31 ? 289 LYS B CD  1 
ATOM   3955 C CE  . LYS B 1 245 ? -4.078  5.505   -43.499 1.00 47.55 ? 289 LYS B CE  1 
ATOM   3956 N NZ  . LYS B 1 245 ? -5.044  5.229   -42.410 1.00 43.25 ? 289 LYS B NZ  1 
ATOM   3957 N N   . ASN B 1 246 ? -5.516  4.744   -48.996 1.00 47.17 ? 290 ASN B N   1 
ATOM   3958 C CA  . ASN B 1 246 ? -4.875  4.755   -50.302 1.00 47.99 ? 290 ASN B CA  1 
ATOM   3959 C C   . ASN B 1 246 ? -5.739  4.065   -51.347 1.00 48.23 ? 290 ASN B C   1 
ATOM   3960 O O   . ASN B 1 246 ? -5.495  2.903   -51.671 1.00 48.09 ? 290 ASN B O   1 
ATOM   3961 N N   . PRO B 1 247 ? -6.750  4.762   -51.867 1.00 49.14 ? 291 PRO B N   1 
ATOM   3962 C CA  . PRO B 1 247 ? -7.447  4.283   -53.045 1.00 51.00 ? 291 PRO B CA  1 
ATOM   3963 C C   . PRO B 1 247 ? -6.378  3.886   -54.071 1.00 52.91 ? 291 PRO B C   1 
ATOM   3964 O O   . PRO B 1 247 ? -5.301  4.510   -54.138 1.00 52.78 ? 291 PRO B O   1 
ATOM   3965 N N   . GLU B 1 248 ? -6.633  2.829   -54.839 1.00 54.06 ? 292 GLU B N   1 
ATOM   3966 C CA  . GLU B 1 248 ? -5.665  2.375   -55.824 1.00 56.01 ? 292 GLU B CA  1 
ATOM   3967 C C   . GLU B 1 248 ? -4.826  1.237   -55.282 1.00 57.34 ? 292 GLU B C   1 
ATOM   3968 O O   . GLU B 1 248 ? -3.896  1.439   -54.490 1.00 57.63 ? 292 GLU B O   1 
ATOM   3969 N N   . ASP B 1 249 ? -5.179  0.029   -55.716 1.00 58.42 ? 293 ASP B N   1 
ATOM   3970 C CA  . ASP B 1 249 ? -4.573  -1.198  -55.235 1.00 59.36 ? 293 ASP B CA  1 
ATOM   3971 C C   . ASP B 1 249 ? -4.816  -2.342  -56.200 1.00 59.93 ? 293 ASP B C   1 
ATOM   3972 O O   . ASP B 1 249 ? -5.956  -2.572  -56.628 1.00 59.88 ? 293 ASP B O   1 
ATOM   3973 N N   . SER B 1 250 ? -3.739  -3.058  -56.530 1.00 60.50 ? 294 SER B N   1 
ATOM   3974 C CA  . SER B 1 250 ? -3.773  -4.194  -57.444 1.00 60.97 ? 294 SER B CA  1 
ATOM   3975 C C   . SER B 1 250 ? -4.544  -5.377  -56.893 1.00 61.24 ? 294 SER B C   1 
ATOM   3976 O O   . SER B 1 250 ? -4.930  -6.273  -57.649 1.00 61.53 ? 294 SER B O   1 
ATOM   3977 N N   . SER B 1 251 ? -4.762  -5.374  -55.577 1.00 61.32 ? 295 SER B N   1 
ATOM   3978 C CA  . SER B 1 251 ? -5.519  -6.410  -54.910 1.00 61.23 ? 295 SER B CA  1 
ATOM   3979 C C   . SER B 1 251 ? -6.487  -5.842  -53.903 1.00 61.31 ? 295 SER B C   1 
ATOM   3980 O O   . SER B 1 251 ? -6.997  -6.582  -53.039 1.00 61.26 ? 295 SER B O   1 
ATOM   3981 N N   . CYS B 1 252 ? -6.748  -4.540  -54.012 1.00 60.88 ? 296 CYS B N   1 
ATOM   3982 C CA  . CYS B 1 252 ? -7.664  -3.863  -53.107 1.00 61.10 ? 296 CYS B CA  1 
ATOM   3983 C C   . CYS B 1 252 ? -9.068  -4.461  -53.159 1.00 61.10 ? 296 CYS B C   1 
ATOM   3984 O O   . CYS B 1 252 ? -10.048 -3.802  -52.785 1.00 61.29 ? 296 CYS B O   1 
ATOM   3985 C CB  . CYS B 1 252 ? -7.725  -2.366  -53.423 1.00 61.42 ? 296 CYS B CB  1 
ATOM   3986 S SG  . CYS B 1 252 ? -6.769  -1.351  -52.283 1.00 60.77 ? 296 CYS B SG  1 
HETATM 3987 O O   . HOH C 2 .   ? -8.924  8.319   -6.795  1.00 30.14 ? 301 HOH A O   1 
HETATM 3988 O O   . HOH C 2 .   ? -2.803  8.576   -11.885 1.00 30.95 ? 302 HOH A O   1 
HETATM 3989 O O   . HOH C 2 .   ? 15.024  -14.978 -5.326  1.00 32.09 ? 303 HOH A O   1 
HETATM 3990 O O   . HOH C 2 .   ? -10.135 8.900   -3.664  1.00 34.21 ? 304 HOH A O   1 
HETATM 3991 O O   . HOH C 2 .   ? -0.450  3.712   -0.542  1.00 36.02 ? 305 HOH A O   1 
HETATM 3992 O O   . HOH C 2 .   ? 4.510   5.402   1.843   1.00 34.10 ? 306 HOH A O   1 
HETATM 3993 O O   . HOH C 2 .   ? 14.028  -5.049  3.136   1.00 36.07 ? 307 HOH A O   1 
HETATM 3994 O O   . HOH C 2 .   ? 5.649   -13.041 -12.391 1.00 33.01 ? 308 HOH A O   1 
HETATM 3995 O O   . HOH C 2 .   ? -3.021  2.300   -1.179  1.00 30.04 ? 309 HOH A O   1 
HETATM 3996 O O   . HOH C 2 .   ? -4.959  -7.159  -8.650  1.00 33.76 ? 310 HOH A O   1 
HETATM 3997 O O   . HOH C 2 .   ? -4.064  -9.696  2.824   1.00 35.12 ? 311 HOH A O   1 
HETATM 3998 O O   . HOH C 2 .   ? 3.613   -5.689  3.549   1.00 35.89 ? 312 HOH A O   1 
HETATM 3999 O O   . HOH C 2 .   ? 15.214  -20.440 -5.407  1.00 38.69 ? 313 HOH A O   1 
HETATM 4000 O O   . HOH C 2 .   ? 12.886  -10.380 -0.505  1.00 30.03 ? 314 HOH A O   1 
HETATM 4001 O O   . HOH C 2 .   ? 13.401  -8.862  1.628   1.00 34.14 ? 315 HOH A O   1 
HETATM 4002 O O   . HOH C 2 .   ? 5.453   -7.499  2.059   1.00 36.85 ? 316 HOH A O   1 
HETATM 4003 O O   . HOH C 2 .   ? 10.031  18.804  -12.359 1.00 43.34 ? 317 HOH A O   1 
HETATM 4004 O O   . HOH C 2 .   ? -4.138  -4.439  -12.659 1.00 44.17 ? 318 HOH A O   1 
HETATM 4005 O O   . HOH C 2 .   ? -3.456  -23.076 0.404   1.00 42.47 ? 319 HOH A O   1 
HETATM 4006 O O   . HOH C 2 .   ? 13.089  -24.565 1.139   1.00 43.10 ? 320 HOH A O   1 
HETATM 4007 O O   . HOH C 2 .   ? 6.109   -23.596 3.134   1.00 42.57 ? 321 HOH A O   1 
HETATM 4008 O O   . HOH C 2 .   ? 15.222  -22.404 3.791   1.00 41.49 ? 322 HOH A O   1 
HETATM 4009 O O   . HOH C 2 .   ? 1.927   26.844  -0.572  1.00 42.49 ? 323 HOH A O   1 
HETATM 4010 O O   . HOH C 2 .   ? -10.158 13.639  -14.513 1.00 39.26 ? 324 HOH A O   1 
HETATM 4011 O O   . HOH C 2 .   ? 18.961  -16.563 -0.854  1.00 38.29 ? 325 HOH A O   1 
HETATM 4012 O O   . HOH C 2 .   ? 3.466   9.837   7.180   1.00 40.21 ? 326 HOH A O   1 
HETATM 4013 O O   . HOH C 2 .   ? 6.670   -15.959 -13.461 1.00 42.08 ? 327 HOH A O   1 
HETATM 4014 O O   . HOH C 2 .   ? -6.219  19.772  -11.376 1.00 47.76 ? 328 HOH A O   1 
HETATM 4015 O O   . HOH C 2 .   ? 0.726   -14.526 -17.082 1.00 45.86 ? 329 HOH A O   1 
HETATM 4016 O O   . HOH C 2 .   ? -0.268  -4.314  -11.121 1.00 40.09 ? 330 HOH A O   1 
HETATM 4017 O O   . HOH C 2 .   ? -0.927  -2.469  -8.976  1.00 42.75 ? 331 HOH A O   1 
HETATM 4018 O O   . HOH C 2 .   ? -1.624  1.283   -13.998 1.00 42.15 ? 332 HOH A O   1 
HETATM 4019 O O   . HOH C 2 .   ? -5.222  -11.673 4.649   1.00 46.38 ? 333 HOH A O   1 
HETATM 4020 O O   . HOH C 2 .   ? -6.291  22.578  1.923   1.00 41.69 ? 334 HOH A O   1 
HETATM 4021 O O   . HOH C 2 .   ? -8.874  -19.705 1.124   1.00 40.66 ? 335 HOH A O   1 
HETATM 4022 O O   . HOH C 2 .   ? -7.475  -14.085 3.340   1.00 48.13 ? 336 HOH A O   1 
HETATM 4023 O O   . HOH C 2 .   ? 15.896  -11.371 -12.465 1.00 48.23 ? 337 HOH A O   1 
HETATM 4024 O O   . HOH C 2 .   ? -12.480 -1.009  -0.055  1.00 46.49 ? 338 HOH A O   1 
HETATM 4025 O O   . HOH C 2 .   ? 7.144   3.079   3.294   1.00 42.45 ? 339 HOH A O   1 
HETATM 4026 O O   . HOH C 2 .   ? 20.052  -5.104  -5.279  1.00 61.76 ? 340 HOH A O   1 
HETATM 4027 O O   . HOH C 2 .   ? 26.293  -23.407 -5.023  1.00 52.12 ? 341 HOH A O   1 
HETATM 4028 O O   . HOH C 2 .   ? 11.534  9.859   -6.479  1.00 42.83 ? 342 HOH A O   1 
HETATM 4029 O O   . HOH C 2 .   ? 8.847   -14.373 -14.491 1.00 44.69 ? 343 HOH A O   1 
HETATM 4030 O O   . HOH C 2 .   ? -11.995 -19.087 -5.185  1.00 55.37 ? 344 HOH A O   1 
HETATM 4031 O O   . HOH C 2 .   ? 4.303   3.236   4.420   1.00 51.59 ? 345 HOH A O   1 
HETATM 4032 O O   . HOH C 2 .   ? -6.143  -14.048 -14.378 1.00 44.62 ? 346 HOH A O   1 
HETATM 4033 O O   . HOH C 2 .   ? 25.598  -16.462 -7.235  1.00 61.54 ? 347 HOH A O   1 
HETATM 4034 O O   . HOH C 2 .   ? 9.243   13.100  -3.767  1.00 44.01 ? 348 HOH A O   1 
HETATM 4035 O O   . HOH C 2 .   ? 12.073  -18.507 -11.786 1.00 43.31 ? 349 HOH A O   1 
HETATM 4036 O O   . HOH C 2 .   ? 1.068   -19.081 -14.391 1.00 42.00 ? 350 HOH A O   1 
HETATM 4037 O O   . HOH C 2 .   ? 5.283   10.172  3.570   1.00 43.22 ? 351 HOH A O   1 
HETATM 4038 O O   . HOH C 2 .   ? -1.860  22.480  3.286   1.00 48.08 ? 352 HOH A O   1 
HETATM 4039 O O   . HOH C 2 .   ? -5.528  -22.777 -1.066  1.00 52.58 ? 353 HOH A O   1 
HETATM 4040 O O   . HOH C 2 .   ? 9.763   -1.097  -2.838  1.00 41.57 ? 354 HOH A O   1 
HETATM 4041 O O   . HOH C 2 .   ? 4.157   0.908   6.807   1.00 55.24 ? 355 HOH A O   1 
HETATM 4042 O O   . HOH C 2 .   ? 9.167   -12.812 -16.618 1.00 64.98 ? 356 HOH A O   1 
HETATM 4043 O O   . HOH C 2 .   ? 11.421  -24.645 -0.850  1.00 42.25 ? 357 HOH A O   1 
HETATM 4044 O O   . HOH C 2 .   ? 14.758  -4.135  -10.102 1.00 49.37 ? 358 HOH A O   1 
HETATM 4045 O O   . HOH C 2 .   ? -10.905 15.272  13.789  1.00 62.18 ? 359 HOH A O   1 
HETATM 4046 O O   . HOH C 2 .   ? 8.813   1.470   -2.793  1.00 46.32 ? 360 HOH A O   1 
HETATM 4047 O O   . HOH C 2 .   ? 2.870   27.194  5.816   1.00 60.73 ? 361 HOH A O   1 
HETATM 4048 O O   . HOH C 2 .   ? 21.230  -16.840 -4.015  1.00 51.79 ? 362 HOH A O   1 
HETATM 4049 O O   . HOH C 2 .   ? 13.288  -2.298  -5.363  1.00 41.20 ? 363 HOH A O   1 
HETATM 4050 O O   . HOH C 2 .   ? 7.173   16.708  9.092   1.00 51.47 ? 364 HOH A O   1 
HETATM 4051 O O   . HOH C 2 .   ? 5.477   19.740  -16.637 1.00 55.18 ? 365 HOH A O   1 
HETATM 4052 O O   . HOH C 2 .   ? -4.915  -7.106  2.585   1.00 47.53 ? 366 HOH A O   1 
HETATM 4053 O O   . HOH C 2 .   ? 15.460  -28.109 -9.605  1.00 46.69 ? 367 HOH A O   1 
HETATM 4054 O O   . HOH C 2 .   ? 2.266   -2.446  1.036   1.00 47.04 ? 368 HOH A O   1 
HETATM 4055 O O   . HOH C 2 .   ? -7.010  -10.712 -14.316 1.00 47.97 ? 369 HOH A O   1 
HETATM 4056 O O   . HOH C 2 .   ? -12.332 3.508   -13.307 1.00 50.35 ? 370 HOH A O   1 
HETATM 4057 O O   . HOH C 2 .   ? -9.627  -8.187  -14.638 1.00 52.45 ? 371 HOH A O   1 
HETATM 4058 O O   . HOH C 2 .   ? -3.356  -15.049 5.696   1.00 51.79 ? 372 HOH A O   1 
HETATM 4059 O O   . HOH C 2 .   ? -8.386  20.615  8.774   1.00 57.43 ? 373 HOH A O   1 
HETATM 4060 O O   . HOH C 2 .   ? -16.094 5.178   -10.728 1.00 44.15 ? 374 HOH A O   1 
HETATM 4061 O O   . HOH C 2 .   ? -2.821  10.031  -18.507 1.00 77.73 ? 375 HOH A O   1 
HETATM 4062 O O   . HOH C 2 .   ? -3.027  -1.261  -10.334 1.00 50.35 ? 376 HOH A O   1 
HETATM 4063 O O   . HOH C 2 .   ? 13.226  -15.016 9.924   1.00 51.95 ? 377 HOH A O   1 
HETATM 4064 O O   . HOH C 2 .   ? -8.945  -6.286  1.640   1.00 59.73 ? 378 HOH A O   1 
HETATM 4065 O O   . HOH C 2 .   ? -10.068 20.698  -12.462 1.00 49.82 ? 379 HOH A O   1 
HETATM 4066 O O   . HOH C 2 .   ? 17.883  -3.397  -11.737 1.00 59.60 ? 380 HOH A O   1 
HETATM 4067 O O   . HOH C 2 .   ? 9.391   -1.394  -10.711 1.00 51.16 ? 381 HOH A O   1 
HETATM 4068 O O   . HOH C 2 .   ? 5.110   16.071  12.607  1.00 59.96 ? 382 HOH A O   1 
HETATM 4069 O O   . HOH C 2 .   ? -12.997 -1.322  10.110  1.00 46.77 ? 383 HOH A O   1 
HETATM 4070 O O   . HOH C 2 .   ? 5.670   -1.729  2.843   1.00 62.13 ? 384 HOH A O   1 
HETATM 4071 O O   . HOH C 2 .   ? -3.122  19.509  -16.061 1.00 62.32 ? 385 HOH A O   1 
HETATM 4072 O O   . HOH C 2 .   ? 0.603   0.700   -0.034  1.00 53.85 ? 386 HOH A O   1 
HETATM 4073 O O   . HOH C 2 .   ? 12.553  -6.165  1.392   1.00 42.32 ? 387 HOH A O   1 
HETATM 4074 O O   . HOH C 2 .   ? -11.154 -20.165 -12.376 1.00 57.89 ? 388 HOH A O   1 
HETATM 4075 O O   . HOH C 2 .   ? 14.341  4.684   -3.932  1.00 55.23 ? 389 HOH A O   1 
HETATM 4076 O O   . HOH C 2 .   ? -21.569 12.376  16.388  1.00 61.73 ? 390 HOH A O   1 
HETATM 4077 O O   . HOH C 2 .   ? 13.077  -9.776  4.498   1.00 59.45 ? 391 HOH A O   1 
HETATM 4078 O O   . HOH C 2 .   ? 6.364   -21.112 -11.575 1.00 49.22 ? 392 HOH A O   1 
HETATM 4079 O O   . HOH C 2 .   ? -11.461 -5.314  -12.511 1.00 52.82 ? 393 HOH A O   1 
HETATM 4080 O O   . HOH C 2 .   ? 21.476  -0.681  8.093   1.00 75.83 ? 394 HOH A O   1 
HETATM 4081 O O   . HOH C 2 .   ? -1.682  -5.864  -12.731 1.00 42.11 ? 395 HOH A O   1 
HETATM 4082 O O   . HOH C 2 .   ? 8.766   5.441   -10.629 1.00 60.98 ? 396 HOH A O   1 
HETATM 4083 O O   . HOH C 2 .   ? 4.297   21.422  11.797  1.00 56.54 ? 397 HOH A O   1 
HETATM 4084 O O   . HOH C 2 .   ? 5.900   23.105  -8.600  1.00 58.22 ? 398 HOH A O   1 
HETATM 4085 O O   . HOH C 2 .   ? 13.680  -23.501 -10.930 1.00 46.92 ? 399 HOH A O   1 
HETATM 4086 O O   . HOH C 2 .   ? -8.970  21.031  -5.286  1.00 47.86 ? 400 HOH A O   1 
HETATM 4087 O O   . HOH C 2 .   ? 10.331  -6.217  3.686   1.00 47.45 ? 401 HOH A O   1 
HETATM 4088 O O   . HOH C 2 .   ? 16.456  -23.328 1.815   1.00 55.77 ? 402 HOH A O   1 
HETATM 4089 O O   . HOH C 2 .   ? -12.966 4.225   16.543  1.00 59.02 ? 403 HOH A O   1 
HETATM 4090 O O   . HOH C 2 .   ? -12.651 14.601  0.116   1.00 44.71 ? 404 HOH A O   1 
HETATM 4091 O O   . HOH C 2 .   ? 7.713   -6.264  3.602   1.00 51.19 ? 405 HOH A O   1 
HETATM 4092 O O   . HOH C 2 .   ? 20.292  -17.356 5.617   1.00 53.86 ? 406 HOH A O   1 
HETATM 4093 O O   . HOH C 2 .   ? 6.888   21.446  15.860  1.00 66.23 ? 407 HOH A O   1 
HETATM 4094 O O   . HOH C 2 .   ? 13.203  -24.954 5.242   1.00 59.53 ? 408 HOH A O   1 
HETATM 4095 O O   . HOH C 2 .   ? -7.537  22.714  -3.923  1.00 49.01 ? 409 HOH A O   1 
HETATM 4096 O O   . HOH C 2 .   ? -18.690 -9.720  -12.245 1.00 74.23 ? 410 HOH A O   1 
HETATM 4097 O O   . HOH C 2 .   ? -9.588  10.126  19.240  1.00 72.34 ? 411 HOH A O   1 
HETATM 4098 O O   . HOH C 2 .   ? 6.176   9.742   7.096   1.00 62.98 ? 412 HOH A O   1 
HETATM 4099 O O   . HOH C 2 .   ? -3.805  23.584  -5.070  1.00 47.29 ? 413 HOH A O   1 
HETATM 4100 O O   . HOH C 2 .   ? 23.530  -17.187 -4.877  1.00 64.71 ? 414 HOH A O   1 
HETATM 4101 O O   . HOH C 2 .   ? 17.760  -23.394 -9.867  1.00 53.61 ? 415 HOH A O   1 
HETATM 4102 O O   . HOH C 2 .   ? 10.791  15.217  -3.004  1.00 48.90 ? 416 HOH A O   1 
HETATM 4103 O O   . HOH C 2 .   ? 14.792  -17.191 10.052  1.00 59.50 ? 417 HOH A O   1 
HETATM 4104 O O   . HOH C 2 .   ? 23.572  -22.570 15.868  1.00 75.21 ? 418 HOH A O   1 
HETATM 4105 O O   . HOH C 2 .   ? 6.813   -12.807 7.567   1.00 53.51 ? 419 HOH A O   1 
HETATM 4106 O O   . HOH C 2 .   ? -3.047  -9.070  5.006   1.00 55.48 ? 420 HOH A O   1 
HETATM 4107 O O   . HOH C 2 .   ? 23.159  -24.898 14.374  1.00 63.10 ? 421 HOH A O   1 
HETATM 4108 O O   . HOH C 2 .   ? -12.024 -18.879 -10.766 1.00 56.84 ? 422 HOH A O   1 
HETATM 4109 O O   . HOH C 2 .   ? 0.908   -21.694 -14.821 1.00 60.42 ? 423 HOH A O   1 
HETATM 4110 O O   . HOH C 2 .   ? 14.848  -1.209  3.943   1.00 74.62 ? 424 HOH A O   1 
HETATM 4111 O O   . HOH C 2 .   ? 19.503  -12.394 9.694   1.00 68.88 ? 425 HOH A O   1 
HETATM 4112 O O   . HOH C 2 .   ? -0.712  16.102  19.562  1.00 73.36 ? 426 HOH A O   1 
HETATM 4113 O O   . HOH C 2 .   ? 10.222  21.704  -0.483  1.00 63.30 ? 427 HOH A O   1 
HETATM 4114 O O   . HOH C 2 .   ? 2.376   -17.271 5.568   1.00 55.18 ? 428 HOH A O   1 
HETATM 4115 O O   . HOH C 2 .   ? -2.472  -4.372  -7.664  1.00 42.50 ? 429 HOH A O   1 
HETATM 4116 O O   . HOH C 2 .   ? 1.919   1.858   9.455   1.00 63.73 ? 430 HOH A O   1 
HETATM 4117 O O   . HOH C 2 .   ? 0.986   -27.293 -0.216  1.00 54.06 ? 431 HOH A O   1 
HETATM 4118 O O   . HOH C 2 .   ? -17.679 -8.531  -2.815  1.00 57.98 ? 432 HOH A O   1 
HETATM 4119 O O   . HOH C 2 .   ? 2.394   -26.277 6.776   1.00 63.32 ? 433 HOH A O   1 
HETATM 4120 O O   . HOH C 2 .   ? 2.618   4.540   0.359   1.00 49.17 ? 434 HOH A O   1 
HETATM 4121 O O   . HOH C 2 .   ? 3.890   -0.461  -0.924  1.00 56.38 ? 435 HOH A O   1 
HETATM 4122 O O   . HOH C 2 .   ? -17.646 3.125   -2.809  1.00 55.67 ? 436 HOH A O   1 
HETATM 4123 O O   . HOH C 2 .   ? 4.338   -11.712 -19.035 1.00 61.57 ? 437 HOH A O   1 
HETATM 4124 O O   . HOH C 2 .   ? 1.049   21.557  -15.556 1.00 80.55 ? 438 HOH A O   1 
HETATM 4125 O O   . HOH C 2 .   ? 6.144   7.272   14.569  1.00 71.96 ? 439 HOH A O   1 
HETATM 4126 O O   . HOH C 2 .   ? 0.268   13.886  16.127  1.00 56.97 ? 440 HOH A O   1 
HETATM 4127 O O   . HOH C 2 .   ? -15.882 -4.484  4.092   1.00 63.86 ? 441 HOH A O   1 
HETATM 4128 O O   . HOH C 2 .   ? 6.126   -0.466  0.240   1.00 44.71 ? 442 HOH A O   1 
HETATM 4129 O O   . HOH C 2 .   ? 14.514  1.020   5.202   1.00 70.84 ? 443 HOH A O   1 
HETATM 4130 O O   . HOH C 2 .   ? 9.919   20.291  4.100   1.00 65.14 ? 444 HOH A O   1 
HETATM 4131 O O   . HOH C 2 .   ? 2.382   1.192   -1.573  1.00 46.27 ? 445 HOH A O   1 
HETATM 4132 O O   . HOH C 2 .   ? -2.161  -25.391 -0.428  1.00 59.71 ? 446 HOH A O   1 
HETATM 4133 O O   . HOH C 2 .   ? 10.568  -24.405 -4.892  1.00 65.80 ? 447 HOH A O   1 
HETATM 4134 O O   . HOH C 2 .   ? -9.142  21.582  6.559   1.00 59.89 ? 448 HOH A O   1 
HETATM 4135 O O   . HOH C 2 .   ? 17.709  -6.167  -11.018 1.00 46.57 ? 449 HOH A O   1 
HETATM 4136 O O   . HOH C 2 .   ? -2.510  11.634  -21.824 1.00 71.52 ? 450 HOH A O   1 
HETATM 4137 O O   . HOH C 2 .   ? 8.683   1.502   -10.697 1.00 65.70 ? 451 HOH A O   1 
HETATM 4138 O O   . HOH C 2 .   ? 2.666   2.045   2.031   1.00 60.38 ? 452 HOH A O   1 
HETATM 4139 O O   . HOH C 2 .   ? -4.232  -25.330 -6.759  1.00 59.08 ? 453 HOH A O   1 
HETATM 4140 O O   . HOH C 2 .   ? 3.324   17.749  -15.625 1.00 45.83 ? 454 HOH A O   1 
HETATM 4141 O O   . HOH C 2 .   ? -8.771  -21.039 -8.276  1.00 60.36 ? 455 HOH A O   1 
HETATM 4142 O O   . HOH C 2 .   ? 11.082  -2.510  1.198   1.00 60.10 ? 456 HOH A O   1 
HETATM 4143 O O   . HOH C 2 .   ? -11.335 -3.377  10.485  1.00 71.53 ? 457 HOH A O   1 
HETATM 4144 O O   . HOH C 2 .   ? -0.878  21.757  -5.902  1.00 49.11 ? 458 HOH A O   1 
HETATM 4145 O O   . HOH C 2 .   ? 6.580   -12.675 -18.872 1.00 66.17 ? 459 HOH A O   1 
HETATM 4146 O O   . HOH C 2 .   ? 1.580   10.750  -17.460 1.00 61.98 ? 460 HOH A O   1 
HETATM 4147 O O   . HOH C 2 .   ? -12.287 -0.622  12.937  1.00 67.45 ? 461 HOH A O   1 
HETATM 4148 O O   . HOH C 2 .   ? -7.674  4.384   -14.753 1.00 61.02 ? 462 HOH A O   1 
HETATM 4149 O O   . HOH C 2 .   ? -10.507 -10.978 3.399   1.00 56.24 ? 463 HOH A O   1 
HETATM 4150 O O   . HOH C 2 .   ? -2.742  -6.127  7.174   1.00 58.90 ? 464 HOH A O   1 
HETATM 4151 O O   . HOH C 2 .   ? -6.050  -27.696 -4.674  1.00 69.24 ? 465 HOH A O   1 
HETATM 4152 O O   . HOH C 2 .   ? 1.757   17.593  -17.431 1.00 45.17 ? 466 HOH A O   1 
HETATM 4153 O O   . HOH C 2 .   ? -8.587  -3.691  9.199   1.00 60.94 ? 467 HOH A O   1 
HETATM 4154 O O   . HOH C 2 .   ? 11.675  15.436  -0.708  1.00 71.16 ? 468 HOH A O   1 
HETATM 4155 O O   . HOH C 2 .   ? 13.685  -6.079  -20.055 1.00 70.24 ? 469 HOH A O   1 
HETATM 4156 O O   . HOH C 2 .   ? 24.700  -19.103 -4.637  1.00 63.37 ? 470 HOH A O   1 
HETATM 4157 O O   . HOH C 2 .   ? 1.805   -3.731  2.831   1.00 58.09 ? 471 HOH A O   1 
HETATM 4158 O O   . HOH C 2 .   ? 12.127  10.666  -3.806  1.00 61.29 ? 472 HOH A O   1 
HETATM 4159 O O   . HOH C 2 .   ? -1.481  -23.902 10.377  1.00 75.27 ? 473 HOH A O   1 
HETATM 4160 O O   . HOH C 2 .   ? 5.524   -24.269 -4.424  1.00 57.35 ? 474 HOH A O   1 
HETATM 4161 O O   . HOH C 2 .   ? 13.506  1.059   2.419   1.00 98.65 ? 475 HOH A O   1 
HETATM 4162 O O   . HOH C 2 .   ? 1.888   -27.695 3.895   1.00 56.32 ? 476 HOH A O   1 
HETATM 4163 O O   . HOH C 2 .   ? 11.886  2.399   1.156   1.00 67.78 ? 477 HOH A O   1 
HETATM 4164 O O   . HOH C 2 .   ? -15.751 -6.437  5.202   1.00 50.86 ? 478 HOH A O   1 
HETATM 4165 O O   . HOH C 2 .   ? 1.486   8.325   17.697  1.00 65.38 ? 479 HOH A O   1 
HETATM 4166 O O   . HOH C 2 .   ? -13.636 0.373   -12.342 1.00 63.29 ? 480 HOH A O   1 
HETATM 4167 O O   . HOH C 2 .   ? 12.308  7.736   -7.303  1.00 55.26 ? 481 HOH A O   1 
HETATM 4168 O O   . HOH C 2 .   ? -1.629  -9.358  7.192   1.00 67.42 ? 482 HOH A O   1 
HETATM 4169 O O   . HOH C 2 .   ? -5.540  2.646   -8.824  1.00 40.64 ? 483 HOH A O   1 
HETATM 4170 O O   . HOH C 2 .   ? 4.578   16.798  -9.667  1.00 72.03 ? 484 HOH A O   1 
HETATM 4171 O O   . HOH C 2 .   ? -13.963 15.278  6.215   1.00 62.49 ? 485 HOH A O   1 
HETATM 4172 O O   . HOH C 2 .   ? 0.277   2.669   -4.720  1.00 56.15 ? 486 HOH A O   1 
HETATM 4173 O O   . HOH C 2 .   ? -0.375  25.377  13.923  1.00 60.18 ? 487 HOH A O   1 
HETATM 4174 O O   . HOH C 2 .   ? -8.538  2.641   -12.567 1.00 80.75 ? 488 HOH A O   1 
HETATM 4175 O O   . HOH C 2 .   ? 0.662   1.521   -15.381 1.00 54.87 ? 489 HOH A O   1 
HETATM 4176 O O   . HOH C 2 .   ? -10.365 9.219   -16.246 1.00 48.92 ? 490 HOH A O   1 
HETATM 4177 O O   . HOH C 2 .   ? 7.084   22.749  -15.073 1.00 90.83 ? 491 HOH A O   1 
HETATM 4178 O O   . HOH C 2 .   ? -10.062 -22.026 -11.486 1.00 54.76 ? 492 HOH A O   1 
HETATM 4179 O O   . HOH C 2 .   ? 3.122   3.404   -1.110  1.00 79.60 ? 493 HOH A O   1 
HETATM 4180 O O   . HOH C 2 .   ? -10.673 21.400  -1.979  1.00 65.55 ? 494 HOH A O   1 
HETATM 4181 O O   . HOH D 2 .   ? -34.460 18.421  -9.035  1.00 33.90 ? 301 HOH B O   1 
HETATM 4182 O O   . HOH D 2 .   ? -25.964 18.287  -12.303 1.00 27.89 ? 302 HOH B O   1 
HETATM 4183 O O   . HOH D 2 .   ? -23.225 12.796  -15.615 1.00 30.18 ? 303 HOH B O   1 
HETATM 4184 O O   . HOH D 2 .   ? -17.910 10.035  -24.937 1.00 40.02 ? 304 HOH B O   1 
HETATM 4185 O O   . HOH D 2 .   ? -22.903 6.088   -16.548 1.00 36.82 ? 305 HOH B O   1 
HETATM 4186 O O   . HOH D 2 .   ? -12.604 11.422  -6.916  1.00 32.52 ? 306 HOH B O   1 
HETATM 4187 O O   . HOH D 2 .   ? -28.614 -3.510  -12.792 1.00 34.43 ? 307 HOH B O   1 
HETATM 4188 O O   . HOH D 2 .   ? -32.604 19.951  -10.326 1.00 39.31 ? 308 HOH B O   1 
HETATM 4189 O O   . HOH D 2 .   ? -11.776 15.112  -11.465 1.00 41.60 ? 309 HOH B O   1 
HETATM 4190 O O   . HOH D 2 .   ? -30.816 24.063  -7.651  1.00 44.51 ? 310 HOH B O   1 
HETATM 4191 O O   . HOH D 2 .   ? -23.293 15.791  -7.327  1.00 40.78 ? 311 HOH B O   1 
HETATM 4192 O O   . HOH D 2 .   ? -23.201 8.678   -17.614 1.00 42.71 ? 312 HOH B O   1 
HETATM 4193 O O   . HOH D 2 .   ? -14.954 24.410  -11.692 1.00 43.00 ? 313 HOH B O   1 
HETATM 4194 O O   . HOH D 2 .   ? -19.716 9.290   -14.646 1.00 44.26 ? 314 HOH B O   1 
HETATM 4195 O O   . HOH D 2 .   ? -22.171 10.193  -15.375 1.00 34.32 ? 315 HOH B O   1 
HETATM 4196 O O   . HOH D 2 .   ? -36.607 15.851  -14.334 1.00 45.40 ? 316 HOH B O   1 
HETATM 4197 O O   . HOH D 2 .   ? -10.840 14.579  -44.551 1.00 68.80 ? 317 HOH B O   1 
HETATM 4198 O O   . HOH D 2 .   ? -32.663 5.272   -13.220 1.00 43.56 ? 318 HOH B O   1 
HETATM 4199 O O   . HOH D 2 .   ? -23.649 22.452  -9.593  1.00 37.97 ? 319 HOH B O   1 
HETATM 4200 O O   . HOH D 2 .   ? -27.374 6.561   -5.779  1.00 42.39 ? 320 HOH B O   1 
HETATM 4201 O O   . HOH D 2 .   ? -13.013 11.827  -17.202 1.00 42.52 ? 321 HOH B O   1 
HETATM 4202 O O   . HOH D 2 .   ? -2.771  -1.132  -52.868 1.00 63.33 ? 322 HOH B O   1 
HETATM 4203 O O   . HOH D 2 .   ? -8.100  28.303  -33.685 1.00 60.66 ? 323 HOH B O   1 
HETATM 4204 O O   . HOH D 2 .   ? -13.362 11.669  -14.653 1.00 36.29 ? 324 HOH B O   1 
HETATM 4205 O O   . HOH D 2 .   ? -18.881 13.166  -4.917  1.00 48.52 ? 325 HOH B O   1 
HETATM 4206 O O   . HOH D 2 .   ? -28.312 26.240  -20.825 1.00 52.05 ? 326 HOH B O   1 
HETATM 4207 O O   . HOH D 2 .   ? -22.363 30.505  -9.967  1.00 51.46 ? 327 HOH B O   1 
HETATM 4208 O O   . HOH D 2 .   ? -22.079 8.200   -35.462 1.00 46.51 ? 328 HOH B O   1 
HETATM 4209 O O   . HOH D 2 .   ? -28.428 23.643  -22.868 1.00 49.86 ? 329 HOH B O   1 
HETATM 4210 O O   . HOH D 2 .   ? -24.280 2.456   -29.830 1.00 51.90 ? 330 HOH B O   1 
HETATM 4211 O O   . HOH D 2 .   ? -15.473 18.309  -6.670  1.00 39.50 ? 331 HOH B O   1 
HETATM 4212 O O   . HOH D 2 .   ? -23.296 20.386  -33.854 1.00 52.53 ? 332 HOH B O   1 
HETATM 4213 O O   . HOH D 2 .   ? -35.576 -4.507  -45.252 1.00 57.18 ? 333 HOH B O   1 
HETATM 4214 O O   . HOH D 2 .   ? -12.298 18.639  -6.636  1.00 45.97 ? 334 HOH B O   1 
HETATM 4215 O O   . HOH D 2 .   ? -25.968 28.447  -10.765 1.00 46.45 ? 335 HOH B O   1 
HETATM 4216 O O   . HOH D 2 .   ? -21.356 -3.928  -32.166 1.00 55.77 ? 336 HOH B O   1 
HETATM 4217 O O   . HOH D 2 .   ? -33.833 9.574   -40.868 1.00 52.21 ? 337 HOH B O   1 
HETATM 4218 O O   . HOH D 2 .   ? -35.527 14.274  -21.441 1.00 44.24 ? 338 HOH B O   1 
HETATM 4219 O O   . HOH D 2 .   ? -19.086 11.248  -22.910 1.00 44.42 ? 339 HOH B O   1 
HETATM 4220 O O   . HOH D 2 .   ? -24.247 28.709  -33.685 1.00 63.42 ? 340 HOH B O   1 
HETATM 4221 O O   . HOH D 2 .   ? -26.640 1.264   -6.069  1.00 48.68 ? 341 HOH B O   1 
HETATM 4222 O O   . HOH D 2 .   ? -7.520  7.771   -39.873 1.00 57.31 ? 342 HOH B O   1 
HETATM 4223 O O   . HOH D 2 .   ? -12.957 21.135  -7.042  1.00 57.09 ? 343 HOH B O   1 
HETATM 4224 O O   . HOH D 2 .   ? -14.372 11.863  -0.375  1.00 56.58 ? 344 HOH B O   1 
HETATM 4225 O O   . HOH D 2 .   ? -28.006 25.739  -14.647 1.00 48.26 ? 345 HOH B O   1 
HETATM 4226 O O   . HOH D 2 .   ? -26.696 8.800   -44.542 1.00 54.12 ? 346 HOH B O   1 
HETATM 4227 O O   . HOH D 2 .   ? -30.607 9.081   -20.180 1.00 51.13 ? 347 HOH B O   1 
HETATM 4228 O O   . HOH D 2 .   ? -7.900  26.244  -27.728 1.00 56.27 ? 348 HOH B O   1 
HETATM 4229 O O   . HOH D 2 .   ? -37.385 17.759  -21.628 1.00 52.29 ? 349 HOH B O   1 
HETATM 4230 O O   . HOH D 2 .   ? -43.132 5.861   -41.236 1.00 68.23 ? 350 HOH B O   1 
HETATM 4231 O O   . HOH D 2 .   ? -14.384 27.895  -20.381 1.00 59.62 ? 351 HOH B O   1 
HETATM 4232 O O   . HOH D 2 .   ? -34.071 4.199   -53.501 1.00 49.70 ? 352 HOH B O   1 
HETATM 4233 O O   . HOH D 2 .   ? -3.121  -1.777  -58.755 1.00 64.16 ? 353 HOH B O   1 
HETATM 4234 O O   . HOH D 2 .   ? -29.396 13.309  -3.908  1.00 49.14 ? 354 HOH B O   1 
HETATM 4235 O O   . HOH D 2 .   ? -23.438 2.264   -26.215 1.00 52.45 ? 355 HOH B O   1 
HETATM 4236 O O   . HOH D 2 .   ? -23.774 4.999   -5.519  1.00 47.08 ? 356 HOH B O   1 
HETATM 4237 O O   . HOH D 2 .   ? -16.724 24.386  -9.571  1.00 46.42 ? 357 HOH B O   1 
HETATM 4238 O O   . HOH D 2 .   ? -29.428 17.158  -3.392  1.00 57.01 ? 358 HOH B O   1 
HETATM 4239 O O   . HOH D 2 .   ? -11.790 -0.799  -34.928 1.00 66.53 ? 359 HOH B O   1 
HETATM 4240 O O   . HOH D 2 .   ? -18.000 2.448   -8.116  1.00 54.95 ? 360 HOH B O   1 
HETATM 4241 O O   . HOH D 2 .   ? -20.969 2.210   -28.746 1.00 61.29 ? 361 HOH B O   1 
HETATM 4242 O O   . HOH D 2 .   ? -30.498 25.063  -19.425 1.00 51.60 ? 362 HOH B O   1 
HETATM 4243 O O   . HOH D 2 .   ? -15.922 21.777  -7.055  1.00 52.47 ? 363 HOH B O   1 
HETATM 4244 O O   . HOH D 2 .   ? -20.545 6.542   -15.213 1.00 53.89 ? 364 HOH B O   1 
HETATM 4245 O O   . HOH D 2 .   ? -13.261 11.726  -37.017 1.00 55.66 ? 365 HOH B O   1 
HETATM 4246 O O   . HOH D 2 .   ? -24.530 6.190   -20.620 1.00 53.46 ? 366 HOH B O   1 
HETATM 4247 O O   . HOH D 2 .   ? -11.895 31.353  -37.491 1.00 54.57 ? 367 HOH B O   1 
HETATM 4248 O O   . HOH D 2 .   ? -3.093  4.155   -55.717 1.00 54.14 ? 368 HOH B O   1 
HETATM 4249 O O   . HOH D 2 .   ? -20.433 -6.477  -51.836 1.00 63.85 ? 369 HOH B O   1 
HETATM 4250 O O   . HOH D 2 .   ? -25.916 10.735  -3.533  1.00 53.69 ? 370 HOH B O   1 
HETATM 4251 O O   . HOH D 2 .   ? -23.680 5.740   -33.627 1.00 60.79 ? 371 HOH B O   1 
HETATM 4252 O O   . HOH D 2 .   ? -28.652 16.881  -46.220 1.00 60.43 ? 372 HOH B O   1 
HETATM 4253 O O   . HOH D 2 .   ? -22.061 7.893   -31.057 1.00 47.50 ? 373 HOH B O   1 
HETATM 4254 O O   . HOH D 2 .   ? -24.723 26.713  -35.008 1.00 59.65 ? 374 HOH B O   1 
HETATM 4255 O O   . HOH D 2 .   ? -27.191 15.592  -33.187 1.00 53.35 ? 375 HOH B O   1 
HETATM 4256 O O   . HOH D 2 .   ? -27.164 7.620   -22.977 1.00 46.60 ? 376 HOH B O   1 
HETATM 4257 O O   . HOH D 2 .   ? -20.185 -9.362  -46.827 1.00 59.59 ? 377 HOH B O   1 
HETATM 4258 O O   . HOH D 2 .   ? -11.342 17.968  -19.546 1.00 56.73 ? 378 HOH B O   1 
HETATM 4259 O O   . HOH D 2 .   ? -7.629  30.242  -31.756 1.00 67.36 ? 379 HOH B O   1 
HETATM 4260 O O   . HOH D 2 .   ? -32.758 9.279   -13.083 1.00 66.81 ? 380 HOH B O   1 
HETATM 4261 O O   . HOH D 2 .   ? -13.086 15.583  -29.275 1.00 54.44 ? 381 HOH B O   1 
HETATM 4262 O O   . HOH D 2 .   ? -30.393 19.137  -2.033  1.00 73.93 ? 382 HOH B O   1 
HETATM 4263 O O   . HOH D 2 .   ? -24.467 5.008   -30.456 1.00 62.76 ? 383 HOH B O   1 
HETATM 4264 O O   . HOH D 2 .   ? -37.378 8.059   -52.902 1.00 62.62 ? 384 HOH B O   1 
HETATM 4265 O O   . HOH D 2 .   ? -22.001 30.297  -40.987 1.00 52.94 ? 385 HOH B O   1 
HETATM 4266 O O   . HOH D 2 .   ? -33.404 15.903  -36.194 1.00 64.27 ? 386 HOH B O   1 
HETATM 4267 O O   . HOH D 2 .   ? -24.220 7.967   -29.938 1.00 58.78 ? 387 HOH B O   1 
HETATM 4268 O O   . HOH D 2 .   ? -14.723 -11.690 -26.869 1.00 63.68 ? 388 HOH B O   1 
HETATM 4269 O O   . HOH D 2 .   ? -5.148  22.875  -31.031 1.00 71.37 ? 389 HOH B O   1 
HETATM 4270 O O   . HOH D 2 .   ? -36.020 14.977  -45.823 1.00 85.39 ? 390 HOH B O   1 
HETATM 4271 O O   . HOH D 2 .   ? -24.418 6.690   -25.827 1.00 63.78 ? 391 HOH B O   1 
HETATM 4272 O O   . HOH D 2 .   ? -37.476 13.477  -16.673 1.00 61.78 ? 392 HOH B O   1 
HETATM 4273 O O   . HOH D 2 .   ? -14.190 -6.142  -34.389 1.00 59.95 ? 393 HOH B O   1 
HETATM 4274 O O   . HOH D 2 .   ? -29.862 -16.760 -41.419 1.00 70.97 ? 394 HOH B O   1 
HETATM 4275 O O   . HOH D 2 .   ? -27.717 16.570  -48.776 1.00 57.08 ? 395 HOH B O   1 
HETATM 4276 O O   . HOH D 2 .   ? -38.761 7.236   -32.412 1.00 65.44 ? 396 HOH B O   1 
HETATM 4277 O O   . HOH D 2 .   ? -19.991 26.429  -12.052 1.00 62.31 ? 397 HOH B O   1 
HETATM 4278 O O   . HOH D 2 .   ? -12.616 14.934  -46.987 1.00 87.64 ? 398 HOH B O   1 
HETATM 4279 O O   . HOH D 2 .   ? -21.458 5.637   -25.622 1.00 58.90 ? 399 HOH B O   1 
HETATM 4280 O O   . HOH D 2 .   ? -36.775 8.388   -17.158 1.00 67.02 ? 400 HOH B O   1 
HETATM 4281 O O   . HOH D 2 .   ? -33.499 12.480  -25.047 1.00 65.38 ? 401 HOH B O   1 
HETATM 4282 O O   . HOH D 2 .   ? -22.833 8.494   -27.550 1.00 67.50 ? 402 HOH B O   1 
HETATM 4283 O O   . HOH D 2 .   ? -13.700 -12.110 -32.445 1.00 68.13 ? 403 HOH B O   1 
HETATM 4284 O O   . HOH D 2 .   ? -6.369  20.080  -20.037 1.00 55.44 ? 404 HOH B O   1 
HETATM 4285 O O   . HOH D 2 .   ? -27.533 17.275  -6.093  1.00 52.22 ? 405 HOH B O   1 
HETATM 4286 O O   . HOH D 2 .   ? -6.485  18.082  -22.962 1.00 61.32 ? 406 HOH B O   1 
HETATM 4287 O O   . HOH D 2 .   ? -25.654 16.008  -5.454  1.00 52.00 ? 407 HOH B O   1 
HETATM 4288 O O   . HOH D 2 .   ? -6.931  21.908  -23.563 1.00 70.64 ? 408 HOH B O   1 
HETATM 4289 O O   . HOH D 2 .   ? -3.677  22.099  -17.279 1.00 64.69 ? 409 HOH B O   1 
HETATM 4290 O O   . HOH D 2 .   ? -13.704 14.471  -31.188 1.00 70.33 ? 410 HOH B O   1 
HETATM 4291 O O   . HOH D 2 .   ? -14.763 17.178  -3.283  1.00 63.81 ? 411 HOH B O   1 
HETATM 4292 O O   . HOH D 2 .   ? -9.371  18.064  -25.774 1.00 50.29 ? 412 HOH B O   1 
HETATM 4293 O O   . HOH D 2 .   ? -33.205 9.902   -20.821 1.00 53.81 ? 413 HOH B O   1 
HETATM 4294 O O   . HOH D 2 .   ? -9.028  20.370  -28.511 1.00 52.35 ? 414 HOH B O   1 
HETATM 4295 O O   . HOH D 2 .   ? -20.963 13.604  -43.805 1.00 74.04 ? 415 HOH B O   1 
HETATM 4296 O O   . HOH D 2 .   ? -24.951 15.352  -2.238  1.00 60.58 ? 416 HOH B O   1 
HETATM 4297 O O   . HOH D 2 .   ? -21.403 -7.767  -26.694 1.00 83.28 ? 417 HOH B O   1 
HETATM 4298 O O   . HOH D 2 .   ? -19.853 15.526  3.717   1.00 67.96 ? 418 HOH B O   1 
HETATM 4299 O O   . HOH D 2 .   ? -15.541 -15.176 -37.349 1.00 59.98 ? 419 HOH B O   1 
HETATM 4300 O O   . HOH D 2 .   ? -2.307  25.353  -18.016 1.00 66.00 ? 420 HOH B O   1 
HETATM 4301 O O   . HOH D 2 .   ? -5.749  -6.313  -50.163 1.00 80.00 ? 421 HOH B O   1 
HETATM 4302 O O   . HOH D 2 .   ? -14.720 8.673   -1.174  1.00 78.55 ? 422 HOH B O   1 
HETATM 4303 O O   . HOH D 2 .   ? -30.856 17.534  -24.932 1.00 91.23 ? 423 HOH B O   1 
HETATM 4304 O O   . HOH D 2 .   ? -33.400 27.563  -26.043 1.00 69.14 ? 424 HOH B O   1 
HETATM 4305 O O   . HOH D 2 .   ? -30.726 6.802   -50.975 1.00 83.74 ? 425 HOH B O   1 
HETATM 4306 O O   . HOH D 2 .   ? -16.685 12.889  -3.441  1.00 87.56 ? 426 HOH B O   1 
HETATM 4307 O O   . HOH D 2 .   ? -9.834  -10.752 -39.320 1.00 76.74 ? 427 HOH B O   1 
HETATM 4308 O O   . HOH D 2 .   ? -18.323 8.954   -17.011 1.00 59.19 ? 428 HOH B O   1 
HETATM 4309 O O   . HOH D 2 .   ? -15.874 31.686  -35.740 1.00 77.25 ? 429 HOH B O   1 
HETATM 4310 O O   . HOH D 2 .   ? -29.500 -7.152  -29.686 1.00 68.16 ? 430 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ARG 1   45  45  ARG ARG A . n 
A 1 2   TRP 2   46  46  TRP TRP A . n 
A 1 3   ARG 3   47  47  ARG ARG A . n 
A 1 4   GLN 4   48  48  GLN GLN A . n 
A 1 5   THR 5   49  49  THR THR A . n 
A 1 6   TRP 6   50  50  TRP TRP A . n 
A 1 7   SER 7   51  51  SER SER A . n 
A 1 8   GLY 8   52  52  GLY GLY A . n 
A 1 9   PRO 9   53  53  PRO PRO A . n 
A 1 10  GLY 10  54  54  GLY GLY A . n 
A 1 11  THR 11  55  55  THR THR A . n 
A 1 12  THR 12  56  56  THR THR A . n 
A 1 13  LYS 13  57  57  LYS LYS A . n 
A 1 14  ARG 14  58  58  ARG ARG A . n 
A 1 15  PHE 15  59  59  PHE PHE A . n 
A 1 16  PRO 16  60  60  PRO PRO A . n 
A 1 17  GLU 17  61  61  GLU GLU A . n 
A 1 18  THR 18  62  62  THR THR A . n 
A 1 19  VAL 19  63  63  VAL VAL A . n 
A 1 20  LEU 20  64  64  LEU LEU A . n 
A 1 21  ALA 21  65  65  ALA ALA A . n 
A 1 22  ARG 22  66  66  ARG ARG A . n 
A 1 23  CYS 23  67  67  CYS CYS A . n 
A 1 24  VAL 24  68  68  VAL VAL A . n 
A 1 25  LYS 25  69  69  LYS LYS A . n 
A 1 26  TYR 26  70  70  TYR TYR A . n 
A 1 27  THR 27  71  71  THR THR A . n 
A 1 28  GLU 28  72  72  GLU GLU A . n 
A 1 29  ILE 29  73  73  ILE ILE A . n 
A 1 30  HIS 30  74  74  HIS HIS A . n 
A 1 31  PRO 31  75  75  PRO PRO A . n 
A 1 32  GLU 32  76  76  GLU GLU A . n 
A 1 33  MET 33  77  77  MET MET A . n 
A 1 34  ARG 34  78  78  ARG ARG A . n 
A 1 35  HIS 35  79  79  HIS HIS A . n 
A 1 36  VAL 36  80  80  VAL VAL A . n 
A 1 37  ASP 37  81  81  ASP ASP A . n 
A 1 38  CYS 38  82  82  CYS CYS A . n 
A 1 39  GLN 39  83  83  GLN GLN A . n 
A 1 40  SER 40  84  84  SER SER A . n 
A 1 41  VAL 41  85  85  VAL VAL A . n 
A 1 42  TRP 42  86  86  TRP TRP A . n 
A 1 43  ASP 43  87  87  ASP ASP A . n 
A 1 44  ALA 44  88  88  ALA ALA A . n 
A 1 45  PHE 45  89  89  PHE PHE A . n 
A 1 46  LYS 46  90  90  LYS LYS A . n 
A 1 47  GLY 47  91  91  GLY GLY A . n 
A 1 48  ALA 48  92  92  ALA ALA A . n 
A 1 49  PHE 49  93  93  PHE PHE A . n 
A 1 50  ILE 50  94  94  ILE ILE A . n 
A 1 51  SER 51  95  95  SER SER A . n 
A 1 52  LYS 52  96  96  LYS LYS A . n 
A 1 53  HIS 53  97  97  HIS HIS A . n 
A 1 54  PRO 54  98  98  PRO PRO A . n 
A 1 55  CYS 55  99  99  CYS CYS A . n 
A 1 56  ASP 56  100 100 ASP ASP A . n 
A 1 57  ILE 57  101 101 ILE ILE A . n 
A 1 58  THR 58  102 102 THR THR A . n 
A 1 59  GLU 59  103 103 GLU GLU A . n 
A 1 60  GLU 60  104 104 GLU GLU A . n 
A 1 61  ASP 61  105 105 ASP ASP A . n 
A 1 62  TYR 62  106 106 TYR TYR A . n 
A 1 63  GLN 63  107 107 GLN GLN A . n 
A 1 64  PRO 64  108 108 PRO PRO A . n 
A 1 65  LEU 65  109 109 LEU LEU A . n 
A 1 66  MET 66  110 110 MET MET A . n 
A 1 67  LYS 67  111 111 LYS LYS A . n 
A 1 68  LEU 68  112 112 LEU LEU A . n 
A 1 69  GLY 69  113 113 GLY GLY A . n 
A 1 70  THR 70  114 114 THR THR A . n 
A 1 71  GLN 71  115 115 GLN GLN A . n 
A 1 72  THR 72  116 116 THR THR A . n 
A 1 73  VAL 73  117 117 VAL VAL A . n 
A 1 74  PRO 74  118 118 PRO PRO A . n 
A 1 75  CYS 75  119 119 CYS CYS A . n 
A 1 76  ASN 76  120 120 ASN ASN A . n 
A 1 77  LYS 77  121 121 LYS LYS A . n 
A 1 78  ILE 78  122 122 ILE ILE A . n 
A 1 79  LEU 79  123 123 LEU LEU A . n 
A 1 80  LEU 80  124 124 LEU LEU A . n 
A 1 81  TRP 81  125 125 TRP TRP A . n 
A 1 82  SER 82  126 126 SER SER A . n 
A 1 83  ARG 83  127 127 ARG ARG A . n 
A 1 84  ILE 84  128 128 ILE ILE A . n 
A 1 85  LYS 85  129 129 LYS LYS A . n 
A 1 86  ASP 86  130 130 ASP ASP A . n 
A 1 87  LEU 87  131 131 LEU LEU A . n 
A 1 88  ALA 88  132 132 ALA ALA A . n 
A 1 89  HIS 89  133 133 HIS HIS A . n 
A 1 90  GLN 90  134 134 GLN GLN A . n 
A 1 91  PHE 91  135 135 PHE PHE A . n 
A 1 92  THR 92  136 136 THR THR A . n 
A 1 93  GLN 93  137 137 GLN GLN A . n 
A 1 94  VAL 94  138 138 VAL VAL A . n 
A 1 95  GLN 95  139 139 GLN GLN A . n 
A 1 96  ARG 96  140 140 ARG ARG A . n 
A 1 97  ASP 97  141 141 ASP ASP A . n 
A 1 98  MET 98  142 142 MET MET A . n 
A 1 99  PHE 99  143 143 PHE PHE A . n 
A 1 100 THR 100 144 144 THR THR A . n 
A 1 101 LEU 101 145 145 LEU LEU A . n 
A 1 102 GLU 102 146 146 GLU GLU A . n 
A 1 103 ASP 103 147 147 ASP ASP A . n 
A 1 104 THR 104 148 148 THR THR A . n 
A 1 105 LEU 105 149 149 LEU LEU A . n 
A 1 106 LEU 106 150 150 LEU LEU A . n 
A 1 107 GLY 107 151 151 GLY GLY A . n 
A 1 108 TYR 108 152 152 TYR TYR A . n 
A 1 109 LEU 109 153 153 LEU LEU A . n 
A 1 110 ALA 110 154 154 ALA ALA A . n 
A 1 111 ASP 111 155 155 ASP ASP A . n 
A 1 112 ASP 112 156 156 ASP ASP A . n 
A 1 113 LEU 113 157 157 LEU LEU A . n 
A 1 114 THR 114 158 158 THR THR A . n 
A 1 115 TRP 115 159 159 TRP TRP A . n 
A 1 116 CYS 116 160 160 CYS CYS A . n 
A 1 117 GLY 117 161 161 GLY GLY A . n 
A 1 118 GLU 118 162 162 GLU GLU A . n 
A 1 119 PHE 119 163 163 PHE PHE A . n 
A 1 120 ALA 120 164 164 ALA ALA A . n 
A 1 121 THR 121 165 165 THR THR A . n 
A 1 122 SER 122 166 166 SER SER A . n 
A 1 123 LYS 123 167 167 LYS LYS A . n 
A 1 124 ILE 124 168 168 ILE ILE A . n 
A 1 125 ASN 125 169 169 ASN ASN A . n 
A 1 126 TYR 126 170 170 TYR TYR A . n 
A 1 127 GLN 127 171 171 GLN GLN A . n 
A 1 128 SER 128 172 172 SER SER A . n 
A 1 129 CYS 129 173 173 CYS CYS A . n 
A 1 130 PRO 130 174 174 PRO PRO A . n 
A 1 131 ASP 131 175 175 ASP ASP A . n 
A 1 132 TRP 132 176 176 TRP TRP A . n 
A 1 133 ARG 133 177 177 ARG ARG A . n 
A 1 134 LYS 134 178 178 LYS LYS A . n 
A 1 135 ASP 135 179 179 ASP ASP A . n 
A 1 136 CYS 136 180 180 CYS CYS A . n 
A 1 137 SER 137 181 181 SER SER A . n 
A 1 138 ASN 138 182 182 ASN ASN A . n 
A 1 139 ASN 139 183 183 ASN ASN A . n 
A 1 140 PRO 140 184 184 PRO PRO A . n 
A 1 141 VAL 141 185 185 VAL VAL A . n 
A 1 142 SER 142 186 186 SER SER A . n 
A 1 143 VAL 143 187 187 VAL VAL A . n 
A 1 144 PHE 144 188 188 PHE PHE A . n 
A 1 145 TRP 145 189 189 TRP TRP A . n 
A 1 146 LYS 146 190 190 LYS LYS A . n 
A 1 147 THR 147 191 191 THR THR A . n 
A 1 148 VAL 148 192 192 VAL VAL A . n 
A 1 149 SER 149 193 193 SER SER A . n 
A 1 150 ARG 150 194 194 ARG ARG A . n 
A 1 151 ARG 151 195 195 ARG ARG A . n 
A 1 152 PHE 152 196 196 PHE PHE A . n 
A 1 153 ALA 153 197 197 ALA ALA A . n 
A 1 154 GLU 154 198 198 GLU GLU A . n 
A 1 155 ALA 155 199 199 ALA ALA A . n 
A 1 156 ALA 156 200 200 ALA ALA A . n 
A 1 157 CYS 157 201 201 CYS CYS A . n 
A 1 158 ASP 158 202 202 ASP ASP A . n 
A 1 159 VAL 159 203 203 VAL VAL A . n 
A 1 160 VAL 160 204 204 VAL VAL A . n 
A 1 161 HIS 161 205 205 HIS HIS A . n 
A 1 162 VAL 162 206 206 VAL VAL A . n 
A 1 163 MET 163 207 207 MET MET A . n 
A 1 164 LEU 164 208 208 LEU LEU A . n 
A 1 165 ASP 165 209 209 ASP ASP A . n 
A 1 166 GLY 166 210 210 GLY GLY A . n 
A 1 167 SER 167 211 211 SER SER A . n 
A 1 168 ARG 168 212 212 ARG ARG A . n 
A 1 169 SER 169 213 213 SER SER A . n 
A 1 170 LYS 170 214 214 LYS LYS A . n 
A 1 171 ILE 171 215 215 ILE ILE A . n 
A 1 172 PHE 172 216 216 PHE PHE A . n 
A 1 173 ASP 173 217 217 ASP ASP A . n 
A 1 174 LYS 174 218 218 LYS LYS A . n 
A 1 175 ASP 175 219 219 ASP ASP A . n 
A 1 176 SER 176 220 220 SER SER A . n 
A 1 177 THR 177 221 221 THR THR A . n 
A 1 178 PHE 178 222 222 PHE PHE A . n 
A 1 179 GLY 179 223 223 GLY GLY A . n 
A 1 180 SER 180 224 224 SER SER A . n 
A 1 181 VAL 181 225 225 VAL VAL A . n 
A 1 182 GLU 182 226 226 GLU GLU A . n 
A 1 183 VAL 183 227 227 VAL VAL A . n 
A 1 184 HIS 184 228 228 HIS HIS A . n 
A 1 185 ASN 185 229 229 ASN ASN A . n 
A 1 186 LEU 186 230 230 LEU LEU A . n 
A 1 187 GLN 187 231 231 GLN GLN A . n 
A 1 188 PRO 188 232 232 PRO PRO A . n 
A 1 189 GLU 189 233 233 GLU GLU A . n 
A 1 190 LYS 190 234 234 LYS LYS A . n 
A 1 191 VAL 191 235 235 VAL VAL A . n 
A 1 192 GLN 192 236 236 GLN GLN A . n 
A 1 193 THR 193 237 237 THR THR A . n 
A 1 194 LEU 194 238 238 LEU LEU A . n 
A 1 195 GLU 195 239 239 GLU GLU A . n 
A 1 196 ALA 196 240 240 ALA ALA A . n 
A 1 197 TRP 197 241 241 TRP TRP A . n 
A 1 198 VAL 198 242 242 VAL VAL A . n 
A 1 199 ILE 199 243 243 ILE ILE A . n 
A 1 200 HIS 200 244 244 HIS HIS A . n 
A 1 201 GLY 201 245 245 GLY GLY A . n 
A 1 202 GLY 202 246 246 GLY GLY A . n 
A 1 203 ARG 203 247 247 ARG ARG A . n 
A 1 204 GLU 204 248 248 GLU GLU A . n 
A 1 205 ASP 205 249 249 ASP ASP A . n 
A 1 206 SER 206 250 250 SER SER A . n 
A 1 207 ARG 207 251 251 ARG ARG A . n 
A 1 208 ASP 208 252 252 ASP ASP A . n 
A 1 209 LEU 209 253 253 LEU LEU A . n 
A 1 210 CYS 210 254 254 CYS CYS A . n 
A 1 211 GLN 211 255 255 GLN GLN A . n 
A 1 212 ASP 212 256 256 ASP ASP A . n 
A 1 213 PRO 213 257 257 PRO PRO A . n 
A 1 214 THR 214 258 258 THR THR A . n 
A 1 215 ILE 215 259 259 ILE ILE A . n 
A 1 216 LYS 216 260 260 LYS LYS A . n 
A 1 217 GLU 217 261 261 GLU GLU A . n 
A 1 218 LEU 218 262 262 LEU LEU A . n 
A 1 219 GLU 219 263 263 GLU GLU A . n 
A 1 220 SER 220 264 264 SER SER A . n 
A 1 221 ILE 221 265 265 ILE ILE A . n 
A 1 222 ILE 222 266 266 ILE ILE A . n 
A 1 223 SER 223 267 267 SER SER A . n 
A 1 224 LYS 224 268 268 LYS LYS A . n 
A 1 225 ARG 225 269 269 ARG ARG A . n 
A 1 226 ASN 226 270 270 ASN ASN A . n 
A 1 227 ILE 227 271 271 ILE ILE A . n 
A 1 228 GLN 228 272 272 GLN GLN A . n 
A 1 229 PHE 229 273 273 PHE PHE A . n 
A 1 230 SER 230 274 274 SER SER A . n 
A 1 231 CYS 231 275 275 CYS CYS A . n 
A 1 232 LYS 232 276 276 LYS LYS A . n 
A 1 233 ASN 233 277 277 ASN ASN A . n 
A 1 234 ILE 234 278 278 ILE ILE A . n 
A 1 235 TYR 235 279 279 TYR TYR A . n 
A 1 236 ARG 236 280 280 ARG ARG A . n 
A 1 237 PRO 237 281 281 PRO PRO A . n 
A 1 238 ASP 238 282 282 ASP ASP A . n 
A 1 239 LYS 239 283 283 LYS LYS A . n 
A 1 240 PHE 240 284 284 PHE PHE A . n 
A 1 241 LEU 241 285 285 LEU LEU A . n 
A 1 242 GLN 242 286 286 GLN GLN A . n 
A 1 243 CYS 243 287 287 CYS CYS A . n 
A 1 244 VAL 244 288 288 VAL VAL A . n 
A 1 245 LYS 245 289 289 LYS LYS A . n 
A 1 246 ASN 246 290 290 ASN ASN A . n 
A 1 247 PRO 247 291 291 PRO PRO A . n 
A 1 248 GLU 248 292 292 GLU GLU A . n 
A 1 249 ASP 249 293 293 ASP ASP A . n 
A 1 250 SER 250 294 294 SER SER A . n 
A 1 251 SER 251 295 295 SER SER A . n 
A 1 252 CYS 252 296 296 CYS CYS A . n 
A 1 253 THR 253 297 ?   ?   ?   A . n 
A 1 254 SER 254 298 ?   ?   ?   A . n 
A 1 255 GLU 255 299 ?   ?   ?   A . n 
A 1 256 ILE 256 300 ?   ?   ?   A . n 
B 1 1   ARG 1   45  45  ARG ARG B . n 
B 1 2   TRP 2   46  46  TRP TRP B . n 
B 1 3   ARG 3   47  47  ARG ARG B . n 
B 1 4   GLN 4   48  48  GLN GLN B . n 
B 1 5   THR 5   49  49  THR THR B . n 
B 1 6   TRP 6   50  50  TRP TRP B . n 
B 1 7   SER 7   51  51  SER SER B . n 
B 1 8   GLY 8   52  52  GLY GLY B . n 
B 1 9   PRO 9   53  53  PRO PRO B . n 
B 1 10  GLY 10  54  54  GLY GLY B . n 
B 1 11  THR 11  55  55  THR THR B . n 
B 1 12  THR 12  56  56  THR THR B . n 
B 1 13  LYS 13  57  57  LYS LYS B . n 
B 1 14  ARG 14  58  58  ARG ARG B . n 
B 1 15  PHE 15  59  59  PHE PHE B . n 
B 1 16  PRO 16  60  60  PRO PRO B . n 
B 1 17  GLU 17  61  61  GLU GLU B . n 
B 1 18  THR 18  62  62  THR THR B . n 
B 1 19  VAL 19  63  63  VAL VAL B . n 
B 1 20  LEU 20  64  64  LEU LEU B . n 
B 1 21  ALA 21  65  65  ALA ALA B . n 
B 1 22  ARG 22  66  66  ARG ARG B . n 
B 1 23  CYS 23  67  67  CYS CYS B . n 
B 1 24  VAL 24  68  68  VAL VAL B . n 
B 1 25  LYS 25  69  69  LYS LYS B . n 
B 1 26  TYR 26  70  70  TYR TYR B . n 
B 1 27  THR 27  71  71  THR THR B . n 
B 1 28  GLU 28  72  72  GLU GLU B . n 
B 1 29  ILE 29  73  73  ILE ILE B . n 
B 1 30  HIS 30  74  74  HIS HIS B . n 
B 1 31  PRO 31  75  75  PRO PRO B . n 
B 1 32  GLU 32  76  76  GLU GLU B . n 
B 1 33  MET 33  77  77  MET MET B . n 
B 1 34  ARG 34  78  78  ARG ARG B . n 
B 1 35  HIS 35  79  79  HIS HIS B . n 
B 1 36  VAL 36  80  80  VAL VAL B . n 
B 1 37  ASP 37  81  81  ASP ASP B . n 
B 1 38  CYS 38  82  82  CYS CYS B . n 
B 1 39  GLN 39  83  83  GLN GLN B . n 
B 1 40  SER 40  84  84  SER SER B . n 
B 1 41  VAL 41  85  85  VAL VAL B . n 
B 1 42  TRP 42  86  86  TRP TRP B . n 
B 1 43  ASP 43  87  87  ASP ASP B . n 
B 1 44  ALA 44  88  88  ALA ALA B . n 
B 1 45  PHE 45  89  89  PHE PHE B . n 
B 1 46  LYS 46  90  90  LYS LYS B . n 
B 1 47  GLY 47  91  91  GLY GLY B . n 
B 1 48  ALA 48  92  92  ALA ALA B . n 
B 1 49  PHE 49  93  93  PHE PHE B . n 
B 1 50  ILE 50  94  94  ILE ILE B . n 
B 1 51  SER 51  95  95  SER SER B . n 
B 1 52  LYS 52  96  96  LYS LYS B . n 
B 1 53  HIS 53  97  97  HIS HIS B . n 
B 1 54  PRO 54  98  98  PRO PRO B . n 
B 1 55  CYS 55  99  99  CYS CYS B . n 
B 1 56  ASP 56  100 100 ASP ASP B . n 
B 1 57  ILE 57  101 101 ILE ILE B . n 
B 1 58  THR 58  102 102 THR THR B . n 
B 1 59  GLU 59  103 103 GLU GLU B . n 
B 1 60  GLU 60  104 104 GLU GLU B . n 
B 1 61  ASP 61  105 105 ASP ASP B . n 
B 1 62  TYR 62  106 106 TYR TYR B . n 
B 1 63  GLN 63  107 107 GLN GLN B . n 
B 1 64  PRO 64  108 108 PRO PRO B . n 
B 1 65  LEU 65  109 109 LEU LEU B . n 
B 1 66  MET 66  110 110 MET MET B . n 
B 1 67  LYS 67  111 111 LYS LYS B . n 
B 1 68  LEU 68  112 112 LEU LEU B . n 
B 1 69  GLY 69  113 113 GLY GLY B . n 
B 1 70  THR 70  114 114 THR THR B . n 
B 1 71  GLN 71  115 115 GLN GLN B . n 
B 1 72  THR 72  116 116 THR THR B . n 
B 1 73  VAL 73  117 117 VAL VAL B . n 
B 1 74  PRO 74  118 118 PRO PRO B . n 
B 1 75  CYS 75  119 119 CYS CYS B . n 
B 1 76  ASN 76  120 120 ASN ASN B . n 
B 1 77  LYS 77  121 121 LYS LYS B . n 
B 1 78  ILE 78  122 122 ILE ILE B . n 
B 1 79  LEU 79  123 123 LEU LEU B . n 
B 1 80  LEU 80  124 124 LEU LEU B . n 
B 1 81  TRP 81  125 125 TRP TRP B . n 
B 1 82  SER 82  126 126 SER SER B . n 
B 1 83  ARG 83  127 127 ARG ARG B . n 
B 1 84  ILE 84  128 128 ILE ILE B . n 
B 1 85  LYS 85  129 129 LYS LYS B . n 
B 1 86  ASP 86  130 130 ASP ASP B . n 
B 1 87  LEU 87  131 131 LEU LEU B . n 
B 1 88  ALA 88  132 132 ALA ALA B . n 
B 1 89  HIS 89  133 133 HIS HIS B . n 
B 1 90  GLN 90  134 134 GLN GLN B . n 
B 1 91  PHE 91  135 135 PHE PHE B . n 
B 1 92  THR 92  136 136 THR THR B . n 
B 1 93  GLN 93  137 137 GLN GLN B . n 
B 1 94  VAL 94  138 138 VAL VAL B . n 
B 1 95  GLN 95  139 139 GLN GLN B . n 
B 1 96  ARG 96  140 140 ARG ARG B . n 
B 1 97  ASP 97  141 141 ASP ASP B . n 
B 1 98  MET 98  142 142 MET MET B . n 
B 1 99  PHE 99  143 143 PHE PHE B . n 
B 1 100 THR 100 144 144 THR THR B . n 
B 1 101 LEU 101 145 145 LEU LEU B . n 
B 1 102 GLU 102 146 146 GLU GLU B . n 
B 1 103 ASP 103 147 147 ASP ASP B . n 
B 1 104 THR 104 148 148 THR THR B . n 
B 1 105 LEU 105 149 149 LEU LEU B . n 
B 1 106 LEU 106 150 150 LEU LEU B . n 
B 1 107 GLY 107 151 151 GLY GLY B . n 
B 1 108 TYR 108 152 152 TYR TYR B . n 
B 1 109 LEU 109 153 153 LEU LEU B . n 
B 1 110 ALA 110 154 154 ALA ALA B . n 
B 1 111 ASP 111 155 155 ASP ASP B . n 
B 1 112 ASP 112 156 156 ASP ASP B . n 
B 1 113 LEU 113 157 157 LEU LEU B . n 
B 1 114 THR 114 158 158 THR THR B . n 
B 1 115 TRP 115 159 159 TRP TRP B . n 
B 1 116 CYS 116 160 160 CYS CYS B . n 
B 1 117 GLY 117 161 161 GLY GLY B . n 
B 1 118 GLU 118 162 162 GLU GLU B . n 
B 1 119 PHE 119 163 163 PHE PHE B . n 
B 1 120 ALA 120 164 164 ALA ALA B . n 
B 1 121 THR 121 165 165 THR THR B . n 
B 1 122 SER 122 166 166 SER SER B . n 
B 1 123 LYS 123 167 167 LYS LYS B . n 
B 1 124 ILE 124 168 168 ILE ILE B . n 
B 1 125 ASN 125 169 169 ASN ASN B . n 
B 1 126 TYR 126 170 170 TYR TYR B . n 
B 1 127 GLN 127 171 171 GLN GLN B . n 
B 1 128 SER 128 172 172 SER SER B . n 
B 1 129 CYS 129 173 173 CYS CYS B . n 
B 1 130 PRO 130 174 174 PRO PRO B . n 
B 1 131 ASP 131 175 175 ASP ASP B . n 
B 1 132 TRP 132 176 176 TRP TRP B . n 
B 1 133 ARG 133 177 177 ARG ARG B . n 
B 1 134 LYS 134 178 178 LYS LYS B . n 
B 1 135 ASP 135 179 179 ASP ASP B . n 
B 1 136 CYS 136 180 180 CYS CYS B . n 
B 1 137 SER 137 181 181 SER SER B . n 
B 1 138 ASN 138 182 182 ASN ASN B . n 
B 1 139 ASN 139 183 183 ASN ASN B . n 
B 1 140 PRO 140 184 184 PRO PRO B . n 
B 1 141 VAL 141 185 185 VAL VAL B . n 
B 1 142 SER 142 186 186 SER SER B . n 
B 1 143 VAL 143 187 187 VAL VAL B . n 
B 1 144 PHE 144 188 188 PHE PHE B . n 
B 1 145 TRP 145 189 189 TRP TRP B . n 
B 1 146 LYS 146 190 190 LYS LYS B . n 
B 1 147 THR 147 191 191 THR THR B . n 
B 1 148 VAL 148 192 192 VAL VAL B . n 
B 1 149 SER 149 193 193 SER SER B . n 
B 1 150 ARG 150 194 194 ARG ARG B . n 
B 1 151 ARG 151 195 195 ARG ARG B . n 
B 1 152 PHE 152 196 196 PHE PHE B . n 
B 1 153 ALA 153 197 197 ALA ALA B . n 
B 1 154 GLU 154 198 198 GLU GLU B . n 
B 1 155 ALA 155 199 199 ALA ALA B . n 
B 1 156 ALA 156 200 200 ALA ALA B . n 
B 1 157 CYS 157 201 201 CYS CYS B . n 
B 1 158 ASP 158 202 202 ASP ASP B . n 
B 1 159 VAL 159 203 203 VAL VAL B . n 
B 1 160 VAL 160 204 204 VAL VAL B . n 
B 1 161 HIS 161 205 205 HIS HIS B . n 
B 1 162 VAL 162 206 206 VAL VAL B . n 
B 1 163 MET 163 207 207 MET MET B . n 
B 1 164 LEU 164 208 208 LEU LEU B . n 
B 1 165 ASP 165 209 209 ASP ASP B . n 
B 1 166 GLY 166 210 210 GLY GLY B . n 
B 1 167 SER 167 211 211 SER SER B . n 
B 1 168 ARG 168 212 212 ARG ARG B . n 
B 1 169 SER 169 213 213 SER SER B . n 
B 1 170 LYS 170 214 214 LYS LYS B . n 
B 1 171 ILE 171 215 215 ILE ILE B . n 
B 1 172 PHE 172 216 216 PHE PHE B . n 
B 1 173 ASP 173 217 217 ASP ASP B . n 
B 1 174 LYS 174 218 218 LYS LYS B . n 
B 1 175 ASP 175 219 219 ASP ASP B . n 
B 1 176 SER 176 220 220 SER SER B . n 
B 1 177 THR 177 221 221 THR THR B . n 
B 1 178 PHE 178 222 222 PHE PHE B . n 
B 1 179 GLY 179 223 223 GLY GLY B . n 
B 1 180 SER 180 224 224 SER SER B . n 
B 1 181 VAL 181 225 225 VAL VAL B . n 
B 1 182 GLU 182 226 226 GLU GLU B . n 
B 1 183 VAL 183 227 227 VAL VAL B . n 
B 1 184 HIS 184 228 228 HIS HIS B . n 
B 1 185 ASN 185 229 229 ASN ASN B . n 
B 1 186 LEU 186 230 230 LEU LEU B . n 
B 1 187 GLN 187 231 231 GLN GLN B . n 
B 1 188 PRO 188 232 232 PRO PRO B . n 
B 1 189 GLU 189 233 233 GLU GLU B . n 
B 1 190 LYS 190 234 234 LYS LYS B . n 
B 1 191 VAL 191 235 235 VAL VAL B . n 
B 1 192 GLN 192 236 236 GLN GLN B . n 
B 1 193 THR 193 237 237 THR THR B . n 
B 1 194 LEU 194 238 238 LEU LEU B . n 
B 1 195 GLU 195 239 239 GLU GLU B . n 
B 1 196 ALA 196 240 240 ALA ALA B . n 
B 1 197 TRP 197 241 241 TRP TRP B . n 
B 1 198 VAL 198 242 242 VAL VAL B . n 
B 1 199 ILE 199 243 243 ILE ILE B . n 
B 1 200 HIS 200 244 244 HIS HIS B . n 
B 1 201 GLY 201 245 245 GLY GLY B . n 
B 1 202 GLY 202 246 246 GLY GLY B . n 
B 1 203 ARG 203 247 247 ARG ARG B . n 
B 1 204 GLU 204 248 248 GLU GLU B . n 
B 1 205 ASP 205 249 249 ASP ASP B . n 
B 1 206 SER 206 250 250 SER SER B . n 
B 1 207 ARG 207 251 251 ARG ARG B . n 
B 1 208 ASP 208 252 252 ASP ASP B . n 
B 1 209 LEU 209 253 253 LEU LEU B . n 
B 1 210 CYS 210 254 254 CYS CYS B . n 
B 1 211 GLN 211 255 255 GLN GLN B . n 
B 1 212 ASP 212 256 256 ASP ASP B . n 
B 1 213 PRO 213 257 257 PRO PRO B . n 
B 1 214 THR 214 258 258 THR THR B . n 
B 1 215 ILE 215 259 259 ILE ILE B . n 
B 1 216 LYS 216 260 260 LYS LYS B . n 
B 1 217 GLU 217 261 261 GLU GLU B . n 
B 1 218 LEU 218 262 262 LEU LEU B . n 
B 1 219 GLU 219 263 263 GLU GLU B . n 
B 1 220 SER 220 264 264 SER SER B . n 
B 1 221 ILE 221 265 265 ILE ILE B . n 
B 1 222 ILE 222 266 266 ILE ILE B . n 
B 1 223 SER 223 267 267 SER SER B . n 
B 1 224 LYS 224 268 268 LYS LYS B . n 
B 1 225 ARG 225 269 269 ARG ARG B . n 
B 1 226 ASN 226 270 270 ASN ASN B . n 
B 1 227 ILE 227 271 271 ILE ILE B . n 
B 1 228 GLN 228 272 272 GLN GLN B . n 
B 1 229 PHE 229 273 273 PHE PHE B . n 
B 1 230 SER 230 274 274 SER SER B . n 
B 1 231 CYS 231 275 275 CYS CYS B . n 
B 1 232 LYS 232 276 276 LYS LYS B . n 
B 1 233 ASN 233 277 277 ASN ASN B . n 
B 1 234 ILE 234 278 278 ILE ILE B . n 
B 1 235 TYR 235 279 279 TYR TYR B . n 
B 1 236 ARG 236 280 280 ARG ARG B . n 
B 1 237 PRO 237 281 281 PRO PRO B . n 
B 1 238 ASP 238 282 282 ASP ASP B . n 
B 1 239 LYS 239 283 283 LYS LYS B . n 
B 1 240 PHE 240 284 284 PHE PHE B . n 
B 1 241 LEU 241 285 285 LEU LEU B . n 
B 1 242 GLN 242 286 286 GLN GLN B . n 
B 1 243 CYS 243 287 287 CYS CYS B . n 
B 1 244 VAL 244 288 288 VAL VAL B . n 
B 1 245 LYS 245 289 289 LYS LYS B . n 
B 1 246 ASN 246 290 290 ASN ASN B . n 
B 1 247 PRO 247 291 291 PRO PRO B . n 
B 1 248 GLU 248 292 292 GLU GLU B . n 
B 1 249 ASP 249 293 293 ASP ASP B . n 
B 1 250 SER 250 294 294 SER SER B . n 
B 1 251 SER 251 295 295 SER SER B . n 
B 1 252 CYS 252 296 296 CYS CYS B . n 
B 1 253 THR 253 297 ?   ?   ?   B . n 
B 1 254 SER 254 298 ?   ?   ?   B . n 
B 1 255 GLU 255 299 ?   ?   ?   B . n 
B 1 256 ILE 256 300 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1   301 1   HOH HOH A . 
C 2 HOH 2   302 2   HOH HOH A . 
C 2 HOH 3   303 5   HOH HOH A . 
C 2 HOH 4   304 6   HOH HOH A . 
C 2 HOH 5   305 7   HOH HOH A . 
C 2 HOH 6   306 8   HOH HOH A . 
C 2 HOH 7   307 10  HOH HOH A . 
C 2 HOH 8   308 11  HOH HOH A . 
C 2 HOH 9   309 13  HOH HOH A . 
C 2 HOH 10  310 14  HOH HOH A . 
C 2 HOH 11  311 16  HOH HOH A . 
C 2 HOH 12  312 18  HOH HOH A . 
C 2 HOH 13  313 19  HOH HOH A . 
C 2 HOH 14  314 20  HOH HOH A . 
C 2 HOH 15  315 21  HOH HOH A . 
C 2 HOH 16  316 25  HOH HOH A . 
C 2 HOH 17  317 26  HOH HOH A . 
C 2 HOH 18  318 27  HOH HOH A . 
C 2 HOH 19  319 29  HOH HOH A . 
C 2 HOH 20  320 30  HOH HOH A . 
C 2 HOH 21  321 31  HOH HOH A . 
C 2 HOH 22  322 33  HOH HOH A . 
C 2 HOH 23  323 37  HOH HOH A . 
C 2 HOH 24  324 39  HOH HOH A . 
C 2 HOH 25  325 40  HOH HOH A . 
C 2 HOH 26  326 41  HOH HOH A . 
C 2 HOH 27  327 43  HOH HOH A . 
C 2 HOH 28  328 45  HOH HOH A . 
C 2 HOH 29  329 47  HOH HOH A . 
C 2 HOH 30  330 48  HOH HOH A . 
C 2 HOH 31  331 49  HOH HOH A . 
C 2 HOH 32  332 51  HOH HOH A . 
C 2 HOH 33  333 52  HOH HOH A . 
C 2 HOH 34  334 55  HOH HOH A . 
C 2 HOH 35  335 56  HOH HOH A . 
C 2 HOH 36  336 57  HOH HOH A . 
C 2 HOH 37  337 59  HOH HOH A . 
C 2 HOH 38  338 61  HOH HOH A . 
C 2 HOH 39  339 62  HOH HOH A . 
C 2 HOH 40  340 67  HOH HOH A . 
C 2 HOH 41  341 68  HOH HOH A . 
C 2 HOH 42  342 69  HOH HOH A . 
C 2 HOH 43  343 72  HOH HOH A . 
C 2 HOH 44  344 73  HOH HOH A . 
C 2 HOH 45  345 75  HOH HOH A . 
C 2 HOH 46  346 76  HOH HOH A . 
C 2 HOH 47  347 77  HOH HOH A . 
C 2 HOH 48  348 78  HOH HOH A . 
C 2 HOH 49  349 79  HOH HOH A . 
C 2 HOH 50  350 80  HOH HOH A . 
C 2 HOH 51  351 82  HOH HOH A . 
C 2 HOH 52  352 83  HOH HOH A . 
C 2 HOH 53  353 84  HOH HOH A . 
C 2 HOH 54  354 85  HOH HOH A . 
C 2 HOH 55  355 89  HOH HOH A . 
C 2 HOH 56  356 90  HOH HOH A . 
C 2 HOH 57  357 92  HOH HOH A . 
C 2 HOH 58  358 93  HOH HOH A . 
C 2 HOH 59  359 94  HOH HOH A . 
C 2 HOH 60  360 97  HOH HOH A . 
C 2 HOH 61  361 98  HOH HOH A . 
C 2 HOH 62  362 99  HOH HOH A . 
C 2 HOH 63  363 101 HOH HOH A . 
C 2 HOH 64  364 103 HOH HOH A . 
C 2 HOH 65  365 104 HOH HOH A . 
C 2 HOH 66  366 106 HOH HOH A . 
C 2 HOH 67  367 107 HOH HOH A . 
C 2 HOH 68  368 108 HOH HOH A . 
C 2 HOH 69  369 109 HOH HOH A . 
C 2 HOH 70  370 110 HOH HOH A . 
C 2 HOH 71  371 111 HOH HOH A . 
C 2 HOH 72  372 112 HOH HOH A . 
C 2 HOH 73  373 113 HOH HOH A . 
C 2 HOH 74  374 116 HOH HOH A . 
C 2 HOH 75  375 117 HOH HOH A . 
C 2 HOH 76  376 118 HOH HOH A . 
C 2 HOH 77  377 119 HOH HOH A . 
C 2 HOH 78  378 120 HOH HOH A . 
C 2 HOH 79  379 123 HOH HOH A . 
C 2 HOH 80  380 124 HOH HOH A . 
C 2 HOH 81  381 126 HOH HOH A . 
C 2 HOH 82  382 128 HOH HOH A . 
C 2 HOH 83  383 130 HOH HOH A . 
C 2 HOH 84  384 131 HOH HOH A . 
C 2 HOH 85  385 132 HOH HOH A . 
C 2 HOH 86  386 135 HOH HOH A . 
C 2 HOH 87  387 136 HOH HOH A . 
C 2 HOH 88  388 138 HOH HOH A . 
C 2 HOH 89  389 139 HOH HOH A . 
C 2 HOH 90  390 140 HOH HOH A . 
C 2 HOH 91  391 142 HOH HOH A . 
C 2 HOH 92  392 143 HOH HOH A . 
C 2 HOH 93  393 144 HOH HOH A . 
C 2 HOH 94  394 148 HOH HOH A . 
C 2 HOH 95  395 151 HOH HOH A . 
C 2 HOH 96  396 153 HOH HOH A . 
C 2 HOH 97  397 154 HOH HOH A . 
C 2 HOH 98  398 155 HOH HOH A . 
C 2 HOH 99  399 156 HOH HOH A . 
C 2 HOH 100 400 158 HOH HOH A . 
C 2 HOH 101 401 160 HOH HOH A . 
C 2 HOH 102 402 161 HOH HOH A . 
C 2 HOH 103 403 162 HOH HOH A . 
C 2 HOH 104 404 163 HOH HOH A . 
C 2 HOH 105 405 167 HOH HOH A . 
C 2 HOH 106 406 168 HOH HOH A . 
C 2 HOH 107 407 169 HOH HOH A . 
C 2 HOH 108 408 170 HOH HOH A . 
C 2 HOH 109 409 171 HOH HOH A . 
C 2 HOH 110 410 174 HOH HOH A . 
C 2 HOH 111 411 175 HOH HOH A . 
C 2 HOH 112 412 176 HOH HOH A . 
C 2 HOH 113 413 177 HOH HOH A . 
C 2 HOH 114 414 178 HOH HOH A . 
C 2 HOH 115 415 179 HOH HOH A . 
C 2 HOH 116 416 180 HOH HOH A . 
C 2 HOH 117 417 182 HOH HOH A . 
C 2 HOH 118 418 183 HOH HOH A . 
C 2 HOH 119 419 184 HOH HOH A . 
C 2 HOH 120 420 185 HOH HOH A . 
C 2 HOH 121 421 189 HOH HOH A . 
C 2 HOH 122 422 192 HOH HOH A . 
C 2 HOH 123 423 193 HOH HOH A . 
C 2 HOH 124 424 194 HOH HOH A . 
C 2 HOH 125 425 196 HOH HOH A . 
C 2 HOH 126 426 198 HOH HOH A . 
C 2 HOH 127 427 201 HOH HOH A . 
C 2 HOH 128 428 202 HOH HOH A . 
C 2 HOH 129 429 203 HOH HOH A . 
C 2 HOH 130 430 204 HOH HOH A . 
C 2 HOH 131 431 205 HOH HOH A . 
C 2 HOH 132 432 206 HOH HOH A . 
C 2 HOH 133 433 210 HOH HOH A . 
C 2 HOH 134 434 211 HOH HOH A . 
C 2 HOH 135 435 212 HOH HOH A . 
C 2 HOH 136 436 215 HOH HOH A . 
C 2 HOH 137 437 216 HOH HOH A . 
C 2 HOH 138 438 219 HOH HOH A . 
C 2 HOH 139 439 220 HOH HOH A . 
C 2 HOH 140 440 223 HOH HOH A . 
C 2 HOH 141 441 227 HOH HOH A . 
C 2 HOH 142 442 228 HOH HOH A . 
C 2 HOH 143 443 229 HOH HOH A . 
C 2 HOH 144 444 231 HOH HOH A . 
C 2 HOH 145 445 232 HOH HOH A . 
C 2 HOH 146 446 235 HOH HOH A . 
C 2 HOH 147 447 238 HOH HOH A . 
C 2 HOH 148 448 240 HOH HOH A . 
C 2 HOH 149 449 241 HOH HOH A . 
C 2 HOH 150 450 246 HOH HOH A . 
C 2 HOH 151 451 247 HOH HOH A . 
C 2 HOH 152 452 248 HOH HOH A . 
C 2 HOH 153 453 249 HOH HOH A . 
C 2 HOH 154 454 253 HOH HOH A . 
C 2 HOH 155 455 254 HOH HOH A . 
C 2 HOH 156 456 255 HOH HOH A . 
C 2 HOH 157 457 256 HOH HOH A . 
C 2 HOH 158 458 257 HOH HOH A . 
C 2 HOH 159 459 259 HOH HOH A . 
C 2 HOH 160 460 260 HOH HOH A . 
C 2 HOH 161 461 261 HOH HOH A . 
C 2 HOH 162 462 263 HOH HOH A . 
C 2 HOH 163 463 264 HOH HOH A . 
C 2 HOH 164 464 265 HOH HOH A . 
C 2 HOH 165 465 266 HOH HOH A . 
C 2 HOH 166 466 267 HOH HOH A . 
C 2 HOH 167 467 268 HOH HOH A . 
C 2 HOH 168 468 271 HOH HOH A . 
C 2 HOH 169 469 272 HOH HOH A . 
C 2 HOH 170 470 273 HOH HOH A . 
C 2 HOH 171 471 277 HOH HOH A . 
C 2 HOH 172 472 282 HOH HOH A . 
C 2 HOH 173 473 285 HOH HOH A . 
C 2 HOH 174 474 287 HOH HOH A . 
C 2 HOH 175 475 290 HOH HOH A . 
C 2 HOH 176 476 292 HOH HOH A . 
C 2 HOH 177 477 296 HOH HOH A . 
C 2 HOH 178 478 297 HOH HOH A . 
C 2 HOH 179 479 300 HOH HOH A . 
C 2 HOH 180 480 301 HOH HOH A . 
C 2 HOH 181 481 302 HOH HOH A . 
C 2 HOH 182 482 303 HOH HOH A . 
C 2 HOH 183 483 304 HOH HOH A . 
C 2 HOH 184 484 305 HOH HOH A . 
C 2 HOH 185 485 306 HOH HOH A . 
C 2 HOH 186 486 308 HOH HOH A . 
C 2 HOH 187 487 309 HOH HOH A . 
C 2 HOH 188 488 310 HOH HOH A . 
C 2 HOH 189 489 311 HOH HOH A . 
C 2 HOH 190 490 313 HOH HOH A . 
C 2 HOH 191 491 314 HOH HOH A . 
C 2 HOH 192 492 315 HOH HOH A . 
C 2 HOH 193 493 321 HOH HOH A . 
C 2 HOH 194 494 324 HOH HOH A . 
D 2 HOH 1   301 3   HOH HOH B . 
D 2 HOH 2   302 4   HOH HOH B . 
D 2 HOH 3   303 9   HOH HOH B . 
D 2 HOH 4   304 12  HOH HOH B . 
D 2 HOH 5   305 15  HOH HOH B . 
D 2 HOH 6   306 17  HOH HOH B . 
D 2 HOH 7   307 22  HOH HOH B . 
D 2 HOH 8   308 23  HOH HOH B . 
D 2 HOH 9   309 24  HOH HOH B . 
D 2 HOH 10  310 28  HOH HOH B . 
D 2 HOH 11  311 32  HOH HOH B . 
D 2 HOH 12  312 34  HOH HOH B . 
D 2 HOH 13  313 35  HOH HOH B . 
D 2 HOH 14  314 36  HOH HOH B . 
D 2 HOH 15  315 38  HOH HOH B . 
D 2 HOH 16  316 42  HOH HOH B . 
D 2 HOH 17  317 44  HOH HOH B . 
D 2 HOH 18  318 46  HOH HOH B . 
D 2 HOH 19  319 50  HOH HOH B . 
D 2 HOH 20  320 53  HOH HOH B . 
D 2 HOH 21  321 54  HOH HOH B . 
D 2 HOH 22  322 58  HOH HOH B . 
D 2 HOH 23  323 60  HOH HOH B . 
D 2 HOH 24  324 63  HOH HOH B . 
D 2 HOH 25  325 64  HOH HOH B . 
D 2 HOH 26  326 65  HOH HOH B . 
D 2 HOH 27  327 66  HOH HOH B . 
D 2 HOH 28  328 70  HOH HOH B . 
D 2 HOH 29  329 71  HOH HOH B . 
D 2 HOH 30  330 74  HOH HOH B . 
D 2 HOH 31  331 81  HOH HOH B . 
D 2 HOH 32  332 86  HOH HOH B . 
D 2 HOH 33  333 87  HOH HOH B . 
D 2 HOH 34  334 88  HOH HOH B . 
D 2 HOH 35  335 91  HOH HOH B . 
D 2 HOH 36  336 95  HOH HOH B . 
D 2 HOH 37  337 96  HOH HOH B . 
D 2 HOH 38  338 100 HOH HOH B . 
D 2 HOH 39  339 102 HOH HOH B . 
D 2 HOH 40  340 105 HOH HOH B . 
D 2 HOH 41  341 114 HOH HOH B . 
D 2 HOH 42  342 115 HOH HOH B . 
D 2 HOH 43  343 121 HOH HOH B . 
D 2 HOH 44  344 122 HOH HOH B . 
D 2 HOH 45  345 125 HOH HOH B . 
D 2 HOH 46  346 127 HOH HOH B . 
D 2 HOH 47  347 129 HOH HOH B . 
D 2 HOH 48  348 133 HOH HOH B . 
D 2 HOH 49  349 134 HOH HOH B . 
D 2 HOH 50  350 137 HOH HOH B . 
D 2 HOH 51  351 141 HOH HOH B . 
D 2 HOH 52  352 145 HOH HOH B . 
D 2 HOH 53  353 146 HOH HOH B . 
D 2 HOH 54  354 147 HOH HOH B . 
D 2 HOH 55  355 149 HOH HOH B . 
D 2 HOH 56  356 150 HOH HOH B . 
D 2 HOH 57  357 152 HOH HOH B . 
D 2 HOH 58  358 157 HOH HOH B . 
D 2 HOH 59  359 159 HOH HOH B . 
D 2 HOH 60  360 164 HOH HOH B . 
D 2 HOH 61  361 165 HOH HOH B . 
D 2 HOH 62  362 166 HOH HOH B . 
D 2 HOH 63  363 172 HOH HOH B . 
D 2 HOH 64  364 173 HOH HOH B . 
D 2 HOH 65  365 181 HOH HOH B . 
D 2 HOH 66  366 186 HOH HOH B . 
D 2 HOH 67  367 187 HOH HOH B . 
D 2 HOH 68  368 188 HOH HOH B . 
D 2 HOH 69  369 190 HOH HOH B . 
D 2 HOH 70  370 191 HOH HOH B . 
D 2 HOH 71  371 195 HOH HOH B . 
D 2 HOH 72  372 197 HOH HOH B . 
D 2 HOH 73  373 199 HOH HOH B . 
D 2 HOH 74  374 200 HOH HOH B . 
D 2 HOH 75  375 207 HOH HOH B . 
D 2 HOH 76  376 208 HOH HOH B . 
D 2 HOH 77  377 209 HOH HOH B . 
D 2 HOH 78  378 213 HOH HOH B . 
D 2 HOH 79  379 214 HOH HOH B . 
D 2 HOH 80  380 217 HOH HOH B . 
D 2 HOH 81  381 218 HOH HOH B . 
D 2 HOH 82  382 221 HOH HOH B . 
D 2 HOH 83  383 222 HOH HOH B . 
D 2 HOH 84  384 224 HOH HOH B . 
D 2 HOH 85  385 225 HOH HOH B . 
D 2 HOH 86  386 226 HOH HOH B . 
D 2 HOH 87  387 230 HOH HOH B . 
D 2 HOH 88  388 233 HOH HOH B . 
D 2 HOH 89  389 234 HOH HOH B . 
D 2 HOH 90  390 236 HOH HOH B . 
D 2 HOH 91  391 237 HOH HOH B . 
D 2 HOH 92  392 239 HOH HOH B . 
D 2 HOH 93  393 242 HOH HOH B . 
D 2 HOH 94  394 243 HOH HOH B . 
D 2 HOH 95  395 244 HOH HOH B . 
D 2 HOH 96  396 245 HOH HOH B . 
D 2 HOH 97  397 250 HOH HOH B . 
D 2 HOH 98  398 251 HOH HOH B . 
D 2 HOH 99  399 252 HOH HOH B . 
D 2 HOH 100 400 258 HOH HOH B . 
D 2 HOH 101 401 262 HOH HOH B . 
D 2 HOH 102 402 269 HOH HOH B . 
D 2 HOH 103 403 270 HOH HOH B . 
D 2 HOH 104 404 274 HOH HOH B . 
D 2 HOH 105 405 275 HOH HOH B . 
D 2 HOH 106 406 276 HOH HOH B . 
D 2 HOH 107 407 278 HOH HOH B . 
D 2 HOH 108 408 279 HOH HOH B . 
D 2 HOH 109 409 280 HOH HOH B . 
D 2 HOH 110 410 281 HOH HOH B . 
D 2 HOH 111 411 283 HOH HOH B . 
D 2 HOH 112 412 284 HOH HOH B . 
D 2 HOH 113 413 286 HOH HOH B . 
D 2 HOH 114 414 288 HOH HOH B . 
D 2 HOH 115 415 289 HOH HOH B . 
D 2 HOH 116 416 291 HOH HOH B . 
D 2 HOH 117 417 293 HOH HOH B . 
D 2 HOH 118 418 294 HOH HOH B . 
D 2 HOH 119 419 295 HOH HOH B . 
D 2 HOH 120 420 298 HOH HOH B . 
D 2 HOH 121 421 299 HOH HOH B . 
D 2 HOH 122 422 307 HOH HOH B . 
D 2 HOH 123 423 312 HOH HOH B . 
D 2 HOH 124 424 316 HOH HOH B . 
D 2 HOH 125 425 317 HOH HOH B . 
D 2 HOH 126 426 318 HOH HOH B . 
D 2 HOH 127 427 319 HOH HOH B . 
D 2 HOH 128 428 320 HOH HOH B . 
D 2 HOH 129 429 322 HOH HOH B . 
D 2 HOH 130 430 323 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C 
2 1 B,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-09-27 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Refinement description'    
4 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1  ? refined 6.5239   -16.9150 3.2326   0.2740 0.2373 0.3027 -0.0364 -0.0416 0.0233  4.7149  0.9474  0.2239  
-1.1322 0.0606   -0.5925 -0.0504 0.0457  0.0046  -0.3318 -0.2704 0.1163  0.1292  -0.0188 0.0178  
'X-RAY DIFFRACTION' 2  ? refined -0.3784  -6.6536  -4.0478  0.2916 0.2397 0.2743 -0.0147 -0.0164 -0.0377 0.9815  1.0995  0.0728  
-0.6602 -0.0616  0.0547  0.0498  -0.0138 -0.0359 -0.0038 -0.1528 0.0817  -0.0035 0.0220  -0.0323 
'X-RAY DIFFRACTION' 3  ? refined 8.5322   -4.6144  -2.7350  0.2930 0.2534 0.2778 -0.0113 -0.0127 -0.0210 1.0015  1.2881  -0.1736 
-0.6353 0.1114   -0.0131 0.0571  -0.0295 -0.0276 0.0267  -0.1240 -0.0671 0.0163  -0.0511 -0.0362 
'X-RAY DIFFRACTION' 4  ? refined 1.7123   11.6322  -1.2744  0.2992 0.2442 0.2574 -0.0152 -0.0029 -0.0227 1.0544  0.5693  1.5187  
0.1020  0.2338   0.4206  0.0307  -0.0073 -0.0234 0.0460  0.1284  -0.0988 0.0557  0.0329  0.0915  
'X-RAY DIFFRACTION' 5  ? refined -2.8033  16.8400  2.8088   0.2846 0.2355 0.2356 -0.0213 -0.0066 -0.0721 1.4284  1.4653  1.3191  
-0.2554 0.2031   -0.5641 0.0534  0.0448  -0.0982 -0.1560 0.4041  -0.0448 0.1313  -0.2018 0.0356  
'X-RAY DIFFRACTION' 6  ? refined -16.6204 13.6166  -7.9169  0.2984 0.2160 0.3099 -0.0133 0.0318  -0.0338 2.9104  -0.6006 3.2073  
-0.9371 0.5118   -2.0523 -0.0372 0.1495  -0.1123 -0.0722 0.4059  -0.0422 0.1016  -0.0847 -0.0412 
'X-RAY DIFFRACTION' 7  ? refined -16.0662 26.1650  -30.6222 0.3015 0.3659 0.4717 0.0111  0.1897  0.3658  5.3329  0.4351  2.2443  
-0.3159 0.6268   1.8429  0.0935  0.0533  -0.1469 0.9524  1.0304  -0.4557 0.0314  -0.6021 0.1799  
'X-RAY DIFFRACTION' 8  ? refined -29.0546 20.3772  -18.4534 0.2329 0.3068 0.3611 0.0757  0.0428  0.1085  0.9389  0.3927  4.1194  
-0.0257 -2.1681  0.8018  0.2692  -0.1987 -0.0706 0.2970  0.5428  -0.1247 0.0011  -0.0622 -0.5186 
'X-RAY DIFFRACTION' 9  ? refined -19.4083 10.3727  -38.2651 0.2437 0.5842 0.1112 0.1311  0.0670  0.1752  0.2979  3.7864  1.4517  
-0.3072 -0.1073  0.2854  0.1984  -0.0128 -0.1856 0.3647  0.0437  -0.1189 -0.1717 -0.0902 -0.1489 
'X-RAY DIFFRACTION' 10 ? refined -22.4862 13.7872  -19.4379 0.2431 0.3052 0.2724 0.0039  0.0247  0.0560  1.9645  0.0826  1.3754  
-0.3624 -0.6432  0.8723  0.1445  -0.0540 -0.0905 0.3122  0.3096  -0.1188 0.0714  0.0165  -0.1807 
'X-RAY DIFFRACTION' 11 ? refined -24.8185 -1.6246  -39.5095 0.2613 0.4542 0.0870 0.0983  -0.0057 0.0584  1.3353  2.3934  1.2854  
-0.0980 -0.4032  0.8050  0.1413  -0.2838 0.1426  0.0207  -0.0469 0.0530  -0.1747 0.0759  -0.0453 
'X-RAY DIFFRACTION' 12 ? refined -13.5005 -11.9796 -8.9371  0.1952 0.2601 0.3783 -0.0694 -0.0520 0.0253  9.6033  -2.6287 20.5592 
-2.7376 -5.3451  -0.8185 0.7266  0.1152  -0.8418 0.5329  -0.0113 0.0202  0.0100  -0.2218 -1.3543 
'X-RAY DIFFRACTION' 13 ? refined -20.8970 8.9469   12.0801  0.2855 0.2836 0.2851 0.0139  0.0074  -0.0080 -0.0046 24.1282 15.8059 
11.5103 -12.0819 8.0360  -0.0965 0.1218  -0.0252 0.0873  0.1657  1.6573  -0.1753 -0.9721 -0.4276 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1  1  A 45  A 72  ? . . . . ? 
'X-RAY DIFFRACTION' 2  2  A 81  A 160 ? . . . . ? 
'X-RAY DIFFRACTION' 3  3  A 161 A 210 ? . . . . ? 
'X-RAY DIFFRACTION' 4  4  A 211 A 244 ? . . . . ? 
'X-RAY DIFFRACTION' 5  5  A 256 A 286 ? . . . . ? 
'X-RAY DIFFRACTION' 6  6  B 45  B 60  ? . . . . ? 
'X-RAY DIFFRACTION' 7  7  B 61  B 88  ? . . . . ? 
'X-RAY DIFFRACTION' 8  8  B 89  B 110 ? . . . . ? 
'X-RAY DIFFRACTION' 9  9  B 111 B 142 ? . . . . ? 
'X-RAY DIFFRACTION' 10 10 B 143 B 192 ? . . . . ? 
'X-RAY DIFFRACTION' 11 11 B 193 B 296 ? . . . . ? 
'X-RAY DIFFRACTION' 12 12 A 73  A 80  ? . . . . ? 
'X-RAY DIFFRACTION' 13 13 A 287 A 296 ? . . . . ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.1.24 ? 1 
DENZO     'data reduction' .      ? 2 
SCALEPACK 'data scaling'   .      ? 3 
AMoRE     phasing          .      ? 4 
# 
_pdbx_database_remark.id     999 
_pdbx_database_remark.text   
;SEQUENCE

Prasad G.S., McRee D.E., Stura E.A., Levitt D.G., Lee H.C.,
Stout C.D.  "Crystal structure of Aplysia ADP ribosyl
cyclase, a homologue of the bifunctional ectozyme CD38."
Nat Struct Biol. 1996 Nov;3(11):957-64

Jackson D.G., Bell J.I.  "Isolation of a cDNA
encoding the human CD38 (T10) molecule, a cell surface
glycoprotein with an unusual discontinuous pattern
of expression during lymphocyte differentiation."
J. Immunol. 144:2811-2815(1990)

;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 434 ? ? O   A HOH 493 ? ? 1.92 
2 1 OE1 A GLU 198 ? ? O   A HOH 489 ? ? 2.03 
3 1 OE1 B GLN 236 ? ? O   B HOH 352 ? ? 2.10 
4 1 O   B LEU 230 ? ? NH1 B ARG 269 ? ? 2.11 
5 1 CD1 A ILE 122 ? ? O   A HOH 483 ? ? 2.16 
6 1 OH  B TYR 70  ? ? N   B LEU 149 ? ? 2.17 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CZ  A TYR 106 ? ? CE2 A TYR 106 ? ? 1.465 1.381 0.084 0.013 N 
2 1 CD1 A TYR 170 ? ? CE1 A TYR 170 ? ? 1.479 1.389 0.090 0.015 N 
3 1 CG  A PHE 196 ? ? CD2 A PHE 196 ? ? 1.481 1.383 0.098 0.015 N 
4 1 CB  A GLN 236 ? ? CG  A GLN 236 ? ? 1.773 1.521 0.252 0.027 N 
5 1 CD  A LYS 276 ? ? CE  A LYS 276 ? ? 1.682 1.508 0.174 0.025 N 
6 1 CE  A LYS 276 ? ? NZ  A LYS 276 ? ? 1.644 1.486 0.158 0.025 N 
7 1 CD  B GLU 61  ? ? OE1 B GLU 61  ? ? 1.332 1.252 0.080 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 N   A PRO 53  ? ? CD A PRO 53  ? ? CG  A PRO 53  ? ? 94.01  103.20 -9.19  1.50 N 
2  1 OE1 A GLU 61  ? ? CD A GLU 61  ? ? OE2 A GLU 61  ? ? 115.74 123.30 -7.56  1.20 N 
3  1 CB  A ASP 81  ? ? CG A ASP 81  ? ? OD2 A ASP 81  ? ? 125.75 118.30 7.45   0.90 N 
4  1 CB  A ASP 141 ? ? CG A ASP 141 ? ? OD1 A ASP 141 ? ? 109.85 118.30 -8.45  0.90 N 
5  1 CB  A ASP 141 ? ? CG A ASP 141 ? ? OD2 A ASP 141 ? ? 127.26 118.30 8.96   0.90 N 
6  1 N   A ALA 164 ? ? CA A ALA 164 ? ? CB  A ALA 164 ? ? 99.95  110.10 -10.15 1.40 N 
7  1 CB  A ASP 179 ? ? CG A ASP 179 ? ? OD2 A ASP 179 ? ? 125.64 118.30 7.34   0.90 N 
8  1 CB  A ASP 219 ? ? CG A ASP 219 ? ? OD2 A ASP 219 ? ? 126.76 118.30 8.46   0.90 N 
9  1 CB  A LEU 230 ? ? CG A LEU 230 ? ? CD1 A LEU 230 ? ? 99.08  111.00 -11.92 1.70 N 
10 1 CB  B ASP 155 ? ? CG B ASP 155 ? ? OD2 B ASP 155 ? ? 124.39 118.30 6.09   0.90 N 
11 1 NE  B ARG 194 ? ? CZ B ARG 194 ? ? NH2 B ARG 194 ? ? 117.02 120.30 -3.28  0.50 N 
12 1 CB  B ASP 202 ? ? CG B ASP 202 ? ? OD2 B ASP 202 ? ? 124.14 118.30 5.84   0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 47  ? ? -105.69 -81.11  
2  1 GLN A 48  ? ? 92.46   127.66  
3  1 ILE A 128 ? ? -143.22 51.07   
4  1 GLN A 139 ? ? -149.34 18.47   
5  1 ASP A 179 ? ? -106.90 -71.81  
6  1 ASN A 182 ? ? -93.97  56.07   
7  1 ASP A 202 ? ? 62.80   -121.83 
8  1 SER A 213 ? ? 81.24   -42.60  
9  1 GLU A 248 ? ? -14.71  157.63  
10 1 SER A 250 ? ? 69.93   132.83  
11 1 ASN A 290 ? ? -119.46 67.65   
12 1 GLU A 292 ? ? 93.95   176.94  
13 1 LYS B 57  ? ? -38.30  135.41  
14 1 ARG B 78  ? ? -63.09  4.69    
15 1 HIS B 79  ? ? -98.10  46.22   
16 1 PRO B 118 ? ? -55.39  106.75  
17 1 ASP B 179 ? ? -114.91 -70.30  
18 1 ASP B 202 ? ? 83.95   -128.88 
19 1 SER B 213 ? ? 59.43   -60.96  
20 1 LYS B 214 ? ? -69.02  58.76   
21 1 ARG B 247 ? ? 122.67  -91.52  
22 1 GLU B 248 ? ? -69.52  -137.55 
23 1 ASP B 249 ? ? 84.56   43.54   
24 1 ASN B 290 ? ? -110.58 79.72   
25 1 GLU B 292 ? ? 97.13   102.04  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLN 139 ? CB  ? A GLN 95  CB  
2   1 Y 1 A GLN 139 ? CG  ? A GLN 95  CG  
3   1 Y 1 A GLN 139 ? CD  ? A GLN 95  CD  
4   1 Y 1 A GLN 139 ? OE1 ? A GLN 95  OE1 
5   1 Y 1 A GLN 139 ? NE2 ? A GLN 95  NE2 
6   1 Y 1 A ARG 247 ? CB  ? A ARG 203 CB  
7   1 Y 1 A ARG 247 ? CG  ? A ARG 203 CG  
8   1 Y 1 A ARG 247 ? CD  ? A ARG 203 CD  
9   1 Y 1 A ARG 247 ? NE  ? A ARG 203 NE  
10  1 Y 1 A ARG 247 ? CZ  ? A ARG 203 CZ  
11  1 Y 1 A ARG 247 ? NH1 ? A ARG 203 NH1 
12  1 Y 1 A ARG 247 ? NH2 ? A ARG 203 NH2 
13  1 Y 1 A GLU 248 ? CB  ? A GLU 204 CB  
14  1 Y 1 A GLU 248 ? CG  ? A GLU 204 CG  
15  1 Y 1 A GLU 248 ? CD  ? A GLU 204 CD  
16  1 Y 1 A GLU 248 ? OE1 ? A GLU 204 OE1 
17  1 Y 1 A GLU 248 ? OE2 ? A GLU 204 OE2 
18  1 Y 1 A ASP 249 ? CB  ? A ASP 205 CB  
19  1 Y 1 A ASP 249 ? CG  ? A ASP 205 CG  
20  1 Y 1 A ASP 249 ? OD1 ? A ASP 205 OD1 
21  1 Y 1 A ASP 249 ? OD2 ? A ASP 205 OD2 
22  1 Y 1 A ARG 280 ? CB  ? A ARG 236 CB  
23  1 Y 1 A ARG 280 ? CG  ? A ARG 236 CG  
24  1 Y 1 A ARG 280 ? CD  ? A ARG 236 CD  
25  1 Y 1 A ARG 280 ? NE  ? A ARG 236 NE  
26  1 Y 1 A ARG 280 ? CZ  ? A ARG 236 CZ  
27  1 Y 1 A ARG 280 ? NH1 ? A ARG 236 NH1 
28  1 Y 1 A ARG 280 ? NH2 ? A ARG 236 NH2 
29  1 Y 1 A ASN 290 ? CG  ? A ASN 246 CG  
30  1 Y 1 A ASN 290 ? OD1 ? A ASN 246 OD1 
31  1 Y 1 A ASN 290 ? ND2 ? A ASN 246 ND2 
32  1 Y 1 A PRO 291 ? CB  ? A PRO 247 CB  
33  1 Y 1 A PRO 291 ? CG  ? A PRO 247 CG  
34  1 Y 1 A PRO 291 ? CD  ? A PRO 247 CD  
35  1 Y 1 A GLU 292 ? CB  ? A GLU 248 CB  
36  1 Y 1 A GLU 292 ? CG  ? A GLU 248 CG  
37  1 Y 1 A GLU 292 ? CD  ? A GLU 248 CD  
38  1 Y 1 A GLU 292 ? OE1 ? A GLU 248 OE1 
39  1 Y 1 A GLU 292 ? OE2 ? A GLU 248 OE2 
40  1 Y 1 A ASP 293 ? CB  ? A ASP 249 CB  
41  1 Y 1 A ASP 293 ? CG  ? A ASP 249 CG  
42  1 Y 1 A ASP 293 ? OD1 ? A ASP 249 OD1 
43  1 Y 1 A ASP 293 ? OD2 ? A ASP 249 OD2 
44  1 Y 1 A SER 294 ? CB  ? A SER 250 CB  
45  1 Y 1 A SER 294 ? OG  ? A SER 250 OG  
46  1 Y 1 A SER 295 ? CB  ? A SER 251 CB  
47  1 Y 1 A SER 295 ? OG  ? A SER 251 OG  
48  1 Y 1 B GLN 139 ? CB  ? B GLN 95  CB  
49  1 Y 1 B GLN 139 ? CG  ? B GLN 95  CG  
50  1 Y 1 B GLN 139 ? CD  ? B GLN 95  CD  
51  1 Y 1 B GLN 139 ? OE1 ? B GLN 95  OE1 
52  1 Y 1 B GLN 139 ? NE2 ? B GLN 95  NE2 
53  1 Y 1 B ARG 140 ? CB  ? B ARG 96  CB  
54  1 Y 1 B ARG 140 ? CG  ? B ARG 96  CG  
55  1 Y 1 B ARG 140 ? CD  ? B ARG 96  CD  
56  1 Y 1 B ARG 140 ? NE  ? B ARG 96  NE  
57  1 Y 1 B ARG 140 ? CZ  ? B ARG 96  CZ  
58  1 Y 1 B ARG 140 ? NH1 ? B ARG 96  NH1 
59  1 Y 1 B ARG 140 ? NH2 ? B ARG 96  NH2 
60  1 Y 1 B ASP 141 ? CB  ? B ASP 97  CB  
61  1 Y 1 B ASP 141 ? CG  ? B ASP 97  CG  
62  1 Y 1 B ASP 141 ? OD1 ? B ASP 97  OD1 
63  1 Y 1 B ASP 141 ? OD2 ? B ASP 97  OD2 
64  1 Y 1 B ARG 247 ? CB  ? B ARG 203 CB  
65  1 Y 1 B ARG 247 ? CG  ? B ARG 203 CG  
66  1 Y 1 B ARG 247 ? CD  ? B ARG 203 CD  
67  1 Y 1 B ARG 247 ? NE  ? B ARG 203 NE  
68  1 Y 1 B ARG 247 ? CZ  ? B ARG 203 CZ  
69  1 Y 1 B ARG 247 ? NH1 ? B ARG 203 NH1 
70  1 Y 1 B ARG 247 ? NH2 ? B ARG 203 NH2 
71  1 Y 1 B GLU 248 ? CB  ? B GLU 204 CB  
72  1 Y 1 B GLU 248 ? CG  ? B GLU 204 CG  
73  1 Y 1 B GLU 248 ? CD  ? B GLU 204 CD  
74  1 Y 1 B GLU 248 ? OE1 ? B GLU 204 OE1 
75  1 Y 1 B GLU 248 ? OE2 ? B GLU 204 OE2 
76  1 Y 1 B ASP 249 ? CB  ? B ASP 205 CB  
77  1 Y 1 B ASP 249 ? CG  ? B ASP 205 CG  
78  1 Y 1 B ASP 249 ? OD1 ? B ASP 205 OD1 
79  1 Y 1 B ASP 249 ? OD2 ? B ASP 205 OD2 
80  1 Y 1 B SER 250 ? CB  ? B SER 206 CB  
81  1 Y 1 B SER 250 ? OG  ? B SER 206 OG  
82  1 Y 1 B ARG 280 ? CB  ? B ARG 236 CB  
83  1 Y 1 B ARG 280 ? CG  ? B ARG 236 CG  
84  1 Y 1 B ARG 280 ? CD  ? B ARG 236 CD  
85  1 Y 1 B ARG 280 ? NE  ? B ARG 236 NE  
86  1 Y 1 B ARG 280 ? CZ  ? B ARG 236 CZ  
87  1 Y 1 B ARG 280 ? NH1 ? B ARG 236 NH1 
88  1 Y 1 B ARG 280 ? NH2 ? B ARG 236 NH2 
89  1 Y 1 B ASN 290 ? CB  ? B ASN 246 CB  
90  1 Y 1 B ASN 290 ? CG  ? B ASN 246 CG  
91  1 Y 1 B ASN 290 ? OD1 ? B ASN 246 OD1 
92  1 Y 1 B ASN 290 ? ND2 ? B ASN 246 ND2 
93  1 Y 1 B PRO 291 ? CB  ? B PRO 247 CB  
94  1 Y 1 B PRO 291 ? CG  ? B PRO 247 CG  
95  1 Y 1 B PRO 291 ? CD  ? B PRO 247 CD  
96  1 Y 1 B GLU 292 ? CB  ? B GLU 248 CB  
97  1 Y 1 B GLU 292 ? CG  ? B GLU 248 CG  
98  1 Y 1 B GLU 292 ? CD  ? B GLU 248 CD  
99  1 Y 1 B GLU 292 ? OE1 ? B GLU 248 OE1 
100 1 Y 1 B GLU 292 ? OE2 ? B GLU 248 OE2 
101 1 Y 1 B ASP 293 ? CB  ? B ASP 249 CB  
102 1 Y 1 B ASP 293 ? CG  ? B ASP 249 CG  
103 1 Y 1 B ASP 293 ? OD1 ? B ASP 249 OD1 
104 1 Y 1 B ASP 293 ? OD2 ? B ASP 249 OD2 
105 1 Y 1 B SER 294 ? CB  ? B SER 250 CB  
106 1 Y 1 B SER 294 ? OG  ? B SER 250 OG  
107 1 Y 1 B SER 295 ? CB  ? B SER 251 CB  
108 1 Y 1 B SER 295 ? OG  ? B SER 251 OG  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 297 ? A THR 253 
2 1 Y 1 A SER 298 ? A SER 254 
3 1 Y 1 A GLU 299 ? A GLU 255 
4 1 Y 1 A ILE 300 ? A ILE 256 
5 1 Y 1 B THR 297 ? B THR 253 
6 1 Y 1 B SER 298 ? B SER 254 
7 1 Y 1 B GLU 299 ? B GLU 255 
8 1 Y 1 B ILE 300 ? B ILE 256 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#