data_1YHQ
# 
_entry.id   1YHQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1YHQ         pdb_00001yhq 10.2210/pdb1yhq/pdb 
NDB   RR0112       ?            ?                   
RCSB  RCSB031524   ?            ?                   
WWPDB D_1000031524 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1YI2 . unspecified 
PDB 1YIJ . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1YHQ 
_pdbx_database_status.recvd_initial_deposition_date   2005-01-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tu, D.'       1 
'Blaha, G.'    2 
'Moore, P.B.'  3 
'Steitz, T.A.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            121 
_citation.page_first                257 
_citation.page_last                 270 
_citation.year                      2005 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15851032 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2005.02.005 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Tu, D.'       1 ? 
primary 'Blaha, G.'    2 ? 
primary 'Moore, P.B.'  3 ? 
primary 'Steitz, T.A.' 4 ? 
# 
_cell.entry_id           1YHQ 
_cell.length_a           212.081 
_cell.length_b           298.910 
_cell.length_c           574.815 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1YHQ 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat '23S Ribosomal RNA'                   946141.375 1    ? G2099A ? 'encoded by rrnA operon' 
2  polymer     nat '5S Ribosomal RNA'                    39303.402  1    ? ?      ? ?                        
3  polymer     nat '50S ribosomal protein L2P'           25354.688  1    ? ?      ? ?                        
4  polymer     nat '50S ribosomal protein L3P'           37396.395  1    ? ?      ? ?                        
5  polymer     nat '50S ribosomal protein L4E'           26442.098  1    ? ?      ? ?                        
6  polymer     nat '50S ribosomal protein L5P'           19551.693  1    ? ?      ? ?                        
7  polymer     nat '50S ribosomal protein L6P'           19961.719  1    ? ?      ? ?                        
8  polymer     nat '50S ribosomal protein L7AE'          12791.941  1    ? ?      ? ?                        
9  polymer     nat 'ACIDIC RIBOSOMAL PROTEIN P0 HOMOLOG' 37213.805  1    ? ?      ? ?                        
10 polymer     nat '50S RIBOSOMAL PROTEIN L10E'          19942.734  1    ? ?      ? ?                        
11 polymer     nat '50S RIBOSOMAL PROTEIN L11P'          17097.547  1    ? ?      ? ?                        
12 polymer     nat '50S ribosomal protein L13P'          16249.214  1    ? ?      ? ?                        
13 polymer     nat '50S ribosomal protein L14P'          14191.243  1    ? ?      ? ?                        
14 polymer     nat '50S ribosomal protein L15P'          18005.367  1    ? ?      ? ?                        
15 polymer     nat '50S Ribosomal Protein L15E'          22143.859  1    ? ?      ? ?                        
16 polymer     nat '50S ribosomal protein L18P'          20640.939  1    ? ?      ? ?                        
17 polymer     nat '50S ribosomal protein L18e'          12438.915  1    ? ?      ? ?                        
18 polymer     nat '50S ribosomal protein L19E'          16796.514  1    ? ?      ? ?                        
19 polymer     nat '50S ribosomal protein L21e'          10567.801  1    ? ?      ? ?                        
20 polymer     nat '50S ribosomal protein L22P'          16966.945  1    ? ?      ? ?                        
21 polymer     nat '50S ribosomal protein L23P'          9612.537   1    ? ?      ? ?                        
22 polymer     nat '50S ribosomal protein L24P'          13670.955  1    ? ?      ? ?                        
23 polymer     nat '50S ribosomal protein L24E'          7233.720   1    ? ?      ? ?                        
24 polymer     nat '50S ribosomal protein L29P'          7889.863   1    ? ?      ? ?                        
25 polymer     nat '50S ribosomal protein L30P'          17062.885  1    ? ?      ? ?                        
26 polymer     nat '50S ribosomal protein L31e'          10384.613  1    ? ?      ? ?                        
27 polymer     nat '50S ribosomal protein L32E'          26455.727  1    ? ?      ? ?                        
28 polymer     nat '50S ribosomal protein L37Ae'         9409.338   1    ? ?      ? ?                        
29 polymer     nat '50S ribosomal protein L37e'          6330.203   1    ? ?      ? ?                        
30 polymer     nat '50S ribosomal protein L39e'          6133.090   1    ? ?      ? ?                        
31 polymer     nat '50S ribosomal protein L44E'          10815.245  1    ? ?      ? ?                        
32 non-polymer syn AZITHROMYCIN                          748.984    1    ? ?      ? ?                        
33 non-polymer syn 'MAGNESIUM ION'                       24.305     93   ? ?      ? ?                        
34 non-polymer syn 'POTASSIUM ION'                       39.098     2    ? ?      ? ?                        
35 non-polymer syn 'SODIUM ION'                          22.990     75   ? ?      ? ?                        
36 non-polymer syn 'CHLORIDE ION'                        35.453     22   ? ?      ? ?                        
37 non-polymer syn 'STRONTIUM ION'                       87.620     108  ? ?      ? ?                        
38 non-polymer syn 'CADMIUM ION'                         112.411    5    ? ?      ? ?                        
39 water       nat water                                 18.015     7763 ? ?      ? ?                        
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  polyribonucleotide no yes 
;GUUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCUGUGGGGA
GCCGCACGGAGGCGAAGAACCACAGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGA
ACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAACGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCC
AAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUUCACGAAGUCUCUUGGAAUAG
AGCGUGAUACAGGGUGACAACCCCGUACUGAAGACCAGUACGCUGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCC
CUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGC
UGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUU
GACGAAUGACCGAGACGCGAGUCUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUG(1MA)AAAACGAG
CCAGGGAGUGUGUCUGUAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUG
CCCGAGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGA
AGCGUGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAA
GGCCCAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAG
AGCGACCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCUGUUUGACGCG
GGGAUUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUU
AAGUGUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGC
GUAACAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACU
CAUACUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGCAGGGGCGAGAGCUCCUGUGGACCGAUUAGUGACGAA
AAUCCUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUC
AGCUGAGGGUUAGCCGGUCCUAAGUCUCACCGCAACUCGACUGAGACGAAAUGGGAAACAGGUUAAUAUUCCUGUGCCAU
CAUGCAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCCGGGCAUUCGCCCGGUCGAACCGUCCAACUCCGUGGAAGCCGU
AAUGGCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUGAUGUCCG
UACCGAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAG
UUAGUCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUA
GUAACAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUC
GUACAAGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGU
AGCGGCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGU
CUGGAGACACCCAGGGGGAAGCAAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAG
CAUAGGUAGGAGUCGUUACAGAGGUACCCGCGCUAGCGGGCCACCCAGACAACAGUGAAAUACUACCCGUCGGUGACUGC
GACUCUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCG
CCCUAUGGUCAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUGACUUGACAGUGUUCUUCCCAAC
GAGGAACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACC
CUAGGGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCC
UGCCCGUGCAGAAGCGGGCAAGGGUGAGGU(OMU)(OMG)UUCGCCUAUUAAAGGAGGUCGUGAGCUGGG(UR3)U
(PSU)AGACCGUCGUGAGACAGGUCGGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACG
AGAGGAACUACGGUUGGUGGCCACUGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAA
GAGCUGAACGCAUCUAAGCUCGAAACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGA
CUCGGGGUGUGCGCGUCGAGGUAACGAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCA
;
;GUUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCUGUGGGGA
GCCGCACGGAGGCGAAGAACCACAGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGA
ACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAACGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCC
AAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUUCACGAAGUCUCUUGGAAUAG
AGCGUGAUACAGGGUGACAACCCCGUACUGAAGACCAGUACGCUGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCC
CUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGC
UGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUU
GACGAAUGACCGAGACGCGAGUCUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAG
GGAGUGUGUCUGUAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCG
AGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCG
UGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCC
CAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCG
ACCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCUGUUUGACGCGGGGA
UUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGU
GUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAA
CAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUA
CUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGCAGGGGCGAGAGCUCCUGUGGACCGAUUAGUGACGAAAAUC
CUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCU
GAGGGUUAGCCGGUCCUAAGUCUCACCGCAACUCGACUGAGACGAAAUGGGAAACAGGUUAAUAUUCCUGUGCCAUCAUG
CAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCCGGGCAUUCGCCCGGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUG
GCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUGAUGUCCGUACC
GAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAG
UCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAA
CAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUAC
AAGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCG
GCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGG
AGACACCCAGGGGGAAGCAAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUA
GGUAGGAGUCGUUACAGAGGUACCCGCGCUAGCGGGCCACCCAGACAACAGUGAAAUACUACCCGUCGGUGACUGCGACU
CUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCU
AUGGUCAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUGACUUGACAGUGUUCUUCCCAACGAGG
AACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAG
GGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCC
CGUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGU
CGGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCAC
UGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAA
ACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAA
CGAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCA
;
0 ? 
2  polyribonucleotide no no  
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCAGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAAUCCGGUUCGCCGCCACC
;
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCAGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAAUCCGGUUCGCCGCCACC
;
9 ? 
3  'polypeptide(L)'   no no  
;MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDE
LQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVV
AGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
;MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDE
LQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVV
AGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
A ? 
4  'polypeptide(L)'   no no  
;MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPM
RAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKP
DVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPND
QPRLDPEVRYVSNESNQG
;
;MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPM
RAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKP
DVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPND
QPRLDPEVRYVSNESNQG
;
B ? 
5  'polypeptide(L)'   no no  
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
C ? 
6  'polypeptide(L)'   no no  
;MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEM
AEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNP
ADAVAFIESTYDVEVSE
;
;MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEM
AEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNP
ADAVAFIESTYDVEVSE
;
D ? 
7  'polypeptide(L)'   no no  
;MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
WEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDV
RVFQDGVYITRKPNRGDA
;
;MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
WEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDV
RVFQDGVYITRKPNRGDA
;
E ? 
8  'polypeptide(L)'   no no  
;MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQ
QDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
;
;MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQ
QDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
;
F ? 
9  'polypeptide(L)'   no no  
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
G ? 
10 'polypeptide(L)'   no no  
;MSDKPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKEL
GEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKI
TPSCRIKVERGEELLIA
;
;MSDKPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKEL
GEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKI
TPSCRIKVERGEELLIA
;
H ? 
11 'polypeptide(L)'   no no  
;MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAG
FETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEA
QA
;
;MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAG
FETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEA
QA
;
I ? 
12 'polypeptide(L)'   no no  
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
J ? 
13 'polypeptide(L)'   no no  
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRLPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRLPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
K ? 
14 'polypeptide(L)'   no no  
;MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAAD
DVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDA
DADEE
;
;MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAAD
DVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDA
DADEE
;
L ? 
15 'polypeptide(L)'   no no  
;ARSAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAG
RRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVF
RGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG
;
;ARSAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAG
RRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVF
RGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG
;
M ? 
16 'polypeptide(L)'   no no  
;MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMP
SAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLY
SGDFDAADLPEHFDELRETLLDGDIEL
;
;MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMP
SAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLY
SGDFDAADLPEHFDELRETLLDGDIEL
;
N ? 
17 'polypeptide(L)'   no no  
;MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAV
DFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
;MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAV
DFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
O ? 
18 'polypeptide(L)'   no no  
;MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGS
RKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
;MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGS
RKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
P ? 
19 'polypeptide(L)'   no no  
;MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGG
KEKTIIVTAAHLRRQE
;
;MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGG
KEKTIIVTAAHLRRQE
;
Q ? 
20 'polypeptide(L)'   no no  
;MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGR
YPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
;MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGR
YPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
R ? 
21 'polypeptide(L)'   no no  
;MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVAS
RIGVF
;
;MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVAS
RIGVF
;
S ? 
22 'polypeptide(L)'   no no  
;MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTL
EKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
;MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTL
EKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
T ? 
23 'polypeptide(L)'   no no  PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA 
PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA U ? 
24 'polypeptide(L)'   no no  MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE 
MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE V ? 
25 'polypeptide(L)'   no no  
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
W ? 
26 'polypeptide(L)'   no no  
;MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEE
EGEAIVEAETAE
;
;MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEE
EGEAIVEAETAE
;
X ? 
27 'polypeptide(L)'   no no  
;MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAE
VEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKG
KGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVS
E
;
;MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAE
VEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKG
KGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVS
E
;
Y ? 
28 'polypeptide(L)'   no no  
;RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRSIRAALSE
DEE
;
;RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRSIRAALSE
DEE
;
Z ? 
29 'polypeptide(L)'   no no  MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 
MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 1 ? 
30 'polypeptide(L)'   no no  MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE 
2 ? 
31 'polypeptide(L)'   no no  
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
3 ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    G   n 
1  2    U   n 
1  3    U   n 
1  4    G   n 
1  5    G   n 
1  6    C   n 
1  7    U   n 
1  8    A   n 
1  9    C   n 
1  10   U   n 
1  11   A   n 
1  12   U   n 
1  13   G   n 
1  14   C   n 
1  15   C   n 
1  16   A   n 
1  17   G   n 
1  18   C   n 
1  19   U   n 
1  20   G   n 
1  21   G   n 
1  22   U   n 
1  23   G   n 
1  24   G   n 
1  25   A   n 
1  26   U   n 
1  27   U   n 
1  28   G   n 
1  29   C   n 
1  30   U   n 
1  31   C   n 
1  32   G   n 
1  33   G   n 
1  34   C   n 
1  35   U   n 
1  36   C   n 
1  37   A   n 
1  38   G   n 
1  39   G   n 
1  40   C   n 
1  41   G   n 
1  42   C   n 
1  43   U   n 
1  44   G   n 
1  45   A   n 
1  46   U   n 
1  47   G   n 
1  48   A   n 
1  49   A   n 
1  50   G   n 
1  51   G   n 
1  52   A   n 
1  53   C   n 
1  54   G   n 
1  55   U   n 
1  56   G   n 
1  57   C   n 
1  58   C   n 
1  59   A   n 
1  60   A   n 
1  61   G   n 
1  62   C   n 
1  63   U   n 
1  64   G   n 
1  65   C   n 
1  66   G   n 
1  67   A   n 
1  68   U   n 
1  69   A   n 
1  70   A   n 
1  71   G   n 
1  72   C   n 
1  73   U   n 
1  74   G   n 
1  75   U   n 
1  76   G   n 
1  77   G   n 
1  78   G   n 
1  79   G   n 
1  80   A   n 
1  81   G   n 
1  82   C   n 
1  83   C   n 
1  84   G   n 
1  85   C   n 
1  86   A   n 
1  87   C   n 
1  88   G   n 
1  89   G   n 
1  90   A   n 
1  91   G   n 
1  92   G   n 
1  93   C   n 
1  94   G   n 
1  95   A   n 
1  96   A   n 
1  97   G   n 
1  98   A   n 
1  99   A   n 
1  100  C   n 
1  101  C   n 
1  102  A   n 
1  103  C   n 
1  104  A   n 
1  105  G   n 
1  106  A   n 
1  107  U   n 
1  108  U   n 
1  109  U   n 
1  110  C   n 
1  111  C   n 
1  112  G   n 
1  113  A   n 
1  114  A   n 
1  115  U   n 
1  116  G   n 
1  117  A   n 
1  118  G   n 
1  119  A   n 
1  120  A   n 
1  121  U   n 
1  122  C   n 
1  123  U   n 
1  124  C   n 
1  125  U   n 
1  126  C   n 
1  127  U   n 
1  128  A   n 
1  129  A   n 
1  130  C   n 
1  131  A   n 
1  132  A   n 
1  133  U   n 
1  134  U   n 
1  135  G   n 
1  136  C   n 
1  137  U   n 
1  138  U   n 
1  139  C   n 
1  140  G   n 
1  141  C   n 
1  142  G   n 
1  143  C   n 
1  144  A   n 
1  145  A   n 
1  146  U   n 
1  147  G   n 
1  148  A   n 
1  149  G   n 
1  150  G   n 
1  151  A   n 
1  152  A   n 
1  153  C   n 
1  154  C   n 
1  155  C   n 
1  156  C   n 
1  157  G   n 
1  158  A   n 
1  159  G   n 
1  160  A   n 
1  161  A   n 
1  162  C   n 
1  163  U   n 
1  164  G   n 
1  165  A   n 
1  166  A   n 
1  167  A   n 
1  168  C   n 
1  169  A   n 
1  170  U   n 
1  171  C   n 
1  172  U   n 
1  173  C   n 
1  174  A   n 
1  175  G   n 
1  176  U   n 
1  177  A   n 
1  178  U   n 
1  179  C   n 
1  180  G   n 
1  181  G   n 
1  182  G   n 
1  183  A   n 
1  184  G   n 
1  185  G   n 
1  186  A   n 
1  187  A   n 
1  188  C   n 
1  189  A   n 
1  190  G   n 
1  191  A   n 
1  192  A   n 
1  193  A   n 
1  194  A   n 
1  195  C   n 
1  196  G   n 
1  197  C   n 
1  198  A   n 
1  199  A   n 
1  200  C   n 
1  201  G   n 
1  202  U   n 
1  203  G   n 
1  204  A   n 
1  205  U   n 
1  206  G   n 
1  207  U   n 
1  208  C   n 
1  209  G   n 
1  210  U   n 
1  211  U   n 
1  212  A   n 
1  213  G   n 
1  214  U   n 
1  215  A   n 
1  216  A   n 
1  217  C   n 
1  218  C   n 
1  219  G   n 
1  220  C   n 
1  221  G   n 
1  222  A   n 
1  223  G   n 
1  224  U   n 
1  225  G   n 
1  226  A   n 
1  227  A   n 
1  228  C   n 
1  229  G   n 
1  230  C   n 
1  231  G   n 
1  232  A   n 
1  233  U   n 
1  234  A   n 
1  235  C   n 
1  236  A   n 
1  237  G   n 
1  238  C   n 
1  239  C   n 
1  240  C   n 
1  241  A   n 
1  242  A   n 
1  243  A   n 
1  244  C   n 
1  245  C   n 
1  246  G   n 
1  247  A   n 
1  248  A   n 
1  249  G   n 
1  250  C   n 
1  251  C   n 
1  252  C   n 
1  253  U   n 
1  254  C   n 
1  255  A   n 
1  256  C   n 
1  257  G   n 
1  258  G   n 
1  259  G   n 
1  260  C   n 
1  261  A   n 
1  262  A   n 
1  263  U   n 
1  264  G   n 
1  265  U   n 
1  266  G   n 
1  267  G   n 
1  268  U   n 
1  269  G   n 
1  270  U   n 
1  271  C   n 
1  272  A   n 
1  273  G   n 
1  274  G   n 
1  275  G   n 
1  276  C   n 
1  277  U   n 
1  278  A   n 
1  279  C   n 
1  280  C   n 
1  281  U   n 
1  282  C   n 
1  283  U   n 
1  284  C   n 
1  285  A   n 
1  286  U   n 
1  287  C   n 
1  288  A   n 
1  289  G   n 
1  290  C   n 
1  291  C   n 
1  292  G   n 
1  293  A   n 
1  294  C   n 
1  295  C   n 
1  296  G   n 
1  297  U   n 
1  298  C   n 
1  299  U   n 
1  300  U   n 
1  301  C   n 
1  302  A   n 
1  303  C   n 
1  304  G   n 
1  305  A   n 
1  306  A   n 
1  307  G   n 
1  308  U   n 
1  309  C   n 
1  310  U   n 
1  311  C   n 
1  312  U   n 
1  313  U   n 
1  314  G   n 
1  315  G   n 
1  316  A   n 
1  317  A   n 
1  318  U   n 
1  319  A   n 
1  320  G   n 
1  321  A   n 
1  322  G   n 
1  323  C   n 
1  324  G   n 
1  325  U   n 
1  326  G   n 
1  327  A   n 
1  328  U   n 
1  329  A   n 
1  330  C   n 
1  331  A   n 
1  332  G   n 
1  333  G   n 
1  334  G   n 
1  335  U   n 
1  336  G   n 
1  337  A   n 
1  338  C   n 
1  339  A   n 
1  340  A   n 
1  341  C   n 
1  342  C   n 
1  343  C   n 
1  344  C   n 
1  345  G   n 
1  346  U   n 
1  347  A   n 
1  348  C   n 
1  349  U   n 
1  350  G   n 
1  351  A   n 
1  352  A   n 
1  353  G   n 
1  354  A   n 
1  355  C   n 
1  356  C   n 
1  357  A   n 
1  358  G   n 
1  359  U   n 
1  360  A   n 
1  361  C   n 
1  362  G   n 
1  363  C   n 
1  364  U   n 
1  365  G   n 
1  366  U   n 
1  367  G   n 
1  368  C   n 
1  369  G   n 
1  370  G   n 
1  371  U   n 
1  372  A   n 
1  373  G   n 
1  374  U   n 
1  375  G   n 
1  376  C   n 
1  377  C   n 
1  378  A   n 
1  379  G   n 
1  380  A   n 
1  381  G   n 
1  382  U   n 
1  383  A   n 
1  384  G   n 
1  385  C   n 
1  386  G   n 
1  387  G   n 
1  388  G   n 
1  389  G   n 
1  390  G   n 
1  391  U   n 
1  392  U   n 
1  393  G   n 
1  394  G   n 
1  395  A   n 
1  396  U   n 
1  397  A   n 
1  398  U   n 
1  399  C   n 
1  400  C   n 
1  401  C   n 
1  402  U   n 
1  403  C   n 
1  404  G   n 
1  405  C   n 
1  406  G   n 
1  407  A   n 
1  408  A   n 
1  409  U   n 
1  410  A   n 
1  411  A   n 
1  412  C   n 
1  413  G   n 
1  414  C   n 
1  415  A   n 
1  416  G   n 
1  417  G   n 
1  418  C   n 
1  419  A   n 
1  420  U   n 
1  421  C   n 
1  422  G   n 
1  423  A   n 
1  424  C   n 
1  425  U   n 
1  426  G   n 
1  427  C   n 
1  428  G   n 
1  429  A   n 
1  430  A   n 
1  431  G   n 
1  432  G   n 
1  433  C   n 
1  434  U   n 
1  435  A   n 
1  436  A   n 
1  437  A   n 
1  438  C   n 
1  439  A   n 
1  440  C   n 
1  441  A   n 
1  442  A   n 
1  443  C   n 
1  444  C   n 
1  445  U   n 
1  446  G   n 
1  447  A   n 
1  448  G   n 
1  449  A   n 
1  450  C   n 
1  451  C   n 
1  452  G   n 
1  453  A   n 
1  454  U   n 
1  455  A   n 
1  456  G   n 
1  457  U   n 
1  458  G   n 
1  459  A   n 
1  460  A   n 
1  461  C   n 
1  462  A   n 
1  463  A   n 
1  464  G   n 
1  465  U   n 
1  466  A   n 
1  467  G   n 
1  468  U   n 
1  469  G   n 
1  470  U   n 
1  471  G   n 
1  472  A   n 
1  473  A   n 
1  474  C   n 
1  475  G   n 
1  476  A   n 
1  477  A   n 
1  478  C   n 
1  479  G   n 
1  480  C   n 
1  481  U   n 
1  482  G   n 
1  483  C   n 
1  484  A   n 
1  485  A   n 
1  486  A   n 
1  487  G   n 
1  488  U   n 
1  489  A   n 
1  490  C   n 
1  491  C   n 
1  492  C   n 
1  493  U   n 
1  494  C   n 
1  495  A   n 
1  496  G   n 
1  497  A   n 
1  498  A   n 
1  499  G   n 
1  500  G   n 
1  501  G   n 
1  502  A   n 
1  503  G   n 
1  504  G   n 
1  505  C   n 
1  506  G   n 
1  507  A   n 
1  508  A   n 
1  509  A   n 
1  510  U   n 
1  511  A   n 
1  512  G   n 
1  513  A   n 
1  514  G   n 
1  515  C   n 
1  516  A   n 
1  517  U   n 
1  518  G   n 
1  519  A   n 
1  520  A   n 
1  521  A   n 
1  522  U   n 
1  523  C   n 
1  524  A   n 
1  525  G   n 
1  526  U   n 
1  527  U   n 
1  528  G   n 
1  529  G   n 
1  530  C   n 
1  531  G   n 
1  532  A   n 
1  533  U   n 
1  534  C   n 
1  535  G   n 
1  536  A   n 
1  537  G   n 
1  538  C   n 
1  539  G   n 
1  540  A   n 
1  541  C   n 
1  542  A   n 
1  543  G   n 
1  544  G   n 
1  545  G   n 
1  546  C   n 
1  547  A   n 
1  548  U   n 
1  549  A   n 
1  550  C   n 
1  551  A   n 
1  552  A   n 
1  553  G   n 
1  554  G   n 
1  555  U   n 
1  556  C   n 
1  557  C   n 
1  558  C   n 
1  559  U   n 
1  560  U   n 
1  561  G   n 
1  562  A   n 
1  563  C   n 
1  564  G   n 
1  565  A   n 
1  566  A   n 
1  567  U   n 
1  568  G   n 
1  569  A   n 
1  570  C   n 
1  571  C   n 
1  572  G   n 
1  573  A   n 
1  574  G   n 
1  575  A   n 
1  576  C   n 
1  577  G   n 
1  578  C   n 
1  579  G   n 
1  580  A   n 
1  581  G   n 
1  582  U   n 
1  583  C   n 
1  584  U   n 
1  585  C   n 
1  586  C   n 
1  587  A   n 
1  588  G   n 
1  589  U   n 
1  590  A   n 
1  591  A   n 
1  592  G   n 
1  593  A   n 
1  594  C   n 
1  595  U   n 
1  596  C   n 
1  597  A   n 
1  598  C   n 
1  599  G   n 
1  600  G   n 
1  601  G   n 
1  602  A   n 
1  603  A   n 
1  604  G   n 
1  605  C   n 
1  606  C   n 
1  607  G   n 
1  608  A   n 
1  609  U   n 
1  610  G   n 
1  611  U   n 
1  612  U   n 
1  613  C   n 
1  614  U   n 
1  615  G   n 
1  616  U   n 
1  617  C   n 
1  618  G   n 
1  619  U   n 
1  620  A   n 
1  621  C   n 
1  622  G   n 
1  623  U   n 
1  624  U   n 
1  625  U   n 
1  626  U   n 
1  627  G   n 
1  628  1MA n 
1  629  A   n 
1  630  A   n 
1  631  A   n 
1  632  A   n 
1  633  C   n 
1  634  G   n 
1  635  A   n 
1  636  G   n 
1  637  C   n 
1  638  C   n 
1  639  A   n 
1  640  G   n 
1  641  G   n 
1  642  G   n 
1  643  A   n 
1  644  G   n 
1  645  U   n 
1  646  G   n 
1  647  U   n 
1  648  G   n 
1  649  U   n 
1  650  C   n 
1  651  U   n 
1  652  G   n 
1  653  U   n 
1  654  A   n 
1  655  U   n 
1  656  G   n 
1  657  G   n 
1  658  C   n 
1  659  A   n 
1  660  A   n 
1  661  G   n 
1  662  U   n 
1  663  C   n 
1  664  U   n 
1  665  A   n 
1  666  A   n 
1  667  C   n 
1  668  C   n 
1  669  G   n 
1  670  G   n 
1  671  A   n 
1  672  G   n 
1  673  U   n 
1  674  A   n 
1  675  U   n 
1  676  C   n 
1  677  C   n 
1  678  G   n 
1  679  G   n 
1  680  G   n 
1  681  G   n 
1  682  A   n 
1  683  G   n 
1  684  G   n 
1  685  C   n 
1  686  A   n 
1  687  C   n 
1  688  A   n 
1  689  G   n 
1  690  G   n 
1  691  G   n 
1  692  A   n 
1  693  A   n 
1  694  A   n 
1  695  C   n 
1  696  C   n 
1  697  G   n 
1  698  A   n 
1  699  C   n 
1  700  A   n 
1  701  U   n 
1  702  G   n 
1  703  G   n 
1  704  C   n 
1  705  C   n 
1  706  G   n 
1  707  C   n 
1  708  A   n 
1  709  G   n 
1  710  G   n 
1  711  G   n 
1  712  C   n 
1  713  U   n 
1  714  U   n 
1  715  U   n 
1  716  G   n 
1  717  C   n 
1  718  C   n 
1  719  C   n 
1  720  G   n 
1  721  A   n 
1  722  G   n 
1  723  G   n 
1  724  G   n 
1  725  C   n 
1  726  C   n 
1  727  G   n 
1  728  C   n 
1  729  C   n 
1  730  G   n 
1  731  U   n 
1  732  C   n 
1  733  U   n 
1  734  U   n 
1  735  C   n 
1  736  A   n 
1  737  A   n 
1  738  G   n 
1  739  G   n 
1  740  G   n 
1  741  C   n 
1  742  G   n 
1  743  G   n 
1  744  G   n 
1  745  G   n 
1  746  A   n 
1  747  G   n 
1  748  C   n 
1  749  C   n 
1  750  A   n 
1  751  U   n 
1  752  G   n 
1  753  U   n 
1  754  G   n 
1  755  G   n 
1  756  A   n 
1  757  C   n 
1  758  A   n 
1  759  C   n 
1  760  G   n 
1  761  A   n 
1  762  C   n 
1  763  C   n 
1  764  C   n 
1  765  G   n 
1  766  A   n 
1  767  A   n 
1  768  U   n 
1  769  C   n 
1  770  C   n 
1  771  G   n 
1  772  G   n 
1  773  A   n 
1  774  C   n 
1  775  G   n 
1  776  A   n 
1  777  U   n 
1  778  C   n 
1  779  U   n 
1  780  A   n 
1  781  C   n 
1  782  G   n 
1  783  C   n 
1  784  A   n 
1  785  U   n 
1  786  G   n 
1  787  G   n 
1  788  A   n 
1  789  C   n 
1  790  A   n 
1  791  A   n 
1  792  G   n 
1  793  A   n 
1  794  U   n 
1  795  G   n 
1  796  A   n 
1  797  A   n 
1  798  G   n 
1  799  C   n 
1  800  G   n 
1  801  U   n 
1  802  G   n 
1  803  C   n 
1  804  C   n 
1  805  G   n 
1  806  A   n 
1  807  A   n 
1  808  A   n 
1  809  G   n 
1  810  G   n 
1  811  C   n 
1  812  A   n 
1  813  C   n 
1  814  G   n 
1  815  U   n 
1  816  G   n 
1  817  G   n 
1  818  A   n 
1  819  A   n 
1  820  G   n 
1  821  U   n 
1  822  C   n 
1  823  U   n 
1  824  G   n 
1  825  U   n 
1  826  U   n 
1  827  A   n 
1  828  G   n 
1  829  A   n 
1  830  G   n 
1  831  U   n 
1  832  U   n 
1  833  G   n 
1  834  G   n 
1  835  U   n 
1  836  G   n 
1  837  U   n 
1  838  C   n 
1  839  C   n 
1  840  U   n 
1  841  A   n 
1  842  C   n 
1  843  A   n 
1  844  A   n 
1  845  U   n 
1  846  A   n 
1  847  C   n 
1  848  C   n 
1  849  C   n 
1  850  U   n 
1  851  C   n 
1  852  U   n 
1  853  C   n 
1  854  G   n 
1  855  U   n 
1  856  G   n 
1  857  A   n 
1  858  U   n 
1  859  C   n 
1  860  U   n 
1  861  A   n 
1  862  U   n 
1  863  G   n 
1  864  U   n 
1  865  G   n 
1  866  U   n 
1  867  A   n 
1  868  G   n 
1  869  G   n 
1  870  G   n 
1  871  G   n 
1  872  U   n 
1  873  G   n 
1  874  A   n 
1  875  A   n 
1  876  A   n 
1  877  G   n 
1  878  G   n 
1  879  C   n 
1  880  C   n 
1  881  C   n 
1  882  A   n 
1  883  U   n 
1  884  C   n 
1  885  G   n 
1  886  A   n 
1  887  G   n 
1  888  U   n 
1  889  C   n 
1  890  C   n 
1  891  G   n 
1  892  G   n 
1  893  C   n 
1  894  A   n 
1  895  A   n 
1  896  C   n 
1  897  A   n 
1  898  G   n 
1  899  C   n 
1  900  U   n 
1  901  G   n 
1  902  G   n 
1  903  U   n 
1  904  U   n 
1  905  C   n 
1  906  C   n 
1  907  A   n 
1  908  A   n 
1  909  U   n 
1  910  C   n 
1  911  G   n 
1  912  A   n 
1  913  A   n 
1  914  A   n 
1  915  C   n 
1  916  A   n 
1  917  U   n 
1  918  G   n 
1  919  U   n 
1  920  C   n 
1  921  G   n 
1  922  A   n 
1  923  A   n 
1  924  G   n 
1  925  C   n 
1  926  A   n 
1  927  U   n 
1  928  G   n 
1  929  A   n 
1  930  C   n 
1  931  C   n 
1  932  U   n 
1  933  C   n 
1  934  C   n 
1  935  G   n 
1  936  C   n 
1  937  C   n 
1  938  G   n 
1  939  A   n 
1  940  G   n 
1  941  G   n 
1  942  U   n 
1  943  A   n 
1  944  G   n 
1  945  U   n 
1  946  C   n 
1  947  U   n 
1  948  G   n 
1  949  U   n 
1  950  G   n 
1  951  A   n 
1  952  G   n 
1  953  G   n 
1  954  U   n 
1  955  A   n 
1  956  G   n 
1  957  A   n 
1  958  G   n 
1  959  C   n 
1  960  G   n 
1  961  A   n 
1  962  C   n 
1  963  C   n 
1  964  G   n 
1  965  A   n 
1  966  U   n 
1  967  U   n 
1  968  G   n 
1  969  G   n 
1  970  U   n 
1  971  G   n 
1  972  U   n 
1  973  G   n 
1  974  U   n 
1  975  C   n 
1  976  C   n 
1  977  G   n 
1  978  C   n 
1  979  C   n 
1  980  U   n 
1  981  C   n 
1  982  C   n 
1  983  G   n 
1  984  A   n 
1  985  G   n 
1  986  A   n 
1  987  G   n 
1  988  G   n 
1  989  A   n 
1  990  G   n 
1  991  U   n 
1  992  C   n 
1  993  G   n 
1  994  G   n 
1  995  C   n 
1  996  A   n 
1  997  C   n 
1  998  A   n 
1  999  C   n 
1  1000 C   n 
1  1001 U   n 
1  1002 G   n 
1  1003 U   n 
1  1004 C   n 
1  1005 A   n 
1  1006 A   n 
1  1007 A   n 
1  1008 C   n 
1  1009 U   n 
1  1010 C   n 
1  1011 C   n 
1  1012 A   n 
1  1013 A   n 
1  1014 A   n 
1  1015 C   n 
1  1016 U   n 
1  1017 U   n 
1  1018 A   n 
1  1019 C   n 
1  1020 A   n 
1  1021 G   n 
1  1022 A   n 
1  1023 C   n 
1  1024 G   n 
1  1025 C   n 
1  1026 U   n 
1  1027 G   n 
1  1028 U   n 
1  1029 U   n 
1  1030 U   n 
1  1031 G   n 
1  1032 A   n 
1  1033 C   n 
1  1034 G   n 
1  1035 C   n 
1  1036 G   n 
1  1037 G   n 
1  1038 G   n 
1  1039 G   n 
1  1040 A   n 
1  1041 U   n 
1  1042 U   n 
1  1043 C   n 
1  1044 C   n 
1  1045 G   n 
1  1046 G   n 
1  1047 U   n 
1  1048 G   n 
1  1049 C   n 
1  1050 G   n 
1  1051 C   n 
1  1052 G   n 
1  1053 G   n 
1  1054 G   n 
1  1055 G   n 
1  1056 U   n 
1  1057 A   n 
1  1058 A   n 
1  1059 G   n 
1  1060 C   n 
1  1061 C   n 
1  1062 U   n 
1  1063 G   n 
1  1064 U   n 
1  1065 G   n 
1  1066 U   n 
1  1067 A   n 
1  1068 C   n 
1  1069 C   n 
1  1070 A   n 
1  1071 G   n 
1  1072 G   n 
1  1073 A   n 
1  1074 G   n 
1  1075 G   n 
1  1076 G   n 
1  1077 G   n 
1  1078 A   n 
1  1079 A   n 
1  1080 C   n 
1  1081 A   n 
1  1082 A   n 
1  1083 C   n 
1  1084 C   n 
1  1085 C   n 
1  1086 A   n 
1  1087 G   n 
1  1088 A   n 
1  1089 G   n 
1  1090 A   n 
1  1091 U   n 
1  1092 A   n 
1  1093 G   n 
1  1094 G   n 
1  1095 U   n 
1  1096 U   n 
1  1097 A   n 
1  1098 A   n 
1  1099 G   n 
1  1100 G   n 
1  1101 U   n 
1  1102 C   n 
1  1103 C   n 
1  1104 C   n 
1  1105 C   n 
1  1106 A   n 
1  1107 A   n 
1  1108 G   n 
1  1109 U   n 
1  1110 G   n 
1  1111 U   n 
1  1112 G   n 
1  1113 G   n 
1  1114 A   n 
1  1115 U   n 
1  1116 U   n 
1  1117 A   n 
1  1118 A   n 
1  1119 G   n 
1  1120 U   n 
1  1121 G   n 
1  1122 U   n 
1  1123 A   n 
1  1124 A   n 
1  1125 U   n 
1  1126 C   n 
1  1127 C   n 
1  1128 U   n 
1  1129 C   n 
1  1130 U   n 
1  1131 G   n 
1  1132 A   n 
1  1133 A   n 
1  1134 G   n 
1  1135 G   n 
1  1136 U   n 
1  1137 G   n 
1  1138 G   n 
1  1139 U   n 
1  1140 C   n 
1  1141 U   n 
1  1142 C   n 
1  1143 G   n 
1  1144 A   n 
1  1145 G   n 
1  1146 C   n 
1  1147 C   n 
1  1148 C   n 
1  1149 U   n 
1  1150 A   n 
1  1151 G   n 
1  1152 A   n 
1  1153 C   n 
1  1154 A   n 
1  1155 G   n 
1  1156 C   n 
1  1157 C   n 
1  1158 G   n 
1  1159 G   n 
1  1160 G   n 
1  1161 A   n 
1  1162 G   n 
1  1163 G   n 
1  1164 U   n 
1  1165 G   n 
1  1166 A   n 
1  1167 G   n 
1  1168 C   n 
1  1169 U   n 
1  1170 U   n 
1  1171 A   n 
1  1172 G   n 
1  1173 A   n 
1  1174 A   n 
1  1175 G   n 
1  1176 C   n 
1  1177 A   n 
1  1178 G   n 
1  1179 C   n 
1  1180 U   n 
1  1181 A   n 
1  1182 C   n 
1  1183 C   n 
1  1184 C   n 
1  1185 U   n 
1  1186 C   n 
1  1187 U   n 
1  1188 A   n 
1  1189 A   n 
1  1190 G   n 
1  1191 A   n 
1  1192 A   n 
1  1193 A   n 
1  1194 A   n 
1  1195 G   n 
1  1196 C   n 
1  1197 G   n 
1  1198 U   n 
1  1199 A   n 
1  1200 A   n 
1  1201 C   n 
1  1202 A   n 
1  1203 G   n 
1  1204 C   n 
1  1205 U   n 
1  1206 U   n 
1  1207 A   n 
1  1208 C   n 
1  1209 C   n 
1  1210 G   n 
1  1211 G   n 
1  1212 C   n 
1  1213 C   n 
1  1214 G   n 
1  1215 A   n 
1  1216 G   n 
1  1217 G   n 
1  1218 U   n 
1  1219 U   n 
1  1220 U   n 
1  1221 G   n 
1  1222 A   n 
1  1223 G   n 
1  1224 G   n 
1  1225 C   n 
1  1226 G   n 
1  1227 C   n 
1  1228 C   n 
1  1229 C   n 
1  1230 A   n 
1  1231 A   n 
1  1232 A   n 
1  1233 A   n 
1  1234 U   n 
1  1235 G   n 
1  1236 A   n 
1  1237 U   n 
1  1238 C   n 
1  1239 G   n 
1  1240 G   n 
1  1241 G   n 
1  1242 A   n 
1  1243 C   n 
1  1244 U   n 
1  1245 C   n 
1  1246 A   n 
1  1247 A   n 
1  1248 A   n 
1  1249 U   n 
1  1250 C   n 
1  1251 C   n 
1  1252 A   n 
1  1253 C   n 
1  1254 C   n 
1  1255 A   n 
1  1256 C   n 
1  1257 C   n 
1  1258 G   n 
1  1259 A   n 
1  1260 G   n 
1  1261 A   n 
1  1262 C   n 
1  1263 C   n 
1  1264 U   n 
1  1265 G   n 
1  1266 U   n 
1  1267 C   n 
1  1268 C   n 
1  1269 G   n 
1  1270 U   n 
1  1271 A   n 
1  1272 C   n 
1  1273 C   n 
1  1274 A   n 
1  1275 C   n 
1  1276 U   n 
1  1277 C   n 
1  1278 A   n 
1  1279 U   n 
1  1280 A   n 
1  1281 C   n 
1  1282 U   n 
1  1283 G   n 
1  1284 G   n 
1  1285 U   n 
1  1286 A   n 
1  1287 A   n 
1  1288 U   n 
1  1289 C   n 
1  1290 G   n 
1  1291 A   n 
1  1292 G   n 
1  1293 U   n 
1  1294 A   n 
1  1295 G   n 
1  1296 A   n 
1  1297 U   n 
1  1298 U   n 
1  1299 G   n 
1  1300 G   n 
1  1301 C   n 
1  1302 G   n 
1  1303 C   n 
1  1304 U   n 
1  1305 C   n 
1  1306 U   n 
1  1307 A   n 
1  1308 A   n 
1  1309 U   n 
1  1310 U   n 
1  1311 G   n 
1  1312 G   n 
1  1313 A   n 
1  1314 U   n 
1  1315 G   n 
1  1316 G   n 
1  1317 A   n 
1  1318 A   n 
1  1319 G   n 
1  1320 C   n 
1  1321 A   n 
1  1322 G   n 
1  1323 G   n 
1  1324 G   n 
1  1325 G   n 
1  1326 C   n 
1  1327 G   n 
1  1328 A   n 
1  1329 G   n 
1  1330 A   n 
1  1331 G   n 
1  1332 C   n 
1  1333 U   n 
1  1334 C   n 
1  1335 C   n 
1  1336 U   n 
1  1337 G   n 
1  1338 U   n 
1  1339 G   n 
1  1340 G   n 
1  1341 A   n 
1  1342 C   n 
1  1343 C   n 
1  1344 G   n 
1  1345 A   n 
1  1346 U   n 
1  1347 U   n 
1  1348 A   n 
1  1349 G   n 
1  1350 U   n 
1  1351 G   n 
1  1352 A   n 
1  1353 C   n 
1  1354 G   n 
1  1355 A   n 
1  1356 A   n 
1  1357 A   n 
1  1358 A   n 
1  1359 U   n 
1  1360 C   n 
1  1361 C   n 
1  1362 U   n 
1  1363 G   n 
1  1364 G   n 
1  1365 C   n 
1  1366 C   n 
1  1367 A   n 
1  1368 U   n 
1  1369 A   n 
1  1370 G   n 
1  1371 U   n 
1  1372 A   n 
1  1373 G   n 
1  1374 C   n 
1  1375 A   n 
1  1376 G   n 
1  1377 C   n 
1  1378 G   n 
1  1379 A   n 
1  1380 U   n 
1  1381 A   n 
1  1382 G   n 
1  1383 U   n 
1  1384 C   n 
1  1385 G   n 
1  1386 G   n 
1  1387 G   n 
1  1388 U   n 
1  1389 G   n 
1  1390 A   n 
1  1391 G   n 
1  1392 A   n 
1  1393 A   n 
1  1394 C   n 
1  1395 C   n 
1  1396 C   n 
1  1397 C   n 
1  1398 G   n 
1  1399 A   n 
1  1400 C   n 
1  1401 G   n 
1  1402 G   n 
1  1403 C   n 
1  1404 C   n 
1  1405 U   n 
1  1406 A   n 
1  1407 A   n 
1  1408 U   n 
1  1409 G   n 
1  1410 G   n 
1  1411 A   n 
1  1412 U   n 
1  1413 A   n 
1  1414 A   n 
1  1415 G   n 
1  1416 G   n 
1  1417 G   n 
1  1418 U   n 
1  1419 U   n 
1  1420 C   n 
1  1421 C   n 
1  1422 U   n 
1  1423 C   n 
1  1424 A   n 
1  1425 G   n 
1  1426 C   n 
1  1427 A   n 
1  1428 C   n 
1  1429 U   n 
1  1430 G   n 
1  1431 C   n 
1  1432 U   n 
1  1433 G   n 
1  1434 A   n 
1  1435 U   n 
1  1436 C   n 
1  1437 A   n 
1  1438 G   n 
1  1439 C   n 
1  1440 U   n 
1  1441 G   n 
1  1442 A   n 
1  1443 G   n 
1  1444 G   n 
1  1445 G   n 
1  1446 U   n 
1  1447 U   n 
1  1448 A   n 
1  1449 G   n 
1  1450 C   n 
1  1451 C   n 
1  1452 G   n 
1  1453 G   n 
1  1454 U   n 
1  1455 C   n 
1  1456 C   n 
1  1457 U   n 
1  1458 A   n 
1  1459 A   n 
1  1460 G   n 
1  1461 U   n 
1  1462 C   n 
1  1463 U   n 
1  1464 C   n 
1  1465 A   n 
1  1466 C   n 
1  1467 C   n 
1  1468 G   n 
1  1469 C   n 
1  1470 A   n 
1  1471 A   n 
1  1472 C   n 
1  1473 U   n 
1  1474 C   n 
1  1475 G   n 
1  1476 A   n 
1  1477 C   n 
1  1478 U   n 
1  1479 G   n 
1  1480 A   n 
1  1481 G   n 
1  1482 A   n 
1  1483 C   n 
1  1484 G   n 
1  1485 A   n 
1  1486 A   n 
1  1487 A   n 
1  1488 U   n 
1  1489 G   n 
1  1490 G   n 
1  1491 G   n 
1  1492 A   n 
1  1493 A   n 
1  1494 A   n 
1  1495 C   n 
1  1496 A   n 
1  1497 G   n 
1  1498 G   n 
1  1499 U   n 
1  1500 U   n 
1  1501 A   n 
1  1502 A   n 
1  1503 U   n 
1  1504 A   n 
1  1505 U   n 
1  1506 U   n 
1  1507 C   n 
1  1508 C   n 
1  1509 U   n 
1  1510 G   n 
1  1511 U   n 
1  1512 G   n 
1  1513 C   n 
1  1514 C   n 
1  1515 A   n 
1  1516 U   n 
1  1517 C   n 
1  1518 A   n 
1  1519 U   n 
1  1520 G   n 
1  1521 C   n 
1  1522 A   n 
1  1523 G   n 
1  1524 U   n 
1  1525 G   n 
1  1526 A   n 
1  1527 A   n 
1  1528 A   n 
1  1529 G   n 
1  1530 U   n 
1  1531 U   n 
1  1532 G   n 
1  1533 A   n 
1  1534 C   n 
1  1535 G   n 
1  1536 C   n 
1  1537 C   n 
1  1538 C   n 
1  1539 U   n 
1  1540 G   n 
1  1541 G   n 
1  1542 G   n 
1  1543 G   n 
1  1544 U   n 
1  1545 C   n 
1  1546 G   n 
1  1547 A   n 
1  1548 U   n 
1  1549 C   n 
1  1550 A   n 
1  1551 C   n 
1  1552 G   n 
1  1553 C   n 
1  1554 C   n 
1  1555 G   n 
1  1556 G   n 
1  1557 G   n 
1  1558 C   n 
1  1559 A   n 
1  1560 U   n 
1  1561 U   n 
1  1562 C   n 
1  1563 G   n 
1  1564 C   n 
1  1565 C   n 
1  1566 C   n 
1  1567 G   n 
1  1568 G   n 
1  1569 U   n 
1  1570 C   n 
1  1571 G   n 
1  1572 A   n 
1  1573 A   n 
1  1574 C   n 
1  1575 C   n 
1  1576 G   n 
1  1577 U   n 
1  1578 C   n 
1  1579 C   n 
1  1580 A   n 
1  1581 A   n 
1  1582 C   n 
1  1583 U   n 
1  1584 C   n 
1  1585 C   n 
1  1586 G   n 
1  1587 U   n 
1  1588 G   n 
1  1589 G   n 
1  1590 A   n 
1  1591 A   n 
1  1592 G   n 
1  1593 C   n 
1  1594 C   n 
1  1595 G   n 
1  1596 U   n 
1  1597 A   n 
1  1598 A   n 
1  1599 U   n 
1  1600 G   n 
1  1601 G   n 
1  1602 C   n 
1  1603 A   n 
1  1604 G   n 
1  1605 G   n 
1  1606 A   n 
1  1607 A   n 
1  1608 G   n 
1  1609 C   n 
1  1610 G   n 
1  1611 G   n 
1  1612 A   n 
1  1613 C   n 
1  1614 G   n 
1  1615 A   n 
1  1616 A   n 
1  1617 C   n 
1  1618 G   n 
1  1619 G   n 
1  1620 C   n 
1  1621 G   n 
1  1622 G   n 
1  1623 C   n 
1  1624 A   n 
1  1625 U   n 
1  1626 A   n 
1  1627 G   n 
1  1628 G   n 
1  1629 G   n 
1  1630 A   n 
1  1631 A   n 
1  1632 A   n 
1  1633 C   n 
1  1634 G   n 
1  1635 U   n 
1  1636 G   n 
1  1637 A   n 
1  1638 U   n 
1  1639 U   n 
1  1640 C   n 
1  1641 A   n 
1  1642 A   n 
1  1643 C   n 
1  1644 C   n 
1  1645 U   n 
1  1646 G   n 
1  1647 G   n 
1  1648 G   n 
1  1649 G   n 
1  1650 C   n 
1  1651 C   n 
1  1652 C   n 
1  1653 A   n 
1  1654 U   n 
1  1655 G   n 
1  1656 A   n 
1  1657 A   n 
1  1658 A   n 
1  1659 A   n 
1  1660 G   n 
1  1661 A   n 
1  1662 C   n 
1  1663 G   n 
1  1664 A   n 
1  1665 G   n 
1  1666 C   n 
1  1667 A   n 
1  1668 U   n 
1  1669 G   n 
1  1670 A   n 
1  1671 U   n 
1  1672 G   n 
1  1673 U   n 
1  1674 C   n 
1  1675 C   n 
1  1676 G   n 
1  1677 U   n 
1  1678 A   n 
1  1679 C   n 
1  1680 C   n 
1  1681 G   n 
1  1682 A   n 
1  1683 G   n 
1  1684 A   n 
1  1685 A   n 
1  1686 C   n 
1  1687 C   n 
1  1688 G   n 
1  1689 A   n 
1  1690 C   n 
1  1691 A   n 
1  1692 C   n 
1  1693 A   n 
1  1694 G   n 
1  1695 G   n 
1  1696 U   n 
1  1697 G   n 
1  1698 U   n 
1  1699 C   n 
1  1700 C   n 
1  1701 A   n 
1  1702 U   n 
1  1703 G   n 
1  1704 G   n 
1  1705 C   n 
1  1706 G   n 
1  1707 G   n 
1  1708 C   n 
1  1709 G   n 
1  1710 A   n 
1  1711 A   n 
1  1712 A   n 
1  1713 G   n 
1  1714 C   n 
1  1715 C   n 
1  1716 A   n 
1  1717 A   n 
1  1718 G   n 
1  1719 G   n 
1  1720 C   n 
1  1721 C   n 
1  1722 U   n 
1  1723 G   n 
1  1724 U   n 
1  1725 C   n 
1  1726 G   n 
1  1727 G   n 
1  1728 G   n 
1  1729 A   n 
1  1730 G   n 
1  1731 C   n 
1  1732 A   n 
1  1733 A   n 
1  1734 C   n 
1  1735 C   n 
1  1736 A   n 
1  1737 A   n 
1  1738 C   n 
1  1739 G   n 
1  1740 U   n 
1  1741 U   n 
1  1742 A   n 
1  1743 G   n 
1  1744 G   n 
1  1745 G   n 
1  1746 A   n 
1  1747 A   n 
1  1748 U   n 
1  1749 U   n 
1  1750 C   n 
1  1751 G   n 
1  1752 G   n 
1  1753 C   n 
1  1754 A   n 
1  1755 A   n 
1  1756 G   n 
1  1757 U   n 
1  1758 U   n 
1  1759 A   n 
1  1760 G   n 
1  1761 U   n 
1  1762 C   n 
1  1763 C   n 
1  1764 C   n 
1  1765 G   n 
1  1766 U   n 
1  1767 A   n 
1  1768 C   n 
1  1769 C   n 
1  1770 U   n 
1  1771 U   n 
1  1772 C   n 
1  1773 G   n 
1  1774 G   n 
1  1775 A   n 
1  1776 A   n 
1  1777 G   n 
1  1778 A   n 
1  1779 A   n 
1  1780 G   n 
1  1781 G   n 
1  1782 G   n 
1  1783 A   n 
1  1784 U   n 
1  1785 G   n 
1  1786 C   n 
1  1787 C   n 
1  1788 U   n 
1  1789 G   n 
1  1790 C   n 
1  1791 U   n 
1  1792 C   n 
1  1793 C   n 
1  1794 G   n 
1  1795 G   n 
1  1796 A   n 
1  1797 A   n 
1  1798 C   n 
1  1799 G   n 
1  1800 G   n 
1  1801 A   n 
1  1802 G   n 
1  1803 C   n 
1  1804 A   n 
1  1805 G   n 
1  1806 G   n 
1  1807 U   n 
1  1808 C   n 
1  1809 G   n 
1  1810 C   n 
1  1811 A   n 
1  1812 G   n 
1  1813 U   n 
1  1814 G   n 
1  1815 A   n 
1  1816 C   n 
1  1817 U   n 
1  1818 C   n 
1  1819 G   n 
1  1820 G   n 
1  1821 A   n 
1  1822 A   n 
1  1823 G   n 
1  1824 C   n 
1  1825 U   n 
1  1826 C   n 
1  1827 G   n 
1  1828 G   n 
1  1829 A   n 
1  1830 C   n 
1  1831 U   n 
1  1832 G   n 
1  1833 U   n 
1  1834 C   n 
1  1835 U   n 
1  1836 A   n 
1  1837 G   n 
1  1838 U   n 
1  1839 A   n 
1  1840 A   n 
1  1841 C   n 
1  1842 A   n 
1  1843 A   n 
1  1844 C   n 
1  1845 A   n 
1  1846 U   n 
1  1847 A   n 
1  1848 G   n 
1  1849 G   n 
1  1850 U   n 
1  1851 G   n 
1  1852 A   n 
1  1853 C   n 
1  1854 C   n 
1  1855 G   n 
1  1856 C   n 
1  1857 A   n 
1  1858 A   n 
1  1859 A   n 
1  1860 U   n 
1  1861 C   n 
1  1862 C   n 
1  1863 G   n 
1  1864 C   n 
1  1865 A   n 
1  1866 A   n 
1  1867 G   n 
1  1868 G   n 
1  1869 A   n 
1  1870 C   n 
1  1871 U   n 
1  1872 C   n 
1  1873 G   n 
1  1874 U   n 
1  1875 A   n 
1  1876 C   n 
1  1877 G   n 
1  1878 G   n 
1  1879 U   n 
1  1880 C   n 
1  1881 A   n 
1  1882 C   n 
1  1883 U   n 
1  1884 G   n 
1  1885 A   n 
1  1886 A   n 
1  1887 U   n 
1  1888 C   n 
1  1889 C   n 
1  1890 U   n 
1  1891 G   n 
1  1892 C   n 
1  1893 C   n 
1  1894 C   n 
1  1895 A   n 
1  1896 G   n 
1  1897 U   n 
1  1898 G   n 
1  1899 C   n 
1  1900 A   n 
1  1901 G   n 
1  1902 G   n 
1  1903 U   n 
1  1904 A   n 
1  1905 U   n 
1  1906 C   n 
1  1907 U   n 
1  1908 G   n 
1  1909 A   n 
1  1910 A   n 
1  1911 C   n 
1  1912 A   n 
1  1913 C   n 
1  1914 C   n 
1  1915 U   n 
1  1916 C   n 
1  1917 G   n 
1  1918 U   n 
1  1919 A   n 
1  1920 C   n 
1  1921 A   n 
1  1922 A   n 
1  1923 G   n 
1  1924 A   n 
1  1925 G   n 
1  1926 G   n 
1  1927 A   n 
1  1928 C   n 
1  1929 G   n 
1  1930 A   n 
1  1931 A   n 
1  1932 G   n 
1  1933 G   n 
1  1934 A   n 
1  1935 C   n 
1  1936 C   n 
1  1937 U   n 
1  1938 G   n 
1  1939 U   n 
1  1940 C   n 
1  1941 A   n 
1  1942 A   n 
1  1943 C   n 
1  1944 G   n 
1  1945 G   n 
1  1946 C   n 
1  1947 G   n 
1  1948 G   n 
1  1949 G   n 
1  1950 G   n 
1  1951 G   n 
1  1952 U   n 
1  1953 A   n 
1  1954 A   n 
1  1955 C   n 
1  1956 U   n 
1  1957 A   n 
1  1958 U   n 
1  1959 G   n 
1  1960 A   n 
1  1961 C   n 
1  1962 C   n 
1  1963 C   n 
1  1964 U   n 
1  1965 C   n 
1  1966 U   n 
1  1967 U   n 
1  1968 A   n 
1  1969 A   n 
1  1970 G   n 
1  1971 G   n 
1  1972 U   n 
1  1973 A   n 
1  1974 G   n 
1  1975 C   n 
1  1976 G   n 
1  1977 U   n 
1  1978 A   n 
1  1979 G   n 
1  1980 U   n 
1  1981 A   n 
1  1982 C   n 
1  1983 C   n 
1  1984 U   n 
1  1985 U   n 
1  1986 G   n 
1  1987 C   n 
1  1988 C   n 
1  1989 G   n 
1  1990 C   n 
1  1991 A   n 
1  1992 U   n 
1  1993 C   n 
1  1994 A   n 
1  1995 G   n 
1  1996 U   n 
1  1997 A   n 
1  1998 G   n 
1  1999 C   n 
1  2000 G   n 
1  2001 G   n 
1  2002 C   n 
1  2003 U   n 
1  2004 U   n 
1  2005 G   n 
1  2006 C   n 
1  2007 A   n 
1  2008 U   n 
1  2009 G   n 
1  2010 A   n 
1  2011 A   n 
1  2012 U   n 
1  2013 G   n 
1  2014 G   n 
1  2015 A   n 
1  2016 U   n 
1  2017 U   n 
1  2018 A   n 
1  2019 A   n 
1  2020 C   n 
1  2021 C   n 
1  2022 A   n 
1  2023 G   n 
1  2024 A   n 
1  2025 G   n 
1  2026 C   n 
1  2027 U   n 
1  2028 U   n 
1  2029 C   n 
1  2030 A   n 
1  2031 C   n 
1  2032 U   n 
1  2033 G   n 
1  2034 U   n 
1  2035 C   n 
1  2036 C   n 
1  2037 C   n 
1  2038 A   n 
1  2039 A   n 
1  2040 C   n 
1  2041 G   n 
1  2042 U   n 
1  2043 U   n 
1  2044 G   n 
1  2045 G   n 
1  2046 G   n 
1  2047 C   n 
1  2048 C   n 
1  2049 C   n 
1  2050 G   n 
1  2051 G   n 
1  2052 U   n 
1  2053 G   n 
1  2054 A   n 
1  2055 A   n 
1  2056 C   n 
1  2057 U   n 
1  2058 G   n 
1  2059 U   n 
1  2060 A   n 
1  2061 C   n 
1  2062 A   n 
1  2063 U   n 
1  2064 U   n 
1  2065 C   n 
1  2066 C   n 
1  2067 A   n 
1  2068 G   n 
1  2069 U   n 
1  2070 G   n 
1  2071 C   n 
1  2072 G   n 
1  2073 G   n 
1  2074 A   n 
1  2075 G   n 
1  2076 U   n 
1  2077 C   n 
1  2078 U   n 
1  2079 G   n 
1  2080 G   n 
1  2081 A   n 
1  2082 G   n 
1  2083 A   n 
1  2084 C   n 
1  2085 A   n 
1  2086 C   n 
1  2087 C   n 
1  2088 C   n 
1  2089 A   n 
1  2090 G   n 
1  2091 G   n 
1  2092 G   n 
1  2093 G   n 
1  2094 G   n 
1  2095 A   n 
1  2096 A   n 
1  2097 G   n 
1  2098 C   n 
1  2099 A   n 
1  2100 A   n 
1  2101 A   n 
1  2102 G   n 
1  2103 A   n 
1  2104 C   n 
1  2105 C   n 
1  2106 C   n 
1  2107 U   n 
1  2108 A   n 
1  2109 U   n 
1  2110 G   n 
1  2111 G   n 
1  2112 A   n 
1  2113 G   n 
1  2114 C   n 
1  2115 U   n 
1  2116 U   n 
1  2117 U   n 
1  2118 A   n 
1  2119 C   n 
1  2120 U   n 
1  2121 G   n 
1  2122 C   n 
1  2123 A   n 
1  2124 G   n 
1  2125 G   n 
1  2126 C   n 
1  2127 U   n 
1  2128 G   n 
1  2129 U   n 
1  2130 C   n 
1  2131 G   n 
1  2132 C   n 
1  2133 U   n 
1  2134 G   n 
1  2135 A   n 
1  2136 G   n 
1  2137 A   n 
1  2138 C   n 
1  2139 G   n 
1  2140 U   n 
1  2141 G   n 
1  2142 G   n 
1  2143 U   n 
1  2144 C   n 
1  2145 G   n 
1  2146 C   n 
1  2147 C   n 
1  2148 G   n 
1  2149 A   n 
1  2150 U   n 
1  2151 G   n 
1  2152 U   n 
1  2153 G   n 
1  2154 C   n 
1  2155 A   n 
1  2156 G   n 
1  2157 C   n 
1  2158 A   n 
1  2159 U   n 
1  2160 A   n 
1  2161 G   n 
1  2162 G   n 
1  2163 U   n 
1  2164 A   n 
1  2165 G   n 
1  2166 G   n 
1  2167 A   n 
1  2168 G   n 
1  2169 U   n 
1  2170 C   n 
1  2171 G   n 
1  2172 U   n 
1  2173 U   n 
1  2174 A   n 
1  2175 C   n 
1  2176 A   n 
1  2177 G   n 
1  2178 A   n 
1  2179 G   n 
1  2180 G   n 
1  2181 U   n 
1  2182 A   n 
1  2183 C   n 
1  2184 C   n 
1  2185 C   n 
1  2186 G   n 
1  2187 C   n 
1  2188 G   n 
1  2189 C   n 
1  2190 U   n 
1  2191 A   n 
1  2192 G   n 
1  2193 C   n 
1  2194 G   n 
1  2195 G   n 
1  2196 G   n 
1  2197 C   n 
1  2198 C   n 
1  2199 A   n 
1  2200 C   n 
1  2201 C   n 
1  2202 C   n 
1  2203 A   n 
1  2204 G   n 
1  2205 A   n 
1  2206 C   n 
1  2207 A   n 
1  2208 A   n 
1  2209 C   n 
1  2210 A   n 
1  2211 G   n 
1  2212 U   n 
1  2213 G   n 
1  2214 A   n 
1  2215 A   n 
1  2216 A   n 
1  2217 U   n 
1  2218 A   n 
1  2219 C   n 
1  2220 U   n 
1  2221 A   n 
1  2222 C   n 
1  2223 C   n 
1  2224 C   n 
1  2225 G   n 
1  2226 U   n 
1  2227 C   n 
1  2228 G   n 
1  2229 G   n 
1  2230 U   n 
1  2231 G   n 
1  2232 A   n 
1  2233 C   n 
1  2234 U   n 
1  2235 G   n 
1  2236 C   n 
1  2237 G   n 
1  2238 A   n 
1  2239 C   n 
1  2240 U   n 
1  2241 C   n 
1  2242 U   n 
1  2243 C   n 
1  2244 A   n 
1  2245 C   n 
1  2246 U   n 
1  2247 C   n 
1  2248 C   n 
1  2249 G   n 
1  2250 G   n 
1  2251 G   n 
1  2252 A   n 
1  2253 G   n 
1  2254 G   n 
1  2255 A   n 
1  2256 G   n 
1  2257 G   n 
1  2258 A   n 
1  2259 C   n 
1  2260 A   n 
1  2261 C   n 
1  2262 C   n 
1  2263 G   n 
1  2264 A   n 
1  2265 U   n 
1  2266 A   n 
1  2267 G   n 
1  2268 C   n 
1  2269 C   n 
1  2270 G   n 
1  2271 G   n 
1  2272 G   n 
1  2273 C   n 
1  2274 A   n 
1  2275 G   n 
1  2276 U   n 
1  2277 U   n 
1  2278 U   n 
1  2279 G   n 
1  2280 A   n 
1  2281 C   n 
1  2282 U   n 
1  2283 G   n 
1  2284 G   n 
1  2285 G   n 
1  2286 G   n 
1  2287 C   n 
1  2288 G   n 
1  2289 G   n 
1  2290 U   n 
1  2291 A   n 
1  2292 C   n 
1  2293 G   n 
1  2294 C   n 
1  2295 G   n 
1  2296 C   n 
1  2297 U   n 
1  2298 C   n 
1  2299 G   n 
1  2300 A   n 
1  2301 A   n 
1  2302 A   n 
1  2303 A   n 
1  2304 G   n 
1  2305 A   n 
1  2306 U   n 
1  2307 A   n 
1  2308 U   n 
1  2309 C   n 
1  2310 G   n 
1  2311 A   n 
1  2312 G   n 
1  2313 C   n 
1  2314 G   n 
1  2315 C   n 
1  2316 G   n 
1  2317 C   n 
1  2318 C   n 
1  2319 C   n 
1  2320 U   n 
1  2321 A   n 
1  2322 U   n 
1  2323 G   n 
1  2324 G   n 
1  2325 U   n 
1  2326 C   n 
1  2327 A   n 
1  2328 U   n 
1  2329 C   n 
1  2330 U   n 
1  2331 C   n 
1  2332 A   n 
1  2333 G   n 
1  2334 C   n 
1  2335 C   n 
1  2336 G   n 
1  2337 G   n 
1  2338 G   n 
1  2339 A   n 
1  2340 C   n 
1  2341 A   n 
1  2342 G   n 
1  2343 A   n 
1  2344 G   n 
1  2345 A   n 
1  2346 C   n 
1  2347 C   n 
1  2348 C   n 
1  2349 G   n 
1  2350 G   n 
1  2351 C   n 
1  2352 G   n 
1  2353 A   n 
1  2354 A   n 
1  2355 G   n 
1  2356 A   n 
1  2357 G   n 
1  2358 U   n 
1  2359 G   n 
1  2360 C   n 
1  2361 A   n 
1  2362 A   n 
1  2363 G   n 
1  2364 A   n 
1  2365 G   n 
1  2366 C   n 
1  2367 A   n 
1  2368 A   n 
1  2369 A   n 
1  2370 A   n 
1  2371 G   n 
1  2372 A   n 
1  2373 U   n 
1  2374 G   n 
1  2375 A   n 
1  2376 C   n 
1  2377 U   n 
1  2378 U   n 
1  2379 G   n 
1  2380 A   n 
1  2381 C   n 
1  2382 A   n 
1  2383 G   n 
1  2384 U   n 
1  2385 G   n 
1  2386 U   n 
1  2387 U   n 
1  2388 C   n 
1  2389 U   n 
1  2390 U   n 
1  2391 C   n 
1  2392 C   n 
1  2393 C   n 
1  2394 A   n 
1  2395 A   n 
1  2396 C   n 
1  2397 G   n 
1  2398 A   n 
1  2399 G   n 
1  2400 G   n 
1  2401 A   n 
1  2402 A   n 
1  2403 C   n 
1  2404 G   n 
1  2405 C   n 
1  2406 U   n 
1  2407 G   n 
1  2408 A   n 
1  2409 C   n 
1  2410 G   n 
1  2411 C   n 
1  2412 G   n 
1  2413 A   n 
1  2414 A   n 
1  2415 A   n 
1  2416 G   n 
1  2417 C   n 
1  2418 G   n 
1  2419 U   n 
1  2420 G   n 
1  2421 G   n 
1  2422 U   n 
1  2423 C   n 
1  2424 U   n 
1  2425 A   n 
1  2426 G   n 
1  2427 C   n 
1  2428 G   n 
1  2429 A   n 
1  2430 A   n 
1  2431 C   n 
1  2432 C   n 
1  2433 A   n 
1  2434 A   n 
1  2435 U   n 
1  2436 U   n 
1  2437 A   n 
1  2438 G   n 
1  2439 C   n 
1  2440 C   n 
1  2441 U   n 
1  2442 G   n 
1  2443 C   n 
1  2444 U   n 
1  2445 U   n 
1  2446 G   n 
1  2447 A   n 
1  2448 U   n 
1  2449 G   n 
1  2450 C   n 
1  2451 G   n 
1  2452 G   n 
1  2453 G   n 
1  2454 C   n 
1  2455 A   n 
1  2456 A   n 
1  2457 U   n 
1  2458 U   n 
1  2459 G   n 
1  2460 A   n 
1  2461 U   n 
1  2462 G   n 
1  2463 A   n 
1  2464 C   n 
1  2465 A   n 
1  2466 G   n 
1  2467 A   n 
1  2468 A   n 
1  2469 A   n 
1  2470 A   n 
1  2471 G   n 
1  2472 C   n 
1  2473 U   n 
1  2474 A   n 
1  2475 C   n 
1  2476 C   n 
1  2477 C   n 
1  2478 U   n 
1  2479 A   n 
1  2480 G   n 
1  2481 G   n 
1  2482 G   n 
1  2483 A   n 
1  2484 U   n 
1  2485 A   n 
1  2486 A   n 
1  2487 C   n 
1  2488 A   n 
1  2489 G   n 
1  2490 A   n 
1  2491 G   n 
1  2492 U   n 
1  2493 C   n 
1  2494 G   n 
1  2495 U   n 
1  2496 C   n 
1  2497 A   n 
1  2498 C   n 
1  2499 U   n 
1  2500 C   n 
1  2501 G   n 
1  2502 C   n 
1  2503 A   n 
1  2504 A   n 
1  2505 G   n 
1  2506 A   n 
1  2507 G   n 
1  2508 C   n 
1  2509 A   n 
1  2510 C   n 
1  2511 A   n 
1  2512 U   n 
1  2513 A   n 
1  2514 U   n 
1  2515 C   n 
1  2516 G   n 
1  2517 A   n 
1  2518 C   n 
1  2519 C   n 
1  2520 G   n 
1  2521 A   n 
1  2522 G   n 
1  2523 U   n 
1  2524 G   n 
1  2525 G   n 
1  2526 C   n 
1  2527 U   n 
1  2528 U   n 
1  2529 G   n 
1  2530 C   n 
1  2531 U   n 
1  2532 A   n 
1  2533 C   n 
1  2534 C   n 
1  2535 U   n 
1  2536 C   n 
1  2537 G   n 
1  2538 A   n 
1  2539 U   n 
1  2540 G   n 
1  2541 U   n 
1  2542 C   n 
1  2543 G   n 
1  2544 G   n 
1  2545 U   n 
1  2546 U   n 
1  2547 C   n 
1  2548 C   n 
1  2549 C   n 
1  2550 U   n 
1  2551 C   n 
1  2552 C   n 
1  2553 A   n 
1  2554 U   n 
1  2555 C   n 
1  2556 C   n 
1  2557 U   n 
1  2558 G   n 
1  2559 C   n 
1  2560 C   n 
1  2561 C   n 
1  2562 G   n 
1  2563 U   n 
1  2564 G   n 
1  2565 C   n 
1  2566 A   n 
1  2567 G   n 
1  2568 A   n 
1  2569 A   n 
1  2570 G   n 
1  2571 C   n 
1  2572 G   n 
1  2573 G   n 
1  2574 G   n 
1  2575 C   n 
1  2576 A   n 
1  2577 A   n 
1  2578 G   n 
1  2579 G   n 
1  2580 G   n 
1  2581 U   n 
1  2582 G   n 
1  2583 A   n 
1  2584 G   n 
1  2585 G   n 
1  2586 U   n 
1  2587 OMU n 
1  2588 OMG n 
1  2589 U   n 
1  2590 U   n 
1  2591 C   n 
1  2592 G   n 
1  2593 C   n 
1  2594 C   n 
1  2595 U   n 
1  2596 A   n 
1  2597 U   n 
1  2598 U   n 
1  2599 A   n 
1  2600 A   n 
1  2601 A   n 
1  2602 G   n 
1  2603 G   n 
1  2604 A   n 
1  2605 G   n 
1  2606 G   n 
1  2607 U   n 
1  2608 C   n 
1  2609 G   n 
1  2610 U   n 
1  2611 G   n 
1  2612 A   n 
1  2613 G   n 
1  2614 C   n 
1  2615 U   n 
1  2616 G   n 
1  2617 G   n 
1  2618 G   n 
1  2619 UR3 n 
1  2620 U   n 
1  2621 PSU n 
1  2622 A   n 
1  2623 G   n 
1  2624 A   n 
1  2625 C   n 
1  2626 C   n 
1  2627 G   n 
1  2628 U   n 
1  2629 C   n 
1  2630 G   n 
1  2631 U   n 
1  2632 G   n 
1  2633 A   n 
1  2634 G   n 
1  2635 A   n 
1  2636 C   n 
1  2637 A   n 
1  2638 G   n 
1  2639 G   n 
1  2640 U   n 
1  2641 C   n 
1  2642 G   n 
1  2643 G   n 
1  2644 C   n 
1  2645 U   n 
1  2646 G   n 
1  2647 C   n 
1  2648 U   n 
1  2649 A   n 
1  2650 U   n 
1  2651 C   n 
1  2652 U   n 
1  2653 A   n 
1  2654 C   n 
1  2655 U   n 
1  2656 G   n 
1  2657 G   n 
1  2658 G   n 
1  2659 U   n 
1  2660 G   n 
1  2661 U   n 
1  2662 G   n 
1  2663 U   n 
1  2664 A   n 
1  2665 A   n 
1  2666 U   n 
1  2667 G   n 
1  2668 G   n 
1  2669 U   n 
1  2670 G   n 
1  2671 U   n 
1  2672 C   n 
1  2673 U   n 
1  2674 G   n 
1  2675 A   n 
1  2676 C   n 
1  2677 A   n 
1  2678 A   n 
1  2679 G   n 
1  2680 A   n 
1  2681 A   n 
1  2682 C   n 
1  2683 G   n 
1  2684 A   n 
1  2685 C   n 
1  2686 C   n 
1  2687 G   n 
1  2688 U   n 
1  2689 A   n 
1  2690 U   n 
1  2691 A   n 
1  2692 G   n 
1  2693 U   n 
1  2694 A   n 
1  2695 C   n 
1  2696 G   n 
1  2697 A   n 
1  2698 G   n 
1  2699 A   n 
1  2700 G   n 
1  2701 G   n 
1  2702 A   n 
1  2703 A   n 
1  2704 C   n 
1  2705 U   n 
1  2706 A   n 
1  2707 C   n 
1  2708 G   n 
1  2709 G   n 
1  2710 U   n 
1  2711 U   n 
1  2712 G   n 
1  2713 G   n 
1  2714 U   n 
1  2715 G   n 
1  2716 G   n 
1  2717 C   n 
1  2718 C   n 
1  2719 A   n 
1  2720 C   n 
1  2721 U   n 
1  2722 G   n 
1  2723 G   n 
1  2724 U   n 
1  2725 G   n 
1  2726 U   n 
1  2727 A   n 
1  2728 C   n 
1  2729 C   n 
1  2730 G   n 
1  2731 G   n 
1  2732 U   n 
1  2733 U   n 
1  2734 G   n 
1  2735 U   n 
1  2736 U   n 
1  2737 C   n 
1  2738 G   n 
1  2739 A   n 
1  2740 G   n 
1  2741 A   n 
1  2742 G   n 
1  2743 A   n 
1  2744 G   n 
1  2745 C   n 
1  2746 A   n 
1  2747 C   n 
1  2748 G   n 
1  2749 U   n 
1  2750 G   n 
1  2751 C   n 
1  2752 C   n 
1  2753 G   n 
1  2754 G   n 
1  2755 G   n 
1  2756 U   n 
1  2757 A   n 
1  2758 G   n 
1  2759 C   n 
1  2760 C   n 
1  2761 A   n 
1  2762 C   n 
1  2763 G   n 
1  2764 C   n 
1  2765 C   n 
1  2766 A   n 
1  2767 C   n 
1  2768 A   n 
1  2769 C   n 
1  2770 G   n 
1  2771 G   n 
1  2772 G   n 
1  2773 G   n 
1  2774 U   n 
1  2775 A   n 
1  2776 A   n 
1  2777 G   n 
1  2778 A   n 
1  2779 G   n 
1  2780 C   n 
1  2781 U   n 
1  2782 G   n 
1  2783 A   n 
1  2784 A   n 
1  2785 C   n 
1  2786 G   n 
1  2787 C   n 
1  2788 A   n 
1  2789 U   n 
1  2790 C   n 
1  2791 U   n 
1  2792 A   n 
1  2793 A   n 
1  2794 G   n 
1  2795 C   n 
1  2796 U   n 
1  2797 C   n 
1  2798 G   n 
1  2799 A   n 
1  2800 A   n 
1  2801 A   n 
1  2802 C   n 
1  2803 C   n 
1  2804 C   n 
1  2805 A   n 
1  2806 C   n 
1  2807 U   n 
1  2808 U   n 
1  2809 G   n 
1  2810 G   n 
1  2811 A   n 
1  2812 A   n 
1  2813 A   n 
1  2814 A   n 
1  2815 G   n 
1  2816 A   n 
1  2817 G   n 
1  2818 A   n 
1  2819 C   n 
1  2820 A   n 
1  2821 C   n 
1  2822 C   n 
1  2823 G   n 
1  2824 C   n 
1  2825 C   n 
1  2826 G   n 
1  2827 A   n 
1  2828 G   n 
1  2829 G   n 
1  2830 U   n 
1  2831 C   n 
1  2832 C   n 
1  2833 C   n 
1  2834 G   n 
1  2835 C   n 
1  2836 G   n 
1  2837 U   n 
1  2838 A   n 
1  2839 C   n 
1  2840 A   n 
1  2841 A   n 
1  2842 G   n 
1  2843 A   n 
1  2844 C   n 
1  2845 G   n 
1  2846 C   n 
1  2847 G   n 
1  2848 G   n 
1  2849 U   n 
1  2850 C   n 
1  2851 G   n 
1  2852 A   n 
1  2853 U   n 
1  2854 A   n 
1  2855 G   n 
1  2856 A   n 
1  2857 C   n 
1  2858 U   n 
1  2859 C   n 
1  2860 G   n 
1  2861 G   n 
1  2862 G   n 
1  2863 G   n 
1  2864 U   n 
1  2865 G   n 
1  2866 U   n 
1  2867 G   n 
1  2868 C   n 
1  2869 G   n 
1  2870 C   n 
1  2871 G   n 
1  2872 U   n 
1  2873 C   n 
1  2874 G   n 
1  2875 A   n 
1  2876 G   n 
1  2877 G   n 
1  2878 U   n 
1  2879 A   n 
1  2880 A   n 
1  2881 C   n 
1  2882 G   n 
1  2883 A   n 
1  2884 G   n 
1  2885 A   n 
1  2886 C   n 
1  2887 G   n 
1  2888 U   n 
1  2889 U   n 
1  2890 A   n 
1  2891 A   n 
1  2892 G   n 
1  2893 C   n 
1  2894 C   n 
1  2895 C   n 
1  2896 A   n 
1  2897 C   n 
1  2898 G   n 
1  2899 A   n 
1  2900 G   n 
1  2901 C   n 
1  2902 A   n 
1  2903 C   n 
1  2904 U   n 
1  2905 A   n 
1  2906 A   n 
1  2907 C   n 
1  2908 A   n 
1  2909 G   n 
1  2910 A   n 
1  2911 C   n 
1  2912 C   n 
1  2913 A   n 
1  2914 A   n 
1  2915 A   n 
1  2916 G   n 
1  2917 C   n 
1  2918 C   n 
1  2919 A   n 
1  2920 U   n 
1  2921 C   n 
1  2922 A   n 
2  1    U   n 
2  2    U   n 
2  3    A   n 
2  4    G   n 
2  5    G   n 
2  6    C   n 
2  7    G   n 
2  8    G   n 
2  9    C   n 
2  10   C   n 
2  11   A   n 
2  12   C   n 
2  13   A   n 
2  14   G   n 
2  15   C   n 
2  16   G   n 
2  17   G   n 
2  18   U   n 
2  19   G   n 
2  20   G   n 
2  21   G   n 
2  22   G   n 
2  23   U   n 
2  24   U   n 
2  25   G   n 
2  26   C   n 
2  27   C   n 
2  28   U   n 
2  29   C   n 
2  30   C   n 
2  31   C   n 
2  32   G   n 
2  33   U   n 
2  34   A   n 
2  35   C   n 
2  36   C   n 
2  37   C   n 
2  38   A   n 
2  39   U   n 
2  40   C   n 
2  41   C   n 
2  42   C   n 
2  43   G   n 
2  44   A   n 
2  45   A   n 
2  46   C   n 
2  47   A   n 
2  48   C   n 
2  49   G   n 
2  50   G   n 
2  51   A   n 
2  52   A   n 
2  53   G   n 
2  54   A   n 
2  55   U   n 
2  56   A   n 
2  57   A   n 
2  58   G   n 
2  59   C   n 
2  60   C   n 
2  61   C   n 
2  62   A   n 
2  63   C   n 
2  64   C   n 
2  65   A   n 
2  66   G   n 
2  67   C   n 
2  68   G   n 
2  69   U   n 
2  70   U   n 
2  71   C   n 
2  72   C   n 
2  73   A   n 
2  74   G   n 
2  75   G   n 
2  76   G   n 
2  77   A   n 
2  78   G   n 
2  79   U   n 
2  80   A   n 
2  81   C   n 
2  82   U   n 
2  83   G   n 
2  84   G   n 
2  85   A   n 
2  86   G   n 
2  87   U   n 
2  88   G   n 
2  89   C   n 
2  90   G   n 
2  91   C   n 
2  92   G   n 
2  93   A   n 
2  94   G   n 
2  95   C   n 
2  96   C   n 
2  97   U   n 
2  98   C   n 
2  99   U   n 
2  100  G   n 
2  101  G   n 
2  102  G   n 
2  103  A   n 
2  104  A   n 
2  105  A   n 
2  106  U   n 
2  107  C   n 
2  108  C   n 
2  109  G   n 
2  110  G   n 
2  111  U   n 
2  112  U   n 
2  113  C   n 
2  114  G   n 
2  115  C   n 
2  116  C   n 
2  117  G   n 
2  118  C   n 
2  119  C   n 
2  120  A   n 
2  121  C   n 
2  122  C   n 
3  1    MET n 
3  2    GLY n 
3  3    ARG n 
3  4    ARG n 
3  5    ILE n 
3  6    GLN n 
3  7    GLY n 
3  8    GLN n 
3  9    ARG n 
3  10   ARG n 
3  11   GLY n 
3  12   ARG n 
3  13   GLY n 
3  14   THR n 
3  15   SER n 
3  16   THR n 
3  17   PHE n 
3  18   ARG n 
3  19   ALA n 
3  20   PRO n 
3  21   SER n 
3  22   HIS n 
3  23   ARG n 
3  24   TYR n 
3  25   LYS n 
3  26   ALA n 
3  27   ASP n 
3  28   LEU n 
3  29   GLU n 
3  30   HIS n 
3  31   ARG n 
3  32   LYS n 
3  33   VAL n 
3  34   GLU n 
3  35   ASP n 
3  36   GLY n 
3  37   ASP n 
3  38   VAL n 
3  39   ILE n 
3  40   ALA n 
3  41   GLY n 
3  42   THR n 
3  43   VAL n 
3  44   VAL n 
3  45   ASP n 
3  46   ILE n 
3  47   GLU n 
3  48   HIS n 
3  49   ASP n 
3  50   PRO n 
3  51   ALA n 
3  52   ARG n 
3  53   SER n 
3  54   ALA n 
3  55   PRO n 
3  56   VAL n 
3  57   ALA n 
3  58   ALA n 
3  59   VAL n 
3  60   GLU n 
3  61   PHE n 
3  62   GLU n 
3  63   ASP n 
3  64   GLY n 
3  65   ASP n 
3  66   ARG n 
3  67   ARG n 
3  68   LEU n 
3  69   ILE n 
3  70   LEU n 
3  71   ALA n 
3  72   PRO n 
3  73   GLU n 
3  74   GLY n 
3  75   VAL n 
3  76   GLY n 
3  77   VAL n 
3  78   GLY n 
3  79   ASP n 
3  80   GLU n 
3  81   LEU n 
3  82   GLN n 
3  83   VAL n 
3  84   GLY n 
3  85   VAL n 
3  86   SER n 
3  87   ALA n 
3  88   GLU n 
3  89   ILE n 
3  90   ALA n 
3  91   PRO n 
3  92   GLY n 
3  93   ASN n 
3  94   THR n 
3  95   LEU n 
3  96   PRO n 
3  97   LEU n 
3  98   ALA n 
3  99   GLU n 
3  100  ILE n 
3  101  PRO n 
3  102  GLU n 
3  103  GLY n 
3  104  VAL n 
3  105  PRO n 
3  106  VAL n 
3  107  CYS n 
3  108  ASN n 
3  109  VAL n 
3  110  GLU n 
3  111  SER n 
3  112  SER n 
3  113  PRO n 
3  114  GLY n 
3  115  ASP n 
3  116  GLY n 
3  117  GLY n 
3  118  LYS n 
3  119  PHE n 
3  120  ALA n 
3  121  ARG n 
3  122  ALA n 
3  123  SER n 
3  124  GLY n 
3  125  VAL n 
3  126  ASN n 
3  127  ALA n 
3  128  GLN n 
3  129  LEU n 
3  130  LEU n 
3  131  THR n 
3  132  HIS n 
3  133  ASP n 
3  134  ARG n 
3  135  ASN n 
3  136  VAL n 
3  137  ALA n 
3  138  VAL n 
3  139  VAL n 
3  140  LYS n 
3  141  LEU n 
3  142  PRO n 
3  143  SER n 
3  144  GLY n 
3  145  GLU n 
3  146  MET n 
3  147  LYS n 
3  148  ARG n 
3  149  LEU n 
3  150  ASP n 
3  151  PRO n 
3  152  GLN n 
3  153  CYS n 
3  154  ARG n 
3  155  ALA n 
3  156  THR n 
3  157  ILE n 
3  158  GLY n 
3  159  VAL n 
3  160  VAL n 
3  161  ALA n 
3  162  GLY n 
3  163  GLY n 
3  164  GLY n 
3  165  ARG n 
3  166  THR n 
3  167  ASP n 
3  168  LYS n 
3  169  PRO n 
3  170  PHE n 
3  171  VAL n 
3  172  LYS n 
3  173  ALA n 
3  174  GLY n 
3  175  ASN n 
3  176  LYS n 
3  177  HIS n 
3  178  HIS n 
3  179  LYS n 
3  180  MET n 
3  181  LYS n 
3  182  ALA n 
3  183  ARG n 
3  184  GLY n 
3  185  THR n 
3  186  LYS n 
3  187  TRP n 
3  188  PRO n 
3  189  ASN n 
3  190  VAL n 
3  191  ARG n 
3  192  GLY n 
3  193  VAL n 
3  194  ALA n 
3  195  MET n 
3  196  ASN n 
3  197  ALA n 
3  198  VAL n 
3  199  ASP n 
3  200  HIS n 
3  201  PRO n 
3  202  PHE n 
3  203  GLY n 
3  204  GLY n 
3  205  GLY n 
3  206  GLY n 
3  207  ARG n 
3  208  GLN n 
3  209  HIS n 
3  210  PRO n 
3  211  GLY n 
3  212  LYS n 
3  213  PRO n 
3  214  LYS n 
3  215  SER n 
3  216  ILE n 
3  217  SER n 
3  218  ARG n 
3  219  ASN n 
3  220  ALA n 
3  221  PRO n 
3  222  PRO n 
3  223  GLY n 
3  224  ARG n 
3  225  LYS n 
3  226  VAL n 
3  227  GLY n 
3  228  ASP n 
3  229  ILE n 
3  230  ALA n 
3  231  SER n 
3  232  LYS n 
3  233  ARG n 
3  234  THR n 
3  235  GLY n 
3  236  ARG n 
3  237  GLY n 
3  238  GLY n 
3  239  ASN n 
3  240  GLU n 
4  1    MET n 
4  2    PRO n 
4  3    GLN n 
4  4    PRO n 
4  5    SER n 
4  6    ARG n 
4  7    PRO n 
4  8    ARG n 
4  9    LYS n 
4  10   GLY n 
4  11   SER n 
4  12   LEU n 
4  13   GLY n 
4  14   PHE n 
4  15   GLY n 
4  16   PRO n 
4  17   ARG n 
4  18   LYS n 
4  19   ARG n 
4  20   SER n 
4  21   THR n 
4  22   SER n 
4  23   GLU n 
4  24   THR n 
4  25   PRO n 
4  26   ARG n 
4  27   PHE n 
4  28   ASN n 
4  29   SER n 
4  30   TRP n 
4  31   PRO n 
4  32   SER n 
4  33   ASP n 
4  34   ASP n 
4  35   GLY n 
4  36   GLN n 
4  37   PRO n 
4  38   GLY n 
4  39   VAL n 
4  40   GLN n 
4  41   GLY n 
4  42   PHE n 
4  43   ALA n 
4  44   GLY n 
4  45   TYR n 
4  46   LYS n 
4  47   ALA n 
4  48   GLY n 
4  49   MET n 
4  50   THR n 
4  51   HIS n 
4  52   VAL n 
4  53   VAL n 
4  54   LEU n 
4  55   VAL n 
4  56   ASN n 
4  57   ASP n 
4  58   GLU n 
4  59   PRO n 
4  60   ASN n 
4  61   SER n 
4  62   PRO n 
4  63   ARG n 
4  64   GLU n 
4  65   GLY n 
4  66   MET n 
4  67   GLU n 
4  68   GLU n 
4  69   THR n 
4  70   VAL n 
4  71   PRO n 
4  72   VAL n 
4  73   THR n 
4  74   VAL n 
4  75   ILE n 
4  76   GLU n 
4  77   THR n 
4  78   PRO n 
4  79   PRO n 
4  80   MET n 
4  81   ARG n 
4  82   ALA n 
4  83   VAL n 
4  84   ALA n 
4  85   LEU n 
4  86   ARG n 
4  87   ALA n 
4  88   TYR n 
4  89   GLU n 
4  90   ASP n 
4  91   THR n 
4  92   PRO n 
4  93   TYR n 
4  94   GLY n 
4  95   GLN n 
4  96   ARG n 
4  97   PRO n 
4  98   LEU n 
4  99   THR n 
4  100  GLU n 
4  101  VAL n 
4  102  TRP n 
4  103  THR n 
4  104  ASP n 
4  105  GLU n 
4  106  PHE n 
4  107  HIS n 
4  108  SER n 
4  109  GLU n 
4  110  LEU n 
4  111  ASP n 
4  112  ARG n 
4  113  THR n 
4  114  LEU n 
4  115  ASP n 
4  116  VAL n 
4  117  PRO n 
4  118  GLU n 
4  119  ASP n 
4  120  HIS n 
4  121  ASP n 
4  122  PRO n 
4  123  ASP n 
4  124  ALA n 
4  125  ALA n 
4  126  GLU n 
4  127  GLU n 
4  128  GLN n 
4  129  ILE n 
4  130  ARG n 
4  131  ASP n 
4  132  ALA n 
4  133  HIS n 
4  134  GLU n 
4  135  ALA n 
4  136  GLY n 
4  137  ASP n 
4  138  LEU n 
4  139  GLY n 
4  140  ASP n 
4  141  LEU n 
4  142  ARG n 
4  143  LEU n 
4  144  ILE n 
4  145  THR n 
4  146  HIS n 
4  147  THR n 
4  148  VAL n 
4  149  PRO n 
4  150  ASP n 
4  151  ALA n 
4  152  VAL n 
4  153  PRO n 
4  154  SER n 
4  155  VAL n 
4  156  PRO n 
4  157  LYS n 
4  158  LYS n 
4  159  LYS n 
4  160  PRO n 
4  161  ASP n 
4  162  VAL n 
4  163  MET n 
4  164  GLU n 
4  165  THR n 
4  166  ARG n 
4  167  VAL n 
4  168  GLY n 
4  169  GLY n 
4  170  GLY n 
4  171  SER n 
4  172  VAL n 
4  173  SER n 
4  174  ASP n 
4  175  ARG n 
4  176  LEU n 
4  177  ASP n 
4  178  HIS n 
4  179  ALA n 
4  180  LEU n 
4  181  ASP n 
4  182  ILE n 
4  183  VAL n 
4  184  GLU n 
4  185  ASP n 
4  186  GLY n 
4  187  GLY n 
4  188  GLU n 
4  189  HIS n 
4  190  ALA n 
4  191  MET n 
4  192  ASN n 
4  193  ASP n 
4  194  ILE n 
4  195  PHE n 
4  196  ARG n 
4  197  ALA n 
4  198  GLY n 
4  199  GLU n 
4  200  TYR n 
4  201  ALA n 
4  202  ASP n 
4  203  VAL n 
4  204  ALA n 
4  205  GLY n 
4  206  VAL n 
4  207  THR n 
4  208  LYS n 
4  209  GLY n 
4  210  LYS n 
4  211  GLY n 
4  212  THR n 
4  213  GLN n 
4  214  GLY n 
4  215  PRO n 
4  216  VAL n 
4  217  LYS n 
4  218  ARG n 
4  219  TRP n 
4  220  GLY n 
4  221  VAL n 
4  222  GLN n 
4  223  LYS n 
4  224  ARG n 
4  225  LYS n 
4  226  GLY n 
4  227  LYS n 
4  228  HIS n 
4  229  ALA n 
4  230  ARG n 
4  231  GLN n 
4  232  GLY n 
4  233  TRP n 
4  234  ARG n 
4  235  ARG n 
4  236  ARG n 
4  237  ILE n 
4  238  GLY n 
4  239  ASN n 
4  240  LEU n 
4  241  GLY n 
4  242  PRO n 
4  243  TRP n 
4  244  ASN n 
4  245  PRO n 
4  246  SER n 
4  247  ARG n 
4  248  VAL n 
4  249  ARG n 
4  250  SER n 
4  251  THR n 
4  252  VAL n 
4  253  PRO n 
4  254  GLN n 
4  255  GLN n 
4  256  GLY n 
4  257  GLN n 
4  258  THR n 
4  259  GLY n 
4  260  TYR n 
4  261  HIS n 
4  262  GLN n 
4  263  ARG n 
4  264  THR n 
4  265  GLU n 
4  266  LEU n 
4  267  ASN n 
4  268  LYS n 
4  269  ARG n 
4  270  LEU n 
4  271  ILE n 
4  272  ASP n 
4  273  ILE n 
4  274  GLY n 
4  275  GLU n 
4  276  GLY n 
4  277  ASP n 
4  278  GLU n 
4  279  PRO n 
4  280  THR n 
4  281  VAL n 
4  282  ASP n 
4  283  GLY n 
4  284  GLY n 
4  285  PHE n 
4  286  VAL n 
4  287  ASN n 
4  288  TYR n 
4  289  GLY n 
4  290  GLU n 
4  291  VAL n 
4  292  ASP n 
4  293  GLY n 
4  294  PRO n 
4  295  TYR n 
4  296  THR n 
4  297  LEU n 
4  298  VAL n 
4  299  LYS n 
4  300  GLY n 
4  301  SER n 
4  302  VAL n 
4  303  PRO n 
4  304  GLY n 
4  305  PRO n 
4  306  ASP n 
4  307  LYS n 
4  308  ARG n 
4  309  LEU n 
4  310  VAL n 
4  311  ARG n 
4  312  PHE n 
4  313  ARG n 
4  314  PRO n 
4  315  ALA n 
4  316  VAL n 
4  317  ARG n 
4  318  PRO n 
4  319  ASN n 
4  320  ASP n 
4  321  GLN n 
4  322  PRO n 
4  323  ARG n 
4  324  LEU n 
4  325  ASP n 
4  326  PRO n 
4  327  GLU n 
4  328  VAL n 
4  329  ARG n 
4  330  TYR n 
4  331  VAL n 
4  332  SER n 
4  333  ASN n 
4  334  GLU n 
4  335  SER n 
4  336  ASN n 
4  337  GLN n 
4  338  GLY n 
5  1    MET n 
5  2    GLN n 
5  3    ALA n 
5  4    THR n 
5  5    ILE n 
5  6    TYR n 
5  7    ASP n 
5  8    LEU n 
5  9    ASP n 
5  10   GLY n 
5  11   ASN n 
5  12   THR n 
5  13   ASP n 
5  14   GLY n 
5  15   GLU n 
5  16   VAL n 
5  17   ASP n 
5  18   LEU n 
5  19   PRO n 
5  20   ASP n 
5  21   VAL n 
5  22   PHE n 
5  23   GLU n 
5  24   THR n 
5  25   PRO n 
5  26   VAL n 
5  27   ARG n 
5  28   SER n 
5  29   ASP n 
5  30   LEU n 
5  31   ILE n 
5  32   GLY n 
5  33   LYS n 
5  34   ALA n 
5  35   VAL n 
5  36   ARG n 
5  37   ALA n 
5  38   ALA n 
5  39   GLN n 
5  40   ALA n 
5  41   ASN n 
5  42   ARG n 
5  43   LYS n 
5  44   GLN n 
5  45   ASP n 
5  46   TYR n 
5  47   GLY n 
5  48   SER n 
5  49   ASP n 
5  50   GLU n 
5  51   TYR n 
5  52   ALA n 
5  53   GLY n 
5  54   LEU n 
5  55   ARG n 
5  56   THR n 
5  57   PRO n 
5  58   ALA n 
5  59   GLU n 
5  60   SER n 
5  61   PHE n 
5  62   GLY n 
5  63   SER n 
5  64   GLY n 
5  65   ARG n 
5  66   GLY n 
5  67   GLN n 
5  68   ALA n 
5  69   HIS n 
5  70   VAL n 
5  71   PRO n 
5  72   LYS n 
5  73   LEU n 
5  74   ASP n 
5  75   GLY n 
5  76   ARG n 
5  77   ALA n 
5  78   ARG n 
5  79   ARG n 
5  80   VAL n 
5  81   PRO n 
5  82   GLN n 
5  83   ALA n 
5  84   VAL n 
5  85   LYS n 
5  86   GLY n 
5  87   ARG n 
5  88   SER n 
5  89   ALA n 
5  90   HIS n 
5  91   PRO n 
5  92   PRO n 
5  93   LYS n 
5  94   THR n 
5  95   GLU n 
5  96   LYS n 
5  97   ASP n 
5  98   ARG n 
5  99   SER n 
5  100  LEU n 
5  101  ASP n 
5  102  LEU n 
5  103  ASN n 
5  104  ASP n 
5  105  LYS n 
5  106  GLU n 
5  107  ARG n 
5  108  GLN n 
5  109  LEU n 
5  110  ALA n 
5  111  VAL n 
5  112  ARG n 
5  113  SER n 
5  114  ALA n 
5  115  LEU n 
5  116  ALA n 
5  117  ALA n 
5  118  THR n 
5  119  ALA n 
5  120  ASP n 
5  121  ALA n 
5  122  ASP n 
5  123  LEU n 
5  124  VAL n 
5  125  ALA n 
5  126  ASP n 
5  127  ARG n 
5  128  GLY n 
5  129  HIS n 
5  130  GLU n 
5  131  PHE n 
5  132  ASP n 
5  133  ARG n 
5  134  ASP n 
5  135  GLU n 
5  136  VAL n 
5  137  PRO n 
5  138  VAL n 
5  139  VAL n 
5  140  VAL n 
5  141  SER n 
5  142  ASP n 
5  143  ASP n 
5  144  PHE n 
5  145  GLU n 
5  146  ASP n 
5  147  LEU n 
5  148  VAL n 
5  149  LYS n 
5  150  THR n 
5  151  GLN n 
5  152  GLU n 
5  153  VAL n 
5  154  VAL n 
5  155  SER n 
5  156  LEU n 
5  157  LEU n 
5  158  GLU n 
5  159  ALA n 
5  160  LEU n 
5  161  ASP n 
5  162  VAL n 
5  163  HIS n 
5  164  ALA n 
5  165  ASP n 
5  166  ILE n 
5  167  ASP n 
5  168  ARG n 
5  169  ALA n 
5  170  ASP n 
5  171  GLU n 
5  172  THR n 
5  173  LYS n 
5  174  ILE n 
5  175  LYS n 
5  176  ALA n 
5  177  GLY n 
5  178  GLN n 
5  179  GLY n 
5  180  SER n 
5  181  ALA n 
5  182  ARG n 
5  183  GLY n 
5  184  ARG n 
5  185  LYS n 
5  186  TYR n 
5  187  ARG n 
5  188  ARG n 
5  189  PRO n 
5  190  ALA n 
5  191  SER n 
5  192  ILE n 
5  193  LEU n 
5  194  PHE n 
5  195  VAL n 
5  196  THR n 
5  197  SER n 
5  198  ASP n 
5  199  GLU n 
5  200  PRO n 
5  201  SER n 
5  202  THR n 
5  203  ALA n 
5  204  ALA n 
5  205  ARG n 
5  206  ASN n 
5  207  LEU n 
5  208  ALA n 
5  209  GLY n 
5  210  ALA n 
5  211  ASP n 
5  212  VAL n 
5  213  ALA n 
5  214  THR n 
5  215  ALA n 
5  216  SER n 
5  217  GLU n 
5  218  VAL n 
5  219  ASN n 
5  220  THR n 
5  221  GLU n 
5  222  ASP n 
5  223  LEU n 
5  224  ALA n 
5  225  PRO n 
5  226  GLY n 
5  227  GLY n 
5  228  ALA n 
5  229  PRO n 
5  230  GLY n 
5  231  ARG n 
5  232  LEU n 
5  233  THR n 
5  234  VAL n 
5  235  PHE n 
5  236  THR n 
5  237  GLU n 
5  238  SER n 
5  239  ALA n 
5  240  LEU n 
5  241  ALA n 
5  242  GLU n 
5  243  VAL n 
5  244  ALA n 
5  245  GLU n 
5  246  ARG n 
6  1    MET n 
6  2    SER n 
6  3    SER n 
6  4    GLU n 
6  5    SER n 
6  6    GLU n 
6  7    SER n 
6  8    GLY n 
6  9    GLY n 
6  10   ASP n 
6  11   PHE n 
6  12   HIS n 
6  13   GLU n 
6  14   MET n 
6  15   ARG n 
6  16   GLU n 
6  17   PRO n 
6  18   ARG n 
6  19   ILE n 
6  20   GLU n 
6  21   LYS n 
6  22   VAL n 
6  23   VAL n 
6  24   VAL n 
6  25   HIS n 
6  26   MET n 
6  27   GLY n 
6  28   ILE n 
6  29   GLY n 
6  30   HIS n 
6  31   GLY n 
6  32   GLY n 
6  33   ARG n 
6  34   ASP n 
6  35   LEU n 
6  36   ALA n 
6  37   ASN n 
6  38   ALA n 
6  39   GLU n 
6  40   ASP n 
6  41   ILE n 
6  42   LEU n 
6  43   GLY n 
6  44   GLU n 
6  45   ILE n 
6  46   THR n 
6  47   GLY n 
6  48   GLN n 
6  49   MET n 
6  50   PRO n 
6  51   VAL n 
6  52   ARG n 
6  53   THR n 
6  54   LYS n 
6  55   ALA n 
6  56   LYS n 
6  57   ARG n 
6  58   THR n 
6  59   VAL n 
6  60   GLY n 
6  61   GLU n 
6  62   PHE n 
6  63   ASP n 
6  64   ILE n 
6  65   ARG n 
6  66   GLU n 
6  67   GLY n 
6  68   ASP n 
6  69   PRO n 
6  70   ILE n 
6  71   GLY n 
6  72   ALA n 
6  73   LYS n 
6  74   VAL n 
6  75   THR n 
6  76   LEU n 
6  77   ARG n 
6  78   ASP n 
6  79   GLU n 
6  80   MET n 
6  81   ALA n 
6  82   GLU n 
6  83   GLU n 
6  84   PHE n 
6  85   LEU n 
6  86   GLN n 
6  87   THR n 
6  88   ALA n 
6  89   LEU n 
6  90   PRO n 
6  91   LEU n 
6  92   ALA n 
6  93   GLU n 
6  94   LEU n 
6  95   ALA n 
6  96   THR n 
6  97   SER n 
6  98   GLN n 
6  99   PHE n 
6  100  ASP n 
6  101  ASP n 
6  102  THR n 
6  103  GLY n 
6  104  ASN n 
6  105  PHE n 
6  106  SER n 
6  107  PHE n 
6  108  GLY n 
6  109  VAL n 
6  110  GLU n 
6  111  GLU n 
6  112  HIS n 
6  113  THR n 
6  114  GLU n 
6  115  PHE n 
6  116  PRO n 
6  117  SER n 
6  118  GLN n 
6  119  GLU n 
6  120  TYR n 
6  121  ASP n 
6  122  PRO n 
6  123  SER n 
6  124  ILE n 
6  125  GLY n 
6  126  ILE n 
6  127  TYR n 
6  128  GLY n 
6  129  LEU n 
6  130  ASP n 
6  131  VAL n 
6  132  THR n 
6  133  VAL n 
6  134  ASN n 
6  135  LEU n 
6  136  VAL n 
6  137  ARG n 
6  138  PRO n 
6  139  GLY n 
6  140  TYR n 
6  141  ARG n 
6  142  VAL n 
6  143  ALA n 
6  144  LYS n 
6  145  ARG n 
6  146  ASP n 
6  147  LYS n 
6  148  ALA n 
6  149  SER n 
6  150  ARG n 
6  151  SER n 
6  152  ILE n 
6  153  PRO n 
6  154  THR n 
6  155  LYS n 
6  156  HIS n 
6  157  ARG n 
6  158  LEU n 
6  159  ASN n 
6  160  PRO n 
6  161  ALA n 
6  162  ASP n 
6  163  ALA n 
6  164  VAL n 
6  165  ALA n 
6  166  PHE n 
6  167  ILE n 
6  168  GLU n 
6  169  SER n 
6  170  THR n 
6  171  TYR n 
6  172  ASP n 
6  173  VAL n 
6  174  GLU n 
6  175  VAL n 
6  176  SER n 
6  177  GLU n 
7  1    MET n 
7  2    PRO n 
7  3    ARG n 
7  4    VAL n 
7  5    GLU n 
7  6    LEU n 
7  7    GLU n 
7  8    ILE n 
7  9    PRO n 
7  10   GLU n 
7  11   ASP n 
7  12   VAL n 
7  13   ASP n 
7  14   ALA n 
7  15   GLU n 
7  16   GLN n 
7  17   ASP n 
7  18   HIS n 
7  19   LEU n 
7  20   ASP n 
7  21   ILE n 
7  22   THR n 
7  23   VAL n 
7  24   GLU n 
7  25   GLY n 
7  26   ASP n 
7  27   ASN n 
7  28   GLY n 
7  29   SER n 
7  30   VAL n 
7  31   THR n 
7  32   ARG n 
7  33   ARG n 
7  34   LEU n 
7  35   TRP n 
7  36   TYR n 
7  37   PRO n 
7  38   ASP n 
7  39   ILE n 
7  40   ASP n 
7  41   VAL n 
7  42   SER n 
7  43   VAL n 
7  44   ASP n 
7  45   GLY n 
7  46   ASP n 
7  47   THR n 
7  48   VAL n 
7  49   VAL n 
7  50   ILE n 
7  51   GLU n 
7  52   SER n 
7  53   ASP n 
7  54   GLU n 
7  55   ASP n 
7  56   ASN n 
7  57   ALA n 
7  58   LYS n 
7  59   THR n 
7  60   MET n 
7  61   SER n 
7  62   THR n 
7  63   ILE n 
7  64   GLY n 
7  65   THR n 
7  66   PHE n 
7  67   GLN n 
7  68   SER n 
7  69   HIS n 
7  70   ILE n 
7  71   GLU n 
7  72   ASN n 
7  73   MET n 
7  74   PHE n 
7  75   HIS n 
7  76   GLY n 
7  77   VAL n 
7  78   THR n 
7  79   GLU n 
7  80   GLY n 
7  81   TRP n 
7  82   GLU n 
7  83   TYR n 
7  84   GLY n 
7  85   MET n 
7  86   GLU n 
7  87   VAL n 
7  88   PHE n 
7  89   TYR n 
7  90   SER n 
7  91   HIS n 
7  92   PHE n 
7  93   PRO n 
7  94   MET n 
7  95   GLN n 
7  96   VAL n 
7  97   ASN n 
7  98   VAL n 
7  99   GLU n 
7  100  GLY n 
7  101  ASP n 
7  102  GLU n 
7  103  VAL n 
7  104  VAL n 
7  105  ILE n 
7  106  GLU n 
7  107  ASN n 
7  108  PHE n 
7  109  LEU n 
7  110  GLY n 
7  111  GLU n 
7  112  LYS n 
7  113  ALA n 
7  114  PRO n 
7  115  ARG n 
7  116  ARG n 
7  117  THR n 
7  118  THR n 
7  119  ILE n 
7  120  HIS n 
7  121  GLY n 
7  122  ASP n 
7  123  THR n 
7  124  ASP n 
7  125  VAL n 
7  126  GLU n 
7  127  ILE n 
7  128  ASP n 
7  129  GLY n 
7  130  GLU n 
7  131  GLU n 
7  132  LEU n 
7  133  THR n 
7  134  VAL n 
7  135  SER n 
7  136  GLY n 
7  137  PRO n 
7  138  ASP n 
7  139  ILE n 
7  140  GLU n 
7  141  ALA n 
7  142  VAL n 
7  143  GLY n 
7  144  GLN n 
7  145  THR n 
7  146  ALA n 
7  147  ALA n 
7  148  ASP n 
7  149  ILE n 
7  150  GLU n 
7  151  GLN n 
7  152  LEU n 
7  153  THR n 
7  154  ARG n 
7  155  ILE n 
7  156  ASN n 
7  157  ASP n 
7  158  LYS n 
7  159  ASP n 
7  160  VAL n 
7  161  ARG n 
7  162  VAL n 
7  163  PHE n 
7  164  GLN n 
7  165  ASP n 
7  166  GLY n 
7  167  VAL n 
7  168  TYR n 
7  169  ILE n 
7  170  THR n 
7  171  ARG n 
7  172  LYS n 
7  173  PRO n 
7  174  ASN n 
7  175  ARG n 
7  176  GLY n 
7  177  ASP n 
7  178  ALA n 
8  1    MET n 
8  2    PRO n 
8  3    VAL n 
8  4    TYR n 
8  5    VAL n 
8  6    ASP n 
8  7    PHE n 
8  8    ASP n 
8  9    VAL n 
8  10   PRO n 
8  11   ALA n 
8  12   ASP n 
8  13   LEU n 
8  14   GLU n 
8  15   ASP n 
8  16   ASP n 
8  17   ALA n 
8  18   LEU n 
8  19   GLU n 
8  20   ALA n 
8  21   LEU n 
8  22   GLU n 
8  23   VAL n 
8  24   ALA n 
8  25   ARG n 
8  26   ASP n 
8  27   THR n 
8  28   GLY n 
8  29   ALA n 
8  30   VAL n 
8  31   LYS n 
8  32   LYS n 
8  33   GLY n 
8  34   THR n 
8  35   ASN n 
8  36   GLU n 
8  37   THR n 
8  38   THR n 
8  39   LYS n 
8  40   SER n 
8  41   ILE n 
8  42   GLU n 
8  43   ARG n 
8  44   GLY n 
8  45   SER n 
8  46   ALA n 
8  47   GLU n 
8  48   LEU n 
8  49   VAL n 
8  50   PHE n 
8  51   VAL n 
8  52   ALA n 
8  53   GLU n 
8  54   ASP n 
8  55   VAL n 
8  56   GLN n 
8  57   PRO n 
8  58   GLU n 
8  59   GLU n 
8  60   ILE n 
8  61   VAL n 
8  62   MET n 
8  63   HIS n 
8  64   ILE n 
8  65   PRO n 
8  66   GLU n 
8  67   LEU n 
8  68   ALA n 
8  69   ASP n 
8  70   GLU n 
8  71   LYS n 
8  72   GLY n 
8  73   VAL n 
8  74   PRO n 
8  75   PHE n 
8  76   ILE n 
8  77   PHE n 
8  78   VAL n 
8  79   GLU n 
8  80   GLN n 
8  81   GLN n 
8  82   ASP n 
8  83   ASP n 
8  84   LEU n 
8  85   GLY n 
8  86   HIS n 
8  87   ALA n 
8  88   ALA n 
8  89   GLY n 
8  90   LEU n 
8  91   GLU n 
8  92   VAL n 
8  93   GLY n 
8  94   SER n 
8  95   ALA n 
8  96   ALA n 
8  97   ALA n 
8  98   ALA n 
8  99   VAL n 
8  100  THR n 
8  101  ASP n 
8  102  ALA n 
8  103  GLY n 
8  104  GLU n 
8  105  ALA n 
8  106  ASP n 
8  107  ALA n 
8  108  ASP n 
8  109  VAL n 
8  110  GLU n 
8  111  ASP n 
8  112  ILE n 
8  113  ALA n 
8  114  ASP n 
8  115  LYS n 
8  116  VAL n 
8  117  GLU n 
8  118  GLU n 
8  119  LEU n 
8  120  ARG n 
9  1    MET n 
9  2    SER n 
9  3    ALA n 
9  4    GLU n 
9  5    SER n 
9  6    GLU n 
9  7    ARG n 
9  8    LYS n 
9  9    THR n 
9  10   GLU n 
9  11   THR n 
9  12   ILE n 
9  13   PRO n 
9  14   GLU n 
9  15   TRP n 
9  16   LYS n 
9  17   GLN n 
9  18   GLU n 
9  19   GLU n 
9  20   VAL n 
9  21   ASP n 
9  22   ALA n 
9  23   ILE n 
9  24   VAL n 
9  25   GLU n 
9  26   MET n 
9  27   ILE n 
9  28   GLU n 
9  29   SER n 
9  30   TYR n 
9  31   GLU n 
9  32   SER n 
9  33   VAL n 
9  34   GLY n 
9  35   VAL n 
9  36   VAL n 
9  37   ASN n 
9  38   ILE n 
9  39   ALA n 
9  40   GLY n 
9  41   ILE n 
9  42   PRO n 
9  43   SER n 
9  44   ARG n 
9  45   GLN n 
9  46   LEU n 
9  47   GLN n 
9  48   ASP n 
9  49   MET n 
9  50   ARG n 
9  51   ARG n 
9  52   ASP n 
9  53   LEU n 
9  54   HIS n 
9  55   GLY n 
9  56   THR n 
9  57   ALA n 
9  58   GLU n 
9  59   LEU n 
9  60   ARG n 
9  61   VAL n 
9  62   SER n 
9  63   ARG n 
9  64   ASN n 
9  65   THR n 
9  66   LEU n 
9  67   LEU n 
9  68   GLU n 
9  69   ARG n 
9  70   ALA n 
9  71   LEU n 
9  72   ASP n 
9  73   ASP n 
9  74   VAL n 
9  75   ASP n 
9  76   ASP n 
9  77   GLY n 
9  78   LEU n 
9  79   GLU n 
9  80   ASP n 
9  81   LEU n 
9  82   ASN n 
9  83   GLY n 
9  84   TYR n 
9  85   ILE n 
9  86   THR n 
9  87   GLY n 
9  88   GLN n 
9  89   VAL n 
9  90   GLY n 
9  91   LEU n 
9  92   ILE n 
9  93   GLY n 
9  94   THR n 
9  95   ASP n 
9  96   ASP n 
9  97   ASN n 
9  98   PRO n 
9  99   PHE n 
9  100  SER n 
9  101  LEU n 
9  102  PHE n 
9  103  GLN n 
9  104  GLU n 
9  105  LEU n 
9  106  GLU n 
9  107  ALA n 
9  108  SER n 
9  109  LYS n 
9  110  THR n 
9  111  PRO n 
9  112  ALA n 
9  113  PRO n 
9  114  ILE n 
9  115  GLY n 
9  116  ALA n 
9  117  GLY n 
9  118  GLU n 
9  119  VAL n 
9  120  ALA n 
9  121  PRO n 
9  122  ASN n 
9  123  ASP n 
9  124  ILE n 
9  125  VAL n 
9  126  ILE n 
9  127  PRO n 
9  128  GLU n 
9  129  GLY n 
9  130  ASP n 
9  131  THR n 
9  132  GLY n 
9  133  VAL n 
9  134  ASP n 
9  135  PRO n 
9  136  GLY n 
9  137  PRO n 
9  138  PHE n 
9  139  VAL n 
9  140  GLY n 
9  141  GLU n 
9  142  LEU n 
9  143  GLN n 
9  144  SER n 
9  145  VAL n 
9  146  GLY n 
9  147  ALA n 
9  148  ASP n 
9  149  ALA n 
9  150  ARG n 
9  151  ILE n 
9  152  GLN n 
9  153  GLU n 
9  154  GLY n 
9  155  SER n 
9  156  ILE n 
9  157  GLN n 
9  158  VAL n 
9  159  LEU n 
9  160  SER n 
9  161  ASP n 
9  162  SER n 
9  163  THR n 
9  164  VAL n 
9  165  LEU n 
9  166  ASP n 
9  167  THR n 
9  168  GLY n 
9  169  GLU n 
9  170  GLU n 
9  171  VAL n 
9  172  SER n 
9  173  GLN n 
9  174  GLU n 
9  175  LEU n 
9  176  SER n 
9  177  ASN n 
9  178  VAL n 
9  179  LEU n 
9  180  ASN n 
9  181  GLU n 
9  182  LEU n 
9  183  GLY n 
9  184  ILE n 
9  185  GLU n 
9  186  PRO n 
9  187  LYS n 
9  188  GLU n 
9  189  VAL n 
9  190  GLY n 
9  191  LEU n 
9  192  ASP n 
9  193  LEU n 
9  194  ARG n 
9  195  ALA n 
9  196  VAL n 
9  197  PHE n 
9  198  ALA n 
9  199  ASP n 
9  200  GLY n 
9  201  VAL n 
9  202  LEU n 
9  203  PHE n 
9  204  GLU n 
9  205  PRO n 
9  206  GLU n 
9  207  GLU n 
9  208  LEU n 
9  209  GLU n 
9  210  LEU n 
9  211  ASP n 
9  212  ILE n 
9  213  ASP n 
9  214  GLU n 
9  215  TYR n 
9  216  ARG n 
9  217  SER n 
9  218  ASP n 
9  219  ILE n 
9  220  GLN n 
9  221  ALA n 
9  222  ALA n 
9  223  ALA n 
9  224  GLY n 
9  225  ARG n 
9  226  ALA n 
9  227  PHE n 
9  228  ASN n 
9  229  LEU n 
9  230  SER n 
9  231  VAL n 
9  232  ASN n 
9  233  ALA n 
9  234  ASP n 
9  235  TYR n 
9  236  PRO n 
9  237  THR n 
9  238  ALA n 
9  239  THR n 
9  240  THR n 
9  241  ALA n 
9  242  PRO n 
9  243  THR n 
9  244  MET n 
9  245  LEU n 
9  246  GLN n 
9  247  SER n 
9  248  ASP n 
9  249  ARG n 
9  250  GLY n 
9  251  ASN n 
9  252  ALA n 
9  253  LYS n 
9  254  SER n 
9  255  LEU n 
9  256  ALA n 
9  257  LEU n 
9  258  GLN n 
9  259  ALA n 
9  260  ALA n 
9  261  ILE n 
9  262  GLU n 
9  263  ASP n 
9  264  PRO n 
9  265  GLU n 
9  266  VAL n 
9  267  VAL n 
9  268  PRO n 
9  269  ASP n 
9  270  LEU n 
9  271  VAL n 
9  272  SER n 
9  273  LYS n 
9  274  ALA n 
9  275  ASP n 
9  276  ALA n 
9  277  GLN n 
9  278  VAL n 
9  279  ARG n 
9  280  ALA n 
9  281  LEU n 
9  282  ALA n 
9  283  SER n 
9  284  GLN n 
9  285  ILE n 
9  286  ASP n 
9  287  ASP n 
9  288  GLU n 
9  289  GLU n 
9  290  ALA n 
9  291  LEU n 
9  292  PRO n 
9  293  GLU n 
9  294  GLU n 
9  295  LEU n 
9  296  GLN n 
9  297  GLY n 
9  298  VAL n 
9  299  GLU n 
9  300  ALA n 
9  301  ASP n 
9  302  VAL n 
9  303  ALA n 
9  304  THR n 
9  305  GLU n 
9  306  GLU n 
9  307  PRO n 
9  308  THR n 
9  309  ASP n 
9  310  ASP n 
9  311  GLN n 
9  312  ASP n 
9  313  ASP n 
9  314  ASP n 
9  315  THR n 
9  316  ALA n 
9  317  SER n 
9  318  GLU n 
9  319  ASP n 
9  320  ASP n 
9  321  ALA n 
9  322  ASP n 
9  323  ALA n 
9  324  ASP n 
9  325  ASP n 
9  326  ALA n 
9  327  ALA n 
9  328  GLU n 
9  329  GLU n 
9  330  ALA n 
9  331  ASP n 
9  332  ASP n 
9  333  ASP n 
9  334  ASP n 
9  335  ASP n 
9  336  ASP n 
9  337  ASP n 
9  338  GLU n 
9  339  ASP n 
9  340  ALA n 
9  341  GLY n 
9  342  ASP n 
9  343  ALA n 
9  344  LEU n 
9  345  GLY n 
9  346  ALA n 
9  347  MET n 
9  348  PHE n 
10 1    MET n 
10 2    SER n 
10 3    ASP n 
10 4    LYS n 
10 5    PRO n 
10 6    ALA n 
10 7    SER n 
10 8    MET n 
10 9    TYR n 
10 10   ARG n 
10 11   ASP n 
10 12   ILE n 
10 13   ASP n 
10 14   LYS n 
10 15   PRO n 
10 16   ALA n 
10 17   TYR n 
10 18   THR n 
10 19   ARG n 
10 20   ARG n 
10 21   GLU n 
10 22   TYR n 
10 23   ILE n 
10 24   THR n 
10 25   GLY n 
10 26   ILE n 
10 27   PRO n 
10 28   GLY n 
10 29   SER n 
10 30   LYS n 
10 31   ILE n 
10 32   ALA n 
10 33   GLN n 
10 34   HIS n 
10 35   LYS n 
10 36   MET n 
10 37   GLY n 
10 38   ARG n 
10 39   LYS n 
10 40   GLN n 
10 41   LYS n 
10 42   ASP n 
10 43   ALA n 
10 44   ASP n 
10 45   ASP n 
10 46   TYR n 
10 47   PRO n 
10 48   VAL n 
10 49   GLN n 
10 50   ILE n 
10 51   SER n 
10 52   LEU n 
10 53   ILE n 
10 54   VAL n 
10 55   GLU n 
10 56   GLU n 
10 57   THR n 
10 58   VAL n 
10 59   GLN n 
10 60   LEU n 
10 61   ARG n 
10 62   HIS n 
10 63   GLY n 
10 64   SER n 
10 65   LEU n 
10 66   GLU n 
10 67   ALA n 
10 68   SER n 
10 69   ARG n 
10 70   LEU n 
10 71   SER n 
10 72   ALA n 
10 73   ASN n 
10 74   ARG n 
10 75   HIS n 
10 76   LEU n 
10 77   ILE n 
10 78   LYS n 
10 79   GLU n 
10 80   LEU n 
10 81   GLY n 
10 82   GLU n 
10 83   GLU n 
10 84   GLY n 
10 85   ASP n 
10 86   TYR n 
10 87   LYS n 
10 88   MET n 
10 89   THR n 
10 90   LEU n 
10 91   ARG n 
10 92   LYS n 
10 93   PHE n 
10 94   PRO n 
10 95   HIS n 
10 96   GLN n 
10 97   VAL n 
10 98   LEU n 
10 99   ARG n 
10 100  GLU n 
10 101  ASN n 
10 102  LYS n 
10 103  GLN n 
10 104  ALA n 
10 105  THR n 
10 106  GLY n 
10 107  ALA n 
10 108  GLY n 
10 109  ALA n 
10 110  ASP n 
10 111  ARG n 
10 112  VAL n 
10 113  SER n 
10 114  ASP n 
10 115  GLY n 
10 116  MET n 
10 117  ARG n 
10 118  ALA n 
10 119  ALA n 
10 120  PHE n 
10 121  GLY n 
10 122  LYS n 
10 123  ILE n 
10 124  VAL n 
10 125  GLY n 
10 126  THR n 
10 127  ALA n 
10 128  ALA n 
10 129  ARG n 
10 130  VAL n 
10 131  GLN n 
10 132  ALA n 
10 133  GLY n 
10 134  GLU n 
10 135  GLN n 
10 136  LEU n 
10 137  PHE n 
10 138  THR n 
10 139  ALA n 
10 140  TYR n 
10 141  CYS n 
10 142  ASN n 
10 143  VAL n 
10 144  GLU n 
10 145  ASP n 
10 146  ALA n 
10 147  GLU n 
10 148  HIS n 
10 149  VAL n 
10 150  LYS n 
10 151  GLU n 
10 152  ALA n 
10 153  PHE n 
10 154  ARG n 
10 155  ARG n 
10 156  ALA n 
10 157  TYR n 
10 158  ASN n 
10 159  LYS n 
10 160  ILE n 
10 161  THR n 
10 162  PRO n 
10 163  SER n 
10 164  CYS n 
10 165  ARG n 
10 166  ILE n 
10 167  LYS n 
10 168  VAL n 
10 169  GLU n 
10 170  ARG n 
10 171  GLY n 
10 172  GLU n 
10 173  GLU n 
10 174  LEU n 
10 175  LEU n 
10 176  ILE n 
10 177  ALA n 
11 1    MET n 
11 2    ALA n 
11 3    GLY n 
11 4    THR n 
11 5    ILE n 
11 6    GLU n 
11 7    VAL n 
11 8    LEU n 
11 9    VAL n 
11 10   PRO n 
11 11   GLY n 
11 12   GLY n 
11 13   GLU n 
11 14   ALA n 
11 15   ASN n 
11 16   PRO n 
11 17   GLY n 
11 18   PRO n 
11 19   PRO n 
11 20   LEU n 
11 21   GLY n 
11 22   PRO n 
11 23   GLU n 
11 24   LEU n 
11 25   GLY n 
11 26   PRO n 
11 27   THR n 
11 28   PRO n 
11 29   VAL n 
11 30   ASP n 
11 31   VAL n 
11 32   GLN n 
11 33   ALA n 
11 34   VAL n 
11 35   VAL n 
11 36   GLN n 
11 37   GLU n 
11 38   ILE n 
11 39   ASN n 
11 40   ASP n 
11 41   GLN n 
11 42   THR n 
11 43   ALA n 
11 44   ALA n 
11 45   PHE n 
11 46   ASP n 
11 47   GLY n 
11 48   THR n 
11 49   GLU n 
11 50   VAL n 
11 51   PRO n 
11 52   VAL n 
11 53   THR n 
11 54   VAL n 
11 55   LYS n 
11 56   TYR n 
11 57   ASP n 
11 58   ASP n 
11 59   ASP n 
11 60   GLY n 
11 61   SER n 
11 62   PHE n 
11 63   GLU n 
11 64   ILE n 
11 65   GLU n 
11 66   VAL n 
11 67   GLY n 
11 68   VAL n 
11 69   PRO n 
11 70   PRO n 
11 71   THR n 
11 72   ALA n 
11 73   GLU n 
11 74   LEU n 
11 75   ILE n 
11 76   LYS n 
11 77   ASP n 
11 78   GLU n 
11 79   ALA n 
11 80   GLY n 
11 81   PHE n 
11 82   GLU n 
11 83   THR n 
11 84   GLY n 
11 85   SER n 
11 86   GLY n 
11 87   GLU n 
11 88   PRO n 
11 89   GLN n 
11 90   GLU n 
11 91   ASP n 
11 92   PHE n 
11 93   VAL n 
11 94   ALA n 
11 95   ASP n 
11 96   LEU n 
11 97   SER n 
11 98   VAL n 
11 99   ASP n 
11 100  GLN n 
11 101  VAL n 
11 102  LYS n 
11 103  GLN n 
11 104  ILE n 
11 105  ALA n 
11 106  GLU n 
11 107  GLN n 
11 108  LYS n 
11 109  HIS n 
11 110  PRO n 
11 111  ASP n 
11 112  LEU n 
11 113  LEU n 
11 114  SER n 
11 115  TYR n 
11 116  ASP n 
11 117  LEU n 
11 118  THR n 
11 119  ASN n 
11 120  ALA n 
11 121  ALA n 
11 122  LYS n 
11 123  GLU n 
11 124  VAL n 
11 125  VAL n 
11 126  GLY n 
11 127  THR n 
11 128  CYS n 
11 129  THR n 
11 130  SER n 
11 131  LEU n 
11 132  GLY n 
11 133  VAL n 
11 134  THR n 
11 135  ILE n 
11 136  GLU n 
11 137  GLY n 
11 138  GLU n 
11 139  ASN n 
11 140  PRO n 
11 141  ARG n 
11 142  GLU n 
11 143  PHE n 
11 144  LYS n 
11 145  GLU n 
11 146  ARG n 
11 147  ILE n 
11 148  ASP n 
11 149  ALA n 
11 150  GLY n 
11 151  GLU n 
11 152  TYR n 
11 153  ASP n 
11 154  ASP n 
11 155  VAL n 
11 156  PHE n 
11 157  ALA n 
11 158  ALA n 
11 159  GLU n 
11 160  ALA n 
11 161  GLN n 
11 162  ALA n 
12 1    MET n 
12 2    SER n 
12 3    VAL n 
12 4    ALA n 
12 5    GLU n 
12 6    PHE n 
12 7    ASP n 
12 8    ALA n 
12 9    ASP n 
12 10   VAL n 
12 11   ILE n 
12 12   VAL n 
12 13   ASP n 
12 14   ALA n 
12 15   ARG n 
12 16   ASP n 
12 17   CYS n 
12 18   ILE n 
12 19   MET n 
12 20   GLY n 
12 21   ARG n 
12 22   VAL n 
12 23   ALA n 
12 24   SER n 
12 25   GLN n 
12 26   VAL n 
12 27   ALA n 
12 28   GLU n 
12 29   GLN n 
12 30   ALA n 
12 31   LEU n 
12 32   ASP n 
12 33   GLY n 
12 34   GLU n 
12 35   THR n 
12 36   VAL n 
12 37   ALA n 
12 38   VAL n 
12 39   VAL n 
12 40   ASN n 
12 41   ALA n 
12 42   GLU n 
12 43   ARG n 
12 44   ALA n 
12 45   VAL n 
12 46   ILE n 
12 47   THR n 
12 48   GLY n 
12 49   ARG n 
12 50   GLU n 
12 51   GLU n 
12 52   GLN n 
12 53   ILE n 
12 54   VAL n 
12 55   GLU n 
12 56   LYS n 
12 57   TYR n 
12 58   GLU n 
12 59   LYS n 
12 60   ARG n 
12 61   VAL n 
12 62   ASP n 
12 63   ILE n 
12 64   GLY n 
12 65   ASN n 
12 66   ASP n 
12 67   ASN n 
12 68   GLY n 
12 69   TYR n 
12 70   PHE n 
12 71   TYR n 
12 72   PRO n 
12 73   LYS n 
12 74   ARG n 
12 75   PRO n 
12 76   ASP n 
12 77   GLY n 
12 78   ILE n 
12 79   PHE n 
12 80   LYS n 
12 81   ARG n 
12 82   THR n 
12 83   ILE n 
12 84   ARG n 
12 85   GLY n 
12 86   MET n 
12 87   LEU n 
12 88   PRO n 
12 89   HIS n 
12 90   LYS n 
12 91   LYS n 
12 92   GLN n 
12 93   ARG n 
12 94   GLY n 
12 95   ARG n 
12 96   GLU n 
12 97   ALA n 
12 98   PHE n 
12 99   GLU n 
12 100  SER n 
12 101  VAL n 
12 102  ARG n 
12 103  VAL n 
12 104  TYR n 
12 105  LEU n 
12 106  GLY n 
12 107  ASN n 
12 108  PRO n 
12 109  TYR n 
12 110  ASP n 
12 111  GLU n 
12 112  ASP n 
12 113  GLY n 
12 114  GLU n 
12 115  VAL n 
12 116  LEU n 
12 117  ASP n 
12 118  GLY n 
12 119  THR n 
12 120  SER n 
12 121  LEU n 
12 122  ASP n 
12 123  ARG n 
12 124  LEU n 
12 125  SER n 
12 126  ASN n 
12 127  ILE n 
12 128  LYS n 
12 129  PHE n 
12 130  VAL n 
12 131  THR n 
12 132  LEU n 
12 133  GLY n 
12 134  GLU n 
12 135  ILE n 
12 136  SER n 
12 137  GLU n 
12 138  THR n 
12 139  LEU n 
12 140  GLY n 
12 141  ALA n 
12 142  ASN n 
12 143  LYS n 
12 144  THR n 
12 145  TRP n 
13 1    MET n 
13 2    GLU n 
13 3    ALA n 
13 4    LEU n 
13 5    GLY n 
13 6    ALA n 
13 7    ASP n 
13 8    VAL n 
13 9    THR n 
13 10   GLN n 
13 11   GLY n 
13 12   LEU n 
13 13   GLU n 
13 14   LYS n 
13 15   GLY n 
13 16   SER n 
13 17   LEU n 
13 18   ILE n 
13 19   THR n 
13 20   CYS n 
13 21   ALA n 
13 22   ASP n 
13 23   ASN n 
13 24   THR n 
13 25   GLY n 
13 26   ALA n 
13 27   ARG n 
13 28   GLU n 
13 29   LEU n 
13 30   LYS n 
13 31   VAL n 
13 32   ILE n 
13 33   SER n 
13 34   VAL n 
13 35   HIS n 
13 36   GLY n 
13 37   TYR n 
13 38   SER n 
13 39   GLY n 
13 40   THR n 
13 41   LYS n 
13 42   ASN n 
13 43   ARG n 
13 44   LEU n 
13 45   PRO n 
13 46   LYS n 
13 47   ALA n 
13 48   GLY n 
13 49   LEU n 
13 50   GLY n 
13 51   ASP n 
13 52   LYS n 
13 53   ILE n 
13 54   THR n 
13 55   VAL n 
13 56   SER n 
13 57   VAL n 
13 58   THR n 
13 59   LYS n 
13 60   GLY n 
13 61   THR n 
13 62   PRO n 
13 63   GLU n 
13 64   MET n 
13 65   ARG n 
13 66   ARG n 
13 67   GLN n 
13 68   VAL n 
13 69   LEU n 
13 70   GLU n 
13 71   ALA n 
13 72   VAL n 
13 73   VAL n 
13 74   VAL n 
13 75   ARG n 
13 76   GLN n 
13 77   ARG n 
13 78   LYS n 
13 79   PRO n 
13 80   ILE n 
13 81   ARG n 
13 82   ARG n 
13 83   PRO n 
13 84   ASP n 
13 85   GLY n 
13 86   THR n 
13 87   ARG n 
13 88   VAL n 
13 89   LYS n 
13 90   PHE n 
13 91   GLU n 
13 92   ASP n 
13 93   ASN n 
13 94   ALA n 
13 95   ALA n 
13 96   VAL n 
13 97   ILE n 
13 98   VAL n 
13 99   ASP n 
13 100  GLU n 
13 101  ASN n 
13 102  GLU n 
13 103  ASP n 
13 104  PRO n 
13 105  ARG n 
13 106  GLY n 
13 107  THR n 
13 108  GLU n 
13 109  LEU n 
13 110  LYS n 
13 111  GLY n 
13 112  PRO n 
13 113  ILE n 
13 114  ALA n 
13 115  ARG n 
13 116  GLU n 
13 117  VAL n 
13 118  ALA n 
13 119  GLN n 
13 120  ARG n 
13 121  PHE n 
13 122  GLY n 
13 123  SER n 
13 124  VAL n 
13 125  ALA n 
13 126  SER n 
13 127  ALA n 
13 128  ALA n 
13 129  THR n 
13 130  MET n 
13 131  ILE n 
13 132  VAL n 
14 1    MET n 
14 2    THR n 
14 3    SER n 
14 4    LYS n 
14 5    LYS n 
14 6    LYS n 
14 7    ARG n 
14 8    GLN n 
14 9    ARG n 
14 10   GLY n 
14 11   SER n 
14 12   ARG n 
14 13   THR n 
14 14   HIS n 
14 15   GLY n 
14 16   GLY n 
14 17   GLY n 
14 18   SER n 
14 19   HIS n 
14 20   LYS n 
14 21   ASN n 
14 22   ARG n 
14 23   ARG n 
14 24   GLY n 
14 25   ALA n 
14 26   GLY n 
14 27   HIS n 
14 28   ARG n 
14 29   GLY n 
14 30   GLY n 
14 31   ARG n 
14 32   GLY n 
14 33   ASP n 
14 34   ALA n 
14 35   GLY n 
14 36   ARG n 
14 37   ASP n 
14 38   LYS n 
14 39   HIS n 
14 40   GLU n 
14 41   PHE n 
14 42   HIS n 
14 43   ASN n 
14 44   HIS n 
14 45   GLU n 
14 46   PRO n 
14 47   LEU n 
14 48   GLY n 
14 49   LYS n 
14 50   SER n 
14 51   GLY n 
14 52   PHE n 
14 53   LYS n 
14 54   ARG n 
14 55   PRO n 
14 56   GLN n 
14 57   LYS n 
14 58   VAL n 
14 59   GLN n 
14 60   GLU n 
14 61   GLU n 
14 62   ALA n 
14 63   ALA n 
14 64   THR n 
14 65   ILE n 
14 66   ASP n 
14 67   VAL n 
14 68   ARG n 
14 69   GLU n 
14 70   ILE n 
14 71   ASP n 
14 72   GLU n 
14 73   ASN n 
14 74   VAL n 
14 75   THR n 
14 76   LEU n 
14 77   LEU n 
14 78   ALA n 
14 79   ALA n 
14 80   ASP n 
14 81   ASP n 
14 82   VAL n 
14 83   ALA n 
14 84   GLU n 
14 85   VAL n 
14 86   GLU n 
14 87   ASP n 
14 88   GLY n 
14 89   GLY n 
14 90   PHE n 
14 91   ARG n 
14 92   VAL n 
14 93   ASP n 
14 94   VAL n 
14 95   ARG n 
14 96   ASP n 
14 97   VAL n 
14 98   VAL n 
14 99   GLU n 
14 100  GLU n 
14 101  ALA n 
14 102  ASP n 
14 103  ASP n 
14 104  ALA n 
14 105  ASP n 
14 106  TYR n 
14 107  VAL n 
14 108  LYS n 
14 109  VAL n 
14 110  LEU n 
14 111  GLY n 
14 112  ALA n 
14 113  GLY n 
14 114  GLN n 
14 115  VAL n 
14 116  ARG n 
14 117  HIS n 
14 118  GLU n 
14 119  LEU n 
14 120  THR n 
14 121  LEU n 
14 122  ILE n 
14 123  ALA n 
14 124  ASP n 
14 125  ASP n 
14 126  PHE n 
14 127  SER n 
14 128  GLU n 
14 129  GLY n 
14 130  ALA n 
14 131  ARG n 
14 132  GLU n 
14 133  LYS n 
14 134  VAL n 
14 135  GLU n 
14 136  GLY n 
14 137  ALA n 
14 138  GLY n 
14 139  GLY n 
14 140  SER n 
14 141  VAL n 
14 142  GLU n 
14 143  LEU n 
14 144  THR n 
14 145  ASP n 
14 146  LEU n 
14 147  GLY n 
14 148  GLU n 
14 149  GLU n 
14 150  ARG n 
14 151  GLN n 
14 152  ALA n 
14 153  GLU n 
14 154  ALA n 
14 155  GLU n 
14 156  GLU n 
14 157  THR n 
14 158  GLU n 
14 159  ASP n 
14 160  ALA n 
14 161  ASP n 
14 162  ALA n 
14 163  ASP n 
14 164  GLU n 
14 165  GLU n 
15 1    ALA n 
15 2    ARG n 
15 3    SER n 
15 4    ALA n 
15 5    TYR n 
15 6    SER n 
15 7    TYR n 
15 8    ILE n 
15 9    ARG n 
15 10   ASP n 
15 11   ALA n 
15 12   TRP n 
15 13   GLU n 
15 14   ASN n 
15 15   PRO n 
15 16   GLY n 
15 17   ASP n 
15 18   GLY n 
15 19   GLN n 
15 20   LEU n 
15 21   ALA n 
15 22   GLU n 
15 23   LEU n 
15 24   GLN n 
15 25   TRP n 
15 26   GLN n 
15 27   ARG n 
15 28   GLN n 
15 29   GLN n 
15 30   GLU n 
15 31   TRP n 
15 32   ARG n 
15 33   ASN n 
15 34   GLU n 
15 35   GLY n 
15 36   ALA n 
15 37   VAL n 
15 38   GLU n 
15 39   ARG n 
15 40   ILE n 
15 41   GLU n 
15 42   ARG n 
15 43   PRO n 
15 44   THR n 
15 45   ARG n 
15 46   LEU n 
15 47   ASP n 
15 48   LYS n 
15 49   ALA n 
15 50   ARG n 
15 51   SER n 
15 52   GLN n 
15 53   GLY n 
15 54   TYR n 
15 55   LYS n 
15 56   ALA n 
15 57   LYS n 
15 58   GLN n 
15 59   GLY n 
15 60   VAL n 
15 61   ILE n 
15 62   VAL n 
15 63   ALA n 
15 64   ARG n 
15 65   VAL n 
15 66   SER n 
15 67   VAL n 
15 68   ARG n 
15 69   LYS n 
15 70   GLY n 
15 71   SER n 
15 72   ALA n 
15 73   ARG n 
15 74   LYS n 
15 75   ARG n 
15 76   ARG n 
15 77   HIS n 
15 78   LYS n 
15 79   ALA n 
15 80   GLY n 
15 81   ARG n 
15 82   ARG n 
15 83   SER n 
15 84   LYS n 
15 85   ARG n 
15 86   GLN n 
15 87   GLY n 
15 88   VAL n 
15 89   THR n 
15 90   ARG n 
15 91   ILE n 
15 92   THR n 
15 93   ARG n 
15 94   ARG n 
15 95   LYS n 
15 96   ASP n 
15 97   ILE n 
15 98   GLN n 
15 99   ARG n 
15 100  VAL n 
15 101  ALA n 
15 102  GLU n 
15 103  GLU n 
15 104  ARG n 
15 105  ALA n 
15 106  SER n 
15 107  ARG n 
15 108  THR n 
15 109  PHE n 
15 110  PRO n 
15 111  ASN n 
15 112  LEU n 
15 113  ARG n 
15 114  VAL n 
15 115  LEU n 
15 116  ASN n 
15 117  SER n 
15 118  TYR n 
15 119  SER n 
15 120  VAL n 
15 121  GLY n 
15 122  GLN n 
15 123  ASP n 
15 124  GLY n 
15 125  ARG n 
15 126  GLN n 
15 127  LYS n 
15 128  TRP n 
15 129  HIS n 
15 130  GLU n 
15 131  VAL n 
15 132  ILE n 
15 133  LEU n 
15 134  ILE n 
15 135  ASP n 
15 136  PRO n 
15 137  ASN n 
15 138  HIS n 
15 139  PRO n 
15 140  ALA n 
15 141  ILE n 
15 142  GLN n 
15 143  ASN n 
15 144  ASP n 
15 145  ASP n 
15 146  ASP n 
15 147  LEU n 
15 148  SER n 
15 149  TRP n 
15 150  ILE n 
15 151  CYS n 
15 152  ALA n 
15 153  ASP n 
15 154  ASP n 
15 155  GLN n 
15 156  ALA n 
15 157  ASP n 
15 158  ARG n 
15 159  VAL n 
15 160  PHE n 
15 161  ARG n 
15 162  GLY n 
15 163  LEU n 
15 164  THR n 
15 165  GLY n 
15 166  ALA n 
15 167  GLY n 
15 168  ARG n 
15 169  ARG n 
15 170  ASN n 
15 171  ARG n 
15 172  GLY n 
15 173  LEU n 
15 174  SER n 
15 175  GLY n 
15 176  LYS n 
15 177  GLY n 
15 178  LYS n 
15 179  GLY n 
15 180  SER n 
15 181  GLU n 
15 182  LYS n 
15 183  THR n 
15 184  ARG n 
15 185  PRO n 
15 186  SER n 
15 187  LEU n 
15 188  ARG n 
15 189  SER n 
15 190  ASN n 
15 191  GLY n 
15 192  GLY n 
15 193  LYS n 
15 194  GLY n 
16 1    MET n 
16 2    ALA n 
16 3    THR n 
16 4    GLY n 
16 5    PRO n 
16 6    ARG n 
16 7    TYR n 
16 8    LYS n 
16 9    VAL n 
16 10   PRO n 
16 11   MET n 
16 12   ARG n 
16 13   ARG n 
16 14   ARG n 
16 15   ARG n 
16 16   GLU n 
16 17   ALA n 
16 18   ARG n 
16 19   THR n 
16 20   ASP n 
16 21   TYR n 
16 22   HIS n 
16 23   GLN n 
16 24   ARG n 
16 25   LEU n 
16 26   ARG n 
16 27   LEU n 
16 28   LEU n 
16 29   LYS n 
16 30   SER n 
16 31   GLY n 
16 32   LYS n 
16 33   PRO n 
16 34   ARG n 
16 35   LEU n 
16 36   VAL n 
16 37   ALA n 
16 38   ARG n 
16 39   LYS n 
16 40   SER n 
16 41   ASN n 
16 42   LYS n 
16 43   HIS n 
16 44   VAL n 
16 45   ARG n 
16 46   ALA n 
16 47   GLN n 
16 48   LEU n 
16 49   VAL n 
16 50   THR n 
16 51   LEU n 
16 52   GLY n 
16 53   PRO n 
16 54   ASN n 
16 55   GLY n 
16 56   ASP n 
16 57   ASP n 
16 58   THR n 
16 59   LEU n 
16 60   ALA n 
16 61   SER n 
16 62   ALA n 
16 63   HIS n 
16 64   SER n 
16 65   SER n 
16 66   ASP n 
16 67   LEU n 
16 68   ALA n 
16 69   GLU n 
16 70   TYR n 
16 71   GLY n 
16 72   TRP n 
16 73   GLU n 
16 74   ALA n 
16 75   PRO n 
16 76   THR n 
16 77   GLY n 
16 78   ASN n 
16 79   MET n 
16 80   PRO n 
16 81   SER n 
16 82   ALA n 
16 83   TYR n 
16 84   LEU n 
16 85   THR n 
16 86   GLY n 
16 87   LEU n 
16 88   LEU n 
16 89   ALA n 
16 90   GLY n 
16 91   LEU n 
16 92   ARG n 
16 93   ALA n 
16 94   GLN n 
16 95   GLU n 
16 96   ALA n 
16 97   GLY n 
16 98   VAL n 
16 99   GLU n 
16 100  GLU n 
16 101  ALA n 
16 102  VAL n 
16 103  LEU n 
16 104  ASP n 
16 105  ILE n 
16 106  GLY n 
16 107  LEU n 
16 108  ASN n 
16 109  SER n 
16 110  PRO n 
16 111  THR n 
16 112  PRO n 
16 113  GLY n 
16 114  SER n 
16 115  LYS n 
16 116  VAL n 
16 117  PHE n 
16 118  ALA n 
16 119  ILE n 
16 120  GLN n 
16 121  GLU n 
16 122  GLY n 
16 123  ALA n 
16 124  ILE n 
16 125  ASP n 
16 126  ALA n 
16 127  GLY n 
16 128  LEU n 
16 129  ASP n 
16 130  ILE n 
16 131  PRO n 
16 132  HIS n 
16 133  ASN n 
16 134  ASP n 
16 135  ASP n 
16 136  VAL n 
16 137  LEU n 
16 138  ALA n 
16 139  ASP n 
16 140  TRP n 
16 141  GLN n 
16 142  ARG n 
16 143  THR n 
16 144  ARG n 
16 145  GLY n 
16 146  ALA n 
16 147  HIS n 
16 148  ILE n 
16 149  ALA n 
16 150  GLU n 
16 151  TYR n 
16 152  ASP n 
16 153  GLU n 
16 154  GLN n 
16 155  LEU n 
16 156  GLU n 
16 157  GLU n 
16 158  PRO n 
16 159  LEU n 
16 160  TYR n 
16 161  SER n 
16 162  GLY n 
16 163  ASP n 
16 164  PHE n 
16 165  ASP n 
16 166  ALA n 
16 167  ALA n 
16 168  ASP n 
16 169  LEU n 
16 170  PRO n 
16 171  GLU n 
16 172  HIS n 
16 173  PHE n 
16 174  ASP n 
16 175  GLU n 
16 176  LEU n 
16 177  ARG n 
16 178  GLU n 
16 179  THR n 
16 180  LEU n 
16 181  LEU n 
16 182  ASP n 
16 183  GLY n 
16 184  ASP n 
16 185  ILE n 
16 186  GLU n 
16 187  LEU n 
17 1    MET n 
17 2    SER n 
17 3    LYS n 
17 4    THR n 
17 5    ASN n 
17 6    PRO n 
17 7    ARG n 
17 8    LEU n 
17 9    SER n 
17 10   SER n 
17 11   LEU n 
17 12   ILE n 
17 13   ALA n 
17 14   ASP n 
17 15   LEU n 
17 16   LYS n 
17 17   SER n 
17 18   ALA n 
17 19   ALA n 
17 20   ARG n 
17 21   SER n 
17 22   SER n 
17 23   GLY n 
17 24   GLY n 
17 25   ALA n 
17 26   VAL n 
17 27   TRP n 
17 28   GLY n 
17 29   ASP n 
17 30   VAL n 
17 31   ALA n 
17 32   GLU n 
17 33   ARG n 
17 34   LEU n 
17 35   GLU n 
17 36   LYS n 
17 37   PRO n 
17 38   ARG n 
17 39   ARG n 
17 40   THR n 
17 41   HIS n 
17 42   ALA n 
17 43   GLU n 
17 44   VAL n 
17 45   ASN n 
17 46   LEU n 
17 47   GLY n 
17 48   ARG n 
17 49   ILE n 
17 50   GLU n 
17 51   ARG n 
17 52   TYR n 
17 53   ALA n 
17 54   GLN n 
17 55   GLU n 
17 56   ASP n 
17 57   GLU n 
17 58   THR n 
17 59   VAL n 
17 60   VAL n 
17 61   VAL n 
17 62   PRO n 
17 63   GLY n 
17 64   LYS n 
17 65   VAL n 
17 66   LEU n 
17 67   GLY n 
17 68   SER n 
17 69   GLY n 
17 70   VAL n 
17 71   LEU n 
17 72   GLN n 
17 73   LYS n 
17 74   ASP n 
17 75   VAL n 
17 76   THR n 
17 77   VAL n 
17 78   ALA n 
17 79   ALA n 
17 80   VAL n 
17 81   ASP n 
17 82   PHE n 
17 83   SER n 
17 84   GLY n 
17 85   THR n 
17 86   ALA n 
17 87   GLU n 
17 88   THR n 
17 89   LYS n 
17 90   ILE n 
17 91   ASP n 
17 92   GLN n 
17 93   VAL n 
17 94   GLY n 
17 95   GLU n 
17 96   ALA n 
17 97   VAL n 
17 98   SER n 
17 99   LEU n 
17 100  GLU n 
17 101  GLN n 
17 102  ALA n 
17 103  ILE n 
17 104  GLU n 
17 105  ASN n 
17 106  ASN n 
17 107  PRO n 
17 108  GLU n 
17 109  GLY n 
17 110  SER n 
17 111  HIS n 
17 112  VAL n 
17 113  ARG n 
17 114  VAL n 
17 115  ILE n 
17 116  ARG n 
18 1    MET n 
18 2    THR n 
18 3    ASP n 
18 4    LEU n 
18 5    SER n 
18 6    ALA n 
18 7    GLN n 
18 8    LYS n 
18 9    ARG n 
18 10   LEU n 
18 11   ALA n 
18 12   ALA n 
18 13   ASP n 
18 14   VAL n 
18 15   LEU n 
18 16   ASP n 
18 17   VAL n 
18 18   GLY n 
18 19   LYS n 
18 20   ASN n 
18 21   ARG n 
18 22   VAL n 
18 23   TRP n 
18 24   PHE n 
18 25   ASN n 
18 26   PRO n 
18 27   GLU n 
18 28   ARG n 
18 29   GLN n 
18 30   GLY n 
18 31   ASP n 
18 32   ILE n 
18 33   ALA n 
18 34   ASP n 
18 35   ALA n 
18 36   ILE n 
18 37   THR n 
18 38   ARG n 
18 39   GLU n 
18 40   ASP n 
18 41   VAL n 
18 42   ARG n 
18 43   GLU n 
18 44   LEU n 
18 45   VAL n 
18 46   ASP n 
18 47   GLU n 
18 48   GLY n 
18 49   ALA n 
18 50   ILE n 
18 51   GLN n 
18 52   ALA n 
18 53   LYS n 
18 54   ASP n 
18 55   LYS n 
18 56   LYS n 
18 57   GLY n 
18 58   ASN n 
18 59   SER n 
18 60   ARG n 
18 61   GLY n 
18 62   ARG n 
18 63   ALA n 
18 64   ARG n 
18 65   GLU n 
18 66   ARG n 
18 67   GLN n 
18 68   LYS n 
18 69   LYS n 
18 70   ARG n 
18 71   ALA n 
18 72   TYR n 
18 73   GLY n 
18 74   HIS n 
18 75   GLN n 
18 76   LYS n 
18 77   GLY n 
18 78   ALA n 
18 79   GLY n 
18 80   SER n 
18 81   ARG n 
18 82   LYS n 
18 83   GLY n 
18 84   LYS n 
18 85   ALA n 
18 86   GLY n 
18 87   ALA n 
18 88   ARG n 
18 89   GLN n 
18 90   ASN n 
18 91   SER n 
18 92   LYS n 
18 93   GLU n 
18 94   ASP n 
18 95   TRP n 
18 96   GLU n 
18 97   SER n 
18 98   ARG n 
18 99   ILE n 
18 100  ARG n 
18 101  ALA n 
18 102  GLN n 
18 103  ARG n 
18 104  THR n 
18 105  LYS n 
18 106  LEU n 
18 107  ARG n 
18 108  GLU n 
18 109  LEU n 
18 110  ARG n 
18 111  ASP n 
18 112  GLU n 
18 113  GLY n 
18 114  THR n 
18 115  LEU n 
18 116  SER n 
18 117  SER n 
18 118  SER n 
18 119  GLN n 
18 120  TYR n 
18 121  ARG n 
18 122  ASP n 
18 123  LEU n 
18 124  TYR n 
18 125  ASP n 
18 126  LYS n 
18 127  ALA n 
18 128  GLY n 
18 129  GLY n 
18 130  GLY n 
18 131  GLU n 
18 132  PHE n 
18 133  ASP n 
18 134  SER n 
18 135  VAL n 
18 136  ALA n 
18 137  ASP n 
18 138  LEU n 
18 139  GLU n 
18 140  ARG n 
18 141  TYR n 
18 142  ILE n 
18 143  ASP n 
18 144  ALA n 
18 145  ASN n 
18 146  HIS n 
18 147  GLY n 
18 148  ASP n 
18 149  ALA n 
19 1    MET n 
19 2    PRO n 
19 3    SER n 
19 4    SER n 
19 5    ASN n 
19 6    GLY n 
19 7    PRO n 
19 8    LEU n 
19 9    GLU n 
19 10   GLY n 
19 11   THR n 
19 12   ARG n 
19 13   GLY n 
19 14   LYS n 
19 15   LEU n 
19 16   LYS n 
19 17   ASN n 
19 18   LYS n 
19 19   PRO n 
19 20   ARG n 
19 21   ASP n 
19 22   ARG n 
19 23   GLY n 
19 24   THR n 
19 25   SER n 
19 26   PRO n 
19 27   PRO n 
19 28   GLN n 
19 29   ARG n 
19 30   ALA n 
19 31   VAL n 
19 32   GLU n 
19 33   GLU n 
19 34   PHE n 
19 35   ASP n 
19 36   ASP n 
19 37   GLY n 
19 38   GLU n 
19 39   LYS n 
19 40   VAL n 
19 41   HIS n 
19 42   LEU n 
19 43   LYS n 
19 44   ILE n 
19 45   ASP n 
19 46   PRO n 
19 47   SER n 
19 48   VAL n 
19 49   PRO n 
19 50   ASN n 
19 51   GLY n 
19 52   ARG n 
19 53   PHE n 
19 54   HIS n 
19 55   PRO n 
19 56   ARG n 
19 57   PHE n 
19 58   ASP n 
19 59   GLY n 
19 60   GLN n 
19 61   THR n 
19 62   GLY n 
19 63   THR n 
19 64   VAL n 
19 65   GLU n 
19 66   GLY n 
19 67   LYS n 
19 68   GLN n 
19 69   GLY n 
19 70   ASP n 
19 71   ALA n 
19 72   TYR n 
19 73   LYS n 
19 74   VAL n 
19 75   ASP n 
19 76   ILE n 
19 77   VAL n 
19 78   ASP n 
19 79   GLY n 
19 80   GLY n 
19 81   LYS n 
19 82   GLU n 
19 83   LYS n 
19 84   THR n 
19 85   ILE n 
19 86   ILE n 
19 87   VAL n 
19 88   THR n 
19 89   ALA n 
19 90   ALA n 
19 91   HIS n 
19 92   LEU n 
19 93   ARG n 
19 94   ARG n 
19 95   GLN n 
19 96   GLU n 
20 1    MET n 
20 2    GLY n 
20 3    ILE n 
20 4    SER n 
20 5    TYR n 
20 6    SER n 
20 7    VAL n 
20 8    GLU n 
20 9    ALA n 
20 10   ASP n 
20 11   PRO n 
20 12   ASP n 
20 13   THR n 
20 14   THR n 
20 15   ALA n 
20 16   LYS n 
20 17   ALA n 
20 18   MET n 
20 19   LEU n 
20 20   ARG n 
20 21   GLU n 
20 22   ARG n 
20 23   GLN n 
20 24   MET n 
20 25   SER n 
20 26   PHE n 
20 27   LYS n 
20 28   HIS n 
20 29   SER n 
20 30   LYS n 
20 31   ALA n 
20 32   ILE n 
20 33   ALA n 
20 34   ARG n 
20 35   GLU n 
20 36   ILE n 
20 37   LYS n 
20 38   GLY n 
20 39   LYS n 
20 40   THR n 
20 41   ALA n 
20 42   GLY n 
20 43   GLU n 
20 44   ALA n 
20 45   VAL n 
20 46   ASP n 
20 47   TYR n 
20 48   LEU n 
20 49   GLU n 
20 50   ALA n 
20 51   VAL n 
20 52   ILE n 
20 53   GLU n 
20 54   GLY n 
20 55   ASP n 
20 56   GLN n 
20 57   PRO n 
20 58   VAL n 
20 59   PRO n 
20 60   PHE n 
20 61   LYS n 
20 62   GLN n 
20 63   HIS n 
20 64   ASN n 
20 65   SER n 
20 66   GLY n 
20 67   VAL n 
20 68   GLY n 
20 69   HIS n 
20 70   LYS n 
20 71   SER n 
20 72   LYS n 
20 73   VAL n 
20 74   ASP n 
20 75   GLY n 
20 76   TRP n 
20 77   ASP n 
20 78   ALA n 
20 79   GLY n 
20 80   ARG n 
20 81   TYR n 
20 82   PRO n 
20 83   GLU n 
20 84   LYS n 
20 85   ALA n 
20 86   SER n 
20 87   LYS n 
20 88   ALA n 
20 89   PHE n 
20 90   LEU n 
20 91   ASP n 
20 92   LEU n 
20 93   LEU n 
20 94   GLU n 
20 95   ASN n 
20 96   ALA n 
20 97   VAL n 
20 98   GLY n 
20 99   ASN n 
20 100  ALA n 
20 101  ASP n 
20 102  HIS n 
20 103  GLN n 
20 104  GLY n 
20 105  PHE n 
20 106  ASP n 
20 107  GLY n 
20 108  GLU n 
20 109  ALA n 
20 110  MET n 
20 111  THR n 
20 112  ILE n 
20 113  LYS n 
20 114  HIS n 
20 115  VAL n 
20 116  ALA n 
20 117  ALA n 
20 118  HIS n 
20 119  LYS n 
20 120  VAL n 
20 121  GLY n 
20 122  GLU n 
20 123  GLN n 
20 124  GLN n 
20 125  GLY n 
20 126  ARG n 
20 127  LYS n 
20 128  PRO n 
20 129  ARG n 
20 130  ALA n 
20 131  MET n 
20 132  GLY n 
20 133  ARG n 
20 134  ALA n 
20 135  SER n 
20 136  ALA n 
20 137  TRP n 
20 138  ASN n 
20 139  SER n 
20 140  PRO n 
20 141  GLN n 
20 142  VAL n 
20 143  ASP n 
20 144  VAL n 
20 145  GLU n 
20 146  LEU n 
20 147  ILE n 
20 148  LEU n 
20 149  GLU n 
20 150  GLU n 
20 151  PRO n 
20 152  GLU n 
20 153  VAL n 
20 154  GLU n 
20 155  ASP n 
21 1    MET n 
21 2    SER n 
21 3    TRP n 
21 4    ASP n 
21 5    VAL n 
21 6    ILE n 
21 7    LYS n 
21 8    HIS n 
21 9    PRO n 
21 10   HIS n 
21 11   VAL n 
21 12   THR n 
21 13   GLU n 
21 14   LYS n 
21 15   ALA n 
21 16   MET n 
21 17   ASN n 
21 18   ASP n 
21 19   MET n 
21 20   ASP n 
21 21   PHE n 
21 22   GLN n 
21 23   ASN n 
21 24   LYS n 
21 25   LEU n 
21 26   GLN n 
21 27   PHE n 
21 28   ALA n 
21 29   VAL n 
21 30   ASP n 
21 31   ASP n 
21 32   ARG n 
21 33   ALA n 
21 34   SER n 
21 35   LYS n 
21 36   GLY n 
21 37   GLU n 
21 38   VAL n 
21 39   ALA n 
21 40   ASP n 
21 41   ALA n 
21 42   VAL n 
21 43   GLU n 
21 44   GLU n 
21 45   GLN n 
21 46   TYR n 
21 47   ASP n 
21 48   VAL n 
21 49   THR n 
21 50   VAL n 
21 51   GLU n 
21 52   GLN n 
21 53   VAL n 
21 54   ASN n 
21 55   THR n 
21 56   GLN n 
21 57   ASN n 
21 58   THR n 
21 59   MET n 
21 60   ASP n 
21 61   GLY n 
21 62   GLU n 
21 63   LYS n 
21 64   LYS n 
21 65   ALA n 
21 66   VAL n 
21 67   VAL n 
21 68   ARG n 
21 69   LEU n 
21 70   SER n 
21 71   GLU n 
21 72   ASP n 
21 73   ASP n 
21 74   ASP n 
21 75   ALA n 
21 76   GLN n 
21 77   GLU n 
21 78   VAL n 
21 79   ALA n 
21 80   SER n 
21 81   ARG n 
21 82   ILE n 
21 83   GLY n 
21 84   VAL n 
21 85   PHE n 
22 1    MET n 
22 2    SER n 
22 3    LYS n 
22 4    GLN n 
22 5    PRO n 
22 6    ASP n 
22 7    LYS n 
22 8    GLN n 
22 9    ARG n 
22 10   LYS n 
22 11   SER n 
22 12   GLN n 
22 13   ARG n 
22 14   ARG n 
22 15   ALA n 
22 16   PRO n 
22 17   LEU n 
22 18   HIS n 
22 19   GLU n 
22 20   ARG n 
22 21   HIS n 
22 22   LYS n 
22 23   GLN n 
22 24   VAL n 
22 25   ARG n 
22 26   ALA n 
22 27   THR n 
22 28   LEU n 
22 29   SER n 
22 30   ALA n 
22 31   ASP n 
22 32   LEU n 
22 33   ARG n 
22 34   GLU n 
22 35   GLU n 
22 36   TYR n 
22 37   GLY n 
22 38   GLN n 
22 39   ARG n 
22 40   ASN n 
22 41   VAL n 
22 42   ARG n 
22 43   VAL n 
22 44   ASN n 
22 45   ALA n 
22 46   GLY n 
22 47   ASP n 
22 48   THR n 
22 49   VAL n 
22 50   GLU n 
22 51   VAL n 
22 52   LEU n 
22 53   ARG n 
22 54   GLY n 
22 55   ASP n 
22 56   PHE n 
22 57   ALA n 
22 58   GLY n 
22 59   GLU n 
22 60   GLU n 
22 61   GLY n 
22 62   GLU n 
22 63   VAL n 
22 64   ILE n 
22 65   ASN n 
22 66   VAL n 
22 67   ASP n 
22 68   LEU n 
22 69   ASP n 
22 70   LYS n 
22 71   ALA n 
22 72   VAL n 
22 73   ILE n 
22 74   HIS n 
22 75   VAL n 
22 76   GLU n 
22 77   ASP n 
22 78   VAL n 
22 79   THR n 
22 80   LEU n 
22 81   GLU n 
22 82   LYS n 
22 83   THR n 
22 84   ASP n 
22 85   GLY n 
22 86   GLU n 
22 87   GLU n 
22 88   VAL n 
22 89   PRO n 
22 90   ARG n 
22 91   PRO n 
22 92   LEU n 
22 93   ASP n 
22 94   THR n 
22 95   SER n 
22 96   ASN n 
22 97   VAL n 
22 98   ARG n 
22 99   VAL n 
22 100  THR n 
22 101  ASP n 
22 102  LEU n 
22 103  ASP n 
22 104  LEU n 
22 105  GLU n 
22 106  ASP n 
22 107  GLU n 
22 108  LYS n 
22 109  ARG n 
22 110  GLU n 
22 111  ALA n 
22 112  ARG n 
22 113  LEU n 
22 114  GLU n 
22 115  SER n 
22 116  GLU n 
22 117  ASP n 
22 118  ASP n 
22 119  SER n 
22 120  ALA n 
23 1    PRO n 
23 2    ARG n 
23 3    THR n 
23 4    ARG n 
23 5    GLU n 
23 6    CYS n 
23 7    ASP n 
23 8    TYR n 
23 9    CYS n 
23 10   GLY n 
23 11   THR n 
23 12   ASP n 
23 13   ILE n 
23 14   GLU n 
23 15   PRO n 
23 16   GLY n 
23 17   THR n 
23 18   GLY n 
23 19   THR n 
23 20   MET n 
23 21   PHE n 
23 22   VAL n 
23 23   HIS n 
23 24   LYS n 
23 25   ASP n 
23 26   GLY n 
23 27   ALA n 
23 28   THR n 
23 29   THR n 
23 30   HIS n 
23 31   PHE n 
23 32   CYS n 
23 33   SER n 
23 34   SER n 
23 35   LYS n 
23 36   CYS n 
23 37   GLU n 
23 38   ASN n 
23 39   ASN n 
23 40   ALA n 
23 41   ASP n 
23 42   LEU n 
23 43   GLY n 
23 44   ARG n 
23 45   GLU n 
23 46   ALA n 
23 47   ARG n 
23 48   ASN n 
23 49   LEU n 
23 50   GLU n 
23 51   TRP n 
23 52   THR n 
23 53   ASP n 
23 54   THR n 
23 55   ALA n 
23 56   ARG n 
23 57   GLY n 
23 58   GLU n 
23 59   ALA n 
23 60   GLY n 
23 61   GLU n 
23 62   ALA n 
23 63   GLU n 
23 64   ASP n 
23 65   GLU n 
23 66   ALA n 
24 1    MET n 
24 2    THR n 
24 3    VAL n 
24 4    LEU n 
24 5    HIS n 
24 6    VAL n 
24 7    GLN n 
24 8    GLU n 
24 9    ILE n 
24 10   ARG n 
24 11   ASP n 
24 12   MET n 
24 13   THR n 
24 14   PRO n 
24 15   ALA n 
24 16   GLU n 
24 17   ARG n 
24 18   GLU n 
24 19   ALA n 
24 20   GLU n 
24 21   LEU n 
24 22   ASP n 
24 23   ASP n 
24 24   LEU n 
24 25   LYS n 
24 26   THR n 
24 27   GLU n 
24 28   LEU n 
24 29   LEU n 
24 30   ASN n 
24 31   ALA n 
24 32   ARG n 
24 33   ALA n 
24 34   VAL n 
24 35   GLN n 
24 36   ALA n 
24 37   ALA n 
24 38   GLY n 
24 39   GLY n 
24 40   ALA n 
24 41   PRO n 
24 42   GLU n 
24 43   ASN n 
24 44   PRO n 
24 45   GLY n 
24 46   ARG n 
24 47   ILE n 
24 48   LYS n 
24 49   GLU n 
24 50   LEU n 
24 51   ARG n 
24 52   LYS n 
24 53   ALA n 
24 54   ILE n 
24 55   ALA n 
24 56   ARG n 
24 57   ILE n 
24 58   LYS n 
24 59   THR n 
24 60   ILE n 
24 61   GLN n 
24 62   GLY n 
24 63   GLU n 
24 64   GLU n 
24 65   GLY n 
24 66   ASP n 
24 67   LEU n 
24 68   GLN n 
24 69   GLU n 
24 70   ASN n 
24 71   GLU n 
25 1    MET n 
25 2    HIS n 
25 3    ALA n 
25 4    LEU n 
25 5    VAL n 
25 6    GLN n 
25 7    LEU n 
25 8    ARG n 
25 9    GLY n 
25 10   GLU n 
25 11   VAL n 
25 12   ASN n 
25 13   MET n 
25 14   HIS n 
25 15   THR n 
25 16   ASP n 
25 17   ILE n 
25 18   GLN n 
25 19   ASP n 
25 20   THR n 
25 21   LEU n 
25 22   GLU n 
25 23   MET n 
25 24   LEU n 
25 25   ASN n 
25 26   ILE n 
25 27   HIS n 
25 28   HIS n 
25 29   VAL n 
25 30   ASN n 
25 31   HIS n 
25 32   CYS n 
25 33   THR n 
25 34   LEU n 
25 35   VAL n 
25 36   PRO n 
25 37   GLU n 
25 38   THR n 
25 39   ASP n 
25 40   ALA n 
25 41   TYR n 
25 42   ARG n 
25 43   GLY n 
25 44   MET n 
25 45   VAL n 
25 46   ALA n 
25 47   LYS n 
25 48   VAL n 
25 49   ASN n 
25 50   ASP n 
25 51   PHE n 
25 52   VAL n 
25 53   ALA n 
25 54   PHE n 
25 55   GLY n 
25 56   GLU n 
25 57   PRO n 
25 58   SER n 
25 59   GLN n 
25 60   GLU n 
25 61   THR n 
25 62   LEU n 
25 63   GLU n 
25 64   THR n 
25 65   VAL n 
25 66   LEU n 
25 67   ALA n 
25 68   THR n 
25 69   ARG n 
25 70   ALA n 
25 71   GLU n 
25 72   PRO n 
25 73   LEU n 
25 74   GLU n 
25 75   GLY n 
25 76   ASP n 
25 77   ALA n 
25 78   ASP n 
25 79   VAL n 
25 80   ASP n 
25 81   ASP n 
25 82   GLU n 
25 83   TRP n 
25 84   VAL n 
25 85   ALA n 
25 86   GLU n 
25 87   HIS n 
25 88   THR n 
25 89   ASP n 
25 90   TYR n 
25 91   ASP n 
25 92   ASP n 
25 93   ILE n 
25 94   SER n 
25 95   GLY n 
25 96   LEU n 
25 97   ALA n 
25 98   PHE n 
25 99   ALA n 
25 100  LEU n 
25 101  LEU n 
25 102  SER n 
25 103  GLU n 
25 104  GLU n 
25 105  THR n 
25 106  THR n 
25 107  LEU n 
25 108  ARG n 
25 109  GLU n 
25 110  GLN n 
25 111  GLY n 
25 112  LEU n 
25 113  SER n 
25 114  PRO n 
25 115  THR n 
25 116  LEU n 
25 117  ARG n 
25 118  LEU n 
25 119  HIS n 
25 120  PRO n 
25 121  PRO n 
25 122  ARG n 
25 123  GLY n 
25 124  GLY n 
25 125  HIS n 
25 126  ASP n 
25 127  GLY n 
25 128  VAL n 
25 129  LYS n 
25 130  HIS n 
25 131  PRO n 
25 132  VAL n 
25 133  LYS n 
25 134  GLU n 
25 135  GLY n 
25 136  GLY n 
25 137  GLN n 
25 138  LEU n 
25 139  GLY n 
25 140  LYS n 
25 141  HIS n 
25 142  ASP n 
25 143  THR n 
25 144  GLU n 
25 145  GLY n 
25 146  ILE n 
25 147  ASP n 
25 148  ASP n 
25 149  LEU n 
25 150  LEU n 
25 151  GLU n 
25 152  ALA n 
25 153  MET n 
25 154  ARG n 
26 1    MET n 
26 2    SER n 
26 3    ALA n 
26 4    SER n 
26 5    ASP n 
26 6    PHE n 
26 7    GLU n 
26 8    GLU n 
26 9    ARG n 
26 10   VAL n 
26 11   VAL n 
26 12   THR n 
26 13   ILE n 
26 14   PRO n 
26 15   LEU n 
26 16   ARG n 
26 17   ASP n 
26 18   ALA n 
26 19   ARG n 
26 20   ALA n 
26 21   GLU n 
26 22   PRO n 
26 23   ASN n 
26 24   HIS n 
26 25   LYS n 
26 26   ARG n 
26 27   ALA n 
26 28   ASP n 
26 29   LYS n 
26 30   ALA n 
26 31   MET n 
26 32   ILE n 
26 33   LEU n 
26 34   ILE n 
26 35   ARG n 
26 36   GLU n 
26 37   HIS n 
26 38   LEU n 
26 39   ALA n 
26 40   LYS n 
26 41   HIS n 
26 42   PHE n 
26 43   SER n 
26 44   VAL n 
26 45   ASP n 
26 46   GLU n 
26 47   ASP n 
26 48   ALA n 
26 49   VAL n 
26 50   ARG n 
26 51   LEU n 
26 52   ASP n 
26 53   PRO n 
26 54   SER n 
26 55   ILE n 
26 56   ASN n 
26 57   GLU n 
26 58   ALA n 
26 59   ALA n 
26 60   TRP n 
26 61   ALA n 
26 62   ARG n 
26 63   GLY n 
26 64   ARG n 
26 65   ALA n 
26 66   ASN n 
26 67   THR n 
26 68   PRO n 
26 69   SER n 
26 70   LYS n 
26 71   ILE n 
26 72   ARG n 
26 73   VAL n 
26 74   ARG n 
26 75   ALA n 
26 76   ALA n 
26 77   ARG n 
26 78   PHE n 
26 79   GLU n 
26 80   GLU n 
26 81   GLU n 
26 82   GLY n 
26 83   GLU n 
26 84   ALA n 
26 85   ILE n 
26 86   VAL n 
26 87   GLU n 
26 88   ALA n 
26 89   GLU n 
26 90   THR n 
26 91   ALA n 
26 92   GLU n 
27 1    MET n 
27 2    ALA n 
27 3    ASP n 
27 4    ASN n 
27 5    GLU n 
27 6    GLU n 
27 7    ASP n 
27 8    VAL n 
27 9    GLU n 
27 10   ALA n 
27 11   GLU n 
27 12   GLU n 
27 13   GLU n 
27 14   TYR n 
27 15   THR n 
27 16   GLU n 
27 17   LEU n 
27 18   THR n 
27 19   ASP n 
27 20   ILE n 
27 21   SER n 
27 22   GLY n 
27 23   VAL n 
27 24   GLY n 
27 25   PRO n 
27 26   SER n 
27 27   LYS n 
27 28   ALA n 
27 29   GLU n 
27 30   SER n 
27 31   LEU n 
27 32   ARG n 
27 33   GLU n 
27 34   ALA n 
27 35   GLY n 
27 36   PHE n 
27 37   GLU n 
27 38   SER n 
27 39   VAL n 
27 40   GLU n 
27 41   ASP n 
27 42   VAL n 
27 43   ARG n 
27 44   GLY n 
27 45   ALA n 
27 46   ASP n 
27 47   GLN n 
27 48   SER n 
27 49   ALA n 
27 50   LEU n 
27 51   ALA n 
27 52   ASP n 
27 53   VAL n 
27 54   SER n 
27 55   GLY n 
27 56   ILE n 
27 57   GLY n 
27 58   ASN n 
27 59   ALA n 
27 60   LEU n 
27 61   ALA n 
27 62   ALA n 
27 63   ARG n 
27 64   ILE n 
27 65   LYS n 
27 66   ALA n 
27 67   ASP n 
27 68   VAL n 
27 69   GLY n 
27 70   GLY n 
27 71   LEU n 
27 72   GLU n 
27 73   VAL n 
27 74   GLU n 
27 75   SER n 
27 76   GLU n 
27 77   THR n 
27 78   GLU n 
27 79   ALA n 
27 80   GLU n 
27 81   VAL n 
27 82   GLU n 
27 83   GLU n 
27 84   GLU n 
27 85   GLY n 
27 86   GLY n 
27 87   GLU n 
27 88   GLU n 
27 89   ALA n 
27 90   PRO n 
27 91   ASP n 
27 92   GLU n 
27 93   ASP n 
27 94   VAL n 
27 95   GLU n 
27 96   THR n 
27 97   GLU n 
27 98   LEU n 
27 99   GLN n 
27 100  ALA n 
27 101  ARG n 
27 102  GLY n 
27 103  LEU n 
27 104  THR n 
27 105  GLU n 
27 106  LYS n 
27 107  THR n 
27 108  PRO n 
27 109  ASP n 
27 110  LEU n 
27 111  SER n 
27 112  ASP n 
27 113  GLU n 
27 114  ASP n 
27 115  ALA n 
27 116  ARG n 
27 117  LEU n 
27 118  LEU n 
27 119  THR n 
27 120  GLN n 
27 121  ARG n 
27 122  HIS n 
27 123  ARG n 
27 124  VAL n 
27 125  GLY n 
27 126  LYS n 
27 127  PRO n 
27 128  GLN n 
27 129  PHE n 
27 130  ASN n 
27 131  ARG n 
27 132  GLN n 
27 133  ASP n 
27 134  HIS n 
27 135  HIS n 
27 136  LYS n 
27 137  LYS n 
27 138  LYS n 
27 139  ARG n 
27 140  VAL n 
27 141  SER n 
27 142  THR n 
27 143  SER n 
27 144  TRP n 
27 145  ARG n 
27 146  LYS n 
27 147  PRO n 
27 148  ARG n 
27 149  GLY n 
27 150  GLN n 
27 151  LEU n 
27 152  SER n 
27 153  LYS n 
27 154  GLN n 
27 155  ARG n 
27 156  ARG n 
27 157  GLY n 
27 158  ILE n 
27 159  LYS n 
27 160  GLY n 
27 161  LYS n 
27 162  GLY n 
27 163  ASP n 
27 164  THR n 
27 165  VAL n 
27 166  GLU n 
27 167  ALA n 
27 168  GLY n 
27 169  PHE n 
27 170  ARG n 
27 171  SER n 
27 172  PRO n 
27 173  THR n 
27 174  ALA n 
27 175  VAL n 
27 176  ARG n 
27 177  GLY n 
27 178  LYS n 
27 179  HIS n 
27 180  PRO n 
27 181  SER n 
27 182  GLY n 
27 183  PHE n 
27 184  GLU n 
27 185  GLU n 
27 186  VAL n 
27 187  ARG n 
27 188  VAL n 
27 189  HIS n 
27 190  ASN n 
27 191  VAL n 
27 192  ASP n 
27 193  ASP n 
27 194  LEU n 
27 195  GLU n 
27 196  GLY n 
27 197  VAL n 
27 198  ASP n 
27 199  GLY n 
27 200  ASP n 
27 201  THR n 
27 202  GLU n 
27 203  ALA n 
27 204  VAL n 
27 205  ARG n 
27 206  ILE n 
27 207  ALA n 
27 208  SER n 
27 209  LYS n 
27 210  VAL n 
27 211  GLY n 
27 212  ALA n 
27 213  ARG n 
27 214  LYS n 
27 215  ARG n 
27 216  GLU n 
27 217  ARG n 
27 218  ILE n 
27 219  GLU n 
27 220  GLU n 
27 221  GLU n 
27 222  ALA n 
27 223  GLU n 
27 224  ASP n 
27 225  ALA n 
27 226  GLY n 
27 227  ILE n 
27 228  ARG n 
27 229  VAL n 
27 230  LEU n 
27 231  ASN n 
27 232  PRO n 
27 233  THR n 
27 234  TYR n 
27 235  VAL n 
27 236  GLU n 
27 237  VAL n 
27 238  GLU n 
27 239  VAL n 
27 240  SER n 
27 241  GLU n 
28 1    ARG n 
28 2    SER n 
28 3    GLY n 
28 4    ARG n 
28 5    PHE n 
28 6    GLY n 
28 7    ALA n 
28 8    ARG n 
28 9    TYR n 
28 10   GLY n 
28 11   ARG n 
28 12   VAL n 
28 13   SER n 
28 14   ARG n 
28 15   ARG n 
28 16   ARG n 
28 17   VAL n 
28 18   ALA n 
28 19   GLU n 
28 20   ILE n 
28 21   GLU n 
28 22   SER n 
28 23   GLU n 
28 24   MET n 
28 25   ASN n 
28 26   GLU n 
28 27   ASP n 
28 28   HIS n 
28 29   ALA n 
28 30   CYS n 
28 31   PRO n 
28 32   ASN n 
28 33   CYS n 
28 34   GLY n 
28 35   GLU n 
28 36   ASP n 
28 37   ARG n 
28 38   VAL n 
28 39   ASP n 
28 40   ARG n 
28 41   GLN n 
28 42   GLY n 
28 43   THR n 
28 44   GLY n 
28 45   ILE n 
28 46   TRP n 
28 47   GLN n 
28 48   CYS n 
28 49   SER n 
28 50   TYR n 
28 51   CYS n 
28 52   ASP n 
28 53   TYR n 
28 54   LYS n 
28 55   PHE n 
28 56   THR n 
28 57   GLY n 
28 58   GLY n 
28 59   SER n 
28 60   TYR n 
28 61   LYS n 
28 62   PRO n 
28 63   GLU n 
28 64   THR n 
28 65   PRO n 
28 66   GLY n 
28 67   GLY n 
28 68   LYS n 
28 69   THR n 
28 70   VAL n 
28 71   ARG n 
28 72   ARG n 
28 73   SER n 
28 74   ILE n 
28 75   ARG n 
28 76   ALA n 
28 77   ALA n 
28 78   LEU n 
28 79   SER n 
28 80   GLU n 
28 81   ASP n 
28 82   GLU n 
28 83   GLU n 
29 1    MET n 
29 2    THR n 
29 3    GLY n 
29 4    ALA n 
29 5    GLY n 
29 6    THR n 
29 7    PRO n 
29 8    SER n 
29 9    GLN n 
29 10   GLY n 
29 11   LYS n 
29 12   LYS n 
29 13   ASN n 
29 14   THR n 
29 15   THR n 
29 16   THR n 
29 17   HIS n 
29 18   THR n 
29 19   LYS n 
29 20   CYS n 
29 21   ARG n 
29 22   ARG n 
29 23   CYS n 
29 24   GLY n 
29 25   GLU n 
29 26   LYS n 
29 27   SER n 
29 28   TYR n 
29 29   HIS n 
29 30   THR n 
29 31   LYS n 
29 32   LYS n 
29 33   LYS n 
29 34   VAL n 
29 35   CYS n 
29 36   SER n 
29 37   SER n 
29 38   CYS n 
29 39   GLY n 
29 40   PHE n 
29 41   GLY n 
29 42   LYS n 
29 43   SER n 
29 44   ALA n 
29 45   LYS n 
29 46   ARG n 
29 47   ARG n 
29 48   ASP n 
29 49   TYR n 
29 50   GLU n 
29 51   TRP n 
29 52   GLN n 
29 53   SER n 
29 54   LYS n 
29 55   ALA n 
29 56   GLY n 
29 57   GLU n 
30 1    MET n 
30 2    GLY n 
30 3    LYS n 
30 4    LYS n 
30 5    SER n 
30 6    LYS n 
30 7    ALA n 
30 8    THR n 
30 9    LYS n 
30 10   LYS n 
30 11   ARG n 
30 12   LEU n 
30 13   ALA n 
30 14   LYS n 
30 15   LEU n 
30 16   ASP n 
30 17   ASN n 
30 18   GLN n 
30 19   ASN n 
30 20   SER n 
30 21   ARG n 
30 22   VAL n 
30 23   PRO n 
30 24   ALA n 
30 25   TRP n 
30 26   VAL n 
30 27   MET n 
30 28   LEU n 
30 29   LYS n 
30 30   THR n 
30 31   ASP n 
30 32   ARG n 
30 33   GLU n 
30 34   VAL n 
30 35   GLN n 
30 36   ARG n 
30 37   ASN n 
30 38   HIS n 
30 39   LYS n 
30 40   ARG n 
30 41   ARG n 
30 42   HIS n 
30 43   TRP n 
30 44   ARG n 
30 45   ARG n 
30 46   ASN n 
30 47   ASP n 
30 48   THR n 
30 49   ASP n 
30 50   GLU n 
31 1    MET n 
31 2    GLN n 
31 3    MET n 
31 4    PRO n 
31 5    ARG n 
31 6    ARG n 
31 7    PHE n 
31 8    ASN n 
31 9    THR n 
31 10   TYR n 
31 11   CYS n 
31 12   PRO n 
31 13   HIS n 
31 14   CYS n 
31 15   ASN n 
31 16   GLU n 
31 17   HIS n 
31 18   GLN n 
31 19   GLU n 
31 20   HIS n 
31 21   GLU n 
31 22   VAL n 
31 23   GLU n 
31 24   LYS n 
31 25   VAL n 
31 26   ARG n 
31 27   SER n 
31 28   GLY n 
31 29   ARG n 
31 30   GLN n 
31 31   THR n 
31 32   GLY n 
31 33   MET n 
31 34   LYS n 
31 35   TRP n 
31 36   ILE n 
31 37   ASP n 
31 38   ARG n 
31 39   GLN n 
31 40   ARG n 
31 41   GLU n 
31 42   ARG n 
31 43   ASN n 
31 44   SER n 
31 45   GLY n 
31 46   ILE n 
31 47   GLY n 
31 48   ASN n 
31 49   ASP n 
31 50   GLY n 
31 51   LYS n 
31 52   PHE n 
31 53   SER n 
31 54   LYS n 
31 55   VAL n 
31 56   PRO n 
31 57   GLY n 
31 58   GLY n 
31 59   ASP n 
31 60   LYS n 
31 61   PRO n 
31 62   THR n 
31 63   LYS n 
31 64   LYS n 
31 65   THR n 
31 66   ASP n 
31 67   LEU n 
31 68   LYS n 
31 69   TYR n 
31 70   ARG n 
31 71   CYS n 
31 72   GLY n 
31 73   GLU n 
31 74   CYS n 
31 75   GLY n 
31 76   LYS n 
31 77   ALA n 
31 78   HIS n 
31 79   LEU n 
31 80   ARG n 
31 81   GLU n 
31 82   GLY n 
31 83   TRP n 
31 84   ARG n 
31 85   ALA n 
31 86   GLY n 
31 87   ARG n 
31 88   LEU n 
31 89   GLU n 
31 90   PHE n 
31 91   GLN n 
31 92   GLU n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
15 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
16 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
17 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
18 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
19 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
20 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
21 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
22 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
23 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
24 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
25 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
26 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
27 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
28 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
29 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
30 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
31 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1  GB  AY596297   55229667 1  
;GUUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCUGUGGGGA
GCCGCACGGAGGCGAAGAACCACAGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGA
ACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAACGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCC
AAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUUCACGAAGUCUCUUGGAAUAG
AGCGUGAUACAGGGUGACAACCCCGUACUGAAGACCAGUACGCUGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCC
CUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGC
UGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUU
GACGAAUGACCGAGACGCGAGUCUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAG
GGAGUGUGUCUGUAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCG
AGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCG
UGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCC
CAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCG
ACCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCUGUUUGACGCGGGGA
UUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGU
GUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAA
CAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUA
CUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGCAGGGGCGAGAGCUCCUGUGGACCGAUUAGUGACGAAAAUC
CUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCU
GAGGGUUAGCCGGUCCUAAGUCUCACCGCAACUCGACUGAGACGAAAUGGGAAACAGGUUAAUAUUCCUGUGCCAUCAUG
CAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCCGGGCAUUCGCCCGGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUG
GCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUGAUGUCCGUACC
GAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAG
UCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAA
CAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUAC
AAGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCG
GCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGG
AGACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUA
GGUAGGAGUCGUUACAGAGGUACCCGCGCUAGCGGGCCACCCAGACAACAGUGAAAUACUACCCGUCGGUGACUGCGACU
CUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCU
AUGGUCAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUGACUUGACAGUGUUCUUCCCAACGAGG
AACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAG
GGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCC
CGUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGU
CGGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCAC
UGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAA
ACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAA
CGAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCA
;
0    ? 
2  GB  AF034619   3377778  2  
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCAGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAAUCCGGUUCGCCGCCACC
;
5581 ? 
3  UNP RL2_HALMA  P20276   3  
;MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDE
LQVGVDAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVV
GGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE

;
0    ? 
4  GB  YP_136234  55378384 4  
;MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPM
RAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKP
DVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPND
QPRLDPEVRYVSNESNQG
;
1    ? 
5  UNP RL4_HALMA  P12735   5  
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
1    ? 
6  UNP RL5_HALMA  P14124   6  
;MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEM
AEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNP
ADAVAFIESTYDVEVSE
;
0    ? 
7  UNP RL6_HALMA  P14135   7  
;MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
WEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDV
RVFQDGVYITRKPNRGDA
;
0    ? 
8  UNP RL7A_HALMA P12743   8  
;MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQ
QDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
;
0    ? 
9  UNP RLA0_HALMA P15825   9  
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
1    ? 
10 GB  AAV47175   55231756 10 
;MSDKPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKEL
GEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKI
TPSCRIKVERGEELLIA
;
1    ? 
11 GB  P14122     132647   11 
;MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAG
FETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEA
QA
;
1    ? 
12 UNP RL13_HALMA P29198   12 
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
1    ? 
13 UNP RL14_HALMA P22450   13 
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
1    ? 
14 UNP RL15_HALMA P12737   14 
;MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAAD
DVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDA
DADEE
;
0    ? 
15 GB  AAV46920   55231501 15 
;MARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKA
GRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRV
FRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKGK
;
1    ? 
16 UNP RL18_HALMA P14123   16 
;MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMP
SAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLY
SGDFDAADLPEHFDELRETLLDGDIEL
;
0    ? 
17 UNP R18E_HALMA P12733   17 
;MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAV
DFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
0    ? 
18 UNP RL19_HALMA P14119   18 
;MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGS
RKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
0    ? 
19 UNP RL21_HALMA P12734   19 
;MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGG
KEKTIIVTAAHLRRQE
;
0    ? 
20 UNP RL22_HALMA P10970   20 
;MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGR
YPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
0    ? 
21 UNP RL23_HALMA P12732   21 
;MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVAS
RIGVF
;
0    ? 
22 UNP RL24_HALMA P10972   22 
;MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTL
EKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
0    ? 
23 UNP R24E_HALMA P14116   23 PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA 1    ? 
24 UNP RL29_HALMA P10971   24 MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE 1    ? 
25 UNP RL30_HALMA P14121   25 
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
1    ? 
26 UNP RL31_HALMA P18138   26 
;MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEE
EGEAIVEAETAE
;
0    ? 
27 UNP RL32_HALMA P12736   27 
;MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAE
VEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKG
KGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVS
E
;
0    ? 
28 GB  AAV46581   55231162 28 
;SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRSIRAALSE
DEE
;
34   ? 
29 UNP RL37_HALMA P32410   29 MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 0    ? 
30 UNP RL39_HALMA P22452   30 MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE 0    ? 
31 UNP RL44_HALMA P32411   31 
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
1    ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  1YHQ 0 1 ? 2922 ? 55229667 0    ? 2921 ? 1  2922 
2  2  1YHQ 9 1 ? 122  ? 3377778  5581 ? 5702 ? 1  122  
3  3  1YHQ A 1 ? 240  ? P20276   0    ? 239  ? 0  239  
4  4  1YHQ B 1 ? 338  ? 55378384 1    ? 338  ? 0  337  
5  5  1YHQ C 1 ? 246  ? P12735   1    ? 246  ? 1  246  
6  6  1YHQ D 1 ? 177  ? P14124   0    ? 176  ? 0  176  
7  7  1YHQ E 1 ? 178  ? P14135   0    ? 177  ? 0  177  
8  8  1YHQ F 1 ? 120  ? P12743   0    ? 119  ? 0  119  
9  9  1YHQ G 1 ? 348  ? P15825   1    ? 348  ? 1  348  
10 10 1YHQ H 1 ? 177  ? 55231756 1    ? 177  ? 1  177  
11 11 1YHQ I 1 ? 162  ? 132647   1    ? 162  ? 0  161  
12 12 1YHQ J 1 ? 145  ? P29198   1    ? 145  ? 1  145  
13 13 1YHQ K 1 ? 132  ? P22450   1    ? 132  ? 1  132  
14 14 1YHQ L 1 ? 165  ? P12737   0    ? 164  ? 0  164  
15 15 1YHQ M 1 ? 194  ? 55231501 2    ? 195  ? 1  194  
16 16 1YHQ N 1 ? 187  ? P14123   0    ? 186  ? 0  186  
17 17 1YHQ O 1 ? 116  ? P12733   0    ? 115  ? 0  115  
18 18 1YHQ P 1 ? 149  ? P14119   0    ? 148  ? 0  148  
19 19 1YHQ Q 1 ? 96   ? P12734   0    ? 95   ? 0  95   
20 20 1YHQ R 1 ? 155  ? P10970   0    ? 154  ? 0  154  
21 21 1YHQ S 1 ? 85   ? P12732   0    ? 84   ? 0  84   
22 22 1YHQ T 1 ? 120  ? P10972   0    ? 119  ? 0  119  
23 23 1YHQ U 1 ? 66   ? P14116   1    ? 66   ? 1  66   
24 24 1YHQ V 1 ? 71   ? P10971   1    ? 71   ? 0  70   
25 25 1YHQ W 1 ? 154  ? P14121   1    ? 154  ? 1  154  
26 26 1YHQ X 1 ? 92   ? P18138   0    ? 91   ? 0  91   
27 27 1YHQ Y 1 ? 241  ? P12736   0    ? 240  ? 0  240  
28 28 1YHQ Z 1 ? 83   ? 55231162 34   ? 116  ? 10 92   
29 29 1YHQ 1 1 ? 57   ? P32410   0    ? 56   ? 0  56   
30 30 1YHQ 2 1 ? 50   ? P22452   0    ? 49   ? 0  49   
31 31 1YHQ 3 1 ? 92   ? P32411   1    ? 92   ? 1  92   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  1YHQ 1MA 0 628  ? GB  55229667 A   627  'modified residue'    628  1 
1  1YHQ A   0 2099 ? GB  55229667 G   2098 'engineered mutation' 2099 2 
1  1YHQ OMU 0 2587 ? GB  55229667 U   2586 'modified residue'    2587 3 
1  1YHQ OMG 0 2588 ? GB  55229667 G   2587 'modified residue'    2588 4 
1  1YHQ UR3 0 2619 ? GB  55229667 U   2618 'modified residue'    2619 5 
1  1YHQ PSU 0 2621 ? GB  55229667 U   2620 'modified residue'    2621 6 
13 1YHQ LEU K 44   ? UNP P22450   HIS 44   conflict              44   7 
15 1YHQ GLU M 13   ? GB  55231501 LYS 14   conflict              13   8 
28 1YHQ ARG Z 1    ? GB  55231162 SER 34   conflict              10   9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1MA 'RNA linking'       n "6-HYDRO-1-METHYLADENOSINE-5'-MONOPHOSPHATE" ? 'C11 H16 N5 O7 P' 361.248 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"                 ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                  ? 'C9 H14 N3 O8 P'  323.197 
CD  non-polymer         . 'CADMIUM ION'                                ? 'Cd 2'            112.411 
CL  non-polymer         . 'CHLORIDE ION'                               ? 'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE                                     ? 'C3 H7 N O2 S'    121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"                 ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                   ? 'C6 H13 N O2'     131.173 
K   non-polymer         . 'POTASSIUM ION'                              ? 'K 1'             39.098  
LEU 'L-peptide linking' y LEUCINE                                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                   ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                              ? 'Mg 2'            24.305  
NA  non-polymer         . 'SODIUM ION'                                 ? 'Na 1'            22.990  
OMG 'RNA linking'       n "O2'-METHYLGUANOSINE-5'-MONOPHOSPHATE"       ? 'C11 H16 N5 O8 P' 377.247 
OMU 'RNA linking'       n 
;O2'-METHYLURIDINE 5'-MONOPHOSPHATE
;
? 'C10 H15 N2 O9 P' 338.208 
PHE 'L-peptide linking' y PHENYLALANINE                                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                      ? 'C5 H9 N O2'      115.130 
PSU 'RNA linking'       n "PSEUDOURIDINE-5'-MONOPHOSPHATE"             ? 'C9 H13 N2 O9 P'  324.181 
SER 'L-peptide linking' y SERINE                                       ? 'C3 H7 N O3'      105.093 
SR  non-polymer         . 'STRONTIUM ION'                              ? 'Sr 2'            87.620  
THR 'L-peptide linking' y THREONINE                                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                   ? 'C9 H13 N2 O9 P'  324.181 
UR3 'RNA linking'       n "3-METHYLURIDINE-5'-MONOPHOSHATE"            ? 'C10 H15 N2 O9 P' 338.208 
VAL 'L-peptide linking' y VALINE                                       ? 'C5 H11 N O2'     117.146 
ZIT non-polymer         . AZITHROMYCIN                                 ? 'C38 H72 N2 O12'  748.984 
# 
_exptl.entry_id          1YHQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.1 
_exptl_crystal.density_percent_sol   60.0 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pdbx_details    
'PEG 6000, KCl, NH4Cl, MgCl2, Kacetate, pH 5.8, VAPOR DIFFUSION, SITTING DROP, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1  1 'PEG 6000' ? ? ? 
1 2  1 KCl        ? ? ? 
1 3  1 NH4Cl      ? ? ? 
1 4  1 MgCl2      ? ? ? 
1 5  1 Kacetate   ? ? ? 
1 6  1 H2O        ? ? ? 
1 7  2 'PEG 6000' ? ? ? 
1 8  2 KCl        ? ? ? 
1 9  2 NH4Cl      ? ? ? 
1 10 2 MgCl2      ? ? ? 
1 11 2 Kacetate   ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2004-10-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.10 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.10 
# 
_reflns.entry_id                     1YHQ 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.40 
_reflns.number_obs                   672764 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            0.062 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.6 
_reflns.B_iso_Wilson_estimate        41.9 
_reflns.pdbx_redundancy              4.8 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.49 
_reflns_shell.percent_possible_all   72.1 
_reflns_shell.Rmerge_I_obs           0.71 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.8 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      50400 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1YHQ 
_refine.ls_number_reflns_obs                     633741 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               359492.31 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.96 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    90.2 
_refine.ls_R_factor_obs                          0.19 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19 
_refine.ls_R_factor_R_free                       0.229 
_refine.ls_R_factor_R_free_error                 0.003 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 1.0 
_refine.ls_number_reflns_R_free                  6149 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               47.3 
_refine.aniso_B[1][1]                            -0.15 
_refine.aniso_B[2][2]                            3.74 
_refine.aniso_B[3][3]                            -3.59 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.336224 
_refine.solvent_model_param_bsol                 35.2122 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1YHQ 
_refine_analyze.Luzzati_coordinate_error_obs    0.29 
_refine_analyze.Luzzati_sigma_a_obs             0.40 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.36 
_refine_analyze.Luzzati_sigma_a_free            0.47 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        29377 
_refine_hist.pdbx_number_atoms_nucleic_acid   61619 
_refine_hist.pdbx_number_atoms_ligand         357 
_refine_hist.number_atoms_solvent             7763 
_refine_hist.number_atoms_total               99116 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        29.96 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.005 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.0   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      15.4  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.35  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.22  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.08  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.64  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.39  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.40 
_refine_ls_shell.d_res_low                        2.55 
_refine_ls_shell.number_reflns_R_work             73885 
_refine_ls_shell.R_factor_R_work                  0.341 
_refine_ls_shell.percent_reflns_obs               64.0 
_refine_ls_shell.R_factor_R_free                  0.383 
_refine_ls_shell.R_factor_R_free_error            0.015 
_refine_ls_shell.percent_reflns_R_free            0.9 
_refine_ls_shell.number_reflns_R_free             687 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM     PROTEIN.TOP             'X-RAY DIFFRACTION' 
2 RNA_RIBO_MODNTS.PARAM RNA_RIBO_MODNTS_DRUGS.T 'X-RAY DIFFRACTION' 
3 ION.PARAM             ION.TOP                 'X-RAY DIFFRACTION' 
4 WATER_REP.PARAM       WATER.TOP               'X-RAY DIFFRACTION' 
5 QUC.PA                QUC.TO                  'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1YHQ 
_struct.title                     
'Crystal Structure Of Azithromycin Bound To The G2099A Mutant 50S Ribosomal Subunit Of Haloarcula Marismortui' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1YHQ 
_struct_keywords.pdbx_keywords   RIBOSOME 
_struct_keywords.text            'azithromycin, antibiotic complexes, mutated 50S subunits, RIBOSOME' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 16 ? 
Q  N N 17 ? 
R  N N 18 ? 
S  N N 19 ? 
T  N N 20 ? 
U  N N 21 ? 
V  N N 22 ? 
W  N N 23 ? 
X  N N 24 ? 
Y  N N 25 ? 
Z  N N 26 ? 
AA N N 27 ? 
BA N N 28 ? 
CA N N 29 ? 
DA N N 30 ? 
EA N N 31 ? 
FA N N 32 ? 
GA N N 33 ? 
HA N N 33 ? 
IA N N 33 ? 
JA N N 33 ? 
KA N N 33 ? 
LA N N 33 ? 
MA N N 33 ? 
NA N N 33 ? 
OA N N 33 ? 
PA N N 33 ? 
QA N N 33 ? 
RA N N 33 ? 
SA N N 33 ? 
TA N N 33 ? 
UA N N 33 ? 
VA N N 33 ? 
WA N N 33 ? 
XA N N 33 ? 
YA N N 33 ? 
ZA N N 33 ? 
AB N N 33 ? 
BB N N 33 ? 
CB N N 33 ? 
DB N N 33 ? 
EB N N 33 ? 
FB N N 33 ? 
GB N N 33 ? 
HB N N 33 ? 
IB N N 33 ? 
JB N N 33 ? 
KB N N 33 ? 
LB N N 33 ? 
MB N N 33 ? 
NB N N 33 ? 
OB N N 33 ? 
PB N N 33 ? 
QB N N 33 ? 
RB N N 33 ? 
SB N N 33 ? 
TB N N 33 ? 
UB N N 33 ? 
VB N N 33 ? 
WB N N 33 ? 
XB N N 33 ? 
YB N N 33 ? 
ZB N N 33 ? 
AC N N 33 ? 
BC N N 33 ? 
CC N N 33 ? 
DC N N 33 ? 
EC N N 33 ? 
FC N N 33 ? 
GC N N 33 ? 
HC N N 33 ? 
IC N N 33 ? 
JC N N 33 ? 
KC N N 33 ? 
LC N N 33 ? 
MC N N 33 ? 
NC N N 33 ? 
OC N N 33 ? 
PC N N 33 ? 
QC N N 33 ? 
RC N N 33 ? 
SC N N 33 ? 
TC N N 33 ? 
UC N N 33 ? 
VC N N 33 ? 
WC N N 33 ? 
XC N N 33 ? 
YC N N 33 ? 
ZC N N 33 ? 
AD N N 33 ? 
BD N N 33 ? 
CD N N 33 ? 
DD N N 33 ? 
ED N N 33 ? 
FD N N 33 ? 
GD N N 33 ? 
HD N N 33 ? 
ID N N 33 ? 
JD N N 33 ? 
KD N N 33 ? 
LD N N 33 ? 
MD N N 33 ? 
ND N N 33 ? 
OD N N 34 ? 
PD N N 34 ? 
QD N N 35 ? 
RD N N 35 ? 
SD N N 35 ? 
TD N N 35 ? 
UD N N 35 ? 
VD N N 35 ? 
WD N N 35 ? 
XD N N 35 ? 
YD N N 35 ? 
ZD N N 35 ? 
AE N N 35 ? 
BE N N 35 ? 
CE N N 35 ? 
DE N N 35 ? 
EE N N 35 ? 
FE N N 35 ? 
GE N N 35 ? 
HE N N 35 ? 
IE N N 35 ? 
JE N N 35 ? 
KE N N 35 ? 
LE N N 35 ? 
ME N N 35 ? 
NE N N 35 ? 
OE N N 35 ? 
PE N N 35 ? 
QE N N 35 ? 
RE N N 35 ? 
SE N N 35 ? 
TE N N 35 ? 
UE N N 35 ? 
VE N N 35 ? 
WE N N 35 ? 
XE N N 35 ? 
YE N N 35 ? 
ZE N N 35 ? 
AF N N 35 ? 
BF N N 35 ? 
CF N N 35 ? 
DF N N 35 ? 
EF N N 35 ? 
FF N N 35 ? 
GF N N 35 ? 
HF N N 35 ? 
IF N N 35 ? 
JF N N 35 ? 
KF N N 35 ? 
LF N N 35 ? 
MF N N 35 ? 
NF N N 35 ? 
OF N N 35 ? 
PF N N 35 ? 
QF N N 35 ? 
RF N N 35 ? 
SF N N 35 ? 
TF N N 35 ? 
UF N N 35 ? 
VF N N 35 ? 
WF N N 35 ? 
XF N N 35 ? 
YF N N 35 ? 
ZF N N 35 ? 
AG N N 35 ? 
BG N N 35 ? 
CG N N 35 ? 
DG N N 36 ? 
EG N N 36 ? 
FG N N 36 ? 
GG N N 36 ? 
HG N N 36 ? 
IG N N 36 ? 
JG N N 36 ? 
KG N N 36 ? 
LG N N 36 ? 
MG N N 36 ? 
NG N N 37 ? 
OG N N 37 ? 
PG N N 37 ? 
QG N N 37 ? 
RG N N 37 ? 
SG N N 37 ? 
TG N N 37 ? 
UG N N 37 ? 
VG N N 37 ? 
WG N N 37 ? 
XG N N 37 ? 
YG N N 37 ? 
ZG N N 37 ? 
AH N N 37 ? 
BH N N 37 ? 
CH N N 37 ? 
DH N N 37 ? 
EH N N 37 ? 
FH N N 37 ? 
GH N N 37 ? 
HH N N 37 ? 
IH N N 37 ? 
JH N N 37 ? 
KH N N 37 ? 
LH N N 37 ? 
MH N N 37 ? 
NH N N 37 ? 
OH N N 37 ? 
PH N N 37 ? 
QH N N 37 ? 
RH N N 37 ? 
SH N N 37 ? 
TH N N 37 ? 
UH N N 37 ? 
VH N N 37 ? 
WH N N 37 ? 
XH N N 37 ? 
YH N N 37 ? 
ZH N N 37 ? 
AI N N 37 ? 
BI N N 37 ? 
CI N N 37 ? 
DI N N 37 ? 
EI N N 37 ? 
FI N N 37 ? 
GI N N 37 ? 
HI N N 37 ? 
II N N 37 ? 
JI N N 37 ? 
KI N N 37 ? 
LI N N 37 ? 
MI N N 37 ? 
NI N N 37 ? 
OI N N 37 ? 
PI N N 37 ? 
QI N N 37 ? 
RI N N 37 ? 
SI N N 37 ? 
TI N N 37 ? 
UI N N 37 ? 
VI N N 37 ? 
WI N N 37 ? 
XI N N 37 ? 
YI N N 37 ? 
ZI N N 37 ? 
AJ N N 37 ? 
BJ N N 37 ? 
CJ N N 37 ? 
DJ N N 37 ? 
EJ N N 37 ? 
FJ N N 37 ? 
GJ N N 37 ? 
HJ N N 37 ? 
IJ N N 37 ? 
JJ N N 37 ? 
KJ N N 37 ? 
LJ N N 37 ? 
MJ N N 37 ? 
NJ N N 37 ? 
OJ N N 37 ? 
PJ N N 37 ? 
QJ N N 37 ? 
RJ N N 37 ? 
SJ N N 37 ? 
TJ N N 37 ? 
UJ N N 37 ? 
VJ N N 37 ? 
WJ N N 37 ? 
XJ N N 37 ? 
YJ N N 37 ? 
ZJ N N 37 ? 
AK N N 37 ? 
BK N N 37 ? 
CK N N 37 ? 
DK N N 33 ? 
EK N N 35 ? 
FK N N 35 ? 
GK N N 37 ? 
HK N N 37 ? 
IK N N 33 ? 
JK N N 33 ? 
KK N N 36 ? 
LK N N 37 ? 
MK N N 37 ? 
NK N N 37 ? 
OK N N 33 ? 
PK N N 36 ? 
QK N N 37 ? 
RK N N 37 ? 
SK N N 35 ? 
TK N N 37 ? 
UK N N 35 ? 
VK N N 37 ? 
WK N N 35 ? 
XK N N 36 ? 
YK N N 36 ? 
ZK N N 36 ? 
AL N N 33 ? 
BL N N 36 ? 
CL N N 35 ? 
DL N N 36 ? 
EL N N 36 ? 
FL N N 38 ? 
GL N N 36 ? 
HL N N 35 ? 
IL N N 35 ? 
JL N N 35 ? 
KL N N 36 ? 
LL N N 37 ? 
ML N N 35 ? 
NL N N 37 ? 
OL N N 33 ? 
PL N N 38 ? 
QL N N 33 ? 
RL N N 36 ? 
SL N N 38 ? 
TL N N 38 ? 
UL N N 37 ? 
VL N N 37 ? 
WL N N 38 ? 
XL N N 36 ? 
YL N N 37 ? 
ZL N N 39 ? 
AM N N 39 ? 
BM N N 39 ? 
CM N N 39 ? 
DM N N 39 ? 
EM N N 39 ? 
FM N N 39 ? 
GM N N 39 ? 
HM N N 39 ? 
IM N N 39 ? 
JM N N 39 ? 
KM N N 39 ? 
LM N N 39 ? 
MM N N 39 ? 
NM N N 39 ? 
OM N N 39 ? 
PM N N 39 ? 
QM N N 39 ? 
RM N N 39 ? 
SM N N 39 ? 
TM N N 39 ? 
UM N N 39 ? 
VM N N 39 ? 
WM N N 39 ? 
XM N N 39 ? 
YM N N 39 ? 
ZM N N 39 ? 
AN N N 39 ? 
BN N N 39 ? 
CN N N 39 ? 
DN N N 39 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ILE C  5   ? ARG C  12  ? ILE A 4   ARG A 11  1 ? 8  
HELX_P HELX_P2   2   GLY C  13  ? ARG C  18  ? GLY A 12  ARG A 17  5 ? 6  
HELX_P HELX_P3   3   PRO C  20  ? TYR C  24  ? PRO A 19  TYR A 23  5 ? 5  
HELX_P HELX_P4   4   ALA C  98  ? ILE C  100 ? ALA A 97  ILE A 99  5 ? 3  
HELX_P HELX_P5   5   GLY C  164 ? LYS C  168 ? GLY A 163 LYS A 167 5 ? 5  
HELX_P HELX_P6   6   LYS C  172 ? LYS C  181 ? LYS A 171 LYS A 180 1 ? 10 
HELX_P HELX_P7   7   ARG C  191 ? MET C  195 ? ARG A 190 MET A 194 5 ? 5  
HELX_P HELX_P8   8   ASN C  196 ? HIS C  200 ? ASN A 195 HIS A 199 5 ? 5  
HELX_P HELX_P9   9   GLU D  109 ? THR D  113 ? GLU B 108 THR B 112 5 ? 5  
HELX_P HELX_P10  10  ASP D  121 ? GLY D  136 ? ASP B 120 GLY B 135 1 ? 16 
HELX_P HELX_P11  11  VAL D  148 ? VAL D  152 ? VAL B 147 VAL B 151 5 ? 5  
HELX_P HELX_P12  12  SER D  171 ? GLY D  186 ? SER B 170 GLY B 185 1 ? 16 
HELX_P HELX_P13  13  ALA D  190 ? PHE D  195 ? ALA B 189 PHE B 194 1 ? 6  
HELX_P HELX_P14  14  GLY D  214 ? GLY D  220 ? GLY B 213 GLY B 219 1 ? 7  
HELX_P HELX_P15  15  LYS D  225 ? GLN D  231 ? LYS B 224 GLN B 230 5 ? 7  
HELX_P HELX_P16  16  PRO E  19  ? THR E  24  ? PRO C 19  THR C 24  5 ? 6  
HELX_P HELX_P17  17  ARG E  27  ? ARG E  42  ? ARG C 27  ARG C 42  1 ? 16 
HELX_P HELX_P18  18  ASN E  103 ? THR E  118 ? ASN C 103 THR C 118 1 ? 16 
HELX_P HELX_P19  19  ASP E  120 ? GLY E  128 ? ASP C 120 GLY C 128 1 ? 9  
HELX_P HELX_P20  20  ASP E  142 ? LEU E  147 ? ASP C 142 LEU C 147 5 ? 6  
HELX_P HELX_P21  21  LYS E  149 ? LEU E  160 ? LYS C 149 LEU C 160 1 ? 12 
HELX_P HELX_P22  22  HIS E  163 ? ALA E  169 ? HIS C 163 ALA C 169 1 ? 7  
HELX_P HELX_P23  23  GLY E  177 ? GLY E  183 ? GLY C 177 GLY C 183 5 ? 7  
HELX_P HELX_P24  24  SER E  201 ? ASN E  206 ? SER C 201 ASN C 206 1 ? 6  
HELX_P HELX_P25  25  ASN E  219 ? ALA E  224 ? ASN C 219 ALA C 224 1 ? 6  
HELX_P HELX_P26  26  PRO E  225 ? ALA E  228 ? PRO C 225 ALA C 228 5 ? 4  
HELX_P HELX_P27  27  GLU E  237 ? ALA E  244 ? GLU C 237 ALA C 244 1 ? 8  
HELX_P HELX_P28  28  ALA F  38  ? GLY F  47  ? ALA D 37  GLY D 46  1 ? 10 
HELX_P HELX_P29  29  ASP F  78  ? LEU F  89  ? ASP D 77  LEU D 88  1 ? 12 
HELX_P HELX_P30  30  PRO F  90  ? ALA F  92  ? PRO D 89  ALA D 91  5 ? 3  
HELX_P HELX_P31  31  GLY F  139 ? LYS F  144 ? GLY D 138 LYS D 143 5 ? 6  
HELX_P HELX_P32  32  PRO F  153 ? ARG F  157 ? PRO D 152 ARG D 156 5 ? 5  
HELX_P HELX_P33  33  ASN F  159 ? SER F  169 ? ASN D 158 SER D 168 1 ? 11 
HELX_P HELX_P34  34  ASN G  56  ? THR G  78  ? ASN E 55  THR E 77  1 ? 23 
HELX_P HELX_P35  35  ASN G  107 ? GLU G  111 ? ASN E 106 GLU E 110 5 ? 5  
HELX_P HELX_P36  36  ASP G  138 ? LEU G  152 ? ASP E 137 LEU E 151 1 ? 15 
HELX_P HELX_P37  37  PRO H  10  ? THR H  27  ? PRO F 9   THR F 26  1 ? 18 
HELX_P HELX_P38  38  GLY H  33  ? GLY H  44  ? GLY F 32  GLY F 43  1 ? 12 
HELX_P HELX_P39  39  GLU H  58  ? HIS H  63  ? GLU F 57  HIS F 62  1 ? 6  
HELX_P HELX_P40  40  HIS H  63  ? GLU H  70  ? HIS F 62  GLU F 69  1 ? 8  
HELX_P HELX_P41  41  GLN H  80  ? ALA H  88  ? GLN F 79  ALA F 87  1 ? 9  
HELX_P HELX_P42  42  ALA H  105 ? ARG H  120 ? ALA F 104 ARG F 119 1 ? 16 
HELX_P HELX_P43  43  PRO I  13  ? SER I  29  ? PRO G 13  SER G 29  1 ? 17 
HELX_P HELX_P44  44  ARG I  63  ? ASP I  72  ? ARG G 63  ASP G 72  1 ? 10 
HELX_P HELX_P45  45  PRO J  5   ? TYR J  9   ? PRO H 5   TYR H 9   5 ? 5  
HELX_P HELX_P46  46  HIS J  62  ? GLY J  81  ? HIS H 62  GLY H 81  1 ? 20 
HELX_P HELX_P47  47  ASN J  142 ? GLU J  144 ? ASN H 142 GLU H 144 5 ? 3  
HELX_P HELX_P48  48  ASP J  145 ? TYR J  157 ? ASP H 145 TYR H 157 1 ? 13 
HELX_P HELX_P49  49  PRO K  70  ? ALA K  79  ? PRO I 69  ALA I 78  1 ? 10 
HELX_P HELX_P50  50  SER K  97  ? LYS K  108 ? SER I 96  LYS I 107 1 ? 12 
HELX_P HELX_P51  51  ASP K  116 ? VAL K  125 ? ASP I 115 VAL I 124 1 ? 10 
HELX_P HELX_P52  52  ILE L  18  ? ASP L  32  ? ILE J 18  ASP J 32  1 ? 15 
HELX_P HELX_P53  53  ASN L  40  ? ARG L  43  ? ASN J 40  ARG J 43  5 ? 4  
HELX_P HELX_P54  54  ARG L  49  ? ILE L  63  ? ARG J 49  ILE J 63  1 ? 15 
HELX_P HELX_P55  55  ARG L  74  ? GLY L  85  ? ARG J 74  GLY J 85  1 ? 12 
HELX_P HELX_P56  56  LYS L  91  ? SER L  100 ? LYS J 91  SER J 100 1 ? 10 
HELX_P HELX_P57  57  LEU L  132 ? GLY L  140 ? LEU J 132 GLY J 140 1 ? 9  
HELX_P HELX_P58  58  ARG M  115 ? PHE M  121 ? ARG K 115 PHE K 121 1 ? 7  
HELX_P HELX_P59  59  PHE M  121 ? SER M  126 ? PHE K 121 SER K 126 1 ? 6  
HELX_P HELX_P60  60  LYS N  4   ? GLN N  8   ? LYS L 3   GLN L 7   5 ? 5  
HELX_P HELX_P61  61  GLY N  24  ? GLY N  29  ? GLY L 23  GLY L 28  5 ? 6  
HELX_P HELX_P62  62  PRO N  55  ? GLN N  59  ? PRO L 54  GLN L 58  5 ? 5  
HELX_P HELX_P63  63  VAL N  67  ? ASN N  73  ? VAL L 66  ASN L 72  1 ? 7  
HELX_P HELX_P64  64  ARG N  95  ? VAL N  97  ? ARG L 94  VAL L 96  5 ? 3  
HELX_P HELX_P65  65  SER N  127 ? ALA N  137 ? SER L 126 ALA L 136 1 ? 11 
HELX_P HELX_P66  66  ALA O  4   ? TRP O  12  ? ALA M 4   TRP M 12  1 ? 9  
HELX_P HELX_P67  67  ASP O  17  ? ARG O  32  ? ASP M 17  ARG M 32  1 ? 16 
HELX_P HELX_P68  68  ARG O  45  ? GLY O  53  ? ARG M 45  GLY M 53  1 ? 9  
HELX_P HELX_P69  69  ARG O  82  ? GLN O  86  ? ARG M 82  GLN M 86  5 ? 5  
HELX_P HELX_P70  70  ASP O  96  ? PHE O  109 ? ASP M 96  PHE M 109 1 ? 14 
HELX_P HELX_P71  71  HIS O  138 ? ASN O  143 ? HIS M 138 ASN M 143 1 ? 6  
HELX_P HELX_P72  72  LEU O  147 ? ALA O  156 ? LEU M 147 ALA M 156 5 ? 10 
HELX_P HELX_P73  73  ASP O  157 ? GLY O  162 ? ASP M 157 GLY M 162 5 ? 6  
HELX_P HELX_P74  74  THR O  164 ? ARG O  171 ? THR M 164 ARG M 171 1 ? 8  
HELX_P HELX_P75  75  MET P  11  ? GLU P  16  ? MET N 10  GLU N 15  1 ? 6  
HELX_P HELX_P76  76  ASP P  20  ? LYS P  29  ? ASP N 19  LYS N 28  1 ? 10 
HELX_P HELX_P77  77  SER P  65  ? GLY P  71  ? SER N 64  GLY N 70  5 ? 7  
HELX_P HELX_P78  78  ASN P  78  ? ALA P  96  ? ASN N 77  ALA N 95  1 ? 19 
HELX_P HELX_P79  79  SER P  114 ? ALA P  126 ? SER N 113 ALA N 125 1 ? 13 
HELX_P HELX_P80  80  ASN P  133 ? LEU P  137 ? ASN N 132 LEU N 136 5 ? 5  
HELX_P HELX_P81  81  ASP P  139 ? GLY P  145 ? ASP N 138 GLY N 144 1 ? 7  
HELX_P HELX_P82  82  GLY P  145 ? GLN P  154 ? GLY N 144 GLN N 153 1 ? 10 
HELX_P HELX_P83  83  LEU P  169 ? ASP P  182 ? LEU N 168 ASP N 181 1 ? 14 
HELX_P HELX_P84  84  ASN Q  5   ? SER Q  22  ? ASN O 4   SER O 21  1 ? 18 
HELX_P HELX_P85  85  ALA Q  25  ? LYS Q  36  ? ALA O 24  LYS O 35  1 ? 12 
HELX_P HELX_P86  86  PRO Q  37  ? HIS Q  41  ? PRO O 36  HIS O 40  5 ? 5  
HELX_P HELX_P87  87  LEU Q  46  ? ALA Q  53  ? LEU O 45  ALA O 52  1 ? 8  
HELX_P HELX_P88  88  SER Q  83  ? GLY Q  94  ? SER O 82  GLY O 93  1 ? 12 
HELX_P HELX_P89  89  LEU Q  99  ? ASN Q  106 ? LEU O 98  ASN O 105 1 ? 8  
HELX_P HELX_P90  90  LEU R  4   ? LEU R  15  ? LEU P 3   LEU P 14  1 ? 12 
HELX_P HELX_P91  91  GLY R  18  ? ASN R  20  ? GLY P 17  ASN P 19  5 ? 3  
HELX_P HELX_P92  92  ARG R  28  ? ALA R  35  ? ARG P 27  ALA P 34  1 ? 8  
HELX_P HELX_P93  93  THR R  37  ? GLU R  47  ? THR P 36  GLU P 46  1 ? 11 
HELX_P HELX_P94  94  ARG R  60  ? TYR R  72  ? ARG P 59  TYR P 71  1 ? 13 
HELX_P HELX_P95  95  GLY R  77  ? ARG R  81  ? GLY P 76  ARG P 80  5 ? 5  
HELX_P HELX_P96  96  LYS R  84  ? GLN R  89  ? LYS P 83  GLN P 88  1 ? 6  
HELX_P HELX_P97  97  ASN R  90  ? GLU R  112 ? ASN P 89  GLU P 111 1 ? 23 
HELX_P HELX_P98  98  SER R  116 ? GLY R  129 ? SER P 115 GLY P 128 1 ? 14 
HELX_P HELX_P99  99  SER R  134 ? ASP R  143 ? SER P 133 ASP P 142 1 ? 10 
HELX_P HELX_P100 100 LYS S  18  ? ARG S  22  ? LYS Q 17  ARG Q 21  5 ? 5  
HELX_P HELX_P101 101 PRO S  27  ? VAL S  31  ? PRO Q 26  VAL Q 30  5 ? 5  
HELX_P HELX_P102 102 HIS S  54  ? ASP S  58  ? HIS Q 53  ASP Q 57  5 ? 5  
HELX_P HELX_P103 103 THR S  88  ? ALA S  90  ? THR Q 87  ALA Q 89  5 ? 3  
HELX_P HELX_P104 104 ASP T  10  ? ASP T  12  ? ASP R 9   ASP R 11  5 ? 3  
HELX_P HELX_P105 105 SER T  25  ? LYS T  37  ? SER R 24  LYS R 36  1 ? 13 
HELX_P HELX_P106 106 THR T  40  ? GLU T  53  ? THR R 39  GLU R 52  1 ? 14 
HELX_P HELX_P107 107 PRO T  82  ? GLN T  103 ? PRO R 81  GLN R 102 1 ? 22 
HELX_P HELX_P108 108 ASP T  106 ? MET T  110 ? ASP R 105 MET R 109 5 ? 5  
HELX_P HELX_P109 109 THR U  12  ? ASN U  23  ? THR S 11  ASN S 22  1 ? 12 
HELX_P HELX_P110 110 SER U  34  ? ASP U  47  ? SER S 33  ASP S 46  1 ? 14 
HELX_P HELX_P111 111 ASP U  74  ? ARG U  81  ? ASP S 73  ARG S 80  1 ? 8  
HELX_P HELX_P112 112 GLN V  4   ? ARG V  14  ? GLN T 3   ARG T 13  1 ? 11 
HELX_P HELX_P113 113 PRO V  16  ? GLN V  23  ? PRO T 15  GLN T 22  5 ? 8  
HELX_P HELX_P114 114 SER V  29  ? GLY V  37  ? SER T 28  GLY T 36  1 ? 9  
HELX_P HELX_P115 115 ASP V  93  ? SER V  95  ? ASP T 92  SER T 94  5 ? 3  
HELX_P HELX_P116 116 ASP V  106 ? SER V  115 ? ASP T 105 SER T 114 1 ? 10 
HELX_P HELX_P117 117 SER W  33  ? LEU W  42  ? SER U 33  LEU U 42  1 ? 10 
HELX_P HELX_P118 118 GLU W  45  ? LEU W  49  ? GLU U 45  LEU U 49  5 ? 5  
HELX_P HELX_P119 119 HIS X  5   ? MET X  12  ? HIS V 4   MET V 11  1 ? 8  
HELX_P HELX_P120 120 THR X  13  ? ALA X  37  ? THR V 12  ALA V 36  1 ? 25 
HELX_P HELX_P121 121 PRO X  44  ? GLU X  64  ? PRO V 43  GLU V 63  1 ? 21 
HELX_P HELX_P122 122 HIS Y  14  ? LEU Y  24  ? HIS W 14  LEU W 24  1 ? 11 
HELX_P HELX_P123 123 THR Y  38  ? ASN Y  49  ? THR W 38  ASN W 49  1 ? 12 
HELX_P HELX_P124 124 SER Y  58  ? ALA Y  70  ? SER W 58  ALA W 70  1 ? 13 
HELX_P HELX_P125 125 ASP Y  80  ? THR Y  88  ? ASP W 80  THR W 88  1 ? 9  
HELX_P HELX_P126 126 ASP Y  92  ? SER Y  102 ? ASP W 92  SER W 102 1 ? 11 
HELX_P HELX_P127 127 PRO Y  131 ? GLY Y  135 ? PRO W 131 GLY W 135 5 ? 5  
HELX_P HELX_P128 128 ASP Y  142 ? MET Y  153 ? ASP W 142 MET W 153 1 ? 12 
HELX_P HELX_P129 129 ARG Z  16  ? GLU Z  21  ? ARG X 15  GLU X 20  5 ? 6  
HELX_P HELX_P130 130 PRO Z  22  ? HIS Z  24  ? PRO X 21  HIS X 23  5 ? 3  
HELX_P HELX_P131 131 LYS Z  25  ? PHE Z  42  ? LYS X 24  PHE X 41  1 ? 18 
HELX_P HELX_P132 132 ASP Z  45  ? ASP Z  47  ? ASP X 44  ASP X 46  5 ? 3  
HELX_P HELX_P133 133 ASP Z  52  ? ALA Z  61  ? ASP X 51  ALA X 60  1 ? 10 
HELX_P HELX_P134 134 SER AA 111 ? GLY AA 125 ? SER Y 110 GLY Y 124 1 ? 15 
HELX_P HELX_P135 135 GLU AA 166 ? ARG AA 170 ? GLU Y 165 ARG Y 169 5 ? 5  
HELX_P HELX_P136 136 ASN AA 190 ? GLU AA 195 ? ASN Y 189 GLU Y 194 5 ? 6  
HELX_P HELX_P137 137 GLY AA 211 ? ALA AA 225 ? GLY Y 210 ALA Y 224 1 ? 15 
HELX_P HELX_P138 138 ARG BA 1   ? GLY BA 6   ? ARG Z 10  GLY Z 15  5 ? 6  
HELX_P HELX_P139 139 GLY BA 10  ? GLU BA 26  ? GLY Z 19  GLU Z 35  1 ? 17 
HELX_P HELX_P140 140 GLY BA 66  ? SER BA 73  ? GLY Z 75  SER Z 82  1 ? 8  
HELX_P HELX_P141 141 GLY CA 5   ? GLY CA 10  ? GLY 1 4   GLY 1 9   1 ? 6  
HELX_P HELX_P142 142 TYR CA 49  ? SER CA 53  ? TYR 1 48  SER 1 52  5 ? 5  
HELX_P HELX_P143 143 SER DA 5   ? ASN DA 19  ? SER 2 4   ASN 2 18  1 ? 15 
HELX_P HELX_P144 144 PRO DA 23  ? THR DA 30  ? PRO 2 22  THR 2 29  1 ? 8  
HELX_P HELX_P145 145 LYS EA 34  ? SER EA 44  ? LYS 3 34  SER 3 44  1 ? 11 
HELX_P HELX_P146 146 ASP EA 49  ? LYS EA 54  ? ASP 3 49  LYS 3 54  5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1    covale both ? A  G   627  "O3'" ? ? ? 1_555 A  1MA 628  P     ? ? 0 G   627  0 1MA 628  1_555 ? ? ? ? ? ? ? 1.609 ? ? 
covale2    covale both ? A  1MA 628  "O3'" ? ? ? 1_555 A  A   629  P     ? ? 0 1MA 628  0 A   629  1_555 ? ? ? ? ? ? ? 1.605 ? ? 
covale3    covale both ? A  U   2586 "O3'" ? ? ? 1_555 A  OMU 2587 P     ? ? 0 U   2586 0 OMU 2587 1_555 ? ? ? ? ? ? ? 1.607 ? ? 
covale4    covale both ? A  OMU 2587 "O3'" ? ? ? 1_555 A  OMG 2588 P     ? ? 0 OMU 2587 0 OMG 2588 1_555 ? ? ? ? ? ? ? 1.608 ? ? 
covale5    covale both ? A  OMG 2588 "O3'" ? ? ? 1_555 A  U   2589 P     ? ? 0 OMG 2588 0 U   2589 1_555 ? ? ? ? ? ? ? 1.613 ? ? 
covale6    covale both ? A  G   2618 "O3'" ? ? ? 1_555 A  UR3 2619 P     ? ? 0 G   2618 0 UR3 2619 1_555 ? ? ? ? ? ? ? 1.604 ? ? 
covale7    covale both ? A  UR3 2619 "O3'" ? ? ? 1_555 A  U   2620 P     ? ? 0 UR3 2619 0 U   2620 1_555 ? ? ? ? ? ? ? 1.602 ? ? 
covale8    covale both ? A  U   2620 "O3'" ? ? ? 1_555 A  PSU 2621 P     ? ? 0 U   2620 0 PSU 2621 1_555 ? ? ? ? ? ? ? 1.602 ? ? 
covale9    covale both ? A  PSU 2621 "O3'" ? ? ? 1_555 A  A   2622 P     ? ? 0 PSU 2621 0 A   2622 1_555 ? ? ? ? ? ? ? 1.611 ? ? 
metalc1    metalc ?    ? A  G   28   OP1   ? ? ? 1_555 NA MG  .    MG    ? ? 0 G   28   0 MG  8008 1_555 ? ? ? ? ? ? ? 2.117 ? ? 
metalc2    metalc ?    ? A  C   40   "O2'" ? ? ? 1_555 UD NA  .    NA    ? ? 0 C   40   0 NA  8506 1_555 ? ? ? ? ? ? ? 2.744 ? ? 
metalc3    metalc ?    ? A  C   40   O2    ? ? ? 1_555 UD NA  .    NA    ? ? 0 C   40   0 NA  8506 1_555 ? ? ? ? ? ? ? 2.676 ? ? 
metalc4    metalc ?    ? A  G   56   O6    ? ? ? 1_555 KE NA  .    NA    ? ? 0 G   56   0 NA  8524 1_555 ? ? ? ? ? ? ? 2.728 ? ? 
metalc5    metalc ?    ? A  A   59   N3    ? ? ? 1_555 KE NA  .    NA    ? ? 0 A   59   0 NA  8524 1_555 ? ? ? ? ? ? ? 2.795 ? ? 
metalc6    metalc ?    ? A  G   61   N7    ? ? ? 1_555 KE NA  .    NA    ? ? 0 G   61   0 NA  8524 1_555 ? ? ? ? ? ? ? 2.893 ? ? 
metalc7    metalc ?    ? A  G   84   "O3'" ? ? ? 1_555 UH SR  .    SR    ? ? 0 G   84   0 SR  8939 1_555 ? ? ? ? ? ? ? 3.355 ? ? 
metalc8    metalc ?    ? A  C   85   OP1   ? ? ? 1_555 XG SR  .    SR    ? ? 0 C   85   0 SR  8911 1_555 ? ? ? ? ? ? ? 2.714 ? ? 
metalc9    metalc ?    ? A  C   85   OP1   ? ? ? 1_555 UH SR  .    SR    ? ? 0 C   85   0 SR  8939 1_555 ? ? ? ? ? ? ? 2.753 ? ? 
metalc10   metalc ?    ? A  A   86   OP2   ? ? ? 1_555 XG SR  .    SR    ? ? 0 A   86   0 SR  8911 1_555 ? ? ? ? ? ? ? 2.548 ? ? 
metalc11   metalc ?    ? A  C   87   OP1   ? ? ? 1_555 XG SR  .    SR    ? ? 0 C   87   0 SR  8911 1_555 ? ? ? ? ? ? ? 2.908 ? ? 
metalc12   metalc ?    ? A  U   108  O2    ? ? ? 1_555 LE NA  .    NA    ? ? 0 U   108  0 NA  8525 1_555 ? ? ? ? ? ? ? 2.723 ? ? 
metalc13   metalc ?    ? A  U   115  OP2   ? ? ? 1_555 IB MG  .    MG    ? ? 0 U   115  0 MG  8029 1_555 ? ? ? ? ? ? ? 1.945 ? ? 
metalc14   metalc ?    ? A  C   141  "O4'" ? ? ? 1_555 ME NA  .    NA    ? ? 0 C   141  0 NA  8526 1_555 ? ? ? ? ? ? ? 2.800 ? ? 
metalc15   metalc ?    ? A  C   141  O2    ? ? ? 1_555 ME NA  .    NA    ? ? 0 C   141  0 NA  8526 1_555 ? ? ? ? ? ? ? 2.767 ? ? 
metalc16   metalc ?    ? A  U   146  O4    ? ? ? 1_555 GE NA  .    NA    ? ? 0 U   146  0 NA  8520 1_555 ? ? ? ? ? ? ? 2.633 ? ? 
metalc17   metalc ?    ? A  G   147  OP1   ? ? ? 1_555 UG SR  .    SR    ? ? 0 G   147  0 SR  8908 1_555 ? ? ? ? ? ? ? 2.713 ? ? 
metalc18   metalc ?    ? A  C   162  OP1   ? ? ? 1_555 UB MG  .    MG    ? ? 0 C   162  0 MG  8041 1_555 ? ? ? ? ? ? ? 1.948 ? ? 
metalc19   metalc ?    ? A  C   162  OP2   ? ? ? 1_555 PD K   .    K     ? ? 0 C   162  0 K   8402 1_555 ? ? ? ? ? ? ? 3.204 ? ? 
metalc20   metalc ?    ? A  U   163  O4    ? ? ? 1_555 PD K   .    K     ? ? 0 U   163  0 K   8402 1_555 ? ? ? ? ? ? ? 2.984 ? ? 
metalc21   metalc ?    ? A  A   165  N7    ? ? ? 1_555 JC MG  .    MG    ? ? 0 A   165  0 MG  8061 1_555 ? ? ? ? ? ? ? 2.284 ? ? 
metalc22   metalc ?    ? A  A   165  OP2   ? ? ? 1_555 AE NA  .    NA    ? ? 0 A   165  0 NA  8513 1_555 ? ? ? ? ? ? ? 2.762 ? ? 
metalc23   metalc ?    ? A  A   166  OP1   ? ? ? 1_555 EC MG  .    MG    ? ? 0 A   166  0 MG  8055 1_555 ? ? ? ? ? ? ? 2.254 ? ? 
metalc24   metalc ?    ? A  A   166  "O3'" ? ? ? 1_555 AE NA  .    NA    ? ? 0 A   166  0 NA  8513 1_555 ? ? ? ? ? ? ? 2.560 ? ? 
metalc25   metalc ?    ? A  A   166  "O2'" ? ? ? 1_555 AE NA  .    NA    ? ? 0 A   166  0 NA  8513 1_555 ? ? ? ? ? ? ? 2.803 ? ? 
metalc26   metalc ?    ? A  A   167  OP1   ? ? ? 1_555 JC MG  .    MG    ? ? 0 A   167  0 MG  8061 1_555 ? ? ? ? ? ? ? 1.930 ? ? 
metalc27   metalc ?    ? A  A   167  OP1   ? ? ? 1_555 AE NA  .    NA    ? ? 0 A   167  0 NA  8513 1_555 ? ? ? ? ? ? ? 2.842 ? ? 
metalc28   metalc ?    ? A  C   168  OP2   ? ? ? 1_555 JC MG  .    MG    ? ? 0 C   168  0 MG  8061 1_555 ? ? ? ? ? ? ? 1.928 ? ? 
metalc29   metalc ?    ? A  U   170  O2    ? ? ? 1_555 NE NA  .    NA    ? ? 0 U   170  0 NA  8527 1_555 ? ? ? ? ? ? ? 2.813 ? ? 
metalc30   metalc ?    ? A  U   172  O4    ? ? ? 1_555 PD K   .    K     ? ? 0 U   172  0 K   8402 1_555 ? ? ? ? ? ? ? 2.921 ? ? 
metalc31   metalc ?    ? A  G   175  OP2   ? ? ? 1_555 ZB MG  .    MG    ? ? 0 G   175  0 MG  8047 1_555 ? ? ? ? ? ? ? 2.556 ? ? 
metalc32   metalc ?    ? A  G   182  "O3'" ? ? ? 1_555 UG SR  .    SR    ? ? 0 G   182  0 SR  8908 1_555 ? ? ? ? ? ? ? 3.396 ? ? 
metalc33   metalc ?    ? A  A   183  OP1   ? ? ? 1_555 UG SR  .    SR    ? ? 0 A   183  0 SR  8908 1_555 ? ? ? ? ? ? ? 2.550 ? ? 
metalc34   metalc ?    ? A  A   187  N1    ? ? ? 1_555 ID MG  .    MG    ? ? 0 A   187  0 MG  8088 1_555 ? ? ? ? ? ? ? 2.621 ? ? 
metalc35   metalc ?    ? A  G   196  OP1   ? ? ? 1_555 KB MG  .    MG    ? ? 0 G   196  0 MG  8031 1_555 ? ? ? ? ? ? ? 2.486 ? ? 
metalc36   metalc ?    ? A  G   196  N7    ? ? ? 1_555 UF NA  .    NA    ? ? 0 G   196  0 NA  8565 1_555 ? ? ? ? ? ? ? 2.859 ? ? 
metalc37   metalc ?    ? A  C   197  N3    ? ? ? 1_555 BG NA  .    NA    ? ? 0 C   197  0 NA  8573 1_555 ? ? ? ? ? ? ? 2.695 ? ? 
metalc38   metalc ?    ? A  C   218  "O2'" ? ? ? 1_555 NE NA  .    NA    ? ? 0 C   218  0 NA  8527 1_555 ? ? ? ? ? ? ? 2.716 ? ? 
metalc39   metalc ?    ? A  G   219  O6    ? ? ? 1_555 EC MG  .    MG    ? ? 0 G   219  0 MG  8055 1_555 ? ? ? ? ? ? ? 2.719 ? ? 
metalc40   metalc ?    ? A  A   227  "O2'" ? ? ? 1_555 KB MG  .    MG    ? ? 0 A   227  0 MG  8031 1_555 ? ? ? ? ? ? ? 2.627 ? ? 
metalc41   metalc ?    ? A  C   228  "O4'" ? ? ? 1_555 KB MG  .    MG    ? ? 0 C   228  0 MG  8031 1_555 ? ? ? ? ? ? ? 2.743 ? ? 
metalc42   metalc ?    ? A  C   235  O2    ? ? ? 1_555 SI SR  .    SR    ? ? 0 C   235  0 SR  8966 1_555 ? ? ? ? ? ? ? 2.369 ? ? 
metalc43   metalc ?    ? A  C   240  OP1   ? ? ? 1_555 ZA MG  .    MG    ? ? 0 C   240  0 MG  8020 1_555 ? ? ? ? ? ? ? 2.008 ? ? 
metalc44   metalc ?    ? A  G   269  O6    ? ? ? 1_555 ZA MG  .    MG    ? ? 0 G   269  0 MG  8020 1_555 ? ? ? ? ? ? ? 2.145 ? ? 
metalc45   metalc ?    ? A  U   308  O4    ? ? ? 1_555 WE NA  .    NA    ? ? 0 U   308  0 NA  8537 1_555 ? ? ? ? ? ? ? 2.781 ? ? 
metalc46   metalc ?    ? A  U   335  O2    ? ? ? 1_555 WE NA  .    NA    ? ? 0 U   335  0 NA  8537 1_555 ? ? ? ? ? ? ? 2.972 ? ? 
metalc47   metalc ?    ? A  C   342  O2    ? ? ? 1_555 WE NA  .    NA    ? ? 0 C   342  0 NA  8537 1_555 ? ? ? ? ? ? ? 2.861 ? ? 
metalc48   metalc ?    ? A  A   378  "O2'" ? ? ? 1_555 HJ SR  .    SR    ? ? 0 A   378  0 SR  8984 1_555 ? ? ? ? ? ? ? 3.103 ? ? 
metalc49   metalc ?    ? A  G   379  OP2   ? ? ? 1_555 HJ SR  .    SR    ? ? 0 G   379  0 SR  8984 1_555 ? ? ? ? ? ? ? 3.138 ? ? 
metalc50   metalc ?    ? A  G   379  N7    ? ? ? 1_555 HJ SR  .    SR    ? ? 0 G   379  0 SR  8984 1_555 ? ? ? ? ? ? ? 2.770 ? ? 
metalc51   metalc ?    ? A  G   387  O6    ? ? ? 1_555 OE NA  .    NA    ? ? 0 G   387  0 NA  8528 1_555 ? ? ? ? ? ? ? 2.568 ? ? 
metalc52   metalc ?    ? A  U   391  "O2'" ? ? ? 1_555 LF NA  .    NA    ? ? 0 U   391  0 NA  8556 1_555 ? ? ? ? ? ? ? 2.754 ? ? 
metalc53   metalc ?    ? A  U   391  O4    ? ? ? 1_555 GI SR  .    SR    ? ? 0 U   391  0 SR  8953 1_555 ? ? ? ? ? ? ? 2.754 ? ? 
metalc54   metalc ?    ? A  U   392  OP2   ? ? ? 1_555 JB MG  .    MG    ? ? 0 U   392  0 MG  8030 1_555 ? ? ? ? ? ? ? 2.447 ? ? 
metalc55   metalc ?    ? A  U   392  O4    ? ? ? 1_555 PF NA  .    NA    ? ? 0 U   392  0 NA  8560 1_555 ? ? ? ? ? ? ? 2.654 ? ? 
metalc56   metalc ?    ? A  A   395  OP1   ? ? ? 1_555 PF NA  .    NA    ? ? 0 A   395  0 NA  8560 1_555 ? ? ? ? ? ? ? 2.905 ? ? 
metalc57   metalc ?    ? A  U   402  O4    ? ? ? 1_555 OE NA  .    NA    ? ? 0 U   402  0 NA  8528 1_555 ? ? ? ? ? ? ? 2.891 ? ? 
metalc58   metalc ?    ? A  A   415  "O2'" ? ? ? 1_555 UF NA  .    NA    ? ? 0 A   415  0 NA  8565 1_555 ? ? ? ? ? ? ? 2.980 ? ? 
metalc59   metalc ?    ? A  A   429  OP2   ? ? ? 1_555 HJ SR  .    SR    ? ? 0 A   429  0 SR  8984 1_555 ? ? ? ? ? ? ? 2.633 ? ? 
metalc60   metalc ?    ? A  C   443  O2    ? ? ? 1_555 UD NA  .    NA    ? ? 0 C   443  0 NA  8506 1_555 ? ? ? ? ? ? ? 2.796 ? ? 
metalc61   metalc ?    ? A  A   453  "O3'" ? ? ? 1_555 GF NA  .    NA    ? ? 0 A   453  0 NA  8551 1_555 ? ? ? ? ? ? ? 2.984 ? ? 
metalc62   metalc ?    ? A  A   453  "O2'" ? ? ? 1_555 GF NA  .    NA    ? ? 0 A   453  0 NA  8551 1_555 ? ? ? ? ? ? ? 2.853 ? ? 
metalc63   metalc ?    ? A  U   454  OP2   ? ? ? 1_555 GF NA  .    NA    ? ? 0 U   454  0 NA  8551 1_555 ? ? ? ? ? ? ? 2.875 ? ? 
metalc64   metalc ?    ? A  U   454  OP2   ? ? ? 1_555 BH SR  .    SR    ? ? 0 U   454  0 SR  8917 1_555 ? ? ? ? ? ? ? 2.627 ? ? 
metalc65   metalc ?    ? A  G   456  O6    ? ? ? 1_555 JA MG  .    MG    ? ? 0 G   456  0 MG  8004 1_555 ? ? ? ? ? ? ? 2.134 ? ? 
metalc66   metalc ?    ? A  G   456  OP2   ? ? ? 1_555 RA MG  .    MG    ? ? 0 G   456  0 MG  8012 1_555 ? ? ? ? ? ? ? 1.981 ? ? 
metalc67   metalc ?    ? A  A   459  OP1   ? ? ? 1_555 JA MG  .    MG    ? ? 0 A   459  0 MG  8004 1_555 ? ? ? ? ? ? ? 1.834 ? ? 
metalc68   metalc ?    ? A  G   464  O6    ? ? ? 1_555 NF NA  .    NA    ? ? 0 G   464  0 NA  8558 1_555 ? ? ? ? ? ? ? 2.825 ? ? 
metalc69   metalc ?    ? A  G   471  O6    ? ? ? 1_555 GH SR  .    SR    ? ? 0 G   471  0 SR  8922 1_555 ? ? ? ? ? ? ? 2.569 ? ? 
metalc70   metalc ?    ? A  C   478  OP1   ? ? ? 1_555 GF NA  .    NA    ? ? 0 C   478  0 NA  8551 1_555 ? ? ? ? ? ? ? 2.964 ? ? 
metalc71   metalc ?    ? A  C   478  OP1   ? ? ? 1_555 BH SR  .    SR    ? ? 0 C   478  0 SR  8917 1_555 ? ? ? ? ? ? ? 2.407 ? ? 
metalc72   metalc ?    ? A  G   503  N7    ? ? ? 1_555 JH SR  .    SR    ? ? 0 G   503  0 SR  8925 1_555 ? ? ? ? ? ? ? 2.752 ? ? 
metalc73   metalc ?    ? A  G   503  O6    ? ? ? 1_555 JH SR  .    SR    ? ? 0 G   503  0 SR  8925 1_555 ? ? ? ? ? ? ? 2.950 ? ? 
metalc74   metalc ?    ? A  C   515  "O3'" ? ? ? 1_555 QC MG  .    MG    ? ? 0 C   515  0 MG  8068 1_555 ? ? ? ? ? ? ? 2.987 ? ? 
metalc75   metalc ?    ? A  A   516  OP1   ? ? ? 1_555 QC MG  .    MG    ? ? 0 A   516  0 MG  8068 1_555 ? ? ? ? ? ? ? 2.545 ? ? 
metalc76   metalc ?    ? A  A   516  "O5'" ? ? ? 1_555 QC MG  .    MG    ? ? 0 A   516  0 MG  8068 1_555 ? ? ? ? ? ? ? 3.053 ? ? 
metalc77   metalc ?    ? A  U   517  OP2   ? ? ? 1_555 QC MG  .    MG    ? ? 0 U   517  0 MG  8068 1_555 ? ? ? ? ? ? ? 2.359 ? ? 
metalc78   metalc ?    ? A  G   518  N7    ? ? ? 1_555 QC MG  .    MG    ? ? 0 G   518  0 MG  8068 1_555 ? ? ? ? ? ? ? 3.037 ? ? 
metalc79   metalc ?    ? A  A   532  OP1   ? ? ? 1_555 OH SR  .    SR    ? ? 0 A   532  0 SR  8933 1_555 ? ? ? ? ? ? ? 2.473 ? ? 
metalc80   metalc ?    ? A  U   533  OP1   ? ? ? 1_555 OH SR  .    SR    ? ? 0 U   533  0 SR  8933 1_555 ? ? ? ? ? ? ? 2.470 ? ? 
metalc81   metalc ?    ? A  G   545  O6    ? ? ? 1_555 MF NA  .    NA    ? ? 0 G   545  0 NA  8557 1_555 ? ? ? ? ? ? ? 2.652 ? ? 
metalc82   metalc ?    ? A  A   565  OP2   ? ? ? 1_555 WI SR  .    SR    ? ? 0 A   565  0 SR  8970 1_555 ? ? ? ? ? ? ? 3.168 ? ? 
metalc83   metalc ?    ? A  G   592  O6    ? ? ? 1_555 WI SR  .    SR    ? ? 0 G   592  0 SR  8970 1_555 ? ? ? ? ? ? ? 2.699 ? ? 
metalc84   metalc ?    ? A  G   622  O6    ? ? ? 1_555 QE NA  .    NA    ? ? 0 G   622  0 NA  8530 1_555 ? ? ? ? ? ? ? 2.937 ? ? 
metalc85   metalc ?    ? A  U   623  O4    ? ? ? 1_555 QE NA  .    NA    ? ? 0 U   623  0 NA  8530 1_555 ? ? ? ? ? ? ? 2.804 ? ? 
metalc86   metalc ?    ? A  U   623  "O2'" ? ? ? 1_555 YE NA  .    NA    ? ? 0 U   623  0 NA  8542 1_555 ? ? ? ? ? ? ? 2.980 ? ? 
metalc87   metalc ?    ? A  G   627  O6    ? ? ? 1_555 HA MG  .    MG    ? ? 0 G   627  0 MG  8002 1_555 ? ? ? ? ? ? ? 1.948 ? ? 
metalc88   metalc ?    ? A  A   630  "O2'" ? ? ? 1_555 SD NA  .    NA    ? ? 0 A   630  0 NA  8504 1_555 ? ? ? ? ? ? ? 2.718 ? ? 
metalc89   metalc ?    ? A  A   630  N3    ? ? ? 1_555 SD NA  .    NA    ? ? 0 A   630  0 NA  8504 1_555 ? ? ? ? ? ? ? 2.652 ? ? 
metalc90   metalc ?    ? A  A   631  "O2'" ? ? ? 1_555 SD NA  .    NA    ? ? 0 A   631  0 NA  8504 1_555 ? ? ? ? ? ? ? 2.820 ? ? 
metalc91   metalc ?    ? A  G   641  OP2   ? ? ? 1_555 SB MG  .    MG    ? ? 0 G   641  0 MG  8039 1_555 ? ? ? ? ? ? ? 2.161 ? ? 
metalc92   metalc ?    ? A  A   643  OP2   ? ? ? 1_555 QG SR  .    SR    ? ? 0 A   643  0 SR  8904 1_555 ? ? ? ? ? ? ? 2.804 ? ? 
metalc93   metalc ?    ? A  U   664  OP2   ? ? ? 1_555 ZG SR  .    SR    ? ? 0 U   664  0 SR  8915 1_555 ? ? ? ? ? ? ? 3.002 ? ? 
metalc94   metalc ?    ? A  G   681  "O3'" ? ? ? 1_555 VE NA  .    NA    ? ? 0 G   681  0 NA  8536 1_555 ? ? ? ? ? ? ? 2.972 ? ? 
metalc95   metalc ?    ? A  G   681  O6    ? ? ? 1_555 ZG SR  .    SR    ? ? 0 G   681  0 SR  8915 1_555 ? ? ? ? ? ? ? 2.815 ? ? 
metalc96   metalc ?    ? A  A   682  OP2   ? ? ? 1_555 JI SR  .    SR    ? ? 0 A   682  0 SR  8956 1_555 ? ? ? ? ? ? ? 2.402 ? ? 
metalc97   metalc ?    ? A  G   683  N7    ? ? ? 1_555 VE NA  .    NA    ? ? 0 G   683  0 NA  8536 1_555 ? ? ? ? ? ? ? 2.895 ? ? 
metalc98   metalc ?    ? A  G   683  O6    ? ? ? 1_555 VE NA  .    NA    ? ? 0 G   683  0 NA  8536 1_555 ? ? ? ? ? ? ? 2.620 ? ? 
metalc99   metalc ?    ? A  G   683  OP2   ? ? ? 1_555 JI SR  .    SR    ? ? 0 G   683  0 SR  8956 1_555 ? ? ? ? ? ? ? 2.500 ? ? 
metalc100  metalc ?    ? A  A   776  "O3'" ? ? ? 1_555 HE NA  .    NA    ? ? 0 A   776  0 NA  8521 1_555 ? ? ? ? ? ? ? 2.410 ? ? 
metalc101  metalc ?    ? A  A   776  "O2'" ? ? ? 1_555 HE NA  .    NA    ? ? 0 A   776  0 NA  8521 1_555 ? ? ? ? ? ? ? 2.556 ? ? 
metalc102  metalc ?    ? A  U   777  OP2   ? ? ? 1_555 DB MG  .    MG    ? ? 0 U   777  0 MG  8024 1_555 ? ? ? ? ? ? ? 2.258 ? ? 
metalc103  metalc ?    ? A  U   777  OP2   ? ? ? 1_555 PH SR  .    SR    ? ? 0 U   777  0 SR  8934 1_555 ? ? ? ? ? ? ? 2.529 ? ? 
metalc104  metalc ?    ? A  C   778  OP2   ? ? ? 1_555 DB MG  .    MG    ? ? 0 C   778  0 MG  8024 1_555 ? ? ? ? ? ? ? 1.998 ? ? 
metalc105  metalc ?    ? A  U   779  O4    ? ? ? 1_555 HE NA  .    NA    ? ? 0 U   779  0 NA  8521 1_555 ? ? ? ? ? ? ? 2.456 ? ? 
metalc106  metalc ?    ? A  A   791  N7    ? ? ? 1_555 TJ SR  .    SR    ? ? 0 A   791  0 SR  8997 1_555 ? ? ? ? ? ? ? 3.329 ? ? 
metalc107  metalc ?    ? A  U   815  O4    ? ? ? 1_555 OF NA  .    NA    ? ? 0 U   815  0 NA  8559 1_555 ? ? ? ? ? ? ? 2.679 ? ? 
metalc108  metalc ?    ? A  G   816  O6    ? ? ? 1_555 MB MG  .    MG    ? ? 0 G   816  0 MG  8033 1_555 ? ? ? ? ? ? ? 2.468 ? ? 
metalc109  metalc ?    ? A  G   817  O6    ? ? ? 1_555 MB MG  .    MG    ? ? 0 G   817  0 MG  8033 1_555 ? ? ? ? ? ? ? 2.567 ? ? 
metalc110  metalc ?    ? A  G   817  O6    ? ? ? 1_555 ED MG  .    MG    ? ? 0 G   817  0 MG  8083 1_555 ? ? ? ? ? ? ? 2.539 ? ? 
metalc111  metalc ?    ? A  U   821  OP2   ? ? ? 1_555 EI SR  .    SR    ? ? 0 U   821  0 SR  8949 1_555 ? ? ? ? ? ? ? 2.406 ? ? 
metalc112  metalc ?    ? A  C   822  OP2   ? ? ? 1_555 EI SR  .    SR    ? ? 0 C   822  0 SR  8949 1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc113  metalc ?    ? A  G   824  N7    ? ? ? 1_555 NG SR  .    SR    ? ? 0 G   824  0 SR  8901 1_555 ? ? ? ? ? ? ? 2.319 ? ? 
metalc114  metalc ?    ? A  G   834  OP2   ? ? ? 1_555 UJ SR  .    SR    ? ? 0 G   834  0 SR  8998 1_555 ? ? ? ? ? ? ? 2.946 ? ? 
metalc115  metalc ?    ? A  U   835  O2    ? ? ? 1_555 UJ SR  .    SR    ? ? 0 U   835  0 SR  8998 1_555 ? ? ? ? ? ? ? 2.993 ? ? 
metalc116  metalc ?    ? A  G   836  OP1   ? ? ? 1_555 OG SR  .    SR    ? ? 0 G   836  0 SR  8902 1_555 ? ? ? ? ? ? ? 2.195 ? ? 
metalc117  metalc ?    ? A  A   844  OP1   ? ? ? 1_555 QA MG  .    MG    ? ? 0 A   844  0 MG  8011 1_555 ? ? ? ? ? ? ? 1.843 ? ? 
metalc118  metalc ?    ? A  A   846  OP1   ? ? ? 1_555 QJ SR  .    SR    ? ? 0 A   846  0 SR  8994 1_555 ? ? ? ? ? ? ? 2.841 ? ? 
metalc119  metalc ?    ? A  G   854  OP1   ? ? ? 1_555 JE NA  .    NA    ? ? 0 G   854  0 NA  8523 1_555 ? ? ? ? ? ? ? 2.693 ? ? 
metalc120  metalc ?    ? A  G   854  N7    ? ? ? 1_555 NG SR  .    SR    ? ? 0 G   854  0 SR  8901 1_555 ? ? ? ? ? ? ? 2.336 ? ? 
metalc121  metalc ?    ? A  G   854  OP1   ? ? ? 1_555 EI SR  .    SR    ? ? 0 G   854  0 SR  8949 1_555 ? ? ? ? ? ? ? 2.276 ? ? 
metalc122  metalc ?    ? A  U   862  OP1   ? ? ? 1_555 UL SR  .    SR    ? ? 0 U   862  1 SR  8913 1_555 ? ? ? ? ? ? ? 2.695 ? ? 
metalc123  metalc ?    ? A  G   863  O6    ? ? ? 1_555 XC MG  .    MG    ? ? 0 G   863  0 MG  8076 1_555 ? ? ? ? ? ? ? 2.405 ? ? 
metalc124  metalc ?    ? A  U   864  O4    ? ? ? 1_555 XC MG  .    MG    ? ? 0 U   864  0 MG  8076 1_555 ? ? ? ? ? ? ? 2.563 ? ? 
metalc125  metalc ?    ? A  G   868  "O2'" ? ? ? 1_555 VF NA  .    NA    ? ? 0 G   868  0 NA  8566 1_555 ? ? ? ? ? ? ? 2.974 ? ? 
metalc126  metalc ?    ? A  A   876  OP2   ? ? ? 1_555 IA MG  .    MG    ? ? 0 A   876  0 MG  8003 1_555 ? ? ? ? ? ? ? 2.102 ? ? 
metalc127  metalc ?    ? A  G   877  OP2   ? ? ? 1_555 IA MG  .    MG    ? ? 0 G   877  0 MG  8003 1_555 ? ? ? ? ? ? ? 2.098 ? ? 
metalc128  metalc ?    ? A  G   877  OP1   ? ? ? 1_555 OA MG  .    MG    ? ? 0 G   877  0 MG  8009 1_555 ? ? ? ? ? ? ? 1.904 ? ? 
metalc129  metalc ?    ? A  G   887  OP2   ? ? ? 1_555 VF NA  .    NA    ? ? 0 G   887  0 NA  8566 1_555 ? ? ? ? ? ? ? 2.846 ? ? 
metalc130  metalc ?    ? A  C   893  O2    ? ? ? 1_555 SG SR  .    SR    ? ? 0 C   893  0 SR  8906 1_555 ? ? ? ? ? ? ? 2.578 ? ? 
metalc131  metalc ?    ? A  C   893  "O2'" ? ? ? 1_555 SG SR  .    SR    ? ? 0 C   893  0 SR  8906 1_555 ? ? ? ? ? ? ? 2.667 ? ? 
metalc132  metalc ?    ? A  C   896  "O2'" ? ? ? 1_555 BE NA  .    NA    ? ? 0 C   896  0 NA  8514 1_555 ? ? ? ? ? ? ? 2.955 ? ? 
metalc133  metalc ?    ? A  C   896  O2    ? ? ? 1_555 BE NA  .    NA    ? ? 0 C   896  0 NA  8514 1_555 ? ? ? ? ? ? ? 2.845 ? ? 
metalc134  metalc ?    ? A  A   897  "O4'" ? ? ? 1_555 BE NA  .    NA    ? ? 0 A   897  0 NA  8514 1_555 ? ? ? ? ? ? ? 2.950 ? ? 
metalc135  metalc ?    ? A  G   902  O6    ? ? ? 1_555 XF NA  .    NA    ? ? 0 G   902  0 NA  8568 1_555 ? ? ? ? ? ? ? 2.947 ? ? 
metalc136  metalc ?    ? A  U   903  OP1   ? ? ? 1_555 HD MG  .    MG    ? ? 0 U   903  0 MG  8087 1_555 ? ? ? ? ? ? ? 2.366 ? ? 
metalc137  metalc ?    ? A  U   903  O4    ? ? ? 1_555 XF NA  .    NA    ? ? 0 U   903  0 NA  8568 1_555 ? ? ? ? ? ? ? 2.879 ? ? 
metalc138  metalc ?    ? A  A   907  "O2'" ? ? ? 1_555 HC MG  .    MG    ? ? 0 A   907  0 MG  8059 1_555 ? ? ? ? ? ? ? 2.632 ? ? 
metalc139  metalc ?    ? A  A   907  N7    ? ? ? 1_555 YC MG  .    MG    ? ? 0 A   907  0 MG  8077 1_555 ? ? ? ? ? ? ? 2.558 ? ? 
metalc140  metalc ?    ? A  A   908  "O4'" ? ? ? 1_555 HC MG  .    MG    ? ? 0 A   908  0 MG  8059 1_555 ? ? ? ? ? ? ? 2.545 ? ? 
metalc141  metalc ?    ? A  A   914  "O3'" ? ? ? 1_555 XE NA  .    NA    ? ? 0 A   914  0 NA  8541 1_555 ? ? ? ? ? ? ? 2.559 ? ? 
metalc142  metalc ?    ? A  A   914  "O2'" ? ? ? 1_555 XE NA  .    NA    ? ? 0 A   914  0 NA  8541 1_555 ? ? ? ? ? ? ? 2.817 ? ? 
metalc143  metalc ?    ? A  C   915  OP2   ? ? ? 1_555 XE NA  .    NA    ? ? 0 C   915  0 NA  8541 1_555 ? ? ? ? ? ? ? 2.878 ? ? 
metalc144  metalc ?    ? A  G   918  OP1   ? ? ? 1_555 SC MG  .    MG    ? ? 0 G   918  0 MG  8070 1_555 ? ? ? ? ? ? ? 2.321 ? ? 
metalc145  metalc ?    ? A  U   919  OP1   ? ? ? 1_555 LA MG  .    MG    ? ? 0 U   919  0 MG  8006 1_555 ? ? ? ? ? ? ? 2.189 ? ? 
metalc146  metalc ?    ? A  U   919  O4    ? ? ? 1_555 SF NA  .    NA    ? ? 0 U   919  0 NA  8563 1_555 ? ? ? ? ? ? ? 2.829 ? ? 
metalc147  metalc ?    ? A  C   920  N3    ? ? ? 1_555 CF NA  .    NA    ? ? 0 C   920  0 NA  8547 1_555 ? ? ? ? ? ? ? 2.879 ? ? 
metalc148  metalc ?    ? A  A   922  OP1   ? ? ? 1_555 FF NA  .    NA    ? ? 0 A   922  0 NA  8550 1_555 ? ? ? ? ? ? ? 2.801 ? ? 
metalc149  metalc ?    ? A  G   941  O6    ? ? ? 1_555 DF NA  .    NA    ? ? 0 G   941  0 NA  8548 1_555 ? ? ? ? ? ? ? 2.965 ? ? 
metalc150  metalc ?    ? A  U   942  O4    ? ? ? 1_555 DF NA  .    NA    ? ? 0 U   942  0 NA  8548 1_555 ? ? ? ? ? ? ? 2.284 ? ? 
metalc151  metalc ?    ? A  U   954  OP1   ? ? ? 1_555 FC MG  .    MG    ? ? 0 U   954  0 MG  8056 1_555 ? ? ? ? ? ? ? 2.570 ? ? 
metalc152  metalc ?    ? A  A   955  "O2'" ? ? ? 1_555 ZE NA  .    NA    ? ? 0 A   955  0 NA  8544 1_555 ? ? ? ? ? ? ? 2.824 ? ? 
metalc153  metalc ?    ? A  G   956  OP2   ? ? ? 1_555 FB MG  .    MG    ? ? 0 G   956  0 MG  8026 1_555 ? ? ? ? ? ? ? 1.993 ? ? 
metalc154  metalc ?    ? A  A   1040 "O2'" ? ? ? 1_555 VI SR  .    SR    ? ? 0 A   1040 0 SR  8969 1_555 ? ? ? ? ? ? ? 3.139 ? ? 
metalc155  metalc ?    ? A  G   1045 OP2   ? ? ? 1_555 XE NA  .    NA    ? ? 0 G   1045 0 NA  8541 1_555 ? ? ? ? ? ? ? 2.288 ? ? 
metalc156  metalc ?    ? A  G   1055 O6    ? ? ? 1_555 TG SR  .    SR    ? ? 0 G   1055 0 SR  8907 1_555 ? ? ? ? ? ? ? 2.576 ? ? 
metalc157  metalc ?    ? A  G   1059 O6    ? ? ? 1_555 HH SR  .    SR    ? ? 0 G   1059 0 SR  8923 1_555 ? ? ? ? ? ? ? 3.079 ? ? 
metalc158  metalc ?    ? A  C   1069 OP2   ? ? ? 1_555 QD NA  .    NA    ? ? 0 C   1069 0 NA  8501 1_555 ? ? ? ? ? ? ? 2.169 ? ? 
metalc159  metalc ?    ? A  A   1070 "O2'" ? ? ? 1_555 UC MG  .    MG    ? ? 0 A   1070 0 MG  8072 1_555 ? ? ? ? ? ? ? 2.867 ? ? 
metalc160  metalc ?    ? A  G   1071 OP1   ? ? ? 1_555 UC MG  .    MG    ? ? 0 G   1071 0 MG  8072 1_555 ? ? ? ? ? ? ? 2.504 ? ? 
metalc161  metalc ?    ? A  G   1072 N7    ? ? ? 1_555 QD NA  .    NA    ? ? 0 G   1072 0 NA  8501 1_555 ? ? ? ? ? ? ? 2.364 ? ? 
metalc162  metalc ?    ? A  G   1077 N7    ? ? ? 1_555 CG NA  .    NA    ? ? 0 G   1077 0 NA  8574 1_555 ? ? ? ? ? ? ? 2.571 ? ? 
metalc163  metalc ?    ? A  A   1079 OP1   ? ? ? 1_555 CG NA  .    NA    ? ? 0 A   1079 0 NA  8574 1_555 ? ? ? ? ? ? ? 2.652 ? ? 
metalc164  metalc ?    ? A  U   1096 OP2   ? ? ? 1_555 VC MG  .    MG    ? ? 0 U   1096 0 MG  8073 1_555 ? ? ? ? ? ? ? 2.363 ? ? 
metalc165  metalc ?    ? A  A   1098 OP2   ? ? ? 1_555 QB MG  .    MG    ? ? 0 A   1098 0 MG  8037 1_555 ? ? ? ? ? ? ? 2.542 ? ? 
metalc166  metalc ?    ? A  C   1103 OP1   ? ? ? 1_555 JJ SR  .    SR    ? ? 0 C   1103 0 SR  8986 1_555 ? ? ? ? ? ? ? 2.906 ? ? 
metalc167  metalc ?    ? A  A   1106 OP2   ? ? ? 1_555 FD MG  .    MG    ? ? 0 A   1106 0 MG  8084 1_555 ? ? ? ? ? ? ? 2.058 ? ? 
metalc168  metalc ?    ? A  A   1107 OP2   ? ? ? 1_555 FD MG  .    MG    ? ? 0 A   1107 0 MG  8084 1_555 ? ? ? ? ? ? ? 1.908 ? ? 
metalc169  metalc ?    ? A  G   1110 OP2   ? ? ? 1_555 MH SR  .    SR    ? ? 0 G   1110 0 SR  8928 1_555 ? ? ? ? ? ? ? 2.723 ? ? 
metalc170  metalc ?    ? A  G   1113 N7    ? ? ? 1_555 NI SR  .    SR    ? ? 0 G   1113 0 SR  8960 1_555 ? ? ? ? ? ? ? 3.201 ? ? 
metalc171  metalc ?    ? A  G   1119 "O2'" ? ? ? 1_555 RD NA  .    NA    ? ? 0 G   1119 0 NA  8502 1_555 ? ? ? ? ? ? ? 2.779 ? ? 
metalc172  metalc ?    ? A  G   1119 O6    ? ? ? 1_555 BF NA  .    NA    ? ? 0 G   1119 0 NA  8546 1_555 ? ? ? ? ? ? ? 2.788 ? ? 
metalc173  metalc ?    ? A  U   1120 OP2   ? ? ? 1_555 XA MG  .    MG    ? ? 0 U   1120 0 MG  8018 1_555 ? ? ? ? ? ? ? 2.105 ? ? 
metalc174  metalc ?    ? A  G   1121 OP2   ? ? ? 1_555 XA MG  .    MG    ? ? 0 G   1121 0 MG  8018 1_555 ? ? ? ? ? ? ? 2.007 ? ? 
metalc175  metalc ?    ? A  G   1121 O6    ? ? ? 1_555 RD NA  .    NA    ? ? 0 G   1121 0 NA  8502 1_555 ? ? ? ? ? ? ? 2.924 ? ? 
metalc176  metalc ?    ? A  U   1125 OP1   ? ? ? 1_555 TB MG  .    MG    ? ? 0 U   1125 0 MG  8040 1_555 ? ? ? ? ? ? ? 2.028 ? ? 
metalc177  metalc ?    ? A  C   1127 N3    ? ? ? 1_555 HH SR  .    SR    ? ? 0 C   1127 0 SR  8923 1_555 ? ? ? ? ? ? ? 2.884 ? ? 
metalc178  metalc ?    ? A  C   1127 O2    ? ? ? 1_555 HH SR  .    SR    ? ? 0 C   1127 0 SR  8923 1_555 ? ? ? ? ? ? ? 2.823 ? ? 
metalc179  metalc ?    ? A  C   1129 O2    ? ? ? 1_555 CJ SR  .    SR    ? ? 0 C   1129 0 SR  8978 1_555 ? ? ? ? ? ? ? 3.286 ? ? 
metalc180  metalc ?    ? A  C   1129 N3    ? ? ? 1_555 CJ SR  .    SR    ? ? 0 C   1129 0 SR  8978 1_555 ? ? ? ? ? ? ? 2.809 ? ? 
metalc181  metalc ?    ? A  A   1133 OP2   ? ? ? 1_555 LI SR  .    SR    ? ? 0 A   1133 0 SR  8958 1_555 ? ? ? ? ? ? ? 2.512 ? ? 
metalc182  metalc ?    ? A  A   1133 "O2'" ? ? ? 1_555 VK SR  .    SR    ? ? 0 A   1133 H SR  8972 1_555 ? ? ? ? ? ? ? 3.076 ? ? 
metalc183  metalc ?    ? A  A   1133 "O3'" ? ? ? 1_555 VK SR  .    SR    ? ? 0 A   1133 H SR  8972 1_555 ? ? ? ? ? ? ? 2.537 ? ? 
metalc184  metalc ?    ? A  G   1134 N7    ? ? ? 1_555 LI SR  .    SR    ? ? 0 G   1134 0 SR  8958 1_555 ? ? ? ? ? ? ? 2.925 ? ? 
metalc185  metalc ?    ? A  G   1134 O6    ? ? ? 1_555 LI SR  .    SR    ? ? 0 G   1134 0 SR  8958 1_555 ? ? ? ? ? ? ? 2.784 ? ? 
metalc186  metalc ?    ? A  G   1134 OP1   ? ? ? 1_555 VK SR  .    SR    ? ? 0 G   1134 H SR  8972 1_555 ? ? ? ? ? ? ? 2.994 ? ? 
metalc187  metalc ?    ? A  C   1243 OP2   ? ? ? 1_555 BF NA  .    NA    ? ? 0 C   1243 0 NA  8546 1_555 ? ? ? ? ? ? ? 2.885 ? ? 
metalc188  metalc ?    ? A  A   1247 OP2   ? ? ? 1_555 MH SR  .    SR    ? ? 0 A   1247 0 SR  8928 1_555 ? ? ? ? ? ? ? 2.759 ? ? 
metalc189  metalc ?    ? A  C   1257 OP2   ? ? ? 1_555 VC MG  .    MG    ? ? 0 C   1257 0 MG  8073 1_555 ? ? ? ? ? ? ? 2.395 ? ? 
metalc190  metalc ?    ? A  A   1286 OP1   ? ? ? 1_555 GC MG  .    MG    ? ? 0 A   1286 0 MG  8058 1_555 ? ? ? ? ? ? ? 1.865 ? ? 
metalc191  metalc ?    ? A  A   1287 OP1   ? ? ? 1_555 GC MG  .    MG    ? ? 0 A   1287 0 MG  8058 1_555 ? ? ? ? ? ? ? 2.286 ? ? 
metalc192  metalc ?    ? A  A   1291 OP1   ? ? ? 1_555 RH SR  .    SR    ? ? 0 A   1291 0 SR  8936 1_555 ? ? ? ? ? ? ? 2.438 ? ? 
metalc193  metalc ?    ? A  A   1291 OP1   ? ? ? 1_555 EJ SR  .    SR    ? ? 0 A   1291 0 SR  8981 1_555 ? ? ? ? ? ? ? 2.797 ? ? 
metalc194  metalc ?    ? A  G   1292 OP2   ? ? ? 1_555 RH SR  .    SR    ? ? 0 G   1292 0 SR  8936 1_555 ? ? ? ? ? ? ? 2.301 ? ? 
metalc195  metalc ?    ? A  G   1292 O6    ? ? ? 1_555 GJ SR  .    SR    ? ? 0 G   1292 0 SR  8983 1_555 ? ? ? ? ? ? ? 3.345 ? ? 
metalc196  metalc ?    ? A  U   1293 OP2   ? ? ? 1_555 WF NA  .    NA    ? ? 0 U   1293 0 NA  8567 1_555 ? ? ? ? ? ? ? 2.658 ? ? 
metalc197  metalc ?    ? A  G   1295 O6    ? ? ? 1_555 WF NA  .    NA    ? ? 0 G   1295 0 NA  8567 1_555 ? ? ? ? ? ? ? 2.762 ? ? 
metalc198  metalc ?    ? A  G   1295 "O3'" ? ? ? 1_555 VI SR  .    SR    ? ? 0 G   1295 0 SR  8969 1_555 ? ? ? ? ? ? ? 3.368 ? ? 
metalc199  metalc ?    ? A  A   1296 OP1   ? ? ? 1_555 VI SR  .    SR    ? ? 0 A   1296 0 SR  8969 1_555 ? ? ? ? ? ? ? 2.686 ? ? 
metalc200  metalc ?    ? A  U   1309 O2    ? ? ? 1_555 LB MG  .    MG    ? ? 0 U   1309 0 MG  8032 1_555 ? ? ? ? ? ? ? 2.486 ? ? 
metalc201  metalc ?    ? A  A   1317 OP1   ? ? ? 1_555 YJ SR  .    SR    ? ? 0 A   1317 0 SR  9002 1_555 ? ? ? ? ? ? ? 3.112 ? ? 
metalc202  metalc ?    ? A  U   1346 O2    ? ? ? 1_555 LB MG  .    MG    ? ? 0 U   1346 0 MG  8032 1_555 ? ? ? ? ? ? ? 2.529 ? ? 
metalc203  metalc ?    ? A  C   1353 OP1   ? ? ? 1_555 QG SR  .    SR    ? ? 0 C   1353 0 SR  8904 1_555 ? ? ? ? ? ? ? 2.994 ? ? 
metalc204  metalc ?    ? A  G   1354 OP1   ? ? ? 1_555 QG SR  .    SR    ? ? 0 G   1354 0 SR  8904 1_555 ? ? ? ? ? ? ? 2.588 ? ? 
metalc205  metalc ?    ? A  A   1357 N7    ? ? ? 1_555 HD MG  .    MG    ? ? 0 A   1357 0 MG  8087 1_555 ? ? ? ? ? ? ? 2.495 ? ? 
metalc206  metalc ?    ? A  C   1360 OP1   ? ? ? 1_555 JF NA  .    NA    ? ? 0 C   1360 0 NA  8554 1_555 ? ? ? ? ? ? ? 2.540 ? ? 
metalc207  metalc ?    ? A  U   1368 O4    ? ? ? 1_555 CK SR  .    SR    ? ? 0 U   1368 0 SR  9008 1_555 ? ? ? ? ? ? ? 2.671 ? ? 
metalc208  metalc ?    ? A  A   1369 OP2   ? ? ? 1_555 AC MG  .    MG    ? ? 0 A   1369 0 MG  8048 1_555 ? ? ? ? ? ? ? 2.145 ? ? 
metalc209  metalc ?    ? A  G   1376 "O2'" ? ? ? 1_555 BK SR  .    SR    ? ? 0 G   1376 0 SR  9007 1_555 ? ? ? ? ? ? ? 3.386 ? ? 
metalc210  metalc ?    ? A  A   1381 N7    ? ? ? 1_555 WA MG  .    MG    ? ? 0 A   1381 0 MG  8017 1_555 ? ? ? ? ? ? ? 2.334 ? ? 
metalc211  metalc ?    ? A  C   1394 O2    ? ? ? 1_555 VD NA  .    NA    ? ? 0 C   1394 0 NA  8507 1_555 ? ? ? ? ? ? ? 2.365 ? ? 
metalc212  metalc ?    ? A  G   1416 "O3'" ? ? ? 1_555 CE NA  .    NA    ? ? 0 G   1416 0 NA  8515 1_555 ? ? ? ? ? ? ? 2.554 ? ? 
metalc213  metalc ?    ? A  G   1417 OP1   ? ? ? 1_555 CE NA  .    NA    ? ? 0 G   1417 0 NA  8515 1_555 ? ? ? ? ? ? ? 2.814 ? ? 
metalc214  metalc ?    ? A  C   1420 OP1   ? ? ? 1_555 AH SR  .    SR    ? ? 0 C   1420 0 SR  8916 1_555 ? ? ? ? ? ? ? 2.373 ? ? 
metalc215  metalc ?    ? A  C   1421 OP2   ? ? ? 1_555 AH SR  .    SR    ? ? 0 C   1421 0 SR  8916 1_555 ? ? ? ? ? ? ? 2.478 ? ? 
metalc216  metalc ?    ? A  U   1432 O4    ? ? ? 1_555 VD NA  .    NA    ? ? 0 U   1432 0 NA  8507 1_555 ? ? ? ? ? ? ? 2.482 ? ? 
metalc217  metalc ?    ? A  U   1432 O4    ? ? ? 1_555 OI SR  .    SR    ? ? 0 U   1432 0 SR  8962 1_555 ? ? ? ? ? ? ? 2.765 ? ? 
metalc218  metalc ?    ? A  G   1433 O6    ? ? ? 1_555 OI SR  .    SR    ? ? 0 G   1433 0 SR  8962 1_555 ? ? ? ? ? ? ? 2.896 ? ? 
metalc219  metalc ?    ? A  A   1437 OP2   ? ? ? 1_555 LC MG  .    MG    ? ? 0 A   1437 0 MG  8063 1_555 ? ? ? ? ? ? ? 2.867 ? ? 
metalc220  metalc ?    ? A  G   1438 OP1   ? ? ? 1_555 AH SR  .    SR    ? ? 0 G   1438 0 SR  8916 1_555 ? ? ? ? ? ? ? 2.556 ? ? 
metalc221  metalc ?    ? A  A   1448 OP2   ? ? ? 1_555 AB MG  .    MG    ? ? 0 A   1448 0 MG  8021 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
metalc222  metalc ?    ? A  C   1462 "O3'" ? ? ? 1_555 KI SR  .    SR    ? ? 0 C   1462 0 SR  8957 1_555 ? ? ? ? ? ? ? 3.305 ? ? 
metalc223  metalc ?    ? A  U   1463 OP1   ? ? ? 1_555 KI SR  .    SR    ? ? 0 U   1463 0 SR  8957 1_555 ? ? ? ? ? ? ? 2.309 ? ? 
metalc224  metalc ?    ? A  G   1484 OP2   ? ? ? 1_555 AI SR  .    SR    ? ? 0 G   1484 0 SR  8945 1_555 ? ? ? ? ? ? ? 2.282 ? ? 
metalc225  metalc ?    ? A  G   1489 OP2   ? ? ? 1_555 PG SR  .    SR    ? ? 0 G   1489 0 SR  8903 1_555 ? ? ? ? ? ? ? 2.561 ? ? 
metalc226  metalc ?    ? A  G   1491 O6    ? ? ? 1_555 PG SR  .    SR    ? ? 0 G   1491 0 SR  8903 1_555 ? ? ? ? ? ? ? 2.450 ? ? 
metalc227  metalc ?    ? A  U   1503 OP1   ? ? ? 1_555 BB MG  .    MG    ? ? 0 U   1503 0 MG  8022 1_555 ? ? ? ? ? ? ? 1.945 ? ? 
metalc228  metalc ?    ? A  A   1504 OP2   ? ? ? 1_555 BB MG  .    MG    ? ? 0 A   1504 0 MG  8022 1_555 ? ? ? ? ? ? ? 2.958 ? ? 
metalc229  metalc ?    ? A  A   1504 OP1   ? ? ? 1_555 CH SR  .    SR    ? ? 0 A   1504 0 SR  8918 1_555 ? ? ? ? ? ? ? 2.582 ? ? 
metalc230  metalc ?    ? A  G   1543 O6    ? ? ? 1_555 NH SR  .    SR    ? ? 0 G   1543 0 SR  8931 1_555 ? ? ? ? ? ? ? 2.428 ? ? 
metalc231  metalc ?    ? A  G   1576 O6    ? ? ? 1_555 TF NA  .    NA    ? ? 0 G   1576 0 NA  8564 1_555 ? ? ? ? ? ? ? 2.781 ? ? 
metalc232  metalc ?    ? A  U   1577 O4    ? ? ? 1_555 TF NA  .    NA    ? ? 0 U   1577 0 NA  8564 1_555 ? ? ? ? ? ? ? 2.974 ? ? 
metalc233  metalc ?    ? A  G   1619 O6    ? ? ? 1_555 TF NA  .    NA    ? ? 0 G   1619 0 NA  8564 1_555 ? ? ? ? ? ? ? 2.842 ? ? 
metalc234  metalc ?    ? A  U   1677 O4    ? ? ? 1_555 AB MG  .    MG    ? ? 0 U   1677 0 MG  8021 1_555 ? ? ? ? ? ? ? 2.148 ? ? 
metalc235  metalc ?    ? A  A   1678 OP1   ? ? ? 1_555 CH SR  .    SR    ? ? 0 A   1678 0 SR  8918 1_555 ? ? ? ? ? ? ? 2.431 ? ? 
metalc236  metalc ?    ? A  C   1679 OP1   ? ? ? 1_555 BB MG  .    MG    ? ? 0 C   1679 0 MG  8022 1_555 ? ? ? ? ? ? ? 2.119 ? ? 
metalc237  metalc ?    ? A  C   1679 OP2   ? ? ? 1_555 CH SR  .    SR    ? ? 0 C   1679 0 SR  8918 1_555 ? ? ? ? ? ? ? 2.429 ? ? 
metalc238  metalc ?    ? A  A   1682 OP1   ? ? ? 1_555 SJ SR  .    SR    ? ? 0 A   1682 0 SR  8996 1_555 ? ? ? ? ? ? ? 3.057 ? ? 
metalc239  metalc ?    ? A  G   1683 OP2   ? ? ? 1_555 WH SR  .    SR    ? ? 0 G   1683 0 SR  8941 1_555 ? ? ? ? ? ? ? 2.528 ? ? 
metalc240  metalc ?    ? A  A   1684 OP2   ? ? ? 1_555 KC MG  .    MG    ? ? 0 A   1684 0 MG  8062 1_555 ? ? ? ? ? ? ? 2.253 ? ? 
metalc241  metalc ?    ? A  A   1689 OP1   ? ? ? 1_555 QA MG  .    MG    ? ? 0 A   1689 0 MG  8011 1_555 ? ? ? ? ? ? ? 2.195 ? ? 
metalc242  metalc ?    ? A  C   1690 OP1   ? ? ? 1_555 CI SR  .    SR    ? ? 0 C   1690 0 SR  8947 1_555 ? ? ? ? ? ? ? 2.907 ? ? 
metalc243  metalc ?    ? A  A   1693 N6    ? ? ? 1_555 BK SR  .    SR    ? ? 0 A   1693 0 SR  9007 1_555 ? ? ? ? ? ? ? 2.848 ? ? 
metalc244  metalc ?    ? A  G   1694 "O2'" ? ? ? 1_555 QJ SR  .    SR    ? ? 0 G   1694 0 SR  8994 1_555 ? ? ? ? ? ? ? 2.909 ? ? 
metalc245  metalc ?    ? A  G   1694 "O3'" ? ? ? 1_555 QJ SR  .    SR    ? ? 0 G   1694 0 SR  8994 1_555 ? ? ? ? ? ? ? 3.325 ? ? 
metalc246  metalc ?    ? A  U   1696 O4    ? ? ? 1_555 WH SR  .    SR    ? ? 0 U   1696 0 SR  8941 1_555 ? ? ? ? ? ? ? 2.760 ? ? 
metalc247  metalc ?    ? A  G   1706 O6    ? ? ? 1_555 RE NA  .    NA    ? ? 0 G   1706 0 NA  8531 1_555 ? ? ? ? ? ? ? 2.428 ? ? 
metalc248  metalc ?    ? A  G   1707 O6    ? ? ? 1_555 RE NA  .    NA    ? ? 0 G   1707 0 NA  8531 1_555 ? ? ? ? ? ? ? 2.528 ? ? 
metalc249  metalc ?    ? A  A   1717 OP2   ? ? ? 1_555 FH SR  .    SR    ? ? 0 A   1717 0 SR  8921 1_555 ? ? ? ? ? ? ? 2.478 ? ? 
metalc250  metalc ?    ? A  G   1718 N7    ? ? ? 1_555 FH SR  .    SR    ? ? 0 G   1718 0 SR  8921 1_555 ? ? ? ? ? ? ? 3.010 ? ? 
metalc251  metalc ?    ? A  G   1718 O6    ? ? ? 1_555 FH SR  .    SR    ? ? 0 G   1718 0 SR  8921 1_555 ? ? ? ? ? ? ? 2.982 ? ? 
metalc252  metalc ?    ? A  U   1724 OP2   ? ? ? 1_555 KC MG  .    MG    ? ? 0 U   1724 0 MG  8062 1_555 ? ? ? ? ? ? ? 2.208 ? ? 
metalc253  metalc ?    ? A  U   1724 O2    ? ? ? 1_555 VD NA  .    NA    ? ? 0 U   1724 0 NA  8507 1_555 ? ? ? ? ? ? ? 2.196 ? ? 
metalc254  metalc ?    ? A  U   1724 O2    ? ? ? 1_555 OI SR  .    SR    ? ? 0 U   1724 0 SR  8962 1_555 ? ? ? ? ? ? ? 2.995 ? ? 
metalc255  metalc ?    ? A  G   1726 OP2   ? ? ? 1_555 BJ SR  .    SR    ? ? 0 G   1726 0 SR  8976 1_555 ? ? ? ? ? ? ? 3.164 ? ? 
metalc256  metalc ?    ? A  U   1740 O4    ? ? ? 1_555 UE NA  .    NA    ? ? 0 U   1740 0 NA  8535 1_555 ? ? ? ? ? ? ? 2.932 ? ? 
metalc257  metalc ?    ? A  U   1741 O4    ? ? ? 1_555 UE NA  .    NA    ? ? 0 U   1741 0 NA  8535 1_555 ? ? ? ? ? ? ? 2.816 ? ? 
metalc258  metalc ?    ? A  A   1742 OP2   ? ? ? 1_555 NC MG  .    MG    ? ? 0 A   1742 0 MG  8065 1_555 ? ? ? ? ? ? ? 1.979 ? ? 
metalc259  metalc ?    ? A  A   1746 "O3'" ? ? ? 1_555 FJ SR  .    SR    ? ? 0 A   1746 0 SR  8982 1_555 ? ? ? ? ? ? ? 3.078 ? ? 
metalc260  metalc ?    ? A  A   1746 "O2'" ? ? ? 1_555 FJ SR  .    SR    ? ? 0 A   1746 0 SR  8982 1_555 ? ? ? ? ? ? ? 3.124 ? ? 
metalc261  metalc ?    ? A  A   1747 OP2   ? ? ? 1_555 WG SR  .    SR    ? ? 0 A   1747 0 SR  8910 1_555 ? ? ? ? ? ? ? 2.322 ? ? 
metalc262  metalc ?    ? A  A   1747 OP2   ? ? ? 1_555 FJ SR  .    SR    ? ? 0 A   1747 0 SR  8982 1_555 ? ? ? ? ? ? ? 3.168 ? ? 
metalc263  metalc ?    ? A  U   1748 OP1   ? ? ? 1_555 CB MG  .    MG    ? ? 0 U   1748 0 MG  8023 1_555 ? ? ? ? ? ? ? 2.075 ? ? 
metalc264  metalc ?    ? A  U   1748 OP2   ? ? ? 1_555 WG SR  .    SR    ? ? 0 U   1748 0 SR  8910 1_555 ? ? ? ? ? ? ? 2.391 ? ? 
metalc265  metalc ?    ? A  U   1748 O4    ? ? ? 1_555 FJ SR  .    SR    ? ? 0 U   1748 0 SR  8982 1_555 ? ? ? ? ? ? ? 2.905 ? ? 
metalc266  metalc ?    ? A  U   1749 OP2   ? ? ? 1_555 CB MG  .    MG    ? ? 0 U   1749 0 MG  8023 1_555 ? ? ? ? ? ? ? 1.959 ? ? 
metalc267  metalc ?    ? A  U   1749 O4    ? ? ? 1_555 WG SR  .    SR    ? ? 0 U   1749 0 SR  8910 1_555 ? ? ? ? ? ? ? 2.357 ? ? 
metalc268  metalc ?    ? A  U   1749 O4    ? ? ? 1_555 FJ SR  .    SR    ? ? 0 U   1749 0 SR  8982 1_555 ? ? ? ? ? ? ? 2.926 ? ? 
metalc269  metalc ?    ? A  G   1752 OP2   ? ? ? 1_555 FJ SR  .    SR    ? ? 0 G   1752 0 SR  8982 1_555 ? ? ? ? ? ? ? 3.043 ? ? 
metalc270  metalc ?    ? A  A   1754 OP2   ? ? ? 1_555 MC MG  .    MG    ? ? 0 A   1754 0 MG  8064 1_555 ? ? ? ? ? ? ? 2.364 ? ? 
metalc271  metalc ?    ? A  A   1755 OP1   ? ? ? 1_555 RG SR  .    SR    ? ? 0 A   1755 0 SR  8905 1_555 ? ? ? ? ? ? ? 2.709 ? ? 
metalc272  metalc ?    ? A  G   1794 N7    ? ? ? 1_555 PB MG  .    MG    ? ? 0 G   1794 0 MG  8036 1_555 ? ? ? ? ? ? ? 2.643 ? ? 
metalc273  metalc ?    ? A  A   1815 OP1   ? ? ? 1_555 RI SR  .    SR    ? ? 0 A   1815 0 SR  8965 1_555 ? ? ? ? ? ? ? 3.180 ? ? 
metalc274  metalc ?    ? A  C   1830 OP1   ? ? ? 1_555 TA MG  .    MG    ? ? 0 C   1830 0 MG  8014 1_555 ? ? ? ? ? ? ? 1.905 ? ? 
metalc275  metalc ?    ? A  U   1831 "O2'" ? ? ? 1_555 JE NA  .    NA    ? ? 0 U   1831 0 NA  8523 1_555 ? ? ? ? ? ? ? 2.508 ? ? 
metalc276  metalc ?    ? A  G   1832 OP2   ? ? ? 1_555 QF NA  .    NA    ? ? 0 G   1832 0 NA  8561 1_555 ? ? ? ? ? ? ? 2.537 ? ? 
metalc277  metalc ?    ? A  U   1835 OP1   ? ? ? 1_555 ZI SR  .    SR    ? ? 0 U   1835 0 SR  8974 1_555 ? ? ? ? ? ? ? 3.380 ? ? 
metalc278  metalc ?    ? A  U   1835 OP2   ? ? ? 1_555 ZI SR  .    SR    ? ? 0 U   1835 0 SR  8974 1_555 ? ? ? ? ? ? ? 2.865 ? ? 
metalc279  metalc ?    ? A  A   1836 OP1   ? ? ? 1_555 KA MG  .    MG    ? ? 0 A   1836 0 MG  8005 1_555 ? ? ? ? ? ? ? 2.184 ? ? 
metalc280  metalc ?    ? A  U   1838 OP1   ? ? ? 1_555 KA MG  .    MG    ? ? 0 U   1838 0 MG  8005 1_555 ? ? ? ? ? ? ? 1.945 ? ? 
metalc281  metalc ?    ? A  A   1839 OP2   ? ? ? 1_555 KA MG  .    MG    ? ? 0 A   1839 0 MG  8005 1_555 ? ? ? ? ? ? ? 1.988 ? ? 
metalc282  metalc ?    ? A  A   1840 "O2'" ? ? ? 1_555 ND MG  .    MG    ? ? 0 A   1840 0 MG  8093 1_555 ? ? ? ? ? ? ? 2.654 ? ? 
metalc283  metalc ?    ? A  A   1840 "O3'" ? ? ? 1_555 ND MG  .    MG    ? ? 0 A   1840 0 MG  8093 1_555 ? ? ? ? ? ? ? 2.500 ? ? 
metalc284  metalc ?    ? A  C   1841 OP2   ? ? ? 1_555 ND MG  .    MG    ? ? 0 C   1841 0 MG  8093 1_555 ? ? ? ? ? ? ? 3.035 ? ? 
metalc285  metalc ?    ? A  A   1843 OP1   ? ? ? 1_555 TC MG  .    MG    ? ? 0 A   1843 0 MG  8071 1_555 ? ? ? ? ? ? ? 2.927 ? ? 
metalc286  metalc ?    ? A  C   1844 OP2   ? ? ? 1_555 TC MG  .    MG    ? ? 0 C   1844 0 MG  8071 1_555 ? ? ? ? ? ? ? 2.555 ? ? 
metalc287  metalc ?    ? A  A   1845 OP1   ? ? ? 1_555 CC MG  .    MG    ? ? 0 A   1845 0 MG  8052 1_555 ? ? ? ? ? ? ? 2.340 ? ? 
metalc288  metalc ?    ? A  U   1846 OP2   ? ? ? 1_555 CC MG  .    MG    ? ? 0 U   1846 0 MG  8052 1_555 ? ? ? ? ? ? ? 2.475 ? ? 
metalc289  metalc ?    ? A  G   1848 O6    ? ? ? 1_555 WC MG  .    MG    ? ? 0 G   1848 0 MG  8075 1_555 ? ? ? ? ? ? ? 2.405 ? ? 
metalc290  metalc ?    ? A  G   1849 O6    ? ? ? 1_555 WC MG  .    MG    ? ? 0 G   1849 0 MG  8075 1_555 ? ? ? ? ? ? ? 2.281 ? ? 
metalc291  metalc ?    ? A  U   1850 O4    ? ? ? 1_555 MD MG  .    MG    ? ? 0 U   1850 0 MG  8092 1_555 ? ? ? ? ? ? ? 2.642 ? ? 
metalc292  metalc ?    ? A  U   1883 OP1   ? ? ? 1_555 WB MG  .    MG    ? ? 0 U   1883 0 MG  8044 1_555 ? ? ? ? ? ? ? 2.405 ? ? 
metalc293  metalc ?    ? A  G   1884 O6    ? ? ? 1_555 CC MG  .    MG    ? ? 0 G   1884 0 MG  8052 1_555 ? ? ? ? ? ? ? 2.366 ? ? 
metalc294  metalc ?    ? A  A   1885 OP1   ? ? ? 1_555 YH SR  .    SR    ? ? 0 A   1885 0 SR  8943 1_555 ? ? ? ? ? ? ? 2.931 ? ? 
metalc295  metalc ?    ? A  A   1886 OP2   ? ? ? 1_555 YH SR  .    SR    ? ? 0 A   1886 0 SR  8943 1_555 ? ? ? ? ? ? ? 2.657 ? ? 
metalc296  metalc ?    ? A  U   1887 O4    ? ? ? 1_555 YH SR  .    SR    ? ? 0 U   1887 0 SR  8943 1_555 ? ? ? ? ? ? ? 3.238 ? ? 
metalc297  metalc ?    ? A  C   1894 O2    ? ? ? 1_555 PE NA  .    NA    ? ? 0 C   1894 0 NA  8529 1_555 ? ? ? ? ? ? ? 2.738 ? ? 
metalc298  metalc ?    ? A  C   1894 O2    ? ? ? 1_555 AJ SR  .    SR    ? ? 0 C   1894 0 SR  8975 1_555 ? ? ? ? ? ? ? 2.752 ? ? 
metalc299  metalc ?    ? A  G   1896 N7    ? ? ? 1_555 PE NA  .    NA    ? ? 0 G   1896 0 NA  8529 1_555 ? ? ? ? ? ? ? 2.747 ? ? 
metalc300  metalc ?    ? A  G   1896 O6    ? ? ? 1_555 PE NA  .    NA    ? ? 0 G   1896 0 NA  8529 1_555 ? ? ? ? ? ? ? 2.695 ? ? 
metalc301  metalc ?    ? A  U   1897 O4    ? ? ? 1_555 AJ SR  .    SR    ? ? 0 U   1897 0 SR  8975 1_555 ? ? ? ? ? ? ? 2.833 ? ? 
metalc302  metalc ?    ? A  G   1898 O6    ? ? ? 1_555 AJ SR  .    SR    ? ? 0 G   1898 0 SR  8975 1_555 ? ? ? ? ? ? ? 2.823 ? ? 
metalc303  metalc ?    ? A  U   1939 O4    ? ? ? 1_555 AJ SR  .    SR    ? ? 0 U   1939 0 SR  8975 1_555 ? ? ? ? ? ? ? 2.974 ? ? 
metalc304  metalc ?    ? A  U   1972 OP2   ? ? ? 1_555 MI SR  .    SR    ? ? 0 U   1972 0 SR  8959 1_555 ? ? ? ? ? ? ? 2.530 ? ? 
metalc305  metalc ?    ? A  G   1979 OP2   ? ? ? 1_555 OB MG  .    MG    ? ? 0 G   1979 0 MG  8035 1_555 ? ? ? ? ? ? ? 2.298 ? ? 
metalc306  metalc ?    ? A  A   2010 OP2   ? ? ? 1_555 IE NA  .    NA    ? ? 0 A   2010 0 NA  8522 1_555 ? ? ? ? ? ? ? 2.747 ? ? 
metalc307  metalc ?    ? A  A   2011 OP1   ? ? ? 1_555 SA MG  .    MG    ? ? 0 A   2011 0 MG  8013 1_555 ? ? ? ? ? ? ? 2.799 ? ? 
metalc308  metalc ?    ? A  A   2011 OP2   ? ? ? 1_555 SA MG  .    MG    ? ? 0 A   2011 0 MG  8013 1_555 ? ? ? ? ? ? ? 2.357 ? ? 
metalc309  metalc ?    ? A  U   2012 "O2'" ? ? ? 1_555 WB MG  .    MG    ? ? 0 U   2012 0 MG  8044 1_555 ? ? ? ? ? ? ? 2.364 ? ? 
metalc310  metalc ?    ? A  U   2012 "O3'" ? ? ? 1_555 WB MG  .    MG    ? ? 0 U   2012 0 MG  8044 1_555 ? ? ? ? ? ? ? 3.003 ? ? 
metalc311  metalc ?    ? A  U   2012 O4    ? ? ? 1_555 IE NA  .    NA    ? ? 0 U   2012 0 NA  8522 1_555 ? ? ? ? ? ? ? 2.444 ? ? 
metalc312  metalc ?    ? A  G   2013 OP2   ? ? ? 1_555 XB MG  .    MG    ? ? 0 G   2013 0 MG  8045 1_555 ? ? ? ? ? ? ? 1.991 ? ? 
metalc313  metalc ?    ? A  U   2016 O4    ? ? ? 1_555 ZH SR  .    SR    ? ? 0 U   2016 0 SR  8944 1_555 ? ? ? ? ? ? ? 2.672 ? ? 
metalc314  metalc ?    ? A  A   2022 N7    ? ? ? 1_555 ND MG  .    MG    ? ? 0 A   2022 0 MG  8093 1_555 ? ? ? ? ? ? ? 2.499 ? ? 
metalc315  metalc ?    ? A  G   2033 "O2'" ? ? ? 1_555 UE NA  .    NA    ? ? 0 G   2033 0 NA  8535 1_555 ? ? ? ? ? ? ? 2.906 ? ? 
metalc316  metalc ?    ? A  C   2048 OP1   ? ? ? 1_555 NB MG  .    MG    ? ? 0 C   2048 0 MG  8034 1_555 ? ? ? ? ? ? ? 2.309 ? ? 
metalc317  metalc ?    ? A  U   2057 O4    ? ? ? 1_555 KF NA  .    NA    ? ? 0 U   2057 0 NA  8555 1_555 ? ? ? ? ? ? ? 2.896 ? ? 
metalc318  metalc ?    ? A  G   2058 O6    ? ? ? 1_555 KF NA  .    NA    ? ? 0 G   2058 0 NA  8555 1_555 ? ? ? ? ? ? ? 2.848 ? ? 
metalc319  metalc ?    ? A  A   2089 OP1   ? ? ? 1_555 NB MG  .    MG    ? ? 0 A   2089 0 MG  8034 1_555 ? ? ? ? ? ? ? 2.495 ? ? 
metalc320  metalc ?    ? A  G   2091 OP2   ? ? ? 1_555 BI SR  .    SR    ? ? 0 G   2091 0 SR  8946 1_555 ? ? ? ? ? ? ? 2.803 ? ? 
metalc321  metalc ?    ? A  G   2094 N7    ? ? ? 1_555 TD NA  .    NA    ? ? 0 G   2094 0 NA  8505 1_555 ? ? ? ? ? ? ? 2.786 ? ? 
metalc322  metalc ?    ? A  G   2097 OP2   ? ? ? 1_555 VA MG  .    MG    ? ? 0 G   2097 0 MG  8016 1_555 ? ? ? ? ? ? ? 2.154 ? ? 
metalc323  metalc ?    ? A  G   2102 OP2   ? ? ? 1_555 PA MG  .    MG    ? ? 0 G   2102 0 MG  8010 1_555 ? ? ? ? ? ? ? 2.687 ? ? 
metalc324  metalc ?    ? A  G   2102 "O5'" ? ? ? 1_555 PA MG  .    MG    ? ? 0 G   2102 0 MG  8010 1_555 ? ? ? ? ? ? ? 2.723 ? ? 
metalc325  metalc ?    ? A  G   2102 N7    ? ? ? 1_555 OD K   .    K     ? ? 0 G   2102 0 K   8401 1_555 ? ? ? ? ? ? ? 3.467 ? ? 
metalc326  metalc ?    ? A  G   2102 O6    ? ? ? 1_555 OD K   .    K     ? ? 0 G   2102 0 K   8401 1_555 ? ? ? ? ? ? ? 2.872 ? ? 
metalc327  metalc ?    ? A  G   2102 OP1   ? ? ? 1_555 ZJ SR  .    SR    ? ? 0 G   2102 0 SR  9004 1_555 ? ? ? ? ? ? ? 3.130 ? ? 
metalc328  metalc ?    ? A  A   2103 OP2   ? ? ? 1_555 RC MG  .    MG    ? ? 0 A   2103 0 MG  8069 1_555 ? ? ? ? ? ? ? 2.912 ? ? 
metalc329  metalc ?    ? A  A   2103 OP1   ? ? ? 1_555 RC MG  .    MG    ? ? 0 A   2103 0 MG  8069 1_555 ? ? ? ? ? ? ? 2.867 ? ? 
metalc330  metalc ?    ? A  A   2103 OP1   ? ? ? 1_555 ZJ SR  .    SR    ? ? 0 A   2103 0 SR  9004 1_555 ? ? ? ? ? ? ? 2.793 ? ? 
metalc331  metalc ?    ? A  C   2104 OP2   ? ? ? 1_555 DD MG  .    MG    ? ? 0 C   2104 0 MG  8082 1_555 ? ? ? ? ? ? ? 2.875 ? ? 
metalc332  metalc ?    ? A  C   2105 OP2   ? ? ? 1_555 DD MG  .    MG    ? ? 0 C   2105 0 MG  8082 1_555 ? ? ? ? ? ? ? 2.630 ? ? 
metalc333  metalc ?    ? A  U   2109 OP2   ? ? ? 1_555 FF NA  .    NA    ? ? 0 U   2109 0 NA  8550 1_555 ? ? ? ? ? ? ? 2.606 ? ? 
metalc334  metalc ?    ? A  G   2110 OP2   ? ? ? 1_555 IF NA  .    NA    ? ? 0 G   2110 0 NA  8553 1_555 ? ? ? ? ? ? ? 2.737 ? ? 
metalc335  metalc ?    ? A  A   2112 N7    ? ? ? 1_555 JD MG  .    MG    ? ? 0 A   2112 0 MG  8089 1_555 ? ? ? ? ? ? ? 2.481 ? ? 
metalc336  metalc ?    ? A  A   2112 N3    ? ? ? 1_555 FE NA  .    NA    ? ? 0 A   2112 0 NA  8519 1_555 ? ? ? ? ? ? ? 2.694 ? ? 
metalc337  metalc ?    ? A  U   2115 OP1   ? ? ? 1_555 EB MG  .    MG    ? ? 0 U   2115 0 MG  8025 1_555 ? ? ? ? ? ? ? 1.923 ? ? 
metalc338  metalc ?    ? A  C   2248 OP2   ? ? ? 1_555 RB MG  .    MG    ? ? 0 C   2248 0 MG  8038 1_555 ? ? ? ? ? ? ? 2.492 ? ? 
metalc339  metalc ?    ? A  U   2276 OP1   ? ? ? 1_555 UB MG  .    MG    ? ? 0 U   2276 0 MG  8041 1_555 ? ? ? ? ? ? ? 2.047 ? ? 
metalc340  metalc ?    ? A  U   2277 O4    ? ? ? 1_555 OJ SR  .    SR    ? ? 0 U   2277 0 SR  8992 1_555 ? ? ? ? ? ? ? 3.046 ? ? 
metalc341  metalc ?    ? A  U   2278 OP1   ? ? ? 1_555 CF NA  .    NA    ? ? 0 U   2278 0 NA  8547 1_555 ? ? ? ? ? ? ? 2.800 ? ? 
metalc342  metalc ?    ? A  U   2278 O4    ? ? ? 1_555 OJ SR  .    SR    ? ? 0 U   2278 0 SR  8992 1_555 ? ? ? ? ? ? ? 2.766 ? ? 
metalc343  metalc ?    ? A  C   2281 OP2   ? ? ? 1_555 AD MG  .    MG    ? ? 0 C   2281 0 MG  8079 1_555 ? ? ? ? ? ? ? 2.671 ? ? 
metalc344  metalc ?    ? A  U   2282 O4    ? ? ? 1_555 AD MG  .    MG    ? ? 0 U   2282 0 MG  8079 1_555 ? ? ? ? ? ? ? 2.542 ? ? 
metalc345  metalc ?    ? A  G   2284 N7    ? ? ? 1_555 PI SR  .    SR    ? ? 0 G   2284 0 SR  8963 1_555 ? ? ? ? ? ? ? 2.941 ? ? 
metalc346  metalc ?    ? A  G   2284 O6    ? ? ? 1_555 PI SR  .    SR    ? ? 0 G   2284 0 SR  8963 1_555 ? ? ? ? ? ? ? 3.141 ? ? 
metalc347  metalc ?    ? A  A   2302 OP1   ? ? ? 1_555 DI SR  .    SR    ? ? 0 A   2302 0 SR  8948 1_555 ? ? ? ? ? ? ? 2.294 ? ? 
metalc348  metalc ?    ? A  A   2303 OP1   ? ? ? 1_555 DI SR  .    SR    ? ? 0 A   2303 0 SR  8948 1_555 ? ? ? ? ? ? ? 2.444 ? ? 
metalc349  metalc ?    ? A  G   2304 OP2   ? ? ? 1_555 UA MG  .    MG    ? ? 0 G   2304 0 MG  8015 1_555 ? ? ? ? ? ? ? 2.045 ? ? 
metalc350  metalc ?    ? A  G   2399 O6    ? ? ? 1_555 YD NA  .    NA    ? ? 0 G   2399 0 NA  8511 1_555 ? ? ? ? ? ? ? 2.621 ? ? 
metalc351  metalc ?    ? A  G   2421 OP1   ? ? ? 1_555 QH SR  .    SR    ? ? 0 G   2421 0 SR  8935 1_555 ? ? ? ? ? ? ? 2.454 ? ? 
metalc352  metalc ?    ? A  U   2422 "O3'" ? ? ? 1_555 QH SR  .    SR    ? ? 0 U   2422 0 SR  8935 1_555 ? ? ? ? ? ? ? 3.074 ? ? 
metalc353  metalc ?    ? A  C   2423 OP1   ? ? ? 1_555 QH SR  .    SR    ? ? 0 C   2423 0 SR  8935 1_555 ? ? ? ? ? ? ? 2.789 ? ? 
metalc354  metalc ?    ? A  A   2430 N1    ? ? ? 1_555 KD MG  .    MG    ? ? 0 A   2430 0 MG  8090 1_555 ? ? ? ? ? ? ? 2.713 ? ? 
metalc355  metalc ?    ? A  A   2434 N3    ? ? ? 1_555 BD MG  .    MG    ? ? 0 A   2434 0 MG  8080 1_555 ? ? ? ? ? ? ? 2.780 ? ? 
metalc356  metalc ?    ? A  U   2458 O2    ? ? ? 1_555 BD MG  .    MG    ? ? 0 U   2458 0 MG  8080 1_555 ? ? ? ? ? ? ? 2.622 ? ? 
metalc357  metalc ?    ? A  U   2461 OP1   ? ? ? 1_555 VJ SR  .    SR    ? ? 0 U   2461 0 SR  8999 1_555 ? ? ? ? ? ? ? 3.346 ? ? 
metalc358  metalc ?    ? A  C   2464 OP1   ? ? ? 1_555 LA MG  .    MG    ? ? 0 C   2464 0 MG  8006 1_555 ? ? ? ? ? ? ? 1.965 ? ? 
metalc359  metalc ?    ? A  A   2465 OP1   ? ? ? 1_555 LA MG  .    MG    ? ? 0 A   2465 0 MG  8006 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
metalc360  metalc ?    ? A  A   2465 "O3'" ? ? ? 1_555 VH SR  .    SR    ? ? 0 A   2465 0 SR  8940 1_555 ? ? ? ? ? ? ? 3.392 ? ? 
metalc361  metalc ?    ? A  G   2466 N7    ? ? ? 1_555 VH SR  .    SR    ? ? 0 G   2466 0 SR  8940 1_555 ? ? ? ? ? ? ? 3.038 ? ? 
metalc362  metalc ?    ? A  G   2466 OP2   ? ? ? 1_555 VH SR  .    SR    ? ? 0 G   2466 0 SR  8940 1_555 ? ? ? ? ? ? ? 2.454 ? ? 
metalc363  metalc ?    ? A  G   2471 O6    ? ? ? 1_555 OJ SR  .    SR    ? ? 0 G   2471 0 SR  8992 1_555 ? ? ? ? ? ? ? 2.837 ? ? 
metalc364  metalc ?    ? A  C   2475 N4    ? ? ? 1_555 FE NA  .    NA    ? ? 0 C   2475 0 NA  8519 1_555 ? ? ? ? ? ? ? 2.822 ? ? 
metalc365  metalc ?    ? A  G   2482 N7    ? ? ? 1_555 OD K   .    K     ? ? 0 G   2482 0 K   8401 1_555 ? ? ? ? ? ? ? 2.865 ? ? 
metalc366  metalc ?    ? A  G   2482 O6    ? ? ? 1_555 OD K   .    K     ? ? 0 G   2482 0 K   8401 1_555 ? ? ? ? ? ? ? 2.845 ? ? 
metalc367  metalc ?    ? A  A   2483 OP2   ? ? ? 1_555 GA MG  .    MG    ? ? 0 A   2483 0 MG  8001 1_555 ? ? ? ? ? ? ? 2.094 ? ? 
metalc368  metalc ?    ? A  A   2483 OP1   ? ? ? 1_555 HA MG  .    MG    ? ? 0 A   2483 0 MG  8002 1_555 ? ? ? ? ? ? ? 1.978 ? ? 
metalc369  metalc ?    ? A  U   2492 O4    ? ? ? 1_555 RF NA  .    NA    ? ? 0 U   2492 0 NA  8562 1_555 ? ? ? ? ? ? ? 2.892 ? ? 
metalc370  metalc ?    ? A  G   2522 OP1   ? ? ? 1_555 UI SR  .    SR    ? ? 0 G   2522 0 SR  8968 1_555 ? ? ? ? ? ? ? 3.287 ? ? 
metalc371  metalc ?    ? A  G   2524 N7    ? ? ? 1_555 XD NA  .    NA    ? ? 0 G   2524 0 NA  8509 1_555 ? ? ? ? ? ? ? 2.688 ? ? 
metalc372  metalc ?    ? A  G   2525 O6    ? ? ? 1_555 XD NA  .    NA    ? ? 0 G   2525 0 NA  8509 1_555 ? ? ? ? ? ? ? 2.502 ? ? 
metalc373  metalc ?    ? A  G   2529 O6    ? ? ? 1_555 RF NA  .    NA    ? ? 0 G   2529 0 NA  8562 1_555 ? ? ? ? ? ? ? 2.586 ? ? 
metalc374  metalc ?    ? A  C   2533 OP2   ? ? ? 1_555 GA MG  .    MG    ? ? 0 C   2533 0 MG  8001 1_555 ? ? ? ? ? ? ? 2.091 ? ? 
metalc375  metalc ?    ? A  C   2534 OP2   ? ? ? 1_555 GA MG  .    MG    ? ? 0 C   2534 0 MG  8001 1_555 ? ? ? ? ? ? ? 1.938 ? ? 
metalc376  metalc ?    ? A  C   2534 OP1   ? ? ? 1_555 HA MG  .    MG    ? ? 0 C   2534 0 MG  8002 1_555 ? ? ? ? ? ? ? 2.099 ? ? 
metalc377  metalc ?    ? A  C   2536 "O4'" ? ? ? 1_555 OD K   .    K     ? ? 0 C   2536 0 K   8401 1_555 ? ? ? ? ? ? ? 3.046 ? ? 
metalc378  metalc ?    ? A  C   2536 N1    ? ? ? 1_555 OD K   .    K     ? ? 0 C   2536 0 K   8401 1_555 ? ? ? ? ? ? ? 3.686 ? ? 
metalc379  metalc ?    ? A  C   2536 O2    ? ? ? 1_555 OD K   .    K     ? ? 0 C   2536 0 K   8401 1_555 ? ? ? ? ? ? ? 2.840 ? ? 
metalc380  metalc ?    ? A  G   2537 OP2   ? ? ? 1_555 PA MG  .    MG    ? ? 0 G   2537 0 MG  8010 1_555 ? ? ? ? ? ? ? 2.062 ? ? 
metalc381  metalc ?    ? A  G   2540 OP1   ? ? ? 1_555 VA MG  .    MG    ? ? 0 G   2540 0 MG  8016 1_555 ? ? ? ? ? ? ? 2.257 ? ? 
metalc382  metalc ?    ? A  G   2540 O6    ? ? ? 1_555 PC MG  .    MG    ? ? 0 G   2540 0 MG  8067 1_555 ? ? ? ? ? ? ? 2.592 ? ? 
metalc383  metalc ?    ? A  G   2540 O6    ? ? ? 1_555 TE NA  .    NA    ? ? 0 G   2540 0 NA  8534 1_555 ? ? ? ? ? ? ? 2.640 ? ? 
metalc384  metalc ?    ? A  G   2543 N7    ? ? ? 1_555 DE NA  .    NA    ? ? 0 G   2543 0 NA  8516 1_555 ? ? ? ? ? ? ? 2.944 ? ? 
metalc385  metalc ?    ? A  G   2543 O6    ? ? ? 1_555 EE NA  .    NA    ? ? 0 G   2543 0 NA  8517 1_555 ? ? ? ? ? ? ? 2.897 ? ? 
metalc386  metalc ?    ? A  G   2543 OP1   ? ? ? 1_555 DH SR  .    SR    ? ? 0 G   2543 0 SR  8919 1_555 ? ? ? ? ? ? ? 2.769 ? ? 
metalc387  metalc ?    ? A  G   2544 N7    ? ? ? 1_555 DE NA  .    NA    ? ? 0 G   2544 0 NA  8516 1_555 ? ? ? ? ? ? ? 2.933 ? ? 
metalc388  metalc ?    ? A  A   2553 OP2   ? ? ? 1_555 GB MG  .    MG    ? ? 0 A   2553 0 MG  8027 1_555 ? ? ? ? ? ? ? 2.168 ? ? 
metalc389  metalc ?    ? A  A   2553 OP2   ? ? ? 1_555 LH SR  .    SR    ? ? 0 A   2553 0 SR  8927 1_555 ? ? ? ? ? ? ? 2.686 ? ? 
metalc390  metalc ?    ? A  U   2557 OP2   ? ? ? 1_555 II SR  .    SR    ? ? 0 U   2557 0 SR  8955 1_555 ? ? ? ? ? ? ? 3.161 ? ? 
metalc391  metalc ?    ? A  A   2568 OP2   ? ? ? 1_555 DC MG  .    MG    ? ? 0 A   2568 0 MG  8053 1_555 ? ? ? ? ? ? ? 3.140 ? ? 
metalc392  metalc ?    ? A  A   2577 N3    ? ? ? 1_555 WD NA  .    NA    ? ? 0 A   2577 0 NA  8508 1_555 ? ? ? ? ? ? ? 2.932 ? ? 
metalc393  metalc ?    ? A  G   2578 OP2   ? ? ? 1_555 CD MG  .    MG    ? ? 0 G   2578 0 MG  8081 1_555 ? ? ? ? ? ? ? 2.369 ? ? 
metalc394  metalc ?    ? A  G   2579 OP2   ? ? ? 1_555 CD MG  .    MG    ? ? 0 G   2579 0 MG  8081 1_555 ? ? ? ? ? ? ? 2.725 ? ? 
metalc395  metalc ?    ? A  G   2579 O6    ? ? ? 1_555 WD NA  .    NA    ? ? 0 G   2579 0 NA  8508 1_555 ? ? ? ? ? ? ? 2.820 ? ? 
metalc396  metalc ?    ? A  G   2585 OP1   ? ? ? 1_555 WG SR  .    SR    ? ? 0 G   2585 0 SR  8910 1_555 ? ? ? ? ? ? ? 2.248 ? ? 
metalc397  metalc ?    ? A  U   2586 O4    ? ? ? 1_555 ZF NA  .    NA    ? ? 0 U   2586 0 NA  8570 1_555 ? ? ? ? ? ? ? 2.444 ? ? 
metalc398  metalc ?    ? A  C   2591 O2    ? ? ? 1_555 XJ SR  .    SR    ? ? 0 C   2591 0 SR  9001 1_555 ? ? ? ? ? ? ? 3.121 ? ? 
metalc399  metalc ?    ? A  G   2592 O6    ? ? ? 1_555 ZF NA  .    NA    ? ? 0 G   2592 0 NA  8570 1_555 ? ? ? ? ? ? ? 2.659 ? ? 
metalc400  metalc ?    ? A  U   2607 "O2'" ? ? ? 1_555 ZD NA  .    NA    ? ? 0 U   2607 0 NA  8512 1_555 ? ? ? ? ? ? ? 2.405 ? ? 
metalc401  metalc ?    ? A  U   2607 O2    ? ? ? 1_555 ZD NA  .    NA    ? ? 0 U   2607 0 NA  8512 1_555 ? ? ? ? ? ? ? 2.631 ? ? 
metalc402  metalc ?    ? A  C   2608 OP1   ? ? ? 1_555 YA MG  .    MG    ? ? 0 C   2608 0 MG  8019 1_555 ? ? ? ? ? ? ? 2.181 ? ? 
metalc403  metalc ?    ? A  C   2608 O2    ? ? ? 1_555 DH SR  .    SR    ? ? 0 C   2608 0 SR  8919 1_555 ? ? ? ? ? ? ? 3.257 ? ? 
metalc404  metalc ?    ? A  G   2609 OP1   ? ? ? 1_555 YA MG  .    MG    ? ? 0 G   2609 0 MG  8019 1_555 ? ? ? ? ? ? ? 1.914 ? ? 
metalc405  metalc ?    ? A  G   2609 N7    ? ? ? 1_555 RJ SR  .    SR    ? ? 0 G   2609 0 SR  8995 1_555 ? ? ? ? ? ? ? 2.641 ? ? 
metalc406  metalc ?    ? A  U   2610 OP2   ? ? ? 1_555 YA MG  .    MG    ? ? 0 U   2610 0 MG  8019 1_555 ? ? ? ? ? ? ? 1.905 ? ? 
metalc407  metalc ?    ? A  G   2611 OP1   ? ? ? 1_555 MA MG  .    MG    ? ? 0 G   2611 0 MG  8007 1_555 ? ? ? ? ? ? ? 2.101 ? ? 
metalc408  metalc ?    ? A  G   2611 "O2'" ? ? ? 1_555 PC MG  .    MG    ? ? 0 G   2611 0 MG  8067 1_555 ? ? ? ? ? ? ? 2.481 ? ? 
metalc409  metalc ?    ? A  G   2611 OP1   ? ? ? 1_555 EF NA  .    NA    ? ? 0 G   2611 0 NA  8549 1_555 ? ? ? ? ? ? ? 2.725 ? ? 
metalc410  metalc ?    ? A  G   2611 OP2   ? ? ? 1_555 EF NA  .    NA    ? ? 0 G   2611 0 NA  8549 1_555 ? ? ? ? ? ? ? 2.899 ? ? 
metalc411  metalc ?    ? A  A   2612 OP1   ? ? ? 1_555 MA MG  .    MG    ? ? 0 A   2612 0 MG  8007 1_555 ? ? ? ? ? ? ? 1.983 ? ? 
metalc412  metalc ?    ? A  A   2612 "O3'" ? ? ? 1_555 ZC MG  .    MG    ? ? 0 A   2612 0 MG  8078 1_555 ? ? ? ? ? ? ? 3.077 ? ? 
metalc413  metalc ?    ? A  A   2612 "O2'" ? ? ? 1_555 ZC MG  .    MG    ? ? 0 A   2612 0 MG  8078 1_555 ? ? ? ? ? ? ? 2.612 ? ? 
metalc414  metalc ?    ? A  U   2615 O4    ? ? ? 1_555 EE NA  .    NA    ? ? 0 U   2615 0 NA  8517 1_555 ? ? ? ? ? ? ? 2.748 ? ? 
metalc415  metalc ?    ? A  U   2615 OP1   ? ? ? 1_555 OG SR  .    SR    ? ? 0 U   2615 0 SR  8902 1_555 ? ? ? ? ? ? ? 2.275 ? ? 
metalc416  metalc ?    ? A  G   2617 "O3'" ? ? ? 1_555 OC MG  .    MG    ? ? 0 G   2617 0 MG  8066 1_555 ? ? ? ? ? ? ? 3.012 ? ? 
metalc417  metalc ?    ? A  G   2617 OP2   ? ? ? 1_555 MJ SR  .    SR    ? ? 0 G   2617 0 SR  8990 1_555 ? ? ? ? ? ? ? 2.449 ? ? 
metalc418  metalc ?    ? A  G   2618 OP1   ? ? ? 1_555 YB MG  .    MG    ? ? 0 G   2618 0 MG  8046 1_555 ? ? ? ? ? ? ? 2.254 ? ? 
metalc419  metalc ?    ? A  G   2618 OP1   ? ? ? 1_555 OC MG  .    MG    ? ? 0 G   2618 0 MG  8066 1_555 ? ? ? ? ? ? ? 2.447 ? ? 
metalc420  metalc ?    ? A  G   2618 OP2   ? ? ? 1_555 MJ SR  .    SR    ? ? 0 G   2618 0 SR  8990 1_555 ? ? ? ? ? ? ? 2.347 ? ? 
metalc421  metalc ?    ? A  A   2622 OP1   ? ? ? 1_555 LJ SR  .    SR    ? ? 0 A   2622 0 SR  8989 1_555 ? ? ? ? ? ? ? 3.011 ? ? 
metalc422  metalc ?    ? A  G   2623 OP1   ? ? ? 1_555 OA MG  .    MG    ? ? 0 G   2623 0 MG  8009 1_555 ? ? ? ? ? ? ? 1.971 ? ? 
metalc423  metalc ?    ? A  G   2623 OP2   ? ? ? 1_555 LJ SR  .    SR    ? ? 0 G   2623 0 SR  8989 1_555 ? ? ? ? ? ? ? 2.543 ? ? 
metalc424  metalc ?    ? A  A   2624 OP1   ? ? ? 1_555 IA MG  .    MG    ? ? 0 A   2624 0 MG  8003 1_555 ? ? ? ? ? ? ? 1.968 ? ? 
metalc425  metalc ?    ? A  G   2632 O6    ? ? ? 1_555 EH SR  .    SR    ? ? 0 G   2632 0 SR  8920 1_555 ? ? ? ? ? ? ? 2.458 ? ? 
metalc426  metalc ?    ? A  A   2633 OP1   ? ? ? 1_555 LK SR  .    SR    ? ? 0 A   2633 A SR  8929 1_555 ? ? ? ? ? ? ? 3.188 ? ? 
metalc427  metalc ?    ? A  U   2645 "O2'" ? ? ? 1_555 TE NA  .    NA    ? ? 0 U   2645 0 NA  8534 1_555 ? ? ? ? ? ? ? 2.958 ? ? 
metalc428  metalc ?    ? A  U   2645 O2    ? ? ? 1_555 TE NA  .    NA    ? ? 0 U   2645 0 NA  8534 1_555 ? ? ? ? ? ? ? 2.899 ? ? 
metalc429  metalc ?    ? A  A   2649 N1    ? ? ? 1_555 TD NA  .    NA    ? ? 0 A   2649 0 NA  8505 1_555 ? ? ? ? ? ? ? 2.889 ? ? 
metalc430  metalc ?    ? A  U   2650 OP1   ? ? ? 1_555 AC MG  .    MG    ? ? 0 U   2650 0 MG  8048 1_555 ? ? ? ? ? ? ? 2.013 ? ? 
metalc431  metalc ?    ? A  U   2659 "O3'" ? ? ? 1_555 SE NA  .    NA    ? ? 0 U   2659 0 NA  8533 1_555 ? ? ? ? ? ? ? 2.523 ? ? 
metalc432  metalc ?    ? A  G   2660 OP1   ? ? ? 1_555 SE NA  .    NA    ? ? 0 G   2660 0 NA  8533 1_555 ? ? ? ? ? ? ? 2.639 ? ? 
metalc433  metalc ?    ? A  U   2663 O2    ? ? ? 1_555 IJ SR  .    SR    ? ? 0 U   2663 0 SR  8985 1_555 ? ? ? ? ? ? ? 2.771 ? ? 
metalc434  metalc ?    ? A  C   2672 OP1   ? ? ? 1_555 RK SR  .    SR    ? ? 0 C   2672 B SR  8987 1_555 ? ? ? ? ? ? ? 3.003 ? ? 
metalc435  metalc ?    ? A  U   2690 O4    ? ? ? 1_555 TI SR  .    SR    ? ? 0 U   2690 0 SR  8967 1_555 ? ? ? ? ? ? ? 2.970 ? ? 
metalc436  metalc ?    ? A  G   2696 O6    ? ? ? 1_555 FI SR  .    SR    ? ? 0 G   2696 0 SR  8951 1_555 ? ? ? ? ? ? ? 2.448 ? ? 
metalc437  metalc ?    ? A  G   2700 OP2   ? ? ? 1_555 KJ SR  .    SR    ? ? 0 G   2700 0 SR  8988 1_555 ? ? ? ? ? ? ? 2.809 ? ? 
metalc438  metalc ?    ? A  G   2725 OP2   ? ? ? 1_555 IH SR  .    SR    ? ? 0 G   2725 0 SR  8924 1_555 ? ? ? ? ? ? ? 3.344 ? ? 
metalc439  metalc ?    ? A  A   2746 OP2   ? ? ? 1_555 XH SR  .    SR    ? ? 0 A   2746 0 SR  8942 1_555 ? ? ? ? ? ? ? 2.507 ? ? 
metalc440  metalc ?    ? A  G   2750 OP2   ? ? ? 1_555 XH SR  .    SR    ? ? 0 G   2750 0 SR  8942 1_555 ? ? ? ? ? ? ? 2.404 ? ? 
metalc441  metalc ?    ? A  G   2755 O6    ? ? ? 1_555 IH SR  .    SR    ? ? 0 G   2755 0 SR  8924 1_555 ? ? ? ? ? ? ? 2.684 ? ? 
metalc442  metalc ?    ? A  A   2757 OP1   ? ? ? 1_555 VB MG  .    MG    ? ? 0 A   2757 0 MG  8043 1_555 ? ? ? ? ? ? ? 1.991 ? ? 
metalc443  metalc ?    ? A  G   2772 O6    ? ? ? 1_555 AG NA  .    NA    ? ? 0 G   2772 0 NA  8571 1_555 ? ? ? ? ? ? ? 2.372 ? ? 
metalc444  metalc ?    ? A  G   2773 O6    ? ? ? 1_555 AG NA  .    NA    ? ? 0 G   2773 0 NA  8571 1_555 ? ? ? ? ? ? ? 2.779 ? ? 
metalc445  metalc ?    ? A  G   2777 O6    ? ? ? 1_555 QI SR  .    SR    ? ? 0 G   2777 0 SR  8964 1_555 ? ? ? ? ? ? ? 2.876 ? ? 
metalc446  metalc ?    ? A  G   2810 O6    ? ? ? 1_555 HI SR  .    SR    ? ? 0 G   2810 0 SR  8954 1_555 ? ? ? ? ? ? ? 2.499 ? ? 
metalc447  metalc ?    ? A  A   2811 "O2'" ? ? ? 1_555 IJ SR  .    SR    ? ? 0 A   2811 0 SR  8985 1_555 ? ? ? ? ? ? ? 2.846 ? ? 
metalc448  metalc ?    ? A  A   2811 "O3'" ? ? ? 1_555 IJ SR  .    SR    ? ? 0 A   2811 0 SR  8985 1_555 ? ? ? ? ? ? ? 2.834 ? ? 
metalc449  metalc ?    ? A  A   2812 OP2   ? ? ? 1_555 IJ SR  .    SR    ? ? 0 A   2812 0 SR  8985 1_555 ? ? ? ? ? ? ? 3.221 ? ? 
metalc450  metalc ?    ? A  A   2816 "O2'" ? ? ? 1_555 IJ SR  .    SR    ? ? 0 A   2816 0 SR  8985 1_555 ? ? ? ? ? ? ? 2.915 ? ? 
metalc451  metalc ?    ? A  G   2817 OP2   ? ? ? 1_555 IJ SR  .    SR    ? ? 0 G   2817 0 SR  8985 1_555 ? ? ? ? ? ? ? 2.973 ? ? 
metalc452  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 SC MG  .    MG    ? ? 0 HOH 3049 0 MG  8070 1_555 ? ? ? ? ? ? ? 2.403 ? ? 
metalc453  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ID MG  .    MG    ? ? 0 HOH 3071 0 MG  8088 1_555 ? ? ? ? ? ? ? 2.321 ? ? 
metalc454  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 JD MG  .    MG    ? ? 0 HOH 3092 0 MG  8089 1_555 ? ? ? ? ? ? ? 2.313 ? ? 
metalc455  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HE NA  .    NA    ? ? 0 HOH 3127 0 NA  8521 1_555 ? ? ? ? ? ? ? 2.254 ? ? 
metalc456  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NA MG  .    MG    ? ? 0 HOH 3139 0 MG  8008 1_555 ? ? ? ? ? ? ? 2.030 ? ? 
metalc457  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MI SR  .    SR    ? ? 0 HOH 3172 0 SR  8959 1_555 ? ? ? ? ? ? ? 2.340 ? ? 
metalc458  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 WG SR  .    SR    ? ? 0 HOH 3179 0 SR  8910 1_555 ? ? ? ? ? ? ? 2.489 ? ? 
metalc459  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AE NA  .    NA    ? ? 0 HOH 3189 0 NA  8513 1_555 ? ? ? ? ? ? ? 2.880 ? ? 
metalc460  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 JE NA  .    NA    ? ? 0 HOH 3231 0 NA  8523 1_555 ? ? ? ? ? ? ? 2.855 ? ? 
metalc461  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 DC MG  .    MG    ? ? 0 HOH 3235 0 MG  8053 1_555 ? ? ? ? ? ? ? 2.362 ? ? 
metalc462  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 EE NA  .    NA    ? ? 0 HOH 3245 0 NA  8517 1_555 ? ? ? ? ? ? ? 2.547 ? ? 
metalc463  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NC MG  .    MG    ? ? 0 HOH 3254 0 MG  8065 1_555 ? ? ? ? ? ? ? 1.989 ? ? 
metalc464  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 VL SR  .    SR    ? ? 0 HOH 3278 1 SR  8952 1_555 ? ? ? ? ? ? ? 2.767 ? ? 
metalc465  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 JA MG  .    MG    ? ? 0 HOH 3279 0 MG  8004 1_555 ? ? ? ? ? ? ? 2.074 ? ? 
metalc466  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 WH SR  .    SR    ? ? 0 HOH 3288 0 SR  8941 1_555 ? ? ? ? ? ? ? 2.793 ? ? 
metalc467  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 EI SR  .    SR    ? ? 0 HOH 3310 0 SR  8949 1_555 ? ? ? ? ? ? ? 2.476 ? ? 
metalc468  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MB MG  .    MG    ? ? 0 HOH 3315 0 MG  8033 1_555 ? ? ? ? ? ? ? 2.462 ? ? 
metalc469  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 KF NA  .    NA    ? ? 0 HOH 3318 0 NA  8555 1_555 ? ? ? ? ? ? ? 2.621 ? ? 
metalc470  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AC MG  .    MG    ? ? 0 HOH 3322 0 MG  8048 1_555 ? ? ? ? ? ? ? 2.161 ? ? 
metalc471  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NF NA  .    NA    ? ? 0 HOH 3332 0 NA  8558 1_555 ? ? ? ? ? ? ? 2.550 ? ? 
metalc472  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 QE NA  .    NA    ? ? 0 HOH 3375 0 NA  8530 1_555 ? ? ? ? ? ? ? 2.573 ? ? 
metalc473  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MF NA  .    NA    ? ? 0 HOH 3388 0 NA  8557 1_555 ? ? ? ? ? ? ? 2.733 ? ? 
metalc474  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 IB MG  .    MG    ? ? 0 HOH 3413 0 MG  8029 1_555 ? ? ? ? ? ? ? 2.411 ? ? 
metalc475  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RE NA  .    NA    ? ? 0 HOH 3427 0 NA  8531 1_555 ? ? ? ? ? ? ? 2.474 ? ? 
metalc476  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 WA MG  .    MG    ? ? 0 HOH 3438 0 MG  8017 1_555 ? ? ? ? ? ? ? 2.286 ? ? 
metalc477  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 QK SR  .    SR    ? ? 0 HOH 3451 B SR  8950 1_555 ? ? ? ? ? ? ? 2.620 ? ? 
metalc478  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YD NA  .    NA    ? ? 0 HOH 3455 0 NA  8511 1_555 ? ? ? ? ? ? ? 2.596 ? ? 
metalc479  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 UA MG  .    MG    ? ? 0 HOH 3467 0 MG  8015 1_555 ? ? ? ? ? ? ? 2.166 ? ? 
metalc480  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 EB MG  .    MG    ? ? 0 HOH 3492 0 MG  8025 1_555 ? ? ? ? ? ? ? 2.153 ? ? 
metalc481  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ZC MG  .    MG    ? ? 0 HOH 3515 0 MG  8078 1_555 ? ? ? ? ? ? ? 2.475 ? ? 
metalc482  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 TE NA  .    NA    ? ? 0 HOH 3530 0 NA  8534 1_555 ? ? ? ? ? ? ? 2.860 ? ? 
metalc483  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 UE NA  .    NA    ? ? 0 HOH 3538 0 NA  8535 1_555 ? ? ? ? ? ? ? 2.612 ? ? 
metalc484  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 GH SR  .    SR    ? ? 0 HOH 3542 0 SR  8922 1_555 ? ? ? ? ? ? ? 2.555 ? ? 
metalc485  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 TI SR  .    SR    ? ? 0 HOH 3554 0 SR  8967 1_555 ? ? ? ? ? ? ? 2.586 ? ? 
metalc486  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 II SR  .    SR    ? ? 0 HOH 3559 0 SR  8955 1_555 ? ? ? ? ? ? ? 2.412 ? ? 
metalc487  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ZD NA  .    NA    ? ? 0 HOH 3632 0 NA  8512 1_555 ? ? ? ? ? ? ? 2.713 ? ? 
metalc488  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 GB MG  .    MG    ? ? 0 HOH 3637 0 MG  8027 1_555 ? ? ? ? ? ? ? 2.132 ? ? 
metalc489  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 QD NA  .    NA    ? ? 0 HOH 3671 0 NA  8501 1_555 ? ? ? ? ? ? ? 2.444 ? ? 
metalc490  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 QD NA  .    NA    ? ? 0 HOH 3702 0 NA  8501 1_555 ? ? ? ? ? ? ? 2.678 ? ? 
metalc491  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 JE NA  .    NA    ? ? 0 HOH 3707 0 NA  8523 1_555 ? ? ? ? ? ? ? 2.934 ? ? 
metalc492  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 GB MG  .    MG    ? ? 0 HOH 3713 0 MG  8027 1_555 ? ? ? ? ? ? ? 2.167 ? ? 
metalc493  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NA MG  .    MG    ? ? 0 HOH 3729 0 MG  8008 1_555 ? ? ? ? ? ? ? 2.256 ? ? 
metalc494  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HE NA  .    NA    ? ? 0 HOH 3777 0 NA  8521 1_555 ? ? ? ? ? ? ? 2.574 ? ? 
metalc495  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 PH SR  .    SR    ? ? 0 HOH 3777 0 SR  8934 1_555 ? ? ? ? ? ? ? 2.624 ? ? 
metalc496  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NB MG  .    MG    ? ? 0 HOH 3796 0 MG  8034 1_555 ? ? ? ? ? ? ? 2.496 ? ? 
metalc497  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RJ SR  .    SR    ? ? 0 HOH 3800 0 SR  8995 1_555 ? ? ? ? ? ? ? 2.622 ? ? 
metalc498  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MI SR  .    SR    ? ? 0 HOH 3803 0 SR  8959 1_555 ? ? ? ? ? ? ? 2.691 ? ? 
metalc499  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 SC MG  .    MG    ? ? 0 HOH 3824 0 MG  8070 1_555 ? ? ? ? ? ? ? 2.268 ? ? 
metalc500  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 XC MG  .    MG    ? ? 0 HOH 3840 0 MG  8076 1_555 ? ? ? ? ? ? ? 2.407 ? ? 
metalc501  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 KH SR  .    SR    ? ? 0 HOH 3841 0 SR  8926 1_555 ? ? ? ? ? ? ? 2.451 ? ? 
metalc502  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YC MG  .    MG    ? ? 0 HOH 3868 0 MG  8077 1_555 ? ? ? ? ? ? ? 2.453 ? ? 
metalc503  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 VD NA  .    NA    ? ? 0 HOH 3909 0 NA  8507 1_555 ? ? ? ? ? ? ? 2.487 ? ? 
metalc504  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AL MG  .    MG    ? ? 0 HOH 3919 K MG  8054 1_555 ? ? ? ? ? ? ? 2.338 ? ? 
metalc505  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MH SR  .    SR    ? ? 0 HOH 3950 0 SR  8928 1_555 ? ? ? ? ? ? ? 2.627 ? ? 
metalc506  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 DE NA  .    NA    ? ? 0 HOH 3961 0 NA  8516 1_555 ? ? ? ? ? ? ? 2.525 ? ? 
metalc507  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 JF NA  .    NA    ? ? 0 HOH 3974 0 NA  8554 1_555 ? ? ? ? ? ? ? 2.690 ? ? 
metalc508  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 XD NA  .    NA    ? ? 0 HOH 4072 0 NA  8509 1_555 ? ? ? ? ? ? ? 2.263 ? ? 
metalc509  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ED MG  .    MG    ? ? 0 HOH 4096 0 MG  8083 1_555 ? ? ? ? ? ? ? 2.271 ? ? 
metalc510  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 JC MG  .    MG    ? ? 0 HOH 4107 0 MG  8061 1_555 ? ? ? ? ? ? ? 2.155 ? ? 
metalc511  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 KA MG  .    MG    ? ? 0 HOH 4108 0 MG  8005 1_555 ? ? ? ? ? ? ? 2.058 ? ? 
metalc512  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RH SR  .    SR    ? ? 0 HOH 4109 0 SR  8936 1_555 ? ? ? ? ? ? ? 2.798 ? ? 
metalc513  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 GA MG  .    MG    ? ? 0 HOH 4111 0 MG  8001 1_555 ? ? ? ? ? ? ? 2.133 ? ? 
metalc514  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 JC MG  .    MG    ? ? 0 HOH 4112 0 MG  8061 1_555 ? ? ? ? ? ? ? 2.146 ? ? 
metalc515  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 EI SR  .    SR    ? ? 0 HOH 4113 0 SR  8949 1_555 ? ? ? ? ? ? ? 2.344 ? ? 
metalc516  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 QA MG  .    MG    ? ? 0 HOH 4117 0 MG  8011 1_555 ? ? ? ? ? ? ? 1.956 ? ? 
metalc517  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 CJ SR  .    SR    ? ? 0 HOH 4119 0 SR  8978 1_555 ? ? ? ? ? ? ? 2.415 ? ? 
metalc518  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HB MG  .    MG    ? ? 0 HOH 4121 0 MG  8028 1_555 ? ? ? ? ? ? ? 2.023 ? ? 
metalc519  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MJ SR  .    SR    ? ? 0 HOH 4123 0 SR  8990 1_555 ? ? ? ? ? ? ? 2.383 ? ? 
metalc520  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 JC MG  .    MG    ? ? 0 HOH 4124 0 MG  8061 1_555 ? ? ? ? ? ? ? 2.198 ? ? 
metalc521  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 LA MG  .    MG    ? ? 0 HOH 4125 0 MG  8006 1_555 ? ? ? ? ? ? ? 2.104 ? ? 
metalc522  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 PG SR  .    SR    ? ? 0 HOH 4128 0 SR  8903 1_555 ? ? ? ? ? ? ? 2.689 ? ? 
metalc523  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NC MG  .    MG    ? ? 0 HOH 4130 0 MG  8065 1_555 ? ? ? ? ? ? ? 2.009 ? ? 
metalc524  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HC MG  .    MG    ? ? 0 HOH 4133 0 MG  8059 1_555 ? ? ? ? ? ? ? 2.170 ? ? 
metalc525  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 UA MG  .    MG    ? ? 0 HOH 4134 0 MG  8015 1_555 ? ? ? ? ? ? ? 2.075 ? ? 
metalc526  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 UA MG  .    MG    ? ? 0 HOH 4135 0 MG  8015 1_555 ? ? ? ? ? ? ? 2.005 ? ? 
metalc527  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 CB MG  .    MG    ? ? 0 HOH 4136 0 MG  8023 1_555 ? ? ? ? ? ? ? 2.138 ? ? 
metalc528  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 OA MG  .    MG    ? ? 0 HOH 4138 0 MG  8009 1_555 ? ? ? ? ? ? ? 2.215 ? ? 
metalc529  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 DI SR  .    SR    ? ? 0 HOH 4139 0 SR  8948 1_555 ? ? ? ? ? ? ? 2.726 ? ? 
metalc530  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NA MG  .    MG    ? ? 0 HOH 4144 0 MG  8008 1_555 ? ? ? ? ? ? ? 2.334 ? ? 
metalc531  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 GB MG  .    MG    ? ? 0 HOH 4145 0 MG  8027 1_555 ? ? ? ? ? ? ? 2.431 ? ? 
metalc532  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HB MG  .    MG    ? ? 0 HOH 4146 0 MG  8028 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
metalc533  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 UC MG  .    MG    ? ? 0 HOH 4147 0 MG  8072 1_555 ? ? ? ? ? ? ? 2.312 ? ? 
metalc534  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 OA MG  .    MG    ? ? 0 HOH 4151 0 MG  8009 1_555 ? ? ? ? ? ? ? 1.969 ? ? 
metalc535  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 LB MG  .    MG    ? ? 0 HOH 4154 0 MG  8032 1_555 ? ? ? ? ? ? ? 2.499 ? ? 
metalc536  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 PA MG  .    MG    ? ? 0 HOH 4156 0 MG  8010 1_555 ? ? ? ? ? ? ? 2.233 ? ? 
metalc537  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 WC MG  .    MG    ? ? 0 HOH 4160 0 MG  8075 1_555 ? ? ? ? ? ? ? 2.333 ? ? 
metalc538  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 IA MG  .    MG    ? ? 0 HOH 4163 0 MG  8003 1_555 ? ? ? ? ? ? ? 2.173 ? ? 
metalc539  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ZC MG  .    MG    ? ? 0 HOH 4164 0 MG  8078 1_555 ? ? ? ? ? ? ? 2.363 ? ? 
metalc540  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 VB MG  .    MG    ? ? 0 HOH 4165 0 MG  8043 1_555 ? ? ? ? ? ? ? 2.011 ? ? 
metalc541  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 FB MG  .    MG    ? ? 0 HOH 4167 0 MG  8026 1_555 ? ? ? ? ? ? ? 2.167 ? ? 
metalc542  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HB MG  .    MG    ? ? 0 HOH 4168 0 MG  8028 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
metalc543  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 XC MG  .    MG    ? ? 0 HOH 4169 0 MG  8076 1_555 ? ? ? ? ? ? ? 2.142 ? ? 
metalc544  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HB MG  .    MG    ? ? 0 HOH 4170 0 MG  8028 1_555 ? ? ? ? ? ? ? 2.091 ? ? 
metalc545  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 XC MG  .    MG    ? ? 0 HOH 4173 0 MG  8076 1_555 ? ? ? ? ? ? ? 2.458 ? ? 
metalc546  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AB MG  .    MG    ? ? 0 HOH 4175 0 MG  8021 1_555 ? ? ? ? ? ? ? 2.131 ? ? 
metalc547  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ZC MG  .    MG    ? ? 0 HOH 4176 0 MG  8078 1_555 ? ? ? ? ? ? ? 2.137 ? ? 
metalc548  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 TF NA  .    NA    ? ? 0 HOH 4177 0 NA  8564 1_555 ? ? ? ? ? ? ? 2.836 ? ? 
metalc549  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 UC MG  .    MG    ? ? 0 HOH 4179 0 MG  8072 1_555 ? ? ? ? ? ? ? 2.273 ? ? 
metalc550  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MD MG  .    MG    ? ? 0 HOH 4186 0 MG  8092 1_555 ? ? ? ? ? ? ? 2.427 ? ? 
metalc551  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ZF NA  .    NA    ? ? 0 HOH 4188 0 NA  8570 1_555 ? ? ? ? ? ? ? 2.421 ? ? 
metalc552  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NI SR  .    SR    ? ? 0 HOH 4191 0 SR  8960 1_555 ? ? ? ? ? ? ? 2.612 ? ? 
metalc553  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AB MG  .    MG    ? ? 0 HOH 4196 0 MG  8021 1_555 ? ? ? ? ? ? ? 2.271 ? ? 
metalc554  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 WC MG  .    MG    ? ? 0 HOH 4197 0 MG  8075 1_555 ? ? ? ? ? ? ? 2.237 ? ? 
metalc555  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MC MG  .    MG    ? ? 0 HOH 4204 0 MG  8064 1_555 ? ? ? ? ? ? ? 2.016 ? ? 
metalc556  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AB MG  .    MG    ? ? 0 HOH 4207 0 MG  8021 1_555 ? ? ? ? ? ? ? 2.009 ? ? 
metalc557  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YF NA  .    NA    ? ? 0 HOH 4210 0 NA  8569 1_555 ? ? ? ? ? ? ? 2.383 ? ? 
metalc558  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AI SR  .    SR    ? ? 0 HOH 4212 0 SR  8945 1_555 ? ? ? ? ? ? ? 2.697 ? ? 
metalc559  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RJ SR  .    SR    ? ? 0 HOH 4217 0 SR  8995 1_555 ? ? ? ? ? ? ? 2.606 ? ? 
metalc560  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YB MG  .    MG    ? ? 0 HOH 4218 0 MG  8046 1_555 ? ? ? ? ? ? ? 2.175 ? ? 
metalc561  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 UC MG  .    MG    ? ? 0 HOH 4219 0 MG  8072 1_555 ? ? ? ? ? ? ? 2.374 ? ? 
metalc562  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ID MG  .    MG    ? ? 0 HOH 4222 0 MG  8088 1_555 ? ? ? ? ? ? ? 2.207 ? ? 
metalc563  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 OH SR  .    SR    ? ? 0 HOH 4228 0 SR  8933 1_555 ? ? ? ? ? ? ? 2.575 ? ? 
metalc564  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MA MG  .    MG    ? ? 0 HOH 4234 0 MG  8007 1_555 ? ? ? ? ? ? ? 2.130 ? ? 
metalc565  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YC MG  .    MG    ? ? 0 HOH 4243 0 MG  8077 1_555 ? ? ? ? ? ? ? 2.237 ? ? 
metalc566  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 EI SR  .    SR    ? ? 0 HOH 4249 0 SR  8949 1_555 ? ? ? ? ? ? ? 2.659 ? ? 
metalc567  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 OK MG  .    MG    ? ? 0 HOH 4253 B MG  8042 1_555 ? ? ? ? ? ? ? 2.064 ? ? 
metalc568  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 OJ SR  .    SR    ? ? 0 HOH 4256 0 SR  8992 1_555 ? ? ? ? ? ? ? 2.728 ? ? 
metalc569  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 XB MG  .    MG    ? ? 0 HOH 4259 0 MG  8045 1_555 ? ? ? ? ? ? ? 2.098 ? ? 
metalc570  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 VG SR  .    SR    ? ? 0 HOH 4262 0 SR  8909 1_555 ? ? ? ? ? ? ? 2.308 ? ? 
metalc571  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ID MG  .    MG    ? ? 0 HOH 4263 0 MG  8088 1_555 ? ? ? ? ? ? ? 2.235 ? ? 
metalc572  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 DI SR  .    SR    ? ? 0 HOH 4265 0 SR  8948 1_555 ? ? ? ? ? ? ? 2.685 ? ? 
metalc573  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 JA MG  .    MG    ? ? 0 HOH 4278 0 MG  8004 1_555 ? ? ? ? ? ? ? 2.006 ? ? 
metalc574  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 OC MG  .    MG    ? ? 0 HOH 4283 0 MG  8066 1_555 ? ? ? ? ? ? ? 2.132 ? ? 
metalc575  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 EB MG  .    MG    ? ? 0 HOH 4284 0 MG  8025 1_555 ? ? ? ? ? ? ? 2.359 ? ? 
metalc576  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RC MG  .    MG    ? ? 0 HOH 4290 0 MG  8069 1_555 ? ? ? ? ? ? ? 2.056 ? ? 
metalc577  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 IH SR  .    SR    ? ? 0 HOH 4308 0 SR  8924 1_555 ? ? ? ? ? ? ? 2.787 ? ? 
metalc578  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 EC MG  .    MG    ? ? 0 HOH 4310 0 MG  8055 1_555 ? ? ? ? ? ? ? 2.437 ? ? 
metalc579  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MJ SR  .    SR    ? ? 0 HOH 4314 0 SR  8990 1_555 ? ? ? ? ? ? ? 2.244 ? ? 
metalc580  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HH SR  .    SR    ? ? 0 HOH 4317 0 SR  8923 1_555 ? ? ? ? ? ? ? 2.602 ? ? 
metalc581  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 TG SR  .    SR    ? ? 0 HOH 4321 0 SR  8907 1_555 ? ? ? ? ? ? ? 2.674 ? ? 
metalc582  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 WC MG  .    MG    ? ? 0 HOH 4328 0 MG  8075 1_555 ? ? ? ? ? ? ? 2.276 ? ? 
metalc583  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YD NA  .    NA    ? ? 0 HOH 4329 0 NA  8511 1_555 ? ? ? ? ? ? ? 2.389 ? ? 
metalc584  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 OG SR  .    SR    ? ? 0 HOH 4333 0 SR  8902 1_555 ? ? ? ? ? ? ? 2.468 ? ? 
metalc585  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MD MG  .    MG    ? ? 0 HOH 4359 0 MG  8092 1_555 ? ? ? ? ? ? ? 2.412 ? ? 
metalc586  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ZA MG  .    MG    ? ? 0 HOH 4367 0 MG  8020 1_555 ? ? ? ? ? ? ? 2.185 ? ? 
metalc587  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MF NA  .    NA    ? ? 0 HOH 4375 0 NA  8557 1_555 ? ? ? ? ? ? ? 2.806 ? ? 
metalc588  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 VL SR  .    SR    ? ? 0 HOH 4376 1 SR  8952 1_555 ? ? ? ? ? ? ? 2.754 ? ? 
metalc589  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HC MG  .    MG    ? ? 0 HOH 4408 0 MG  8059 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc590  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 JD MG  .    MG    ? ? 0 HOH 4416 0 MG  8089 1_555 ? ? ? ? ? ? ? 2.479 ? ? 
metalc591  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HD MG  .    MG    ? ? 0 HOH 4418 0 MG  8087 1_555 ? ? ? ? ? ? ? 2.409 ? ? 
metalc592  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 DE NA  .    NA    ? ? 0 HOH 4422 0 NA  8516 1_555 ? ? ? ? ? ? ? 2.234 ? ? 
metalc593  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RA MG  .    MG    ? ? 0 HOH 4435 0 MG  8012 1_555 ? ? ? ? ? ? ? 1.988 ? ? 
metalc594  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 PG SR  .    SR    ? ? 0 HOH 4449 0 SR  8903 1_555 ? ? ? ? ? ? ? 2.498 ? ? 
metalc595  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YL SR  .    SR    ? ? 0 HOH 4450 3 SR  8932 1_555 ? ? ? ? ? ? ? 2.533 ? ? 
metalc596  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NG SR  .    SR    ? ? 0 HOH 4451 0 SR  8901 1_555 ? ? ? ? ? ? ? 2.216 ? ? 
metalc597  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 IB MG  .    MG    ? ? 0 HOH 4458 0 MG  8029 1_555 ? ? ? ? ? ? ? 2.139 ? ? 
metalc598  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 IK MG  .    MG    ? ? 0 HOH 4462 A MG  8050 1_555 ? ? ? ? ? ? ? 1.888 ? ? 
metalc599  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 VB MG  .    MG    ? ? 0 HOH 4467 0 MG  8043 1_555 ? ? ? ? ? ? ? 2.214 ? ? 
metalc600  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 OH SR  .    SR    ? ? 0 HOH 4468 0 SR  8933 1_555 ? ? ? ? ? ? ? 2.557 ? ? 
metalc601  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 FC MG  .    MG    ? ? 0 HOH 4490 0 MG  8056 1_555 ? ? ? ? ? ? ? 2.140 ? ? 
metalc602  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ZA MG  .    MG    ? ? 0 HOH 4508 0 MG  8020 1_555 ? ? ? ? ? ? ? 2.010 ? ? 
metalc603  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YB MG  .    MG    ? ? 0 HOH 4545 0 MG  8046 1_555 ? ? ? ? ? ? ? 2.039 ? ? 
metalc604  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 SD NA  .    NA    ? ? 0 HOH 4580 0 NA  8504 1_555 ? ? ? ? ? ? ? 2.642 ? ? 
metalc605  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 QF NA  .    NA    ? ? 0 HOH 4593 0 NA  8561 1_555 ? ? ? ? ? ? ? 2.511 ? ? 
metalc606  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 KB MG  .    MG    ? ? 0 HOH 4599 0 MG  8031 1_555 ? ? ? ? ? ? ? 2.459 ? ? 
metalc607  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 GE NA  .    NA    ? ? 0 HOH 4620 0 NA  8520 1_555 ? ? ? ? ? ? ? 2.476 ? ? 
metalc608  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 SA MG  .    MG    ? ? 0 HOH 4643 0 MG  8013 1_555 ? ? ? ? ? ? ? 2.104 ? ? 
metalc609  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MC MG  .    MG    ? ? 0 HOH 4644 0 MG  8064 1_555 ? ? ? ? ? ? ? 2.159 ? ? 
metalc610  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ZA MG  .    MG    ? ? 0 HOH 4648 0 MG  8020 1_555 ? ? ? ? ? ? ? 2.491 ? ? 
metalc611  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 PA MG  .    MG    ? ? 0 HOH 4656 0 MG  8010 1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc612  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 XA MG  .    MG    ? ? 0 HOH 4661 0 MG  8018 1_555 ? ? ? ? ? ? ? 2.170 ? ? 
metalc613  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 BC MG  .    MG    ? ? 0 HOH 4673 0 MG  8049 1_555 ? ? ? ? ? ? ? 2.191 ? ? 
metalc614  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 EB MG  .    MG    ? ? 0 HOH 4682 0 MG  8025 1_555 ? ? ? ? ? ? ? 2.068 ? ? 
metalc615  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 KB MG  .    MG    ? ? 0 HOH 4693 0 MG  8031 1_555 ? ? ? ? ? ? ? 2.421 ? ? 
metalc616  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AL MG  .    MG    ? ? 0 HOH 4731 K MG  8054 1_555 ? ? ? ? ? ? ? 2.341 ? ? 
metalc617  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 VG SR  .    SR    ? ? 0 HOH 4739 0 SR  8909 1_555 ? ? ? ? ? ? ? 2.619 ? ? 
metalc618  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 VH SR  .    SR    ? ? 0 HOH 4749 0 SR  8940 1_555 ? ? ? ? ? ? ? 2.623 ? ? 
metalc619  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 LD MG  .    MG    ? ? 0 HOH 4774 0 MG  8091 1_555 ? ? ? ? ? ? ? 2.269 ? ? 
metalc620  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NG SR  .    SR    ? ? 0 HOH 4779 0 SR  8901 1_555 ? ? ? ? ? ? ? 2.254 ? ? 
metalc621  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 TE NA  .    NA    ? ? 0 HOH 4781 0 NA  8534 1_555 ? ? ? ? ? ? ? 2.863 ? ? 
metalc622  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 SH SR  .    SR    ? ? 0 HOH 4782 0 SR  8937 1_555 ? ? ? ? ? ? ? 2.643 ? ? 
metalc623  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 LD MG  .    MG    ? ? 0 HOH 4790 0 MG  8091 1_555 ? ? ? ? ? ? ? 2.492 ? ? 
metalc624  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HA MG  .    MG    ? ? 0 HOH 4813 0 MG  8002 1_555 ? ? ? ? ? ? ? 1.994 ? ? 
metalc625  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MK SR  .    SR    ? ? 0 HOH 4840 A SR  8930 1_555 ? ? ? ? ? ? ? 2.627 ? ? 
metalc626  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NG SR  .    SR    ? ? 0 HOH 4913 0 SR  8901 1_555 ? ? ? ? ? ? ? 2.403 ? ? 
metalc627  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YF NA  .    NA    ? ? 0 HOH 4917 0 NA  8569 1_555 ? ? ? ? ? ? ? 2.253 ? ? 
metalc628  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 FE NA  .    NA    ? ? 0 HOH 4968 0 NA  8519 1_555 ? ? ? ? ? ? ? 2.265 ? ? 
metalc629  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 WD NA  .    NA    ? ? 0 HOH 4993 0 NA  8508 1_555 ? ? ? ? ? ? ? 2.984 ? ? 
metalc630  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NG SR  .    SR    ? ? 0 HOH 5018 0 SR  8901 1_555 ? ? ? ? ? ? ? 2.483 ? ? 
metalc631  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 FH SR  .    SR    ? ? 0 HOH 5042 0 SR  8921 1_555 ? ? ? ? ? ? ? 2.519 ? ? 
metalc632  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HJ SR  .    SR    ? ? 0 HOH 5055 0 SR  8984 1_555 ? ? ? ? ? ? ? 2.785 ? ? 
metalc633  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NF NA  .    NA    ? ? 0 HOH 5092 0 NA  8558 1_555 ? ? ? ? ? ? ? 2.772 ? ? 
metalc634  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AD MG  .    MG    ? ? 0 HOH 5111 0 MG  8079 1_555 ? ? ? ? ? ? ? 2.331 ? ? 
metalc635  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 XD NA  .    NA    ? ? 0 HOH 5144 0 NA  8509 1_555 ? ? ? ? ? ? ? 2.428 ? ? 
metalc636  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 SD NA  .    NA    ? ? 0 HOH 5190 0 NA  8504 1_555 ? ? ? ? ? ? ? 2.524 ? ? 
metalc637  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 SI SR  .    SR    ? ? 0 HOH 5191 0 SR  8966 1_555 ? ? ? ? ? ? ? 2.770 ? ? 
metalc638  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 BF NA  .    NA    ? ? 0 HOH 5298 0 NA  8546 1_555 ? ? ? ? ? ? ? 2.183 ? ? 
metalc639  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AF NA  .    NA    ? ? 0 HOH 5306 0 NA  8545 1_555 ? ? ? ? ? ? ? 2.423 ? ? 
metalc640  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 DC MG  .    MG    ? ? 0 HOH 5309 0 MG  8053 1_555 ? ? ? ? ? ? ? 1.998 ? ? 
metalc641  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 TG SR  .    SR    ? ? 0 HOH 5315 0 SR  8907 1_555 ? ? ? ? ? ? ? 2.688 ? ? 
metalc642  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 DI SR  .    SR    ? ? 0 HOH 5351 0 SR  8948 1_555 ? ? ? ? ? ? ? 2.611 ? ? 
metalc643  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 CK SR  .    SR    ? ? 0 HOH 5359 0 SR  9008 1_555 ? ? ? ? ? ? ? 2.797 ? ? 
metalc644  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 UL SR  .    SR    ? ? 0 HOH 5368 1 SR  8913 1_555 ? ? ? ? ? ? ? 2.785 ? ? 
metalc645  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HF NA  .    NA    ? ? 0 HOH 5388 0 NA  8552 1_555 ? ? ? ? ? ? ? 2.780 ? ? 
metalc646  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HC MG  .    MG    ? ? 0 HOH 5418 0 MG  8059 1_555 ? ? ? ? ? ? ? 2.428 ? ? 
metalc647  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 QD NA  .    NA    ? ? 0 HOH 5452 0 NA  8501 1_555 ? ? ? ? ? ? ? 2.369 ? ? 
metalc648  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 TH SR  .    SR    ? ? 0 HOH 5499 0 SR  8938 1_555 ? ? ? ? ? ? ? 2.747 ? ? 
metalc649  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 BG NA  .    NA    ? ? 0 HOH 5500 0 NA  8573 1_555 ? ? ? ? ? ? ? 2.677 ? ? 
metalc650  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YD NA  .    NA    ? ? 0 HOH 5552 0 NA  8511 1_555 ? ? ? ? ? ? ? 2.741 ? ? 
metalc651  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 IB MG  .    MG    ? ? 0 HOH 5579 0 MG  8029 1_555 ? ? ? ? ? ? ? 2.493 ? ? 
metalc652  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 TK SR  .    SR    ? ? 0 HOH 5583 F SR  9005 1_555 ? ? ? ? ? ? ? 2.617 ? ? 
metalc653  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YD NA  .    NA    ? ? 0 HOH 5599 0 NA  8511 1_555 ? ? ? ? ? ? ? 2.375 ? ? 
metalc654  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 TH SR  .    SR    ? ? 0 HOH 5661 0 SR  8938 1_555 ? ? ? ? ? ? ? 2.594 ? ? 
metalc655  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 KE NA  .    NA    ? ? 0 HOH 5693 0 NA  8524 1_555 ? ? ? ? ? ? ? 2.899 ? ? 
metalc656  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YG SR  .    SR    ? ? 0 HOH 5697 0 SR  8914 1_555 ? ? ? ? ? ? ? 2.715 ? ? 
metalc657  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 LC MG  .    MG    ? ? 0 HOH 5721 0 MG  8063 1_555 ? ? ? ? ? ? ? 2.471 ? ? 
metalc658  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 PE NA  .    NA    ? ? 0 HOH 5727 0 NA  8529 1_555 ? ? ? ? ? ? ? 2.481 ? ? 
metalc659  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 BG NA  .    NA    ? ? 0 HOH 5730 0 NA  8573 1_555 ? ? ? ? ? ? ? 2.775 ? ? 
metalc660  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RE NA  .    NA    ? ? 0 HOH 5818 0 NA  8531 1_555 ? ? ? ? ? ? ? 2.187 ? ? 
metalc661  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HD MG  .    MG    ? ? 0 HOH 5880 0 MG  8087 1_555 ? ? ? ? ? ? ? 2.195 ? ? 
metalc662  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 VG SR  .    SR    ? ? 0 HOH 5986 0 SR  8909 1_555 ? ? ? ? ? ? ? 2.451 ? ? 
metalc663  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 TI SR  .    SR    ? ? 0 HOH 6016 0 SR  8967 1_555 ? ? ? ? ? ? ? 2.645 ? ? 
metalc664  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 XC MG  .    MG    ? ? 0 HOH 6033 0 MG  8076 1_555 ? ? ? ? ? ? ? 2.437 ? ? 
metalc665  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RJ SR  .    SR    ? ? 0 HOH 6083 0 SR  8995 1_555 ? ? ? ? ? ? ? 2.296 ? ? 
metalc666  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 GH SR  .    SR    ? ? 0 HOH 6097 0 SR  8922 1_555 ? ? ? ? ? ? ? 2.552 ? ? 
metalc667  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RJ SR  .    SR    ? ? 0 HOH 6228 0 SR  8995 1_555 ? ? ? ? ? ? ? 2.744 ? ? 
metalc668  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 WK NA  .    NA    ? ? 0 HOH 6237 J NA  8538 1_555 ? ? ? ? ? ? ? 2.687 ? ? 
metalc669  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 KH SR  .    SR    ? ? 0 HOH 6261 0 SR  8926 1_555 ? ? ? ? ? ? ? 2.767 ? ? 
metalc670  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 SD NA  .    NA    ? ? 0 HOH 6265 0 NA  8504 1_555 ? ? ? ? ? ? ? 2.696 ? ? 
metalc671  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 XH SR  .    SR    ? ? 0 HOH 6355 0 SR  8942 1_555 ? ? ? ? ? ? ? 2.799 ? ? 
metalc672  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MK SR  .    SR    ? ? 0 HOH 6411 A SR  8930 1_555 ? ? ? ? ? ? ? 2.756 ? ? 
metalc673  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 GF NA  .    NA    ? ? 0 HOH 6433 0 NA  8551 1_555 ? ? ? ? ? ? ? 2.527 ? ? 
metalc674  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HD MG  .    MG    ? ? 0 HOH 6508 0 MG  8087 1_555 ? ? ? ? ? ? ? 2.103 ? ? 
metalc675  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AL MG  .    MG    ? ? 0 HOH 6519 K MG  8054 1_555 ? ? ? ? ? ? ? 2.447 ? ? 
metalc676  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RI SR  .    SR    ? ? 0 HOH 6526 0 SR  8965 1_555 ? ? ? ? ? ? ? 2.649 ? ? 
metalc677  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NH SR  .    SR    ? ? 0 HOH 6557 0 SR  8931 1_555 ? ? ? ? ? ? ? 2.720 ? ? 
metalc678  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NH SR  .    SR    ? ? 0 HOH 6569 0 SR  8931 1_555 ? ? ? ? ? ? ? 2.597 ? ? 
metalc679  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 GD MG  .    MG    ? ? 0 HOH 6570 0 MG  8085 1_555 ? ? ? ? ? ? ? 2.321 ? ? 
metalc680  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 BI SR  .    SR    ? ? 0 HOH 6578 0 SR  8946 1_555 ? ? ? ? ? ? ? 2.761 ? ? 
metalc681  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 JD MG  .    MG    ? ? 0 HOH 6602 0 MG  8089 1_555 ? ? ? ? ? ? ? 2.284 ? ? 
metalc682  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 VG SR  .    SR    ? ? 0 HOH 6625 0 SR  8909 1_555 ? ? ? ? ? ? ? 2.798 ? ? 
metalc683  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 SI SR  .    SR    ? ? 0 HOH 6626 0 SR  8966 1_555 ? ? ? ? ? ? ? 2.305 ? ? 
metalc684  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 PG SR  .    SR    ? ? 0 HOH 6644 0 SR  8903 1_555 ? ? ? ? ? ? ? 2.669 ? ? 
metalc685  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 FL CD  .    CD    ? ? 0 HOH 6721 O CD  8705 1_555 ? ? ? ? ? ? ? 2.336 ? ? 
metalc686  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 DF NA  .    NA    ? ? 0 HOH 6747 0 NA  8548 1_555 ? ? ? ? ? ? ? 2.176 ? ? 
metalc687  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 BE NA  .    NA    ? ? 0 HOH 6786 0 NA  8514 1_555 ? ? ? ? ? ? ? 2.279 ? ? 
metalc688  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 TG SR  .    SR    ? ? 0 HOH 6803 0 SR  8907 1_555 ? ? ? ? ? ? ? 2.608 ? ? 
metalc689  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 IH SR  .    SR    ? ? 0 HOH 6813 0 SR  8924 1_555 ? ? ? ? ? ? ? 2.664 ? ? 
metalc690  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 WF NA  .    NA    ? ? 0 HOH 6815 0 NA  8567 1_555 ? ? ? ? ? ? ? 2.408 ? ? 
metalc691  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MC MG  .    MG    ? ? 0 HOH 6828 0 MG  8064 1_555 ? ? ? ? ? ? ? 2.209 ? ? 
metalc692  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 FH SR  .    SR    ? ? 0 HOH 6855 0 SR  8921 1_555 ? ? ? ? ? ? ? 2.792 ? ? 
metalc693  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 OK MG  .    MG    ? ? 0 HOH 6886 B MG  8042 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
metalc694  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YI SR  .    SR    ? ? 0 HOH 6920 0 SR  8973 1_555 ? ? ? ? ? ? ? 2.512 ? ? 
metalc695  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 KE NA  .    NA    ? ? 0 HOH 6945 0 NA  8524 1_555 ? ? ? ? ? ? ? 2.747 ? ? 
metalc696  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 SC MG  .    MG    ? ? 0 HOH 6950 0 MG  8070 1_555 ? ? ? ? ? ? ? 2.150 ? ? 
metalc697  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 SH SR  .    SR    ? ? 0 HOH 6967 0 SR  8937 1_555 ? ? ? ? ? ? ? 2.582 ? ? 
metalc698  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 BG NA  .    NA    ? ? 0 HOH 7037 0 NA  8573 1_555 ? ? ? ? ? ? ? 2.524 ? ? 
metalc699  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 PF NA  .    NA    ? ? 0 HOH 7038 0 NA  8560 1_555 ? ? ? ? ? ? ? 2.752 ? ? 
metalc700  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 LE NA  .    NA    ? ? 0 HOH 7044 0 NA  8525 1_555 ? ? ? ? ? ? ? 2.972 ? ? 
metalc701  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 QG SR  .    SR    ? ? 0 HOH 7047 0 SR  8904 1_555 ? ? ? ? ? ? ? 2.473 ? ? 
metalc702  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RG SR  .    SR    ? ? 0 HOH 7055 0 SR  8905 1_555 ? ? ? ? ? ? ? 2.543 ? ? 
metalc703  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 LD MG  .    MG    ? ? 0 HOH 7066 0 MG  8091 1_555 ? ? ? ? ? ? ? 2.382 ? ? 
metalc704  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ZE NA  .    NA    ? ? 0 HOH 7070 0 NA  8544 1_555 ? ? ? ? ? ? ? 2.642 ? ? 
metalc705  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 II SR  .    SR    ? ? 0 HOH 7127 0 SR  8955 1_555 ? ? ? ? ? ? ? 2.509 ? ? 
metalc706  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AD MG  .    MG    ? ? 0 HOH 7369 0 MG  8079 1_555 ? ? ? ? ? ? ? 2.389 ? ? 
metalc707  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YE NA  .    NA    ? ? 0 HOH 7423 0 NA  8542 1_555 ? ? ? ? ? ? ? 2.923 ? ? 
metalc708  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MH SR  .    SR    ? ? 0 HOH 7433 0 SR  8928 1_555 ? ? ? ? ? ? ? 2.781 ? ? 
metalc709  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 BC MG  .    MG    ? ? 0 HOH 7468 0 MG  8049 1_555 ? ? ? ? ? ? ? 2.299 ? ? 
metalc710  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 OE NA  .    NA    ? ? 0 HOH 7534 0 NA  8528 1_555 ? ? ? ? ? ? ? 2.842 ? ? 
metalc711  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RG SR  .    SR    ? ? 0 HOH 7625 0 SR  8905 1_555 ? ? ? ? ? ? ? 2.743 ? ? 
metalc712  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 SA MG  .    MG    ? ? 0 HOH 7691 0 MG  8013 1_555 ? ? ? ? ? ? ? 2.134 ? ? 
metalc713  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 TF NA  .    NA    ? ? 0 HOH 7754 0 NA  8564 1_555 ? ? ? ? ? ? ? 2.936 ? ? 
metalc714  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HF NA  .    NA    ? ? 0 HOH 7792 0 NA  8552 1_555 ? ? ? ? ? ? ? 2.838 ? ? 
metalc715  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RE NA  .    NA    ? ? 0 HOH 7803 0 NA  8531 1_555 ? ? ? ? ? ? ? 2.575 ? ? 
metalc716  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RA MG  .    MG    ? ? 0 HOH 7845 0 MG  8012 1_555 ? ? ? ? ? ? ? 2.085 ? ? 
metalc717  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ED MG  .    MG    ? ? 0 HOH 7864 0 MG  8083 1_555 ? ? ? ? ? ? ? 2.489 ? ? 
metalc718  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MB MG  .    MG    ? ? 0 HOH 7869 0 MG  8033 1_555 ? ? ? ? ? ? ? 2.261 ? ? 
metalc719  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ED MG  .    MG    ? ? 0 HOH 7869 0 MG  8083 1_555 ? ? ? ? ? ? ? 2.258 ? ? 
metalc720  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MA MG  .    MG    ? ? 0 HOH 7878 0 MG  8007 1_555 ? ? ? ? ? ? ? 2.152 ? ? 
metalc721  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RH SR  .    SR    ? ? 0 HOH 7912 0 SR  8936 1_555 ? ? ? ? ? ? ? 2.645 ? ? 
metalc722  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HJ SR  .    SR    ? ? 0 HOH 7932 0 SR  8984 1_555 ? ? ? ? ? ? ? 2.562 ? ? 
metalc723  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 DE NA  .    NA    ? ? 0 HOH 7949 0 NA  8516 1_555 ? ? ? ? ? ? ? 2.331 ? ? 
metalc724  metalc ?    ? GA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8001 0 HOH 8293 1_555 ? ? ? ? ? ? ? 2.096 ? ? 
metalc725  metalc ?    ? GA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8001 0 HOH 9675 1_555 ? ? ? ? ? ? ? 2.117 ? ? 
metalc726  metalc ?    ? HA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8002 0 HOH 8271 1_555 ? ? ? ? ? ? ? 2.014 ? ? 
metalc727  metalc ?    ? HA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8002 0 HOH 8272 1_555 ? ? ? ? ? ? ? 2.184 ? ? 
metalc728  metalc ?    ? IA MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? 0 MG  8003 A HOH 8980 1_555 ? ? ? ? ? ? ? 2.197 ? ? 
metalc729  metalc ?    ? IA MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? 0 MG  8003 A HOH 8999 1_555 ? ? ? ? ? ? ? 2.299 ? ? 
metalc730  metalc ?    ? JA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8004 0 HOH 8278 1_555 ? ? ? ? ? ? ? 2.086 ? ? 
metalc731  metalc ?    ? JA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8004 0 HOH 9545 1_555 ? ? ? ? ? ? ? 1.992 ? ? 
metalc732  metalc ?    ? KA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8005 0 HOH 8294 1_555 ? ? ? ? ? ? ? 2.061 ? ? 
metalc733  metalc ?    ? KA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8005 0 HOH 8295 1_555 ? ? ? ? ? ? ? 2.050 ? ? 
metalc734  metalc ?    ? LA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8006 0 HOH 8287 1_555 ? ? ? ? ? ? ? 2.041 ? ? 
metalc735  metalc ?    ? LA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8006 0 HOH 8367 1_555 ? ? ? ? ? ? ? 1.945 ? ? 
metalc736  metalc ?    ? MA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8007 0 HOH 8288 1_555 ? ? ? ? ? ? ? 2.153 ? ? 
metalc737  metalc ?    ? MA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8007 0 HOH 8289 1_555 ? ? ? ? ? ? ? 2.015 ? ? 
metalc738  metalc ?    ? NA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8008 0 HOH 8368 1_555 ? ? ? ? ? ? ? 2.002 ? ? 
metalc739  metalc ?    ? NA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8008 0 HOH 9537 1_555 ? ? ? ? ? ? ? 2.068 ? ? 
metalc740  metalc ?    ? OA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8009 0 HOH 9519 1_555 ? ? ? ? ? ? ? 1.879 ? ? 
metalc741  metalc ?    ? OA MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? 0 MG  8009 A HOH 9089 1_555 ? ? ? ? ? ? ? 2.091 ? ? 
metalc742  metalc ?    ? PA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8010 0 HOH 8269 1_555 ? ? ? ? ? ? ? 1.946 ? ? 
metalc743  metalc ?    ? PA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8010 0 HOH 9531 1_555 ? ? ? ? ? ? ? 2.081 ? ? 
metalc744  metalc ?    ? QA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8011 0 HOH 8303 1_555 ? ? ? ? ? ? ? 2.007 ? ? 
metalc745  metalc ?    ? QA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8011 0 HOH 9504 1_555 ? ? ? ? ? ? ? 2.001 ? ? 
metalc746  metalc ?    ? QA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8011 0 HOH 9522 1_555 ? ? ? ? ? ? ? 2.264 ? ? 
metalc747  metalc ?    ? RA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8012 0 HOH 8279 1_555 ? ? ? ? ? ? ? 2.075 ? ? 
metalc748  metalc ?    ? RA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8012 0 HOH 9915 1_555 ? ? ? ? ? ? ? 2.038 ? ? 
metalc749  metalc ?    ? RA MG  .    MG    ? ? ? 1_555 DM HOH .    O     ? ? 0 MG  8012 C HOH 8562 1_555 ? ? ? ? ? ? ? 2.171 ? ? 
metalc750  metalc ?    ? SA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8013 0 HOH 8298 1_555 ? ? ? ? ? ? ? 1.985 ? ? 
metalc751  metalc ?    ? SA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8013 0 HOH 8299 1_555 ? ? ? ? ? ? ? 2.335 ? ? 
metalc752  metalc ?    ? SA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8013 0 HOH 8300 1_555 ? ? ? ? ? ? ? 2.085 ? ? 
metalc753  metalc ?    ? TA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8014 0 HOH 8282 1_555 ? ? ? ? ? ? ? 2.006 ? ? 
metalc754  metalc ?    ? TA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8014 0 HOH 8301 1_555 ? ? ? ? ? ? ? 1.893 ? ? 
metalc755  metalc ?    ? TA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8014 0 HOH 9619 1_555 ? ? ? ? ? ? ? 1.990 ? ? 
metalc756  metalc ?    ? TA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8014 0 HOH 9622 1_555 ? ? ? ? ? ? ? 1.989 ? ? 
metalc757  metalc ?    ? TA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8014 0 HOH 9696 1_555 ? ? ? ? ? ? ? 2.162 ? ? 
metalc758  metalc ?    ? UA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8015 0 HOH 8285 1_555 ? ? ? ? ? ? ? 1.844 ? ? 
metalc759  metalc ?    ? UA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8015 0 HOH 8286 1_555 ? ? ? ? ? ? ? 1.998 ? ? 
metalc760  metalc ?    ? VA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8016 0 HOH 8290 1_555 ? ? ? ? ? ? ? 2.249 ? ? 
metalc761  metalc ?    ? VA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8016 0 HOH 9607 1_555 ? ? ? ? ? ? ? 1.935 ? ? 
metalc762  metalc ?    ? VA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8016 0 HOH 9957 1_555 ? ? ? ? ? ? ? 2.431 ? ? 
metalc763  metalc ?    ? XA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8018 0 HOH 8306 1_555 ? ? ? ? ? ? ? 1.997 ? ? 
metalc764  metalc ?    ? XA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8018 0 HOH 8307 1_555 ? ? ? ? ? ? ? 1.990 ? ? 
metalc765  metalc ?    ? XA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8018 0 HOH 8372 1_555 ? ? ? ? ? ? ? 2.063 ? ? 
metalc766  metalc ?    ? YA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8019 0 HOH 8308 1_555 ? ? ? ? ? ? ? 2.195 ? ? 
metalc767  metalc ?    ? YA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8019 0 HOH 8309 1_555 ? ? ? ? ? ? ? 2.079 ? ? 
metalc768  metalc ?    ? YA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8019 0 HOH 9894 1_555 ? ? ? ? ? ? ? 2.373 ? ? 
metalc769  metalc ?    ? ZA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8020 0 HOH 8373 1_555 ? ? ? ? ? ? ? 2.019 ? ? 
metalc770  metalc ?    ? AB MG  .    MG    ? ? ? 1_555 TM HOH .    O     ? ? 0 MG  8021 S HOH 8993 1_555 ? ? ? ? ? ? ? 1.917 ? ? 
metalc771  metalc ?    ? BB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8022 0 HOH 8313 1_555 ? ? ? ? ? ? ? 2.053 ? ? 
metalc772  metalc ?    ? BB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8022 0 HOH 8314 1_555 ? ? ? ? ? ? ? 2.283 ? ? 
metalc773  metalc ?    ? CB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8023 0 HOH 8280 1_555 ? ? ? ? ? ? ? 2.030 ? ? 
metalc774  metalc ?    ? CB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8023 0 HOH 8281 1_555 ? ? ? ? ? ? ? 1.995 ? ? 
metalc775  metalc ?    ? CB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8023 0 HOH 8291 1_555 ? ? ? ? ? ? ? 2.075 ? ? 
metalc776  metalc ?    ? DB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8024 0 HOH 8317 1_555 ? ? ? ? ? ? ? 2.102 ? ? 
metalc777  metalc ?    ? DB MG  .    MG    ? ? ? 1_555 PH SR  .    SR    ? ? 0 MG  8024 0 SR  8934 1_555 ? ? ? ? ? ? ? 1.772 ? ? 
metalc778  metalc ?    ? DB MG  .    MG    ? ? ? 1_555 BN HOH .    O     ? ? 0 MG  8024 1 HOH 9002 1_555 ? ? ? ? ? ? ? 2.549 ? ? 
metalc779  metalc ?    ? EB MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? 0 MG  8025 A HOH 9015 1_555 ? ? ? ? ? ? ? 2.128 ? ? 
metalc780  metalc ?    ? EB MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? 0 MG  8025 A HOH 9090 1_555 ? ? ? ? ? ? ? 1.971 ? ? 
metalc781  metalc ?    ? FB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8026 0 HOH 8321 1_555 ? ? ? ? ? ? ? 2.049 ? ? 
metalc782  metalc ?    ? FB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8026 0 HOH 8322 1_555 ? ? ? ? ? ? ? 1.808 ? ? 
metalc783  metalc ?    ? FB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8026 0 HOH 8323 1_555 ? ? ? ? ? ? ? 2.024 ? ? 
metalc784  metalc ?    ? FB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8026 0 HOH 9866 1_555 ? ? ? ? ? ? ? 2.129 ? ? 
metalc785  metalc ?    ? GB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8027 0 HOH 8377 1_555 ? ? ? ? ? ? ? 2.098 ? ? 
metalc786  metalc ?    ? GB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8027 0 HOH 9574 1_555 ? ? ? ? ? ? ? 2.225 ? ? 
metalc787  metalc ?    ? HB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8028 0 HOH 8325 1_555 ? ? ? ? ? ? ? 1.880 ? ? 
metalc788  metalc ?    ? HB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8028 0 HOH 9780 1_555 ? ? ? ? ? ? ? 2.152 ? ? 
metalc789  metalc ?    ? IB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8029 0 HOH 8326 1_555 ? ? ? ? ? ? ? 1.942 ? ? 
metalc790  metalc ?    ? JB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8030 0 HOH 8379 1_555 ? ? ? ? ? ? ? 2.067 ? ? 
metalc791  metalc ?    ? LB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8032 0 HOH 8328 1_555 ? ? ? ? ? ? ? 2.257 ? ? 
metalc792  metalc ?    ? LB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8032 0 HOH 9937 1_555 ? ? ? ? ? ? ? 2.667 ? ? 
metalc793  metalc ?    ? MB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8033 0 HOH 8381 1_555 ? ? ? ? ? ? ? 2.235 ? ? 
metalc794  metalc ?    ? NB MG  .    MG    ? ? ? 1_555 T  GLY 66   O     ? ? 0 MG  8034 R GLY 65   1_555 ? ? ? ? ? ? ? 2.179 ? ? 
metalc795  metalc ?    ? NB MG  .    MG    ? ? ? 1_555 SM HOH .    O     ? ? 0 MG  8034 R HOH 8999 1_555 ? ? ? ? ? ? ? 2.438 ? ? 
metalc796  metalc ?    ? OB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8035 0 HOH 8329 1_555 ? ? ? ? ? ? ? 2.337 ? ? 
metalc797  metalc ?    ? OB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8035 0 HOH 8384 1_555 ? ? ? ? ? ? ? 2.075 ? ? 
metalc798  metalc ?    ? PB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8036 0 HOH 8385 1_555 ? ? ? ? ? ? ? 2.277 ? ? 
metalc799  metalc ?    ? PB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8036 0 HOH 8386 1_555 ? ? ? ? ? ? ? 2.223 ? ? 
metalc800  metalc ?    ? QB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8037 0 HOH 8400 1_555 ? ? ? ? ? ? ? 1.986 ? ? 
metalc801  metalc ?    ? SB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8039 0 HOH 8330 1_555 ? ? ? ? ? ? ? 1.826 ? ? 
metalc802  metalc ?    ? SB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8039 0 HOH 8331 1_555 ? ? ? ? ? ? ? 2.160 ? ? 
metalc803  metalc ?    ? TB MG  .    MG    ? ? ? 1_555 AM HOH .    O     ? ? 0 MG  8040 9 HOH 9010 1_555 ? ? ? ? ? ? ? 2.447 ? ? 
metalc804  metalc ?    ? TB MG  .    MG    ? ? ? 1_555 AM HOH .    O     ? ? 0 MG  8040 9 HOH 9039 1_555 ? ? ? ? ? ? ? 2.396 ? ? 
metalc805  metalc ?    ? UB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8041 0 HOH 8284 1_555 ? ? ? ? ? ? ? 1.942 ? ? 
metalc806  metalc ?    ? UB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8041 0 HOH 8332 1_555 ? ? ? ? ? ? ? 2.241 ? ? 
metalc807  metalc ?    ? UB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8041 0 HOH 8333 1_555 ? ? ? ? ? ? ? 1.989 ? ? 
metalc808  metalc ?    ? UB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8041 0 HOH 9933 1_555 ? ? ? ? ? ? ? 2.158 ? ? 
metalc809  metalc ?    ? VB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8043 0 HOH 8351 1_555 ? ? ? ? ? ? ? 1.877 ? ? 
metalc810  metalc ?    ? VB MG  .    MG    ? ? ? 1_555 D  ASN 336  O     ? ? 0 MG  8043 B ASN 335  1_555 ? ? ? ? ? ? ? 2.215 ? ? 
metalc811  metalc ?    ? VB MG  .    MG    ? ? ? 1_555 CM HOH .    O     ? ? 0 MG  8043 B HOH 9010 1_555 ? ? ? ? ? ? ? 1.986 ? ? 
metalc812  metalc ?    ? WB MG  .    MG    ? ? ? 1_555 C  GLN 208  O     ? ? 0 MG  8044 A GLN 207  1_555 ? ? ? ? ? ? ? 2.925 ? ? 
metalc813  metalc ?    ? WB MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? 0 MG  8044 A HOH 9093 1_555 ? ? ? ? ? ? ? 2.715 ? ? 
metalc814  metalc ?    ? XB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8045 0 HOH 8334 1_555 ? ? ? ? ? ? ? 2.150 ? ? 
metalc815  metalc ?    ? XB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8045 0 HOH 8335 1_555 ? ? ? ? ? ? ? 2.161 ? ? 
metalc816  metalc ?    ? XB MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? 0 MG  8045 A HOH 9091 1_555 ? ? ? ? ? ? ? 2.088 ? ? 
metalc817  metalc ?    ? XB MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? 0 MG  8045 A HOH 9093 1_555 ? ? ? ? ? ? ? 2.313 ? ? 
metalc818  metalc ?    ? YB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8046 0 HOH 9536 1_555 ? ? ? ? ? ? ? 2.390 ? ? 
metalc819  metalc ?    ? YB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8046 0 HOH 9540 1_555 ? ? ? ? ? ? ? 2.567 ? ? 
metalc820  metalc ?    ? ZB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8047 0 HOH 8337 1_555 ? ? ? ? ? ? ? 1.992 ? ? 
metalc821  metalc ?    ? ZB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8047 0 HOH 8338 1_555 ? ? ? ? ? ? ? 1.967 ? ? 
metalc822  metalc ?    ? ZB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8047 0 HOH 9668 1_555 ? ? ? ? ? ? ? 1.919 ? ? 
metalc823  metalc ?    ? AC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8048 0 HOH 8339 1_555 ? ? ? ? ? ? ? 2.152 ? ? 
metalc824  metalc ?    ? AC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8048 0 HOH 8340 1_555 ? ? ? ? ? ? ? 2.296 ? ? 
metalc825  metalc ?    ? AC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8048 0 HOH 8341 1_555 ? ? ? ? ? ? ? 2.149 ? ? 
metalc826  metalc ?    ? BC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8049 0 HOH 8277 1_555 ? ? ? ? ? ? ? 2.415 ? ? 
metalc827  metalc ?    ? BC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8049 0 HOH 8350 1_555 ? ? ? ? ? ? ? 2.193 ? ? 
metalc828  metalc ?    ? CC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8052 0 HOH 8343 1_555 ? ? ? ? ? ? ? 2.249 ? ? 
metalc829  metalc ?    ? CC MG  .    MG    ? ? ? 1_555 C  ASN 189  O     ? ? 0 MG  8052 A ASN 188  1_555 ? ? ? ? ? ? ? 2.222 ? ? 
metalc830  metalc ?    ? DC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8053 0 HOH 8406 1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc831  metalc ?    ? EC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8055 0 HOH 9620 1_555 ? ? ? ? ? ? ? 2.616 ? ? 
metalc832  metalc ?    ? FC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8056 0 HOH 8347 1_555 ? ? ? ? ? ? ? 2.429 ? ? 
metalc833  metalc ?    ? FC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8056 0 HOH 8407 1_555 ? ? ? ? ? ? ? 2.262 ? ? 
metalc834  metalc ?    ? GC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8058 0 HOH 8344 1_555 ? ? ? ? ? ? ? 2.108 ? ? 
metalc835  metalc ?    ? GC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8058 0 HOH 8345 1_555 ? ? ? ? ? ? ? 1.961 ? ? 
metalc836  metalc ?    ? GC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8058 0 HOH 8408 1_555 ? ? ? ? ? ? ? 2.048 ? ? 
metalc837  metalc ?    ? GC MG  .    MG    ? ? ? 1_555 XM HOH .    O     ? ? 0 MG  8058 W HOH 7874 1_555 ? ? ? ? ? ? ? 2.505 ? ? 
metalc838  metalc ?    ? IC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8060 0 HOH 8353 1_555 ? ? ? ? ? ? ? 2.327 ? ? 
metalc839  metalc ?    ? IC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8060 0 HOH 8410 1_555 ? ? ? ? ? ? ? 2.021 ? ? 
metalc840  metalc ?    ? IC MG  .    MG    ? ? ? 1_555 CN HOH .    O     ? ? 0 MG  8060 2 HOH 7875 1_555 ? ? ? ? ? ? ? 2.801 ? ? 
metalc841  metalc ?    ? KC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8062 0 HOH 8356 1_555 ? ? ? ? ? ? ? 2.137 ? ? 
metalc842  metalc ?    ? KC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8062 0 HOH 8413 1_555 ? ? ? ? ? ? ? 2.282 ? ? 
metalc843  metalc ?    ? LC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8063 0 HOH 8421 1_555 ? ? ? ? ? ? ? 2.043 ? ? 
metalc844  metalc ?    ? MC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8064 0 HOH 8357 1_555 ? ? ? ? ? ? ? 2.189 ? ? 
metalc845  metalc ?    ? MC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8064 0 HOH 8414 1_555 ? ? ? ? ? ? ? 2.370 ? ? 
metalc846  metalc ?    ? NC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8065 0 HOH 8358 1_555 ? ? ? ? ? ? ? 1.981 ? ? 
metalc847  metalc ?    ? NC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8065 0 HOH 9749 1_555 ? ? ? ? ? ? ? 2.312 ? ? 
metalc848  metalc ?    ? NC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8065 0 HOH 9873 1_555 ? ? ? ? ? ? ? 2.299 ? ? 
metalc849  metalc ?    ? OC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8066 0 HOH 9536 1_555 ? ? ? ? ? ? ? 2.869 ? ? 
metalc850  metalc ?    ? PC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8067 0 HOH 9561 1_555 ? ? ? ? ? ? ? 2.474 ? ? 
metalc851  metalc ?    ? QC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8068 0 HOH 8416 1_555 ? ? ? ? ? ? ? 2.116 ? ? 
metalc852  metalc ?    ? SC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8070 0 HOH 8362 1_555 ? ? ? ? ? ? ? 2.310 ? ? 
metalc853  metalc ?    ? SC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8070 0 HOH 9588 1_555 ? ? ? ? ? ? ? 2.447 ? ? 
metalc854  metalc ?    ? VC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8073 0 HOH 8363 1_555 ? ? ? ? ? ? ? 2.248 ? ? 
metalc855  metalc ?    ? YC MG  .    MG    ? ? ? 1_555 ZM HOH .    O     ? ? 0 MG  8077 Y HOH 8867 1_555 ? ? ? ? ? ? ? 2.720 ? ? 
metalc856  metalc ?    ? BD MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8080 0 HOH 8426 1_555 ? ? ? ? ? ? ? 2.460 ? ? 
metalc857  metalc ?    ? BD MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8080 0 HOH 9752 1_555 ? ? ? ? ? ? ? 2.504 ? ? 
metalc858  metalc ?    ? BD MG  .    MG    ? ? ? 1_555 DN HOH .    O     ? ? 0 MG  8080 3 HOH 8950 1_555 ? ? ? ? ? ? ? 2.530 ? ? 
metalc859  metalc ?    ? CD MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8081 0 HOH 8419 1_555 ? ? ? ? ? ? ? 2.400 ? ? 
metalc860  metalc ?    ? ED MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8083 0 HOH 8381 1_555 ? ? ? ? ? ? ? 2.325 ? ? 
metalc861  metalc ?    ? ED MG  .    MG    ? ? ? 1_555 QM HOH .    O     ? ? 0 MG  8083 P HOH 185  1_555 ? ? ? ? ? ? ? 2.260 ? ? 
metalc862  metalc ?    ? FD MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8084 0 HOH 8390 1_555 ? ? ? ? ? ? ? 2.178 ? ? 
metalc863  metalc ?    ? FD MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8084 0 HOH 8391 1_555 ? ? ? ? ? ? ? 2.083 ? ? 
metalc864  metalc ?    ? FD MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8084 0 HOH 8392 1_555 ? ? ? ? ? ? ? 1.926 ? ? 
metalc865  metalc ?    ? FD MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8084 0 HOH 8393 1_555 ? ? ? ? ? ? ? 2.188 ? ? 
metalc866  metalc ?    ? GD MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8085 0 HOH 8395 1_555 ? ? ? ? ? ? ? 2.092 ? ? 
metalc867  metalc ?    ? GD MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8085 0 HOH 8396 1_555 ? ? ? ? ? ? ? 2.081 ? ? 
metalc868  metalc ?    ? GD MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8085 0 HOH 8397 1_555 ? ? ? ? ? ? ? 2.480 ? ? 
metalc869  metalc ?    ? ID MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8088 0 HOH 9626 1_555 ? ? ? ? ? ? ? 2.415 ? ? 
metalc870  metalc ?    ? ID MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8088 0 HOH 9828 1_555 ? ? ? ? ? ? ? 2.244 ? ? 
metalc871  metalc ?    ? KD MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8090 0 HOH 9848 1_555 ? ? ? ? ? ? ? 2.466 ? ? 
metalc872  metalc ?    ? KD MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8090 0 HOH 9951 1_555 ? ? ? ? ? ? ? 2.248 ? ? 
metalc873  metalc ?    ? LD MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? 0 MG  8091 A HOH 9019 1_555 ? ? ? ? ? ? ? 2.586 ? ? 
metalc874  metalc ?    ? LD MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? 0 MG  8091 A HOH 9094 1_555 ? ? ? ? ? ? ? 2.948 ? ? 
metalc875  metalc ?    ? MD MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? 0 MG  8092 A HOH 9019 1_555 ? ? ? ? ? ? ? 2.420 ? ? 
metalc876  metalc ?    ? ND MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8093 0 HOH 9725 1_555 ? ? ? ? ? ? ? 2.555 ? ? 
metalc877  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HI SR  .    SR    ? ? 0 HOH 8126 0 SR  8954 1_555 ? ? ? ? ? ? ? 2.373 ? ? 
metalc878  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ZI SR  .    SR    ? ? 0 HOH 8130 0 SR  8974 1_555 ? ? ? ? ? ? ? 2.682 ? ? 
metalc879  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HE NA  .    NA    ? ? 0 HOH 8186 0 NA  8521 1_555 ? ? ? ? ? ? ? 2.791 ? ? 
metalc880  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 CG NA  .    NA    ? ? 0 HOH 8205 0 NA  8574 1_555 ? ? ? ? ? ? ? 2.642 ? ? 
metalc881  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 BE NA  .    NA    ? ? 0 HOH 8209 0 NA  8514 1_555 ? ? ? ? ? ? ? 2.975 ? ? 
metalc882  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RE NA  .    NA    ? ? 0 HOH 8212 0 NA  8531 1_555 ? ? ? ? ? ? ? 2.393 ? ? 
metalc883  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 OK MG  .    MG    ? ? 0 HOH 8236 B MG  8042 1_555 ? ? ? ? ? ? ? 2.017 ? ? 
metalc884  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NJ SR  .    SR    ? ? 0 HOH 8266 0 SR  8991 1_555 ? ? ? ? ? ? ? 2.620 ? ? 
metalc885  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 CH SR  .    SR    ? ? 0 HOH 8296 0 SR  8918 1_555 ? ? ? ? ? ? ? 2.297 ? ? 
metalc886  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RD NA  .    NA    ? ? 0 HOH 8307 0 NA  8502 1_555 ? ? ? ? ? ? ? 2.899 ? ? 
metalc887  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 CH SR  .    SR    ? ? 0 HOH 8315 0 SR  8918 1_555 ? ? ? ? ? ? ? 2.754 ? ? 
metalc888  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 PH SR  .    SR    ? ? 0 HOH 8317 0 SR  8934 1_555 ? ? ? ? ? ? ? 2.596 ? ? 
metalc889  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 DI SR  .    SR    ? ? 0 HOH 8318 0 SR  8948 1_555 ? ? ? ? ? ? ? 2.790 ? ? 
metalc890  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AI SR  .    SR    ? ? 0 HOH 8319 0 SR  8945 1_555 ? ? ? ? ? ? ? 2.740 ? ? 
metalc891  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AI SR  .    SR    ? ? 0 HOH 8320 0 SR  8945 1_555 ? ? ? ? ? ? ? 2.735 ? ? 
metalc892  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RI SR  .    SR    ? ? 0 HOH 8348 0 SR  8965 1_555 ? ? ? ? ? ? ? 2.509 ? ? 
metalc893  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 OH SR  .    SR    ? ? 0 HOH 8360 0 SR  8933 1_555 ? ? ? ? ? ? ? 2.539 ? ? 
metalc894  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RH SR  .    SR    ? ? 0 HOH 8369 0 SR  8936 1_555 ? ? ? ? ? ? ? 2.775 ? ? 
metalc895  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AI SR  .    SR    ? ? 0 HOH 8375 0 SR  8945 1_555 ? ? ? ? ? ? ? 2.459 ? ? 
metalc896  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AI SR  .    SR    ? ? 0 HOH 8376 0 SR  8945 1_555 ? ? ? ? ? ? ? 2.799 ? ? 
metalc897  metalc ?    ? PD K   .    K     ? ? ? 1_555 ZL HOH .    O     ? ? 0 K   8402 0 HOH 9513 1_555 ? ? ? ? ? ? ? 2.753 ? ? 
metalc898  metalc ?    ? PD K   .    K     ? ? ? 1_555 ZL HOH .    O     ? ? 0 K   8402 0 HOH 9608 1_555 ? ? ? ? ? ? ? 2.845 ? ? 
metalc899  metalc ?    ? PD K   .    K     ? ? ? 1_555 ZL HOH .    O     ? ? 0 K   8402 0 HOH 9644 1_555 ? ? ? ? ? ? ? 3.139 ? ? 
metalc900  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YL SR  .    SR    ? ? 0 HOH 8411 3 SR  8932 1_555 ? ? ? ? ? ? ? 2.732 ? ? 
metalc901  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YL SR  .    SR    ? ? 0 HOH 8412 3 SR  8932 1_555 ? ? ? ? ? ? ? 2.603 ? ? 
metalc902  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MK SR  .    SR    ? ? 0 HOH 8420 A SR  8930 1_555 ? ? ? ? ? ? ? 2.617 ? ? 
metalc903  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 VE NA  .    NA    ? ? 0 HOH 8422 0 NA  8536 1_555 ? ? ? ? ? ? ? 2.878 ? ? 
metalc904  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 JI SR  .    SR    ? ? 0 HOH 8422 0 SR  8956 1_555 ? ? ? ? ? ? ? 2.438 ? ? 
metalc905  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 XH SR  .    SR    ? ? 0 HOH 8425 0 SR  8942 1_555 ? ? ? ? ? ? ? 2.523 ? ? 
metalc906  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 PE NA  .    NA    ? ? 0 HOH 8429 0 NA  8529 1_555 ? ? ? ? ? ? ? 2.761 ? ? 
metalc907  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 SG SR  .    SR    ? ? 0 HOH 8431 0 SR  8906 1_555 ? ? ? ? ? ? ? 2.754 ? ? 
metalc908  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 QG SR  .    SR    ? ? 0 HOH 8432 0 SR  8904 1_555 ? ? ? ? ? ? ? 2.545 ? ? 
metalc909  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 JI SR  .    SR    ? ? 0 HOH 8434 0 SR  8956 1_555 ? ? ? ? ? ? ? 2.570 ? ? 
metalc910  metalc ?    ? TD NA  .    NA    ? ? ? 1_555 ZL HOH .    O     ? ? 0 NA  8505 0 HOH 9624 1_555 ? ? ? ? ? ? ? 2.988 ? ? 
metalc911  metalc ?    ? ZD NA  .    NA    ? ? ? 1_555 ZL HOH .    O     ? ? 0 NA  8512 0 HOH 9829 1_555 ? ? ? ? ? ? ? 2.438 ? ? 
metalc912  metalc ?    ? CE NA  .    NA    ? ? ? 1_555 ZL HOH .    O     ? ? 0 NA  8515 0 HOH 9775 1_555 ? ? ? ? ? ? ? 2.521 ? ? 
metalc913  metalc ?    ? CE NA  .    NA    ? ? ? 1_555 DA TRP 43   O     ? ? 0 NA  8515 2 TRP 42   1_555 ? ? ? ? ? ? ? 2.557 ? ? 
metalc914  metalc ?    ? CE NA  .    NA    ? ? ? 1_555 DA ASN 46   O     ? ? 0 NA  8515 2 ASN 45   1_555 ? ? ? ? ? ? ? 2.926 ? ? 
metalc915  metalc ?    ? CE NA  .    NA    ? ? ? 1_555 CN HOH .    O     ? ? 0 NA  8515 2 HOH 4135 1_555 ? ? ? ? ? ? ? 2.533 ? ? 
metalc916  metalc ?    ? DE NA  .    NA    ? ? ? 1_555 ZL HOH .    O     ? ? 0 NA  8516 0 HOH 9711 1_555 ? ? ? ? ? ? ? 2.814 ? ? 
metalc917  metalc ?    ? GE NA  .    NA    ? ? ? 1_555 ZL HOH .    O     ? ? 0 NA  8520 0 HOH 9994 1_555 ? ? ? ? ? ? ? 2.905 ? ? 
metalc918  metalc ?    ? JE NA  .    NA    ? ? ? 1_555 ZL HOH .    O     ? ? 0 NA  8523 0 HOH 9535 1_555 ? ? ? ? ? ? ? 2.471 ? ? 
metalc919  metalc ?    ? ME NA  .    NA    ? ? ? 1_555 ZL HOH .    O     ? ? 0 NA  8526 0 HOH 9735 1_555 ? ? ? ? ? ? ? 2.622 ? ? 
metalc920  metalc ?    ? NE NA  .    NA    ? ? ? 1_555 ZL HOH .    O     ? ? 0 NA  8527 0 HOH 9798 1_555 ? ? ? ? ? ? ? 2.735 ? ? 
metalc921  metalc ?    ? SE NA  .    NA    ? ? ? 1_555 T  VAL 73   O     ? ? 0 NA  8533 R VAL 72   1_555 ? ? ? ? ? ? ? 2.374 ? ? 
metalc922  metalc ?    ? SE NA  .    NA    ? ? ? 1_555 T  TRP 76   O     ? ? 0 NA  8533 R TRP 75   1_555 ? ? ? ? ? ? ? 2.367 ? ? 
metalc923  metalc ?    ? SE NA  .    NA    ? ? ? 1_555 SM HOH .    O     ? ? 0 NA  8533 R HOH 8919 1_555 ? ? ? ? ? ? ? 2.413 ? ? 
metalc924  metalc ?    ? SE NA  .    NA    ? ? ? 1_555 SM HOH .    O     ? ? 0 NA  8533 R HOH 8930 1_555 ? ? ? ? ? ? ? 2.370 ? ? 
metalc925  metalc ?    ? WE NA  .    NA    ? ? ? 1_555 V  SER 95   OG    ? ? 0 NA  8537 T SER 94   1_555 ? ? ? ? ? ? ? 2.306 ? ? 
metalc926  metalc ?    ? WE NA  .    NA    ? ? ? 1_555 V  ASN 96   OD1   ? ? 0 NA  8537 T ASN 95   1_555 ? ? ? ? ? ? ? 2.599 ? ? 
metalc927  metalc ?    ? WE NA  .    NA    ? ? ? 1_555 UM HOH .    O     ? ? 0 NA  8537 T HOH 1124 1_555 ? ? ? ? ? ? ? 2.751 ? ? 
metalc928  metalc ?    ? ZE NA  .    NA    ? ? ? 1_555 B  U   82   OP1   ? ? 0 NA  8544 9 U   82   1_555 ? ? ? ? ? ? ? 2.870 ? ? 
metalc929  metalc ?    ? EF NA  .    NA    ? ? ? 1_555 ZL HOH .    O     ? ? 0 NA  8549 0 HOH 9985 1_555 ? ? ? ? ? ? ? 2.295 ? ? 
metalc930  metalc ?    ? HF NA  .    NA    ? ? ? 1_555 D  GLN 231  O     ? ? 0 NA  8552 B GLN 230  1_555 ? ? ? ? ? ? ? 2.721 ? ? 
metalc931  metalc ?    ? LF NA  .    NA    ? ? ? 1_555 O  LYS 193  O     ? ? 0 NA  8556 M LYS 193  1_555 ? ? ? ? ? ? ? 2.875 ? ? 
metalc932  metalc ?    ? NF NA  .    NA    ? ? ? 1_555 E  ARG 55   O     ? ? 0 NA  8558 C ARG 55   1_555 ? ? ? ? ? ? ? 2.965 ? ? 
metalc933  metalc ?    ? NF NA  .    NA    ? ? ? 1_555 DM HOH .    O     ? ? 0 NA  8558 C HOH 8588 1_555 ? ? ? ? ? ? ? 2.685 ? ? 
metalc934  metalc ?    ? QF NA  .    NA    ? ? ? 1_555 ZL HOH .    O     ? ? 0 NA  8561 0 HOH 9600 1_555 ? ? ? ? ? ? ? 2.757 ? ? 
metalc935  metalc ?    ? SF NA  .    NA    ? ? ? 1_555 ZL HOH .    O     ? ? 0 NA  8563 0 HOH 9771 1_555 ? ? ? ? ? ? ? 2.854 ? ? 
metalc936  metalc ?    ? XF NA  .    NA    ? ? ? 1_555 N  HIS 19   O     ? ? 0 NA  8568 L HIS 18   1_555 ? ? ? ? ? ? ? 2.867 ? ? 
metalc937  metalc ?    ? XF NA  .    NA    ? ? ? 1_555 MM HOH .    O     ? ? 0 NA  8568 L HOH 8826 1_555 ? ? ? ? ? ? ? 2.363 ? ? 
metalc938  metalc ?    ? XF NA  .    NA    ? ? ? 1_555 MM HOH .    O     ? ? 0 NA  8568 L HOH 8844 1_555 ? ? ? ? ? ? ? 2.754 ? ? 
metalc939  metalc ?    ? ZF NA  .    NA    ? ? ? 1_555 ZL HOH .    O     ? ? 0 NA  8570 0 HOH 9827 1_555 ? ? ? ? ? ? ? 2.557 ? ? 
metalc940  metalc ?    ? OG SR  .    SR    ? ? ? 1_555 ZL HOH .    O     ? ? 0 SR  8902 0 HOH 9861 1_555 ? ? ? ? ? ? ? 2.613 ? ? 
metalc941  metalc ?    ? OG SR  .    SR    ? ? ? 1_555 D  GLN 231  OE1   ? ? 0 SR  8902 B GLN 230  1_555 ? ? ? ? ? ? ? 2.584 ? ? 
metalc942  metalc ?    ? OG SR  .    SR    ? ? ? 1_555 CM HOH .    O     ? ? 0 SR  8902 B HOH 8994 1_555 ? ? ? ? ? ? ? 2.310 ? ? 
metalc943  metalc ?    ? PG SR  .    SR    ? ? ? 1_555 ZL HOH .    O     ? ? 0 SR  8903 0 HOH 9897 1_555 ? ? ? ? ? ? ? 2.652 ? ? 
metalc944  metalc ?    ? QG SR  .    SR    ? ? ? 1_555 ZL HOH .    O     ? ? 0 SR  8904 0 HOH 9931 1_555 ? ? ? ? ? ? ? 2.437 ? ? 
metalc945  metalc ?    ? SG SR  .    SR    ? ? ? 1_555 DM HOH .    O     ? ? 0 SR  8906 C HOH 8547 1_555 ? ? ? ? ? ? ? 2.604 ? ? 
metalc946  metalc ?    ? TG SR  .    SR    ? ? ? 1_555 J  ASP 13   O     ? ? 0 SR  8907 H ASP 13   1_555 ? ? ? ? ? ? ? 2.503 ? ? 
metalc947  metalc ?    ? TG SR  .    SR    ? ? ? 1_555 IM HOH .    O     ? ? 0 SR  8907 H HOH 8991 1_555 ? ? ? ? ? ? ? 2.862 ? ? 
metalc948  metalc ?    ? UG SR  .    SR    ? ? ? 1_555 O  ASP 157  OD2   ? ? 0 SR  8908 M ASP 157  1_555 ? ? ? ? ? ? ? 2.798 ? ? 
metalc949  metalc ?    ? UG SR  .    SR    ? ? ? 1_555 NM HOH .    O     ? ? 0 SR  8908 M HOH 8939 1_555 ? ? ? ? ? ? ? 2.982 ? ? 
metalc950  metalc ?    ? XG SR  .    SR    ? ? ? 1_555 V  ASP 69   OD1   ? ? 0 SR  8911 T ASP 68   1_555 ? ? ? ? ? ? ? 3.201 ? ? 
metalc951  metalc ?    ? XG SR  .    SR    ? ? ? 1_555 V  ASP 69   OD2   ? ? 0 SR  8911 T ASP 68   1_555 ? ? ? ? ? ? ? 2.803 ? ? 
metalc952  metalc ?    ? XG SR  .    SR    ? ? ? 1_555 UM HOH .    O     ? ? 0 SR  8911 T HOH 4403 1_555 ? ? ? ? ? ? ? 2.466 ? ? 
metalc953  metalc ?    ? ZG SR  .    SR    ? ? ? 1_555 DM HOH .    O     ? ? 0 SR  8915 C HOH 8540 1_555 ? ? ? ? ? ? ? 2.925 ? ? 
metalc954  metalc ?    ? GH SR  .    SR    ? ? ? 1_555 ZL HOH .    O     ? ? 0 SR  8922 0 HOH 9702 1_555 ? ? ? ? ? ? ? 2.636 ? ? 
metalc955  metalc ?    ? GH SR  .    SR    ? ? ? 1_555 ZL HOH .    O     ? ? 0 SR  8922 0 HOH 9742 1_555 ? ? ? ? ? ? ? 2.830 ? ? 
metalc956  metalc ?    ? HH SR  .    SR    ? ? ? 1_555 ZL HOH .    O     ? ? 0 SR  8923 0 HOH 9612 1_555 ? ? ? ? ? ? ? 2.688 ? ? 
metalc957  metalc ?    ? PH SR  .    SR    ? ? ? 1_555 BN HOH .    O     ? ? 0 SR  8934 1 HOH 9002 1_555 ? ? ? ? ? ? ? 3.389 ? ? 
metalc958  metalc ?    ? UH SR  .    SR    ? ? ? 1_555 V  ASP 69   OD2   ? ? 0 SR  8939 T ASP 68   1_555 ? ? ? ? ? ? ? 3.277 ? ? 
metalc959  metalc ?    ? UH SR  .    SR    ? ? ? 1_555 UM HOH .    O     ? ? 0 SR  8939 T HOH 4403 1_555 ? ? ? ? ? ? ? 2.926 ? ? 
metalc960  metalc ?    ? VH SR  .    SR    ? ? ? 1_555 ZL HOH .    O     ? ? 0 SR  8940 0 HOH 9558 1_555 ? ? ? ? ? ? ? 3.171 ? ? 
metalc961  metalc ?    ? VH SR  .    SR    ? ? ? 1_555 N  ASP 37   O     ? ? 0 SR  8940 L ASP 36   1_555 ? ? ? ? ? ? ? 2.642 ? ? 
metalc962  metalc ?    ? VH SR  .    SR    ? ? ? 1_555 MM HOH .    O     ? ? 0 SR  8940 L HOH 8831 1_555 ? ? ? ? ? ? ? 3.352 ? ? 
metalc963  metalc ?    ? CI SR  .    SR    ? ? ? 1_555 ZL HOH .    O     ? ? 0 SR  8947 0 HOH 9946 1_555 ? ? ? ? ? ? ? 2.746 ? ? 
metalc964  metalc ?    ? GI SR  .    SR    ? ? ? 1_555 EA ARG 42   O     ? ? 0 SR  8953 3 ARG 42   1_555 ? ? ? ? ? ? ? 2.801 ? ? 
metalc965  metalc ?    ? GI SR  .    SR    ? ? ? 1_555 DN HOH .    O     ? ? 0 SR  8953 3 HOH 8970 1_555 ? ? ? ? ? ? ? 2.753 ? ? 
metalc966  metalc ?    ? KI SR  .    SR    ? ? ? 1_555 CA GLY 41   O     ? ? 0 SR  8957 1 GLY 40   1_555 ? ? ? ? ? ? ? 2.510 ? ? 
metalc967  metalc ?    ? LI SR  .    SR    ? ? ? 1_555 ZL HOH .    O     ? ? 0 SR  8958 0 HOH 9927 1_555 ? ? ? ? ? ? ? 2.332 ? ? 
metalc968  metalc ?    ? UI SR  .    SR    ? ? ? 1_555 B  C   91   O2    ? ? 0 SR  8968 9 C   91   1_555 ? ? ? ? ? ? ? 2.885 ? ? 
metalc969  metalc ?    ? UI SR  .    SR    ? ? ? 1_555 IM HOH .    O     ? ? 0 SR  8968 H HOH 9012 1_555 ? ? ? ? ? ? ? 2.651 ? ? 
metalc970  metalc ?    ? VI SR  .    SR    ? ? ? 1_555 ZL HOH .    O     ? ? 0 SR  8969 0 HOH 9713 1_555 ? ? ? ? ? ? ? 3.059 ? ? 
metalc971  metalc ?    ? VI SR  .    SR    ? ? ? 1_555 N  GLY 15   O     ? ? 0 SR  8969 L GLY 14   1_555 ? ? ? ? ? ? ? 3.097 ? ? 
metalc972  metalc ?    ? VI SR  .    SR    ? ? ? 1_555 MM HOH .    O     ? ? 0 SR  8969 L HOH 8881 1_555 ? ? ? ? ? ? ? 2.489 ? ? 
metalc973  metalc ?    ? CJ SR  .    SR    ? ? ? 1_555 B  C   91   "O3'" ? ? 0 SR  8978 9 C   91   1_555 ? ? ? ? ? ? ? 3.102 ? ? 
metalc974  metalc ?    ? CJ SR  .    SR    ? ? ? 1_555 B  G   92   OP1   ? ? 0 SR  8978 9 G   92   1_555 ? ? ? ? ? ? ? 2.540 ? ? 
metalc975  metalc ?    ? CJ SR  .    SR    ? ? ? 1_555 AM HOH .    O     ? ? 0 SR  8978 9 HOH 9071 1_555 ? ? ? ? ? ? ? 2.834 ? ? 
metalc976  metalc ?    ? IJ SR  .    SR    ? ? ? 1_555 ZL HOH .    O     ? ? 0 SR  8985 0 HOH 9724 1_555 ? ? ? ? ? ? ? 3.330 ? ? 
metalc977  metalc ?    ? JJ SR  .    SR    ? ? ? 1_555 L  GLU 28   OE2   ? ? 0 SR  8986 J GLU 28   1_555 ? ? ? ? ? ? ? 2.735 ? ? 
metalc978  metalc ?    ? VJ SR  .    SR    ? ? ? 1_555 EA ASP 59   O     ? ? 0 SR  8999 3 ASP 59   1_555 ? ? ? ? ? ? ? 2.420 ? ? 
metalc979  metalc ?    ? YJ SR  .    SR    ? ? ? 1_555 AA SER 208  O     ? ? 0 SR  9002 Y SER 207  1_555 ? ? ? ? ? ? ? 3.225 ? ? 
metalc980  metalc ?    ? CK SR  .    SR    ? ? ? 1_555 SM HOH .    O     ? ? 0 SR  9008 R HOH 8959 1_555 ? ? ? ? ? ? ? 2.823 ? ? 
metalc981  metalc ?    ? CK SR  .    SR    ? ? ? 1_555 SM HOH .    O     ? ? 0 SR  9008 R HOH 8960 1_555 ? ? ? ? ? ? ? 2.716 ? ? 
metalc982  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 UL SR  .    SR    ? ? 0 HOH 9666 1 SR  8913 1_555 ? ? ? ? ? ? ? 2.733 ? ? 
metalc983  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 VL SR  .    SR    ? ? 0 HOH 9799 1 SR  8952 1_555 ? ? ? ? ? ? ? 2.813 ? ? 
metalc984  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 WK NA  .    NA    ? ? 0 HOH 9984 J NA  8538 1_555 ? ? ? ? ? ? ? 2.574 ? ? 
metalc985  metalc ?    ? B  C   40   N3    ? ? ? 1_555 EK NA  .    NA    ? ? 9 C   40   9 NA  8543 1_555 ? ? ? ? ? ? ? 2.481 ? ? 
metalc986  metalc ?    ? B  C   40   O2    ? ? ? 1_555 EK NA  .    NA    ? ? 9 C   40   9 NA  8543 1_555 ? ? ? ? ? ? ? 2.994 ? ? 
metalc987  metalc ?    ? B  A   44   OP2   ? ? ? 1_555 HK SR  .    SR    ? ? 9 A   44   9 SR  9003 1_555 ? ? ? ? ? ? ? 2.647 ? ? 
metalc988  metalc ?    ? B  A   56   OP2   ? ? ? 1_555 DK MG  .    MG    ? ? 9 A   56   9 MG  8074 1_555 ? ? ? ? ? ? ? 2.082 ? ? 
metalc989  metalc ?    ? B  A   57   OP2   ? ? ? 1_555 DK MG  .    MG    ? ? 9 A   57   9 MG  8074 1_555 ? ? ? ? ? ? ? 2.410 ? ? 
metalc990  metalc ?    ? B  G   78   O6    ? ? ? 1_555 GK SR  .    SR    ? ? 9 G   78   9 SR  8980 1_555 ? ? ? ? ? ? ? 3.034 ? ? 
metalc991  metalc ?    ? B  G   102  OP2   ? ? ? 1_555 GK SR  .    SR    ? ? 9 G   102  9 SR  8980 1_555 ? ? ? ? ? ? ? 2.725 ? ? 
metalc992  metalc ?    ? DK MG  .    MG    ? ? ? 1_555 AM HOH .    O     ? ? 9 MG  8074 9 HOH 9138 1_555 ? ? ? ? ? ? ? 2.215 ? ? 
metalc993  metalc ?    ? HK SR  .    SR    ? ? ? 1_555 AM HOH .    O     ? ? 9 SR  9003 9 HOH 9032 1_555 ? ? ? ? ? ? ? 3.053 ? ? 
metalc994  metalc ?    ? HK SR  .    SR    ? ? ? 1_555 AM HOH .    O     ? ? 9 SR  9003 9 HOH 9082 1_555 ? ? ? ? ? ? ? 2.670 ? ? 
metalc995  metalc ?    ? HK SR  .    SR    ? ? ? 1_555 AM HOH .    O     ? ? 9 SR  9003 9 HOH 9107 1_555 ? ? ? ? ? ? ? 2.474 ? ? 
metalc996  metalc ?    ? C  ASP 27   OD2   ? ? ? 1_555 MK SR  .    SR    ? ? A ASP 26   A SR  8930 1_555 ? ? ? ? ? ? ? 3.240 ? ? 
metalc997  metalc ?    ? C  LEU 28   N     ? ? ? 1_555 JK MG  .    MG    ? ? A LEU 27   A MG  8051 1_555 ? ? ? ? ? ? ? 1.797 ? ? 
metalc998  metalc ?    ? C  GLU 29   OE1   ? ? ? 1_555 MK SR  .    SR    ? ? A GLU 28   A SR  8930 1_555 ? ? ? ? ? ? ? 2.807 ? ? 
metalc999  metalc ?    ? C  GLU 29   OE1   ? ? ? 1_555 NK SR  .    SR    ? ? A GLU 28   A SR  8977 1_555 ? ? ? ? ? ? ? 3.257 ? ? 
metalc1000 metalc ?    ? C  GLU 29   OE2   ? ? ? 1_555 NK SR  .    SR    ? ? A GLU 28   A SR  8977 1_555 ? ? ? ? ? ? ? 2.882 ? ? 
metalc1001 metalc ?    ? C  ARG 121  NH2   ? ? ? 1_555 JK MG  .    MG    ? ? A ARG 120  A MG  8051 1_555 ? ? ? ? ? ? ? 3.055 ? ? 
metalc1002 metalc ?    ? C  PHE 202  O     ? ? ? 1_555 LK SR  .    SR    ? ? A PHE 201  A SR  8929 1_555 ? ? ? ? ? ? ? 2.628 ? ? 
metalc1003 metalc ?    ? C  GLY 203  O     ? ? ? 1_555 LK SR  .    SR    ? ? A GLY 202  A SR  8929 1_555 ? ? ? ? ? ? ? 2.999 ? ? 
metalc1004 metalc ?    ? C  GLY 204  O     ? ? ? 1_555 LK SR  .    SR    ? ? A GLY 203  A SR  8929 1_555 ? ? ? ? ? ? ? 3.040 ? ? 
metalc1005 metalc ?    ? C  HIS 209  O     ? ? ? 1_555 LK SR  .    SR    ? ? A HIS 208  A SR  8929 1_555 ? ? ? ? ? ? ? 2.988 ? ? 
metalc1006 metalc ?    ? IK MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? A MG  8050 A HOH 8988 1_555 ? ? ? ? ? ? ? 1.995 ? ? 
metalc1007 metalc ?    ? IK MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? A MG  8050 A HOH 9002 1_555 ? ? ? ? ? ? ? 2.680 ? ? 
metalc1008 metalc ?    ? IK MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? A MG  8050 A HOH 9016 1_555 ? ? ? ? ? ? ? 2.488 ? ? 
metalc1009 metalc ?    ? IK MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? A MG  8050 A HOH 9063 1_555 ? ? ? ? ? ? ? 2.237 ? ? 
metalc1010 metalc ?    ? IK MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? A MG  8050 A HOH 9092 1_555 ? ? ? ? ? ? ? 2.307 ? ? 
metalc1011 metalc ?    ? LK SR  .    SR    ? ? ? 1_555 BM HOH .    O     ? ? A SR  8929 A HOH 9022 1_555 ? ? ? ? ? ? ? 3.091 ? ? 
metalc1012 metalc ?    ? LK SR  .    SR    ? ? ? 1_555 BM HOH .    O     ? ? A SR  8929 A HOH 9062 1_555 ? ? ? ? ? ? ? 3.260 ? ? 
metalc1013 metalc ?    ? LK SR  .    SR    ? ? ? 1_555 BM HOH .    O     ? ? A SR  8929 A HOH 9095 1_555 ? ? ? ? ? ? ? 2.999 ? ? 
metalc1014 metalc ?    ? D  ASN 244  OD1   ? ? ? 1_555 QK SR  .    SR    ? ? B ASN 243  B SR  8950 1_555 ? ? ? ? ? ? ? 2.762 ? ? 
metalc1015 metalc ?    ? D  SER 246  OG    ? ? ? 1_555 QK SR  .    SR    ? ? B SER 245  B SR  8950 1_555 ? ? ? ? ? ? ? 2.834 ? ? 
metalc1016 metalc ?    ? D  ARG 311  NH2   ? ? ? 1_555 RK SR  .    SR    ? ? B ARG 310  B SR  8987 1_555 ? ? ? ? ? ? ? 2.357 ? ? 
metalc1017 metalc ?    ? OK MG  .    MG    ? ? ? 1_555 CM HOH .    O     ? ? B MG  8042 B HOH 9021 1_555 ? ? ? ? ? ? ? 2.062 ? ? 
metalc1018 metalc ?    ? OK MG  .    MG    ? ? ? 1_555 CM HOH .    O     ? ? B MG  8042 B HOH 9135 1_555 ? ? ? ? ? ? ? 2.026 ? ? 
metalc1019 metalc ?    ? OK MG  .    MG    ? ? ? 1_555 CM HOH .    O     ? ? B MG  8042 B HOH 9136 1_555 ? ? ? ? ? ? ? 2.388 ? ? 
metalc1020 metalc ?    ? E  ASP 45   OD1   ? ? ? 1_555 SK NA  .    NA    ? ? C ASP 45   C NA  8503 1_555 ? ? ? ? ? ? ? 2.506 ? ? 
metalc1021 metalc ?    ? E  THR 94   O     ? ? ? 1_555 SK NA  .    NA    ? ? C THR 94   C NA  8503 1_555 ? ? ? ? ? ? ? 2.921 ? ? 
metalc1022 metalc ?    ? E  LYS 96   O     ? ? ? 1_555 SK NA  .    NA    ? ? C LYS 96   C NA  8503 1_555 ? ? ? ? ? ? ? 2.642 ? ? 
metalc1023 metalc ?    ? GM HOH .    O     ? ? ? 1_555 TK SR  .    SR    ? ? F HOH 6403 F SR  9005 1_555 ? ? ? ? ? ? ? 3.320 ? ? 
metalc1024 metalc ?    ? J  TYR 157  O     ? ? ? 1_555 VK SR  .    SR    ? ? H TYR 157  H SR  8972 1_555 ? ? ? ? ? ? ? 3.027 ? ? 
metalc1025 metalc ?    ? J  ILE 160  O     ? ? ? 1_555 VK SR  .    SR    ? ? H ILE 160  H SR  8972 1_555 ? ? ? ? ? ? ? 3.006 ? ? 
metalc1026 metalc ?    ? J  THR 161  O     ? ? ? 1_555 VK SR  .    SR    ? ? H THR 161  H SR  8972 1_555 ? ? ? ? ? ? ? 3.326 ? ? 
metalc1027 metalc ?    ? J  PRO 162  O     ? ? ? 1_555 VK SR  .    SR    ? ? H PRO 162  H SR  8972 1_555 ? ? ? ? ? ? ? 2.799 ? ? 
metalc1028 metalc ?    ? L  ARG 60   O     ? ? ? 1_555 WK NA  .    NA    ? ? J ARG 60   J NA  8538 1_555 ? ? ? ? ? ? ? 2.737 ? ? 
metalc1029 metalc ?    ? L  VAL 61   O     ? ? ? 1_555 WK NA  .    NA    ? ? J VAL 61   J NA  8538 1_555 ? ? ? ? ? ? ? 2.669 ? ? 
metalc1030 metalc ?    ? L  ILE 63   O     ? ? ? 1_555 WK NA  .    NA    ? ? J ILE 63   J NA  8538 1_555 ? ? ? ? ? ? ? 2.605 ? ? 
metalc1031 metalc ?    ? L  TYR 69   O     ? ? ? 1_555 WK NA  .    NA    ? ? J TYR 69   J NA  8538 1_555 ? ? ? ? ? ? ? 2.589 ? ? 
metalc1032 metalc ?    ? M  ASN 42   OD1   ? ? ? 1_555 AL MG  .    MG    ? ? K ASN 42   K MG  8054 1_555 ? ? ? ? ? ? ? 2.569 ? ? 
metalc1033 metalc ?    ? LM HOH .    O     ? ? ? 1_555 AL MG  .    MG    ? ? K HOH 2121 K MG  8054 1_555 ? ? ? ? ? ? ? 2.167 ? ? 
metalc1034 metalc ?    ? LM HOH .    O     ? ? ? 1_555 AL MG  .    MG    ? ? K HOH 7871 K MG  8054 1_555 ? ? ? ? ? ? ? 1.928 ? ? 
metalc1035 metalc ?    ? O  SER 106  O     ? ? ? 1_555 CL NA  .    NA    ? ? M SER 106  M NA  8539 1_555 ? ? ? ? ? ? ? 2.612 ? ? 
metalc1036 metalc ?    ? O  SER 106  OG    ? ? ? 1_555 CL NA  .    NA    ? ? M SER 106  M NA  8539 1_555 ? ? ? ? ? ? ? 2.616 ? ? 
metalc1037 metalc ?    ? O  PHE 109  O     ? ? ? 1_555 CL NA  .    NA    ? ? M PHE 109  M NA  8539 1_555 ? ? ? ? ? ? ? 2.732 ? ? 
metalc1038 metalc ?    ? O  LEU 112  O     ? ? ? 1_555 CL NA  .    NA    ? ? M LEU 112  M NA  8539 1_555 ? ? ? ? ? ? ? 2.656 ? ? 
metalc1039 metalc ?    ? CL NA  .    NA    ? ? ? 1_555 NM HOH .    O     ? ? M NA  8539 M HOH 8924 1_555 ? ? ? ? ? ? ? 2.749 ? ? 
metalc1040 metalc ?    ? Q  HIS 41   ND1   ? ? ? 1_555 FL CD  .    CD    ? ? O HIS 40   O CD  8705 1_555 ? ? ? ? ? ? ? 2.427 ? ? 
metalc1041 metalc ?    ? S  ASP 21   O     ? ? ? 1_555 HL NA  .    NA    ? ? Q ASP 20   Q NA  8540 1_555 ? ? ? ? ? ? ? 2.574 ? ? 
metalc1042 metalc ?    ? S  GLY 23   O     ? ? ? 1_555 HL NA  .    NA    ? ? Q GLY 22   Q NA  8540 1_555 ? ? ? ? ? ? ? 2.513 ? ? 
metalc1043 metalc ?    ? S  SER 25   OG    ? ? ? 1_555 HL NA  .    NA    ? ? Q SER 24   Q NA  8540 1_555 ? ? ? ? ? ? ? 2.867 ? ? 
metalc1044 metalc ?    ? S  SER 47   OG    ? ? ? 1_555 HL NA  .    NA    ? ? Q SER 46   Q NA  8540 1_555 ? ? ? ? ? ? ? 2.570 ? ? 
metalc1045 metalc ?    ? RM HOH .    O     ? ? ? 1_555 HL NA  .    NA    ? ? Q HOH 1795 Q NA  8540 1_555 ? ? ? ? ? ? ? 2.442 ? ? 
metalc1046 metalc ?    ? RM HOH .    O     ? ? ? 1_555 HL NA  .    NA    ? ? Q HOH 5427 Q NA  8540 1_555 ? ? ? ? ? ? ? 2.922 ? ? 
metalc1047 metalc ?    ? T  LYS 61   O     ? ? ? 1_555 JL NA  .    NA    ? ? R LYS 60   R NA  8575 1_555 ? ? ? ? ? ? ? 2.618 ? ? 
metalc1048 metalc ?    ? T  GLN 62   O     ? ? ? 1_555 LL SR  .    SR    ? ? R GLN 61   R SR  8912 1_555 ? ? ? ? ? ? ? 2.659 ? ? 
metalc1049 metalc ?    ? T  ASN 64   OD1   ? ? ? 1_555 LL SR  .    SR    ? ? R ASN 63   R SR  8912 1_555 ? ? ? ? ? ? ? 3.043 ? ? 
metalc1050 metalc ?    ? T  SER 71   O     ? ? ? 1_555 IL NA  .    NA    ? ? R SER 70   R NA  8532 1_555 ? ? ? ? ? ? ? 2.523 ? ? 
metalc1051 metalc ?    ? T  VAL 73   O     ? ? ? 1_555 IL NA  .    NA    ? ? R VAL 72   R NA  8532 1_555 ? ? ? ? ? ? ? 2.711 ? ? 
metalc1052 metalc ?    ? IL NA  .    NA    ? ? ? 1_555 SM HOH .    O     ? ? R NA  8532 R HOH 8928 1_555 ? ? ? ? ? ? ? 2.461 ? ? 
metalc1053 metalc ?    ? IL NA  .    NA    ? ? ? 1_555 SM HOH .    O     ? ? R NA  8532 R HOH 8930 1_555 ? ? ? ? ? ? ? 2.693 ? ? 
metalc1054 metalc ?    ? IL NA  .    NA    ? ? ? 1_555 SM HOH .    O     ? ? R NA  8532 R HOH 8964 1_555 ? ? ? ? ? ? ? 2.484 ? ? 
metalc1055 metalc ?    ? JL NA  .    NA    ? ? ? 1_555 LL SR  .    SR    ? ? R NA  8575 R SR  8912 1_555 ? ? ? ? ? ? ? 2.976 ? ? 
metalc1056 metalc ?    ? U  HIS 8    NE2   ? ? ? 1_555 ML NA  .    NA    ? ? S HIS 7    S NA  8510 1_555 ? ? ? ? ? ? ? 2.483 ? ? 
metalc1057 metalc ?    ? U  ASP 60   OD2   ? ? ? 1_555 NL SR  .    SR    ? ? S ASP 59   S SR  8961 1_555 ? ? ? ? ? ? ? 2.801 ? ? 
metalc1058 metalc ?    ? U  ASP 60   OD1   ? ? ? 1_555 NL SR  .    SR    ? ? S ASP 59   S SR  8961 1_555 ? ? ? ? ? ? ? 3.212 ? ? 
metalc1059 metalc ?    ? U  GLU 62   OE2   ? ? ? 1_555 ML NA  .    NA    ? ? S GLU 61   S NA  8510 1_555 ? ? ? ? ? ? ? 2.169 ? ? 
metalc1060 metalc ?    ? U  GLU 62   OE1   ? ? ? 1_555 ML NA  .    NA    ? ? S GLU 61   S NA  8510 1_555 ? ? ? ? ? ? ? 2.562 ? ? 
metalc1061 metalc ?    ? ML NA  .    NA    ? ? ? 1_555 TM HOH .    O     ? ? S NA  8510 S HOH 8973 1_555 ? ? ? ? ? ? ? 2.390 ? ? 
metalc1062 metalc ?    ? V  GLN 38   OE1   ? ? ? 1_555 OL MG  .    MG    ? ? T GLN 37   T MG  8057 1_555 ? ? ? ? ? ? ? 3.066 ? ? 
metalc1063 metalc ?    ? V  LEU 113  O     ? ? ? 1_555 OL MG  .    MG    ? ? T LEU 112  T MG  8057 1_555 ? ? ? ? ? ? ? 2.763 ? ? 
metalc1064 metalc ?    ? V  SER 115  O     ? ? ? 1_555 OL MG  .    MG    ? ? T SER 114  T MG  8057 1_555 ? ? ? ? ? ? ? 2.363 ? ? 
metalc1065 metalc ?    ? V  ASP 118  O     ? ? ? 1_555 OL MG  .    MG    ? ? T ASP 117  T MG  8057 1_555 ? ? ? ? ? ? ? 2.174 ? ? 
metalc1066 metalc ?    ? UM HOH .    O     ? ? ? 1_555 OL MG  .    MG    ? ? T HOH 2868 T MG  8057 1_555 ? ? ? ? ? ? ? 2.460 ? ? 
metalc1067 metalc ?    ? W  CYS 6    SG    ? ? ? 1_555 PL CD  .    CD    ? ? U CYS 6    U CD  8701 1_555 ? ? ? ? ? ? ? 2.471 ? ? 
metalc1068 metalc ?    ? W  CYS 9    SG    ? ? ? 1_555 PL CD  .    CD    ? ? U CYS 9    U CD  8701 1_555 ? ? ? ? ? ? ? 2.487 ? ? 
metalc1069 metalc ?    ? W  CYS 32   SG    ? ? ? 1_555 PL CD  .    CD    ? ? U CYS 32   U CD  8701 1_555 ? ? ? ? ? ? ? 2.469 ? ? 
metalc1070 metalc ?    ? W  CYS 36   SG    ? ? ? 1_555 PL CD  .    CD    ? ? U CYS 36   U CD  8701 1_555 ? ? ? ? ? ? ? 2.507 ? ? 
metalc1071 metalc ?    ? AA HIS 134  O     ? ? ? 1_555 QL MG  .    MG    ? ? Y HIS 133  Y MG  8086 1_555 ? ? ? ? ? ? ? 2.275 ? ? 
metalc1072 metalc ?    ? AA LYS 137  O     ? ? ? 1_555 QL MG  .    MG    ? ? Y LYS 136  Y MG  8086 1_555 ? ? ? ? ? ? ? 2.637 ? ? 
metalc1073 metalc ?    ? AA VAL 140  O     ? ? ? 1_555 QL MG  .    MG    ? ? Y VAL 139  Y MG  8086 1_555 ? ? ? ? ? ? ? 2.437 ? ? 
metalc1074 metalc ?    ? QL MG  .    MG    ? ? ? 1_555 ZM HOH .    O     ? ? Y MG  8086 Y HOH 8859 1_555 ? ? ? ? ? ? ? 2.502 ? ? 
metalc1075 metalc ?    ? QL MG  .    MG    ? ? ? 1_555 ZM HOH .    O     ? ? Y MG  8086 Y HOH 8880 1_555 ? ? ? ? ? ? ? 2.448 ? ? 
metalc1076 metalc ?    ? QL MG  .    MG    ? ? ? 1_555 ZM HOH .    O     ? ? Y MG  8086 Y HOH 8915 1_555 ? ? ? ? ? ? ? 2.610 ? ? 
metalc1077 metalc ?    ? BA CYS 30   SG    ? ? ? 1_555 SL CD  .    CD    ? ? Z CYS 39   Z CD  8703 1_555 ? ? ? ? ? ? ? 2.407 ? ? 
metalc1078 metalc ?    ? BA CYS 33   SG    ? ? ? 1_555 SL CD  .    CD    ? ? Z CYS 42   Z CD  8703 1_555 ? ? ? ? ? ? ? 2.659 ? ? 
metalc1079 metalc ?    ? BA CYS 48   SG    ? ? ? 1_555 SL CD  .    CD    ? ? Z CYS 57   Z CD  8703 1_555 ? ? ? ? ? ? ? 2.473 ? ? 
metalc1080 metalc ?    ? BA CYS 51   SG    ? ? ? 1_555 SL CD  .    CD    ? ? Z CYS 60   Z CD  8703 1_555 ? ? ? ? ? ? ? 2.222 ? ? 
metalc1081 metalc ?    ? CA LYS 11   O     ? ? ? 1_555 UL SR  .    SR    ? ? 1 LYS 10   1 SR  8913 1_555 ? ? ? ? ? ? ? 2.640 ? ? 
metalc1082 metalc ?    ? CA ASN 13   OD1   ? ? ? 1_555 UL SR  .    SR    ? ? 1 ASN 12   1 SR  8913 1_555 ? ? ? ? ? ? ? 2.680 ? ? 
metalc1083 metalc ?    ? CA CYS 20   SG    ? ? ? 1_555 TL CD  .    CD    ? ? 1 CYS 19   1 CD  8702 1_555 ? ? ? ? ? ? ? 2.526 ? ? 
metalc1084 metalc ?    ? CA CYS 23   SG    ? ? ? 1_555 TL CD  .    CD    ? ? 1 CYS 22   1 CD  8702 1_555 ? ? ? ? ? ? ? 2.447 ? ? 
metalc1085 metalc ?    ? CA CYS 35   SG    ? ? ? 1_555 TL CD  .    CD    ? ? 1 CYS 34   1 CD  8702 1_555 ? ? ? ? ? ? ? 2.471 ? ? 
metalc1086 metalc ?    ? CA CYS 38   SG    ? ? ? 1_555 TL CD  .    CD    ? ? 1 CYS 37   1 CD  8702 1_555 ? ? ? ? ? ? ? 2.408 ? ? 
metalc1087 metalc ?    ? CA ASP 48   O     ? ? ? 1_555 VL SR  .    SR    ? ? 1 ASP 47   1 SR  8952 1_555 ? ? ? ? ? ? ? 2.517 ? ? 
metalc1088 metalc ?    ? UL SR  .    SR    ? ? ? 1_555 BN HOH .    O     ? ? 1 SR  8913 1 HOH 8990 1_555 ? ? ? ? ? ? ? 3.077 ? ? 
metalc1089 metalc ?    ? VL SR  .    SR    ? ? ? 1_555 BN HOH .    O     ? ? 1 SR  8952 1 HOH 8976 1_555 ? ? ? ? ? ? ? 3.045 ? ? 
metalc1090 metalc ?    ? EA CYS 11   SG    ? ? ? 1_555 WL CD  .    CD    ? ? 3 CYS 11   3 CD  8704 1_555 ? ? ? ? ? ? ? 2.417 ? ? 
metalc1091 metalc ?    ? EA CYS 14   SG    ? ? ? 1_555 WL CD  .    CD    ? ? 3 CYS 14   3 CD  8704 1_555 ? ? ? ? ? ? ? 2.488 ? ? 
metalc1092 metalc ?    ? EA GLY 45   O     ? ? ? 1_555 YL SR  .    SR    ? ? 3 GLY 45   3 SR  8932 1_555 ? ? ? ? ? ? ? 2.459 ? ? 
metalc1093 metalc ?    ? EA GLY 47   O     ? ? ? 1_555 YL SR  .    SR    ? ? 3 GLY 47   3 SR  8932 1_555 ? ? ? ? ? ? ? 2.739 ? ? 
metalc1094 metalc ?    ? EA ASP 49   OD2   ? ? ? 1_555 YL SR  .    SR    ? ? 3 ASP 49   3 SR  8932 1_555 ? ? ? ? ? ? ? 2.825 ? ? 
metalc1095 metalc ?    ? EA ASP 49   OD1   ? ? ? 1_555 YL SR  .    SR    ? ? 3 ASP 49   3 SR  8932 1_555 ? ? ? ? ? ? ? 2.864 ? ? 
metalc1096 metalc ?    ? EA CYS 71   SG    ? ? ? 1_555 WL CD  .    CD    ? ? 3 CYS 71   3 CD  8704 1_555 ? ? ? ? ? ? ? 2.306 ? ? 
metalc1097 metalc ?    ? EA CYS 74   SG    ? ? ? 1_555 WL CD  .    CD    ? ? 3 CYS 74   3 CD  8704 1_555 ? ? ? ? ? ? ? 2.396 ? ? 
hydrog1    hydrog ?    ? A  U   12   O4    ? ? ? 1_555 A  G   531  N2    ? ? 0 U   12   0 G   531  1_555 ? ? ? ? ? ? 'U-G MISPAIR' 
?     ? ? 
hydrog2    hydrog ?    ? A  G   13   N1    ? ? ? 1_555 A  C   530  N3    ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog3    hydrog ?    ? A  G   13   N2    ? ? ? 1_555 A  C   530  O2    ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog4    hydrog ?    ? A  G   13   O6    ? ? ? 1_555 A  C   530  N4    ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog5    hydrog ?    ? A  C   14   N3    ? ? ? 1_555 A  G   529  N1    ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog6    hydrog ?    ? A  C   14   N4    ? ? ? 1_555 A  G   529  O6    ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog7    hydrog ?    ? A  C   14   O2    ? ? ? 1_555 A  G   529  N2    ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog8    hydrog ?    ? A  C   15   N3    ? ? ? 1_555 A  G   528  N1    ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog9    hydrog ?    ? A  C   15   N4    ? ? ? 1_555 A  G   528  O6    ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog10   hydrog ?    ? A  C   15   O2    ? ? ? 1_555 A  G   528  N2    ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog11   hydrog ?    ? A  A   16   N1    ? ? ? 1_555 A  U   527  N3    ? ? 0 A   16   0 U   527  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog12   hydrog ?    ? A  A   16   N6    ? ? ? 1_555 A  U   527  O4    ? ? 0 A   16   0 U   527  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog13   hydrog ?    ? A  G   17   N1    ? ? ? 1_555 A  U   526  O2    ? ? 0 G   17   0 U   526  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog14   hydrog ?    ? A  G   17   O6    ? ? ? 1_555 A  U   526  N3    ? ? 0 G   17   0 U   526  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog15   hydrog ?    ? A  C   18   N3    ? ? ? 1_555 A  G   525  N1    ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog16   hydrog ?    ? A  C   18   N4    ? ? ? 1_555 A  G   525  O6    ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog17   hydrog ?    ? A  C   18   O2    ? ? ? 1_555 A  G   525  N2    ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog18   hydrog ?    ? A  U   19   N3    ? ? ? 1_555 A  A   524  N1    ? ? 0 U   19   0 A   524  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog19   hydrog ?    ? A  U   19   O4    ? ? ? 1_555 A  A   524  N6    ? ? 0 U   19   0 A   524  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog20   hydrog ?    ? A  G   20   N1    ? ? ? 1_555 A  C   523  N3    ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog21   hydrog ?    ? A  G   20   N2    ? ? ? 1_555 A  C   523  O2    ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog22   hydrog ?    ? A  G   20   O6    ? ? ? 1_555 A  C   523  N4    ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog23   hydrog ?    ? A  G   21   N1    ? ? ? 1_555 A  U   522  O2    ? ? 0 G   21   0 U   522  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog24   hydrog ?    ? A  G   21   O6    ? ? ? 1_555 A  U   522  N3    ? ? 0 G   21   0 U   522  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog25   hydrog ?    ? A  U   22   O2    ? ? ? 1_555 A  A   521  N6    ? ? 0 U   22   0 A   521  1_555 ? ? ? ? ? ? 'U-A PAIR' ? 
? ? 
hydrog26   hydrog ?    ? A  G   23   N2    ? ? ? 1_555 A  A   520  N7    ? ? 0 G   23   0 A   520  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog27   hydrog ?    ? A  G   23   N3    ? ? ? 1_555 A  A   520  N6    ? ? 0 G   23   0 A   520  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog28   hydrog ?    ? A  G   24   N2    ? ? ? 1_555 A  A   519  N7    ? ? 0 G   24   0 A   519  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog29   hydrog ?    ? A  G   24   N3    ? ? ? 1_555 A  A   519  N6    ? ? 0 G   24   0 A   519  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog30   hydrog ?    ? A  A   25   N6    ? ? ? 1_555 A  G   518  N3    ? ? 0 A   25   0 G   518  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog31   hydrog ?    ? A  A   25   N7    ? ? ? 1_555 A  G   518  N2    ? ? 0 A   25   0 G   518  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog32   hydrog ?    ? A  U   26   N3    ? ? ? 1_555 A  U   517  O2    ? ? 0 U   26   0 U   517  1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog33   hydrog ?    ? A  U   26   O4    ? ? ? 1_555 A  U   517  N3    ? ? 0 U   26   0 U   517  1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog34   hydrog ?    ? A  U   27   N3    ? ? ? 1_555 A  A   516  N1    ? ? 0 U   27   0 A   516  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog35   hydrog ?    ? A  U   27   O4    ? ? ? 1_555 A  A   516  N6    ? ? 0 U   27   0 A   516  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog36   hydrog ?    ? A  G   28   N1    ? ? ? 1_555 A  C   480  N3    ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog37   hydrog ?    ? A  G   28   N2    ? ? ? 1_555 A  C   480  O2    ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog38   hydrog ?    ? A  G   28   O6    ? ? ? 1_555 A  C   480  N4    ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog39   hydrog ?    ? A  C   29   N3    ? ? ? 1_555 A  G   479  N1    ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog40   hydrog ?    ? A  C   29   N4    ? ? ? 1_555 A  G   479  O6    ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog41   hydrog ?    ? A  C   29   O2    ? ? ? 1_555 A  G   479  N2    ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog42   hydrog ?    ? A  U   30   N3    ? ? ? 1_555 A  A   453  N7    ? ? 0 U   30   0 A   453  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog43   hydrog ?    ? A  U   30   O2    ? ? ? 1_555 A  A   453  N6    ? ? 0 U   30   0 A   453  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog44   hydrog ?    ? A  G   32   N1    ? ? ? 1_555 A  C   451  N3    ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog45   hydrog ?    ? A  G   32   N2    ? ? ? 1_555 A  C   451  O2    ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog46   hydrog ?    ? A  G   32   O6    ? ? ? 1_555 A  C   451  N4    ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog47   hydrog ?    ? A  G   32   N2    ? ? ? 1_555 A  A   455  N1    ? ? 0 G   32   0 A   455  1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog48   hydrog ?    ? A  G   32   N2    ? ? ? 1_555 A  G   456  N3    ? ? 0 G   32   0 G   456  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? 
? ? 
hydrog49   hydrog ?    ? A  G   32   N3    ? ? ? 1_555 A  G   456  N2    ? ? 0 G   32   0 G   456  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? 
? ? 
hydrog50   hydrog ?    ? A  G   33   N1    ? ? ? 1_555 A  C   450  N3    ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog51   hydrog ?    ? A  G   33   N2    ? ? ? 1_555 A  C   450  O2    ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog52   hydrog ?    ? A  G   33   O6    ? ? ? 1_555 A  C   450  N4    ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog53   hydrog ?    ? A  C   34   N3    ? ? ? 1_555 A  G   448  N1    ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog54   hydrog ?    ? A  C   34   N4    ? ? ? 1_555 A  G   448  O6    ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog55   hydrog ?    ? A  C   34   O2    ? ? ? 1_555 A  G   448  N2    ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog56   hydrog ?    ? A  U   35   N3    ? ? ? 1_555 A  A   447  N1    ? ? 0 U   35   0 A   447  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog57   hydrog ?    ? A  U   35   O4    ? ? ? 1_555 A  A   447  N6    ? ? 0 U   35   0 A   447  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog58   hydrog ?    ? A  C   36   N3    ? ? ? 1_555 A  G   446  N1    ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog59   hydrog ?    ? A  C   36   N4    ? ? ? 1_555 A  G   446  O6    ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog60   hydrog ?    ? A  C   36   O2    ? ? ? 1_555 A  G   446  N2    ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog61   hydrog ?    ? A  C   36   O2    ? ? ? 1_555 A  A   674  N6    ? ? 0 C   36   0 A   674  1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog62   hydrog ?    ? A  A   37   N1    ? ? ? 1_555 A  U   445  N3    ? ? 0 A   37   0 U   445  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog63   hydrog ?    ? A  A   37   N6    ? ? ? 1_555 A  U   445  O4    ? ? 0 A   37   0 U   445  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog64   hydrog ?    ? A  G   38   N1    ? ? ? 1_555 A  C   444  N3    ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog65   hydrog ?    ? A  G   38   N2    ? ? ? 1_555 A  C   444  O2    ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog66   hydrog ?    ? A  G   38   O6    ? ? ? 1_555 A  C   444  N4    ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog67   hydrog ?    ? A  G   39   N1    ? ? ? 1_555 A  C   443  N3    ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog68   hydrog ?    ? A  G   39   N2    ? ? ? 1_555 A  C   443  O2    ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog69   hydrog ?    ? A  G   39   O6    ? ? ? 1_555 A  C   443  N4    ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog70   hydrog ?    ? A  C   40   N4    ? ? ? 1_555 A  A   441  N1    ? ? 0 C   40   0 A   441  1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog71   hydrog ?    ? A  C   40   O2    ? ? ? 1_555 A  A   442  N6    ? ? 0 C   40   0 A   442  1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog72   hydrog ?    ? A  G   41   N2    ? ? ? 1_555 A  A   151  N1    ? ? 0 G   41   0 A   151  1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog73   hydrog ?    ? A  G   41   N1    ? ? ? 1_555 A  C   440  N3    ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog74   hydrog ?    ? A  G   41   N2    ? ? ? 1_555 A  C   440  O2    ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog75   hydrog ?    ? A  G   41   O6    ? ? ? 1_555 A  C   440  N4    ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog76   hydrog ?    ? A  C   42   N3    ? ? ? 1_555 A  G   149  N1    ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog77   hydrog ?    ? A  C   42   N4    ? ? ? 1_555 A  G   149  O6    ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog78   hydrog ?    ? A  C   42   O2    ? ? ? 1_555 A  G   149  N2    ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog79   hydrog ?    ? A  U   43   N3    ? ? ? 1_555 A  A   148  N1    ? ? 0 U   43   0 A   148  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog80   hydrog ?    ? A  U   43   O4    ? ? ? 1_555 A  A   148  N6    ? ? 0 U   43   0 A   148  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog81   hydrog ?    ? A  G   44   N2    ? ? ? 1_555 A  A   45   N1    ? ? 0 G   44   0 A   45   1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog82   hydrog ?    ? A  A   45   N6    ? ? ? 1_555 A  U   115  O4    ? ? 0 A   45   0 U   115  1_555 ? ? ? ? ? ? HOOGSTEEN ? ? 
? 
hydrog83   hydrog ?    ? A  A   45   N7    ? ? ? 1_555 A  U   115  N3    ? ? 0 A   45   0 U   115  1_555 ? ? ? ? ? ? HOOGSTEEN ? ? 
? 
hydrog84   hydrog ?    ? A  G   47   N2    ? ? ? 1_555 A  A   113  N7    ? ? 0 G   47   0 A   113  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog85   hydrog ?    ? A  G   47   N3    ? ? ? 1_555 A  A   113  N6    ? ? 0 G   47   0 A   113  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog86   hydrog ?    ? A  A   48   N6    ? ? ? 1_555 A  A   114  N7    ? ? 0 A   48   0 A   114  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog87   hydrog ?    ? A  A   48   N7    ? ? ? 1_555 A  A   114  N6    ? ? 0 A   48   0 A   114  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog88   hydrog ?    ? A  A   49   N6    ? ? ? 1_555 A  G   112  N3    ? ? 0 A   49   0 G   112  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog89   hydrog ?    ? A  A   49   N7    ? ? ? 1_555 A  G   112  N2    ? ? 0 A   49   0 G   112  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog90   hydrog ?    ? A  G   50   N1    ? ? ? 1_555 A  C   111  N3    ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog91   hydrog ?    ? A  G   50   N2    ? ? ? 1_555 A  C   111  O2    ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog92   hydrog ?    ? A  G   50   O6    ? ? ? 1_555 A  C   111  N4    ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog93   hydrog ?    ? A  G   51   N1    ? ? ? 1_555 A  C   110  N3    ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog94   hydrog ?    ? A  G   51   N2    ? ? ? 1_555 A  C   110  O2    ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog95   hydrog ?    ? A  G   51   O6    ? ? ? 1_555 A  C   110  N4    ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog96   hydrog ?    ? A  G   51   N2    ? ? ? 1_555 A  U   121  O2    ? ? 0 G   51   0 U   121  1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog97   hydrog ?    ? A  A   52   N1    ? ? ? 1_555 A  U   109  N3    ? ? 0 A   52   0 U   109  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog98   hydrog ?    ? A  A   52   N6    ? ? ? 1_555 A  U   109  O4    ? ? 0 A   52   0 U   109  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog99   hydrog ?    ? A  C   53   N3    ? ? ? 1_555 A  G   66   N1    ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog100  hydrog ?    ? A  C   53   N4    ? ? ? 1_555 A  G   66   O6    ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog101  hydrog ?    ? A  C   53   O2    ? ? ? 1_555 A  G   66   N2    ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog102  hydrog ?    ? A  G   54   N1    ? ? ? 1_555 A  C   65   N3    ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog103  hydrog ?    ? A  G   54   N2    ? ? ? 1_555 A  C   65   O2    ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog104  hydrog ?    ? A  G   54   O6    ? ? ? 1_555 A  C   65   N4    ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog105  hydrog ?    ? A  G   54   N2    ? ? ? 1_555 A  A   69   N3    ? ? 0 G   54   0 A   69   1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog106  hydrog ?    ? A  U   55   N3    ? ? ? 1_555 A  G   64   O6    ? ? 0 U   55   0 G   64   1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog107  hydrog ?    ? A  U   55   O2    ? ? ? 1_555 A  G   64   N1    ? ? 0 U   55   0 G   64   1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog108  hydrog ?    ? A  G   56   O6    ? ? ? 1_555 A  C   62   N4    ? ? 0 G   56   0 C   62   1_555 ? ? ? ? ? ? 'G-C PAIR' ? 
? ? 
hydrog109  hydrog ?    ? A  G   56   N1    ? ? ? 1_555 A  G   84   O6    ? ? 0 G   56   0 G   84   1_555 ? ? ? ? ? ? TYPE_6_PAIR ? 
? ? 
hydrog110  hydrog ?    ? A  G   56   N2    ? ? ? 1_555 A  G   84   N7    ? ? 0 G   56   0 G   84   1_555 ? ? ? ? ? ? TYPE_6_PAIR ? 
? ? 
hydrog111  hydrog ?    ? A  C   57   N3    ? ? ? 1_555 A  G   89   N1    ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog112  hydrog ?    ? A  C   57   N4    ? ? ? 1_555 A  G   89   O6    ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog113  hydrog ?    ? A  C   57   O2    ? ? ? 1_555 A  G   89   N2    ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog114  hydrog ?    ? A  C   58   N3    ? ? ? 1_555 A  G   88   N1    ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog115  hydrog ?    ? A  C   58   N4    ? ? ? 1_555 A  G   88   O6    ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog116  hydrog ?    ? A  C   58   O2    ? ? ? 1_555 A  G   88   N2    ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog117  hydrog ?    ? A  A   59   N3    ? ? ? 1_555 A  A   60   N6    ? ? 0 A   59   0 A   60   1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog118  hydrog ?    ? A  A   59   N1    ? ? ? 1_555 A  C   85   N4    ? ? 0 A   59   0 C   85   1_555 ? ? ? ? ? ? 'A-C MISPAIR' 
?     ? ? 
hydrog119  hydrog ?    ? A  A   60   N1    ? ? ? 1_555 A  A   86   N6    ? ? 0 A   60   0 A   86   1_555 ? ? ? ? ? ? TYPE_1_PAIR ? 
? ? 
hydrog120  hydrog ?    ? A  A   60   N6    ? ? ? 1_555 A  A   86   N1    ? ? 0 A   60   0 A   86   1_555 ? ? ? ? ? ? TYPE_1_PAIR ? 
? ? 
hydrog121  hydrog ?    ? A  G   61   N1    ? ? ? 1_555 A  C   85   N3    ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog122  hydrog ?    ? A  G   61   N2    ? ? ? 1_555 A  C   85   O2    ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog123  hydrog ?    ? A  G   61   O6    ? ? ? 1_555 A  C   85   N4    ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog124  hydrog ?    ? A  C   62   N3    ? ? ? 1_555 A  G   84   N1    ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog125  hydrog ?    ? A  C   62   N4    ? ? ? 1_555 A  G   84   O6    ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog126  hydrog ?    ? A  C   62   O2    ? ? ? 1_555 A  G   84   N2    ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog127  hydrog ?    ? A  U   63   N3    ? ? ? 1_555 A  A   70   N7    ? ? 0 U   63   0 A   70   1_555 ? ? ? ? ? ? HOOGSTEEN ? ? 
? 
hydrog128  hydrog ?    ? A  U   63   O4    ? ? ? 1_555 A  A   70   N6    ? ? 0 U   63   0 A   70   1_555 ? ? ? ? ? ? HOOGSTEEN ? ? 
? 
hydrog129  hydrog ?    ? A  G   66   N2    ? ? ? 1_555 A  A   67   N1    ? ? 0 G   66   0 A   67   1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog130  hydrog ?    ? A  G   71   N1    ? ? ? 1_555 A  A   106  N1    ? ? 0 G   71   0 A   106  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? 
? ? 
hydrog131  hydrog ?    ? A  G   71   O6    ? ? ? 1_555 A  A   106  N6    ? ? 0 G   71   0 A   106  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? 
? ? 
hydrog132  hydrog ?    ? A  G   71   N1    ? ? ? 1_555 A  U   107  O2    ? ? 0 G   71   0 U   107  1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog133  hydrog ?    ? A  C   72   N3    ? ? ? 1_555 A  G   105  N1    ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog134  hydrog ?    ? A  C   72   N4    ? ? ? 1_555 A  G   105  O6    ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog135  hydrog ?    ? A  C   72   O2    ? ? ? 1_555 A  G   105  N2    ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog136  hydrog ?    ? A  U   73   N3    ? ? ? 1_555 A  A   104  N1    ? ? 0 U   73   0 A   104  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog137  hydrog ?    ? A  U   73   O4    ? ? ? 1_555 A  A   104  N6    ? ? 0 U   73   0 A   104  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog138  hydrog ?    ? A  G   74   N1    ? ? ? 1_555 A  C   103  N3    ? ? 0 G   74   0 C   103  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog139  hydrog ?    ? A  G   74   N2    ? ? ? 1_555 A  C   103  O2    ? ? 0 G   74   0 C   103  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog140  hydrog ?    ? A  G   74   O6    ? ? ? 1_555 A  C   103  N4    ? ? 0 G   74   0 C   103  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog141  hydrog ?    ? A  U   75   N3    ? ? ? 1_555 A  A   102  N1    ? ? 0 U   75   0 A   102  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog142  hydrog ?    ? A  U   75   O4    ? ? ? 1_555 A  A   102  N6    ? ? 0 U   75   0 A   102  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog143  hydrog ?    ? A  G   76   N1    ? ? ? 1_555 A  C   101  N3    ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog144  hydrog ?    ? A  G   76   N2    ? ? ? 1_555 A  C   101  O2    ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog145  hydrog ?    ? A  G   76   O6    ? ? ? 1_555 A  C   101  N4    ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog146  hydrog ?    ? A  G   77   N1    ? ? ? 1_555 A  C   100  N3    ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog147  hydrog ?    ? A  G   77   N2    ? ? ? 1_555 A  C   100  O2    ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog148  hydrog ?    ? A  G   77   O6    ? ? ? 1_555 A  C   100  N4    ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog149  hydrog ?    ? A  G   78   N2    ? ? ? 1_555 A  A   99   N7    ? ? 0 G   78   0 A   99   1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog150  hydrog ?    ? A  G   78   N3    ? ? ? 1_555 A  A   99   N6    ? ? 0 G   78   0 A   99   1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog151  hydrog ?    ? A  G   79   N2    ? ? ? 1_555 A  A   98   N7    ? ? 0 G   79   0 A   98   1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog152  hydrog ?    ? A  A   80   N3    ? ? ? 1_555 A  G   94   N2    ? ? 0 A   80   0 G   94   1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog153  hydrog ?    ? A  A   80   N6    ? ? ? 1_555 A  G   97   N3    ? ? 0 A   80   0 G   97   1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog154  hydrog ?    ? A  A   80   N7    ? ? ? 1_555 A  G   97   N2    ? ? 0 A   80   0 G   97   1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog155  hydrog ?    ? A  G   81   N1    ? ? ? 1_555 A  C   93   N3    ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog156  hydrog ?    ? A  G   81   N2    ? ? ? 1_555 A  C   93   O2    ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog157  hydrog ?    ? A  G   81   O6    ? ? ? 1_555 A  C   93   N4    ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog158  hydrog ?    ? A  G   81   N2    ? ? ? 1_555 A  A   98   N3    ? ? 0 G   81   0 A   98   1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog159  hydrog ?    ? A  C   82   N3    ? ? ? 1_555 A  G   92   N1    ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog160  hydrog ?    ? A  C   82   N4    ? ? ? 1_555 A  G   92   O6    ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog161  hydrog ?    ? A  C   82   O2    ? ? ? 1_555 A  G   92   N2    ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog162  hydrog ?    ? A  C   83   N3    ? ? ? 1_555 A  G   91   N1    ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog163  hydrog ?    ? A  C   83   N4    ? ? ? 1_555 A  G   91   O6    ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog164  hydrog ?    ? A  C   83   O2    ? ? ? 1_555 A  G   91   N2    ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog165  hydrog ?    ? A  G   116  N1    ? ? ? 1_555 A  C   124  N3    ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog166  hydrog ?    ? A  G   116  N2    ? ? ? 1_555 A  C   124  O2    ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog167  hydrog ?    ? A  G   116  O6    ? ? ? 1_555 A  C   124  N4    ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog168  hydrog ?    ? A  A   117  N1    ? ? ? 1_555 A  U   123  N3    ? ? 0 A   117  0 U   123  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog169  hydrog ?    ? A  A   117  N6    ? ? ? 1_555 A  U   123  O4    ? ? 0 A   117  0 U   123  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog170  hydrog ?    ? A  G   118  N1    ? ? ? 1_555 A  C   122  N3    ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog171  hydrog ?    ? A  G   118  N2    ? ? ? 1_555 A  C   122  O2    ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog172  hydrog ?    ? A  G   118  O6    ? ? ? 1_555 A  C   122  N4    ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog173  hydrog ?    ? A  U   125  N3    ? ? ? 1_555 A  A   129  N1    ? ? 0 U   125  0 A   129  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog174  hydrog ?    ? A  U   125  O4    ? ? ? 1_555 A  A   129  N6    ? ? 0 U   125  0 A   129  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog175  hydrog ?    ? A  C   130  N4    ? ? ? 1_555 A  A   144  N7    ? ? 0 C   130  0 A   144  1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog176  hydrog ?    ? A  A   131  N6    ? ? ? 1_555 A  G   147  N7    ? ? 0 A   131  0 G   147  1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog177  hydrog ?    ? A  A   132  N1    ? ? ? 1_555 A  U   146  N3    ? ? 0 A   132  0 U   146  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog178  hydrog ?    ? A  A   132  N6    ? ? ? 1_555 A  U   146  O4    ? ? 0 A   132  0 U   146  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog179  hydrog ?    ? A  U   133  N3    ? ? ? 1_555 A  A   145  N1    ? ? 0 U   133  0 A   145  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog180  hydrog ?    ? A  U   133  O4    ? ? ? 1_555 A  A   145  N6    ? ? 0 U   133  0 A   145  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog181  hydrog ?    ? A  U   134  N3    ? ? ? 1_555 A  A   144  N1    ? ? 0 U   134  0 A   144  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog182  hydrog ?    ? A  U   134  O4    ? ? ? 1_555 A  A   144  N6    ? ? 0 U   134  0 A   144  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog183  hydrog ?    ? A  G   135  N1    ? ? ? 1_555 A  C   143  N3    ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog184  hydrog ?    ? A  G   135  N2    ? ? ? 1_555 A  C   143  O2    ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog185  hydrog ?    ? A  G   135  O6    ? ? ? 1_555 A  C   143  N4    ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog186  hydrog ?    ? A  C   136  N3    ? ? ? 1_555 A  G   142  N1    ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog187  hydrog ?    ? A  C   136  N4    ? ? ? 1_555 A  G   142  O6    ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog188  hydrog ?    ? A  C   136  O2    ? ? ? 1_555 A  G   142  N2    ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog189  hydrog ?    ? A  U   137  O2    ? ? ? 1_555 A  G   140  N1    ? ? 0 U   137  0 G   140  1_555 ? ? ? ? ? ? 'U-G MISPAIR' 
?     ? ? 
hydrog190  hydrog ?    ? A  C   141  O2    ? ? ? 1_555 A  C   143  N4    ? ? 0 C   141  0 C   143  1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog191  hydrog ?    ? A  C   141  N3    ? ? ? 1_555 A  A   144  N6    ? ? 0 C   141  0 A   144  1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog192  hydrog ?    ? A  A   152  N1    ? ? ? 1_555 A  G   185  N1    ? ? 0 A   152  0 G   185  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? 
? ? 
hydrog193  hydrog ?    ? A  A   152  N6    ? ? ? 1_555 A  G   185  O6    ? ? 0 A   152  0 G   185  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? 
? ? 
hydrog194  hydrog ?    ? A  C   153  N3    ? ? ? 1_555 A  G   184  N1    ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog195  hydrog ?    ? A  C   153  N4    ? ? ? 1_555 A  G   184  O6    ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog196  hydrog ?    ? A  C   153  O2    ? ? ? 1_555 A  G   184  N2    ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog197  hydrog ?    ? A  C   154  N3    ? ? ? 1_555 A  G   182  N1    ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog198  hydrog ?    ? A  C   154  N4    ? ? ? 1_555 A  G   182  O6    ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog199  hydrog ?    ? A  C   154  O2    ? ? ? 1_555 A  G   182  N2    ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog200  hydrog ?    ? A  C   155  N3    ? ? ? 1_555 A  G   181  N1    ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog201  hydrog ?    ? A  C   155  N4    ? ? ? 1_555 A  G   181  O6    ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog202  hydrog ?    ? A  C   155  O2    ? ? ? 1_555 A  G   181  N2    ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog203  hydrog ?    ? A  C   156  N3    ? ? ? 1_555 A  G   180  N1    ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog204  hydrog ?    ? A  C   156  N4    ? ? ? 1_555 A  G   180  O6    ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog205  hydrog ?    ? A  C   156  O2    ? ? ? 1_555 A  G   180  N2    ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog206  hydrog ?    ? A  G   157  N1    ? ? ? 1_555 A  C   179  N3    ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog207  hydrog ?    ? A  G   157  N2    ? ? ? 1_555 A  C   179  O2    ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog208  hydrog ?    ? A  G   157  O6    ? ? ? 1_555 A  C   179  N4    ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog209  hydrog ?    ? A  G   157  N2    ? ? ? 1_555 A  A   1470 N1    ? ? 0 G   157  0 A   1470 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog210  hydrog ?    ? A  A   158  N1    ? ? ? 1_555 A  U   178  N3    ? ? 0 A   158  0 U   178  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog211  hydrog ?    ? A  A   158  N6    ? ? ? 1_555 A  U   178  O4    ? ? 0 A   158  0 U   178  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog212  hydrog ?    ? A  G   159  N2    ? ? ? 1_555 A  A   177  N7    ? ? 0 G   159  0 A   177  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog213  hydrog ?    ? A  G   159  N3    ? ? ? 1_555 A  A   177  N6    ? ? 0 G   159  0 A   177  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog214  hydrog ?    ? A  G   159  N2    ? ? ? 1_555 A  U   178  O4    ? ? 0 G   159  0 U   178  1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog215  hydrog ?    ? A  A   160  N6    ? ? ? 1_555 A  U   176  O2    ? ? 0 A   160  0 U   176  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog216  hydrog ?    ? A  A   160  N7    ? ? ? 1_555 A  U   176  N3    ? ? 0 A   160  0 U   176  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog217  hydrog ?    ? A  A   161  N6    ? ? ? 1_555 A  A   174  N7    ? ? 0 A   161  0 A   174  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog218  hydrog ?    ? A  A   161  N7    ? ? ? 1_555 A  A   174  N6    ? ? 0 A   161  0 A   174  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog219  hydrog ?    ? A  A   161  N3    ? ? ? 1_555 A  G   892  N2    ? ? 0 A   161  0 G   892  1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog220  hydrog ?    ? A  C   162  N4    ? ? ? 1_555 A  C   173  O2    ? ? 0 C   162  0 C   173  1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog221  hydrog ?    ? A  C   162  O2    ? ? ? 1_555 A  C   893  N4    ? ? 0 C   162  0 C   893  1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog222  hydrog ?    ? A  U   163  N3    ? ? ? 1_555 A  U   172  O2    ? ? 0 U   163  0 U   172  1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog223  hydrog ?    ? A  U   163  O4    ? ? ? 1_555 A  U   172  N3    ? ? 0 U   163  0 U   172  1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog224  hydrog ?    ? A  G   164  N1    ? ? ? 1_555 A  C   171  N3    ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog225  hydrog ?    ? A  G   164  N2    ? ? ? 1_555 A  C   171  O2    ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog226  hydrog ?    ? A  G   164  O6    ? ? ? 1_555 A  C   171  N4    ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog227  hydrog ?    ? A  G   164  N2    ? ? ? 1_555 A  A   222  N3    ? ? 0 G   164  0 A   222  1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog228  hydrog ?    ? A  A   165  N3    ? ? ? 1_555 A  G   221  N2    ? ? 0 A   165  0 G   221  1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog229  hydrog ?    ? A  A   166  N1    ? ? ? 1_555 A  G   924  N2    ? ? 0 A   166  0 G   924  1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog230  hydrog ?    ? A  A   166  N6    ? ? ? 1_555 A  G   924  N3    ? ? 0 A   166  0 G   924  1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog231  hydrog ?    ? A  C   168  N3    ? ? ? 1_555 A  G   219  N1    ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog232  hydrog ?    ? A  C   168  N4    ? ? ? 1_555 A  G   219  O6    ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog233  hydrog ?    ? A  C   168  O2    ? ? ? 1_555 A  G   219  N2    ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog234  hydrog ?    ? A  U   170  N3    ? ? ? 1_555 A  G   221  O6    ? ? 0 U   170  0 G   221  1_555 ? ? ? ? ? ? TYPE_27_PAIR 
?     ? ? 
hydrog235  hydrog ?    ? A  U   170  O4    ? ? ? 1_555 A  G   221  N1    ? ? 0 U   170  0 G   221  1_555 ? ? ? ? ? ? TYPE_27_PAIR 
?     ? ? 
hydrog236  hydrog ?    ? A  C   171  O2    ? ? ? 1_555 A  G   221  N1    ? ? 0 C   171  0 G   221  1_555 ? ? ? ? ? ? 'C-G PAIR' ? 
? ? 
hydrog237  hydrog ?    ? A  G   175  N2    ? ? ? 1_555 A  U   176  O4    ? ? 0 G   175  0 U   176  1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog238  hydrog ?    ? A  G   185  N2    ? ? ? 1_555 A  A   439  N1    ? ? 0 G   185  0 A   439  1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog239  hydrog ?    ? A  G   190  N2    ? ? ? 1_555 A  A   435  N7    ? ? 0 G   190  0 A   435  1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog240  hydrog ?    ? A  A   191  N6    ? ? ? 1_555 A  A   236  N3    ? ? 0 A   191  0 A   236  1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog241  hydrog ?    ? A  A   191  N6    ? ? ? 1_555 A  U   434  O2    ? ? 0 A   191  0 U   434  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog242  hydrog ?    ? A  A   191  N7    ? ? ? 1_555 A  U   434  N3    ? ? 0 A   191  0 U   434  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog243  hydrog ?    ? A  A   192  N6    ? ? ? 1_555 A  G   203  N3    ? ? 0 A   192  0 G   203  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog244  hydrog ?    ? A  A   192  N7    ? ? ? 1_555 A  G   203  N2    ? ? 0 A   192  0 G   203  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog245  hydrog ?    ? A  A   193  N3    ? ? ? 1_555 A  G   413  N2    ? ? 0 A   193  0 G   413  1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog246  hydrog ?    ? A  A   194  N1    ? ? ? 1_555 A  U   202  N3    ? ? 0 A   194  0 U   202  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog247  hydrog ?    ? A  A   194  N6    ? ? ? 1_555 A  U   202  O4    ? ? 0 A   194  0 U   202  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog248  hydrog ?    ? A  C   195  N3    ? ? ? 1_555 A  G   201  N1    ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog249  hydrog ?    ? A  C   195  N4    ? ? ? 1_555 A  G   201  O6    ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog250  hydrog ?    ? A  C   195  O2    ? ? ? 1_555 A  G   201  N2    ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog251  hydrog ?    ? A  G   196  N2    ? ? ? 1_555 A  A   199  N7    ? ? 0 G   196  0 A   199  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog252  hydrog ?    ? A  G   196  N3    ? ? ? 1_555 A  A   199  N6    ? ? 0 G   196  0 A   199  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog253  hydrog ?    ? A  G   196  N1    ? ? ? 1_555 A  U   425  O2    ? ? 0 G   196  0 U   425  1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog254  hydrog ?    ? A  A   198  N1    ? ? ? 1_555 A  G   416  N2    ? ? 0 A   198  0 G   416  1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog255  hydrog ?    ? A  A   198  N6    ? ? ? 1_555 A  G   416  N3    ? ? 0 A   198  0 G   416  1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog256  hydrog ?    ? A  A   204  N1    ? ? ? 1_555 A  A   436  N6    ? ? 0 A   204  0 A   436  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? 
? ? 
hydrog257  hydrog ?    ? A  A   204  N6    ? ? ? 1_555 A  A   436  N1    ? ? 0 A   204  0 A   436  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? 
? ? 
hydrog258  hydrog ?    ? A  U   205  N3    ? ? ? 1_555 A  A   437  N1    ? ? 0 U   205  0 A   437  1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog259  hydrog ?    ? A  U   205  O2    ? ? ? 1_555 A  A   437  N6    ? ? 0 U   205  0 A   437  1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog260  hydrog ?    ? A  G   206  N1    ? ? ? 1_555 A  U   233  O2    ? ? 0 G   206  0 U   233  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog261  hydrog ?    ? A  G   206  O6    ? ? ? 1_555 A  U   233  N3    ? ? 0 G   206  0 U   233  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog262  hydrog ?    ? A  U   207  N3    ? ? ? 1_555 A  A   232  N1    ? ? 0 U   207  0 A   232  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog263  hydrog ?    ? A  U   207  O4    ? ? ? 1_555 A  A   232  N6    ? ? 0 U   207  0 A   232  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog264  hydrog ?    ? A  C   208  N3    ? ? ? 1_555 A  G   231  N1    ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog265  hydrog ?    ? A  C   208  N4    ? ? ? 1_555 A  G   231  O6    ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog266  hydrog ?    ? A  C   208  O2    ? ? ? 1_555 A  G   231  N2    ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog267  hydrog ?    ? A  G   209  N1    ? ? ? 1_555 A  C   230  N3    ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog268  hydrog ?    ? A  G   209  N2    ? ? ? 1_555 A  C   230  O2    ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog269  hydrog ?    ? A  G   209  O6    ? ? ? 1_555 A  C   230  N4    ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog270  hydrog ?    ? A  U   210  N3    ? ? ? 1_555 A  G   229  O6    ? ? 0 U   210  0 G   229  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog271  hydrog ?    ? A  U   210  O2    ? ? ? 1_555 A  G   229  N1    ? ? 0 U   210  0 G   229  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog272  hydrog ?    ? A  U   211  O2    ? ? ? 1_555 A  C   228  N4    ? ? 0 U   211  0 C   228  1_555 ? ? ? ? ? ? 'U-C MISPAIR' 
?     ? ? 
hydrog273  hydrog ?    ? A  A   212  N6    ? ? ? 1_555 A  A   227  N7    ? ? 0 A   212  0 A   227  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog274  hydrog ?    ? A  A   212  N7    ? ? ? 1_555 A  A   227  N6    ? ? 0 A   212  0 A   227  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog275  hydrog ?    ? A  G   213  N2    ? ? ? 1_555 A  U   214  O4    ? ? 0 G   213  0 U   214  1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog276  hydrog ?    ? A  U   214  N3    ? ? ? 1_555 A  A   226  N7    ? ? 0 U   214  0 A   226  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog277  hydrog ?    ? A  U   214  O2    ? ? ? 1_555 A  A   226  N6    ? ? 0 U   214  0 A   226  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog278  hydrog ?    ? A  A   215  N6    ? ? ? 1_555 A  G   225  N3    ? ? 0 A   215  0 G   225  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog279  hydrog ?    ? A  A   215  N7    ? ? ? 1_555 A  G   225  N2    ? ? 0 A   215  0 G   225  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog280  hydrog ?    ? A  A   216  N1    ? ? ? 1_555 A  U   224  N3    ? ? 0 A   216  0 U   224  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog281  hydrog ?    ? A  A   216  N6    ? ? ? 1_555 A  U   224  O4    ? ? 0 A   216  0 U   224  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog282  hydrog ?    ? A  C   217  N3    ? ? ? 1_555 A  G   223  N1    ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog283  hydrog ?    ? A  C   217  N4    ? ? ? 1_555 A  G   223  O6    ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog284  hydrog ?    ? A  C   217  O2    ? ? ? 1_555 A  G   223  N2    ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog285  hydrog ?    ? A  C   218  O2    ? ? ? 1_555 A  A   222  N6    ? ? 0 C   218  0 A   222  1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog286  hydrog ?    ? A  G   231  N2    ? ? ? 1_555 A  A   666  N3    ? ? 0 G   231  0 A   666  1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog287  hydrog ?    ? A  G   237  N1    ? ? ? 1_555 A  C   433  N3    ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog288  hydrog ?    ? A  G   237  N2    ? ? ? 1_555 A  C   433  O2    ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog289  hydrog ?    ? A  G   237  O6    ? ? ? 1_555 A  C   433  N4    ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog290  hydrog ?    ? A  C   238  N3    ? ? ? 1_555 A  G   432  N1    ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog291  hydrog ?    ? A  C   238  N4    ? ? ? 1_555 A  G   432  O6    ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog292  hydrog ?    ? A  C   238  O2    ? ? ? 1_555 A  G   432  N2    ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog293  hydrog ?    ? A  C   239  N3    ? ? ? 1_555 A  G   431  N1    ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog294  hydrog ?    ? A  C   239  N4    ? ? ? 1_555 A  G   431  O6    ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog295  hydrog ?    ? A  C   239  O2    ? ? ? 1_555 A  G   431  N2    ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog296  hydrog ?    ? A  C   240  N3    ? ? ? 1_555 A  G   379  N1    ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog297  hydrog ?    ? A  C   240  N4    ? ? ? 1_555 A  G   379  O6    ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog298  hydrog ?    ? A  C   240  O2    ? ? ? 1_555 A  G   379  N2    ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog299  hydrog ?    ? A  A   241  N6    ? ? ? 1_555 A  U   270  O2    ? ? 0 A   241  0 U   270  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog300  hydrog ?    ? A  A   241  N7    ? ? ? 1_555 A  U   270  N3    ? ? 0 A   241  0 U   270  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog301  hydrog ?    ? A  A   242  N6    ? ? ? 1_555 A  G   269  N3    ? ? 0 A   242  0 G   269  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog302  hydrog ?    ? A  A   242  N7    ? ? ? 1_555 A  G   269  N2    ? ? 0 A   242  0 G   269  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog303  hydrog ?    ? A  A   243  N6    ? ? ? 1_555 A  U   268  O2    ? ? 0 A   243  0 U   268  1_555 ? ? ? ? ? ? 'A-U PAIR' ? 
? ? 
hydrog304  hydrog ?    ? A  A   243  N3    ? ? ? 1_555 A  G   274  N2    ? ? 0 A   243  0 G   274  1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog305  hydrog ?    ? A  C   244  N3    ? ? ? 1_555 A  G   267  N1    ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog306  hydrog ?    ? A  C   244  N4    ? ? ? 1_555 A  G   267  O6    ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog307  hydrog ?    ? A  C   244  O2    ? ? ? 1_555 A  G   267  N2    ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog308  hydrog ?    ? A  C   245  N3    ? ? ? 1_555 A  G   266  N1    ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog309  hydrog ?    ? A  C   245  N4    ? ? ? 1_555 A  G   266  O6    ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog310  hydrog ?    ? A  C   245  O2    ? ? ? 1_555 A  G   266  N2    ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog311  hydrog ?    ? A  G   246  N2    ? ? ? 1_555 A  U   265  O4    ? ? 0 G   246  0 U   265  1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog312  hydrog ?    ? A  A   247  N6    ? ? ? 1_555 A  G   264  N3    ? ? 0 A   247  0 G   264  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog313  hydrog ?    ? A  A   247  N7    ? ? ? 1_555 A  G   264  N2    ? ? 0 A   247  0 G   264  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog314  hydrog ?    ? A  A   248  N1    ? ? ? 1_555 A  U   265  N3    ? ? 0 A   248  0 U   265  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog315  hydrog ?    ? A  A   248  N6    ? ? ? 1_555 A  U   265  O4    ? ? 0 A   248  0 U   265  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog316  hydrog ?    ? A  G   249  N1    ? ? ? 1_555 A  C   260  N3    ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog317  hydrog ?    ? A  G   249  N2    ? ? ? 1_555 A  C   260  O2    ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog318  hydrog ?    ? A  G   249  O6    ? ? ? 1_555 A  C   260  N4    ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog319  hydrog ?    ? A  C   250  N3    ? ? ? 1_555 A  G   259  N1    ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog320  hydrog ?    ? A  C   250  N4    ? ? ? 1_555 A  G   259  O6    ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog321  hydrog ?    ? A  C   250  O2    ? ? ? 1_555 A  G   259  N2    ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog322  hydrog ?    ? A  C   251  N3    ? ? ? 1_555 A  G   258  N1    ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog323  hydrog ?    ? A  C   251  N4    ? ? ? 1_555 A  G   258  O6    ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog324  hydrog ?    ? A  C   251  O2    ? ? ? 1_555 A  G   258  N2    ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog325  hydrog ?    ? A  C   252  N3    ? ? ? 1_555 A  G   257  N1    ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog326  hydrog ?    ? A  C   252  N4    ? ? ? 1_555 A  G   257  O6    ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog327  hydrog ?    ? A  C   252  O2    ? ? ? 1_555 A  G   257  N2    ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog328  hydrog ?    ? A  U   253  O2    ? ? ? 1_555 A  C   256  N4    ? ? 0 U   253  0 C   256  1_555 ? ? ? ? ? ? 'U-C MISPAIR' 
?     ? ? 
hydrog329  hydrog ?    ? A  U   253  N3    ? ? ? 1_555 A  G   257  O6    ? ? 0 U   253  0 G   257  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog330  hydrog ?    ? A  U   253  O2    ? ? ? 1_555 A  G   257  N1    ? ? 0 U   253  0 G   257  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog331  hydrog ?    ? A  C   271  N4    ? ? ? 1_555 A  A   378  N1    ? ? 0 C   271  0 A   378  1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog332  hydrog ?    ? A  G   273  N1    ? ? ? 1_555 A  C   377  N3    ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog333  hydrog ?    ? A  G   273  N2    ? ? ? 1_555 A  C   377  O2    ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog334  hydrog ?    ? A  G   273  O6    ? ? ? 1_555 A  C   377  N4    ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog335  hydrog ?    ? A  G   274  N1    ? ? ? 1_555 A  C   376  N3    ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog336  hydrog ?    ? A  G   274  N2    ? ? ? 1_555 A  C   376  O2    ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog337  hydrog ?    ? A  G   274  O6    ? ? ? 1_555 A  C   376  N4    ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog338  hydrog ?    ? A  G   275  N1    ? ? ? 1_555 A  U   374  O2    ? ? 0 G   275  0 U   374  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog339  hydrog ?    ? A  G   275  O6    ? ? ? 1_555 A  U   374  N3    ? ? 0 G   275  0 U   374  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog340  hydrog ?    ? A  C   276  N3    ? ? ? 1_555 A  G   373  N1    ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog341  hydrog ?    ? A  C   276  N4    ? ? ? 1_555 A  G   373  O6    ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog342  hydrog ?    ? A  C   276  O2    ? ? ? 1_555 A  G   373  N2    ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog343  hydrog ?    ? A  U   277  N3    ? ? ? 1_555 A  A   372  N1    ? ? 0 U   277  0 A   372  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog344  hydrog ?    ? A  U   277  O4    ? ? ? 1_555 A  A   372  N6    ? ? 0 U   277  0 A   372  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog345  hydrog ?    ? A  A   278  N1    ? ? ? 1_555 A  U   371  N3    ? ? 0 A   278  0 U   371  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog346  hydrog ?    ? A  A   278  N6    ? ? ? 1_555 A  U   371  O4    ? ? 0 A   278  0 U   371  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog347  hydrog ?    ? A  C   279  N3    ? ? ? 1_555 A  G   370  N1    ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog348  hydrog ?    ? A  C   279  N4    ? ? ? 1_555 A  G   370  O6    ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog349  hydrog ?    ? A  C   279  O2    ? ? ? 1_555 A  G   370  N2    ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog350  hydrog ?    ? A  C   280  N3    ? ? ? 1_555 A  G   369  N1    ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog351  hydrog ?    ? A  C   280  N4    ? ? ? 1_555 A  G   369  O6    ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog352  hydrog ?    ? A  C   280  O2    ? ? ? 1_555 A  G   369  N2    ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog353  hydrog ?    ? A  U   281  O2    ? ? ? 1_555 A  C   368  N4    ? ? 0 U   281  0 C   368  1_555 ? ? ? ? ? ? 'U-C MISPAIR' 
?     ? ? 
hydrog354  hydrog ?    ? A  C   282  O2    ? ? ? 1_555 A  C   368  N4    ? ? 0 C   282  0 C   368  1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog355  hydrog ?    ? A  A   285  N6    ? ? ? 1_555 A  G   367  N3    ? ? 0 A   285  0 G   367  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog356  hydrog ?    ? A  A   285  N7    ? ? ? 1_555 A  G   367  N2    ? ? 0 A   285  0 G   367  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog357  hydrog ?    ? A  U   286  N3    ? ? ? 1_555 A  U   366  O2    ? ? 0 U   286  0 U   366  1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog358  hydrog ?    ? A  U   286  O4    ? ? ? 1_555 A  U   366  N3    ? ? 0 U   286  0 U   366  1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog359  hydrog ?    ? A  C   287  N3    ? ? ? 1_555 A  G   365  N1    ? ? 0 C   287  0 G   365  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog360  hydrog ?    ? A  C   287  N4    ? ? ? 1_555 A  G   365  O6    ? ? 0 C   287  0 G   365  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog361  hydrog ?    ? A  C   287  O2    ? ? ? 1_555 A  G   365  N2    ? ? 0 C   287  0 G   365  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog362  hydrog ?    ? A  A   288  N1    ? ? ? 1_555 A  U   364  N3    ? ? 0 A   288  0 U   364  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog363  hydrog ?    ? A  A   288  N6    ? ? ? 1_555 A  U   364  O4    ? ? 0 A   288  0 U   364  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog364  hydrog ?    ? A  G   289  N1    ? ? ? 1_555 A  C   363  N3    ? ? 0 G   289  0 C   363  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog365  hydrog ?    ? A  G   289  N2    ? ? ? 1_555 A  C   363  O2    ? ? 0 G   289  0 C   363  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog366  hydrog ?    ? A  G   289  O6    ? ? ? 1_555 A  C   363  N4    ? ? 0 G   289  0 C   363  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog367  hydrog ?    ? A  C   290  N3    ? ? ? 1_555 A  G   362  N1    ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog368  hydrog ?    ? A  C   290  N4    ? ? ? 1_555 A  G   362  O6    ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog369  hydrog ?    ? A  C   290  O2    ? ? ? 1_555 A  G   362  N2    ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog370  hydrog ?    ? A  C   291  N3    ? ? ? 1_555 A  C   361  N4    ? ? 0 C   291  0 C   361  1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog371  hydrog ?    ? A  G   292  N2    ? ? ? 1_555 A  A   360  N7    ? ? 0 G   292  0 A   360  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog372  hydrog ?    ? A  G   292  N3    ? ? ? 1_555 A  A   360  N6    ? ? 0 G   292  0 A   360  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog373  hydrog ?    ? A  A   293  N6    ? ? ? 1_555 A  U   359  O2    ? ? 0 A   293  0 U   359  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog374  hydrog ?    ? A  A   293  N7    ? ? ? 1_555 A  U   359  N3    ? ? 0 A   293  0 U   359  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog375  hydrog ?    ? A  C   295  N4    ? ? ? 1_555 A  C   356  O2    ? ? 0 C   295  0 C   356  1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog376  hydrog ?    ? A  G   296  N1    ? ? ? 1_555 A  C   355  N3    ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog377  hydrog ?    ? A  G   296  N2    ? ? ? 1_555 A  C   355  O2    ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog378  hydrog ?    ? A  G   296  O6    ? ? ? 1_555 A  C   355  N4    ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog379  hydrog ?    ? A  U   297  N3    ? ? ? 1_555 A  A   354  N1    ? ? 0 U   297  0 A   354  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog380  hydrog ?    ? A  U   297  O4    ? ? ? 1_555 A  A   354  N6    ? ? 0 U   297  0 A   354  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog381  hydrog ?    ? A  C   298  N3    ? ? ? 1_555 A  G   353  N1    ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog382  hydrog ?    ? A  C   298  N4    ? ? ? 1_555 A  G   353  O6    ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog383  hydrog ?    ? A  C   298  O2    ? ? ? 1_555 A  G   353  N2    ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog384  hydrog ?    ? A  U   299  N3    ? ? ? 1_555 A  A   352  N1    ? ? 0 U   299  0 A   352  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog385  hydrog ?    ? A  U   299  O4    ? ? ? 1_555 A  A   352  N6    ? ? 0 U   299  0 A   352  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog386  hydrog ?    ? A  U   300  N3    ? ? ? 1_555 A  A   351  N1    ? ? 0 U   300  0 A   351  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog387  hydrog ?    ? A  U   300  O4    ? ? ? 1_555 A  A   351  N6    ? ? 0 U   300  0 A   351  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog388  hydrog ?    ? A  C   301  N3    ? ? ? 1_555 A  G   350  N1    ? ? 0 C   301  0 G   350  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog389  hydrog ?    ? A  C   301  N4    ? ? ? 1_555 A  G   350  O6    ? ? 0 C   301  0 G   350  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog390  hydrog ?    ? A  C   301  O2    ? ? ? 1_555 A  G   350  N2    ? ? 0 C   301  0 G   350  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog391  hydrog ?    ? A  A   302  N1    ? ? ? 1_555 A  U   349  N3    ? ? 0 A   302  0 U   349  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog392  hydrog ?    ? A  A   302  N6    ? ? ? 1_555 A  U   349  O4    ? ? 0 A   302  0 U   349  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog393  hydrog ?    ? A  C   303  N3    ? ? ? 1_555 A  C   348  N4    ? ? 0 C   303  0 C   348  1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog394  hydrog ?    ? A  G   304  N2    ? ? ? 1_555 A  A   347  N7    ? ? 0 G   304  0 A   347  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog395  hydrog ?    ? A  G   304  N3    ? ? ? 1_555 A  A   347  N6    ? ? 0 G   304  0 A   347  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog396  hydrog ?    ? A  A   305  N6    ? ? ? 1_555 A  G   345  O6    ? ? 0 A   305  0 G   345  1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog397  hydrog ?    ? A  A   306  N6    ? ? ? 1_555 A  G   345  O6    ? ? 0 A   306  0 G   345  1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog398  hydrog ?    ? A  G   307  N1    ? ? ? 1_555 A  C   323  N3    ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog399  hydrog ?    ? A  G   307  N2    ? ? ? 1_555 A  C   323  O2    ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog400  hydrog ?    ? A  G   307  O6    ? ? ? 1_555 A  C   323  N4    ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog401  hydrog ?    ? A  U   308  N3    ? ? ? 1_555 A  A   339  N1    ? ? 0 U   308  0 A   339  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog402  hydrog ?    ? A  U   308  O4    ? ? ? 1_555 A  A   339  N6    ? ? 0 U   308  0 A   339  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog403  hydrog ?    ? A  C   309  N3    ? ? ? 1_555 A  G   322  N1    ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog404  hydrog ?    ? A  C   309  N4    ? ? ? 1_555 A  G   322  O6    ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog405  hydrog ?    ? A  C   309  O2    ? ? ? 1_555 A  G   322  N2    ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog406  hydrog ?    ? A  U   310  N3    ? ? ? 1_555 A  A   321  N1    ? ? 0 U   310  0 A   321  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog407  hydrog ?    ? A  U   310  O4    ? ? ? 1_555 A  A   321  N6    ? ? 0 U   310  0 A   321  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog408  hydrog ?    ? A  C   311  N3    ? ? ? 1_555 A  G   320  N1    ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog409  hydrog ?    ? A  C   311  N4    ? ? ? 1_555 A  G   320  O6    ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog410  hydrog ?    ? A  C   311  O2    ? ? ? 1_555 A  G   320  N2    ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog411  hydrog ?    ? A  U   312  N3    ? ? ? 1_555 A  A   319  N1    ? ? 0 U   312  0 A   319  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog412  hydrog ?    ? A  U   312  O4    ? ? ? 1_555 A  A   319  N6    ? ? 0 U   312  0 A   319  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog413  hydrog ?    ? A  U   313  N3    ? ? ? 1_555 A  A   317  N7    ? ? 0 U   313  0 A   317  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog414  hydrog ?    ? A  U   313  O2    ? ? ? 1_555 A  A   317  N6    ? ? 0 U   313  0 A   317  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog415  hydrog ?    ? A  G   314  N2    ? ? ? 1_555 A  A   337  N1    ? ? 0 G   314  0 A   337  1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog416  hydrog ?    ? A  G   314  N3    ? ? ? 1_555 A  A   337  N6    ? ? 0 G   314  0 A   337  1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog417  hydrog ?    ? A  G   315  N2    ? ? ? 1_555 A  G   336  N3    ? ? 0 G   315  0 G   336  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? 
? ? 
hydrog418  hydrog ?    ? A  G   315  N3    ? ? ? 1_555 A  G   336  N2    ? ? 0 G   315  0 G   336  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? 
? ? 
hydrog419  hydrog ?    ? A  A   316  N6    ? ? ? 1_555 A  U   1314 O2    ? ? 0 A   316  0 U   1314 1_555 ? ? ? ? ? ? 'A-U PAIR' ? 
? ? 
hydrog420  hydrog ?    ? A  G   324  N1    ? ? ? 1_555 A  C   341  N3    ? ? 0 G   324  0 C   341  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog421  hydrog ?    ? A  G   324  N2    ? ? ? 1_555 A  C   341  O2    ? ? 0 G   324  0 C   341  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog422  hydrog ?    ? A  G   324  O6    ? ? ? 1_555 A  C   341  N4    ? ? 0 G   324  0 C   341  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog423  hydrog ?    ? A  U   325  N3    ? ? ? 1_555 A  A   340  N1    ? ? 0 U   325  0 A   340  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog424  hydrog ?    ? A  U   325  O4    ? ? ? 1_555 A  A   340  N6    ? ? 0 U   325  0 A   340  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog425  hydrog ?    ? A  G   326  N1    ? ? ? 1_555 A  C   330  N3    ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog426  hydrog ?    ? A  G   326  N2    ? ? ? 1_555 A  C   330  O2    ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog427  hydrog ?    ? A  G   326  O6    ? ? ? 1_555 A  C   330  N4    ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog428  hydrog ?    ? A  A   329  N3    ? ? ? 1_555 A  U   346  N3    ? ? 0 A   329  0 U   346  1_555 ? ? ? ? ? ? 'A-U PAIR' ? 
? ? 
hydrog429  hydrog ?    ? A  A   331  N6    ? ? ? 1_555 A  G   345  N3    ? ? 0 A   331  0 G   345  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog430  hydrog ?    ? A  A   331  N7    ? ? ? 1_555 A  G   345  N2    ? ? 0 A   331  0 G   345  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog431  hydrog ?    ? A  G   332  N1    ? ? ? 1_555 A  C   344  N3    ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog432  hydrog ?    ? A  G   332  N2    ? ? ? 1_555 A  C   344  O2    ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog433  hydrog ?    ? A  G   332  O6    ? ? ? 1_555 A  C   344  N4    ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog434  hydrog ?    ? A  G   333  N1    ? ? ? 1_555 A  C   343  N3    ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog435  hydrog ?    ? A  G   333  N2    ? ? ? 1_555 A  C   343  O2    ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog436  hydrog ?    ? A  G   333  O6    ? ? ? 1_555 A  C   343  N4    ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog437  hydrog ?    ? A  G   334  N1    ? ? ? 1_555 A  C   342  N3    ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog438  hydrog ?    ? A  G   334  N2    ? ? ? 1_555 A  C   342  O2    ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog439  hydrog ?    ? A  G   334  O6    ? ? ? 1_555 A  C   342  N4    ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog440  hydrog ?    ? A  U   335  N3    ? ? ? 1_555 A  A   339  N7    ? ? 0 U   335  0 A   339  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog441  hydrog ?    ? A  U   335  O2    ? ? ? 1_555 A  A   339  N6    ? ? 0 U   335  0 A   339  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog442  hydrog ?    ? A  G   358  N2    ? ? ? 1_555 A  U   359  O4    ? ? 0 G   358  0 U   359  1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog443  hydrog ?    ? A  A   380  N6    ? ? ? 1_555 A  A   408  N7    ? ? 0 A   380  0 A   408  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog444  hydrog ?    ? A  A   380  N7    ? ? ? 1_555 A  A   408  N6    ? ? 0 A   380  0 A   408  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog445  hydrog ?    ? A  G   381  N2    ? ? ? 1_555 A  U   382  O4    ? ? 0 G   381  0 U   382  1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog446  hydrog ?    ? A  U   382  N3    ? ? ? 1_555 A  A   407  N7    ? ? 0 U   382  0 A   407  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog447  hydrog ?    ? A  U   382  O2    ? ? ? 1_555 A  A   407  N6    ? ? 0 U   382  0 A   407  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog448  hydrog ?    ? A  A   383  N6    ? ? ? 1_555 A  G   406  N3    ? ? 0 A   383  0 G   406  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog449  hydrog ?    ? A  A   383  N7    ? ? ? 1_555 A  G   406  N2    ? ? 0 A   383  0 G   406  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog450  hydrog ?    ? A  G   384  N1    ? ? ? 1_555 A  C   405  N3    ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog451  hydrog ?    ? A  G   384  N2    ? ? ? 1_555 A  C   405  O2    ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog452  hydrog ?    ? A  G   384  O6    ? ? ? 1_555 A  C   405  N4    ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog453  hydrog ?    ? A  C   385  N3    ? ? ? 1_555 A  G   404  N1    ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog454  hydrog ?    ? A  C   385  N4    ? ? ? 1_555 A  G   404  O6    ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog455  hydrog ?    ? A  C   385  O2    ? ? ? 1_555 A  G   404  N2    ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog456  hydrog ?    ? A  G   386  N1    ? ? ? 1_555 A  C   403  N3    ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog457  hydrog ?    ? A  G   386  N2    ? ? ? 1_555 A  C   403  O2    ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog458  hydrog ?    ? A  G   386  O6    ? ? ? 1_555 A  C   403  N4    ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog459  hydrog ?    ? A  G   387  N1    ? ? ? 1_555 A  U   402  O2    ? ? 0 G   387  0 U   402  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog460  hydrog ?    ? A  G   387  O6    ? ? ? 1_555 A  U   402  N3    ? ? 0 G   387  0 U   402  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog461  hydrog ?    ? A  G   388  N1    ? ? ? 1_555 A  C   401  N3    ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog462  hydrog ?    ? A  G   388  N2    ? ? ? 1_555 A  C   401  O2    ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog463  hydrog ?    ? A  G   388  O6    ? ? ? 1_555 A  C   401  N4    ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog464  hydrog ?    ? A  G   389  N1    ? ? ? 1_555 A  C   400  N3    ? ? 0 G   389  0 C   400  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog465  hydrog ?    ? A  G   389  N2    ? ? ? 1_555 A  C   400  O2    ? ? 0 G   389  0 C   400  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog466  hydrog ?    ? A  G   389  O6    ? ? ? 1_555 A  C   400  N4    ? ? 0 G   389  0 C   400  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog467  hydrog ?    ? A  G   390  N1    ? ? ? 1_555 A  C   399  N3    ? ? 0 G   390  0 C   399  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog468  hydrog ?    ? A  G   390  N2    ? ? ? 1_555 A  C   399  O2    ? ? 0 G   390  0 C   399  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog469  hydrog ?    ? A  G   390  O6    ? ? ? 1_555 A  C   399  N4    ? ? 0 G   390  0 C   399  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog470  hydrog ?    ? A  U   391  N3    ? ? ? 1_555 A  U   398  O4    ? ? 0 U   391  0 U   398  1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog471  hydrog ?    ? A  U   391  O2    ? ? ? 1_555 A  U   398  N3    ? ? 0 U   391  0 U   398  1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog472  hydrog ?    ? A  G   394  N3    ? ? ? 1_555 A  G   417  N2    ? ? 0 G   394  0 G   417  1_555 ? ? ? ? ? ? 'G-G MISPAIR' 
?     ? ? 
hydrog473  hydrog ?    ? A  A   395  N1    ? ? ? 1_555 A  C   2443 N4    ? ? 0 A   395  0 C   2443 1_555 ? ? ? ? ? ? 'A-C MISPAIR' 
?     ? ? 
hydrog474  hydrog ?    ? A  U   396  O4    ? ? ? 1_555 A  G   2442 N2    ? ? 0 U   396  0 G   2442 1_555 ? ? ? ? ? ? 'U-G MISPAIR' 
?     ? ? 
hydrog475  hydrog ?    ? A  A   407  N6    ? ? ? 1_555 A  A   429  N1    ? ? 0 A   407  0 A   429  1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog476  hydrog ?    ? A  A   408  N1    ? ? ? 1_555 A  A   429  N6    ? ? 0 A   408  0 A   429  1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog477  hydrog ?    ? A  A   408  N6    ? ? ? 1_555 A  A   430  N1    ? ? 0 A   408  0 A   430  1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog478  hydrog ?    ? A  C   412  N3    ? ? ? 1_555 A  G   428  N1    ? ? 0 C   412  0 G   428  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog479  hydrog ?    ? A  C   412  N4    ? ? ? 1_555 A  G   428  O6    ? ? 0 C   412  0 G   428  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog480  hydrog ?    ? A  C   412  O2    ? ? ? 1_555 A  G   428  N2    ? ? 0 C   412  0 G   428  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog481  hydrog ?    ? A  G   413  N1    ? ? ? 1_555 A  C   427  N3    ? ? 0 G   413  0 C   427  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog482  hydrog ?    ? A  G   413  N2    ? ? ? 1_555 A  C   427  O2    ? ? 0 G   413  0 C   427  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog483  hydrog ?    ? A  G   413  O6    ? ? ? 1_555 A  C   427  N4    ? ? 0 G   413  0 C   427  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog484  hydrog ?    ? A  C   414  N3    ? ? ? 1_555 A  G   426  N1    ? ? 0 C   414  0 G   426  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog485  hydrog ?    ? A  C   414  N4    ? ? ? 1_555 A  G   426  O6    ? ? 0 C   414  0 G   426  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog486  hydrog ?    ? A  C   414  O2    ? ? ? 1_555 A  G   426  N2    ? ? 0 C   414  0 G   426  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog487  hydrog ?    ? A  A   415  N1    ? ? ? 1_555 A  U   425  N3    ? ? 0 A   415  0 U   425  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog488  hydrog ?    ? A  A   415  N6    ? ? ? 1_555 A  U   425  O4    ? ? 0 A   415  0 U   425  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog489  hydrog ?    ? A  G   416  N1    ? ? ? 1_555 A  C   424  N3    ? ? 0 G   416  0 C   424  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog490  hydrog ?    ? A  G   416  N2    ? ? ? 1_555 A  C   424  O2    ? ? 0 G   416  0 C   424  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog491  hydrog ?    ? A  G   416  O6    ? ? ? 1_555 A  C   424  N4    ? ? 0 G   416  0 C   424  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog492  hydrog ?    ? A  C   418  N3    ? ? ? 1_555 A  G   2449 N1    ? ? 0 C   418  0 G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog493  hydrog ?    ? A  C   418  N4    ? ? ? 1_555 A  G   2449 O6    ? ? 0 C   418  0 G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog494  hydrog ?    ? A  C   418  O2    ? ? ? 1_555 A  G   2449 N2    ? ? 0 C   418  0 G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog495  hydrog ?    ? A  A   419  N3    ? ? ? 1_555 A  C   1920 N4    ? ? 0 A   419  0 C   1920 1_555 ? ? ? ? ? ? 'A-C MISPAIR' 
?     ? ? 
hydrog496  hydrog ?    ? A  A   419  N1    ? ? ? 1_555 A  U   2448 N3    ? ? 0 A   419  0 U   2448 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog497  hydrog ?    ? A  A   419  N6    ? ? ? 1_555 A  U   2448 O4    ? ? 0 A   419  0 U   2448 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog498  hydrog ?    ? A  U   420  N3    ? ? ? 1_555 A  A   2447 N1    ? ? 0 U   420  0 A   2447 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog499  hydrog ?    ? A  U   420  O4    ? ? ? 1_555 A  A   2447 N6    ? ? 0 U   420  0 A   2447 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog500  hydrog ?    ? A  C   421  N3    ? ? ? 1_555 A  G   2446 N1    ? ? 0 C   421  0 G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog501  hydrog ?    ? A  C   421  N4    ? ? ? 1_555 A  G   2446 O6    ? ? 0 C   421  0 G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog502  hydrog ?    ? A  C   421  O2    ? ? ? 1_555 A  G   2446 N2    ? ? 0 C   421  0 G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog503  hydrog ?    ? A  G   422  N1    ? ? ? 1_555 A  U   2445 O2    ? ? 0 G   422  0 U   2445 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog504  hydrog ?    ? A  G   422  O6    ? ? ? 1_555 A  U   2445 N3    ? ? 0 G   422  0 U   2445 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog505  hydrog ?    ? A  A   423  N1    ? ? ? 1_555 A  U   2444 N3    ? ? 0 A   423  0 U   2444 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog506  hydrog ?    ? A  A   423  N6    ? ? ? 1_555 A  U   2444 O4    ? ? 0 A   423  0 U   2444 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog507  hydrog ?    ? A  A   441  N3    ? ? ? 1_555 A  A   442  N6    ? ? 0 A   441  0 A   442  1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog508  hydrog ?    ? A  A   449  N3    ? ? ? 1_555 A  G   1349 N2    ? ? 0 A   449  0 G   1349 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog509  hydrog ?    ? A  G   452  N2    ? ? ? 1_555 A  A   460  N1    ? ? 0 G   452  0 A   460  1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog510  hydrog ?    ? A  G   452  N3    ? ? ? 1_555 A  A   460  N6    ? ? 0 G   452  0 A   460  1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog511  hydrog ?    ? A  U   454  N3    ? ? ? 1_555 A  U   1362 O2    ? ? 0 U   454  0 U   1362 1_555 ? ? ? ? ? ? 'U-U MISPAIR' 
?     ? ? 
hydrog512  hydrog ?    ? A  A   455  N1    ? ? ? 1_555 A  A   460  N6    ? ? 0 A   455  0 A   460  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? 
? ? 
hydrog513  hydrog ?    ? A  A   455  N6    ? ? ? 1_555 A  A   460  N7    ? ? 0 A   455  0 A   460  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? 
? ? 
hydrog514  hydrog ?    ? A  G   458  N2    ? ? ? 1_555 A  A   463  N3    ? ? 0 G   458  0 A   463  1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog515  hydrog ?    ? A  A   463  N6    ? ? ? 1_555 A  A   477  N7    ? ? 0 A   463  0 A   477  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog516  hydrog ?    ? A  A   463  N7    ? ? ? 1_555 A  A   477  N6    ? ? 0 A   463  0 A   477  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog517  hydrog ?    ? A  G   464  N2    ? ? ? 1_555 A  U   465  O4    ? ? 0 G   464  0 U   465  1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog518  hydrog ?    ? A  U   465  N3    ? ? ? 1_555 A  A   476  N7    ? ? 0 U   465  0 A   476  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog519  hydrog ?    ? A  U   465  O2    ? ? ? 1_555 A  A   476  N6    ? ? 0 U   465  0 A   476  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog520  hydrog ?    ? A  A   466  N6    ? ? ? 1_555 A  G   475  N3    ? ? 0 A   466  0 G   475  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog521  hydrog ?    ? A  A   466  N7    ? ? ? 1_555 A  G   475  N2    ? ? 0 A   466  0 G   475  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog522  hydrog ?    ? A  G   467  N1    ? ? ? 1_555 A  C   474  N3    ? ? 0 G   467  0 C   474  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog523  hydrog ?    ? A  G   467  N2    ? ? ? 1_555 A  C   474  O2    ? ? 0 G   467  0 C   474  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog524  hydrog ?    ? A  G   467  O6    ? ? ? 1_555 A  C   474  N4    ? ? 0 G   467  0 C   474  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog525  hydrog ?    ? A  U   468  N3    ? ? ? 1_555 A  A   473  N1    ? ? 0 U   468  0 A   473  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog526  hydrog ?    ? A  U   468  O4    ? ? ? 1_555 A  A   473  N6    ? ? 0 U   468  0 A   473  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog527  hydrog ?    ? A  G   469  N2    ? ? ? 1_555 A  A   472  N7    ? ? 0 G   469  0 A   472  1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog528  hydrog ?    ? A  G   471  N2    ? ? ? 1_555 A  C   774  O2    ? ? 0 G   471  0 C   774  1_555 ? ? ? ? ? ? 'G-C PAIR' ? 
? ? 
hydrog529  hydrog ?    ? A  U   481  N3    ? ? ? 1_555 A  A   485  N7    ? ? 0 U   481  0 A   485  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog530  hydrog ?    ? A  U   481  O2    ? ? ? 1_555 A  A   485  N6    ? ? 0 U   481  0 A   485  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog531  hydrog ?    ? A  G   482  N2    ? ? ? 1_555 A  A   486  N7    ? ? 0 G   482  0 A   486  1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog532  hydrog ?    ? A  C   483  N4    ? ? ? 1_555 A  A   507  N7    ? ? 0 C   483  0 A   507  1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog533  hydrog ?    ? A  A   485  N1    ? ? ? 1_555 A  A   509  N6    ? ? 0 A   485  0 A   509  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? 
? ? 
hydrog534  hydrog ?    ? A  A   485  N6    ? ? ? 1_555 A  A   509  N1    ? ? 0 A   485  0 A   509  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? 
? ? 
hydrog535  hydrog ?    ? A  A   486  N1    ? ? ? 1_555 A  A   511  N6    ? ? 0 A   486  0 A   511  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? 
? ? 
hydrog536  hydrog ?    ? A  A   486  N6    ? ? ? 1_555 A  A   511  N1    ? ? 0 A   486  0 A   511  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? 
? ? 
hydrog537  hydrog ?    ? A  G   487  N3    ? ? ? 1_555 A  G   512  N2    ? ? 0 G   487  0 G   512  1_555 ? ? ? ? ? ? 'G-G MISPAIR' 
?     ? ? 
hydrog538  hydrog ?    ? A  G   487  N1    ? ? ? 1_555 A  C   515  N3    ? ? 0 G   487  0 C   515  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog539  hydrog ?    ? A  G   487  N2    ? ? ? 1_555 A  C   515  O2    ? ? 0 G   487  0 C   515  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog540  hydrog ?    ? A  G   487  O6    ? ? ? 1_555 A  C   515  N4    ? ? 0 G   487  0 C   515  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog541  hydrog ?    ? A  U   488  O2    ? ? ? 1_555 A  G   503  N1    ? ? 0 U   488  0 G   503  1_555 ? ? ? ? ? ? 'U-G MISPAIR' 
?     ? ? 
hydrog542  hydrog ?    ? A  A   489  N6    ? ? ? 1_555 A  G   503  N3    ? ? 0 A   489  0 G   503  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog543  hydrog ?    ? A  A   489  N7    ? ? ? 1_555 A  G   503  N2    ? ? 0 A   489  0 G   503  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog544  hydrog ?    ? A  C   490  N4    ? ? ? 1_555 A  A   502  N1    ? ? 0 C   490  0 A   502  1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog545  hydrog ?    ? A  C   491  N3    ? ? ? 1_555 A  G   501  N1    ? ? 0 C   491  0 G   501  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog546  hydrog ?    ? A  C   491  N4    ? ? ? 1_555 A  G   501  O6    ? ? 0 C   491  0 G   501  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog547  hydrog ?    ? A  C   491  O2    ? ? ? 1_555 A  G   501  N2    ? ? 0 C   491  0 G   501  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog548  hydrog ?    ? A  C   492  N3    ? ? ? 1_555 A  G   500  N1    ? ? 0 C   492  0 G   500  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog549  hydrog ?    ? A  C   492  N4    ? ? ? 1_555 A  G   500  O6    ? ? 0 C   492  0 G   500  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog550  hydrog ?    ? A  C   492  O2    ? ? ? 1_555 A  G   500  N2    ? ? 0 C   492  0 G   500  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog551  hydrog ?    ? A  U   493  N3    ? ? ? 1_555 A  G   499  O6    ? ? 0 U   493  0 G   499  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog552  hydrog ?    ? A  U   493  O2    ? ? ? 1_555 A  G   499  N1    ? ? 0 U   493  0 G   499  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog553  hydrog ?    ? A  C   494  O2    ? ? ? 1_555 A  A   498  N6    ? ? 0 C   494  0 A   498  1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog554  hydrog ?    ? A  G   504  N1    ? ? ? 1_555 A  G   512  O6    ? ? 0 G   504  0 G   512  1_555 ? ? ? ? ? ? 'G-G MISPAIR' 
?     ? ? 
hydrog555  hydrog ?    ? A  C   505  O2    ? ? ? 1_555 A  A   509  N6    ? ? 0 C   505  0 A   509  1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog556  hydrog ?    ? A  G   506  N2    ? ? ? 1_555 A  A   511  N7    ? ? 0 G   506  0 A   511  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog557  hydrog ?    ? A  G   506  N3    ? ? ? 1_555 A  A   511  N6    ? ? 0 G   506  0 A   511  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog558  hydrog ?    ? A  A   521  N3    ? ? ? 1_555 A  G   1364 N2    ? ? 0 A   521  0 G   1364 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog559  hydrog ?    ? A  A   532  N3    ? ? ? 1_555 A  G   2660 N2    ? ? 0 A   532  0 G   2660 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog560  hydrog ?    ? A  G   535  N7    ? ? ? 1_555 A  G   2082 N1    ? ? 0 G   535  0 G   2082 1_555 ? ? ? ? ? ? TYPE_7_PAIR ? 
? ? 
hydrog561  hydrog ?    ? A  G   535  O6    ? ? ? 1_555 A  G   2082 N2    ? ? 0 G   535  0 G   2082 1_555 ? ? ? ? ? ? TYPE_7_PAIR ? 
? ? 
hydrog562  hydrog ?    ? A  A   536  N3    ? ? ? 1_555 A  G   2075 N2    ? ? 0 A   536  0 G   2075 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog563  hydrog ?    ? A  G   537  N1    ? ? ? 1_555 A  U   2059 O2    ? ? 0 G   537  0 U   2059 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog564  hydrog ?    ? A  G   537  O6    ? ? ? 1_555 A  U   2059 N3    ? ? 0 G   537  0 U   2059 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog565  hydrog ?    ? A  C   538  N4    ? ? ? 1_555 A  A   2060 N3    ? ? 0 C   538  0 A   2060 1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog566  hydrog ?    ? A  G   539  N1    ? ? ? 1_555 A  C   617  N3    ? ? 0 G   539  0 C   617  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog567  hydrog ?    ? A  G   539  N2    ? ? ? 1_555 A  C   617  O2    ? ? 0 G   539  0 C   617  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog568  hydrog ?    ? A  G   539  O6    ? ? ? 1_555 A  C   617  N4    ? ? 0 G   539  0 C   617  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog569  hydrog ?    ? A  A   540  N1    ? ? ? 1_555 A  U   616  N3    ? ? 0 A   540  0 U   616  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog570  hydrog ?    ? A  A   540  N6    ? ? ? 1_555 A  U   616  O4    ? ? 0 A   540  0 U   616  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog571  hydrog ?    ? A  C   541  N3    ? ? ? 1_555 A  G   615  N1    ? ? 0 C   541  0 G   615  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog572  hydrog ?    ? A  C   541  N4    ? ? ? 1_555 A  G   615  O6    ? ? 0 C   541  0 G   615  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog573  hydrog ?    ? A  C   541  O2    ? ? ? 1_555 A  G   615  N2    ? ? 0 C   541  0 G   615  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog574  hydrog ?    ? A  A   542  N1    ? ? ? 1_555 A  U   614  N3    ? ? 0 A   542  0 U   614  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog575  hydrog ?    ? A  A   542  N6    ? ? ? 1_555 A  U   614  O4    ? ? 0 A   542  0 U   614  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog576  hydrog ?    ? A  G   543  N1    ? ? ? 1_555 A  C   613  N3    ? ? 0 G   543  0 C   613  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog577  hydrog ?    ? A  G   543  N2    ? ? ? 1_555 A  C   613  O2    ? ? 0 G   543  0 C   613  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog578  hydrog ?    ? A  G   543  O6    ? ? ? 1_555 A  C   613  N4    ? ? 0 G   543  0 C   613  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog579  hydrog ?    ? A  G   544  N1    ? ? ? 1_555 A  U   612  O2    ? ? 0 G   544  0 U   612  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog580  hydrog ?    ? A  G   544  O6    ? ? ? 1_555 A  U   612  N3    ? ? 0 G   544  0 U   612  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog581  hydrog ?    ? A  G   545  N1    ? ? ? 1_555 A  U   611  O2    ? ? 0 G   545  0 U   611  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog582  hydrog ?    ? A  G   545  O6    ? ? ? 1_555 A  U   611  N3    ? ? 0 G   545  0 U   611  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog583  hydrog ?    ? A  C   546  N3    ? ? ? 1_555 A  G   610  N1    ? ? 0 C   546  0 G   610  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog584  hydrog ?    ? A  C   546  N4    ? ? ? 1_555 A  G   610  O6    ? ? 0 C   546  0 G   610  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog585  hydrog ?    ? A  C   546  O2    ? ? ? 1_555 A  G   610  N2    ? ? 0 C   546  0 G   610  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog586  hydrog ?    ? A  A   547  N1    ? ? ? 1_555 A  U   609  N3    ? ? 0 A   547  0 U   609  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog587  hydrog ?    ? A  A   547  N6    ? ? ? 1_555 A  U   609  O4    ? ? 0 A   547  0 U   609  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog588  hydrog ?    ? A  U   548  N3    ? ? ? 1_555 A  A   608  N1    ? ? 0 U   548  0 A   608  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog589  hydrog ?    ? A  U   548  O4    ? ? ? 1_555 A  A   608  N6    ? ? 0 U   548  0 A   608  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog590  hydrog ?    ? A  A   552  N3    ? ? ? 1_555 A  G   1323 N2    ? ? 0 A   552  0 G   1323 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog591  hydrog ?    ? A  G   553  N1    ? ? ? 1_555 A  C   606  N3    ? ? 0 G   553  0 C   606  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog592  hydrog ?    ? A  G   553  N2    ? ? ? 1_555 A  C   606  O2    ? ? 0 G   553  0 C   606  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog593  hydrog ?    ? A  G   553  O6    ? ? ? 1_555 A  C   606  N4    ? ? 0 G   553  0 C   606  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog594  hydrog ?    ? A  G   554  N1    ? ? ? 1_555 A  C   605  N3    ? ? 0 G   554  0 C   605  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog595  hydrog ?    ? A  G   554  N2    ? ? ? 1_555 A  C   605  O2    ? ? 0 G   554  0 C   605  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog596  hydrog ?    ? A  G   554  O6    ? ? ? 1_555 A  C   605  N4    ? ? 0 G   554  0 C   605  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog597  hydrog ?    ? A  U   555  N3    ? ? ? 1_555 A  A   602  N1    ? ? 0 U   555  0 A   602  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog598  hydrog ?    ? A  U   555  O4    ? ? ? 1_555 A  A   602  N6    ? ? 0 U   555  0 A   602  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog599  hydrog ?    ? A  C   556  N3    ? ? ? 1_555 A  G   601  N1    ? ? 0 C   556  0 G   601  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog600  hydrog ?    ? A  C   556  N4    ? ? ? 1_555 A  G   601  O6    ? ? 0 C   556  0 G   601  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog601  hydrog ?    ? A  C   556  O2    ? ? ? 1_555 A  G   601  N2    ? ? 0 C   556  0 G   601  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog602  hydrog ?    ? A  C   557  N3    ? ? ? 1_555 A  G   600  N1    ? ? 0 C   557  0 G   600  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog603  hydrog ?    ? A  C   557  N4    ? ? ? 1_555 A  G   600  O6    ? ? 0 C   557  0 G   600  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog604  hydrog ?    ? A  C   557  O2    ? ? ? 1_555 A  G   600  N2    ? ? 0 C   557  0 G   600  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog605  hydrog ?    ? A  C   558  N3    ? ? ? 1_555 A  G   599  N1    ? ? 0 C   558  0 G   599  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog606  hydrog ?    ? A  C   558  N4    ? ? ? 1_555 A  G   599  O6    ? ? 0 C   558  0 G   599  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog607  hydrog ?    ? A  C   558  O2    ? ? ? 1_555 A  G   599  N2    ? ? 0 C   558  0 G   599  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog608  hydrog ?    ? A  U   559  O4    ? ? ? 1_555 A  C   598  N4    ? ? 0 U   559  0 C   598  1_555 ? ? ? ? ? ? 'U-C MISPAIR' 
?     ? ? 
hydrog609  hydrog ?    ? A  U   560  N3    ? ? ? 1_555 A  A   597  N1    ? ? 0 U   560  0 A   597  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog610  hydrog ?    ? A  U   560  O4    ? ? ? 1_555 A  A   597  N6    ? ? 0 U   560  0 A   597  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog611  hydrog ?    ? A  G   561  N1    ? ? ? 1_555 A  C   596  N3    ? ? 0 G   561  0 C   596  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog612  hydrog ?    ? A  G   561  N2    ? ? ? 1_555 A  C   596  O2    ? ? 0 G   561  0 C   596  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog613  hydrog ?    ? A  G   561  O6    ? ? ? 1_555 A  C   596  N4    ? ? 0 G   561  0 C   596  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog614  hydrog ?    ? A  A   562  N1    ? ? ? 1_555 A  U   595  N3    ? ? 0 A   562  0 U   595  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog615  hydrog ?    ? A  A   562  N6    ? ? ? 1_555 A  U   595  O4    ? ? 0 A   562  0 U   595  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog616  hydrog ?    ? A  C   563  O2    ? ? ? 1_555 A  C   594  N4    ? ? 0 C   563  0 C   594  1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog617  hydrog ?    ? A  A   566  N6    ? ? ? 1_555 A  G   592  N3    ? ? 0 A   566  0 G   592  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog618  hydrog ?    ? A  A   566  N7    ? ? ? 1_555 A  G   592  N2    ? ? 0 A   566  0 G   592  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog619  hydrog ?    ? A  A   566  N3    ? ? ? 1_555 A  G   1093 N2    ? ? 0 A   566  0 G   1093 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog620  hydrog ?    ? A  U   567  N3    ? ? ? 1_555 A  A   591  N1    ? ? 0 U   567  0 A   591  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog621  hydrog ?    ? A  U   567  O4    ? ? ? 1_555 A  A   591  N6    ? ? 0 U   567  0 A   591  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog622  hydrog ?    ? A  G   568  N2    ? ? ? 1_555 A  A   590  N7    ? ? 0 G   568  0 A   590  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog623  hydrog ?    ? A  G   568  N3    ? ? ? 1_555 A  A   590  N6    ? ? 0 G   568  0 A   590  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog624  hydrog ?    ? A  A   569  N6    ? ? ? 1_555 A  U   589  O2    ? ? 0 A   569  0 U   589  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog625  hydrog ?    ? A  A   569  N7    ? ? ? 1_555 A  U   589  N3    ? ? 0 A   569  0 U   589  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog626  hydrog ?    ? A  C   571  N4    ? ? ? 1_555 A  C   586  O2    ? ? 0 C   571  0 C   586  1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog627  hydrog ?    ? A  G   572  N1    ? ? ? 1_555 A  C   585  N3    ? ? 0 G   572  0 C   585  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog628  hydrog ?    ? A  G   572  N2    ? ? ? 1_555 A  C   585  O2    ? ? 0 G   572  0 C   585  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog629  hydrog ?    ? A  G   572  O6    ? ? ? 1_555 A  C   585  N4    ? ? 0 G   572  0 C   585  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog630  hydrog ?    ? A  A   573  N1    ? ? ? 1_555 A  U   584  N3    ? ? 0 A   573  0 U   584  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog631  hydrog ?    ? A  A   573  N6    ? ? ? 1_555 A  U   584  O4    ? ? 0 A   573  0 U   584  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog632  hydrog ?    ? A  G   574  N1    ? ? ? 1_555 A  C   583  N3    ? ? 0 G   574  0 C   583  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog633  hydrog ?    ? A  G   574  N2    ? ? ? 1_555 A  C   583  O2    ? ? 0 G   574  0 C   583  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog634  hydrog ?    ? A  G   574  O6    ? ? ? 1_555 A  C   583  N4    ? ? 0 G   574  0 C   583  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog635  hydrog ?    ? A  A   575  N1    ? ? ? 1_555 A  U   582  N3    ? ? 0 A   575  0 U   582  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog636  hydrog ?    ? A  A   575  N6    ? ? ? 1_555 A  U   582  O4    ? ? 0 A   575  0 U   582  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog637  hydrog ?    ? A  C   576  N3    ? ? ? 1_555 A  G   581  N1    ? ? 0 C   576  0 G   581  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog638  hydrog ?    ? A  C   576  N4    ? ? ? 1_555 A  G   581  O6    ? ? 0 C   576  0 G   581  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog639  hydrog ?    ? A  C   576  O2    ? ? ? 1_555 A  G   581  N2    ? ? 0 C   576  0 G   581  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog640  hydrog ?    ? A  G   577  N2    ? ? ? 1_555 A  A   580  N7    ? ? 0 G   577  0 A   580  1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog641  hydrog ?    ? A  G   579  N2    ? ? ? 1_555 A  U   1111 O2    ? ? 0 G   579  0 U   1111 1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog642  hydrog ?    ? A  A   580  N3    ? ? ? 1_555 A  G   1110 N2    ? ? 0 A   580  0 G   1110 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog643  hydrog ?    ? A  G   588  N2    ? ? ? 1_555 A  U   589  O4    ? ? 0 G   588  0 U   589  1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog644  hydrog ?    ? A  G   604  N1    ? ? ? 1_555 A  G   607  O6    ? ? 0 G   604  0 G   607  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? 
? ? 
hydrog645  hydrog ?    ? A  G   604  N2    ? ? ? 1_555 A  G   607  N7    ? ? 0 G   604  0 G   607  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? 
? ? 
hydrog646  hydrog ?    ? A  U   619  N3    ? ? ? 1_555 A  A   2074 N1    ? ? 0 U   619  0 A   2074 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog647  hydrog ?    ? A  U   619  O4    ? ? ? 1_555 A  A   2074 N6    ? ? 0 U   619  0 A   2074 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog648  hydrog ?    ? A  A   620  N6    ? ? ? 1_555 A  A   635  N1    ? ? 0 A   620  0 A   635  1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog649  hydrog ?    ? A  C   621  N3    ? ? ? 1_555 A  G   634  N1    ? ? 0 C   621  0 G   634  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog650  hydrog ?    ? A  C   621  N4    ? ? ? 1_555 A  G   634  O6    ? ? 0 C   621  0 G   634  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog651  hydrog ?    ? A  C   621  O2    ? ? ? 1_555 A  G   634  N2    ? ? 0 C   621  0 G   634  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog652  hydrog ?    ? A  G   622  N1    ? ? ? 1_555 A  C   633  N3    ? ? 0 G   622  0 C   633  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog653  hydrog ?    ? A  G   622  N2    ? ? ? 1_555 A  C   633  O2    ? ? 0 G   622  0 C   633  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog654  hydrog ?    ? A  G   622  O6    ? ? ? 1_555 A  C   633  N4    ? ? 0 G   622  0 C   633  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog655  hydrog ?    ? A  U   623  N3    ? ? ? 1_555 A  A   632  N1    ? ? 0 U   623  0 A   632  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog656  hydrog ?    ? A  U   623  O4    ? ? ? 1_555 A  A   632  N6    ? ? 0 U   623  0 A   632  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog657  hydrog ?    ? A  U   624  N3    ? ? ? 1_555 A  1MA 628  N7    ? ? 0 U   624  0 1MA 628  1_555 ? ? ? ? ? ? 'U-1MA PAIR' 
?     ? ? 
hydrog658  hydrog ?    ? A  U   625  O2    ? ? ? 1_555 A  C   2071 N4    ? ? 0 U   625  0 C   2071 1_555 ? ? ? ? ? ? 'U-C MISPAIR' 
?     ? ? 
hydrog659  hydrog ?    ? A  U   626  O2    ? ? ? 1_555 A  A   1081 N6    ? ? 0 U   626  0 A   1081 1_555 ? ? ? ? ? ? 'U-A PAIR' ? 
? ? 
hydrog660  hydrog ?    ? A  A   629  N1    ? ? ? 1_555 A  G   2070 N2    ? ? 0 A   629  0 G   2070 1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog661  hydrog ?    ? A  A   629  N6    ? ? ? 1_555 A  G   2070 N3    ? ? 0 A   629  0 G   2070 1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog662  hydrog ?    ? A  G   636  N1    ? ? ? 1_555 A  C   1365 N3    ? ? 0 G   636  0 C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog663  hydrog ?    ? A  G   636  N2    ? ? ? 1_555 A  C   1365 O2    ? ? 0 G   636  0 C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog664  hydrog ?    ? A  G   636  O6    ? ? ? 1_555 A  C   1365 N4    ? ? 0 G   636  0 C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog665  hydrog ?    ? A  C   637  N3    ? ? ? 1_555 A  G   1364 N1    ? ? 0 C   637  0 G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog666  hydrog ?    ? A  C   637  N4    ? ? ? 1_555 A  G   1364 O6    ? ? 0 C   637  0 G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog667  hydrog ?    ? A  C   637  O2    ? ? ? 1_555 A  G   1364 N2    ? ? 0 C   637  0 G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog668  hydrog ?    ? A  C   638  N3    ? ? ? 1_555 A  G   1363 N1    ? ? 0 C   638  0 G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog669  hydrog ?    ? A  C   638  N4    ? ? ? 1_555 A  G   1363 O6    ? ? 0 C   638  0 G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog670  hydrog ?    ? A  C   638  O2    ? ? ? 1_555 A  G   1363 N2    ? ? 0 C   638  0 G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog671  hydrog ?    ? A  A   639  N1    ? ? ? 1_555 A  U   1362 N3    ? ? 0 A   639  0 U   1362 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog672  hydrog ?    ? A  A   639  N6    ? ? ? 1_555 A  U   1362 O4    ? ? 0 A   639  0 U   1362 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog673  hydrog ?    ? A  G   640  N1    ? ? ? 1_555 A  C   1361 N3    ? ? 0 G   640  0 C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog674  hydrog ?    ? A  G   640  N2    ? ? ? 1_555 A  C   1361 O2    ? ? 0 G   640  0 C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog675  hydrog ?    ? A  G   640  O6    ? ? ? 1_555 A  C   1361 N4    ? ? 0 G   640  0 C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog676  hydrog ?    ? A  G   641  N1    ? ? ? 1_555 A  C   1360 N3    ? ? 0 G   641  0 C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog677  hydrog ?    ? A  G   641  N2    ? ? ? 1_555 A  C   1360 O2    ? ? 0 G   641  0 C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog678  hydrog ?    ? A  G   641  O6    ? ? ? 1_555 A  C   1360 N4    ? ? 0 G   641  0 C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog679  hydrog ?    ? A  G   642  N2    ? ? ? 1_555 A  A   1358 N7    ? ? 0 G   642  0 A   1358 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog680  hydrog ?    ? A  G   642  N3    ? ? ? 1_555 A  A   1358 N6    ? ? 0 G   642  0 A   1358 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog681  hydrog ?    ? A  A   643  N3    ? ? ? 1_555 A  G   902  N2    ? ? 0 A   643  0 G   902  1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog682  hydrog ?    ? A  A   643  N6    ? ? ? 1_555 A  A   1355 N7    ? ? 0 A   643  0 A   1355 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog683  hydrog ?    ? A  A   643  N7    ? ? ? 1_555 A  A   1355 N6    ? ? 0 A   643  0 A   1355 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog684  hydrog ?    ? A  G   644  N1    ? ? ? 1_555 A  U   903  O2    ? ? 0 G   644  0 U   903  1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog685  hydrog ?    ? A  U   645  N3    ? ? ? 1_555 A  A   761  N3    ? ? 0 U   645  0 A   761  1_555 ? ? ? ? ? ? 'U-A PAIR' ? 
? ? 
hydrog686  hydrog ?    ? A  G   646  N1    ? ? ? 1_555 A  C   759  N3    ? ? 0 G   646  0 C   759  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog687  hydrog ?    ? A  G   646  N2    ? ? ? 1_555 A  C   759  O2    ? ? 0 G   646  0 C   759  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog688  hydrog ?    ? A  G   646  O6    ? ? ? 1_555 A  C   759  N4    ? ? 0 G   646  0 C   759  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog689  hydrog ?    ? A  U   647  N3    ? ? ? 1_555 A  A   758  N1    ? ? 0 U   647  0 A   758  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog690  hydrog ?    ? A  U   647  O4    ? ? ? 1_555 A  A   758  N6    ? ? 0 U   647  0 A   758  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog691  hydrog ?    ? A  G   648  N1    ? ? ? 1_555 A  C   757  N3    ? ? 0 G   648  0 C   757  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog692  hydrog ?    ? A  G   648  N2    ? ? ? 1_555 A  C   757  O2    ? ? 0 G   648  0 C   757  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog693  hydrog ?    ? A  G   648  O6    ? ? ? 1_555 A  C   757  N4    ? ? 0 G   648  0 C   757  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog694  hydrog ?    ? A  U   649  N3    ? ? ? 1_555 A  A   756  N1    ? ? 0 U   649  0 A   756  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog695  hydrog ?    ? A  U   649  O4    ? ? ? 1_555 A  A   756  N6    ? ? 0 U   649  0 A   756  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog696  hydrog ?    ? A  C   650  N3    ? ? ? 1_555 A  G   755  N1    ? ? 0 C   650  0 G   755  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog697  hydrog ?    ? A  C   650  N4    ? ? ? 1_555 A  G   755  O6    ? ? 0 C   650  0 G   755  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog698  hydrog ?    ? A  C   650  O2    ? ? ? 1_555 A  G   755  N2    ? ? 0 C   650  0 G   755  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog699  hydrog ?    ? A  U   651  N3    ? ? ? 1_555 A  G   754  O6    ? ? 0 U   651  0 G   754  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog700  hydrog ?    ? A  U   651  O2    ? ? ? 1_555 A  G   754  N1    ? ? 0 U   651  0 G   754  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog701  hydrog ?    ? A  G   652  N1    ? ? ? 1_555 A  U   753  O2    ? ? 0 G   652  0 U   753  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog702  hydrog ?    ? A  G   652  O6    ? ? ? 1_555 A  U   753  N3    ? ? 0 G   652  0 U   753  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog703  hydrog ?    ? A  U   653  N3    ? ? ? 1_555 A  G   752  O6    ? ? 0 U   653  0 G   752  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog704  hydrog ?    ? A  U   653  O2    ? ? ? 1_555 A  G   752  N1    ? ? 0 U   653  0 G   752  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog705  hydrog ?    ? A  A   654  N1    ? ? ? 1_555 A  U   751  N3    ? ? 0 A   654  0 U   751  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog706  hydrog ?    ? A  A   654  N6    ? ? ? 1_555 A  U   751  O4    ? ? 0 A   654  0 U   751  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog707  hydrog ?    ? A  U   655  N3    ? ? ? 1_555 A  A   750  N1    ? ? 0 U   655  0 A   750  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog708  hydrog ?    ? A  U   655  O4    ? ? ? 1_555 A  A   750  N6    ? ? 0 U   655  0 A   750  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog709  hydrog ?    ? A  G   656  N1    ? ? ? 1_555 A  C   749  N3    ? ? 0 G   656  0 C   749  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog710  hydrog ?    ? A  G   656  N2    ? ? ? 1_555 A  C   749  O2    ? ? 0 G   656  0 C   749  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog711  hydrog ?    ? A  G   656  O6    ? ? ? 1_555 A  C   749  N4    ? ? 0 G   656  0 C   749  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog712  hydrog ?    ? A  G   657  N1    ? ? ? 1_555 A  C   748  N3    ? ? 0 G   657  0 C   748  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog713  hydrog ?    ? A  G   657  N2    ? ? ? 1_555 A  C   748  O2    ? ? 0 G   657  0 C   748  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog714  hydrog ?    ? A  G   657  O6    ? ? ? 1_555 A  C   748  N4    ? ? 0 G   657  0 C   748  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog715  hydrog ?    ? A  C   658  N3    ? ? ? 1_555 A  G   747  N1    ? ? 0 C   658  0 G   747  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog716  hydrog ?    ? A  C   658  N4    ? ? ? 1_555 A  G   747  O6    ? ? 0 C   658  0 G   747  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog717  hydrog ?    ? A  C   658  O2    ? ? ? 1_555 A  G   747  N2    ? ? 0 C   658  0 G   747  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog718  hydrog ?    ? A  G   661  N1    ? ? ? 1_555 A  C   685  N3    ? ? 0 G   661  0 C   685  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog719  hydrog ?    ? A  G   661  N2    ? ? ? 1_555 A  C   685  O2    ? ? 0 G   661  0 C   685  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog720  hydrog ?    ? A  G   661  O6    ? ? ? 1_555 A  C   685  N4    ? ? 0 G   661  0 C   685  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog721  hydrog ?    ? A  U   662  N3    ? ? ? 1_555 A  G   684  O6    ? ? 0 U   662  0 G   684  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog722  hydrog ?    ? A  U   662  O2    ? ? ? 1_555 A  G   684  N1    ? ? 0 U   662  0 G   684  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog723  hydrog ?    ? A  C   663  N3    ? ? ? 1_555 A  G   683  N1    ? ? 0 C   663  0 G   683  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog724  hydrog ?    ? A  C   663  N4    ? ? ? 1_555 A  G   683  O6    ? ? 0 C   663  0 G   683  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog725  hydrog ?    ? A  C   663  O2    ? ? ? 1_555 A  G   683  N2    ? ? 0 C   663  0 G   683  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog726  hydrog ?    ? A  U   664  N3    ? ? ? 1_555 A  A   682  N7    ? ? 0 U   664  0 A   682  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog727  hydrog ?    ? A  U   664  O2    ? ? ? 1_555 A  A   682  N6    ? ? 0 U   664  0 A   682  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog728  hydrog ?    ? A  A   666  N6    ? ? ? 1_555 A  G   680  N3    ? ? 0 A   666  0 G   680  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog729  hydrog ?    ? A  A   666  N7    ? ? ? 1_555 A  G   680  N2    ? ? 0 A   666  0 G   680  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog730  hydrog ?    ? A  C   667  N3    ? ? ? 1_555 A  G   679  N1    ? ? 0 C   667  0 G   679  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog731  hydrog ?    ? A  C   667  N4    ? ? ? 1_555 A  G   679  O6    ? ? 0 C   667  0 G   679  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog732  hydrog ?    ? A  C   667  O2    ? ? ? 1_555 A  G   679  N2    ? ? 0 C   667  0 G   679  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog733  hydrog ?    ? A  C   668  N3    ? ? ? 1_555 A  G   678  N1    ? ? 0 C   668  0 G   678  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog734  hydrog ?    ? A  C   668  N4    ? ? ? 1_555 A  G   678  O6    ? ? 0 C   668  0 G   678  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog735  hydrog ?    ? A  C   668  O2    ? ? ? 1_555 A  G   678  N2    ? ? 0 C   668  0 G   678  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog736  hydrog ?    ? A  G   669  N1    ? ? ? 1_555 A  C   677  N3    ? ? 0 G   669  0 C   677  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog737  hydrog ?    ? A  G   669  N2    ? ? ? 1_555 A  C   677  O2    ? ? 0 G   669  0 C   677  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog738  hydrog ?    ? A  G   669  O6    ? ? ? 1_555 A  C   677  N4    ? ? 0 G   669  0 C   677  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog739  hydrog ?    ? A  G   670  N1    ? ? ? 1_555 A  C   676  N3    ? ? 0 G   670  0 C   676  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog740  hydrog ?    ? A  G   670  N2    ? ? ? 1_555 A  C   676  O2    ? ? 0 G   670  0 C   676  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog741  hydrog ?    ? A  G   670  O6    ? ? ? 1_555 A  C   676  N4    ? ? 0 G   670  0 C   676  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog742  hydrog ?    ? A  G   689  N1    ? ? ? 1_555 A  C   696  N3    ? ? 0 G   689  0 C   696  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog743  hydrog ?    ? A  G   689  N2    ? ? ? 1_555 A  C   696  O2    ? ? 0 G   689  0 C   696  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog744  hydrog ?    ? A  G   689  O6    ? ? ? 1_555 A  C   696  N4    ? ? 0 G   689  0 C   696  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog745  hydrog ?    ? A  G   690  N1    ? ? ? 1_555 A  C   695  N3    ? ? 0 G   690  0 C   695  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog746  hydrog ?    ? A  G   690  N2    ? ? ? 1_555 A  C   695  O2    ? ? 0 G   690  0 C   695  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog747  hydrog ?    ? A  G   690  O6    ? ? ? 1_555 A  C   695  N4    ? ? 0 G   690  0 C   695  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog748  hydrog ?    ? A  G   691  N2    ? ? ? 1_555 A  A   694  N7    ? ? 0 G   691  0 A   694  1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog749  hydrog ?    ? A  A   692  N1    ? ? ? 1_555 A  G   2453 N2    ? ? 0 A   692  0 G   2453 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog750  hydrog ?    ? A  A   698  N3    ? ? ? 1_555 A  G   742  N2    ? ? 0 A   698  0 G   742  1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog751  hydrog ?    ? A  C   699  N3    ? ? ? 1_555 A  G   727  N1    ? ? 0 C   699  0 G   727  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog752  hydrog ?    ? A  C   699  N4    ? ? ? 1_555 A  G   727  O6    ? ? 0 C   699  0 G   727  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog753  hydrog ?    ? A  C   699  O2    ? ? ? 1_555 A  G   727  N2    ? ? 0 C   699  0 G   727  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog754  hydrog ?    ? A  G   702  N1    ? ? ? 1_555 A  C   726  N3    ? ? 0 G   702  0 C   726  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog755  hydrog ?    ? A  G   702  N2    ? ? ? 1_555 A  C   726  O2    ? ? 0 G   702  0 C   726  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog756  hydrog ?    ? A  G   702  O6    ? ? ? 1_555 A  C   726  N4    ? ? 0 G   702  0 C   726  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog757  hydrog ?    ? A  G   702  N7    ? ? ? 1_555 A  G   744  N2    ? ? 0 G   702  0 G   744  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? 
? ? 
hydrog758  hydrog ?    ? A  G   702  O6    ? ? ? 1_555 A  G   744  N1    ? ? 0 G   702  0 G   744  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? 
? ? 
hydrog759  hydrog ?    ? A  G   703  N1    ? ? ? 1_555 A  C   725  N3    ? ? 0 G   703  0 C   725  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog760  hydrog ?    ? A  G   703  N2    ? ? ? 1_555 A  C   725  O2    ? ? 0 G   703  0 C   725  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog761  hydrog ?    ? A  G   703  O6    ? ? ? 1_555 A  C   725  N4    ? ? 0 G   703  0 C   725  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog762  hydrog ?    ? A  C   704  N3    ? ? ? 1_555 A  G   724  N1    ? ? 0 C   704  0 G   724  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog763  hydrog ?    ? A  C   704  N4    ? ? ? 1_555 A  G   724  O6    ? ? 0 C   704  0 G   724  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog764  hydrog ?    ? A  C   704  O2    ? ? ? 1_555 A  G   724  N2    ? ? 0 C   704  0 G   724  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog765  hydrog ?    ? A  C   705  N3    ? ? ? 1_555 A  G   723  N1    ? ? 0 C   705  0 G   723  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog766  hydrog ?    ? A  C   705  N4    ? ? ? 1_555 A  G   723  O6    ? ? 0 C   705  0 G   723  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog767  hydrog ?    ? A  C   705  O2    ? ? ? 1_555 A  G   723  N2    ? ? 0 C   705  0 G   723  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog768  hydrog ?    ? A  G   706  N2    ? ? ? 1_555 A  G   722  O6    ? ? 0 G   706  0 G   722  1_555 ? ? ? ? ? ? 'G-G MISPAIR' 
?     ? ? 
hydrog769  hydrog ?    ? A  C   707  N3    ? ? ? 1_555 A  A   721  N6    ? ? 0 C   707  0 A   721  1_555 ? ? ? ? ? ? TYPE_25_PAIR 
?     ? ? 
hydrog770  hydrog ?    ? A  C   707  N4    ? ? ? 1_555 A  A   721  N7    ? ? 0 C   707  0 A   721  1_555 ? ? ? ? ? ? TYPE_25_PAIR 
?     ? ? 
hydrog771  hydrog ?    ? A  A   708  N6    ? ? ? 1_555 A  G   720  N3    ? ? 0 A   708  0 G   720  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog772  hydrog ?    ? A  A   708  N7    ? ? ? 1_555 A  G   720  N2    ? ? 0 A   708  0 G   720  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog773  hydrog ?    ? A  G   709  N1    ? ? ? 1_555 A  C   719  N3    ? ? 0 G   709  0 C   719  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog774  hydrog ?    ? A  G   709  N2    ? ? ? 1_555 A  C   719  O2    ? ? 0 G   709  0 C   719  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog775  hydrog ?    ? A  G   709  O6    ? ? ? 1_555 A  C   719  N4    ? ? 0 G   709  0 C   719  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog776  hydrog ?    ? A  G   710  N1    ? ? ? 1_555 A  C   718  N3    ? ? 0 G   710  0 C   718  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog777  hydrog ?    ? A  G   710  N2    ? ? ? 1_555 A  C   718  O2    ? ? 0 G   710  0 C   718  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog778  hydrog ?    ? A  G   710  O6    ? ? ? 1_555 A  C   718  N4    ? ? 0 G   710  0 C   718  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog779  hydrog ?    ? A  G   711  N1    ? ? ? 1_555 A  C   717  N3    ? ? 0 G   711  0 C   717  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog780  hydrog ?    ? A  G   711  N2    ? ? ? 1_555 A  C   717  O2    ? ? 0 G   711  0 C   717  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog781  hydrog ?    ? A  G   711  O6    ? ? ? 1_555 A  C   717  N4    ? ? 0 G   711  0 C   717  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog782  hydrog ?    ? A  C   712  N3    ? ? ? 1_555 A  G   716  N1    ? ? 0 C   712  0 G   716  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog783  hydrog ?    ? A  C   712  N4    ? ? ? 1_555 A  G   716  O6    ? ? 0 C   712  0 G   716  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog784  hydrog ?    ? A  C   712  O2    ? ? ? 1_555 A  G   716  N2    ? ? 0 C   712  0 G   716  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog785  hydrog ?    ? A  C   726  N4    ? ? ? 1_555 A  G   744  O6    ? ? 0 C   726  0 G   744  1_555 ? ? ? ? ? ? 'C-G PAIR' ? 
? ? 
hydrog786  hydrog ?    ? A  C   728  N3    ? ? ? 1_555 A  G   743  N1    ? ? 0 C   728  0 G   743  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog787  hydrog ?    ? A  C   728  N4    ? ? ? 1_555 A  G   743  O6    ? ? 0 C   728  0 G   743  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog788  hydrog ?    ? A  C   728  O2    ? ? ? 1_555 A  G   743  N2    ? ? 0 C   728  0 G   743  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog789  hydrog ?    ? A  C   729  N3    ? ? ? 1_555 A  G   742  N1    ? ? 0 C   729  0 G   742  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog790  hydrog ?    ? A  C   729  N4    ? ? ? 1_555 A  G   742  O6    ? ? 0 C   729  0 G   742  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog791  hydrog ?    ? A  C   729  O2    ? ? ? 1_555 A  G   742  N2    ? ? 0 C   729  0 G   742  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog792  hydrog ?    ? A  G   730  N1    ? ? ? 1_555 A  C   741  N3    ? ? 0 G   730  0 C   741  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog793  hydrog ?    ? A  G   730  N2    ? ? ? 1_555 A  C   741  O2    ? ? 0 G   730  0 C   741  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog794  hydrog ?    ? A  G   730  O6    ? ? ? 1_555 A  C   741  N4    ? ? 0 G   730  0 C   741  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog795  hydrog ?    ? A  U   731  N3    ? ? ? 1_555 A  G   740  O6    ? ? 0 U   731  0 G   740  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog796  hydrog ?    ? A  U   731  O2    ? ? ? 1_555 A  G   740  N1    ? ? 0 U   731  0 G   740  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog797  hydrog ?    ? A  C   732  N3    ? ? ? 1_555 A  G   739  N1    ? ? 0 C   732  0 G   739  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog798  hydrog ?    ? A  C   732  N4    ? ? ? 1_555 A  G   739  O6    ? ? 0 C   732  0 G   739  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog799  hydrog ?    ? A  C   732  O2    ? ? ? 1_555 A  G   739  N2    ? ? 0 C   732  0 G   739  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog800  hydrog ?    ? A  U   733  N3    ? ? ? 1_555 A  G   738  O6    ? ? 0 U   733  0 G   738  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog801  hydrog ?    ? A  U   733  O2    ? ? ? 1_555 A  G   738  N1    ? ? 0 U   733  0 G   738  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog802  hydrog ?    ? A  C   762  N3    ? ? ? 1_555 A  G   902  N1    ? ? 0 C   762  0 G   902  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog803  hydrog ?    ? A  C   762  N4    ? ? ? 1_555 A  G   902  O6    ? ? 0 C   762  0 G   902  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog804  hydrog ?    ? A  C   762  O2    ? ? ? 1_555 A  G   902  N2    ? ? 0 C   762  0 G   902  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog805  hydrog ?    ? A  C   763  N3    ? ? ? 1_555 A  G   901  N1    ? ? 0 C   763  0 G   901  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog806  hydrog ?    ? A  C   763  N4    ? ? ? 1_555 A  G   901  O6    ? ? 0 C   763  0 G   901  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog807  hydrog ?    ? A  C   763  O2    ? ? ? 1_555 A  G   901  N2    ? ? 0 C   763  0 G   901  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog808  hydrog ?    ? A  C   764  N4    ? ? ? 1_555 A  U   900  O4    ? ? 0 C   764  0 U   900  1_555 ? ? ? ? ? ? 'C-U MISPAIR' 
?     ? ? 
hydrog809  hydrog ?    ? A  G   765  N1    ? ? ? 1_555 A  C   899  N3    ? ? 0 G   765  0 C   899  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog810  hydrog ?    ? A  G   765  N2    ? ? ? 1_555 A  C   899  O2    ? ? 0 G   765  0 C   899  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog811  hydrog ?    ? A  G   765  O6    ? ? ? 1_555 A  C   899  N4    ? ? 0 G   765  0 C   899  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog812  hydrog ?    ? A  A   766  N6    ? ? ? 1_555 A  C   896  N3    ? ? 0 A   766  0 C   896  1_555 ? ? ? ? ? ? TYPE_25_PAIR 
?     ? ? 
hydrog813  hydrog ?    ? A  A   766  N7    ? ? ? 1_555 A  C   896  N4    ? ? 0 A   766  0 C   896  1_555 ? ? ? ? ? ? TYPE_25_PAIR 
?     ? ? 
hydrog814  hydrog ?    ? A  A   767  N6    ? ? ? 1_555 A  A   895  N1    ? ? 0 A   767  0 A   895  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? 
? ? 
hydrog815  hydrog ?    ? A  A   767  N7    ? ? ? 1_555 A  A   895  N6    ? ? 0 A   767  0 A   895  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? 
? ? 
hydrog816  hydrog ?    ? A  A   767  N3    ? ? ? 1_555 A  G   2110 N2    ? ? 0 A   767  0 G   2110 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog817  hydrog ?    ? A  U   768  O4    ? ? ? 1_555 A  C   893  N4    ? ? 0 U   768  0 C   893  1_555 ? ? ? ? ? ? 'U-C MISPAIR' 
?     ? ? 
hydrog818  hydrog ?    ? A  C   769  N3    ? ? ? 1_555 A  G   892  N1    ? ? 0 C   769  0 G   892  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog819  hydrog ?    ? A  C   769  N4    ? ? ? 1_555 A  G   892  O6    ? ? 0 C   769  0 G   892  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog820  hydrog ?    ? A  C   769  O2    ? ? ? 1_555 A  G   892  N2    ? ? 0 C   769  0 G   892  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog821  hydrog ?    ? A  C   770  N3    ? ? ? 1_555 A  G   891  N1    ? ? 0 C   770  0 G   891  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog822  hydrog ?    ? A  C   770  N4    ? ? ? 1_555 A  G   891  O6    ? ? 0 C   770  0 G   891  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog823  hydrog ?    ? A  C   770  O2    ? ? ? 1_555 A  G   891  N2    ? ? 0 C   770  0 G   891  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog824  hydrog ?    ? A  G   771  N1    ? ? ? 1_555 A  C   890  N3    ? ? 0 G   771  0 C   890  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog825  hydrog ?    ? A  G   771  N2    ? ? ? 1_555 A  C   890  O2    ? ? 0 G   771  0 C   890  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog826  hydrog ?    ? A  G   771  O6    ? ? ? 1_555 A  C   890  N4    ? ? 0 G   771  0 C   890  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog827  hydrog ?    ? A  G   772  N1    ? ? ? 1_555 A  C   889  N3    ? ? 0 G   772  0 C   889  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog828  hydrog ?    ? A  G   772  N2    ? ? ? 1_555 A  C   889  O2    ? ? 0 G   772  0 C   889  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog829  hydrog ?    ? A  G   772  O6    ? ? ? 1_555 A  C   889  N4    ? ? 0 G   772  0 C   889  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog830  hydrog ?    ? A  A   773  N1    ? ? ? 1_555 A  U   888  N3    ? ? 0 A   773  0 U   888  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog831  hydrog ?    ? A  A   773  N6    ? ? ? 1_555 A  U   888  O4    ? ? 0 A   773  0 U   888  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog832  hydrog ?    ? A  C   774  N3    ? ? ? 1_555 A  G   887  N1    ? ? 0 C   774  0 G   887  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog833  hydrog ?    ? A  C   774  N4    ? ? ? 1_555 A  G   887  O6    ? ? 0 C   774  0 G   887  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog834  hydrog ?    ? A  C   774  O2    ? ? ? 1_555 A  G   887  N2    ? ? 0 C   774  0 G   887  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog835  hydrog ?    ? A  G   775  N1    ? ? ? 1_555 A  G   868  N7    ? ? 0 G   775  0 G   868  1_555 ? ? ? ? ? ? TYPE_7_PAIR ? 
? ? 
hydrog836  hydrog ?    ? A  G   775  N2    ? ? ? 1_555 A  G   868  O6    ? ? 0 G   775  0 G   868  1_555 ? ? ? ? ? ? TYPE_7_PAIR ? 
? ? 
hydrog837  hydrog ?    ? A  A   776  N3    ? ? ? 1_555 A  U   779  N3    ? ? 0 A   776  0 U   779  1_555 ? ? ? ? ? ? 'A-U PAIR' ? 
? ? 
hydrog838  hydrog ?    ? A  A   776  N1    ? ? ? 1_555 A  G   871  N2    ? ? 0 A   776  0 G   871  1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog839  hydrog ?    ? A  A   776  N6    ? ? ? 1_555 A  G   871  N3    ? ? 0 A   776  0 G   871  1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog840  hydrog ?    ? A  C   778  O2    ? ? ? 1_555 A  A   1836 N6    ? ? 0 C   778  0 A   1836 1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog841  hydrog ?    ? A  A   780  N1    ? ? ? 1_555 A  U   866  N3    ? ? 0 A   780  0 U   866  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog842  hydrog ?    ? A  A   780  N6    ? ? ? 1_555 A  U   866  O4    ? ? 0 A   780  0 U   866  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog843  hydrog ?    ? A  C   781  N3    ? ? ? 1_555 A  G   865  N1    ? ? 0 C   781  0 G   865  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog844  hydrog ?    ? A  C   781  N4    ? ? ? 1_555 A  G   865  O6    ? ? 0 C   781  0 G   865  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog845  hydrog ?    ? A  C   781  O2    ? ? ? 1_555 A  G   865  N2    ? ? 0 C   781  0 G   865  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog846  hydrog ?    ? A  G   782  N1    ? ? ? 1_555 A  U   864  O2    ? ? 0 G   782  0 U   864  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog847  hydrog ?    ? A  G   782  O6    ? ? ? 1_555 A  U   864  N3    ? ? 0 G   782  0 U   864  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog848  hydrog ?    ? A  C   783  N3    ? ? ? 1_555 A  G   863  N1    ? ? 0 C   783  0 G   863  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog849  hydrog ?    ? A  C   783  N4    ? ? ? 1_555 A  G   863  O6    ? ? 0 C   783  0 G   863  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog850  hydrog ?    ? A  C   783  O2    ? ? ? 1_555 A  G   863  N2    ? ? 0 C   783  0 G   863  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog851  hydrog ?    ? A  A   784  N1    ? ? ? 1_555 A  U   862  N3    ? ? 0 A   784  0 U   862  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog852  hydrog ?    ? A  A   784  N6    ? ? ? 1_555 A  U   862  O4    ? ? 0 A   784  0 U   862  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog853  hydrog ?    ? A  U   785  N3    ? ? ? 1_555 A  A   861  N1    ? ? 0 U   785  0 A   861  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog854  hydrog ?    ? A  U   785  O4    ? ? ? 1_555 A  A   861  N6    ? ? 0 U   785  0 A   861  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog855  hydrog ?    ? A  G   786  N1    ? ? ? 1_555 A  U   860  O2    ? ? 0 G   786  0 U   860  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog856  hydrog ?    ? A  G   786  O6    ? ? ? 1_555 A  U   860  N3    ? ? 0 G   786  0 U   860  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog857  hydrog ?    ? A  G   787  N1    ? ? ? 1_555 A  C   859  N3    ? ? 0 G   787  0 C   859  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog858  hydrog ?    ? A  G   787  N2    ? ? ? 1_555 A  C   859  O2    ? ? 0 G   787  0 C   859  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog859  hydrog ?    ? A  G   787  O6    ? ? ? 1_555 A  C   859  N4    ? ? 0 G   787  0 C   859  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog860  hydrog ?    ? A  A   788  N1    ? ? ? 1_555 A  U   858  N3    ? ? 0 A   788  0 U   858  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog861  hydrog ?    ? A  A   788  N6    ? ? ? 1_555 A  U   858  O4    ? ? 0 A   788  0 U   858  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog862  hydrog ?    ? A  C   789  N3    ? ? ? 1_555 A  G   856  N1    ? ? 0 C   789  0 G   856  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog863  hydrog ?    ? A  C   789  N4    ? ? ? 1_555 A  G   856  O6    ? ? 0 C   789  0 G   856  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog864  hydrog ?    ? A  C   789  O2    ? ? ? 1_555 A  G   856  N2    ? ? 0 C   789  0 G   856  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog865  hydrog ?    ? A  A   790  N6    ? ? ? 1_555 A  G   824  N3    ? ? 0 A   790  0 G   824  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog866  hydrog ?    ? A  A   790  N7    ? ? ? 1_555 A  G   824  N2    ? ? 0 A   790  0 G   824  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog867  hydrog ?    ? A  A   790  N1    ? ? ? 1_555 A  G   1709 N2    ? ? 0 A   790  0 G   1709 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog868  hydrog ?    ? A  A   791  N1    ? ? ? 1_555 A  U   823  N3    ? ? 0 A   791  0 U   823  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog869  hydrog ?    ? A  A   791  N6    ? ? ? 1_555 A  U   823  O4    ? ? 0 A   791  0 U   823  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog870  hydrog ?    ? A  G   792  N1    ? ? ? 1_555 A  C   822  N3    ? ? 0 G   792  0 C   822  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog871  hydrog ?    ? A  G   792  N2    ? ? ? 1_555 A  C   822  O2    ? ? 0 G   792  0 C   822  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog872  hydrog ?    ? A  G   792  O6    ? ? ? 1_555 A  C   822  N4    ? ? 0 G   792  0 C   822  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog873  hydrog ?    ? A  A   793  N1    ? ? ? 1_555 A  U   821  N3    ? ? 0 A   793  0 U   821  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog874  hydrog ?    ? A  A   793  N6    ? ? ? 1_555 A  U   821  O4    ? ? 0 A   793  0 U   821  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog875  hydrog ?    ? A  U   794  N3    ? ? ? 1_555 A  A   819  N1    ? ? 0 U   794  0 A   819  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog876  hydrog ?    ? A  U   794  O4    ? ? ? 1_555 A  A   819  N6    ? ? 0 U   794  0 A   819  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog877  hydrog ?    ? A  G   795  N2    ? ? ? 1_555 A  A   818  N7    ? ? 0 G   795  0 A   818  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog878  hydrog ?    ? A  G   795  N3    ? ? ? 1_555 A  A   818  N6    ? ? 0 G   795  0 A   818  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog879  hydrog ?    ? A  A   796  N6    ? ? ? 1_555 A  G   817  N3    ? ? 0 A   796  0 G   817  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog880  hydrog ?    ? A  A   796  N7    ? ? ? 1_555 A  G   817  N2    ? ? 0 A   796  0 G   817  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog881  hydrog ?    ? A  A   797  N6    ? ? ? 1_555 A  G   816  N3    ? ? 0 A   797  0 G   816  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog882  hydrog ?    ? A  A   797  N7    ? ? ? 1_555 A  G   816  N2    ? ? 0 A   797  0 G   816  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog883  hydrog ?    ? A  G   798  N1    ? ? ? 1_555 A  U   815  O2    ? ? 0 G   798  0 U   815  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog884  hydrog ?    ? A  G   798  O6    ? ? ? 1_555 A  U   815  N3    ? ? 0 G   798  0 U   815  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog885  hydrog ?    ? A  C   799  N3    ? ? ? 1_555 A  G   814  N1    ? ? 0 C   799  0 G   814  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog886  hydrog ?    ? A  C   799  N4    ? ? ? 1_555 A  G   814  O6    ? ? 0 C   799  0 G   814  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog887  hydrog ?    ? A  C   799  O2    ? ? ? 1_555 A  G   814  N2    ? ? 0 C   799  0 G   814  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog888  hydrog ?    ? A  G   800  N1    ? ? ? 1_555 A  C   813  N3    ? ? 0 G   800  0 C   813  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog889  hydrog ?    ? A  G   800  N2    ? ? ? 1_555 A  C   813  O2    ? ? 0 G   800  0 C   813  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog890  hydrog ?    ? A  G   800  O6    ? ? ? 1_555 A  C   813  N4    ? ? 0 G   800  0 C   813  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog891  hydrog ?    ? A  U   801  N3    ? ? ? 1_555 A  A   812  N1    ? ? 0 U   801  0 A   812  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog892  hydrog ?    ? A  U   801  O4    ? ? ? 1_555 A  A   812  N6    ? ? 0 U   801  0 A   812  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog893  hydrog ?    ? A  G   802  N1    ? ? ? 1_555 A  C   811  N3    ? ? 0 G   802  0 C   811  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog894  hydrog ?    ? A  G   802  N2    ? ? ? 1_555 A  C   811  O2    ? ? 0 G   802  0 C   811  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog895  hydrog ?    ? A  G   802  O6    ? ? ? 1_555 A  C   811  N4    ? ? 0 G   802  0 C   811  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog896  hydrog ?    ? A  C   803  N3    ? ? ? 1_555 A  G   810  N1    ? ? 0 C   803  0 G   810  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog897  hydrog ?    ? A  C   803  N4    ? ? ? 1_555 A  G   810  O6    ? ? 0 C   803  0 G   810  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog898  hydrog ?    ? A  C   803  O2    ? ? ? 1_555 A  G   810  N2    ? ? 0 C   803  0 G   810  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog899  hydrog ?    ? A  C   804  N3    ? ? ? 1_555 A  G   809  N1    ? ? 0 C   804  0 G   809  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog900  hydrog ?    ? A  C   804  N4    ? ? ? 1_555 A  G   809  O6    ? ? 0 C   804  0 G   809  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog901  hydrog ?    ? A  C   804  O2    ? ? ? 1_555 A  G   809  N2    ? ? 0 C   804  0 G   809  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog902  hydrog ?    ? A  G   805  N2    ? ? ? 1_555 A  A   808  N7    ? ? 0 G   805  0 A   808  1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog903  hydrog ?    ? A  G   820  N1    ? ? ? 1_555 A  C   1830 N3    ? ? 0 G   820  0 C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog904  hydrog ?    ? A  G   820  N2    ? ? ? 1_555 A  C   1830 O2    ? ? 0 G   820  0 C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog905  hydrog ?    ? A  G   820  O6    ? ? ? 1_555 A  C   1830 N4    ? ? 0 G   820  0 C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog906  hydrog ?    ? A  A   827  N6    ? ? ? 1_555 A  G   854  N3    ? ? 0 A   827  0 G   854  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog907  hydrog ?    ? A  A   827  N7    ? ? ? 1_555 A  G   854  N2    ? ? 0 A   827  0 G   854  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog908  hydrog ?    ? A  G   828  N1    ? ? ? 1_555 A  C   853  N3    ? ? 0 G   828  0 C   853  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog909  hydrog ?    ? A  G   828  N2    ? ? ? 1_555 A  C   853  O2    ? ? 0 G   828  0 C   853  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog910  hydrog ?    ? A  G   828  O6    ? ? ? 1_555 A  C   853  N4    ? ? 0 G   828  0 C   853  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog911  hydrog ?    ? A  A   829  N1    ? ? ? 1_555 A  U   852  N3    ? ? 0 A   829  0 U   852  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog912  hydrog ?    ? A  A   829  N6    ? ? ? 1_555 A  U   852  O4    ? ? 0 A   829  0 U   852  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog913  hydrog ?    ? A  G   830  N1    ? ? ? 1_555 A  C   851  N3    ? ? 0 G   830  0 C   851  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog914  hydrog ?    ? A  G   830  N2    ? ? ? 1_555 A  C   851  O2    ? ? 0 G   830  0 C   851  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog915  hydrog ?    ? A  G   830  O6    ? ? ? 1_555 A  C   851  N4    ? ? 0 G   830  0 C   851  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog916  hydrog ?    ? A  G   830  N2    ? ? ? 1_555 A  A   2022 N1    ? ? 0 G   830  0 A   2022 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog917  hydrog ?    ? A  U   832  N3    ? ? ? 1_555 A  U   850  O2    ? ? 0 U   832  0 U   850  1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog918  hydrog ?    ? A  U   832  O4    ? ? ? 1_555 A  U   850  N3    ? ? 0 U   832  0 U   850  1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog919  hydrog ?    ? A  G   833  N1    ? ? ? 1_555 A  C   849  N3    ? ? 0 G   833  0 C   849  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog920  hydrog ?    ? A  G   833  N2    ? ? ? 1_555 A  C   849  O2    ? ? 0 G   833  0 C   849  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog921  hydrog ?    ? A  G   833  O6    ? ? ? 1_555 A  C   849  N4    ? ? 0 G   833  0 C   849  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog922  hydrog ?    ? A  G   834  N1    ? ? ? 1_555 A  C   848  N3    ? ? 0 G   834  0 C   848  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog923  hydrog ?    ? A  G   834  N2    ? ? ? 1_555 A  C   848  O2    ? ? 0 G   834  0 C   848  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog924  hydrog ?    ? A  G   834  O6    ? ? ? 1_555 A  C   848  N4    ? ? 0 G   834  0 C   848  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog925  hydrog ?    ? A  G   836  N1    ? ? ? 1_555 A  C   847  N3    ? ? 0 G   836  0 C   847  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog926  hydrog ?    ? A  G   836  N2    ? ? ? 1_555 A  C   847  O2    ? ? 0 G   836  0 C   847  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog927  hydrog ?    ? A  G   836  O6    ? ? ? 1_555 A  C   847  N4    ? ? 0 G   836  0 C   847  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog928  hydrog ?    ? A  U   837  N3    ? ? ? 1_555 A  A   846  N1    ? ? 0 U   837  0 A   846  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog929  hydrog ?    ? A  U   837  O4    ? ? ? 1_555 A  A   846  N6    ? ? 0 U   837  0 A   846  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog930  hydrog ?    ? A  C   838  O2    ? ? ? 1_555 A  A   843  N6    ? ? 0 C   838  0 A   843  1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog931  hydrog ?    ? A  U   840  N3    ? ? ? 1_555 A  A   2055 N3    ? ? 0 U   840  0 A   2055 1_555 ? ? ? ? ? ? 'U-A PAIR' ? 
? ? 
hydrog932  hydrog ?    ? A  C   842  N4    ? ? ? 1_555 A  A   846  N3    ? ? 0 C   842  0 A   846  1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog933  hydrog ?    ? A  A   857  N6    ? ? ? 1_555 A  U   1831 O4    ? ? 0 A   857  0 U   1831 1_555 ? ? ? ? ? ? HOOGSTEEN ? ? 
? 
hydrog934  hydrog ?    ? A  A   857  N7    ? ? ? 1_555 A  U   1831 N3    ? ? 0 A   857  0 U   1831 1_555 ? ? ? ? ? ? HOOGSTEEN ? ? 
? 
hydrog935  hydrog ?    ? A  A   857  N6    ? ? ? 1_555 A  A   1845 N3    ? ? 0 A   857  0 A   1845 1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog936  hydrog ?    ? A  A   861  N3    ? ? ? 1_555 A  U   1488 N3    ? ? 0 A   861  0 U   1488 1_555 ? ? ? ? ? ? 'A-U PAIR' ? 
? ? 
hydrog937  hydrog ?    ? A  G   863  N2    ? ? ? 1_555 A  A   1459 N3    ? ? 0 G   863  0 A   1459 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog938  hydrog ?    ? A  A   867  N3    ? ? ? 1_555 A  G   870  N2    ? ? 0 A   867  0 G   870  1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog939  hydrog ?    ? A  G   868  N1    ? ? ? 1_555 A  C   884  N3    ? ? 0 G   868  0 C   884  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog940  hydrog ?    ? A  G   868  N2    ? ? ? 1_555 A  C   884  O2    ? ? 0 G   868  0 C   884  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog941  hydrog ?    ? A  G   868  O6    ? ? ? 1_555 A  C   884  N4    ? ? 0 G   868  0 C   884  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog942  hydrog ?    ? A  G   870  N1    ? ? ? 1_555 A  C   880  N3    ? ? 0 G   870  0 C   880  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog943  hydrog ?    ? A  G   870  N2    ? ? ? 1_555 A  C   880  O2    ? ? 0 G   870  0 C   880  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog944  hydrog ?    ? A  G   870  O6    ? ? ? 1_555 A  C   880  N4    ? ? 0 G   870  0 C   880  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog945  hydrog ?    ? A  G   871  N1    ? ? ? 1_555 A  C   879  N3    ? ? 0 G   871  0 C   879  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog946  hydrog ?    ? A  G   871  N2    ? ? ? 1_555 A  C   879  O2    ? ? 0 G   871  0 C   879  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog947  hydrog ?    ? A  G   871  O6    ? ? ? 1_555 A  C   879  N4    ? ? 0 G   871  0 C   879  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog948  hydrog ?    ? A  U   872  N3    ? ? ? 1_555 A  G   878  O6    ? ? 0 U   872  0 G   878  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog949  hydrog ?    ? A  U   872  O2    ? ? ? 1_555 A  G   878  N1    ? ? 0 U   872  0 G   878  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog950  hydrog ?    ? A  G   873  N2    ? ? ? 1_555 A  A   876  N1    ? ? 0 G   873  0 A   876  1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog951  hydrog ?    ? A  G   873  N3    ? ? ? 1_555 A  A   876  N6    ? ? 0 G   873  0 A   876  1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog952  hydrog ?    ? A  A   874  N3    ? ? ? 1_555 A  G   1832 N2    ? ? 0 A   874  0 G   1832 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog953  hydrog ?    ? A  G   885  N2    ? ? ? 1_555 A  G   2113 N3    ? ? 0 G   885  0 G   2113 1_555 ? ? ? ? ? ? 'G-G MISPAIR' 
?     ? ? 
hydrog954  hydrog ?    ? A  U   900  O2    ? ? ? 1_555 A  A   2101 N6    ? ? 0 U   900  0 A   2101 1_555 ? ? ? ? ? ? 'U-A PAIR' ? 
? ? 
hydrog955  hydrog ?    ? A  G   901  N2    ? ? ? 1_555 A  A   1358 N3    ? ? 0 G   901  0 A   1358 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog956  hydrog ?    ? A  C   905  N3    ? ? ? 1_555 A  G   1300 N1    ? ? 0 C   905  0 G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog957  hydrog ?    ? A  C   905  N4    ? ? ? 1_555 A  G   1300 O6    ? ? 0 C   905  0 G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog958  hydrog ?    ? A  C   905  O2    ? ? ? 1_555 A  G   1300 N2    ? ? 0 C   905  0 G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog959  hydrog ?    ? A  C   906  N3    ? ? ? 1_555 A  G   1299 N1    ? ? 0 C   906  0 G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog960  hydrog ?    ? A  C   906  N4    ? ? ? 1_555 A  G   1299 O6    ? ? 0 C   906  0 G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog961  hydrog ?    ? A  C   906  O2    ? ? ? 1_555 A  G   1299 N2    ? ? 0 C   906  0 G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog962  hydrog ?    ? A  C   906  O2    ? ? ? 1_555 A  G   1329 N2    ? ? 0 C   906  0 G   1329 1_555 ? ? ? ? ? ? 'C-G PAIR' ? 
? ? 
hydrog963  hydrog ?    ? A  A   907  N1    ? ? ? 1_555 A  U   1298 N3    ? ? 0 A   907  0 U   1298 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog964  hydrog ?    ? A  A   907  N6    ? ? ? 1_555 A  U   1298 O4    ? ? 0 A   907  0 U   1298 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog965  hydrog ?    ? A  A   908  N1    ? ? ? 1_555 A  U   1297 N3    ? ? 0 A   908  0 U   1297 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog966  hydrog ?    ? A  A   908  N6    ? ? ? 1_555 A  U   1297 O4    ? ? 0 A   908  0 U   1297 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog967  hydrog ?    ? A  U   909  N3    ? ? ? 1_555 A  A   1296 N1    ? ? 0 U   909  0 A   1296 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog968  hydrog ?    ? A  U   909  O4    ? ? ? 1_555 A  A   1296 N6    ? ? 0 U   909  0 A   1296 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog969  hydrog ?    ? A  C   910  N3    ? ? ? 1_555 A  G   1295 N1    ? ? 0 C   910  0 G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog970  hydrog ?    ? A  C   910  N4    ? ? ? 1_555 A  G   1295 O6    ? ? 0 C   910  0 G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog971  hydrog ?    ? A  C   910  O2    ? ? ? 1_555 A  G   1295 N2    ? ? 0 C   910  0 G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog972  hydrog ?    ? A  G   911  N2    ? ? ? 1_555 A  A   1294 N7    ? ? 0 G   911  0 A   1294 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog973  hydrog ?    ? A  G   911  N3    ? ? ? 1_555 A  A   1294 N6    ? ? 0 G   911  0 A   1294 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog974  hydrog ?    ? A  A   912  N6    ? ? ? 1_555 A  U   1293 O2    ? ? 0 A   912  0 U   1293 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog975  hydrog ?    ? A  A   912  N7    ? ? ? 1_555 A  U   1293 N3    ? ? 0 A   912  0 U   1293 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog976  hydrog ?    ? A  A   913  N6    ? ? ? 1_555 A  G   1071 O6    ? ? 0 A   913  0 G   1071 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog977  hydrog ?    ? A  A   914  N6    ? ? ? 1_555 A  A   1070 N3    ? ? 0 A   914  0 A   1070 1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog978  hydrog ?    ? A  C   915  N3    ? ? ? 1_555 A  G   928  N1    ? ? 0 C   915  0 G   928  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog979  hydrog ?    ? A  C   915  N4    ? ? ? 1_555 A  G   928  O6    ? ? 0 C   915  0 G   928  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog980  hydrog ?    ? A  C   915  O2    ? ? ? 1_555 A  G   928  N2    ? ? 0 C   915  0 G   928  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog981  hydrog ?    ? A  C   915  N4    ? ? ? 1_555 A  U   1042 O2    ? ? 0 C   915  0 U   1042 1_555 ? ? ? ? ? ? 'C-U MISPAIR' 
?     ? ? 
hydrog982  hydrog ?    ? A  A   916  N1    ? ? ? 1_555 A  U   927  N3    ? ? 0 A   916  0 U   927  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog983  hydrog ?    ? A  A   916  N6    ? ? ? 1_555 A  U   927  O4    ? ? 0 A   916  0 U   927  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog984  hydrog ?    ? A  U   917  N3    ? ? ? 1_555 A  A   926  N1    ? ? 0 U   917  0 A   926  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog985  hydrog ?    ? A  U   917  O4    ? ? ? 1_555 A  A   926  N6    ? ? 0 U   917  0 A   926  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog986  hydrog ?    ? A  G   918  N1    ? ? ? 1_555 A  C   925  N3    ? ? 0 G   918  0 C   925  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog987  hydrog ?    ? A  G   918  N2    ? ? ? 1_555 A  C   925  O2    ? ? 0 G   918  0 C   925  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog988  hydrog ?    ? A  G   918  O6    ? ? ? 1_555 A  C   925  N4    ? ? 0 G   918  0 C   925  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog989  hydrog ?    ? A  U   919  N3    ? ? ? 1_555 A  G   924  O6    ? ? 0 U   919  0 G   924  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog990  hydrog ?    ? A  U   919  O2    ? ? ? 1_555 A  G   924  N1    ? ? 0 U   919  0 G   924  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog991  hydrog ?    ? A  G   921  O6    ? ? ? 1_555 A  G   2279 N2    ? ? 0 G   921  0 G   2279 1_555 ? ? ? ? ? ? 'G-G MISPAIR' 
?     ? ? 
hydrog992  hydrog ?    ? A  A   923  N6    ? ? ? 1_555 A  U   2107 O2    ? ? 0 A   923  0 U   2107 1_555 ? ? ? ? ? ? 'A-U PAIR' ? 
? ? 
hydrog993  hydrog ?    ? A  A   923  N6    ? ? ? 1_555 A  G   2480 N3    ? ? 0 A   923  0 G   2480 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog994  hydrog ?    ? A  A   926  N6    ? ? ? 1_555 A  C   1043 N3    ? ? 0 A   926  0 C   1043 1_555 ? ? ? ? ? ? TYPE_25_PAIR 
?     ? ? 
hydrog995  hydrog ?    ? A  A   926  N7    ? ? ? 1_555 A  C   1043 N4    ? ? 0 A   926  0 C   1043 1_555 ? ? ? ? ? ? TYPE_25_PAIR 
?     ? ? 
hydrog996  hydrog ?    ? A  G   928  N2    ? ? ? 1_555 A  A   2394 N1    ? ? 0 G   928  0 A   2394 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog997  hydrog ?    ? A  A   929  N6    ? ? ? 1_555 A  U   1041 O4    ? ? 0 A   929  0 U   1041 1_555 ? ? ? ? ? ? 'A-U PAIR' ? 
? ? 
hydrog998  hydrog ?    ? A  C   930  O2    ? ? ? 1_555 A  A   1040 N6    ? ? 0 C   930  0 A   1040 1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog999  hydrog ?    ? A  C   931  N3    ? ? ? 1_555 A  G   1039 N1    ? ? 0 C   931  0 G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1000 hydrog ?    ? A  C   931  N4    ? ? ? 1_555 A  G   1039 O6    ? ? 0 C   931  0 G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1001 hydrog ?    ? A  C   931  O2    ? ? ? 1_555 A  G   1039 N2    ? ? 0 C   931  0 G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1002 hydrog ?    ? A  U   932  N3    ? ? ? 1_555 A  G   1038 O6    ? ? 0 U   932  0 G   1038 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1003 hydrog ?    ? A  U   932  O2    ? ? ? 1_555 A  G   1038 N1    ? ? 0 U   932  0 G   1038 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1004 hydrog ?    ? A  C   933  N3    ? ? ? 1_555 A  G   1037 N1    ? ? 0 C   933  0 G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1005 hydrog ?    ? A  C   933  N4    ? ? ? 1_555 A  G   1037 O6    ? ? 0 C   933  0 G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1006 hydrog ?    ? A  C   933  O2    ? ? ? 1_555 A  G   1037 N2    ? ? 0 C   933  0 G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1007 hydrog ?    ? A  C   934  N3    ? ? ? 1_555 A  G   1036 N1    ? ? 0 C   934  0 G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1008 hydrog ?    ? A  C   934  N4    ? ? ? 1_555 A  G   1036 O6    ? ? 0 C   934  0 G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1009 hydrog ?    ? A  C   934  O2    ? ? ? 1_555 A  G   1036 N2    ? ? 0 C   934  0 G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1010 hydrog ?    ? A  G   935  N1    ? ? ? 1_555 A  C   1035 N3    ? ? 0 G   935  0 C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1011 hydrog ?    ? A  G   935  N2    ? ? ? 1_555 A  C   1035 O2    ? ? 0 G   935  0 C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1012 hydrog ?    ? A  G   935  O6    ? ? ? 1_555 A  C   1035 N4    ? ? 0 G   935  0 C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1013 hydrog ?    ? A  C   936  N3    ? ? ? 1_555 A  G   1034 N1    ? ? 0 C   936  0 G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1014 hydrog ?    ? A  C   936  N4    ? ? ? 1_555 A  G   1034 O6    ? ? 0 C   936  0 G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1015 hydrog ?    ? A  C   936  O2    ? ? ? 1_555 A  G   1034 N2    ? ? 0 C   936  0 G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1016 hydrog ?    ? A  C   937  O2    ? ? ? 1_555 A  C   1033 N4    ? ? 0 C   937  0 C   1033 1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog1017 hydrog ?    ? A  G   938  N2    ? ? ? 1_555 A  A   1032 N7    ? ? 0 G   938  0 A   1032 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1018 hydrog ?    ? A  A   939  N3    ? ? ? 1_555 A  G   1027 N2    ? ? 0 A   939  0 G   1027 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog1019 hydrog ?    ? A  A   939  N6    ? ? ? 1_555 A  G   1031 N3    ? ? 0 A   939  0 G   1031 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1020 hydrog ?    ? A  A   939  N7    ? ? ? 1_555 A  G   1031 N2    ? ? 0 A   939  0 G   1031 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1021 hydrog ?    ? A  G   940  N1    ? ? ? 1_555 A  U   1026 O2    ? ? 0 G   940  0 U   1026 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1022 hydrog ?    ? A  G   940  O6    ? ? ? 1_555 A  U   1026 N3    ? ? 0 G   940  0 U   1026 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1023 hydrog ?    ? A  G   940  N2    ? ? ? 1_555 A  A   1032 N3    ? ? 0 G   940  0 A   1032 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1024 hydrog ?    ? A  G   941  N1    ? ? ? 1_555 A  C   1025 N3    ? ? 0 G   941  0 C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1025 hydrog ?    ? A  G   941  N2    ? ? ? 1_555 A  C   1025 O2    ? ? 0 G   941  0 C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1026 hydrog ?    ? A  G   941  O6    ? ? ? 1_555 A  C   1025 N4    ? ? 0 G   941  0 C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1027 hydrog ?    ? A  U   942  N3    ? ? ? 1_555 A  G   1024 O6    ? ? 0 U   942  0 G   1024 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1028 hydrog ?    ? A  U   942  O2    ? ? ? 1_555 A  G   1024 N1    ? ? 0 U   942  0 G   1024 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1029 hydrog ?    ? A  A   943  N6    ? ? ? 1_555 A  C   1025 O2    ? ? 0 A   943  0 C   1025 1_555 ? ? ? ? ? ? 'A-C MISPAIR' 
?     ? ? 
hydrog1030 hydrog ?    ? A  G   944  N1    ? ? ? 1_555 A  C   1023 N3    ? ? 0 G   944  0 C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1031 hydrog ?    ? A  G   944  N2    ? ? ? 1_555 A  C   1023 O2    ? ? 0 G   944  0 C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1032 hydrog ?    ? A  G   944  O6    ? ? ? 1_555 A  C   1023 N4    ? ? 0 G   944  0 C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1033 hydrog ?    ? A  U   945  N3    ? ? ? 1_555 A  A   1022 N1    ? ? 0 U   945  0 A   1022 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1034 hydrog ?    ? A  U   945  O4    ? ? ? 1_555 A  A   1022 N6    ? ? 0 U   945  0 A   1022 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1035 hydrog ?    ? A  C   946  N3    ? ? ? 1_555 A  G   1021 N1    ? ? 0 C   946  0 G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1036 hydrog ?    ? A  C   946  N4    ? ? ? 1_555 A  G   1021 O6    ? ? 0 C   946  0 G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1037 hydrog ?    ? A  C   946  O2    ? ? ? 1_555 A  G   1021 N2    ? ? 0 C   946  0 G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1038 hydrog ?    ? A  U   947  N3    ? ? ? 1_555 A  A   1020 N1    ? ? 0 U   947  0 A   1020 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1039 hydrog ?    ? A  U   947  O4    ? ? ? 1_555 A  A   1020 N6    ? ? 0 U   947  0 A   1020 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1040 hydrog ?    ? A  G   948  N1    ? ? ? 1_555 A  C   1019 N3    ? ? 0 G   948  0 C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1041 hydrog ?    ? A  G   948  N2    ? ? ? 1_555 A  C   1019 O2    ? ? 0 G   948  0 C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1042 hydrog ?    ? A  G   948  O6    ? ? ? 1_555 A  C   1019 N4    ? ? 0 G   948  0 C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1043 hydrog ?    ? A  U   949  N3    ? ? ? 1_555 A  A   1018 N1    ? ? 0 U   949  0 A   1018 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1044 hydrog ?    ? A  U   949  O4    ? ? ? 1_555 A  A   1018 N6    ? ? 0 U   949  0 A   1018 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1045 hydrog ?    ? A  G   950  N1    ? ? ? 1_555 A  U   1017 O2    ? ? 0 G   950  0 U   1017 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1046 hydrog ?    ? A  G   950  O6    ? ? ? 1_555 A  U   1017 N3    ? ? 0 G   950  0 U   1017 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1047 hydrog ?    ? A  A   951  N1    ? ? ? 1_555 A  U   1016 N3    ? ? 0 A   951  0 U   1016 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1048 hydrog ?    ? A  A   951  N6    ? ? ? 1_555 A  U   1016 O4    ? ? 0 A   951  0 U   1016 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1049 hydrog ?    ? A  G   952  N1    ? ? ? 1_555 A  C   1015 N3    ? ? 0 G   952  0 C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1050 hydrog ?    ? A  G   952  N2    ? ? ? 1_555 A  C   1015 O2    ? ? 0 G   952  0 C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1051 hydrog ?    ? A  G   952  O6    ? ? ? 1_555 A  C   1015 N4    ? ? 0 G   952  0 C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1052 hydrog ?    ? A  G   953  N2    ? ? ? 1_555 A  U   954  O4    ? ? 0 G   953  0 U   954  1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog1053 hydrog ?    ? A  U   954  N3    ? ? ? 1_555 A  A   1013 N7    ? ? 0 U   954  0 A   1013 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1054 hydrog ?    ? A  U   954  O2    ? ? ? 1_555 A  A   1013 N6    ? ? 0 U   954  0 A   1013 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1055 hydrog ?    ? A  A   955  N6    ? ? ? 1_555 A  A   1012 N3    ? ? 0 A   955  0 A   1012 1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog1056 hydrog ?    ? A  G   956  N1    ? ? ? 1_555 A  C   1011 N3    ? ? 0 G   956  0 C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1057 hydrog ?    ? A  G   956  N2    ? ? ? 1_555 A  C   1011 O2    ? ? 0 G   956  0 C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1058 hydrog ?    ? A  G   956  O6    ? ? ? 1_555 A  C   1011 N4    ? ? 0 G   956  0 C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1059 hydrog ?    ? A  A   957  N1    ? ? ? 1_555 A  U   1009 N3    ? ? 0 A   957  0 U   1009 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1060 hydrog ?    ? A  A   957  N6    ? ? ? 1_555 A  U   1009 O4    ? ? 0 A   957  0 U   1009 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1061 hydrog ?    ? A  G   958  N2    ? ? ? 1_555 A  A   961  N1    ? ? 0 G   958  0 A   961  1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog1062 hydrog ?    ? A  G   958  N3    ? ? ? 1_555 A  A   961  N6    ? ? 0 G   958  0 A   961  1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog1063 hydrog ?    ? A  G   958  N1    ? ? ? 1_555 A  C   1008 N3    ? ? 0 G   958  0 C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1064 hydrog ?    ? A  G   958  N2    ? ? ? 1_555 A  C   1008 O2    ? ? 0 G   958  0 C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1065 hydrog ?    ? A  G   958  O6    ? ? ? 1_555 A  C   1008 N4    ? ? 0 G   958  0 C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1066 hydrog ?    ? A  C   959  O2    ? ? ? 1_555 A  C   962  N4    ? ? 0 C   959  0 C   962  1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog1067 hydrog ?    ? A  C   959  O2    ? ? ? 1_555 A  C   963  N4    ? ? 0 C   959  0 C   963  1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog1068 hydrog ?    ? A  C   959  N3    ? ? ? 1_555 A  A   1005 N6    ? ? 0 C   959  0 A   1005 1_555 ? ? ? ? ? ? TYPE_25_PAIR 
?     ? ? 
hydrog1069 hydrog ?    ? A  C   959  N4    ? ? ? 1_555 A  A   1005 N7    ? ? 0 C   959  0 A   1005 1_555 ? ? ? ? ? ? TYPE_25_PAIR 
?     ? ? 
hydrog1070 hydrog ?    ? A  C   962  N4    ? ? ? 1_555 A  C   1008 O2    ? ? 0 C   962  0 C   1008 1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog1071 hydrog ?    ? A  C   963  N3    ? ? ? 1_555 A  A   1005 N6    ? ? 0 C   963  0 A   1005 1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog1072 hydrog ?    ? A  G   964  N1    ? ? ? 1_555 A  C   1004 N3    ? ? 0 G   964  0 C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1073 hydrog ?    ? A  G   964  N2    ? ? ? 1_555 A  C   1004 O2    ? ? 0 G   964  0 C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1074 hydrog ?    ? A  G   964  O6    ? ? ? 1_555 A  C   1004 N4    ? ? 0 G   964  0 C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1075 hydrog ?    ? A  A   965  N1    ? ? ? 1_555 A  U   1003 N3    ? ? 0 A   965  0 U   1003 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1076 hydrog ?    ? A  A   965  N6    ? ? ? 1_555 A  U   1003 O4    ? ? 0 A   965  0 U   1003 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1077 hydrog ?    ? A  U   966  O2    ? ? ? 1_555 A  G   1002 N1    ? ? 0 U   966  0 G   1002 1_555 ? ? ? ? ? ? 'U-G MISPAIR' 
?     ? ? 
hydrog1078 hydrog ?    ? A  U   967  N3    ? ? ? 1_555 A  U   1001 O2    ? ? 0 U   967  0 U   1001 1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog1079 hydrog ?    ? A  U   967  O4    ? ? ? 1_555 A  U   1001 N3    ? ? 0 U   967  0 U   1001 1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog1080 hydrog ?    ? A  G   968  N1    ? ? ? 1_555 A  C   1000 N3    ? ? 0 G   968  0 C   1000 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1081 hydrog ?    ? A  G   968  N2    ? ? ? 1_555 A  C   1000 O2    ? ? 0 G   968  0 C   1000 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1082 hydrog ?    ? A  G   968  O6    ? ? ? 1_555 A  C   1000 N4    ? ? 0 G   968  0 C   1000 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1083 hydrog ?    ? A  G   969  N1    ? ? ? 1_555 A  C   999  N3    ? ? 0 G   969  0 C   999  1_555 ? ? ? ? ? ? 'G-C PAIR' ? 
? ? 
hydrog1084 hydrog ?    ? A  U   1009 O2    ? ? ? 1_555 A  C   1010 N4    ? ? 0 U   1009 0 C   1010 1_555 ? ? ? ? ? ? 'U-C MISPAIR' 
?     ? ? 
hydrog1085 hydrog ?    ? A  A   1014 N6    ? ? ? 1_555 A  A   2302 N7    ? ? 0 A   1014 0 A   2302 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog1086 hydrog ?    ? A  A   1014 N7    ? ? ? 1_555 A  A   2302 N6    ? ? 0 A   1014 0 A   2302 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog1087 hydrog ?    ? A  G   1045 N1    ? ? ? 1_555 A  C   1069 N3    ? ? 0 G   1045 0 C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1088 hydrog ?    ? A  G   1045 N2    ? ? ? 1_555 A  C   1069 O2    ? ? 0 G   1045 0 C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1089 hydrog ?    ? A  G   1045 O6    ? ? ? 1_555 A  C   1069 N4    ? ? 0 G   1045 0 C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1090 hydrog ?    ? A  G   1046 N1    ? ? ? 1_555 A  C   1068 N3    ? ? 0 G   1046 0 C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1091 hydrog ?    ? A  G   1046 N2    ? ? ? 1_555 A  C   1068 O2    ? ? 0 G   1046 0 C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1092 hydrog ?    ? A  G   1046 O6    ? ? ? 1_555 A  C   1068 N4    ? ? 0 G   1046 0 C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1093 hydrog ?    ? A  G   1046 N2    ? ? ? 1_555 A  A   1082 N3    ? ? 0 G   1046 0 A   1082 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1094 hydrog ?    ? A  U   1047 N3    ? ? ? 1_555 A  A   1067 N1    ? ? 0 U   1047 0 A   1067 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1095 hydrog ?    ? A  U   1047 O4    ? ? ? 1_555 A  A   1067 N6    ? ? 0 U   1047 0 A   1067 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1096 hydrog ?    ? A  G   1048 N1    ? ? ? 1_555 A  U   1066 O2    ? ? 0 G   1048 0 U   1066 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1097 hydrog ?    ? A  G   1048 O6    ? ? ? 1_555 A  U   1066 N3    ? ? 0 G   1048 0 U   1066 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1098 hydrog ?    ? A  C   1049 N3    ? ? ? 1_555 A  G   1065 N1    ? ? 0 C   1049 0 G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1099 hydrog ?    ? A  C   1049 N4    ? ? ? 1_555 A  G   1065 O6    ? ? 0 C   1049 0 G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1100 hydrog ?    ? A  C   1049 O2    ? ? ? 1_555 A  G   1065 N2    ? ? 0 C   1049 0 G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1101 hydrog ?    ? A  G   1050 N1    ? ? ? 1_555 A  U   1064 O2    ? ? 0 G   1050 0 U   1064 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1102 hydrog ?    ? A  G   1050 O6    ? ? ? 1_555 A  U   1064 N3    ? ? 0 G   1050 0 U   1064 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1103 hydrog ?    ? A  C   1051 N3    ? ? ? 1_555 A  G   1063 N1    ? ? 0 C   1051 0 G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1104 hydrog ?    ? A  C   1051 N4    ? ? ? 1_555 A  G   1063 O6    ? ? 0 C   1051 0 G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1105 hydrog ?    ? A  C   1051 O2    ? ? ? 1_555 A  G   1063 N2    ? ? 0 C   1051 0 G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1106 hydrog ?    ? A  G   1052 N1    ? ? ? 1_555 A  U   1062 O2    ? ? 0 G   1052 0 U   1062 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1107 hydrog ?    ? A  G   1052 O6    ? ? ? 1_555 A  U   1062 N3    ? ? 0 G   1052 0 U   1062 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1108 hydrog ?    ? A  G   1053 N1    ? ? ? 1_555 A  C   1061 N3    ? ? 0 G   1053 0 C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1109 hydrog ?    ? A  G   1053 N2    ? ? ? 1_555 A  C   1061 O2    ? ? 0 G   1053 0 C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1110 hydrog ?    ? A  G   1053 O6    ? ? ? 1_555 A  C   1061 N4    ? ? 0 G   1053 0 C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1111 hydrog ?    ? A  G   1053 N2    ? ? ? 1_555 A  U   2308 O2    ? ? 0 G   1053 0 U   2308 1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog1112 hydrog ?    ? A  G   1054 N1    ? ? ? 1_555 A  C   1060 N3    ? ? 0 G   1054 0 C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1113 hydrog ?    ? A  G   1054 N2    ? ? ? 1_555 A  C   1060 O2    ? ? 0 G   1054 0 C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1114 hydrog ?    ? A  G   1054 O6    ? ? ? 1_555 A  C   1060 N4    ? ? 0 G   1054 0 C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1115 hydrog ?    ? A  G   1054 N2    ? ? ? 1_555 A  G   2283 O6    ? ? 0 G   1054 0 G   2283 1_555 ? ? ? ? ? ? 'G-G MISPAIR' 
?     ? ? 
hydrog1116 hydrog ?    ? A  G   1055 N2    ? ? ? 1_555 A  A   1058 N7    ? ? 0 G   1055 0 A   1058 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1117 hydrog ?    ? A  U   1056 O4    ? ? ? 1_555 A  G   2529 N2    ? ? 0 U   1056 0 G   2529 1_555 ? ? ? ? ? ? 'U-G MISPAIR' 
?     ? ? 
hydrog1118 hydrog ?    ? A  A   1058 N3    ? ? ? 1_555 A  G   2491 N2    ? ? 0 A   1058 0 G   2491 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog1119 hydrog ?    ? A  G   1063 N2    ? ? ? 1_555 A  A   2301 N7    ? ? 0 G   1063 0 A   2301 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1120 hydrog ?    ? A  G   1072 N2    ? ? ? 1_555 A  A   1088 N7    ? ? 0 G   1072 0 A   1088 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1121 hydrog ?    ? A  G   1072 N3    ? ? ? 1_555 A  A   1088 N6    ? ? 0 G   1072 0 A   1088 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1122 hydrog ?    ? A  A   1073 N6    ? ? ? 1_555 A  A   1086 N3    ? ? 0 A   1073 0 A   1086 1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog1123 hydrog ?    ? A  A   1073 N7    ? ? ? 1_555 A  G   1087 N2    ? ? 0 A   1073 0 G   1087 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog1124 hydrog ?    ? A  G   1074 N1    ? ? ? 1_555 A  C   1085 N3    ? ? 0 G   1074 0 C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1125 hydrog ?    ? A  G   1074 N2    ? ? ? 1_555 A  C   1085 O2    ? ? 0 G   1074 0 C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1126 hydrog ?    ? A  G   1074 O6    ? ? ? 1_555 A  C   1085 N4    ? ? 0 G   1074 0 C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1127 hydrog ?    ? A  G   1075 N1    ? ? ? 1_555 A  C   1084 N3    ? ? 0 G   1075 0 C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1128 hydrog ?    ? A  G   1075 N2    ? ? ? 1_555 A  C   1084 O2    ? ? 0 G   1075 0 C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1129 hydrog ?    ? A  G   1075 O6    ? ? ? 1_555 A  C   1084 N4    ? ? 0 G   1075 0 C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1130 hydrog ?    ? A  G   1075 N2    ? ? ? 1_555 A  A   1098 N3    ? ? 0 G   1075 0 A   1098 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1131 hydrog ?    ? A  G   1076 N1    ? ? ? 1_555 A  C   1083 N3    ? ? 0 G   1076 0 C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1132 hydrog ?    ? A  G   1076 N2    ? ? ? 1_555 A  C   1083 O2    ? ? 0 G   1076 0 C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1133 hydrog ?    ? A  G   1076 O6    ? ? ? 1_555 A  C   1083 N4    ? ? 0 G   1076 0 C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1134 hydrog ?    ? A  G   1076 N2    ? ? ? 1_555 B  U   87   O4    ? ? 0 G   1076 9 U   87   1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog1135 hydrog ?    ? A  A   1079 N3    ? ? ? 1_555 A  G   2068 N2    ? ? 0 A   1079 0 G   2068 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog1136 hydrog ?    ? A  C   1083 O2    ? ? ? 1_555 A  A   1124 N6    ? ? 0 C   1083 0 A   1124 1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog1137 hydrog ?    ? A  G   1089 N1    ? ? ? 1_555 A  C   1267 N3    ? ? 0 G   1089 0 C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1138 hydrog ?    ? A  G   1089 N2    ? ? ? 1_555 A  C   1267 O2    ? ? 0 G   1089 0 C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1139 hydrog ?    ? A  G   1089 O6    ? ? ? 1_555 A  C   1267 N4    ? ? 0 G   1089 0 C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1140 hydrog ?    ? A  A   1090 N1    ? ? ? 1_555 A  U   1266 N3    ? ? 0 A   1090 0 U   1266 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1141 hydrog ?    ? A  A   1090 N6    ? ? ? 1_555 A  U   1266 O4    ? ? 0 A   1090 0 U   1266 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1142 hydrog ?    ? A  U   1091 N3    ? ? ? 1_555 A  G   1265 O6    ? ? 0 U   1091 0 G   1265 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1143 hydrog ?    ? A  U   1091 O2    ? ? ? 1_555 A  G   1265 N1    ? ? 0 U   1091 0 G   1265 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1144 hydrog ?    ? A  A   1092 N1    ? ? ? 1_555 A  U   1264 N3    ? ? 0 A   1092 0 U   1264 1_555 ? ? ? ? ? ? 'A-U PAIR' ? 
? ? 
hydrog1145 hydrog ?    ? A  G   1093 N1    ? ? ? 1_555 A  C   1263 N3    ? ? 0 G   1093 0 C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1146 hydrog ?    ? A  G   1093 N2    ? ? ? 1_555 A  C   1263 O2    ? ? 0 G   1093 0 C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1147 hydrog ?    ? A  G   1093 O6    ? ? ? 1_555 A  C   1263 N4    ? ? 0 G   1093 0 C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1148 hydrog ?    ? A  G   1094 N1    ? ? ? 1_555 A  C   1262 N3    ? ? 0 G   1094 0 C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1149 hydrog ?    ? A  G   1094 N2    ? ? ? 1_555 A  C   1262 O2    ? ? 0 G   1094 0 C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1150 hydrog ?    ? A  G   1094 O6    ? ? ? 1_555 A  C   1262 N4    ? ? 0 G   1094 0 C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1151 hydrog ?    ? A  U   1095 N3    ? ? ? 1_555 A  A   1261 N1    ? ? 0 U   1095 0 A   1261 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1152 hydrog ?    ? A  U   1095 O4    ? ? ? 1_555 A  A   1261 N6    ? ? 0 U   1095 0 A   1261 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1153 hydrog ?    ? A  U   1096 N3    ? ? ? 1_555 A  A   1259 N7    ? ? 0 U   1096 0 A   1259 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1154 hydrog ?    ? A  U   1096 O2    ? ? ? 1_555 A  A   1259 N6    ? ? 0 U   1096 0 A   1259 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1155 hydrog ?    ? A  A   1098 N6    ? ? ? 1_555 A  G   1258 N3    ? ? 0 A   1098 0 G   1258 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1156 hydrog ?    ? A  A   1098 N7    ? ? ? 1_555 A  G   1258 N2    ? ? 0 A   1098 0 G   1258 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1157 hydrog ?    ? A  G   1099 N1    ? ? ? 1_555 A  C   1257 N3    ? ? 0 G   1099 0 C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1158 hydrog ?    ? A  G   1099 N2    ? ? ? 1_555 A  C   1257 O2    ? ? 0 G   1099 0 C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1159 hydrog ?    ? A  G   1099 O6    ? ? ? 1_555 A  C   1257 N4    ? ? 0 G   1099 0 C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1160 hydrog ?    ? A  G   1100 N2    ? ? ? 1_555 A  A   1107 N3    ? ? 0 G   1100 0 A   1107 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1161 hydrog ?    ? A  G   1100 N1    ? ? ? 1_555 A  C   1256 N3    ? ? 0 G   1100 0 C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1162 hydrog ?    ? A  G   1100 N2    ? ? ? 1_555 A  C   1256 O2    ? ? 0 G   1100 0 C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1163 hydrog ?    ? A  G   1100 O6    ? ? ? 1_555 A  C   1256 N4    ? ? 0 G   1100 0 C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1164 hydrog ?    ? A  U   1101 N3    ? ? ? 1_555 A  A   1255 N1    ? ? 0 U   1101 0 A   1255 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1165 hydrog ?    ? A  U   1101 O4    ? ? ? 1_555 A  A   1255 N6    ? ? 0 U   1101 0 A   1255 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1166 hydrog ?    ? A  C   1102 N3    ? ? ? 1_555 A  G   1241 N1    ? ? 0 C   1102 0 G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1167 hydrog ?    ? A  C   1102 N4    ? ? ? 1_555 A  G   1241 O6    ? ? 0 C   1102 0 G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1168 hydrog ?    ? A  C   1102 O2    ? ? ? 1_555 A  G   1241 N2    ? ? 0 C   1102 0 G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1169 hydrog ?    ? A  C   1103 N3    ? ? ? 1_555 A  G   1240 N1    ? ? 0 C   1103 0 G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1170 hydrog ?    ? A  C   1103 N4    ? ? ? 1_555 A  G   1240 O6    ? ? 0 C   1103 0 G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1171 hydrog ?    ? A  C   1103 O2    ? ? ? 1_555 A  G   1240 N2    ? ? 0 C   1103 0 G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1172 hydrog ?    ? A  C   1104 N3    ? ? ? 1_555 A  G   1239 N1    ? ? 0 C   1104 0 G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1173 hydrog ?    ? A  C   1104 N4    ? ? ? 1_555 A  G   1239 O6    ? ? 0 C   1104 0 G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1174 hydrog ?    ? A  C   1104 O2    ? ? ? 1_555 A  G   1239 N2    ? ? 0 C   1104 0 G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1175 hydrog ?    ? A  C   1105 O2    ? ? ? 1_555 A  A   1106 N6    ? ? 0 C   1105 0 A   1106 1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog1176 hydrog ?    ? A  C   1105 O2    ? ? ? 1_555 A  A   1107 N6    ? ? 0 C   1105 0 A   1107 1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog1177 hydrog ?    ? A  G   1108 N1    ? ? ? 1_555 A  C   1254 N3    ? ? 0 G   1108 0 C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1178 hydrog ?    ? A  G   1108 N2    ? ? ? 1_555 A  C   1254 O2    ? ? 0 G   1108 0 C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1179 hydrog ?    ? A  G   1108 O6    ? ? ? 1_555 A  C   1254 N4    ? ? 0 G   1108 0 C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1180 hydrog ?    ? A  U   1109 N3    ? ? ? 1_555 A  A   1247 N7    ? ? 0 U   1109 0 A   1247 1_555 ? ? ? ? ? ? HOOGSTEEN ? ? 
? 
hydrog1181 hydrog ?    ? A  U   1109 O4    ? ? ? 1_555 A  A   1247 N6    ? ? 0 U   1109 0 A   1247 1_555 ? ? ? ? ? ? HOOGSTEEN ? ? 
? 
hydrog1182 hydrog ?    ? A  G   1110 N1    ? ? ? 1_555 A  C   1253 N3    ? ? 0 G   1110 0 C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1183 hydrog ?    ? A  G   1110 N2    ? ? ? 1_555 A  C   1253 O2    ? ? 0 G   1110 0 C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1184 hydrog ?    ? A  G   1110 O6    ? ? ? 1_555 A  C   1253 N4    ? ? 0 G   1110 0 C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1185 hydrog ?    ? A  U   1111 N3    ? ? ? 1_555 A  A   1252 N1    ? ? 0 U   1111 0 A   1252 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1186 hydrog ?    ? A  U   1111 O4    ? ? ? 1_555 A  A   1252 N6    ? ? 0 U   1111 0 A   1252 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1187 hydrog ?    ? A  G   1112 N1    ? ? ? 1_555 A  C   1251 N3    ? ? 0 G   1112 0 C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1188 hydrog ?    ? A  G   1112 N2    ? ? ? 1_555 A  C   1251 O2    ? ? 0 G   1112 0 C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1189 hydrog ?    ? A  G   1112 O6    ? ? ? 1_555 A  C   1251 N4    ? ? 0 G   1112 0 C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1190 hydrog ?    ? A  G   1113 N1    ? ? ? 1_555 A  C   1250 N3    ? ? 0 G   1113 0 C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1191 hydrog ?    ? A  G   1113 N2    ? ? ? 1_555 A  C   1250 O2    ? ? 0 G   1113 0 C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1192 hydrog ?    ? A  G   1113 O6    ? ? ? 1_555 A  C   1250 N4    ? ? 0 G   1113 0 C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1193 hydrog ?    ? A  A   1114 N1    ? ? ? 1_555 A  U   1249 N3    ? ? 0 A   1114 0 U   1249 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1194 hydrog ?    ? A  A   1114 N6    ? ? ? 1_555 A  U   1249 O4    ? ? 0 A   1114 0 U   1249 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1195 hydrog ?    ? A  U   1115 N3    ? ? ? 1_555 A  A   1248 N1    ? ? 0 U   1115 0 A   1248 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1196 hydrog ?    ? A  U   1115 O4    ? ? ? 1_555 A  A   1248 N6    ? ? 0 U   1115 0 A   1248 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1197 hydrog ?    ? A  U   1116 O2    ? ? ? 1_555 A  A   1246 N6    ? ? 0 U   1116 0 A   1246 1_555 ? ? ? ? ? ? 'U-A PAIR' ? 
? ? 
hydrog1198 hydrog ?    ? A  A   1118 N6    ? ? ? 1_555 A  U   1244 O2    ? ? 0 A   1118 0 U   1244 1_555 ? ? ? ? ? ? 'A-U PAIR' ? 
? ? 
hydrog1199 hydrog ?    ? A  G   1119 N2    ? ? ? 1_555 A  U   1120 O4    ? ? 0 G   1119 0 U   1120 1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog1200 hydrog ?    ? A  G   1121 N1    ? ? ? 1_555 A  C   1243 N3    ? ? 0 G   1121 0 C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1201 hydrog ?    ? A  G   1121 N2    ? ? ? 1_555 A  C   1243 O2    ? ? 0 G   1121 0 C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1202 hydrog ?    ? A  G   1121 O6    ? ? ? 1_555 A  C   1243 N4    ? ? 0 G   1121 0 C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1203 hydrog ?    ? A  U   1122 N3    ? ? ? 1_555 A  A   1242 N1    ? ? 0 U   1122 0 A   1242 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1204 hydrog ?    ? A  U   1122 O4    ? ? ? 1_555 A  A   1242 N6    ? ? 0 U   1122 0 A   1242 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1205 hydrog ?    ? A  A   1132 N6    ? ? ? 1_555 A  A   1230 N7    ? ? 0 A   1132 0 A   1230 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog1206 hydrog ?    ? A  A   1132 N7    ? ? ? 1_555 A  A   1230 N6    ? ? 0 A   1132 0 A   1230 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog1207 hydrog ?    ? A  A   1133 N6    ? ? ? 1_555 A  C   1229 O2    ? ? 0 A   1133 0 C   1229 1_555 ? ? ? ? ? ? 'A-C MISPAIR' 
?     ? ? 
hydrog1208 hydrog ?    ? A  G   1134 N1    ? ? ? 1_555 A  C   1228 N3    ? ? 0 G   1134 0 C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1209 hydrog ?    ? A  G   1134 N2    ? ? ? 1_555 A  C   1228 O2    ? ? 0 G   1134 0 C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1210 hydrog ?    ? A  G   1134 O6    ? ? ? 1_555 A  C   1228 N4    ? ? 0 G   1134 0 C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1211 hydrog ?    ? A  G   1135 N1    ? ? ? 1_555 A  C   1227 N3    ? ? 0 G   1135 0 C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1212 hydrog ?    ? A  G   1135 N2    ? ? ? 1_555 A  C   1227 O2    ? ? 0 G   1135 0 C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1213 hydrog ?    ? A  G   1135 O6    ? ? ? 1_555 A  C   1227 N4    ? ? 0 G   1135 0 C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1214 hydrog ?    ? A  U   1136 N3    ? ? ? 1_555 A  G   1226 O6    ? ? 0 U   1136 0 G   1226 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1215 hydrog ?    ? A  U   1136 O2    ? ? ? 1_555 A  G   1226 N1    ? ? 0 U   1136 0 G   1226 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1216 hydrog ?    ? A  G   1138 N1    ? ? ? 1_555 A  C   1225 N3    ? ? 0 G   1138 0 C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1217 hydrog ?    ? A  G   1138 N2    ? ? ? 1_555 A  C   1225 O2    ? ? 0 G   1138 0 C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1218 hydrog ?    ? A  G   1138 O6    ? ? ? 1_555 A  C   1225 N4    ? ? 0 G   1138 0 C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1219 hydrog ?    ? A  U   1139 N3    ? ? ? 1_555 A  G   1224 O6    ? ? 0 U   1139 0 G   1224 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1220 hydrog ?    ? A  U   1139 O2    ? ? ? 1_555 A  G   1224 N1    ? ? 0 U   1139 0 G   1224 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1221 hydrog ?    ? A  C   1140 N3    ? ? ? 1_555 A  G   1223 N1    ? ? 0 C   1140 0 G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1222 hydrog ?    ? A  C   1140 N4    ? ? ? 1_555 A  G   1223 O6    ? ? 0 C   1140 0 G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1223 hydrog ?    ? A  C   1140 O2    ? ? ? 1_555 A  G   1223 N2    ? ? 0 C   1140 0 G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1224 hydrog ?    ? A  U   1141 N3    ? ? ? 1_555 A  A   1222 N1    ? ? 0 U   1141 0 A   1222 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1225 hydrog ?    ? A  U   1141 O4    ? ? ? 1_555 A  A   1222 N6    ? ? 0 U   1141 0 A   1222 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1226 hydrog ?    ? A  C   1142 N3    ? ? ? 1_555 A  G   1221 N1    ? ? 0 C   1142 0 G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1227 hydrog ?    ? A  C   1142 N4    ? ? ? 1_555 A  G   1221 O6    ? ? 0 C   1142 0 G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1228 hydrog ?    ? A  C   1142 O2    ? ? ? 1_555 A  G   1221 N2    ? ? 0 C   1142 0 G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1229 hydrog ?    ? A  G   1143 N1    ? ? ? 1_555 A  U   1220 O2    ? ? 0 G   1143 0 U   1220 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1230 hydrog ?    ? A  G   1143 O6    ? ? ? 1_555 A  U   1220 N3    ? ? 0 G   1143 0 U   1220 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1231 hydrog ?    ? A  A   1144 N1    ? ? ? 1_555 A  U   1219 N3    ? ? 0 A   1144 0 U   1219 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1232 hydrog ?    ? A  A   1144 N6    ? ? ? 1_555 A  U   1219 O4    ? ? 0 A   1144 0 U   1219 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1233 hydrog ?    ? A  G   1145 N1    ? ? ? 1_555 A  U   1218 O2    ? ? 0 G   1145 0 U   1218 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1234 hydrog ?    ? A  G   1145 O6    ? ? ? 1_555 A  U   1218 N3    ? ? 0 G   1145 0 U   1218 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1235 hydrog ?    ? A  C   1146 N3    ? ? ? 1_555 A  G   1217 N1    ? ? 0 C   1146 0 G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1236 hydrog ?    ? A  C   1146 N4    ? ? ? 1_555 A  G   1217 O6    ? ? 0 C   1146 0 G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1237 hydrog ?    ? A  C   1146 O2    ? ? ? 1_555 A  G   1217 N2    ? ? 0 C   1146 0 G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1238 hydrog ?    ? A  C   1147 N3    ? ? ? 1_555 A  G   1216 N1    ? ? 0 C   1147 0 G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1239 hydrog ?    ? A  C   1147 N4    ? ? ? 1_555 A  G   1216 O6    ? ? 0 C   1147 0 G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1240 hydrog ?    ? A  C   1147 O2    ? ? ? 1_555 A  G   1216 N2    ? ? 0 C   1147 0 G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1241 hydrog ?    ? A  G   1151 N2    ? ? ? 1_555 A  A   1215 N7    ? ? 0 G   1151 0 A   1215 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1242 hydrog ?    ? A  G   1151 N3    ? ? ? 1_555 A  A   1215 N6    ? ? 0 G   1151 0 A   1215 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1243 hydrog ?    ? A  A   1152 N7    ? ? ? 1_555 A  G   1214 N2    ? ? 0 A   1152 0 G   1214 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog1244 hydrog ?    ? A  A   1152 N3    ? ? ? 1_555 A  G   1216 N2    ? ? 0 A   1152 0 G   1216 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog1245 hydrog ?    ? A  C   1153 N4    ? ? ? 1_555 A  G   2786 O6    ? ? 0 C   1153 0 G   2786 1_555 ? ? ? ? ? ? 'C-G PAIR' ? 
? ? 
hydrog1246 hydrog ?    ? A  A   1154 N6    ? ? ? 1_555 A  C   1213 O2    ? ? 0 A   1154 0 C   1213 1_555 ? ? ? ? ? ? 'A-C MISPAIR' 
?     ? ? 
hydrog1247 hydrog ?    ? A  G   1155 N1    ? ? ? 1_555 A  C   1212 N3    ? ? 0 G   1155 0 C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1248 hydrog ?    ? A  G   1155 N2    ? ? ? 1_555 A  C   1212 O2    ? ? 0 G   1155 0 C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1249 hydrog ?    ? A  G   1155 O6    ? ? ? 1_555 A  C   1212 N4    ? ? 0 G   1155 0 C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1250 hydrog ?    ? A  C   1156 N3    ? ? ? 1_555 A  G   1211 N1    ? ? 0 C   1156 0 G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1251 hydrog ?    ? A  C   1156 N4    ? ? ? 1_555 A  G   1211 O6    ? ? 0 C   1156 0 G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1252 hydrog ?    ? A  C   1156 O2    ? ? ? 1_555 A  G   1211 N2    ? ? 0 C   1156 0 G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1253 hydrog ?    ? A  C   1157 N3    ? ? ? 1_555 A  G   1210 N1    ? ? 0 C   1157 0 G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1254 hydrog ?    ? A  C   1157 N4    ? ? ? 1_555 A  G   1210 O6    ? ? 0 C   1157 0 G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1255 hydrog ?    ? A  C   1157 O2    ? ? ? 1_555 A  G   1210 N2    ? ? 0 C   1157 0 G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1256 hydrog ?    ? A  G   1158 N1    ? ? ? 1_555 A  C   1209 N3    ? ? 0 G   1158 0 C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1257 hydrog ?    ? A  G   1158 N2    ? ? ? 1_555 A  C   1209 O2    ? ? 0 G   1158 0 C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1258 hydrog ?    ? A  G   1158 O6    ? ? ? 1_555 A  C   1209 N4    ? ? 0 G   1158 0 C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1259 hydrog ?    ? A  G   1159 N1    ? ? ? 1_555 A  C   1208 N3    ? ? 0 G   1159 0 C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1260 hydrog ?    ? A  G   1159 N2    ? ? ? 1_555 A  C   1208 O2    ? ? 0 G   1159 0 C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1261 hydrog ?    ? A  G   1159 O6    ? ? ? 1_555 A  C   1208 N4    ? ? 0 G   1159 0 C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1262 hydrog ?    ? A  G   1160 N2    ? ? ? 1_555 A  A   1207 N7    ? ? 0 G   1160 0 A   1207 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1263 hydrog ?    ? A  A   1161 N1    ? ? ? 1_555 A  U   1185 N3    ? ? 0 A   1161 0 U   1185 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1264 hydrog ?    ? A  A   1161 N6    ? ? ? 1_555 A  U   1185 O4    ? ? 0 A   1161 0 U   1185 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1265 hydrog ?    ? A  G   1162 N1    ? ? ? 1_555 A  C   1184 N3    ? ? 0 G   1162 0 C   1184 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1266 hydrog ?    ? A  G   1162 N2    ? ? ? 1_555 A  C   1184 O2    ? ? 0 G   1162 0 C   1184 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1267 hydrog ?    ? A  G   1162 O6    ? ? ? 1_555 A  C   1184 N4    ? ? 0 G   1162 0 C   1184 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1268 hydrog ?    ? A  G   1163 N2    ? ? ? 1_555 A  C   1183 O2    ? ? 0 G   1163 0 C   1183 1_555 ? ? ? ? ? ? 'G-C PAIR' ? 
? ? 
hydrog1269 hydrog ?    ? A  G   1163 N1    ? ? ? 1_555 A  C   1184 N3    ? ? 0 G   1163 0 C   1184 1_555 ? ? ? ? ? ? 'G-C PAIR' ? 
? ? 
hydrog1270 hydrog ?    ? A  A   1166 N6    ? ? ? 1_555 A  U   1180 O4    ? ? 0 A   1166 0 U   1180 1_555 ? ? ? ? ? ? 'A-U PAIR' ? 
? ? 
hydrog1271 hydrog ?    ? A  G   1167 N1    ? ? ? 1_555 A  C   1179 N3    ? ? 0 G   1167 0 C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1272 hydrog ?    ? A  G   1167 N2    ? ? ? 1_555 A  C   1179 O2    ? ? 0 G   1167 0 C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1273 hydrog ?    ? A  G   1167 O6    ? ? ? 1_555 A  C   1179 N4    ? ? 0 G   1167 0 C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1274 hydrog ?    ? A  C   1168 O2    ? ? ? 1_555 A  G   1178 N1    ? ? 0 C   1168 0 G   1178 1_555 ? ? ? ? ? ? 'C-G PAIR' ? 
? ? 
hydrog1275 hydrog ?    ? A  U   1169 O2    ? ? ? 1_555 A  A   1177 N6    ? ? 0 U   1169 0 A   1177 1_555 ? ? ? ? ? ? 'U-A PAIR' ? 
? ? 
hydrog1276 hydrog ?    ? A  A   1174 N6    ? ? ? 1_555 A  A   1200 N3    ? ? 0 A   1174 0 A   1200 1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog1277 hydrog ?    ? A  G   1175 O6    ? ? ? 1_555 A  C   1204 N4    ? ? 0 G   1175 0 C   1204 1_555 ? ? ? ? ? ? 'G-C PAIR' ? 
? ? 
hydrog1278 hydrog ?    ? A  C   1176 N3    ? ? ? 1_555 A  C   1196 N4    ? ? 0 C   1176 0 C   1196 1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog1279 hydrog ?    ? A  C   1176 N4    ? ? ? 1_555 A  G   1203 O6    ? ? 0 C   1176 0 G   1203 1_555 ? ? ? ? ? ? 'C-G PAIR' ? 
? ? 
hydrog1280 hydrog ?    ? A  C   1186 N3    ? ? ? 1_555 A  G   1190 N1    ? ? 0 C   1186 0 G   1190 1_555 ? ? ? ? ? ? 'C-G PAIR' ? 
? ? 
hydrog1281 hydrog ?    ? A  U   1187 O2    ? ? ? 1_555 A  G   1190 N1    ? ? 0 U   1187 0 G   1190 1_555 ? ? ? ? ? ? 'U-G MISPAIR' 
?     ? ? 
hydrog1282 hydrog ?    ? A  A   1193 N3    ? ? ? 1_555 A  A   1194 N6    ? ? 0 A   1193 0 A   1194 1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog1283 hydrog ?    ? A  A   1194 N1    ? ? ? 1_555 A  U   1205 N3    ? ? 0 A   1194 0 U   1205 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1284 hydrog ?    ? A  A   1194 N6    ? ? ? 1_555 A  U   1205 O4    ? ? 0 A   1194 0 U   1205 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1285 hydrog ?    ? A  G   1195 N1    ? ? ? 1_555 A  C   1204 N3    ? ? 0 G   1195 0 C   1204 1_555 ? ? ? ? ? ? 'G-C PAIR' ? 
? ? 
hydrog1286 hydrog ?    ? A  C   1196 N3    ? ? ? 1_555 A  G   1203 N1    ? ? 0 C   1196 0 G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1287 hydrog ?    ? A  C   1196 N4    ? ? ? 1_555 A  G   1203 O6    ? ? 0 C   1196 0 G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1288 hydrog ?    ? A  C   1196 O2    ? ? ? 1_555 A  G   1203 N2    ? ? 0 C   1196 0 G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1289 hydrog ?    ? A  G   1197 N2    ? ? ? 1_555 A  A   1202 N7    ? ? 0 G   1197 0 A   1202 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1290 hydrog ?    ? A  G   1197 N3    ? ? ? 1_555 A  A   1202 N6    ? ? 0 G   1197 0 A   1202 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1291 hydrog ?    ? A  A   1231 N6    ? ? ? 1_555 A  C   2498 O2    ? ? 0 A   1231 0 C   2498 1_555 ? ? ? ? ? ? 'A-C MISPAIR' 
?     ? ? 
hydrog1292 hydrog ?    ? A  A   1231 N6    ? ? ? 1_555 A  U   2523 O2    ? ? 0 A   1231 0 U   2523 1_555 ? ? ? ? ? ? 'A-U PAIR' ? 
? ? 
hydrog1293 hydrog ?    ? A  G   1235 N2    ? ? ? 1_555 A  A   1236 N7    ? ? 0 G   1235 0 A   1236 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1294 hydrog ?    ? A  G   1235 O6    ? ? ? 1_555 A  G   2080 N2    ? ? 0 G   1235 0 G   2080 1_555 ? ? ? ? ? ? 'G-G MISPAIR' 
?     ? ? 
hydrog1295 hydrog ?    ? A  C   1238 N4    ? ? ? 1_555 A  G   1241 N7    ? ? 0 C   1238 0 G   1241 1_555 ? ? ? ? ? ? 'C-G PAIR' ? 
? ? 
hydrog1296 hydrog ?    ? A  C   1268 N3    ? ? ? 1_555 A  G   1290 N1    ? ? 0 C   1268 0 G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1297 hydrog ?    ? A  C   1268 N4    ? ? ? 1_555 A  G   1290 O6    ? ? 0 C   1268 0 G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1298 hydrog ?    ? A  C   1268 O2    ? ? ? 1_555 A  G   1290 N2    ? ? 0 C   1268 0 G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1299 hydrog ?    ? A  G   1269 N1    ? ? ? 1_555 A  C   1289 N3    ? ? 0 G   1269 0 C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1300 hydrog ?    ? A  G   1269 N2    ? ? ? 1_555 A  C   1289 O2    ? ? 0 G   1269 0 C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1301 hydrog ?    ? A  G   1269 O6    ? ? ? 1_555 A  C   1289 N4    ? ? 0 G   1269 0 C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1302 hydrog ?    ? A  U   1270 N3    ? ? ? 1_555 A  A   1286 N1    ? ? 0 U   1270 0 A   1286 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1303 hydrog ?    ? A  U   1270 O4    ? ? ? 1_555 A  A   1286 N6    ? ? 0 U   1270 0 A   1286 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1304 hydrog ?    ? A  A   1271 N1    ? ? ? 1_555 A  U   1285 N3    ? ? 0 A   1271 0 U   1285 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1305 hydrog ?    ? A  A   1271 N6    ? ? ? 1_555 A  U   1285 O4    ? ? 0 A   1271 0 U   1285 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1306 hydrog ?    ? A  C   1272 N3    ? ? ? 1_555 A  G   1284 N1    ? ? 0 C   1272 0 G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1307 hydrog ?    ? A  C   1272 N4    ? ? ? 1_555 A  G   1284 O6    ? ? 0 C   1272 0 G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1308 hydrog ?    ? A  C   1272 O2    ? ? ? 1_555 A  G   1284 N2    ? ? 0 C   1272 0 G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1309 hydrog ?    ? A  C   1273 N3    ? ? ? 1_555 A  G   1283 N1    ? ? 0 C   1273 0 G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1310 hydrog ?    ? A  C   1273 N4    ? ? ? 1_555 A  G   1283 O6    ? ? 0 C   1273 0 G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1311 hydrog ?    ? A  C   1273 O2    ? ? ? 1_555 A  G   1283 N2    ? ? 0 C   1273 0 G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1312 hydrog ?    ? A  A   1274 N1    ? ? ? 1_555 A  U   1282 N3    ? ? 0 A   1274 0 U   1282 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1313 hydrog ?    ? A  A   1274 N6    ? ? ? 1_555 A  U   1282 O4    ? ? 0 A   1274 0 U   1282 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1314 hydrog ?    ? A  C   1275 O2    ? ? ? 1_555 A  C   1281 N4    ? ? 0 C   1275 0 C   1281 1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog1315 hydrog ?    ? A  U   1276 O2    ? ? ? 1_555 A  A   1280 N6    ? ? 0 U   1276 0 A   1280 1_555 ? ? ? ? ? ? 'U-A PAIR' ? 
? ? 
hydrog1316 hydrog ?    ? A  G   1292 N2    ? ? ? 1_555 A  U   1293 O4    ? ? 0 G   1292 0 U   1293 1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog1317 hydrog ?    ? A  G   1300 N2    ? ? ? 1_555 A  A   1330 N3    ? ? 0 G   1300 0 A   1330 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1318 hydrog ?    ? A  C   1301 N3    ? ? ? 1_555 A  G   1354 N1    ? ? 0 C   1301 0 G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1319 hydrog ?    ? A  C   1301 N4    ? ? ? 1_555 A  G   1354 O6    ? ? 0 C   1301 0 G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1320 hydrog ?    ? A  C   1301 O2    ? ? ? 1_555 A  G   1354 N2    ? ? 0 C   1301 0 G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1321 hydrog ?    ? A  G   1302 N1    ? ? ? 1_555 A  C   1353 O2    ? ? 0 G   1302 0 C   1353 1_555 ? ? ? ? ? ? 'G-C PAIR' ? 
? ? 
hydrog1322 hydrog ?    ? A  C   1303 N3    ? ? ? 1_555 A  G   1351 N1    ? ? 0 C   1303 0 G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1323 hydrog ?    ? A  C   1303 N4    ? ? ? 1_555 A  G   1351 O6    ? ? 0 C   1303 0 G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1324 hydrog ?    ? A  C   1303 O2    ? ? ? 1_555 A  G   1351 N2    ? ? 0 C   1303 0 G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1325 hydrog ?    ? A  U   1304 N3    ? ? ? 1_555 A  U   1350 O2    ? ? 0 U   1304 0 U   1350 1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog1326 hydrog ?    ? A  U   1304 O4    ? ? ? 1_555 A  U   1350 N3    ? ? 0 U   1304 0 U   1350 1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog1327 hydrog ?    ? A  C   1305 N3    ? ? ? 1_555 A  G   1349 N1    ? ? 0 C   1305 0 G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1328 hydrog ?    ? A  C   1305 N4    ? ? ? 1_555 A  G   1349 O6    ? ? 0 C   1305 0 G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1329 hydrog ?    ? A  C   1305 O2    ? ? ? 1_555 A  G   1349 N2    ? ? 0 C   1305 0 G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1330 hydrog ?    ? A  U   1306 N3    ? ? ? 1_555 A  A   1348 N1    ? ? 0 U   1306 0 A   1348 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1331 hydrog ?    ? A  U   1306 O4    ? ? ? 1_555 A  A   1348 N6    ? ? 0 U   1306 0 A   1348 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1332 hydrog ?    ? A  A   1307 N1    ? ? ? 1_555 A  U   1347 N3    ? ? 0 A   1307 0 U   1347 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1333 hydrog ?    ? A  A   1307 N6    ? ? ? 1_555 A  U   1347 O4    ? ? 0 A   1307 0 U   1347 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1334 hydrog ?    ? A  A   1308 N1    ? ? ? 1_555 A  U   1346 N3    ? ? 0 A   1308 0 U   1346 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1335 hydrog ?    ? A  A   1308 N6    ? ? ? 1_555 A  U   1346 O4    ? ? 0 A   1308 0 U   1346 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1336 hydrog ?    ? A  U   1309 N3    ? ? ? 1_555 A  A   1345 N1    ? ? 0 U   1309 0 A   1345 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1337 hydrog ?    ? A  U   1309 O4    ? ? ? 1_555 A  A   1345 N6    ? ? 0 U   1309 0 A   1345 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1338 hydrog ?    ? A  U   1310 N3    ? ? ? 1_555 A  G   1344 O6    ? ? 0 U   1310 0 G   1344 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1339 hydrog ?    ? A  U   1310 O2    ? ? ? 1_555 A  G   1344 N1    ? ? 0 U   1310 0 G   1344 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1340 hydrog ?    ? A  G   1311 N1    ? ? ? 1_555 A  C   1343 N3    ? ? 0 G   1311 0 C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1341 hydrog ?    ? A  G   1311 N2    ? ? ? 1_555 A  C   1343 O2    ? ? 0 G   1311 0 C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1342 hydrog ?    ? A  G   1311 O6    ? ? ? 1_555 A  C   1343 N4    ? ? 0 G   1311 0 C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1343 hydrog ?    ? A  G   1312 N1    ? ? ? 1_555 A  C   1342 N3    ? ? 0 G   1312 0 C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1344 hydrog ?    ? A  G   1312 N2    ? ? ? 1_555 A  C   1342 O2    ? ? 0 G   1312 0 C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1345 hydrog ?    ? A  G   1312 O6    ? ? ? 1_555 A  C   1342 N4    ? ? 0 G   1312 0 C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1346 hydrog ?    ? A  G   1316 N2    ? ? ? 1_555 A  A   1341 N7    ? ? 0 G   1316 0 A   1341 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1347 hydrog ?    ? A  G   1316 N3    ? ? ? 1_555 A  A   1341 N6    ? ? 0 G   1316 0 A   1341 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1348 hydrog ?    ? A  A   1317 N6    ? ? ? 1_555 A  G   1340 N3    ? ? 0 A   1317 0 G   1340 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1349 hydrog ?    ? A  A   1317 N7    ? ? ? 1_555 A  G   1340 N2    ? ? 0 A   1317 0 G   1340 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1350 hydrog ?    ? A  A   1318 N6    ? ? ? 1_555 A  G   1339 N3    ? ? 0 A   1318 0 G   1339 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1351 hydrog ?    ? A  A   1318 N7    ? ? ? 1_555 A  G   1339 N2    ? ? 0 A   1318 0 G   1339 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1352 hydrog ?    ? A  G   1319 N1    ? ? ? 1_555 A  U   1338 O2    ? ? 0 G   1319 0 U   1338 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1353 hydrog ?    ? A  G   1319 O6    ? ? ? 1_555 A  U   1338 N3    ? ? 0 G   1319 0 U   1338 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1354 hydrog ?    ? A  C   1320 N3    ? ? ? 1_555 A  G   1337 N1    ? ? 0 C   1320 0 G   1337 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1355 hydrog ?    ? A  C   1320 N4    ? ? ? 1_555 A  G   1337 O6    ? ? 0 C   1320 0 G   1337 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1356 hydrog ?    ? A  C   1320 O2    ? ? ? 1_555 A  G   1337 N2    ? ? 0 C   1320 0 G   1337 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1357 hydrog ?    ? A  A   1321 N1    ? ? ? 1_555 A  U   1336 N3    ? ? 0 A   1321 0 U   1336 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1358 hydrog ?    ? A  A   1321 N6    ? ? ? 1_555 A  U   1336 O4    ? ? 0 A   1321 0 U   1336 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1359 hydrog ?    ? A  G   1322 N1    ? ? ? 1_555 A  C   1335 N3    ? ? 0 G   1322 0 C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1360 hydrog ?    ? A  G   1322 N2    ? ? ? 1_555 A  C   1335 O2    ? ? 0 G   1322 0 C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1361 hydrog ?    ? A  G   1322 O6    ? ? ? 1_555 A  C   1335 N4    ? ? 0 G   1322 0 C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1362 hydrog ?    ? A  G   1323 N1    ? ? ? 1_555 A  C   1334 N3    ? ? 0 G   1323 0 C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1363 hydrog ?    ? A  G   1323 N2    ? ? ? 1_555 A  C   1334 O2    ? ? 0 G   1323 0 C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1364 hydrog ?    ? A  G   1323 O6    ? ? ? 1_555 A  C   1334 N4    ? ? 0 G   1323 0 C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1365 hydrog ?    ? A  G   1324 N1    ? ? ? 1_555 A  U   1333 O2    ? ? 0 G   1324 0 U   1333 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1366 hydrog ?    ? A  G   1324 O6    ? ? ? 1_555 A  U   1333 N3    ? ? 0 G   1324 0 U   1333 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1367 hydrog ?    ? A  G   1325 N1    ? ? ? 1_555 A  C   1332 N3    ? ? 0 G   1325 0 C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1368 hydrog ?    ? A  G   1325 N2    ? ? ? 1_555 A  C   1332 O2    ? ? 0 G   1325 0 C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1369 hydrog ?    ? A  G   1325 O6    ? ? ? 1_555 A  C   1332 N4    ? ? 0 G   1325 0 C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1370 hydrog ?    ? A  C   1326 N3    ? ? ? 1_555 A  G   1331 N1    ? ? 0 C   1326 0 G   1331 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1371 hydrog ?    ? A  C   1326 N4    ? ? ? 1_555 A  G   1331 O6    ? ? 0 C   1326 0 G   1331 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1372 hydrog ?    ? A  C   1326 O2    ? ? ? 1_555 A  G   1331 N2    ? ? 0 C   1326 0 G   1331 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1373 hydrog ?    ? A  G   1327 N2    ? ? ? 1_555 A  A   1330 N7    ? ? 0 G   1327 0 A   1330 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1374 hydrog ?    ? A  C   1366 N3    ? ? ? 1_555 A  G   2058 N1    ? ? 0 C   1366 0 G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1375 hydrog ?    ? A  C   1366 N4    ? ? ? 1_555 A  G   2058 O6    ? ? 0 C   1366 0 G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1376 hydrog ?    ? A  C   1366 O2    ? ? ? 1_555 A  G   2058 N2    ? ? 0 C   1366 0 G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1377 hydrog ?    ? A  A   1367 N1    ? ? ? 1_555 A  U   2057 N3    ? ? 0 A   1367 0 U   2057 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1378 hydrog ?    ? A  A   1367 N6    ? ? ? 1_555 A  U   2057 O4    ? ? 0 A   1367 0 U   2057 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1379 hydrog ?    ? A  U   1368 O2    ? ? ? 1_555 A  C   2056 N4    ? ? 0 U   1368 0 C   2056 1_555 ? ? ? ? ? ? 'U-C MISPAIR' 
?     ? ? 
hydrog1380 hydrog ?    ? A  A   1369 N6    ? ? ? 1_555 A  A   2055 N7    ? ? 0 A   1369 0 A   2055 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog1381 hydrog ?    ? A  A   1369 N7    ? ? ? 1_555 A  A   2055 N6    ? ? 0 A   1369 0 A   2055 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog1382 hydrog ?    ? A  G   1370 N2    ? ? ? 1_555 A  U   1371 O4    ? ? 0 G   1370 0 U   1371 1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog1383 hydrog ?    ? A  U   1371 N3    ? ? ? 1_555 A  A   2054 N7    ? ? 0 U   1371 0 A   2054 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1384 hydrog ?    ? A  U   1371 O2    ? ? ? 1_555 A  A   2054 N6    ? ? 0 U   1371 0 A   2054 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1385 hydrog ?    ? A  A   1372 N6    ? ? ? 1_555 A  G   2053 N3    ? ? 0 A   1372 0 G   2053 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1386 hydrog ?    ? A  A   1372 N7    ? ? ? 1_555 A  G   2053 N2    ? ? 0 A   1372 0 G   2053 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1387 hydrog ?    ? A  G   1373 N2    ? ? ? 1_555 A  C   1431 O2    ? ? 0 G   1373 0 C   1431 1_555 ? ? ? ? ? ? 'G-C PAIR' ? 
? ? 
hydrog1388 hydrog ?    ? A  G   1373 N1    ? ? ? 1_555 A  U   2052 O2    ? ? 0 G   1373 0 U   2052 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1389 hydrog ?    ? A  G   1373 O6    ? ? ? 1_555 A  U   2052 N3    ? ? 0 G   1373 0 U   2052 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1390 hydrog ?    ? A  C   1374 N3    ? ? ? 1_555 A  G   2051 N1    ? ? 0 C   1374 0 G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1391 hydrog ?    ? A  C   1374 N4    ? ? ? 1_555 A  G   2051 O6    ? ? 0 C   1374 0 G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1392 hydrog ?    ? A  C   1374 O2    ? ? ? 1_555 A  G   2051 N2    ? ? 0 C   1374 0 G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1393 hydrog ?    ? A  C   1377 N3    ? ? ? 1_555 A  G   1683 N2    ? ? 0 C   1377 0 G   1683 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog1394 hydrog ?    ? A  C   1377 O2    ? ? ? 1_555 A  G   1683 N1    ? ? 0 C   1377 0 G   1683 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog1395 hydrog ?    ? A  A   1381 N3    ? ? ? 1_555 A  G   1401 N2    ? ? 0 A   1381 0 G   1401 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog1396 hydrog ?    ? A  G   1382 N1    ? ? ? 1_555 A  C   1400 N3    ? ? 0 G   1382 0 C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1397 hydrog ?    ? A  G   1382 N2    ? ? ? 1_555 A  C   1400 O2    ? ? 0 G   1382 0 C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1398 hydrog ?    ? A  G   1382 O6    ? ? ? 1_555 A  C   1400 N4    ? ? 0 G   1382 0 C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1399 hydrog ?    ? A  U   1383 N3    ? ? ? 1_555 A  A   1399 N1    ? ? 0 U   1383 0 A   1399 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1400 hydrog ?    ? A  U   1383 O4    ? ? ? 1_555 A  A   1399 N6    ? ? 0 U   1383 0 A   1399 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1401 hydrog ?    ? A  C   1384 N3    ? ? ? 1_555 A  G   1398 N1    ? ? 0 C   1384 0 G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1402 hydrog ?    ? A  C   1384 N4    ? ? ? 1_555 A  G   1398 O6    ? ? 0 C   1384 0 G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1403 hydrog ?    ? A  C   1384 O2    ? ? ? 1_555 A  G   1398 N2    ? ? 0 C   1384 0 G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1404 hydrog ?    ? A  G   1385 N1    ? ? ? 1_555 A  C   1397 N3    ? ? 0 G   1385 0 C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1405 hydrog ?    ? A  G   1385 N2    ? ? ? 1_555 A  C   1397 O2    ? ? 0 G   1385 0 C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1406 hydrog ?    ? A  G   1385 O6    ? ? ? 1_555 A  C   1397 N4    ? ? 0 G   1385 0 C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1407 hydrog ?    ? A  G   1386 N1    ? ? ? 1_555 A  C   1396 N3    ? ? 0 G   1386 0 C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1408 hydrog ?    ? A  G   1386 N2    ? ? ? 1_555 A  C   1396 O2    ? ? 0 G   1386 0 C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1409 hydrog ?    ? A  G   1386 O6    ? ? ? 1_555 A  C   1396 N4    ? ? 0 G   1386 0 C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1410 hydrog ?    ? A  G   1387 N1    ? ? ? 1_555 A  C   1395 N3    ? ? 0 G   1387 0 C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1411 hydrog ?    ? A  G   1387 N2    ? ? ? 1_555 A  C   1395 O2    ? ? 0 G   1387 0 C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1412 hydrog ?    ? A  G   1387 O6    ? ? ? 1_555 A  C   1395 N4    ? ? 0 G   1387 0 C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1413 hydrog ?    ? A  U   1388 N3    ? ? ? 1_555 A  A   1392 N7    ? ? 0 U   1388 0 A   1392 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1414 hydrog ?    ? A  U   1388 O2    ? ? ? 1_555 A  A   1392 N6    ? ? 0 U   1388 0 A   1392 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1415 hydrog ?    ? A  G   1389 N2    ? ? ? 1_555 A  U   1435 O4    ? ? 0 G   1389 0 U   1435 1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog1416 hydrog ?    ? A  A   1393 N6    ? ? ? 1_555 A  C   1725 O2    ? ? 0 A   1393 0 C   1725 1_555 ? ? ? ? ? ? 'A-C MISPAIR' 
?     ? ? 
hydrog1417 hydrog ?    ? A  C   1394 N3    ? ? ? 1_555 A  U   1432 N3    ? ? 0 C   1394 0 U   1432 1_555 ? ? ? ? ? ? TYPE_17_PAIR 
?     ? ? 
hydrog1418 hydrog ?    ? A  C   1394 N4    ? ? ? 1_555 A  U   1432 O2    ? ? 0 C   1394 0 U   1432 1_555 ? ? ? ? ? ? TYPE_17_PAIR 
?     ? ? 
hydrog1419 hydrog ?    ? A  G   1401 N1    ? ? ? 1_555 A  C   1721 N3    ? ? 0 G   1401 0 C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1420 hydrog ?    ? A  G   1401 N2    ? ? ? 1_555 A  C   1721 O2    ? ? 0 G   1401 0 C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1421 hydrog ?    ? A  G   1401 O6    ? ? ? 1_555 A  C   1721 N4    ? ? 0 G   1401 0 C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1422 hydrog ?    ? A  G   1402 N1    ? ? ? 1_555 A  C   1720 N3    ? ? 0 G   1402 0 C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1423 hydrog ?    ? A  G   1402 N2    ? ? ? 1_555 A  C   1720 O2    ? ? 0 G   1402 0 C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1424 hydrog ?    ? A  G   1402 O6    ? ? ? 1_555 A  C   1720 N4    ? ? 0 G   1402 0 C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1425 hydrog ?    ? A  C   1403 N3    ? ? ? 1_555 A  G   1719 N1    ? ? 0 C   1403 0 G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1426 hydrog ?    ? A  C   1403 N4    ? ? ? 1_555 A  G   1719 O6    ? ? 0 C   1403 0 G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1427 hydrog ?    ? A  C   1403 O2    ? ? ? 1_555 A  G   1719 N2    ? ? 0 C   1403 0 G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1428 hydrog ?    ? A  C   1404 N3    ? ? ? 1_555 A  G   1718 N1    ? ? 0 C   1404 0 G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1429 hydrog ?    ? A  C   1404 N4    ? ? ? 1_555 A  G   1718 O6    ? ? 0 C   1404 0 G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1430 hydrog ?    ? A  C   1404 O2    ? ? ? 1_555 A  G   1718 N2    ? ? 0 C   1404 0 G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1431 hydrog ?    ? A  U   1405 N3    ? ? ? 1_555 A  A   1716 N7    ? ? 0 U   1405 0 A   1716 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1432 hydrog ?    ? A  U   1405 O2    ? ? ? 1_555 A  A   1716 N6    ? ? 0 U   1405 0 A   1716 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1433 hydrog ?    ? A  A   1407 N1    ? ? ? 1_555 A  A   1717 N6    ? ? 0 A   1407 0 A   1717 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? 
? ? 
hydrog1434 hydrog ?    ? A  A   1407 N6    ? ? ? 1_555 A  A   1717 N1    ? ? 0 A   1407 0 A   1717 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? 
? ? 
hydrog1435 hydrog ?    ? A  G   1409 N1    ? ? ? 1_555 A  C   1700 N3    ? ? 0 G   1409 0 C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1436 hydrog ?    ? A  G   1409 N2    ? ? ? 1_555 A  C   1700 O2    ? ? 0 G   1409 0 C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1437 hydrog ?    ? A  G   1409 O6    ? ? ? 1_555 A  C   1700 N4    ? ? 0 G   1409 0 C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1438 hydrog ?    ? A  G   1410 N1    ? ? ? 1_555 A  C   1699 N3    ? ? 0 G   1410 0 C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1439 hydrog ?    ? A  G   1410 N2    ? ? ? 1_555 A  C   1699 O2    ? ? 0 G   1410 0 C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1440 hydrog ?    ? A  G   1410 O6    ? ? ? 1_555 A  C   1699 N4    ? ? 0 G   1410 0 C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1441 hydrog ?    ? A  A   1411 N1    ? ? ? 1_555 A  U   1698 N3    ? ? 0 A   1411 0 U   1698 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1442 hydrog ?    ? A  A   1411 N6    ? ? ? 1_555 A  U   1698 O4    ? ? 0 A   1411 0 U   1698 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1443 hydrog ?    ? A  U   1412 N3    ? ? ? 1_555 A  G   1697 O6    ? ? 0 U   1412 0 G   1697 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1444 hydrog ?    ? A  U   1412 O2    ? ? ? 1_555 A  G   1697 N1    ? ? 0 U   1412 0 G   1697 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1445 hydrog ?    ? A  A   1414 N6    ? ? ? 1_555 A  G   1681 N3    ? ? 0 A   1414 0 G   1681 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1446 hydrog ?    ? A  A   1414 N7    ? ? ? 1_555 A  G   1681 N2    ? ? 0 A   1414 0 G   1681 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1447 hydrog ?    ? A  A   1414 N1    ? ? ? 1_555 A  A   1682 N6    ? ? 0 A   1414 0 A   1682 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? 
? ? 
hydrog1448 hydrog ?    ? A  A   1414 N6    ? ? ? 1_555 A  A   1682 N1    ? ? 0 A   1414 0 A   1682 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? 
? ? 
hydrog1449 hydrog ?    ? A  G   1415 N1    ? ? ? 1_555 A  C   1680 N3    ? ? 0 G   1415 0 C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1450 hydrog ?    ? A  G   1415 N2    ? ? ? 1_555 A  C   1680 O2    ? ? 0 G   1415 0 C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1451 hydrog ?    ? A  G   1415 O6    ? ? ? 1_555 A  C   1680 N4    ? ? 0 G   1415 0 C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1452 hydrog ?    ? A  G   1416 N1    ? ? ? 1_555 A  C   1679 N3    ? ? 0 G   1416 0 C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1453 hydrog ?    ? A  G   1416 N2    ? ? ? 1_555 A  C   1679 O2    ? ? 0 G   1416 0 C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1454 hydrog ?    ? A  G   1416 O6    ? ? ? 1_555 A  C   1679 N4    ? ? 0 G   1416 0 C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1455 hydrog ?    ? A  G   1416 N2    ? ? ? 1_555 A  A   1685 N3    ? ? 0 G   1416 0 A   1685 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1456 hydrog ?    ? A  U   1418 N3    ? ? ? 1_555 A  U   1446 O4    ? ? 0 U   1418 0 U   1446 1_555 ? ? ? ? ? ? 'U-U MISPAIR' 
?     ? ? 
hydrog1457 hydrog ?    ? A  U   1419 N3    ? ? ? 1_555 A  A   1678 N1    ? ? 0 U   1419 0 A   1678 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1458 hydrog ?    ? A  U   1419 O4    ? ? ? 1_555 A  A   1678 N6    ? ? 0 U   1419 0 A   1678 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1459 hydrog ?    ? A  C   1420 N3    ? ? ? 1_555 A  G   1444 N1    ? ? 0 C   1420 0 G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1460 hydrog ?    ? A  C   1420 N4    ? ? ? 1_555 A  G   1444 O6    ? ? 0 C   1420 0 G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1461 hydrog ?    ? A  C   1420 O2    ? ? ? 1_555 A  G   1444 N2    ? ? 0 C   1420 0 G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1462 hydrog ?    ? A  C   1421 N3    ? ? ? 1_555 A  G   1443 N1    ? ? 0 C   1421 0 G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1463 hydrog ?    ? A  C   1421 N4    ? ? ? 1_555 A  G   1443 O6    ? ? 0 C   1421 0 G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1464 hydrog ?    ? A  C   1421 O2    ? ? ? 1_555 A  G   1443 N2    ? ? 0 C   1421 0 G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1465 hydrog ?    ? A  U   1422 N3    ? ? ? 1_555 A  A   1442 N1    ? ? 0 U   1422 0 A   1442 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1466 hydrog ?    ? A  U   1422 O4    ? ? ? 1_555 A  A   1442 N6    ? ? 0 U   1422 0 A   1442 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1467 hydrog ?    ? A  C   1423 N3    ? ? ? 1_555 A  G   1441 N1    ? ? 0 C   1423 0 G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1468 hydrog ?    ? A  C   1423 N4    ? ? ? 1_555 A  G   1441 O6    ? ? 0 C   1423 0 G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1469 hydrog ?    ? A  C   1423 O2    ? ? ? 1_555 A  G   1441 N2    ? ? 0 C   1423 0 G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1470 hydrog ?    ? A  A   1424 N1    ? ? ? 1_555 A  U   1440 N3    ? ? 0 A   1424 0 U   1440 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1471 hydrog ?    ? A  A   1424 N6    ? ? ? 1_555 A  U   1440 O4    ? ? 0 A   1424 0 U   1440 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1472 hydrog ?    ? A  G   1425 N1    ? ? ? 1_555 A  C   1439 N3    ? ? 0 G   1425 0 C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1473 hydrog ?    ? A  G   1425 N2    ? ? ? 1_555 A  C   1439 O2    ? ? 0 G   1425 0 C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1474 hydrog ?    ? A  G   1425 O6    ? ? ? 1_555 A  C   1439 N4    ? ? 0 G   1425 0 C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1475 hydrog ?    ? A  C   1426 N3    ? ? ? 1_555 A  A   1437 N6    ? ? 0 C   1426 0 A   1437 1_555 ? ? ? ? ? ? TYPE_25_PAIR 
?     ? ? 
hydrog1476 hydrog ?    ? A  C   1426 N4    ? ? ? 1_555 A  A   1437 N7    ? ? 0 C   1426 0 A   1437 1_555 ? ? ? ? ? ? TYPE_25_PAIR 
?     ? ? 
hydrog1477 hydrog ?    ? A  C   1428 N4    ? ? ? 1_555 A  C   1439 O2    ? ? 0 C   1428 0 C   1439 1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog1478 hydrog ?    ? A  U   1429 N3    ? ? ? 1_555 A  A   1437 N1    ? ? 0 U   1429 0 A   1437 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1479 hydrog ?    ? A  U   1429 O4    ? ? ? 1_555 A  A   1437 N6    ? ? 0 U   1429 0 A   1437 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1480 hydrog ?    ? A  G   1430 N1    ? ? ? 1_555 A  C   1436 N3    ? ? 0 G   1430 0 C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1481 hydrog ?    ? A  G   1430 N2    ? ? ? 1_555 A  C   1436 O2    ? ? 0 G   1430 0 C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1482 hydrog ?    ? A  G   1430 O6    ? ? ? 1_555 A  C   1436 N4    ? ? 0 G   1430 0 C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1483 hydrog ?    ? A  G   1430 N3    ? ? ? 1_555 A  A   1691 N6    ? ? 0 G   1430 0 A   1691 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1484 hydrog ?    ? A  G   1444 N2    ? ? ? 1_555 A  A   1502 N3    ? ? 0 G   1444 0 A   1502 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1485 hydrog ?    ? A  A   1448 N6    ? ? ? 1_555 A  U   1677 O2    ? ? 0 A   1448 0 U   1677 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1486 hydrog ?    ? A  A   1448 N7    ? ? ? 1_555 A  U   1677 N3    ? ? 0 A   1448 0 U   1677 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1487 hydrog ?    ? A  G   1449 N2    ? ? ? 1_555 A  A   1493 N3    ? ? 0 G   1449 0 A   1493 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1488 hydrog ?    ? A  G   1449 N1    ? ? ? 1_555 A  C   1513 N3    ? ? 0 G   1449 0 C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1489 hydrog ?    ? A  G   1449 N2    ? ? ? 1_555 A  C   1513 O2    ? ? 0 G   1449 0 C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1490 hydrog ?    ? A  G   1449 O6    ? ? ? 1_555 A  C   1513 N4    ? ? 0 G   1449 0 C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1491 hydrog ?    ? A  C   1450 N3    ? ? ? 1_555 A  G   1512 N1    ? ? 0 C   1450 0 G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1492 hydrog ?    ? A  C   1450 N4    ? ? ? 1_555 A  G   1512 O6    ? ? 0 C   1450 0 G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1493 hydrog ?    ? A  C   1450 O2    ? ? ? 1_555 A  G   1512 N2    ? ? 0 C   1450 0 G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1494 hydrog ?    ? A  C   1451 N3    ? ? ? 1_555 A  G   1676 N1    ? ? 0 C   1451 0 G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1495 hydrog ?    ? A  C   1451 N4    ? ? ? 1_555 A  G   1676 O6    ? ? 0 C   1451 0 G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1496 hydrog ?    ? A  C   1451 O2    ? ? ? 1_555 A  G   1676 N2    ? ? 0 C   1451 0 G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1497 hydrog ?    ? A  G   1452 N2    ? ? ? 1_555 A  A   1486 N1    ? ? 0 G   1452 0 A   1486 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1498 hydrog ?    ? A  G   1452 N1    ? ? ? 1_555 A  C   1675 N3    ? ? 0 G   1452 0 C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1499 hydrog ?    ? A  G   1452 N2    ? ? ? 1_555 A  C   1675 O2    ? ? 0 G   1452 0 C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1500 hydrog ?    ? A  G   1452 O6    ? ? ? 1_555 A  C   1675 N4    ? ? 0 G   1452 0 C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1501 hydrog ?    ? A  G   1453 N1    ? ? ? 1_555 A  C   1674 N3    ? ? 0 G   1453 0 C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1502 hydrog ?    ? A  G   1453 N2    ? ? ? 1_555 A  C   1674 O2    ? ? 0 G   1453 0 C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1503 hydrog ?    ? A  G   1453 O6    ? ? ? 1_555 A  C   1674 N4    ? ? 0 G   1453 0 C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1504 hydrog ?    ? A  U   1454 O4    ? ? ? 1_555 A  G   1491 N2    ? ? 0 U   1454 0 G   1491 1_555 ? ? ? ? ? ? 'U-G MISPAIR' 
?     ? ? 
hydrog1505 hydrog ?    ? A  C   1455 N3    ? ? ? 1_555 A  G   1490 N1    ? ? 0 C   1455 0 G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1506 hydrog ?    ? A  C   1455 N4    ? ? ? 1_555 A  G   1490 O6    ? ? 0 C   1455 0 G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1507 hydrog ?    ? A  C   1455 O2    ? ? ? 1_555 A  G   1490 N2    ? ? 0 C   1455 0 G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1508 hydrog ?    ? A  C   1456 N3    ? ? ? 1_555 A  G   1489 N1    ? ? 0 C   1456 0 G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1509 hydrog ?    ? A  C   1456 N4    ? ? ? 1_555 A  G   1489 O6    ? ? 0 C   1456 0 G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1510 hydrog ?    ? A  C   1456 O2    ? ? ? 1_555 A  G   1489 N2    ? ? 0 C   1456 0 G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1511 hydrog ?    ? A  U   1457 N3    ? ? ? 1_555 A  A   1485 N7    ? ? 0 U   1457 0 A   1485 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1512 hydrog ?    ? A  U   1457 O2    ? ? ? 1_555 A  A   1485 N6    ? ? 0 U   1457 0 A   1485 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1513 hydrog ?    ? A  A   1459 N6    ? ? ? 1_555 A  G   1484 N3    ? ? 0 A   1459 0 G   1484 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1514 hydrog ?    ? A  A   1459 N7    ? ? ? 1_555 A  G   1484 N2    ? ? 0 A   1459 0 G   1484 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1515 hydrog ?    ? A  G   1460 N1    ? ? ? 1_555 A  C   1483 N3    ? ? 0 G   1460 0 C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1516 hydrog ?    ? A  G   1460 N2    ? ? ? 1_555 A  C   1483 O2    ? ? 0 G   1460 0 C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1517 hydrog ?    ? A  G   1460 O6    ? ? ? 1_555 A  C   1483 N4    ? ? 0 G   1460 0 C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1518 hydrog ?    ? A  U   1461 N3    ? ? ? 1_555 A  A   1482 N1    ? ? 0 U   1461 0 A   1482 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1519 hydrog ?    ? A  U   1461 O4    ? ? ? 1_555 A  A   1482 N6    ? ? 0 U   1461 0 A   1482 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1520 hydrog ?    ? A  C   1462 N3    ? ? ? 1_555 A  G   1481 N1    ? ? 0 C   1462 0 G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1521 hydrog ?    ? A  C   1462 N4    ? ? ? 1_555 A  G   1481 O6    ? ? 0 C   1462 0 G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1522 hydrog ?    ? A  C   1462 O2    ? ? ? 1_555 A  G   1481 N2    ? ? 0 C   1462 0 G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1523 hydrog ?    ? A  U   1463 N3    ? ? ? 1_555 A  A   1480 N1    ? ? 0 U   1463 0 A   1480 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1524 hydrog ?    ? A  U   1463 O4    ? ? ? 1_555 A  A   1480 N6    ? ? 0 U   1463 0 A   1480 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1525 hydrog ?    ? A  C   1464 N3    ? ? ? 1_555 A  G   1479 N1    ? ? 0 C   1464 0 G   1479 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1526 hydrog ?    ? A  C   1464 N4    ? ? ? 1_555 A  G   1479 O6    ? ? 0 C   1464 0 G   1479 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1527 hydrog ?    ? A  C   1464 O2    ? ? ? 1_555 A  G   1479 N2    ? ? 0 C   1464 0 G   1479 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1528 hydrog ?    ? A  A   1465 N1    ? ? ? 1_555 A  U   1478 N3    ? ? 0 A   1465 0 U   1478 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1529 hydrog ?    ? A  A   1465 N6    ? ? ? 1_555 A  U   1478 O4    ? ? 0 A   1465 0 U   1478 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1530 hydrog ?    ? A  C   1466 O2    ? ? ? 1_555 A  C   1477 N4    ? ? 0 C   1466 0 C   1477 1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog1531 hydrog ?    ? A  C   1467 N3    ? ? ? 1_555 A  G   1475 N1    ? ? 0 C   1467 0 G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1532 hydrog ?    ? A  C   1467 N4    ? ? ? 1_555 A  G   1475 O6    ? ? 0 C   1467 0 G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1533 hydrog ?    ? A  C   1467 O2    ? ? ? 1_555 A  G   1475 N2    ? ? 0 C   1467 0 G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1534 hydrog ?    ? A  C   1467 O2    ? ? ? 1_555 A  A   1476 N6    ? ? 0 C   1467 0 A   1476 1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog1535 hydrog ?    ? A  G   1468 N1    ? ? ? 1_555 A  C   1474 N3    ? ? 0 G   1468 0 C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1536 hydrog ?    ? A  G   1468 N2    ? ? ? 1_555 A  C   1474 O2    ? ? 0 G   1468 0 C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1537 hydrog ?    ? A  G   1468 O6    ? ? ? 1_555 A  C   1474 N4    ? ? 0 G   1468 0 C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1538 hydrog ?    ? A  G   1475 N2    ? ? ? 1_555 A  A   1866 N3    ? ? 0 G   1475 0 A   1866 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1539 hydrog ?    ? A  A   1485 N6    ? ? ? 1_555 A  A   1656 N1    ? ? 0 A   1485 0 A   1656 1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog1540 hydrog ?    ? A  A   1487 N3    ? ? ? 1_555 A  G   1697 N2    ? ? 0 A   1487 0 G   1697 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog1541 hydrog ?    ? A  G   1489 N3    ? ? ? 1_555 A  A   1656 N6    ? ? 0 G   1489 0 A   1656 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1542 hydrog ?    ? A  G   1489 N2    ? ? ? 1_555 A  A   1657 N1    ? ? 0 G   1489 0 A   1657 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1543 hydrog ?    ? A  A   1494 N1    ? ? ? 1_555 A  U   1511 N3    ? ? 0 A   1494 0 U   1511 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1544 hydrog ?    ? A  A   1494 N6    ? ? ? 1_555 A  U   1511 O4    ? ? 0 A   1494 0 U   1511 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1545 hydrog ?    ? A  C   1495 N3    ? ? ? 1_555 A  G   1510 N1    ? ? 0 C   1495 0 G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1546 hydrog ?    ? A  C   1495 N4    ? ? ? 1_555 A  G   1510 O6    ? ? 0 C   1495 0 G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1547 hydrog ?    ? A  C   1495 O2    ? ? ? 1_555 A  G   1510 N2    ? ? 0 C   1495 0 G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1548 hydrog ?    ? A  A   1496 N1    ? ? ? 1_555 A  U   1509 N3    ? ? 0 A   1496 0 U   1509 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1549 hydrog ?    ? A  A   1496 N6    ? ? ? 1_555 A  U   1509 O4    ? ? 0 A   1496 0 U   1509 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1550 hydrog ?    ? A  G   1497 N1    ? ? ? 1_555 A  C   1508 N3    ? ? 0 G   1497 0 C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1551 hydrog ?    ? A  G   1497 N2    ? ? ? 1_555 A  C   1508 O2    ? ? 0 G   1497 0 C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1552 hydrog ?    ? A  G   1497 O6    ? ? ? 1_555 A  C   1508 N4    ? ? 0 G   1497 0 C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1553 hydrog ?    ? A  G   1498 N1    ? ? ? 1_555 A  C   1507 N3    ? ? 0 G   1498 0 C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1554 hydrog ?    ? A  G   1498 N2    ? ? ? 1_555 A  C   1507 O2    ? ? 0 G   1498 0 C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1555 hydrog ?    ? A  G   1498 O6    ? ? ? 1_555 A  C   1507 N4    ? ? 0 G   1498 0 C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1556 hydrog ?    ? A  U   1499 N3    ? ? ? 1_555 A  A   1504 N7    ? ? 0 U   1499 0 A   1504 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1557 hydrog ?    ? A  U   1499 O2    ? ? ? 1_555 A  A   1504 N6    ? ? 0 U   1499 0 A   1504 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1558 hydrog ?    ? A  C   1514 N3    ? ? ? 1_555 A  G   1672 N1    ? ? 0 C   1514 0 G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1559 hydrog ?    ? A  C   1514 N4    ? ? ? 1_555 A  G   1672 O6    ? ? 0 C   1514 0 G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1560 hydrog ?    ? A  C   1514 O2    ? ? ? 1_555 A  G   1672 N2    ? ? 0 C   1514 0 G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1561 hydrog ?    ? A  A   1515 N1    ? ? ? 1_555 A  U   1671 N3    ? ? 0 A   1515 0 U   1671 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1562 hydrog ?    ? A  A   1515 N6    ? ? ? 1_555 A  U   1671 O4    ? ? 0 A   1515 0 U   1671 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1563 hydrog ?    ? A  U   1516 N3    ? ? ? 1_555 A  A   1670 N1    ? ? 0 U   1516 0 A   1670 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1564 hydrog ?    ? A  U   1516 O4    ? ? ? 1_555 A  A   1670 N6    ? ? 0 U   1516 0 A   1670 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1565 hydrog ?    ? A  C   1517 N3    ? ? ? 1_555 A  G   1669 N1    ? ? 0 C   1517 0 G   1669 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1566 hydrog ?    ? A  C   1517 N4    ? ? ? 1_555 A  G   1669 O6    ? ? 0 C   1517 0 G   1669 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1567 hydrog ?    ? A  C   1517 O2    ? ? ? 1_555 A  G   1669 N2    ? ? 0 C   1517 0 G   1669 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1568 hydrog ?    ? A  A   1518 N1    ? ? ? 1_555 A  U   1668 N3    ? ? 0 A   1518 0 U   1668 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1569 hydrog ?    ? A  A   1518 N6    ? ? ? 1_555 A  U   1668 O4    ? ? 0 A   1518 0 U   1668 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1570 hydrog ?    ? A  U   1519 N3    ? ? ? 1_555 A  A   1667 N1    ? ? 0 U   1519 0 A   1667 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1571 hydrog ?    ? A  U   1519 O4    ? ? ? 1_555 A  A   1667 N6    ? ? 0 U   1519 0 A   1667 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1572 hydrog ?    ? A  G   1520 N1    ? ? ? 1_555 A  C   1666 N3    ? ? 0 G   1520 0 C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1573 hydrog ?    ? A  G   1520 N2    ? ? ? 1_555 A  C   1666 O2    ? ? 0 G   1520 0 C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1574 hydrog ?    ? A  G   1520 O6    ? ? ? 1_555 A  C   1666 N4    ? ? 0 G   1520 0 C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1575 hydrog ?    ? A  C   1521 N3    ? ? ? 1_555 A  G   1665 N1    ? ? 0 C   1521 0 G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1576 hydrog ?    ? A  C   1521 N4    ? ? ? 1_555 A  G   1665 O6    ? ? 0 C   1521 0 G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1577 hydrog ?    ? A  C   1521 O2    ? ? ? 1_555 A  G   1665 N2    ? ? 0 C   1521 0 G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1578 hydrog ?    ? A  A   1527 N6    ? ? ? 1_555 A  A   1664 N7    ? ? 0 A   1527 0 A   1664 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog1579 hydrog ?    ? A  A   1527 N7    ? ? ? 1_555 A  A   1664 N6    ? ? 0 A   1527 0 A   1664 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog1580 hydrog ?    ? A  A   1528 N6    ? ? ? 1_555 A  G   1663 N3    ? ? 0 A   1528 0 G   1663 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1581 hydrog ?    ? A  A   1528 N7    ? ? ? 1_555 A  G   1663 N2    ? ? 0 A   1528 0 G   1663 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1582 hydrog ?    ? A  G   1529 N1    ? ? ? 1_555 A  C   1662 N3    ? ? 0 G   1529 0 C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1583 hydrog ?    ? A  G   1529 N2    ? ? ? 1_555 A  C   1662 O2    ? ? 0 G   1529 0 C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1584 hydrog ?    ? A  G   1529 O6    ? ? ? 1_555 A  C   1662 N4    ? ? 0 G   1529 0 C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1585 hydrog ?    ? A  U   1530 N3    ? ? ? 1_555 A  A   1661 N1    ? ? 0 U   1530 0 A   1661 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1586 hydrog ?    ? A  U   1530 O4    ? ? ? 1_555 A  A   1661 N6    ? ? 0 U   1530 0 A   1661 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1587 hydrog ?    ? A  U   1531 N3    ? ? ? 1_555 A  G   1660 O6    ? ? 0 U   1531 0 G   1660 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1588 hydrog ?    ? A  U   1531 O2    ? ? ? 1_555 A  G   1660 N1    ? ? 0 U   1531 0 G   1660 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1589 hydrog ?    ? A  G   1532 N2    ? ? ? 1_555 A  A   1659 N7    ? ? 0 G   1532 0 A   1659 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1590 hydrog ?    ? A  G   1532 N3    ? ? ? 1_555 A  A   1659 N6    ? ? 0 G   1532 0 A   1659 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1591 hydrog ?    ? A  A   1533 N6    ? ? ? 1_555 A  A   1658 N7    ? ? 0 A   1533 0 A   1658 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog1592 hydrog ?    ? A  A   1533 N7    ? ? ? 1_555 A  A   1658 N6    ? ? 0 A   1533 0 A   1658 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog1593 hydrog ?    ? A  C   1534 N4    ? ? ? 1_555 A  A   1657 N7    ? ? 0 C   1534 0 A   1657 1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog1594 hydrog ?    ? A  G   1535 N1    ? ? ? 1_555 A  C   1650 N3    ? ? 0 G   1535 0 C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1595 hydrog ?    ? A  G   1535 N2    ? ? ? 1_555 A  C   1650 O2    ? ? 0 G   1535 0 C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1596 hydrog ?    ? A  G   1535 O6    ? ? ? 1_555 A  C   1650 N4    ? ? 0 G   1535 0 C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1597 hydrog ?    ? A  C   1536 N3    ? ? ? 1_555 A  G   1649 N1    ? ? 0 C   1536 0 G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1598 hydrog ?    ? A  C   1536 N4    ? ? ? 1_555 A  G   1649 O6    ? ? 0 C   1536 0 G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1599 hydrog ?    ? A  C   1536 O2    ? ? ? 1_555 A  G   1649 N2    ? ? 0 C   1536 0 G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1600 hydrog ?    ? A  C   1537 N3    ? ? ? 1_555 A  G   1648 N1    ? ? 0 C   1537 0 G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1601 hydrog ?    ? A  C   1537 N4    ? ? ? 1_555 A  G   1648 O6    ? ? 0 C   1537 0 G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1602 hydrog ?    ? A  C   1537 O2    ? ? ? 1_555 A  G   1648 N2    ? ? 0 C   1537 0 G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1603 hydrog ?    ? A  C   1538 N3    ? ? ? 1_555 A  G   1647 N1    ? ? 0 C   1538 0 G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1604 hydrog ?    ? A  C   1538 N4    ? ? ? 1_555 A  G   1647 O6    ? ? 0 C   1538 0 G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1605 hydrog ?    ? A  C   1538 O2    ? ? ? 1_555 A  G   1647 N2    ? ? 0 C   1538 0 G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1606 hydrog ?    ? A  U   1539 N3    ? ? ? 1_555 A  G   1646 O6    ? ? 0 U   1539 0 G   1646 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1607 hydrog ?    ? A  U   1539 O2    ? ? ? 1_555 A  G   1646 N1    ? ? 0 U   1539 0 G   1646 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1608 hydrog ?    ? A  G   1540 N1    ? ? ? 1_555 A  U   1645 O2    ? ? 0 G   1540 0 U   1645 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1609 hydrog ?    ? A  G   1540 O6    ? ? ? 1_555 A  U   1645 N3    ? ? 0 G   1540 0 U   1645 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1610 hydrog ?    ? A  G   1541 N1    ? ? ? 1_555 A  C   1644 N3    ? ? 0 G   1541 0 C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1611 hydrog ?    ? A  G   1541 N2    ? ? ? 1_555 A  C   1644 O2    ? ? 0 G   1541 0 C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1612 hydrog ?    ? A  G   1541 O6    ? ? ? 1_555 A  C   1644 N4    ? ? 0 G   1541 0 C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1613 hydrog ?    ? A  G   1542 N2    ? ? ? 1_555 A  A   1616 N3    ? ? 0 G   1542 0 A   1616 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1614 hydrog ?    ? A  G   1542 N1    ? ? ? 1_555 A  C   1643 N3    ? ? 0 G   1542 0 C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1615 hydrog ?    ? A  G   1542 N2    ? ? ? 1_555 A  C   1643 O2    ? ? 0 G   1542 0 C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1616 hydrog ?    ? A  G   1542 O6    ? ? ? 1_555 A  C   1643 N4    ? ? 0 G   1542 0 C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1617 hydrog ?    ? A  G   1543 N2    ? ? ? 1_555 A  A   1642 N7    ? ? 0 G   1543 0 A   1642 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1618 hydrog ?    ? A  G   1543 N3    ? ? ? 1_555 A  A   1642 N6    ? ? 0 G   1543 0 A   1642 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1619 hydrog ?    ? A  U   1544 N3    ? ? ? 1_555 A  A   1641 N7    ? ? 0 U   1544 0 A   1641 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1620 hydrog ?    ? A  U   1544 O2    ? ? ? 1_555 A  A   1641 N6    ? ? 0 U   1544 0 A   1641 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1621 hydrog ?    ? A  C   1545 N4    ? ? ? 1_555 A  C   1640 O2    ? ? 0 C   1545 0 C   1640 1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog1622 hydrog ?    ? A  C   1545 N3    ? ? ? 1_555 A  U   1702 N3    ? ? 0 C   1545 0 U   1702 1_555 ? ? ? ? ? ? TYPE_18_PAIR 
?     ? ? 
hydrog1623 hydrog ?    ? A  C   1545 N4    ? ? ? 1_555 A  U   1702 O4    ? ? 0 C   1545 0 U   1702 1_555 ? ? ? ? ? ? TYPE_18_PAIR 
?     ? ? 
hydrog1624 hydrog ?    ? A  G   1546 N1    ? ? ? 1_555 A  U   1639 O2    ? ? 0 G   1546 0 U   1639 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1625 hydrog ?    ? A  G   1546 O6    ? ? ? 1_555 A  U   1639 N3    ? ? 0 G   1546 0 U   1639 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1626 hydrog ?    ? A  A   1547 N1    ? ? ? 1_555 A  U   1638 N3    ? ? 0 A   1547 0 U   1638 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1627 hydrog ?    ? A  A   1547 N6    ? ? ? 1_555 A  U   1638 O4    ? ? 0 A   1547 0 U   1638 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1628 hydrog ?    ? A  U   1548 N3    ? ? ? 1_555 A  A   1637 N1    ? ? 0 U   1548 0 A   1637 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1629 hydrog ?    ? A  U   1548 O4    ? ? ? 1_555 A  A   1637 N6    ? ? 0 U   1548 0 A   1637 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1630 hydrog ?    ? A  C   1549 N3    ? ? ? 1_555 A  G   1636 N1    ? ? 0 C   1549 0 G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1631 hydrog ?    ? A  C   1549 N4    ? ? ? 1_555 A  G   1636 O6    ? ? 0 C   1549 0 G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1632 hydrog ?    ? A  C   1549 O2    ? ? ? 1_555 A  G   1636 N2    ? ? 0 C   1549 0 G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1633 hydrog ?    ? A  A   1550 N1    ? ? ? 1_555 A  U   1635 N3    ? ? 0 A   1550 0 U   1635 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1634 hydrog ?    ? A  A   1550 N6    ? ? ? 1_555 A  U   1635 O4    ? ? 0 A   1550 0 U   1635 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1635 hydrog ?    ? A  C   1551 N3    ? ? ? 1_555 A  G   1634 N1    ? ? 0 C   1551 0 G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1636 hydrog ?    ? A  C   1551 N4    ? ? ? 1_555 A  G   1634 O6    ? ? 0 C   1551 0 G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1637 hydrog ?    ? A  C   1551 O2    ? ? ? 1_555 A  G   1634 N2    ? ? 0 C   1551 0 G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1638 hydrog ?    ? A  G   1552 N1    ? ? ? 1_555 A  U   1569 O2    ? ? 0 G   1552 0 U   1569 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1639 hydrog ?    ? A  G   1552 O6    ? ? ? 1_555 A  U   1569 N3    ? ? 0 G   1552 0 U   1569 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1640 hydrog ?    ? A  C   1553 N3    ? ? ? 1_555 A  G   1568 N1    ? ? 0 C   1553 0 G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1641 hydrog ?    ? A  C   1553 N4    ? ? ? 1_555 A  G   1568 O6    ? ? 0 C   1553 0 G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1642 hydrog ?    ? A  C   1553 O2    ? ? ? 1_555 A  G   1568 N2    ? ? 0 C   1553 0 G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1643 hydrog ?    ? A  C   1554 N3    ? ? ? 1_555 A  G   1567 N1    ? ? 0 C   1554 0 G   1567 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1644 hydrog ?    ? A  C   1554 N4    ? ? ? 1_555 A  G   1567 O6    ? ? 0 C   1554 0 G   1567 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1645 hydrog ?    ? A  C   1554 O2    ? ? ? 1_555 A  G   1567 N2    ? ? 0 C   1554 0 G   1567 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1646 hydrog ?    ? A  G   1555 N1    ? ? ? 1_555 A  C   1566 N3    ? ? 0 G   1555 0 C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1647 hydrog ?    ? A  G   1555 N2    ? ? ? 1_555 A  C   1566 O2    ? ? 0 G   1555 0 C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1648 hydrog ?    ? A  G   1555 O6    ? ? ? 1_555 A  C   1566 N4    ? ? 0 G   1555 0 C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1649 hydrog ?    ? A  G   1556 N1    ? ? ? 1_555 A  C   1565 N3    ? ? 0 G   1556 0 C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1650 hydrog ?    ? A  G   1556 N2    ? ? ? 1_555 A  C   1565 O2    ? ? 0 G   1556 0 C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1651 hydrog ?    ? A  G   1556 O6    ? ? ? 1_555 A  C   1565 N4    ? ? 0 G   1556 0 C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1652 hydrog ?    ? A  G   1557 N1    ? ? ? 1_555 A  C   1564 N3    ? ? 0 G   1557 0 C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1653 hydrog ?    ? A  G   1557 N2    ? ? ? 1_555 A  C   1564 O2    ? ? 0 G   1557 0 C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1654 hydrog ?    ? A  G   1557 O6    ? ? ? 1_555 A  C   1564 N4    ? ? 0 G   1557 0 C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1655 hydrog ?    ? A  U   1561 N3    ? ? ? 1_555 A  A   2739 N1    ? ? 0 U   1561 0 A   2739 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1656 hydrog ?    ? A  U   1561 O4    ? ? ? 1_555 A  A   2739 N6    ? ? 0 U   1561 0 A   2739 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1657 hydrog ?    ? A  C   1562 N3    ? ? ? 1_555 A  G   2738 N1    ? ? 0 C   1562 0 G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1658 hydrog ?    ? A  C   1562 N4    ? ? ? 1_555 A  G   2738 O6    ? ? 0 C   1562 0 G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1659 hydrog ?    ? A  C   1562 O2    ? ? ? 1_555 A  G   2738 N2    ? ? 0 C   1562 0 G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1660 hydrog ?    ? A  G   1568 N2    ? ? ? 1_555 A  A   1632 N3    ? ? 0 G   1568 0 A   1632 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1661 hydrog ?    ? A  C   1570 N3    ? ? ? 1_555 A  G   1627 N1    ? ? 0 C   1570 0 G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1662 hydrog ?    ? A  C   1570 N4    ? ? ? 1_555 A  G   1627 O6    ? ? 0 C   1570 0 G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1663 hydrog ?    ? A  C   1570 O2    ? ? ? 1_555 A  G   1627 N2    ? ? 0 C   1570 0 G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1664 hydrog ?    ? A  G   1571 N2    ? ? ? 1_555 A  A   1626 N7    ? ? 0 G   1571 0 A   1626 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1665 hydrog ?    ? A  G   1571 N3    ? ? ? 1_555 A  A   1626 N6    ? ? 0 G   1571 0 A   1626 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1666 hydrog ?    ? A  A   1572 N6    ? ? ? 1_555 A  A   1624 N7    ? ? 0 A   1572 0 A   1624 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog1667 hydrog ?    ? A  A   1572 N7    ? ? ? 1_555 A  A   1624 N6    ? ? 0 A   1572 0 A   1624 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog1668 hydrog ?    ? A  A   1573 N6    ? ? ? 1_555 A  C   1623 O2    ? ? 0 A   1573 0 C   1623 1_555 ? ? ? ? ? ? 'A-C MISPAIR' 
?     ? ? 
hydrog1669 hydrog ?    ? A  C   1574 N3    ? ? ? 1_555 A  G   1622 N1    ? ? 0 C   1574 0 G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1670 hydrog ?    ? A  C   1574 N4    ? ? ? 1_555 A  G   1622 O6    ? ? 0 C   1574 0 G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1671 hydrog ?    ? A  C   1574 O2    ? ? ? 1_555 A  G   1622 N2    ? ? 0 C   1574 0 G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1672 hydrog ?    ? A  C   1575 N3    ? ? ? 1_555 A  G   1621 N1    ? ? 0 C   1575 0 G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1673 hydrog ?    ? A  C   1575 N4    ? ? ? 1_555 A  G   1621 O6    ? ? 0 C   1575 0 G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1674 hydrog ?    ? A  C   1575 O2    ? ? ? 1_555 A  G   1621 N2    ? ? 0 C   1575 0 G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1675 hydrog ?    ? A  G   1576 N1    ? ? ? 1_555 A  C   1620 N3    ? ? 0 G   1576 0 C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1676 hydrog ?    ? A  G   1576 N2    ? ? ? 1_555 A  C   1620 O2    ? ? 0 G   1576 0 C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1677 hydrog ?    ? A  G   1576 O6    ? ? ? 1_555 A  C   1620 N4    ? ? 0 G   1576 0 C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1678 hydrog ?    ? A  U   1577 N3    ? ? ? 1_555 A  G   1619 O6    ? ? 0 U   1577 0 G   1619 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1679 hydrog ?    ? A  U   1577 O2    ? ? ? 1_555 A  G   1619 N1    ? ? 0 U   1577 0 G   1619 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1680 hydrog ?    ? A  C   1578 N3    ? ? ? 1_555 A  G   1618 N1    ? ? 0 C   1578 0 G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1681 hydrog ?    ? A  C   1578 N4    ? ? ? 1_555 A  G   1618 O6    ? ? 0 C   1578 0 G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1682 hydrog ?    ? A  C   1578 O2    ? ? ? 1_555 A  G   1618 N2    ? ? 0 C   1578 0 G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1683 hydrog ?    ? A  C   1579 N3    ? ? ? 1_555 A  A   1616 N6    ? ? 0 C   1579 0 A   1616 1_555 ? ? ? ? ? ? TYPE_25_PAIR 
?     ? ? 
hydrog1684 hydrog ?    ? A  C   1579 N4    ? ? ? 1_555 A  A   1616 N7    ? ? 0 C   1579 0 A   1616 1_555 ? ? ? ? ? ? TYPE_25_PAIR 
?     ? ? 
hydrog1685 hydrog ?    ? A  C   1579 N4    ? ? ? 1_555 A  G   1618 O6    ? ? 0 C   1579 0 G   1618 1_555 ? ? ? ? ? ? 'C-G PAIR' ? 
? ? 
hydrog1686 hydrog ?    ? A  A   1581 N6    ? ? ? 1_555 A  G   1614 N3    ? ? 0 A   1581 0 G   1614 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1687 hydrog ?    ? A  A   1581 N7    ? ? ? 1_555 A  G   1614 N2    ? ? 0 A   1581 0 G   1614 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1688 hydrog ?    ? A  C   1582 N4    ? ? ? 1_555 A  C   1613 N3    ? ? 0 C   1582 0 C   1613 1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog1689 hydrog ?    ? A  U   1583 N3    ? ? ? 1_555 A  A   1612 N1    ? ? 0 U   1583 0 A   1612 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1690 hydrog ?    ? A  U   1583 O4    ? ? ? 1_555 A  A   1612 N6    ? ? 0 U   1583 0 A   1612 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1691 hydrog ?    ? A  C   1584 N3    ? ? ? 1_555 A  G   1611 N1    ? ? 0 C   1584 0 G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1692 hydrog ?    ? A  C   1584 N4    ? ? ? 1_555 A  G   1611 O6    ? ? 0 C   1584 0 G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1693 hydrog ?    ? A  C   1584 O2    ? ? ? 1_555 A  G   1611 N2    ? ? 0 C   1584 0 G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1694 hydrog ?    ? A  C   1585 N3    ? ? ? 1_555 A  G   1610 N1    ? ? 0 C   1585 0 G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1695 hydrog ?    ? A  C   1585 N4    ? ? ? 1_555 A  G   1610 O6    ? ? 0 C   1585 0 G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1696 hydrog ?    ? A  C   1585 O2    ? ? ? 1_555 A  G   1610 N2    ? ? 0 C   1585 0 G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1697 hydrog ?    ? A  G   1586 N1    ? ? ? 1_555 A  C   1609 N3    ? ? 0 G   1586 0 C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1698 hydrog ?    ? A  G   1586 N2    ? ? ? 1_555 A  C   1609 O2    ? ? 0 G   1586 0 C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1699 hydrog ?    ? A  G   1586 O6    ? ? ? 1_555 A  C   1609 N4    ? ? 0 G   1586 0 C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1700 hydrog ?    ? A  U   1587 N3    ? ? ? 1_555 A  G   1608 O6    ? ? 0 U   1587 0 G   1608 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1701 hydrog ?    ? A  U   1587 O2    ? ? ? 1_555 A  G   1608 N1    ? ? 0 U   1587 0 G   1608 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1702 hydrog ?    ? A  G   1588 N2    ? ? ? 1_555 A  A   1607 N7    ? ? 0 G   1588 0 A   1607 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1703 hydrog ?    ? A  G   1588 N3    ? ? ? 1_555 A  A   1607 N6    ? ? 0 G   1588 0 A   1607 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1704 hydrog ?    ? A  G   1589 N2    ? ? ? 1_555 A  A   1606 N7    ? ? 0 G   1589 0 A   1606 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1705 hydrog ?    ? A  A   1590 N6    ? ? ? 1_555 A  G   1605 N3    ? ? 0 A   1590 0 G   1605 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1706 hydrog ?    ? A  A   1590 N7    ? ? ? 1_555 A  G   1605 N2    ? ? 0 A   1590 0 G   1605 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1707 hydrog ?    ? A  G   1592 N1    ? ? ? 1_555 A  C   1602 N3    ? ? 0 G   1592 0 C   1602 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1708 hydrog ?    ? A  G   1592 N2    ? ? ? 1_555 A  C   1602 O2    ? ? 0 G   1592 0 C   1602 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1709 hydrog ?    ? A  G   1592 O6    ? ? ? 1_555 A  C   1602 N4    ? ? 0 G   1592 0 C   1602 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1710 hydrog ?    ? A  C   1593 N3    ? ? ? 1_555 A  G   1601 N1    ? ? 0 C   1593 0 G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1711 hydrog ?    ? A  C   1593 N4    ? ? ? 1_555 A  G   1601 O6    ? ? 0 C   1593 0 G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1712 hydrog ?    ? A  C   1593 O2    ? ? ? 1_555 A  G   1601 N2    ? ? 0 C   1593 0 G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1713 hydrog ?    ? A  C   1594 N3    ? ? ? 1_555 A  G   1600 N1    ? ? 0 C   1594 0 G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1714 hydrog ?    ? A  C   1594 N4    ? ? ? 1_555 A  G   1600 O6    ? ? 0 C   1594 0 G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1715 hydrog ?    ? A  C   1594 O2    ? ? ? 1_555 A  G   1600 N2    ? ? 0 C   1594 0 G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1716 hydrog ?    ? A  A   1597 N1    ? ? ? 1_555 A  G   1647 N2    ? ? 0 A   1597 0 G   1647 1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog1717 hydrog ?    ? A  A   1597 N6    ? ? ? 1_555 A  G   1647 N3    ? ? 0 A   1597 0 G   1647 1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog1718 hydrog ?    ? A  G   1628 N1    ? ? ? 1_555 A  C   1633 N3    ? ? 0 G   1628 0 C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1719 hydrog ?    ? A  G   1628 N2    ? ? ? 1_555 A  C   1633 O2    ? ? 0 G   1628 0 C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1720 hydrog ?    ? A  G   1628 O6    ? ? ? 1_555 A  C   1633 N4    ? ? 0 G   1628 0 C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1721 hydrog ?    ? A  G   1629 N2    ? ? ? 1_555 A  A   1632 N7    ? ? 0 G   1629 0 A   1632 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1722 hydrog ?    ? A  G   1629 N1    ? ? ? 1_555 A  C   1633 N3    ? ? 0 G   1629 0 C   1633 1_555 ? ? ? ? ? ? 'G-C PAIR' ? 
? ? 
hydrog1723 hydrog ?    ? A  C   1651 N3    ? ? ? 1_555 A  G   1655 N1    ? ? 0 C   1651 0 G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1724 hydrog ?    ? A  C   1651 N4    ? ? ? 1_555 A  G   1655 O6    ? ? 0 C   1651 0 G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1725 hydrog ?    ? A  C   1651 O2    ? ? ? 1_555 A  G   1655 N2    ? ? 0 C   1651 0 G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1726 hydrog ?    ? A  A   1682 N6    ? ? ? 1_555 A  U   1696 O2    ? ? 0 A   1682 0 U   1696 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1727 hydrog ?    ? A  A   1682 N7    ? ? ? 1_555 A  U   1696 N3    ? ? 0 A   1682 0 U   1696 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1728 hydrog ?    ? A  A   1684 N6    ? ? ? 1_555 A  U   1722 O4    ? ? 0 A   1684 0 U   1722 1_555 ? ? ? ? ? ? HOOGSTEEN ? ? 
? 
hydrog1729 hydrog ?    ? A  A   1684 N7    ? ? ? 1_555 A  U   1722 N3    ? ? 0 A   1684 0 U   1722 1_555 ? ? ? ? ? ? HOOGSTEEN ? ? 
? 
hydrog1730 hydrog ?    ? A  C   1686 N3    ? ? ? 1_555 A  G   1695 N1    ? ? 0 C   1686 0 G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1731 hydrog ?    ? A  C   1686 N4    ? ? ? 1_555 A  G   1695 O6    ? ? 0 C   1686 0 G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1732 hydrog ?    ? A  C   1686 O2    ? ? ? 1_555 A  G   1695 N2    ? ? 0 C   1686 0 G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1733 hydrog ?    ? A  C   1687 N3    ? ? ? 1_555 A  G   1694 N1    ? ? 0 C   1687 0 G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1734 hydrog ?    ? A  C   1687 N4    ? ? ? 1_555 A  G   1694 O6    ? ? 0 C   1687 0 G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1735 hydrog ?    ? A  C   1687 O2    ? ? ? 1_555 A  G   1694 N2    ? ? 0 C   1687 0 G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1736 hydrog ?    ? A  G   1703 N1    ? ? ? 1_555 A  C   1715 N3    ? ? 0 G   1703 0 C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1737 hydrog ?    ? A  G   1703 N2    ? ? ? 1_555 A  C   1715 O2    ? ? 0 G   1703 0 C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1738 hydrog ?    ? A  G   1703 O6    ? ? ? 1_555 A  C   1715 N4    ? ? 0 G   1703 0 C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1739 hydrog ?    ? A  G   1704 N1    ? ? ? 1_555 A  C   1714 N3    ? ? 0 G   1704 0 C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1740 hydrog ?    ? A  G   1704 N2    ? ? ? 1_555 A  C   1714 O2    ? ? 0 G   1704 0 C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1741 hydrog ?    ? A  G   1704 O6    ? ? ? 1_555 A  C   1714 N4    ? ? 0 G   1704 0 C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1742 hydrog ?    ? A  C   1705 N3    ? ? ? 1_555 A  G   1713 N1    ? ? 0 C   1705 0 G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1743 hydrog ?    ? A  C   1705 N4    ? ? ? 1_555 A  G   1713 O6    ? ? 0 C   1705 0 G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1744 hydrog ?    ? A  C   1705 O2    ? ? ? 1_555 A  G   1713 N2    ? ? 0 C   1705 0 G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1745 hydrog ?    ? A  G   1706 N2    ? ? ? 1_555 A  A   1712 N7    ? ? 0 G   1706 0 A   1712 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1746 hydrog ?    ? A  G   1706 N3    ? ? ? 1_555 A  A   1712 N6    ? ? 0 G   1706 0 A   1712 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1747 hydrog ?    ? A  G   1707 N2    ? ? ? 1_555 A  A   1711 N7    ? ? 0 G   1707 0 A   1711 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1748 hydrog ?    ? A  G   1707 N3    ? ? ? 1_555 A  A   1711 N6    ? ? 0 G   1707 0 A   1711 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1749 hydrog ?    ? A  C   1725 N3    ? ? ? 1_555 A  G   2050 N1    ? ? 0 C   1725 0 G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1750 hydrog ?    ? A  C   1725 N4    ? ? ? 1_555 A  G   2050 O6    ? ? 0 C   1725 0 G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1751 hydrog ?    ? A  C   1725 O2    ? ? ? 1_555 A  G   2050 N2    ? ? 0 C   1725 0 G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1752 hydrog ?    ? A  G   1726 N1    ? ? ? 1_555 A  C   2049 N3    ? ? 0 G   1726 0 C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1753 hydrog ?    ? A  G   1726 N2    ? ? ? 1_555 A  C   2049 O2    ? ? 0 G   1726 0 C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1754 hydrog ?    ? A  G   1726 O6    ? ? ? 1_555 A  C   2049 N4    ? ? 0 G   1726 0 C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1755 hydrog ?    ? A  G   1727 N1    ? ? ? 1_555 A  C   2048 N3    ? ? 0 G   1727 0 C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1756 hydrog ?    ? A  G   1727 N2    ? ? ? 1_555 A  C   2048 O2    ? ? 0 G   1727 0 C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1757 hydrog ?    ? A  G   1727 O6    ? ? ? 1_555 A  C   2048 N4    ? ? 0 G   1727 0 C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1758 hydrog ?    ? A  G   1728 N1    ? ? ? 1_555 A  C   2047 N3    ? ? 0 G   1728 0 C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1759 hydrog ?    ? A  G   1728 N2    ? ? ? 1_555 A  C   2047 O2    ? ? 0 G   1728 0 C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1760 hydrog ?    ? A  G   1728 O6    ? ? ? 1_555 A  C   2047 N4    ? ? 0 G   1728 0 C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1761 hydrog ?    ? A  A   1733 N6    ? ? ? 1_555 A  G   2046 N3    ? ? 0 A   1733 0 G   2046 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1762 hydrog ?    ? A  A   1733 N7    ? ? ? 1_555 A  G   2046 N2    ? ? 0 A   1733 0 G   2046 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1763 hydrog ?    ? A  C   1734 N3    ? ? ? 1_555 A  G   2045 N1    ? ? 0 C   1734 0 G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1764 hydrog ?    ? A  C   1734 N4    ? ? ? 1_555 A  G   2045 O6    ? ? 0 C   1734 0 G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1765 hydrog ?    ? A  C   1734 O2    ? ? ? 1_555 A  G   2045 N2    ? ? 0 C   1734 0 G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1766 hydrog ?    ? A  C   1735 N3    ? ? ? 1_555 A  G   2044 N1    ? ? 0 C   1735 0 G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1767 hydrog ?    ? A  C   1735 N4    ? ? ? 1_555 A  G   2044 O6    ? ? 0 C   1735 0 G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1768 hydrog ?    ? A  C   1735 O2    ? ? ? 1_555 A  G   2044 N2    ? ? 0 C   1735 0 G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1769 hydrog ?    ? A  A   1736 N1    ? ? ? 1_555 A  U   2043 N3    ? ? 0 A   1736 0 U   2043 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1770 hydrog ?    ? A  A   1736 N6    ? ? ? 1_555 A  U   2043 O4    ? ? 0 A   1736 0 U   2043 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1771 hydrog ?    ? A  A   1737 N1    ? ? ? 1_555 A  U   2042 N3    ? ? 0 A   1737 0 U   2042 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1772 hydrog ?    ? A  A   1737 N6    ? ? ? 1_555 A  U   2042 O4    ? ? 0 A   1737 0 U   2042 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1773 hydrog ?    ? A  C   1738 N3    ? ? ? 1_555 A  G   2041 N1    ? ? 0 C   1738 0 G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1774 hydrog ?    ? A  C   1738 N4    ? ? ? 1_555 A  G   2041 O6    ? ? 0 C   1738 0 G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1775 hydrog ?    ? A  C   1738 O2    ? ? ? 1_555 A  G   2041 N2    ? ? 0 C   1738 0 G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1776 hydrog ?    ? A  G   1739 N1    ? ? ? 1_555 A  C   2040 N3    ? ? 0 G   1739 0 C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1777 hydrog ?    ? A  G   1739 N2    ? ? ? 1_555 A  C   2040 O2    ? ? 0 G   1739 0 C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1778 hydrog ?    ? A  G   1739 O6    ? ? ? 1_555 A  C   2040 N4    ? ? 0 G   1739 0 C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1779 hydrog ?    ? A  U   1740 N3    ? ? ? 1_555 A  A   2039 N1    ? ? 0 U   1740 0 A   2039 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1780 hydrog ?    ? A  U   1740 O4    ? ? ? 1_555 A  A   2039 N6    ? ? 0 U   1740 0 A   2039 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1781 hydrog ?    ? A  U   1741 N3    ? ? ? 1_555 A  A   2038 N1    ? ? 0 U   1741 0 A   2038 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1782 hydrog ?    ? A  U   1741 O4    ? ? ? 1_555 A  A   2038 N6    ? ? 0 U   1741 0 A   2038 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1783 hydrog ?    ? A  A   1742 N6    ? ? ? 1_555 A  G   2033 O6    ? ? 0 A   1742 0 G   2033 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog1784 hydrog ?    ? A  A   1742 N1    ? ? ? 1_555 A  C   2037 N4    ? ? 0 A   1742 0 C   2037 1_555 ? ? ? ? ? ? TYPE_26_PAIR 
?     ? ? 
hydrog1785 hydrog ?    ? A  A   1742 N6    ? ? ? 1_555 A  C   2037 N3    ? ? 0 A   1742 0 C   2037 1_555 ? ? ? ? ? ? TYPE_26_PAIR 
?     ? ? 
hydrog1786 hydrog ?    ? A  G   1743 N1    ? ? ? 1_555 A  C   2036 N3    ? ? 0 G   1743 0 C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1787 hydrog ?    ? A  G   1743 N2    ? ? ? 1_555 A  C   2036 O2    ? ? 0 G   1743 0 C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1788 hydrog ?    ? A  G   1743 O6    ? ? ? 1_555 A  C   2036 N4    ? ? 0 G   1743 0 C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1789 hydrog ?    ? A  G   1744 N1    ? ? ? 1_555 A  C   2035 N3    ? ? 0 G   1744 0 C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1790 hydrog ?    ? A  G   1744 N2    ? ? ? 1_555 A  C   2035 O2    ? ? 0 G   1744 0 C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1791 hydrog ?    ? A  G   1744 O6    ? ? ? 1_555 A  C   2035 N4    ? ? 0 G   1744 0 C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1792 hydrog ?    ? A  G   1745 N2    ? ? ? 1_555 A  U   2034 O4    ? ? 0 G   1745 0 U   2034 1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog1793 hydrog ?    ? A  A   1746 N6    ? ? ? 1_555 A  U   2032 O2    ? ? 0 A   1746 0 U   2032 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1794 hydrog ?    ? A  A   1746 N7    ? ? ? 1_555 A  U   2032 N3    ? ? 0 A   1746 0 U   2032 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1795 hydrog ?    ? A  A   1747 N1    ? ? ? 1_555 A  U   2034 N3    ? ? 0 A   1747 0 U   2034 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1796 hydrog ?    ? A  A   1747 N6    ? ? ? 1_555 A  U   2034 O4    ? ? 0 A   1747 0 U   2034 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1797 hydrog ?    ? A  G   1752 N1    ? ? ? 1_555 A  C   2031 N3    ? ? 0 G   1752 0 C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1798 hydrog ?    ? A  G   1752 N2    ? ? ? 1_555 A  C   2031 O2    ? ? 0 G   1752 0 C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1799 hydrog ?    ? A  G   1752 O6    ? ? ? 1_555 A  C   2031 N4    ? ? 0 G   1752 0 C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1800 hydrog ?    ? A  G   1760 N1    ? ? ? 1_555 A  U   1784 O2    ? ? 0 G   1760 0 U   1784 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1801 hydrog ?    ? A  G   1760 O6    ? ? ? 1_555 A  U   1784 N3    ? ? 0 G   1760 0 U   1784 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1802 hydrog ?    ? A  U   1761 N3    ? ? ? 1_555 A  A   1783 N1    ? ? 0 U   1761 0 A   1783 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1803 hydrog ?    ? A  U   1761 O4    ? ? ? 1_555 A  A   1783 N6    ? ? 0 U   1761 0 A   1783 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1804 hydrog ?    ? A  C   1762 N3    ? ? ? 1_555 A  G   1782 N1    ? ? 0 C   1762 0 G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1805 hydrog ?    ? A  C   1762 N4    ? ? ? 1_555 A  G   1782 O6    ? ? 0 C   1762 0 G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1806 hydrog ?    ? A  C   1762 O2    ? ? ? 1_555 A  G   1782 N2    ? ? 0 C   1762 0 G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1807 hydrog ?    ? A  C   1763 N3    ? ? ? 1_555 A  G   1781 N1    ? ? 0 C   1763 0 G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1808 hydrog ?    ? A  C   1763 N4    ? ? ? 1_555 A  G   1781 O6    ? ? 0 C   1763 0 G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1809 hydrog ?    ? A  C   1763 O2    ? ? ? 1_555 A  G   1781 N2    ? ? 0 C   1763 0 G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1810 hydrog ?    ? A  C   1764 N3    ? ? ? 1_555 A  G   1780 N1    ? ? 0 C   1764 0 G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1811 hydrog ?    ? A  C   1764 N4    ? ? ? 1_555 A  G   1780 O6    ? ? 0 C   1764 0 G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1812 hydrog ?    ? A  C   1764 O2    ? ? ? 1_555 A  G   1780 N2    ? ? 0 C   1764 0 G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1813 hydrog ?    ? A  G   1765 N2    ? ? ? 1_555 A  A   1779 N7    ? ? 0 G   1765 0 A   1779 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1814 hydrog ?    ? A  G   1765 N3    ? ? ? 1_555 A  A   1779 N6    ? ? 0 G   1765 0 A   1779 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1815 hydrog ?    ? A  A   1767 N6    ? ? ? 1_555 A  A   1776 N7    ? ? 0 A   1767 0 A   1776 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog1816 hydrog ?    ? A  A   1767 N7    ? ? ? 1_555 A  A   1776 N6    ? ? 0 A   1767 0 A   1776 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog1817 hydrog ?    ? A  C   1768 N4    ? ? ? 1_555 A  A   1775 N3    ? ? 0 C   1768 0 A   1775 1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog1818 hydrog ?    ? A  C   1769 N3    ? ? ? 1_555 A  G   1774 N1    ? ? 0 C   1769 0 G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1819 hydrog ?    ? A  C   1769 N4    ? ? ? 1_555 A  G   1774 O6    ? ? 0 C   1769 0 G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1820 hydrog ?    ? A  C   1769 O2    ? ? ? 1_555 A  G   1774 N2    ? ? 0 C   1769 0 G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1821 hydrog ?    ? A  U   1770 O2    ? ? ? 1_555 A  G   1773 N1    ? ? 0 U   1770 0 G   1773 1_555 ? ? ? ? ? ? 'U-G MISPAIR' 
?     ? ? 
hydrog1822 hydrog ?    ? A  U   1771 N3    ? ? ? 1_555 A  A   1885 N1    ? ? 0 U   1771 0 A   1885 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1823 hydrog ?    ? A  U   1771 O4    ? ? ? 1_555 A  A   1885 N6    ? ? 0 U   1771 0 A   1885 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1824 hydrog ?    ? A  G   1785 N1    ? ? ? 1_555 A  U   1807 O2    ? ? 0 G   1785 0 U   1807 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1825 hydrog ?    ? A  G   1785 O6    ? ? ? 1_555 A  U   1807 N3    ? ? 0 G   1785 0 U   1807 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1826 hydrog ?    ? A  C   1786 N3    ? ? ? 1_555 A  G   1806 N1    ? ? 0 C   1786 0 G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1827 hydrog ?    ? A  C   1786 N4    ? ? ? 1_555 A  G   1806 O6    ? ? 0 C   1786 0 G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1828 hydrog ?    ? A  C   1786 O2    ? ? ? 1_555 A  G   1806 N2    ? ? 0 C   1786 0 G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1829 hydrog ?    ? A  C   1787 N3    ? ? ? 1_555 A  G   1805 N1    ? ? 0 C   1787 0 G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1830 hydrog ?    ? A  C   1787 N4    ? ? ? 1_555 A  G   1805 O6    ? ? 0 C   1787 0 G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1831 hydrog ?    ? A  C   1787 O2    ? ? ? 1_555 A  G   1805 N2    ? ? 0 C   1787 0 G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1832 hydrog ?    ? A  U   1788 N3    ? ? ? 1_555 A  A   1804 N1    ? ? 0 U   1788 0 A   1804 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1833 hydrog ?    ? A  U   1788 O4    ? ? ? 1_555 A  A   1804 N6    ? ? 0 U   1788 0 A   1804 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1834 hydrog ?    ? A  G   1789 N1    ? ? ? 1_555 A  C   1803 N3    ? ? 0 G   1789 0 C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1835 hydrog ?    ? A  G   1789 N2    ? ? ? 1_555 A  C   1803 O2    ? ? 0 G   1789 0 C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1836 hydrog ?    ? A  G   1789 O6    ? ? ? 1_555 A  C   1803 N4    ? ? 0 G   1789 0 C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1837 hydrog ?    ? A  C   1790 N3    ? ? ? 1_555 A  G   1802 N1    ? ? 0 C   1790 0 G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1838 hydrog ?    ? A  C   1790 N4    ? ? ? 1_555 A  G   1802 O6    ? ? 0 C   1790 0 G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1839 hydrog ?    ? A  C   1790 O2    ? ? ? 1_555 A  G   1802 N2    ? ? 0 C   1790 0 G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1840 hydrog ?    ? A  U   1791 N3    ? ? ? 1_555 A  A   1801 N1    ? ? 0 U   1791 0 A   1801 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1841 hydrog ?    ? A  U   1791 O4    ? ? ? 1_555 A  A   1801 N6    ? ? 0 U   1791 0 A   1801 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1842 hydrog ?    ? A  C   1792 N3    ? ? ? 1_555 A  G   1800 N1    ? ? 0 C   1792 0 G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1843 hydrog ?    ? A  C   1792 N4    ? ? ? 1_555 A  G   1800 O6    ? ? 0 C   1792 0 G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1844 hydrog ?    ? A  C   1792 O2    ? ? ? 1_555 A  G   1800 N2    ? ? 0 C   1792 0 G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1845 hydrog ?    ? A  C   1793 N3    ? ? ? 1_555 A  G   1799 N1    ? ? 0 C   1793 0 G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1846 hydrog ?    ? A  C   1793 N4    ? ? ? 1_555 A  G   1799 O6    ? ? 0 C   1793 0 G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1847 hydrog ?    ? A  C   1793 O2    ? ? ? 1_555 A  G   1799 N2    ? ? 0 C   1793 0 G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1848 hydrog ?    ? A  G   1794 N2    ? ? ? 1_555 A  A   1797 N7    ? ? 0 G   1794 0 A   1797 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1849 hydrog ?    ? A  G   1805 N2    ? ? ? 1_555 A  A   2875 N3    ? ? 0 G   1805 0 A   2875 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1850 hydrog ?    ? A  G   1806 N2    ? ? ? 1_555 A  A   2883 N3    ? ? 0 G   1806 0 A   2883 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1851 hydrog ?    ? A  C   1808 N3    ? ? ? 1_555 A  G   1812 N1    ? ? 0 C   1808 0 G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1852 hydrog ?    ? A  C   1808 N4    ? ? ? 1_555 A  G   1812 O6    ? ? 0 C   1808 0 G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1853 hydrog ?    ? A  C   1808 O2    ? ? ? 1_555 A  G   1812 N2    ? ? 0 C   1808 0 G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1854 hydrog ?    ? A  C   1810 N4    ? ? ? 1_555 A  C   2752 O2    ? ? 0 C   1810 0 C   2752 1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog1855 hydrog ?    ? A  A   1811 N1    ? ? ? 1_555 A  G   2731 N2    ? ? 0 A   1811 0 G   2731 1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog1856 hydrog ?    ? A  A   1811 N6    ? ? ? 1_555 A  G   2731 N3    ? ? 0 A   1811 0 G   2731 1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog1857 hydrog ?    ? A  U   1813 N3    ? ? ? 1_555 A  U   1817 O4    ? ? 0 U   1813 0 U   1817 1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog1858 hydrog ?    ? A  U   1813 O2    ? ? ? 1_555 A  U   1817 N3    ? ? 0 U   1813 0 U   1817 1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog1859 hydrog ?    ? A  U   1813 N3    ? ? ? 1_555 A  C   1818 O2    ? ? 0 U   1813 0 C   1818 1_555 ? ? ? ? ? ? 'U-C MISPAIR' 
?     ? ? 
hydrog1860 hydrog ?    ? A  G   1820 N1    ? ? ? 1_555 A  C   2029 N3    ? ? 0 G   1820 0 C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1861 hydrog ?    ? A  G   1820 N2    ? ? ? 1_555 A  C   2029 O2    ? ? 0 G   1820 0 C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1862 hydrog ?    ? A  G   1820 O6    ? ? ? 1_555 A  C   2029 N4    ? ? 0 G   1820 0 C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1863 hydrog ?    ? A  A   1821 N1    ? ? ? 1_555 A  U   2028 N3    ? ? 0 A   1821 0 U   2028 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1864 hydrog ?    ? A  A   1821 N6    ? ? ? 1_555 A  U   2028 O4    ? ? 0 A   1821 0 U   2028 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1865 hydrog ?    ? A  A   1822 N1    ? ? ? 1_555 A  U   2027 N3    ? ? 0 A   1822 0 U   2027 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1866 hydrog ?    ? A  A   1822 N6    ? ? ? 1_555 A  U   2027 O4    ? ? 0 A   1822 0 U   2027 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1867 hydrog ?    ? A  G   1823 N1    ? ? ? 1_555 A  C   2026 N3    ? ? 0 G   1823 0 C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1868 hydrog ?    ? A  G   1823 N2    ? ? ? 1_555 A  C   2026 O2    ? ? 0 G   1823 0 C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1869 hydrog ?    ? A  G   1823 O6    ? ? ? 1_555 A  C   2026 N4    ? ? 0 G   1823 0 C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1870 hydrog ?    ? A  C   1824 N3    ? ? ? 1_555 A  G   2025 N1    ? ? 0 C   1824 0 G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1871 hydrog ?    ? A  C   1824 N4    ? ? ? 1_555 A  G   2025 O6    ? ? 0 C   1824 0 G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1872 hydrog ?    ? A  C   1824 O2    ? ? ? 1_555 A  G   2025 N2    ? ? 0 C   1824 0 G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1873 hydrog ?    ? A  U   1825 N3    ? ? ? 1_555 A  A   2024 N1    ? ? 0 U   1825 0 A   2024 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1874 hydrog ?    ? A  U   1825 O4    ? ? ? 1_555 A  A   2024 N6    ? ? 0 U   1825 0 A   2024 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1875 hydrog ?    ? A  C   1826 N3    ? ? ? 1_555 A  G   2023 N1    ? ? 0 C   1826 0 G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1876 hydrog ?    ? A  C   1826 N4    ? ? ? 1_555 A  G   2023 O6    ? ? 0 C   1826 0 G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1877 hydrog ?    ? A  C   1826 O2    ? ? ? 1_555 A  G   2023 N2    ? ? 0 C   1826 0 G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1878 hydrog ?    ? A  G   1827 N1    ? ? ? 1_555 A  C   2021 N3    ? ? 0 G   1827 0 C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1879 hydrog ?    ? A  G   1827 N2    ? ? ? 1_555 A  C   2021 O2    ? ? 0 G   1827 0 C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1880 hydrog ?    ? A  G   1827 O6    ? ? ? 1_555 A  C   2021 N4    ? ? 0 G   1827 0 C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1881 hydrog ?    ? A  G   1828 N1    ? ? ? 1_555 A  C   2020 N3    ? ? 0 G   1828 0 C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1882 hydrog ?    ? A  G   1828 N2    ? ? ? 1_555 A  C   2020 O2    ? ? 0 G   1828 0 C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1883 hydrog ?    ? A  G   1828 O6    ? ? ? 1_555 A  C   2020 N4    ? ? 0 G   1828 0 C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1884 hydrog ?    ? A  A   1829 N3    ? ? ? 1_555 A  A   2018 N6    ? ? 0 A   1829 0 A   2018 1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog1885 hydrog ?    ? A  C   1830 N4    ? ? ? 1_555 A  U   1846 O2    ? ? 0 C   1830 0 U   1846 1_555 ? ? ? ? ? ? 'C-U MISPAIR' 
?     ? ? 
hydrog1886 hydrog ?    ? A  G   1832 N1    ? ? ? 1_555 A  C   1844 N3    ? ? 0 G   1832 0 C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1887 hydrog ?    ? A  G   1832 N2    ? ? ? 1_555 A  C   1844 O2    ? ? 0 G   1832 0 C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1888 hydrog ?    ? A  G   1832 O6    ? ? ? 1_555 A  C   1844 N4    ? ? 0 G   1832 0 C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1889 hydrog ?    ? A  U   1833 N3    ? ? ? 1_555 A  A   1843 N1    ? ? 0 U   1833 0 A   1843 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1890 hydrog ?    ? A  U   1833 O4    ? ? ? 1_555 A  A   1843 N6    ? ? 0 U   1833 0 A   1843 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1891 hydrog ?    ? A  C   1834 O2    ? ? ? 1_555 A  C   1841 N4    ? ? 0 C   1834 0 C   1841 1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog1892 hydrog ?    ? A  U   1835 O4    ? ? ? 1_555 A  C   1841 N4    ? ? 0 U   1835 0 C   1841 1_555 ? ? ? ? ? ? 'U-C MISPAIR' 
?     ? ? 
hydrog1893 hydrog ?    ? A  U   1838 N3    ? ? ? 1_555 A  PSU 2621 O2    ? ? 0 U   1838 0 PSU 2621 1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog1894 hydrog ?    ? A  U   1838 O4    ? ? ? 1_555 A  PSU 2621 N3    ? ? 0 U   1838 0 PSU 2621 1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog1895 hydrog ?    ? A  A   1839 N3    ? ? ? 1_555 A  G   2642 N2    ? ? 0 A   1839 0 G   2642 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog1896 hydrog ?    ? A  A   1847 N6    ? ? ? 1_555 A  G   1884 N3    ? ? 0 A   1847 0 G   1884 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1897 hydrog ?    ? A  A   1847 N7    ? ? ? 1_555 A  G   1884 N2    ? ? 0 A   1847 0 G   1884 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1898 hydrog ?    ? A  G   1848 N1    ? ? ? 1_555 A  U   1883 O2    ? ? 0 G   1848 0 U   1883 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1899 hydrog ?    ? A  G   1848 O6    ? ? ? 1_555 A  U   1883 N3    ? ? 0 G   1848 0 U   1883 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1900 hydrog ?    ? A  G   1849 N1    ? ? ? 1_555 A  C   1882 N3    ? ? 0 G   1849 0 C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1901 hydrog ?    ? A  G   1849 N2    ? ? ? 1_555 A  C   1882 O2    ? ? 0 G   1849 0 C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1902 hydrog ?    ? A  G   1849 O6    ? ? ? 1_555 A  C   1882 N4    ? ? 0 G   1849 0 C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1903 hydrog ?    ? A  U   1850 N3    ? ? ? 1_555 A  A   1881 N1    ? ? 0 U   1850 0 A   1881 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1904 hydrog ?    ? A  U   1850 O4    ? ? ? 1_555 A  A   1881 N6    ? ? 0 U   1850 0 A   1881 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1905 hydrog ?    ? A  G   1851 N1    ? ? ? 1_555 A  C   1880 N3    ? ? 0 G   1851 0 C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1906 hydrog ?    ? A  G   1851 N2    ? ? ? 1_555 A  C   1880 O2    ? ? 0 G   1851 0 C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1907 hydrog ?    ? A  G   1851 O6    ? ? ? 1_555 A  C   1880 N4    ? ? 0 G   1851 0 C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1908 hydrog ?    ? A  A   1852 N1    ? ? ? 1_555 A  U   1879 N3    ? ? 0 A   1852 0 U   1879 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1909 hydrog ?    ? A  A   1852 N6    ? ? ? 1_555 A  U   1879 O4    ? ? 0 A   1852 0 U   1879 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1910 hydrog ?    ? A  C   1853 N3    ? ? ? 1_555 A  G   1878 N1    ? ? 0 C   1853 0 G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1911 hydrog ?    ? A  C   1853 N4    ? ? ? 1_555 A  G   1878 O6    ? ? 0 C   1853 0 G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1912 hydrog ?    ? A  C   1853 O2    ? ? ? 1_555 A  G   1878 N2    ? ? 0 C   1853 0 G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1913 hydrog ?    ? A  C   1854 N3    ? ? ? 1_555 A  G   1877 N1    ? ? 0 C   1854 0 G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1914 hydrog ?    ? A  C   1854 N4    ? ? ? 1_555 A  G   1877 O6    ? ? 0 C   1854 0 G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1915 hydrog ?    ? A  C   1854 O2    ? ? ? 1_555 A  G   1877 N2    ? ? 0 C   1854 0 G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1916 hydrog ?    ? A  G   1855 N2    ? ? ? 1_555 A  U   1874 O2    ? ? 0 G   1855 0 U   1874 1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog1917 hydrog ?    ? A  C   1856 N3    ? ? ? 1_555 A  G   1873 N2    ? ? 0 C   1856 0 G   1873 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog1918 hydrog ?    ? A  C   1856 O2    ? ? ? 1_555 A  G   1873 N1    ? ? 0 C   1856 0 G   1873 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog1919 hydrog ?    ? A  C   1856 N4    ? ? ? 1_555 A  A   1875 N7    ? ? 0 C   1856 0 A   1875 1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog1920 hydrog ?    ? A  A   1857 N6    ? ? ? 1_555 A  U   2246 O2    ? ? 0 A   1857 0 U   2246 1_555 ? ? ? ? ? ? 'A-U PAIR' ? 
? ? 
hydrog1921 hydrog ?    ? A  A   1858 N6    ? ? ? 1_555 A  U   1871 O4    ? ? 0 A   1858 0 U   1871 1_555 ? ? ? ? ? ? 'A-U PAIR' ? 
? ? 
hydrog1922 hydrog ?    ? A  A   1859 N6    ? ? ? 1_555 A  C   1870 O2    ? ? 0 A   1859 0 C   1870 1_555 ? ? ? ? ? ? 'A-C MISPAIR' 
?     ? ? 
hydrog1923 hydrog ?    ? A  A   1859 N3    ? ? ? 1_555 A  G   1878 N2    ? ? 0 A   1859 0 G   1878 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog1924 hydrog ?    ? A  U   1860 N3    ? ? ? 1_555 A  A   1869 N1    ? ? 0 U   1860 0 A   1869 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1925 hydrog ?    ? A  U   1860 O4    ? ? ? 1_555 A  A   1869 N6    ? ? 0 U   1860 0 A   1869 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1926 hydrog ?    ? A  C   1861 N3    ? ? ? 1_555 A  G   1868 N1    ? ? 0 C   1861 0 G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1927 hydrog ?    ? A  C   1861 N4    ? ? ? 1_555 A  G   1868 O6    ? ? 0 C   1861 0 G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1928 hydrog ?    ? A  C   1861 O2    ? ? ? 1_555 A  G   1868 N2    ? ? 0 C   1861 0 G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1929 hydrog ?    ? A  C   1862 N3    ? ? ? 1_555 A  G   1867 N1    ? ? 0 C   1862 0 G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1930 hydrog ?    ? A  C   1862 N4    ? ? ? 1_555 A  G   1867 O6    ? ? 0 C   1862 0 G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1931 hydrog ?    ? A  C   1862 O2    ? ? ? 1_555 A  G   1867 N2    ? ? 0 C   1862 0 G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1932 hydrog ?    ? A  G   1863 N2    ? ? ? 1_555 A  A   1866 N7    ? ? 0 G   1863 0 A   1866 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1933 hydrog ?    ? A  A   1885 N6    ? ? ? 1_555 A  U   2017 O2    ? ? 0 A   1885 0 U   2017 1_555 ? ? ? ? ? ? 'A-U PAIR' ? 
? ? 
hydrog1934 hydrog ?    ? A  A   1886 N6    ? ? ? 1_555 A  U   2016 O2    ? ? 0 A   1886 0 U   2016 1_555 ? ? ? ? ? ? 'A-U PAIR' ? 
? ? 
hydrog1935 hydrog ?    ? A  U   1887 N3    ? ? ? 1_555 A  A   2015 N1    ? ? 0 U   1887 0 A   2015 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1936 hydrog ?    ? A  U   1887 O4    ? ? ? 1_555 A  A   2015 N6    ? ? 0 U   1887 0 A   2015 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1937 hydrog ?    ? A  C   1888 N3    ? ? ? 1_555 A  G   2014 N1    ? ? 0 C   1888 0 G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1938 hydrog ?    ? A  C   1888 N4    ? ? ? 1_555 A  G   2014 O6    ? ? 0 C   1888 0 G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1939 hydrog ?    ? A  C   1888 O2    ? ? ? 1_555 A  G   2014 N2    ? ? 0 C   1888 0 G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1940 hydrog ?    ? A  C   1889 N3    ? ? ? 1_555 A  G   2013 N1    ? ? 0 C   1889 0 G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1941 hydrog ?    ? A  C   1889 N4    ? ? ? 1_555 A  G   2013 O6    ? ? 0 C   1889 0 G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1942 hydrog ?    ? A  C   1889 O2    ? ? ? 1_555 A  G   2013 N2    ? ? 0 C   1889 0 G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1943 hydrog ?    ? A  U   1890 N3    ? ? ? 1_555 A  A   2011 N7    ? ? 0 U   1890 0 A   2011 1_555 ? ? ? ? ? ? HOOGSTEEN ? ? 
? 
hydrog1944 hydrog ?    ? A  U   1890 O4    ? ? ? 1_555 A  A   2011 N6    ? ? 0 U   1890 0 A   2011 1_555 ? ? ? ? ? ? HOOGSTEEN ? ? 
? 
hydrog1945 hydrog ?    ? A  G   1891 N1    ? ? ? 1_555 A  C   1946 N3    ? ? 0 G   1891 0 C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1946 hydrog ?    ? A  G   1891 N2    ? ? ? 1_555 A  C   1946 O2    ? ? 0 G   1891 0 C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1947 hydrog ?    ? A  G   1891 O6    ? ? ? 1_555 A  C   1946 N4    ? ? 0 G   1891 0 C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1948 hydrog ?    ? A  C   1892 N3    ? ? ? 1_555 A  G   1945 N1    ? ? 0 C   1892 0 G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1949 hydrog ?    ? A  C   1892 N4    ? ? ? 1_555 A  G   1945 O6    ? ? 0 C   1892 0 G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1950 hydrog ?    ? A  C   1892 O2    ? ? ? 1_555 A  G   1945 N2    ? ? 0 C   1892 0 G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1951 hydrog ?    ? A  C   1893 N3    ? ? ? 1_555 A  G   1944 N1    ? ? 0 C   1893 0 G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1952 hydrog ?    ? A  C   1893 N4    ? ? ? 1_555 A  G   1944 O6    ? ? 0 C   1893 0 G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1953 hydrog ?    ? A  C   1893 O2    ? ? ? 1_555 A  G   1944 N2    ? ? 0 C   1893 0 G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1954 hydrog ?    ? A  C   1894 N3    ? ? ? 1_555 A  A   1942 N6    ? ? 0 C   1894 0 A   1942 1_555 ? ? ? ? ? ? TYPE_25_PAIR 
?     ? ? 
hydrog1955 hydrog ?    ? A  C   1894 N4    ? ? ? 1_555 A  A   1942 N7    ? ? 0 C   1894 0 A   1942 1_555 ? ? ? ? ? ? TYPE_25_PAIR 
?     ? ? 
hydrog1956 hydrog ?    ? A  G   1896 N1    ? ? ? 1_555 A  C   1943 N3    ? ? 0 G   1896 0 C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1957 hydrog ?    ? A  G   1896 N2    ? ? ? 1_555 A  C   1943 O2    ? ? 0 G   1896 0 C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1958 hydrog ?    ? A  G   1896 O6    ? ? ? 1_555 A  C   1943 N4    ? ? 0 G   1896 0 C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1959 hydrog ?    ? A  U   1897 N3    ? ? ? 1_555 A  A   1942 N1    ? ? 0 U   1897 0 A   1942 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1960 hydrog ?    ? A  U   1897 O4    ? ? ? 1_555 A  A   1942 N6    ? ? 0 U   1897 0 A   1942 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1961 hydrog ?    ? A  G   1898 N1    ? ? ? 1_555 A  U   1939 O2    ? ? 0 G   1898 0 U   1939 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1962 hydrog ?    ? A  G   1898 O6    ? ? ? 1_555 A  U   1939 N3    ? ? 0 G   1898 0 U   1939 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1963 hydrog ?    ? A  C   1899 N3    ? ? ? 1_555 A  G   1938 N1    ? ? 0 C   1899 0 G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1964 hydrog ?    ? A  C   1899 N4    ? ? ? 1_555 A  G   1938 O6    ? ? 0 C   1899 0 G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1965 hydrog ?    ? A  C   1899 O2    ? ? ? 1_555 A  G   1938 N2    ? ? 0 C   1899 0 G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1966 hydrog ?    ? A  A   1900 N1    ? ? ? 1_555 A  U   1937 N3    ? ? 0 A   1900 0 U   1937 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1967 hydrog ?    ? A  A   1900 N6    ? ? ? 1_555 A  U   1937 O4    ? ? 0 A   1900 0 U   1937 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1968 hydrog ?    ? A  G   1901 N1    ? ? ? 1_555 A  C   1936 N3    ? ? 0 G   1901 0 C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1969 hydrog ?    ? A  G   1901 N2    ? ? ? 1_555 A  C   1936 O2    ? ? 0 G   1901 0 C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1970 hydrog ?    ? A  G   1901 O6    ? ? ? 1_555 A  C   1936 N4    ? ? 0 G   1901 0 C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1971 hydrog ?    ? A  G   1902 N1    ? ? ? 1_555 A  C   1935 N3    ? ? 0 G   1902 0 C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1972 hydrog ?    ? A  G   1902 N2    ? ? ? 1_555 A  C   1935 O2    ? ? 0 G   1902 0 C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1973 hydrog ?    ? A  G   1902 O6    ? ? ? 1_555 A  C   1935 N4    ? ? 0 G   1902 0 C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1974 hydrog ?    ? A  U   1903 O2    ? ? ? 1_555 A  A   1934 N6    ? ? 0 U   1903 0 A   1934 1_555 ? ? ? ? ? ? 'U-A PAIR' ? 
? ? 
hydrog1975 hydrog ?    ? A  U   1905 N3    ? ? ? 1_555 A  A   1934 N1    ? ? 0 U   1905 0 A   1934 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1976 hydrog ?    ? A  U   1905 O4    ? ? ? 1_555 A  A   1934 N6    ? ? 0 U   1905 0 A   1934 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1977 hydrog ?    ? A  C   1906 N3    ? ? ? 1_555 A  G   1933 N1    ? ? 0 C   1906 0 G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1978 hydrog ?    ? A  C   1906 N4    ? ? ? 1_555 A  G   1933 O6    ? ? 0 C   1906 0 G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1979 hydrog ?    ? A  C   1906 O2    ? ? ? 1_555 A  G   1933 N2    ? ? 0 C   1906 0 G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1980 hydrog ?    ? A  U   1907 N3    ? ? ? 1_555 A  G   1932 O6    ? ? 0 U   1907 0 G   1932 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1981 hydrog ?    ? A  U   1907 O2    ? ? ? 1_555 A  G   1932 N1    ? ? 0 U   1907 0 G   1932 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog1982 hydrog ?    ? A  G   1908 N2    ? ? ? 1_555 A  A   1931 N7    ? ? 0 G   1908 0 A   1931 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1983 hydrog ?    ? A  G   1908 N3    ? ? ? 1_555 A  A   1931 N6    ? ? 0 G   1908 0 A   1931 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog1984 hydrog ?    ? A  A   1910 N3    ? ? ? 1_555 A  G   2128 N2    ? ? 0 A   1910 0 G   2128 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog1985 hydrog ?    ? A  A   1912 N6    ? ? ? 1_555 A  A   1927 N1    ? ? 0 A   1912 0 A   1927 1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog1986 hydrog ?    ? A  C   1913 N3    ? ? ? 1_555 A  G   1926 N1    ? ? 0 C   1913 0 G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1987 hydrog ?    ? A  C   1913 N4    ? ? ? 1_555 A  G   1926 O6    ? ? 0 C   1913 0 G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1988 hydrog ?    ? A  C   1913 O2    ? ? ? 1_555 A  G   1926 N2    ? ? 0 C   1913 0 G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1989 hydrog ?    ? A  C   1914 N3    ? ? ? 1_555 A  G   1925 N1    ? ? 0 C   1914 0 G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1990 hydrog ?    ? A  C   1914 N4    ? ? ? 1_555 A  G   1925 O6    ? ? 0 C   1914 0 G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1991 hydrog ?    ? A  C   1914 O2    ? ? ? 1_555 A  G   1925 N2    ? ? 0 C   1914 0 G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1992 hydrog ?    ? A  U   1915 N3    ? ? ? 1_555 A  A   1924 N1    ? ? 0 U   1915 0 A   1924 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1993 hydrog ?    ? A  U   1915 O4    ? ? ? 1_555 A  A   1924 N6    ? ? 0 U   1915 0 A   1924 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1994 hydrog ?    ? A  C   1916 N3    ? ? ? 1_555 A  G   1923 N1    ? ? 0 C   1916 0 G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1995 hydrog ?    ? A  C   1916 N4    ? ? ? 1_555 A  G   1923 O6    ? ? 0 C   1916 0 G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1996 hydrog ?    ? A  C   1916 O2    ? ? ? 1_555 A  G   1923 N2    ? ? 0 C   1916 0 G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog1997 hydrog ?    ? A  G   1917 N2    ? ? ? 1_555 A  A   1922 N7    ? ? 0 G   1917 0 A   1922 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog1998 hydrog ?    ? A  A   1921 N1    ? ? ? 1_555 A  G   2449 N2    ? ? 0 A   1921 0 G   2449 1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog1999 hydrog ?    ? A  A   1921 N6    ? ? ? 1_555 A  G   2449 N3    ? ? 0 A   1921 0 G   2449 1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog2000 hydrog ?    ? A  A   1931 N3    ? ? ? 1_555 A  G   2267 N2    ? ? 0 A   1931 0 G   2267 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog2001 hydrog ?    ? A  C   1940 O2    ? ? ? 1_555 A  C   1943 N4    ? ? 0 C   1940 0 C   1943 1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog2002 hydrog ?    ? A  G   1945 N2    ? ? ? 1_555 A  A   1969 N3    ? ? 0 G   1945 0 A   1969 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog2003 hydrog ?    ? A  G   1947 N1    ? ? ? 1_555 A  C   1965 N3    ? ? 0 G   1947 0 C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2004 hydrog ?    ? A  G   1947 N2    ? ? ? 1_555 A  C   1965 O2    ? ? 0 G   1947 0 C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2005 hydrog ?    ? A  G   1947 O6    ? ? ? 1_555 A  C   1965 N4    ? ? 0 G   1947 0 C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2006 hydrog ?    ? A  G   1948 N1    ? ? ? 1_555 A  U   1964 O2    ? ? 0 G   1948 0 U   1964 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2007 hydrog ?    ? A  G   1948 O6    ? ? ? 1_555 A  U   1964 N3    ? ? 0 G   1948 0 U   1964 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2008 hydrog ?    ? A  U   1966 N3    ? ? ? 1_555 A  G   1970 O6    ? ? 0 U   1966 0 G   1970 1_555 ? ? ? ? ? ? TYPE_27_PAIR 
?     ? ? 
hydrog2009 hydrog ?    ? A  U   1966 O4    ? ? ? 1_555 A  G   1970 N1    ? ? 0 U   1966 0 G   1970 1_555 ? ? ? ? ? ? TYPE_27_PAIR 
?     ? ? 
hydrog2010 hydrog ?    ? A  U   1967 O2    ? ? ? 1_555 A  A   1969 N6    ? ? 0 U   1967 0 A   1969 1_555 ? ? ? ? ? ? 'U-A PAIR' ? 
? ? 
hydrog2011 hydrog ?    ? A  G   1971 N2    ? ? ? 1_555 A  U   1972 O4    ? ? 0 G   1971 0 U   1972 1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog2012 hydrog ?    ? A  U   1972 N3    ? ? ? 1_555 A  A   2010 N7    ? ? 0 U   1972 0 A   2010 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2013 hydrog ?    ? A  U   1972 O2    ? ? ? 1_555 A  A   2010 N6    ? ? 0 U   1972 0 A   2010 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2014 hydrog ?    ? A  A   1973 N6    ? ? ? 1_555 A  G   2009 N3    ? ? 0 A   1973 0 G   2009 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2015 hydrog ?    ? A  A   1973 N7    ? ? ? 1_555 A  G   2009 N2    ? ? 0 A   1973 0 G   2009 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2016 hydrog ?    ? A  G   1974 N1    ? ? ? 1_555 A  U   2008 O2    ? ? 0 G   1974 0 U   2008 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2017 hydrog ?    ? A  G   1974 O6    ? ? ? 1_555 A  U   2008 N3    ? ? 0 G   1974 0 U   2008 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2018 hydrog ?    ? A  C   1975 N3    ? ? ? 1_555 A  G   2005 N1    ? ? 0 C   1975 0 G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2019 hydrog ?    ? A  C   1975 N4    ? ? ? 1_555 A  G   2005 O6    ? ? 0 C   1975 0 G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2020 hydrog ?    ? A  C   1975 O2    ? ? ? 1_555 A  G   2005 N2    ? ? 0 C   1975 0 G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2021 hydrog ?    ? A  U   1977 N3    ? ? ? 1_555 A  U   1984 O4    ? ? 0 U   1977 0 U   1984 1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog2022 hydrog ?    ? A  U   1977 O2    ? ? ? 1_555 A  U   1984 N3    ? ? 0 U   1977 0 U   1984 1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog2023 hydrog ?    ? A  A   1978 N1    ? ? ? 1_555 A  G   2005 N2    ? ? 0 A   1978 0 G   2005 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog2024 hydrog ?    ? A  G   1979 N2    ? ? ? 1_555 A  U   2640 O2    ? ? 0 G   1979 0 U   2640 1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog2025 hydrog ?    ? A  A   1981 N3    ? ? ? 1_555 A  C   1983 N4    ? ? 0 A   1981 0 C   1983 1_555 ? ? ? ? ? ? 'A-C MISPAIR' 
?     ? ? 
hydrog2026 hydrog ?    ? A  G   1986 N1    ? ? ? 1_555 A  C   2002 N3    ? ? 0 G   1986 0 C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2027 hydrog ?    ? A  G   1986 N2    ? ? ? 1_555 A  C   2002 O2    ? ? 0 G   1986 0 C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2028 hydrog ?    ? A  G   1986 O6    ? ? ? 1_555 A  C   2002 N4    ? ? 0 G   1986 0 C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2029 hydrog ?    ? A  C   1987 N3    ? ? ? 1_555 A  G   2001 N1    ? ? 0 C   1987 0 G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2030 hydrog ?    ? A  C   1987 N4    ? ? ? 1_555 A  G   2001 O6    ? ? 0 C   1987 0 G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2031 hydrog ?    ? A  C   1987 O2    ? ? ? 1_555 A  G   2001 N2    ? ? 0 C   1987 0 G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2032 hydrog ?    ? A  C   1988 N3    ? ? ? 1_555 A  G   2000 N1    ? ? 0 C   1988 0 G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2033 hydrog ?    ? A  C   1988 N4    ? ? ? 1_555 A  G   2000 O6    ? ? 0 C   1988 0 G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2034 hydrog ?    ? A  C   1988 O2    ? ? ? 1_555 A  G   2000 N2    ? ? 0 C   1988 0 G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2035 hydrog ?    ? A  G   1989 N1    ? ? ? 1_555 A  C   1999 N3    ? ? 0 G   1989 0 C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2036 hydrog ?    ? A  G   1989 N2    ? ? ? 1_555 A  C   1999 O2    ? ? 0 G   1989 0 C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2037 hydrog ?    ? A  G   1989 O6    ? ? ? 1_555 A  C   1999 N4    ? ? 0 G   1989 0 C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2038 hydrog ?    ? A  C   1990 N3    ? ? ? 1_555 A  G   1998 N1    ? ? 0 C   1990 0 G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2039 hydrog ?    ? A  C   1990 N4    ? ? ? 1_555 A  G   1998 O6    ? ? 0 C   1990 0 G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2040 hydrog ?    ? A  C   1990 O2    ? ? ? 1_555 A  G   1998 N2    ? ? 0 C   1990 0 G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2041 hydrog ?    ? A  A   1994 N3    ? ? ? 1_555 A  G   2584 N2    ? ? 0 A   1994 0 G   2584 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog2042 hydrog ?    ? A  U   1996 O4    ? ? ? 1_555 A  C   2591 N4    ? ? 0 U   1996 0 C   2591 1_555 ? ? ? ? ? ? 'U-C MISPAIR' 
?     ? ? 
hydrog2043 hydrog ?    ? A  A   2007 N1    ? ? ? 1_555 A  G   2627 N2    ? ? 0 A   2007 0 G   2627 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog2044 hydrog ?    ? A  A   2010 N3    ? ? ? 1_555 A  G   2013 N2    ? ? 0 A   2010 0 G   2013 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog2045 hydrog ?    ? A  G   2033 N1    ? ? ? 1_555 A  C   2037 O2    ? ? 0 G   2033 0 C   2037 1_555 ? ? ? ? ? ? 'G-C PAIR' ? 
? ? 
hydrog2046 hydrog ?    ? A  G   2041 N2    ? ? ? 1_555 A  U   2726 O4    ? ? 0 G   2041 0 U   2726 1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog2047 hydrog ?    ? A  A   2054 N1    ? ? ? 1_555 A  U   2648 N3    ? ? 0 A   2054 0 U   2648 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2048 hydrog ?    ? A  A   2054 N6    ? ? ? 1_555 A  U   2648 O2    ? ? 0 A   2054 0 U   2648 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2049 hydrog ?    ? A  A   2060 N1    ? ? ? 1_555 A  U   2076 N3    ? ? 0 A   2060 0 U   2076 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2050 hydrog ?    ? A  A   2060 N6    ? ? ? 1_555 A  U   2076 O4    ? ? 0 A   2060 0 U   2076 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2051 hydrog ?    ? A  C   2061 N3    ? ? ? 1_555 A  G   2075 N1    ? ? 0 C   2061 0 G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2052 hydrog ?    ? A  C   2061 N4    ? ? ? 1_555 A  G   2075 O6    ? ? 0 C   2061 0 G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2053 hydrog ?    ? A  C   2061 O2    ? ? ? 1_555 A  G   2075 N2    ? ? 0 C   2061 0 G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2054 hydrog ?    ? A  U   2063 N3    ? ? ? 1_555 A  A   2083 N3    ? ? 0 U   2063 0 A   2083 1_555 ? ? ? ? ? ? 'U-A PAIR' ? 
? ? 
hydrog2055 hydrog ?    ? A  U   2064 N3    ? ? ? 1_555 A  A   2081 N1    ? ? 0 U   2064 0 A   2081 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2056 hydrog ?    ? A  U   2064 O4    ? ? ? 1_555 A  A   2081 N6    ? ? 0 U   2064 0 A   2081 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2057 hydrog ?    ? A  C   2065 N3    ? ? ? 1_555 A  G   2080 N1    ? ? 0 C   2065 0 G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2058 hydrog ?    ? A  C   2065 N4    ? ? ? 1_555 A  G   2080 O6    ? ? 0 C   2065 0 G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2059 hydrog ?    ? A  C   2065 O2    ? ? ? 1_555 A  G   2080 N2    ? ? 0 C   2065 0 G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2060 hydrog ?    ? A  C   2066 N3    ? ? ? 1_555 A  G   2079 N1    ? ? 0 C   2066 0 G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2061 hydrog ?    ? A  C   2066 N4    ? ? ? 1_555 A  G   2079 O6    ? ? 0 C   2066 0 G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2062 hydrog ?    ? A  C   2066 O2    ? ? ? 1_555 A  G   2079 N2    ? ? 0 C   2066 0 G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2063 hydrog ?    ? A  A   2067 N1    ? ? ? 1_555 A  U   2078 N3    ? ? 0 A   2067 0 U   2078 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2064 hydrog ?    ? A  A   2067 N6    ? ? ? 1_555 A  U   2078 O4    ? ? 0 A   2067 0 U   2078 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2065 hydrog ?    ? A  G   2068 N1    ? ? ? 1_555 A  C   2077 N3    ? ? 0 G   2068 0 C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2066 hydrog ?    ? A  G   2068 N2    ? ? ? 1_555 A  C   2077 O2    ? ? 0 G   2068 0 C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2067 hydrog ?    ? A  G   2068 O6    ? ? ? 1_555 A  C   2077 N4    ? ? 0 G   2068 0 C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2068 hydrog ?    ? A  U   2069 N3    ? ? ? 1_555 A  A   2074 N7    ? ? 0 U   2069 0 A   2074 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2069 hydrog ?    ? A  U   2069 O2    ? ? ? 1_555 A  A   2074 N6    ? ? 0 U   2069 0 A   2074 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2070 hydrog ?    ? A  G   2072 N2    ? ? ? 1_555 A  A   2490 N3    ? ? 0 G   2072 0 A   2490 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog2071 hydrog ?    ? A  C   2084 N3    ? ? ? 1_555 A  G   2660 N1    ? ? 0 C   2084 0 G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2072 hydrog ?    ? A  C   2084 N4    ? ? ? 1_555 A  G   2660 O6    ? ? 0 C   2084 0 G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2073 hydrog ?    ? A  C   2084 O2    ? ? ? 1_555 A  G   2660 N2    ? ? 0 C   2084 0 G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2074 hydrog ?    ? A  A   2085 N1    ? ? ? 1_555 A  U   2659 N3    ? ? 0 A   2085 0 U   2659 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2075 hydrog ?    ? A  A   2085 N6    ? ? ? 1_555 A  U   2659 O4    ? ? 0 A   2085 0 U   2659 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2076 hydrog ?    ? A  C   2086 N3    ? ? ? 1_555 A  G   2658 N1    ? ? 0 C   2086 0 G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2077 hydrog ?    ? A  C   2086 N4    ? ? ? 1_555 A  G   2658 O6    ? ? 0 C   2086 0 G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2078 hydrog ?    ? A  C   2086 O2    ? ? ? 1_555 A  G   2658 N2    ? ? 0 C   2086 0 G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2079 hydrog ?    ? A  C   2087 N3    ? ? ? 1_555 A  G   2657 N1    ? ? 0 C   2087 0 G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2080 hydrog ?    ? A  C   2087 N4    ? ? ? 1_555 A  G   2657 O6    ? ? 0 C   2087 0 G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2081 hydrog ?    ? A  C   2087 O2    ? ? ? 1_555 A  G   2657 N2    ? ? 0 C   2087 0 G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2082 hydrog ?    ? A  C   2088 N3    ? ? ? 1_555 A  G   2656 N1    ? ? 0 C   2088 0 G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2083 hydrog ?    ? A  C   2088 N4    ? ? ? 1_555 A  G   2656 O6    ? ? 0 C   2088 0 G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2084 hydrog ?    ? A  C   2088 O2    ? ? ? 1_555 A  G   2656 N2    ? ? 0 C   2088 0 G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2085 hydrog ?    ? A  C   2088 O2    ? ? ? 1_555 A  A   2840 N6    ? ? 0 C   2088 0 A   2840 1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog2086 hydrog ?    ? A  A   2089 N1    ? ? ? 1_555 A  U   2655 N3    ? ? 0 A   2089 0 U   2655 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2087 hydrog ?    ? A  A   2089 N6    ? ? ? 1_555 A  U   2655 O4    ? ? 0 A   2089 0 U   2655 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2088 hydrog ?    ? A  G   2090 N1    ? ? ? 1_555 A  C   2654 N3    ? ? 0 G   2090 0 C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2089 hydrog ?    ? A  G   2090 N2    ? ? ? 1_555 A  C   2654 O2    ? ? 0 G   2090 0 C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2090 hydrog ?    ? A  G   2090 O6    ? ? ? 1_555 A  C   2654 N4    ? ? 0 G   2090 0 C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2091 hydrog ?    ? A  G   2091 N1    ? ? ? 1_555 A  A   2653 N1    ? ? 0 G   2091 0 A   2653 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? 
? ? 
hydrog2092 hydrog ?    ? A  G   2091 O6    ? ? ? 1_555 A  A   2653 N6    ? ? 0 G   2091 0 A   2653 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? 
? ? 
hydrog2093 hydrog ?    ? A  G   2092 N2    ? ? ? 1_555 A  G   2093 O6    ? ? 0 G   2092 0 G   2093 1_555 ? ? ? ? ? ? 'G-G MISPAIR' 
?     ? ? 
hydrog2094 hydrog ?    ? A  G   2092 N2    ? ? ? 1_555 A  U   2652 O4    ? ? 0 G   2092 0 U   2652 1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog2095 hydrog ?    ? A  G   2093 N1    ? ? ? 1_555 A  U   2652 O2    ? ? 0 G   2093 0 U   2652 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2096 hydrog ?    ? A  G   2093 O6    ? ? ? 1_555 A  U   2652 N3    ? ? 0 G   2093 0 U   2652 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2097 hydrog ?    ? A  G   2094 N1    ? ? ? 1_555 A  C   2651 N3    ? ? 0 G   2094 0 C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2098 hydrog ?    ? A  G   2094 N2    ? ? ? 1_555 A  C   2651 O2    ? ? 0 G   2094 0 C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2099 hydrog ?    ? A  G   2094 O6    ? ? ? 1_555 A  C   2651 N4    ? ? 0 G   2094 0 C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2100 hydrog ?    ? A  A   2095 N6    ? ? ? 1_555 A  A   2612 N1    ? ? 0 A   2095 0 A   2612 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? 
? ? 
hydrog2101 hydrog ?    ? A  A   2095 N7    ? ? ? 1_555 A  A   2612 N6    ? ? 0 A   2095 0 A   2612 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? 
? ? 
hydrog2102 hydrog ?    ? A  A   2095 N1    ? ? ? 1_555 A  U   2650 N3    ? ? 0 A   2095 0 U   2650 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2103 hydrog ?    ? A  A   2095 N6    ? ? ? 1_555 A  U   2650 O4    ? ? 0 A   2095 0 U   2650 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2104 hydrog ?    ? A  G   2097 N1    ? ? ? 1_555 A  C   2647 N3    ? ? 0 G   2097 0 C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2105 hydrog ?    ? A  G   2097 N2    ? ? ? 1_555 A  C   2647 O2    ? ? 0 G   2097 0 C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2106 hydrog ?    ? A  G   2097 O6    ? ? ? 1_555 A  C   2647 N4    ? ? 0 G   2097 0 C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2107 hydrog ?    ? A  C   2098 N3    ? ? ? 1_555 A  G   2646 N1    ? ? 0 C   2098 0 G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2108 hydrog ?    ? A  C   2098 N4    ? ? ? 1_555 A  G   2646 O6    ? ? 0 C   2098 0 G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2109 hydrog ?    ? A  C   2098 O2    ? ? ? 1_555 A  G   2646 N2    ? ? 0 C   2098 0 G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2110 hydrog ?    ? A  G   2102 N1    ? ? ? 1_555 A  A   2486 N1    ? ? 0 G   2102 0 A   2486 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? 
? ? 
hydrog2111 hydrog ?    ? A  G   2102 O6    ? ? ? 1_555 A  A   2486 N6    ? ? 0 G   2102 0 A   2486 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? 
? ? 
hydrog2112 hydrog ?    ? A  C   2104 N3    ? ? ? 1_555 A  A   2485 N6    ? ? 0 C   2104 0 A   2485 1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog2113 hydrog ?    ? A  C   2104 N4    ? ? ? 1_555 A  C   2536 O2    ? ? 0 C   2104 0 C   2536 1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog2114 hydrog ?    ? A  C   2105 N3    ? ? ? 1_555 A  G   2481 N1    ? ? 0 C   2105 0 G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2115 hydrog ?    ? A  C   2105 N4    ? ? ? 1_555 A  G   2481 O6    ? ? 0 C   2105 0 G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2116 hydrog ?    ? A  C   2105 O2    ? ? ? 1_555 A  G   2481 N2    ? ? 0 C   2105 0 G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2117 hydrog ?    ? A  C   2106 N3    ? ? ? 1_555 A  G   2480 N1    ? ? 0 C   2106 0 G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2118 hydrog ?    ? A  C   2106 N4    ? ? ? 1_555 A  G   2480 O6    ? ? 0 C   2106 0 G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2119 hydrog ?    ? A  C   2106 O2    ? ? ? 1_555 A  G   2480 N2    ? ? 0 C   2106 0 G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2120 hydrog ?    ? A  U   2107 N3    ? ? ? 1_555 A  A   2479 N1    ? ? 0 U   2107 0 A   2479 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2121 hydrog ?    ? A  U   2107 O4    ? ? ? 1_555 A  A   2479 N6    ? ? 0 U   2107 0 A   2479 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2122 hydrog ?    ? A  A   2108 N1    ? ? ? 1_555 A  U   2478 N3    ? ? 0 A   2108 0 U   2478 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2123 hydrog ?    ? A  A   2108 N6    ? ? ? 1_555 A  U   2478 O4    ? ? 0 A   2108 0 U   2478 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2124 hydrog ?    ? A  U   2109 N3    ? ? ? 1_555 A  A   2467 N1    ? ? 0 U   2109 0 A   2467 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2125 hydrog ?    ? A  U   2109 O2    ? ? ? 1_555 A  A   2467 N6    ? ? 0 U   2109 0 A   2467 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2126 hydrog ?    ? A  G   2110 N1    ? ? ? 1_555 A  C   2477 N3    ? ? 0 G   2110 0 C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2127 hydrog ?    ? A  G   2110 N2    ? ? ? 1_555 A  C   2477 O2    ? ? 0 G   2110 0 C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2128 hydrog ?    ? A  G   2110 O6    ? ? ? 1_555 A  C   2477 N4    ? ? 0 G   2110 0 C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2129 hydrog ?    ? A  G   2111 N1    ? ? ? 1_555 A  C   2476 N3    ? ? 0 G   2111 0 C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2130 hydrog ?    ? A  G   2111 N2    ? ? ? 1_555 A  C   2476 O2    ? ? 0 G   2111 0 C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2131 hydrog ?    ? A  G   2111 O6    ? ? ? 1_555 A  C   2476 N4    ? ? 0 G   2111 0 C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2132 hydrog ?    ? A  A   2112 N1    ? ? ? 1_555 A  U   2473 N3    ? ? 0 A   2112 0 U   2473 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2133 hydrog ?    ? A  A   2112 N6    ? ? ? 1_555 A  U   2473 O4    ? ? 0 A   2112 0 U   2473 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2134 hydrog ?    ? A  G   2113 N1    ? ? ? 1_555 A  C   2472 N3    ? ? 0 G   2113 0 C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2135 hydrog ?    ? A  G   2113 N2    ? ? ? 1_555 A  C   2472 O2    ? ? 0 G   2113 0 C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2136 hydrog ?    ? A  G   2113 O6    ? ? ? 1_555 A  C   2472 N4    ? ? 0 G   2113 0 C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2137 hydrog ?    ? A  G   2113 N3    ? ? ? 1_555 A  C   2475 N4    ? ? 0 G   2113 0 C   2475 1_555 ? ? ? ? ? ? 'G-C PAIR' ? 
? ? 
hydrog2138 hydrog ?    ? A  C   2114 N3    ? ? ? 1_555 A  G   2471 N1    ? ? 0 C   2114 0 G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2139 hydrog ?    ? A  C   2114 N4    ? ? ? 1_555 A  G   2471 O6    ? ? 0 C   2114 0 G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2140 hydrog ?    ? A  C   2114 O2    ? ? ? 1_555 A  G   2471 N2    ? ? 0 C   2114 0 G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2141 hydrog ?    ? A  U   2115 N3    ? ? ? 1_555 A  A   2470 N1    ? ? 0 U   2115 0 A   2470 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2142 hydrog ?    ? A  U   2115 O4    ? ? ? 1_555 A  A   2470 N6    ? ? 0 U   2115 0 A   2470 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2143 hydrog ?    ? A  U   2115 O2    ? ? ? 1_555 A  G   2632 N2    ? ? 0 U   2115 0 G   2632 1_555 ? ? ? ? ? ? 'U-G MISPAIR' 
?     ? ? 
hydrog2144 hydrog ?    ? A  U   2116 N3    ? ? ? 1_555 A  A   2118 N7    ? ? 0 U   2116 0 A   2118 1_555 ? ? ? ? ? ? HOOGSTEEN ? ? 
? 
hydrog2145 hydrog ?    ? A  U   2116 O4    ? ? ? 1_555 A  A   2118 N6    ? ? 0 U   2116 0 A   2118 1_555 ? ? ? ? ? ? HOOGSTEEN ? ? 
? 
hydrog2146 hydrog ?    ? A  A   2118 N1    ? ? ? 1_555 A  U   2276 N3    ? ? 0 A   2118 0 U   2276 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2147 hydrog ?    ? A  A   2118 N6    ? ? ? 1_555 A  U   2276 O4    ? ? 0 A   2118 0 U   2276 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2148 hydrog ?    ? A  C   2119 N4    ? ? ? 1_555 A  G   2271 O6    ? ? 0 C   2119 0 G   2271 1_555 ? ? ? ? ? ? 'C-G PAIR' ? 
? ? 
hydrog2149 hydrog ?    ? A  C   2119 N3    ? ? ? 1_555 A  G   2275 N1    ? ? 0 C   2119 0 G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2150 hydrog ?    ? A  C   2119 N4    ? ? ? 1_555 A  G   2275 O6    ? ? 0 C   2119 0 G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2151 hydrog ?    ? A  C   2119 O2    ? ? ? 1_555 A  G   2275 N2    ? ? 0 C   2119 0 G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2152 hydrog ?    ? A  U   2120 N3    ? ? ? 1_555 A  A   2274 N1    ? ? 0 U   2120 0 A   2274 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2153 hydrog ?    ? A  U   2120 O4    ? ? ? 1_555 A  A   2274 N6    ? ? 0 U   2120 0 A   2274 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2154 hydrog ?    ? A  G   2121 N1    ? ? ? 1_555 A  C   2273 N3    ? ? 0 G   2121 0 C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2155 hydrog ?    ? A  G   2121 N2    ? ? ? 1_555 A  C   2273 O2    ? ? 0 G   2121 0 C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2156 hydrog ?    ? A  G   2121 O6    ? ? ? 1_555 A  C   2273 N4    ? ? 0 G   2121 0 C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2157 hydrog ?    ? A  C   2122 N3    ? ? ? 1_555 A  G   2272 N1    ? ? 0 C   2122 0 G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2158 hydrog ?    ? A  C   2122 N4    ? ? ? 1_555 A  G   2272 O6    ? ? 0 C   2122 0 G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2159 hydrog ?    ? A  C   2122 O2    ? ? ? 1_555 A  G   2272 N2    ? ? 0 C   2122 0 G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2160 hydrog ?    ? A  A   2123 N6    ? ? ? 1_555 A  G   2270 N3    ? ? 0 A   2123 0 G   2270 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2161 hydrog ?    ? A  A   2123 N7    ? ? ? 1_555 A  G   2270 N2    ? ? 0 A   2123 0 G   2270 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2162 hydrog ?    ? A  G   2124 N1    ? ? ? 1_555 A  C   2269 N3    ? ? 0 G   2124 0 C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2163 hydrog ?    ? A  G   2124 N2    ? ? ? 1_555 A  C   2269 O2    ? ? 0 G   2124 0 C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2164 hydrog ?    ? A  G   2124 O6    ? ? ? 1_555 A  C   2269 N4    ? ? 0 G   2124 0 C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2165 hydrog ?    ? A  G   2125 N1    ? ? ? 1_555 A  C   2268 N3    ? ? 0 G   2125 0 C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2166 hydrog ?    ? A  G   2125 N2    ? ? ? 1_555 A  C   2268 O2    ? ? 0 G   2125 0 C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2167 hydrog ?    ? A  G   2125 O6    ? ? ? 1_555 A  C   2268 N4    ? ? 0 G   2125 0 C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2168 hydrog ?    ? A  C   2126 N3    ? ? ? 1_555 A  G   2267 N1    ? ? 0 C   2126 0 G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2169 hydrog ?    ? A  C   2126 N4    ? ? ? 1_555 A  G   2267 O6    ? ? 0 C   2126 0 G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2170 hydrog ?    ? A  C   2126 O2    ? ? ? 1_555 A  G   2267 N2    ? ? 0 C   2126 0 G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2171 hydrog ?    ? A  U   2127 N3    ? ? ? 1_555 A  A   2266 N1    ? ? 0 U   2127 0 A   2266 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2172 hydrog ?    ? A  U   2127 O4    ? ? ? 1_555 A  A   2266 N6    ? ? 0 U   2127 0 A   2266 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2173 hydrog ?    ? A  G   2128 N1    ? ? ? 1_555 A  U   2265 O2    ? ? 0 G   2128 0 U   2265 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2174 hydrog ?    ? A  G   2128 O6    ? ? ? 1_555 A  U   2265 N3    ? ? 0 G   2128 0 U   2265 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2175 hydrog ?    ? A  U   2129 N3    ? ? ? 1_555 A  A   2264 N1    ? ? 0 U   2129 0 A   2264 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2176 hydrog ?    ? A  U   2129 O4    ? ? ? 1_555 A  A   2264 N6    ? ? 0 U   2129 0 A   2264 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2177 hydrog ?    ? A  C   2130 N3    ? ? ? 1_555 A  G   2263 N1    ? ? 0 C   2130 0 G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2178 hydrog ?    ? A  C   2130 N4    ? ? ? 1_555 A  G   2263 O6    ? ? 0 C   2130 0 G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2179 hydrog ?    ? A  C   2130 O2    ? ? ? 1_555 A  G   2263 N2    ? ? 0 C   2130 0 G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2180 hydrog ?    ? A  G   2131 N1    ? ? ? 1_555 A  C   2262 N3    ? ? 0 G   2131 0 C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2181 hydrog ?    ? A  G   2131 N2    ? ? ? 1_555 A  C   2262 O2    ? ? 0 G   2131 0 C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2182 hydrog ?    ? A  G   2131 O6    ? ? ? 1_555 A  C   2262 N4    ? ? 0 G   2131 0 C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2183 hydrog ?    ? A  C   2132 O2    ? ? ? 1_555 A  C   2261 N4    ? ? 0 C   2132 0 C   2261 1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog2184 hydrog ?    ? A  U   2133 O4    ? ? ? 1_555 A  A   2260 N6    ? ? 0 U   2133 0 A   2260 1_555 ? ? ? ? ? ? 'U-A PAIR' ? 
? ? 
hydrog2185 hydrog ?    ? A  G   2134 N1    ? ? ? 1_555 A  C   2241 N3    ? ? 0 G   2134 0 C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2186 hydrog ?    ? A  G   2134 N2    ? ? ? 1_555 A  C   2241 O2    ? ? 0 G   2134 0 C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2187 hydrog ?    ? A  G   2134 O6    ? ? ? 1_555 A  C   2241 N4    ? ? 0 G   2134 0 C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2188 hydrog ?    ? A  A   2135 N1    ? ? ? 1_555 A  U   2240 N3    ? ? 0 A   2135 0 U   2240 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2189 hydrog ?    ? A  A   2135 N6    ? ? ? 1_555 A  U   2240 O4    ? ? 0 A   2135 0 U   2240 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2190 hydrog ?    ? A  G   2136 N1    ? ? ? 1_555 A  C   2239 N3    ? ? 0 G   2136 0 C   2239 1_555 ? ? ? ? ? ? 'G-C PAIR' ? 
? ? 
hydrog2191 hydrog ?    ? A  U   2242 N3    ? ? ? 1_555 A  A   2258 N7    ? ? 0 U   2242 0 A   2258 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2192 hydrog ?    ? A  U   2242 O2    ? ? ? 1_555 A  A   2258 N6    ? ? 0 U   2242 0 A   2258 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2193 hydrog ?    ? A  A   2244 N6    ? ? ? 1_555 A  G   2257 N3    ? ? 0 A   2244 0 G   2257 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2194 hydrog ?    ? A  A   2244 N7    ? ? ? 1_555 A  G   2257 N2    ? ? 0 A   2244 0 G   2257 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2195 hydrog ?    ? A  C   2245 N3    ? ? ? 1_555 A  G   2256 N1    ? ? 0 C   2245 0 G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2196 hydrog ?    ? A  C   2245 N4    ? ? ? 1_555 A  G   2256 O6    ? ? 0 C   2245 0 G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2197 hydrog ?    ? A  C   2245 O2    ? ? ? 1_555 A  G   2256 N2    ? ? 0 C   2245 0 G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2198 hydrog ?    ? A  U   2246 N3    ? ? ? 1_555 A  A   2255 N1    ? ? 0 U   2246 0 A   2255 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2199 hydrog ?    ? A  U   2246 O4    ? ? ? 1_555 A  A   2255 N6    ? ? 0 U   2246 0 A   2255 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2200 hydrog ?    ? A  C   2247 N3    ? ? ? 1_555 A  G   2254 N1    ? ? 0 C   2247 0 G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2201 hydrog ?    ? A  C   2247 N4    ? ? ? 1_555 A  G   2254 O6    ? ? 0 C   2247 0 G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2202 hydrog ?    ? A  C   2247 O2    ? ? ? 1_555 A  G   2254 N2    ? ? 0 C   2247 0 G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2203 hydrog ?    ? A  C   2248 N3    ? ? ? 1_555 A  G   2253 N1    ? ? 0 C   2248 0 G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2204 hydrog ?    ? A  C   2248 N4    ? ? ? 1_555 A  G   2253 O6    ? ? 0 C   2248 0 G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2205 hydrog ?    ? A  C   2248 O2    ? ? ? 1_555 A  G   2253 N2    ? ? 0 C   2248 0 G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2206 hydrog ?    ? A  G   2249 N2    ? ? ? 1_555 A  A   2252 N7    ? ? 0 G   2249 0 A   2252 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog2207 hydrog ?    ? A  G   2271 N7    ? ? ? 1_555 A  A   2274 N6    ? ? 0 G   2271 0 A   2274 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog2208 hydrog ?    ? A  U   2277 N3    ? ? ? 1_555 A  A   2470 N7    ? ? 0 U   2277 0 A   2470 1_555 ? ? ? ? ? ? HOOGSTEEN ? ? 
? 
hydrog2209 hydrog ?    ? A  U   2277 O4    ? ? ? 1_555 A  A   2470 N6    ? ? 0 U   2277 0 A   2470 1_555 ? ? ? ? ? ? HOOGSTEEN ? ? 
? 
hydrog2210 hydrog ?    ? A  U   2278 N3    ? ? ? 1_555 A  G   2471 N7    ? ? 0 U   2278 0 G   2471 1_555 ? ? ? ? ? ? 'U-G MISPAIR' 
?     ? ? 
hydrog2211 hydrog ?    ? A  G   2279 N1    ? ? ? 1_555 A  C   2292 N3    ? ? 0 G   2279 0 C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2212 hydrog ?    ? A  G   2279 N2    ? ? ? 1_555 A  C   2292 O2    ? ? 0 G   2279 0 C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2213 hydrog ?    ? A  G   2279 O6    ? ? ? 1_555 A  C   2292 N4    ? ? 0 G   2279 0 C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2214 hydrog ?    ? A  A   2280 N1    ? ? ? 1_555 A  U   2290 N3    ? ? 0 A   2280 0 U   2290 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2215 hydrog ?    ? A  A   2280 N6    ? ? ? 1_555 A  U   2290 O4    ? ? 0 A   2280 0 U   2290 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2216 hydrog ?    ? A  C   2281 N3    ? ? ? 1_555 A  G   2289 N1    ? ? 0 C   2281 0 G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2217 hydrog ?    ? A  C   2281 N4    ? ? ? 1_555 A  G   2289 O6    ? ? 0 C   2281 0 G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2218 hydrog ?    ? A  C   2281 O2    ? ? ? 1_555 A  G   2289 N2    ? ? 0 C   2281 0 G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2219 hydrog ?    ? A  G   2288 N1    ? ? ? 1_555 A  C   2309 N3    ? ? 0 G   2288 0 C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2220 hydrog ?    ? A  G   2288 N2    ? ? ? 1_555 A  C   2309 O2    ? ? 0 G   2288 0 C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2221 hydrog ?    ? A  G   2288 O6    ? ? ? 1_555 A  C   2309 N4    ? ? 0 G   2288 0 C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2222 hydrog ?    ? A  G   2289 N2    ? ? ? 1_555 A  A   2291 N1    ? ? 0 G   2289 0 A   2291 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog2223 hydrog ?    ? A  G   2293 N1    ? ? ? 1_555 A  C   2315 N3    ? ? 0 G   2293 0 C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2224 hydrog ?    ? A  G   2293 N2    ? ? ? 1_555 A  C   2315 O2    ? ? 0 G   2293 0 C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2225 hydrog ?    ? A  G   2293 O6    ? ? ? 1_555 A  C   2315 N4    ? ? 0 G   2293 0 C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2226 hydrog ?    ? A  C   2294 N3    ? ? ? 1_555 A  G   2314 N1    ? ? 0 C   2294 0 G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2227 hydrog ?    ? A  C   2294 N4    ? ? ? 1_555 A  G   2314 O6    ? ? 0 C   2294 0 G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2228 hydrog ?    ? A  C   2294 O2    ? ? ? 1_555 A  G   2314 N2    ? ? 0 C   2294 0 G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2229 hydrog ?    ? A  G   2295 N1    ? ? ? 1_555 A  C   2313 N3    ? ? 0 G   2295 0 C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2230 hydrog ?    ? A  G   2295 N2    ? ? ? 1_555 A  C   2313 O2    ? ? 0 G   2295 0 C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2231 hydrog ?    ? A  G   2295 O6    ? ? ? 1_555 A  C   2313 N4    ? ? 0 G   2295 0 C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2232 hydrog ?    ? A  G   2295 N2    ? ? ? 1_555 A  A   2361 N3    ? ? 0 G   2295 0 A   2361 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog2233 hydrog ?    ? A  C   2296 N3    ? ? ? 1_555 A  G   2312 N1    ? ? 0 C   2296 0 G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2234 hydrog ?    ? A  C   2296 N4    ? ? ? 1_555 A  G   2312 O6    ? ? 0 C   2296 0 G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2235 hydrog ?    ? A  C   2296 O2    ? ? ? 1_555 A  G   2312 N2    ? ? 0 C   2296 0 G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2236 hydrog ?    ? A  U   2297 N3    ? ? ? 1_555 A  A   2311 N1    ? ? 0 U   2297 0 A   2311 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2237 hydrog ?    ? A  U   2297 O4    ? ? ? 1_555 A  A   2311 N6    ? ? 0 U   2297 0 A   2311 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2238 hydrog ?    ? A  C   2298 N3    ? ? ? 1_555 A  G   2310 N1    ? ? 0 C   2298 0 G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2239 hydrog ?    ? A  C   2298 N4    ? ? ? 1_555 A  G   2310 O6    ? ? 0 C   2298 0 G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2240 hydrog ?    ? A  C   2298 O2    ? ? ? 1_555 A  G   2310 N2    ? ? 0 C   2298 0 G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2241 hydrog ?    ? A  G   2299 N2    ? ? ? 1_555 A  U   2308 O4    ? ? 0 G   2299 0 U   2308 1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog2242 hydrog ?    ? A  A   2300 N6    ? ? ? 1_555 A  A   2307 N7    ? ? 0 A   2300 0 A   2307 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog2243 hydrog ?    ? A  A   2300 N7    ? ? ? 1_555 A  A   2307 N6    ? ? 0 A   2300 0 A   2307 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog2244 hydrog ?    ? A  A   2301 N1    ? ? ? 1_555 A  U   2306 N3    ? ? 0 A   2301 0 U   2306 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2245 hydrog ?    ? A  A   2301 N6    ? ? ? 1_555 A  U   2306 O2    ? ? 0 A   2301 0 U   2306 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2246 hydrog ?    ? A  G   2314 N2    ? ? ? 1_555 A  A   2425 N3    ? ? 0 G   2314 0 A   2425 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog2247 hydrog ?    ? A  G   2316 N1    ? ? ? 1_555 A  C   2464 N3    ? ? 0 G   2316 0 C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2248 hydrog ?    ? A  G   2316 N2    ? ? ? 1_555 A  C   2464 O2    ? ? 0 G   2316 0 C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2249 hydrog ?    ? A  G   2316 O6    ? ? ? 1_555 A  C   2464 N4    ? ? 0 G   2316 0 C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2250 hydrog ?    ? A  C   2317 N3    ? ? ? 1_555 A  G   2359 N1    ? ? 0 C   2317 0 G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2251 hydrog ?    ? A  C   2317 N4    ? ? ? 1_555 A  G   2359 O6    ? ? 0 C   2317 0 G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2252 hydrog ?    ? A  C   2317 O2    ? ? ? 1_555 A  G   2359 N2    ? ? 0 C   2317 0 G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2253 hydrog ?    ? A  C   2318 N3    ? ? ? 1_555 A  G   2421 N1    ? ? 0 C   2318 0 G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2254 hydrog ?    ? A  C   2318 N4    ? ? ? 1_555 A  G   2421 O6    ? ? 0 C   2318 0 G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2255 hydrog ?    ? A  C   2318 O2    ? ? ? 1_555 A  G   2421 N2    ? ? 0 C   2318 0 G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2256 hydrog ?    ? A  C   2319 N3    ? ? ? 1_555 A  G   2420 N1    ? ? 0 C   2319 0 G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2257 hydrog ?    ? A  C   2319 N4    ? ? ? 1_555 A  G   2420 O6    ? ? 0 C   2319 0 G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2258 hydrog ?    ? A  C   2319 O2    ? ? ? 1_555 A  G   2420 N2    ? ? 0 C   2319 0 G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2259 hydrog ?    ? A  A   2321 N1    ? ? ? 1_555 A  U   2378 N3    ? ? 0 A   2321 0 U   2378 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2260 hydrog ?    ? A  A   2321 N6    ? ? ? 1_555 A  U   2378 O2    ? ? 0 A   2321 0 U   2378 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2261 hydrog ?    ? A  A   2321 N6    ? ? ? 1_555 A  A   2380 N7    ? ? 0 A   2321 0 A   2380 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog2262 hydrog ?    ? A  A   2321 N7    ? ? ? 1_555 A  A   2380 N6    ? ? 0 A   2321 0 A   2380 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog2263 hydrog ?    ? A  U   2322 O2    ? ? ? 1_555 A  G   2421 N2    ? ? 0 U   2322 0 G   2421 1_555 ? ? ? ? ? ? 'U-G MISPAIR' 
?     ? ? 
hydrog2264 hydrog ?    ? A  G   2323 N1    ? ? ? 1_555 A  U   2377 O2    ? ? 0 G   2323 0 U   2377 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2265 hydrog ?    ? A  G   2323 O6    ? ? ? 1_555 A  U   2377 N3    ? ? 0 G   2323 0 U   2377 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2266 hydrog ?    ? A  G   2324 N1    ? ? ? 1_555 A  C   2376 N3    ? ? 0 G   2324 0 C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2267 hydrog ?    ? A  G   2324 N2    ? ? ? 1_555 A  C   2376 O2    ? ? 0 G   2324 0 C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2268 hydrog ?    ? A  G   2324 O6    ? ? ? 1_555 A  C   2376 N4    ? ? 0 G   2324 0 C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2269 hydrog ?    ? A  U   2325 N3    ? ? ? 1_555 A  A   2375 N1    ? ? 0 U   2325 0 A   2375 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2270 hydrog ?    ? A  U   2325 O4    ? ? ? 1_555 A  A   2375 N6    ? ? 0 U   2325 0 A   2375 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2271 hydrog ?    ? A  C   2326 N3    ? ? ? 1_555 A  G   2374 N1    ? ? 0 C   2326 0 G   2374 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2272 hydrog ?    ? A  C   2326 N4    ? ? ? 1_555 A  G   2374 O6    ? ? 0 C   2326 0 G   2374 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2273 hydrog ?    ? A  C   2326 O2    ? ? ? 1_555 A  G   2374 N2    ? ? 0 C   2326 0 G   2374 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2274 hydrog ?    ? A  A   2327 N1    ? ? ? 1_555 A  U   2373 N3    ? ? 0 A   2327 0 U   2373 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2275 hydrog ?    ? A  A   2327 N6    ? ? ? 1_555 A  U   2373 O4    ? ? 0 A   2327 0 U   2373 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2276 hydrog ?    ? A  U   2328 N3    ? ? ? 1_555 A  A   2372 N1    ? ? 0 U   2328 0 A   2372 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2277 hydrog ?    ? A  U   2328 O4    ? ? ? 1_555 A  A   2372 N6    ? ? 0 U   2328 0 A   2372 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2278 hydrog ?    ? A  C   2329 N3    ? ? ? 1_555 A  G   2371 N1    ? ? 0 C   2329 0 G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2279 hydrog ?    ? A  C   2329 N4    ? ? ? 1_555 A  G   2371 O6    ? ? 0 C   2329 0 G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2280 hydrog ?    ? A  C   2329 O2    ? ? ? 1_555 A  G   2371 N2    ? ? 0 C   2329 0 G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2281 hydrog ?    ? A  U   2330 N3    ? ? ? 1_555 A  A   2369 N7    ? ? 0 U   2330 0 A   2369 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2282 hydrog ?    ? A  U   2330 O2    ? ? ? 1_555 A  A   2369 N6    ? ? 0 U   2330 0 A   2369 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2283 hydrog ?    ? A  C   2331 N3    ? ? ? 1_555 A  G   2355 N1    ? ? 0 C   2331 0 G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2284 hydrog ?    ? A  C   2331 N4    ? ? ? 1_555 A  G   2355 O6    ? ? 0 C   2331 0 G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2285 hydrog ?    ? A  C   2331 O2    ? ? ? 1_555 A  G   2355 N2    ? ? 0 C   2331 0 G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2286 hydrog ?    ? A  A   2332 N6    ? ? ? 1_555 A  G   2352 N3    ? ? 0 A   2332 0 G   2352 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2287 hydrog ?    ? A  A   2332 N7    ? ? ? 1_555 A  G   2352 N2    ? ? 0 A   2332 0 G   2352 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2288 hydrog ?    ? A  G   2333 N1    ? ? ? 1_555 A  C   2351 N3    ? ? 0 G   2333 0 C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2289 hydrog ?    ? A  G   2333 N2    ? ? ? 1_555 A  C   2351 O2    ? ? 0 G   2333 0 C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2290 hydrog ?    ? A  G   2333 O6    ? ? ? 1_555 A  C   2351 N4    ? ? 0 G   2333 0 C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2291 hydrog ?    ? A  C   2334 N3    ? ? ? 1_555 A  G   2350 N1    ? ? 0 C   2334 0 G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2292 hydrog ?    ? A  C   2334 N4    ? ? ? 1_555 A  G   2350 O6    ? ? 0 C   2334 0 G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2293 hydrog ?    ? A  C   2334 O2    ? ? ? 1_555 A  G   2350 N2    ? ? 0 C   2334 0 G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2294 hydrog ?    ? A  C   2335 N3    ? ? ? 1_555 A  G   2349 N1    ? ? 0 C   2335 0 G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2295 hydrog ?    ? A  C   2335 N4    ? ? ? 1_555 A  G   2349 O6    ? ? 0 C   2335 0 G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2296 hydrog ?    ? A  C   2335 O2    ? ? ? 1_555 A  G   2349 N2    ? ? 0 C   2335 0 G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2297 hydrog ?    ? A  G   2336 N1    ? ? ? 1_555 A  C   2348 N3    ? ? 0 G   2336 0 C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2298 hydrog ?    ? A  G   2336 N2    ? ? ? 1_555 A  C   2348 O2    ? ? 0 G   2336 0 C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2299 hydrog ?    ? A  G   2336 O6    ? ? ? 1_555 A  C   2348 N4    ? ? 0 G   2336 0 C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2300 hydrog ?    ? A  G   2337 N1    ? ? ? 1_555 A  C   2347 N3    ? ? 0 G   2337 0 C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2301 hydrog ?    ? A  G   2337 N2    ? ? ? 1_555 A  C   2347 O2    ? ? 0 G   2337 0 C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2302 hydrog ?    ? A  G   2337 O6    ? ? ? 1_555 A  C   2347 N4    ? ? 0 G   2337 0 C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2303 hydrog ?    ? A  G   2338 N1    ? ? ? 1_555 A  C   2346 N3    ? ? 0 G   2338 0 C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2304 hydrog ?    ? A  G   2338 N2    ? ? ? 1_555 A  C   2346 O2    ? ? 0 G   2338 0 C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2305 hydrog ?    ? A  G   2338 O6    ? ? ? 1_555 A  C   2346 N4    ? ? 0 G   2338 0 C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2306 hydrog ?    ? A  A   2356 N1    ? ? ? 1_555 A  A   2369 N6    ? ? 0 A   2356 0 A   2369 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? 
? ? 
hydrog2307 hydrog ?    ? A  A   2356 N6    ? ? ? 1_555 A  A   2369 N1    ? ? 0 A   2356 0 A   2369 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? 
? ? 
hydrog2308 hydrog ?    ? A  G   2357 N1    ? ? ? 1_555 A  C   2366 N3    ? ? 0 G   2357 0 C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2309 hydrog ?    ? A  G   2357 N2    ? ? ? 1_555 A  C   2366 O2    ? ? 0 G   2357 0 C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2310 hydrog ?    ? A  G   2357 O6    ? ? ? 1_555 A  C   2366 N4    ? ? 0 G   2357 0 C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2311 hydrog ?    ? A  U   2358 N3    ? ? ? 1_555 A  G   2365 O6    ? ? 0 U   2358 0 G   2365 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2312 hydrog ?    ? A  U   2358 O2    ? ? ? 1_555 A  G   2365 N1    ? ? 0 U   2358 0 G   2365 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2313 hydrog ?    ? A  C   2360 N3    ? ? ? 1_555 A  G   2426 N1    ? ? 0 C   2360 0 G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2314 hydrog ?    ? A  C   2360 N4    ? ? ? 1_555 A  G   2426 O6    ? ? 0 C   2360 0 G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2315 hydrog ?    ? A  C   2360 O2    ? ? ? 1_555 A  G   2426 N2    ? ? 0 C   2360 0 G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2316 hydrog ?    ? A  A   2362 N1    ? ? ? 1_555 A  U   2424 N3    ? ? 0 A   2362 0 U   2424 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2317 hydrog ?    ? A  A   2362 N6    ? ? ? 1_555 A  U   2424 O4    ? ? 0 A   2362 0 U   2424 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2318 hydrog ?    ? A  G   2363 N1    ? ? ? 1_555 A  C   2423 N3    ? ? 0 G   2363 0 C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2319 hydrog ?    ? A  G   2363 N2    ? ? ? 1_555 A  C   2423 O2    ? ? 0 G   2363 0 C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2320 hydrog ?    ? A  G   2363 O6    ? ? ? 1_555 A  C   2423 N4    ? ? 0 G   2363 0 C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2321 hydrog ?    ? A  A   2364 N1    ? ? ? 1_555 A  U   2422 N3    ? ? 0 A   2364 0 U   2422 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2322 hydrog ?    ? A  A   2364 N6    ? ? ? 1_555 A  U   2422 O4    ? ? 0 A   2364 0 U   2422 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2323 hydrog ?    ? A  G   2365 N2    ? ? ? 1_555 A  A   2370 N3    ? ? 0 G   2365 0 A   2370 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog2324 hydrog ?    ? A  G   2379 O6    ? ? ? 1_555 A  A   2408 N6    ? ? 0 G   2379 0 A   2408 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog2325 hydrog ?    ? A  C   2381 N3    ? ? ? 1_555 A  G   2407 N1    ? ? 0 C   2381 0 G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2326 hydrog ?    ? A  C   2381 N4    ? ? ? 1_555 A  G   2407 O6    ? ? 0 C   2381 0 G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2327 hydrog ?    ? A  C   2381 O2    ? ? ? 1_555 A  G   2407 N2    ? ? 0 C   2381 0 G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2328 hydrog ?    ? A  A   2382 N1    ? ? ? 1_555 A  U   2406 N3    ? ? 0 A   2382 0 U   2406 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2329 hydrog ?    ? A  A   2382 N6    ? ? ? 1_555 A  U   2406 O4    ? ? 0 A   2382 0 U   2406 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2330 hydrog ?    ? A  G   2383 N1    ? ? ? 1_555 A  C   2405 N3    ? ? 0 G   2383 0 C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2331 hydrog ?    ? A  G   2383 N2    ? ? ? 1_555 A  C   2405 O2    ? ? 0 G   2383 0 C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2332 hydrog ?    ? A  G   2383 O6    ? ? ? 1_555 A  C   2405 N4    ? ? 0 G   2383 0 C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2333 hydrog ?    ? A  U   2384 N3    ? ? ? 1_555 A  G   2404 O6    ? ? 0 U   2384 0 G   2404 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2334 hydrog ?    ? A  U   2384 O2    ? ? ? 1_555 A  G   2404 N1    ? ? 0 U   2384 0 G   2404 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2335 hydrog ?    ? A  G   2385 N1    ? ? ? 1_555 A  C   2403 N3    ? ? 0 G   2385 0 C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2336 hydrog ?    ? A  G   2385 N2    ? ? ? 1_555 A  C   2403 O2    ? ? 0 G   2385 0 C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2337 hydrog ?    ? A  G   2385 O6    ? ? ? 1_555 A  C   2403 N4    ? ? 0 G   2385 0 C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2338 hydrog ?    ? A  U   2386 N3    ? ? ? 1_555 A  A   2402 N1    ? ? 0 U   2386 0 A   2402 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2339 hydrog ?    ? A  U   2386 O4    ? ? ? 1_555 A  A   2402 N6    ? ? 0 U   2386 0 A   2402 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2340 hydrog ?    ? A  U   2387 N3    ? ? ? 1_555 A  A   2401 N1    ? ? 0 U   2387 0 A   2401 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2341 hydrog ?    ? A  U   2387 O4    ? ? ? 1_555 A  A   2401 N6    ? ? 0 U   2387 0 A   2401 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2342 hydrog ?    ? A  C   2388 N3    ? ? ? 1_555 A  G   2400 N1    ? ? 0 C   2388 0 G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2343 hydrog ?    ? A  C   2388 N4    ? ? ? 1_555 A  G   2400 O6    ? ? 0 C   2388 0 G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2344 hydrog ?    ? A  C   2388 O2    ? ? ? 1_555 A  G   2400 N2    ? ? 0 C   2388 0 G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2345 hydrog ?    ? A  U   2389 N3    ? ? ? 1_555 A  G   2399 O6    ? ? 0 U   2389 0 G   2399 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2346 hydrog ?    ? A  U   2389 O2    ? ? ? 1_555 A  G   2399 N1    ? ? 0 U   2389 0 G   2399 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2347 hydrog ?    ? A  U   2390 O2    ? ? ? 1_555 A  A   2398 N6    ? ? 0 U   2390 0 A   2398 1_555 ? ? ? ? ? ? 'U-A PAIR' ? 
? ? 
hydrog2348 hydrog ?    ? A  C   2391 N4    ? ? ? 1_555 A  G   2397 N7    ? ? 0 C   2391 0 G   2397 1_555 ? ? ? ? ? ? 'C-G PAIR' ? 
? ? 
hydrog2349 hydrog ?    ? A  C   2409 N3    ? ? ? 1_555 A  G   2418 N1    ? ? 0 C   2409 0 G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2350 hydrog ?    ? A  C   2409 N4    ? ? ? 1_555 A  G   2418 O6    ? ? 0 C   2409 0 G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2351 hydrog ?    ? A  C   2409 O2    ? ? ? 1_555 A  G   2418 N2    ? ? 0 C   2409 0 G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2352 hydrog ?    ? A  G   2410 N1    ? ? ? 1_555 A  C   2417 N3    ? ? 0 G   2410 0 C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2353 hydrog ?    ? A  G   2410 N2    ? ? ? 1_555 A  C   2417 O2    ? ? 0 G   2410 0 C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2354 hydrog ?    ? A  G   2410 O6    ? ? ? 1_555 A  C   2417 N4    ? ? 0 G   2410 0 C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2355 hydrog ?    ? A  C   2411 N3    ? ? ? 1_555 A  G   2416 N1    ? ? 0 C   2411 0 G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2356 hydrog ?    ? A  C   2411 N4    ? ? ? 1_555 A  G   2416 O6    ? ? 0 C   2411 0 G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2357 hydrog ?    ? A  C   2411 O2    ? ? ? 1_555 A  G   2416 N2    ? ? 0 C   2411 0 G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2358 hydrog ?    ? A  G   2412 N2    ? ? ? 1_555 A  A   2415 N7    ? ? 0 G   2412 0 A   2415 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog2359 hydrog ?    ? A  C   2427 N4    ? ? ? 1_555 A  G   2462 O6    ? ? 0 C   2427 0 G   2462 1_555 ? ? ? ? ? ? 'C-G PAIR' ? 
? ? 
hydrog2360 hydrog ?    ? A  G   2428 N2    ? ? ? 1_555 A  G   2466 N3    ? ? 0 G   2428 0 G   2466 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? 
? ? 
hydrog2361 hydrog ?    ? A  G   2428 N3    ? ? ? 1_555 A  G   2466 N2    ? ? 0 G   2428 0 G   2466 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? 
? ? 
hydrog2362 hydrog ?    ? A  A   2429 N6    ? ? ? 1_555 A  U   2461 O2    ? ? 0 A   2429 0 U   2461 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2363 hydrog ?    ? A  A   2429 N7    ? ? ? 1_555 A  U   2461 N3    ? ? 0 A   2429 0 U   2461 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2364 hydrog ?    ? A  A   2430 N6    ? ? ? 1_555 A  A   2460 N1    ? ? 0 A   2430 0 A   2460 1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog2365 hydrog ?    ? A  C   2432 N3    ? ? ? 1_555 A  G   2459 N1    ? ? 0 C   2432 0 G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2366 hydrog ?    ? A  C   2432 N4    ? ? ? 1_555 A  G   2459 O6    ? ? 0 C   2432 0 G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2367 hydrog ?    ? A  C   2432 O2    ? ? ? 1_555 A  G   2459 N2    ? ? 0 C   2432 0 G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2368 hydrog ?    ? A  A   2433 N1    ? ? ? 1_555 A  U   2458 N3    ? ? 0 A   2433 0 U   2458 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2369 hydrog ?    ? A  A   2433 N6    ? ? ? 1_555 A  U   2458 O4    ? ? 0 A   2433 0 U   2458 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2370 hydrog ?    ? A  A   2434 N1    ? ? ? 1_555 A  U   2457 N3    ? ? 0 A   2434 0 U   2457 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2371 hydrog ?    ? A  A   2434 N6    ? ? ? 1_555 A  U   2457 O4    ? ? 0 A   2434 0 U   2457 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2372 hydrog ?    ? A  U   2435 N3    ? ? ? 1_555 A  A   2456 N1    ? ? 0 U   2435 0 A   2456 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2373 hydrog ?    ? A  U   2435 O4    ? ? ? 1_555 A  A   2456 N6    ? ? 0 U   2435 0 A   2456 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2374 hydrog ?    ? A  U   2436 N3    ? ? ? 1_555 A  A   2455 N1    ? ? 0 U   2436 0 A   2455 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2375 hydrog ?    ? A  U   2436 O4    ? ? ? 1_555 A  A   2455 N6    ? ? 0 U   2436 0 A   2455 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2376 hydrog ?    ? A  G   2438 N1    ? ? ? 1_555 A  C   2454 N3    ? ? 0 G   2438 0 C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2377 hydrog ?    ? A  G   2438 N2    ? ? ? 1_555 A  C   2454 O2    ? ? 0 G   2438 0 C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2378 hydrog ?    ? A  G   2438 O6    ? ? ? 1_555 A  C   2454 N4    ? ? 0 G   2438 0 C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2379 hydrog ?    ? A  C   2439 N3    ? ? ? 1_555 A  G   2453 N1    ? ? 0 C   2439 0 G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2380 hydrog ?    ? A  C   2439 N4    ? ? ? 1_555 A  G   2453 O6    ? ? 0 C   2439 0 G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2381 hydrog ?    ? A  C   2439 O2    ? ? ? 1_555 A  G   2453 N2    ? ? 0 C   2439 0 G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2382 hydrog ?    ? A  C   2440 N3    ? ? ? 1_555 A  G   2452 N1    ? ? 0 C   2440 0 G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2383 hydrog ?    ? A  C   2440 N4    ? ? ? 1_555 A  G   2452 O6    ? ? 0 C   2440 0 G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2384 hydrog ?    ? A  C   2440 O2    ? ? ? 1_555 A  G   2452 N2    ? ? 0 C   2440 0 G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2385 hydrog ?    ? A  U   2441 N3    ? ? ? 1_555 A  G   2451 O6    ? ? 0 U   2441 0 G   2451 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2386 hydrog ?    ? A  U   2441 O2    ? ? ? 1_555 A  G   2451 N1    ? ? 0 U   2441 0 G   2451 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2387 hydrog ?    ? A  G   2442 N1    ? ? ? 1_555 A  C   2450 N3    ? ? 0 G   2442 0 C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2388 hydrog ?    ? A  G   2442 N2    ? ? ? 1_555 A  C   2450 O2    ? ? 0 G   2442 0 C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2389 hydrog ?    ? A  G   2442 O6    ? ? ? 1_555 A  C   2450 N4    ? ? 0 G   2442 0 C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2390 hydrog ?    ? A  G   2471 N2    ? ? ? 1_555 A  A   2633 N3    ? ? 0 G   2471 0 A   2633 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog2391 hydrog ?    ? A  U   2473 O2    ? ? ? 1_555 A  C   2475 N4    ? ? 0 U   2473 0 C   2475 1_555 ? ? ? ? ? ? 'U-C MISPAIR' 
?     ? ? 
hydrog2392 hydrog ?    ? A  G   2482 O6    ? ? ? 1_555 A  A   2486 N6    ? ? 0 G   2482 0 A   2486 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog2393 hydrog ?    ? A  A   2485 N6    ? ? ? 1_555 A  C   2536 N3    ? ? 0 A   2485 0 C   2536 1_555 ? ? ? ? ? ? TYPE_25_PAIR 
?     ? ? 
hydrog2394 hydrog ?    ? A  A   2485 N7    ? ? ? 1_555 A  C   2536 N4    ? ? 0 A   2485 0 C   2536 1_555 ? ? ? ? ? ? TYPE_25_PAIR 
?     ? ? 
hydrog2395 hydrog ?    ? A  C   2487 N4    ? ? ? 1_555 A  U   2535 O4    ? ? 0 C   2487 0 U   2535 1_555 ? ? ? ? ? ? 'C-U MISPAIR' 
?     ? ? 
hydrog2396 hydrog ?    ? A  G   2489 N1    ? ? ? 1_555 A  C   2533 N3    ? ? 0 G   2489 0 C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2397 hydrog ?    ? A  G   2489 N2    ? ? ? 1_555 A  C   2533 O2    ? ? 0 G   2489 0 C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2398 hydrog ?    ? A  G   2489 O6    ? ? ? 1_555 A  C   2533 N4    ? ? 0 G   2489 0 C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2399 hydrog ?    ? A  A   2490 N1    ? ? ? 1_555 A  U   2531 N3    ? ? 0 A   2490 0 U   2531 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2400 hydrog ?    ? A  A   2490 N6    ? ? ? 1_555 A  U   2531 O4    ? ? 0 A   2490 0 U   2531 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2401 hydrog ?    ? A  G   2491 N1    ? ? ? 1_555 A  C   2530 N3    ? ? 0 G   2491 0 C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2402 hydrog ?    ? A  G   2491 N2    ? ? ? 1_555 A  C   2530 O2    ? ? 0 G   2491 0 C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2403 hydrog ?    ? A  G   2491 O6    ? ? ? 1_555 A  C   2530 N4    ? ? 0 G   2491 0 C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2404 hydrog ?    ? A  U   2492 N3    ? ? ? 1_555 A  G   2529 O6    ? ? 0 U   2492 0 G   2529 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2405 hydrog ?    ? A  U   2492 O2    ? ? ? 1_555 A  G   2529 N1    ? ? 0 U   2492 0 G   2529 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2406 hydrog ?    ? A  G   2494 N1    ? ? ? 1_555 A  U   2528 O2    ? ? 0 G   2494 0 U   2528 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2407 hydrog ?    ? A  G   2494 O6    ? ? ? 1_555 A  U   2528 N3    ? ? 0 G   2494 0 U   2528 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2408 hydrog ?    ? A  U   2495 O4    ? ? ? 1_555 A  G   2525 N2    ? ? 0 U   2495 0 G   2525 1_555 ? ? ? ? ? ? 'U-G MISPAIR' 
?     ? ? 
hydrog2409 hydrog ?    ? A  U   2495 N3    ? ? ? 1_555 A  U   2527 O4    ? ? 0 U   2495 0 U   2527 1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog2410 hydrog ?    ? A  U   2495 O2    ? ? ? 1_555 A  U   2527 N3    ? ? 0 U   2495 0 U   2527 1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog2411 hydrog ?    ? A  C   2496 N3    ? ? ? 1_555 A  G   2524 N1    ? ? 0 C   2496 0 G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2412 hydrog ?    ? A  C   2496 N4    ? ? ? 1_555 A  G   2524 O6    ? ? 0 C   2496 0 G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2413 hydrog ?    ? A  C   2496 O2    ? ? ? 1_555 A  G   2524 N2    ? ? 0 C   2496 0 G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2414 hydrog ?    ? A  A   2497 N1    ? ? ? 1_555 A  U   2523 N3    ? ? 0 A   2497 0 U   2523 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2415 hydrog ?    ? A  A   2497 N6    ? ? ? 1_555 A  U   2523 O4    ? ? 0 A   2497 0 U   2523 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2416 hydrog ?    ? A  C   2498 N3    ? ? ? 1_555 A  G   2522 N1    ? ? 0 C   2498 0 G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2417 hydrog ?    ? A  C   2498 N4    ? ? ? 1_555 A  G   2522 O6    ? ? 0 C   2498 0 G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2418 hydrog ?    ? A  C   2498 O2    ? ? ? 1_555 A  G   2522 N2    ? ? 0 C   2498 0 G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2419 hydrog ?    ? A  U   2499 N3    ? ? ? 1_555 A  A   2521 N1    ? ? 0 U   2499 0 A   2521 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2420 hydrog ?    ? A  U   2499 O4    ? ? ? 1_555 A  A   2521 N6    ? ? 0 U   2499 0 A   2521 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2421 hydrog ?    ? A  C   2500 N3    ? ? ? 1_555 A  G   2520 N1    ? ? 0 C   2500 0 G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2422 hydrog ?    ? A  C   2500 N4    ? ? ? 1_555 A  G   2520 O6    ? ? 0 C   2500 0 G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2423 hydrog ?    ? A  C   2500 O2    ? ? ? 1_555 A  G   2520 N2    ? ? 0 C   2500 0 G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2424 hydrog ?    ? A  G   2501 N1    ? ? ? 1_555 A  C   2519 N3    ? ? 0 G   2501 0 C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2425 hydrog ?    ? A  G   2501 N2    ? ? ? 1_555 A  C   2519 O2    ? ? 0 G   2501 0 C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2426 hydrog ?    ? A  G   2501 O6    ? ? ? 1_555 A  C   2519 N4    ? ? 0 G   2501 0 C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2427 hydrog ?    ? A  C   2502 O2    ? ? ? 1_555 A  C   2518 N4    ? ? 0 C   2502 0 C   2518 1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog2428 hydrog ?    ? A  A   2503 N3    ? ? ? 1_555 A  A   2517 N6    ? ? 0 A   2503 0 A   2517 1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog2429 hydrog ?    ? A  A   2504 N6    ? ? ? 1_555 A  G   2516 N3    ? ? 0 A   2504 0 G   2516 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2430 hydrog ?    ? A  A   2504 N7    ? ? ? 1_555 A  G   2516 N2    ? ? 0 A   2504 0 G   2516 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2431 hydrog ?    ? A  G   2505 N1    ? ? ? 1_555 A  C   2515 N3    ? ? 0 G   2505 0 C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2432 hydrog ?    ? A  G   2505 N2    ? ? ? 1_555 A  C   2515 O2    ? ? 0 G   2505 0 C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2433 hydrog ?    ? A  G   2505 O6    ? ? ? 1_555 A  C   2515 N4    ? ? 0 G   2505 0 C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2434 hydrog ?    ? A  A   2506 N1    ? ? ? 1_555 A  U   2514 N3    ? ? 0 A   2506 0 U   2514 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2435 hydrog ?    ? A  A   2506 N6    ? ? ? 1_555 A  U   2514 O4    ? ? 0 A   2506 0 U   2514 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2436 hydrog ?    ? A  G   2507 N2    ? ? ? 1_555 A  A   2513 N7    ? ? 0 G   2507 0 A   2513 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2437 hydrog ?    ? A  G   2507 N3    ? ? ? 1_555 A  A   2513 N6    ? ? 0 G   2507 0 A   2513 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2438 hydrog ?    ? A  G   2507 N2    ? ? ? 1_555 A  G   2564 O6    ? ? 0 G   2507 0 G   2564 1_555 ? ? ? ? ? ? 'G-G MISPAIR' 
?     ? ? 
hydrog2439 hydrog ?    ? A  C   2510 N3    ? ? ? 1_555 A  G   2564 N2    ? ? 0 C   2510 0 G   2564 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2440 hydrog ?    ? A  C   2510 O2    ? ? ? 1_555 A  G   2564 N1    ? ? 0 C   2510 0 G   2564 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2441 hydrog ?    ? A  G   2525 N2    ? ? ? 1_555 A  U   2527 O4    ? ? 0 G   2525 0 U   2527 1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog2442 hydrog ?    ? A  A   2532 N3    ? ? ? 1_555 A  C   2533 N4    ? ? 0 A   2532 0 C   2533 1_555 ? ? ? ? ? ? 'A-C MISPAIR' 
?     ? ? 
hydrog2443 hydrog ?    ? A  G   2540 N1    ? ? ? 1_555 A  U   2645 O2    ? ? 0 G   2540 0 U   2645 1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog2444 hydrog ?    ? A  U   2541 N3    ? ? ? 1_555 A  G   2618 O6    ? ? 0 U   2541 0 G   2618 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2445 hydrog ?    ? A  U   2541 O2    ? ? ? 1_555 A  G   2618 N1    ? ? 0 U   2541 0 G   2618 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2446 hydrog ?    ? A  C   2542 O2    ? ? ? 1_555 A  OMG 2588 N2    ? ? 0 C   2542 0 OMG 2588 1_555 ? ? ? ? ? ? 'C-OMG PAIR' 
?     ? ? 
hydrog2447 hydrog ?    ? A  C   2542 N3    ? ? ? 1_555 A  G   2617 N1    ? ? 0 C   2542 0 G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2448 hydrog ?    ? A  C   2542 N4    ? ? ? 1_555 A  G   2617 O6    ? ? 0 C   2542 0 G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2449 hydrog ?    ? A  C   2542 O2    ? ? ? 1_555 A  G   2617 N2    ? ? 0 C   2542 0 G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2450 hydrog ?    ? A  G   2543 N1    ? ? ? 1_555 A  U   2615 O2    ? ? 0 G   2543 0 U   2615 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2451 hydrog ?    ? A  G   2543 O6    ? ? ? 1_555 A  U   2615 N3    ? ? 0 G   2543 0 U   2615 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2452 hydrog ?    ? A  G   2544 N1    ? ? ? 1_555 A  C   2614 N3    ? ? 0 G   2544 0 C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2453 hydrog ?    ? A  G   2544 N2    ? ? ? 1_555 A  C   2614 O2    ? ? 0 G   2544 0 C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2454 hydrog ?    ? A  G   2544 O6    ? ? ? 1_555 A  C   2614 N4    ? ? 0 G   2544 0 C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2455 hydrog ?    ? A  U   2545 N3    ? ? ? 1_555 A  G   2613 O6    ? ? 0 U   2545 0 G   2613 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2456 hydrog ?    ? A  U   2545 O2    ? ? ? 1_555 A  G   2613 N1    ? ? 0 U   2545 0 G   2613 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2457 hydrog ?    ? A  U   2546 N3    ? ? ? 1_555 A  U   2610 O2    ? ? 0 U   2546 0 U   2610 1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog2458 hydrog ?    ? A  U   2546 O4    ? ? ? 1_555 A  U   2610 N3    ? ? 0 U   2546 0 U   2610 1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog2459 hydrog ?    ? A  C   2547 N3    ? ? ? 1_555 A  G   2609 N1    ? ? 0 C   2547 0 G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2460 hydrog ?    ? A  C   2547 N4    ? ? ? 1_555 A  G   2609 O6    ? ? 0 C   2547 0 G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2461 hydrog ?    ? A  C   2547 O2    ? ? ? 1_555 A  G   2609 N2    ? ? 0 C   2547 0 G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2462 hydrog ?    ? A  C   2548 N3    ? ? ? 1_555 A  G   2606 N1    ? ? 0 C   2548 0 G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2463 hydrog ?    ? A  C   2548 N4    ? ? ? 1_555 A  G   2606 O6    ? ? 0 C   2548 0 G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2464 hydrog ?    ? A  C   2548 O2    ? ? ? 1_555 A  G   2606 N2    ? ? 0 C   2548 0 G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2465 hydrog ?    ? A  C   2549 N3    ? ? ? 1_555 A  G   2605 N1    ? ? 0 C   2549 0 G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2466 hydrog ?    ? A  C   2549 N4    ? ? ? 1_555 A  G   2605 O6    ? ? 0 C   2549 0 G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2467 hydrog ?    ? A  C   2549 O2    ? ? ? 1_555 A  G   2605 N2    ? ? 0 C   2549 0 G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2468 hydrog ?    ? A  U   2550 N3    ? ? ? 1_555 A  A   2604 N1    ? ? 0 U   2550 0 A   2604 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2469 hydrog ?    ? A  U   2550 O4    ? ? ? 1_555 A  A   2604 N6    ? ? 0 U   2550 0 A   2604 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2470 hydrog ?    ? A  C   2551 N3    ? ? ? 1_555 A  G   2603 N1    ? ? 0 C   2551 0 G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2471 hydrog ?    ? A  C   2551 N4    ? ? ? 1_555 A  G   2603 O6    ? ? 0 C   2551 0 G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2472 hydrog ?    ? A  C   2551 O2    ? ? ? 1_555 A  G   2603 N2    ? ? 0 C   2551 0 G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2473 hydrog ?    ? A  C   2552 N3    ? ? ? 1_555 A  G   2602 N1    ? ? 0 C   2552 0 G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2474 hydrog ?    ? A  C   2552 N4    ? ? ? 1_555 A  G   2602 O6    ? ? 0 C   2552 0 G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2475 hydrog ?    ? A  C   2552 O2    ? ? ? 1_555 A  G   2602 N2    ? ? 0 C   2552 0 G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2476 hydrog ?    ? A  U   2554 O2    ? ? ? 1_555 A  C   2556 N4    ? ? 0 U   2554 0 C   2556 1_555 ? ? ? ? ? ? 'U-C MISPAIR' 
?     ? ? 
hydrog2477 hydrog ?    ? A  C   2555 N4    ? ? ? 1_555 A  A   2577 N1    ? ? 0 C   2555 0 A   2577 1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog2478 hydrog ?    ? A  C   2555 N3    ? ? ? 1_555 A  G   2580 N1    ? ? 0 C   2555 0 G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2479 hydrog ?    ? A  C   2555 N4    ? ? ? 1_555 A  G   2580 O6    ? ? 0 C   2555 0 G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2480 hydrog ?    ? A  C   2555 O2    ? ? ? 1_555 A  G   2580 N2    ? ? 0 C   2555 0 G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2481 hydrog ?    ? A  C   2556 N3    ? ? ? 1_555 A  G   2579 N1    ? ? 0 C   2556 0 G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2482 hydrog ?    ? A  C   2556 N4    ? ? ? 1_555 A  G   2579 O6    ? ? 0 C   2556 0 G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2483 hydrog ?    ? A  C   2556 O2    ? ? ? 1_555 A  G   2579 N2    ? ? 0 C   2556 0 G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2484 hydrog ?    ? A  U   2557 N3    ? ? ? 1_555 A  G   2578 O6    ? ? 0 U   2557 0 G   2578 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2485 hydrog ?    ? A  U   2557 O2    ? ? ? 1_555 A  G   2578 N1    ? ? 0 U   2557 0 G   2578 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2486 hydrog ?    ? A  G   2558 N1    ? ? ? 1_555 A  C   2575 N3    ? ? 0 G   2558 0 C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2487 hydrog ?    ? A  G   2558 N2    ? ? ? 1_555 A  C   2575 O2    ? ? 0 G   2558 0 C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2488 hydrog ?    ? A  G   2558 O6    ? ? ? 1_555 A  C   2575 N4    ? ? 0 G   2558 0 C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2489 hydrog ?    ? A  C   2559 N3    ? ? ? 1_555 A  G   2574 N1    ? ? 0 C   2559 0 G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2490 hydrog ?    ? A  C   2559 N4    ? ? ? 1_555 A  G   2574 O6    ? ? 0 C   2559 0 G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2491 hydrog ?    ? A  C   2559 O2    ? ? ? 1_555 A  G   2574 N2    ? ? 0 C   2559 0 G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2492 hydrog ?    ? A  C   2560 N3    ? ? ? 1_555 A  G   2573 N1    ? ? 0 C   2560 0 G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2493 hydrog ?    ? A  C   2560 N4    ? ? ? 1_555 A  G   2573 O6    ? ? 0 C   2560 0 G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2494 hydrog ?    ? A  C   2560 O2    ? ? ? 1_555 A  G   2573 N2    ? ? 0 C   2560 0 G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2495 hydrog ?    ? A  C   2561 N3    ? ? ? 1_555 A  G   2572 N1    ? ? 0 C   2561 0 G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2496 hydrog ?    ? A  C   2561 N4    ? ? ? 1_555 A  G   2572 O6    ? ? 0 C   2561 0 G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2497 hydrog ?    ? A  C   2561 O2    ? ? ? 1_555 A  G   2572 N2    ? ? 0 C   2561 0 G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2498 hydrog ?    ? A  G   2562 N1    ? ? ? 1_555 A  C   2571 N3    ? ? 0 G   2562 0 C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2499 hydrog ?    ? A  G   2562 N2    ? ? ? 1_555 A  C   2571 O2    ? ? 0 G   2562 0 C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2500 hydrog ?    ? A  G   2562 O6    ? ? ? 1_555 A  C   2571 N4    ? ? 0 G   2562 0 C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2501 hydrog ?    ? A  U   2563 N3    ? ? ? 1_555 A  G   2570 O6    ? ? 0 U   2563 0 G   2570 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2502 hydrog ?    ? A  U   2563 O2    ? ? ? 1_555 A  G   2570 N1    ? ? 0 U   2563 0 G   2570 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2503 hydrog ?    ? A  A   2566 N1    ? ? ? 1_555 A  A   2699 N6    ? ? 0 A   2566 0 A   2699 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? 
? ? 
hydrog2504 hydrog ?    ? A  A   2566 N6    ? ? ? 1_555 A  A   2699 N1    ? ? 0 A   2566 0 A   2699 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? 
? ? 
hydrog2505 hydrog ?    ? A  G   2567 N2    ? ? ? 1_555 A  G   2700 N3    ? ? 0 G   2567 0 G   2700 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? 
? ? 
hydrog2506 hydrog ?    ? A  G   2567 N3    ? ? ? 1_555 A  G   2700 N2    ? ? 0 G   2567 0 G   2700 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? 
? ? 
hydrog2507 hydrog ?    ? A  G   2574 N2    ? ? ? 1_555 A  A   2776 N3    ? ? 0 G   2574 0 A   2776 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog2508 hydrog ?    ? A  A   2576 N3    ? ? ? 1_555 A  A   2800 N6    ? ? 0 A   2576 0 A   2800 1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog2509 hydrog ?    ? A  G   2580 N2    ? ? ? 1_555 A  A   2600 N3    ? ? 0 G   2580 0 A   2600 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog2510 hydrog ?    ? A  U   2581 N3    ? ? ? 1_555 A  G   2602 N7    ? ? 0 U   2581 0 G   2602 1_555 ? ? ? ? ? ? 'U-G MISPAIR' 
?     ? ? 
hydrog2511 hydrog ?    ? A  G   2582 N1    ? ? ? 1_555 A  A   2596 N1    ? ? 0 G   2582 0 A   2596 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? 
? ? 
hydrog2512 hydrog ?    ? A  G   2582 O6    ? ? ? 1_555 A  A   2596 N6    ? ? 0 G   2582 0 A   2596 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? 
? ? 
hydrog2513 hydrog ?    ? A  A   2583 N1    ? ? ? 1_555 A  U   2595 N3    ? ? 0 A   2583 0 U   2595 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2514 hydrog ?    ? A  A   2583 N6    ? ? ? 1_555 A  U   2595 O4    ? ? 0 A   2583 0 U   2595 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2515 hydrog ?    ? A  G   2584 N1    ? ? ? 1_555 A  C   2594 N3    ? ? 0 G   2584 0 C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2516 hydrog ?    ? A  G   2584 N2    ? ? ? 1_555 A  C   2594 O2    ? ? 0 G   2584 0 C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2517 hydrog ?    ? A  G   2584 O6    ? ? ? 1_555 A  C   2594 N4    ? ? 0 G   2584 0 C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2518 hydrog ?    ? A  G   2585 N1    ? ? ? 1_555 A  C   2593 N3    ? ? 0 G   2585 0 C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2519 hydrog ?    ? A  G   2585 N2    ? ? ? 1_555 A  C   2593 O2    ? ? 0 G   2585 0 C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2520 hydrog ?    ? A  G   2585 O6    ? ? ? 1_555 A  C   2593 N4    ? ? 0 G   2585 0 C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2521 hydrog ?    ? A  U   2586 O4    ? ? ? 1_555 A  G   2592 N1    ? ? 0 U   2586 0 G   2592 1_555 ? ? ? ? ? ? 'U-G MISPAIR' 
?     ? ? 
hydrog2522 hydrog ?    ? A  OMU 2587 O2    ? ? ? 1_555 A  C   2591 N4    ? ? 0 OMU 2587 0 C   2591 1_555 ? ? ? ? ? ? 
'OMU-C MISPAIR'         ?     ? ? 
hydrog2523 hydrog ?    ? A  U   2597 N3    ? ? ? 1_555 A  A   2601 N7    ? ? 0 U   2597 0 A   2601 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2524 hydrog ?    ? A  U   2597 O2    ? ? ? 1_555 A  A   2601 N6    ? ? 0 U   2597 0 A   2601 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2525 hydrog ?    ? A  A   2622 N6    ? ? ? 1_555 A  G   2643 N3    ? ? 0 A   2622 0 G   2643 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2526 hydrog ?    ? A  A   2622 N7    ? ? ? 1_555 A  G   2643 N2    ? ? 0 A   2622 0 G   2643 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2527 hydrog ?    ? A  G   2623 N1    ? ? ? 1_555 A  C   2641 N3    ? ? 0 G   2623 0 C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2528 hydrog ?    ? A  G   2623 N2    ? ? ? 1_555 A  C   2641 O2    ? ? 0 G   2623 0 C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2529 hydrog ?    ? A  G   2623 O6    ? ? ? 1_555 A  C   2641 N4    ? ? 0 G   2623 0 C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2530 hydrog ?    ? A  A   2624 N1    ? ? ? 1_555 A  U   2640 N3    ? ? 0 A   2624 0 U   2640 1_555 ? ? ? ? ? ? 'A-U PAIR' ? 
? ? 
hydrog2531 hydrog ?    ? A  C   2625 N3    ? ? ? 1_555 A  G   2639 N1    ? ? 0 C   2625 0 G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2532 hydrog ?    ? A  C   2625 N4    ? ? ? 1_555 A  G   2639 O6    ? ? 0 C   2625 0 G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2533 hydrog ?    ? A  C   2625 O2    ? ? ? 1_555 A  G   2639 N2    ? ? 0 C   2625 0 G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2534 hydrog ?    ? A  C   2626 N3    ? ? ? 1_555 A  G   2638 N1    ? ? 0 C   2626 0 G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2535 hydrog ?    ? A  C   2626 N4    ? ? ? 1_555 A  G   2638 O6    ? ? 0 C   2626 0 G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2536 hydrog ?    ? A  C   2626 O2    ? ? ? 1_555 A  G   2638 N2    ? ? 0 C   2626 0 G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2537 hydrog ?    ? A  G   2627 N1    ? ? ? 1_555 A  C   2636 N3    ? ? 0 G   2627 0 C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2538 hydrog ?    ? A  G   2627 N2    ? ? ? 1_555 A  C   2636 O2    ? ? 0 G   2627 0 C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2539 hydrog ?    ? A  G   2627 O6    ? ? ? 1_555 A  C   2636 N4    ? ? 0 G   2627 0 C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2540 hydrog ?    ? A  U   2628 N3    ? ? ? 1_555 A  A   2635 N1    ? ? 0 U   2628 0 A   2635 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2541 hydrog ?    ? A  U   2628 O4    ? ? ? 1_555 A  A   2635 N6    ? ? 0 U   2628 0 A   2635 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2542 hydrog ?    ? A  C   2629 N3    ? ? ? 1_555 A  G   2634 N1    ? ? 0 C   2629 0 G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2543 hydrog ?    ? A  C   2629 N4    ? ? ? 1_555 A  G   2634 O6    ? ? 0 C   2629 0 G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2544 hydrog ?    ? A  C   2629 O2    ? ? ? 1_555 A  G   2634 N2    ? ? 0 C   2629 0 G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2545 hydrog ?    ? A  G   2630 N2    ? ? ? 1_555 A  A   2633 N7    ? ? 0 G   2630 0 A   2633 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog2546 hydrog ?    ? A  A   2649 N3    ? ? ? 1_555 A  C   2651 N4    ? ? 0 A   2649 0 C   2651 1_555 ? ? ? ? ? ? 'A-C MISPAIR' 
?     ? ? 
hydrog2547 hydrog ?    ? A  G   2657 N2    ? ? ? 1_555 A  A   2841 N1    ? ? 0 G   2657 0 A   2841 1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog2548 hydrog ?    ? A  G   2657 N3    ? ? ? 1_555 A  A   2841 N6    ? ? 0 G   2657 0 A   2841 1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog2549 hydrog ?    ? A  U   2661 O2    ? ? ? 1_555 A  A   2812 N6    ? ? 0 U   2661 0 A   2812 1_555 ? ? ? ? ? ? 'U-A PAIR' ? 
? ? 
hydrog2550 hydrog ?    ? A  G   2662 N2    ? ? ? 1_555 A  A   2816 N3    ? ? 0 G   2662 0 A   2816 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog2551 hydrog ?    ? A  G   2667 N1    ? ? ? 1_555 A  C   2822 N3    ? ? 0 G   2667 0 C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2552 hydrog ?    ? A  G   2667 N2    ? ? ? 1_555 A  C   2822 O2    ? ? 0 G   2667 0 C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2553 hydrog ?    ? A  G   2667 O6    ? ? ? 1_555 A  C   2822 N4    ? ? 0 G   2667 0 C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2554 hydrog ?    ? A  G   2667 N2    ? ? ? 1_555 A  A   2827 N3    ? ? 0 G   2667 0 A   2827 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog2555 hydrog ?    ? A  G   2668 N1    ? ? ? 1_555 A  C   2821 N3    ? ? 0 G   2668 0 C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2556 hydrog ?    ? A  G   2668 N2    ? ? ? 1_555 A  C   2821 O2    ? ? 0 G   2668 0 C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2557 hydrog ?    ? A  G   2668 O6    ? ? ? 1_555 A  C   2821 N4    ? ? 0 G   2668 0 C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2558 hydrog ?    ? A  U   2669 N3    ? ? ? 1_555 A  A   2820 N1    ? ? 0 U   2669 0 A   2820 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2559 hydrog ?    ? A  U   2669 O4    ? ? ? 1_555 A  A   2820 N6    ? ? 0 U   2669 0 A   2820 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2560 hydrog ?    ? A  G   2670 N1    ? ? ? 1_555 A  C   2819 N3    ? ? 0 G   2670 0 C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2561 hydrog ?    ? A  G   2670 N2    ? ? ? 1_555 A  C   2819 O2    ? ? 0 G   2670 0 C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2562 hydrog ?    ? A  G   2670 O6    ? ? ? 1_555 A  C   2819 N4    ? ? 0 G   2670 0 C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2563 hydrog ?    ? A  U   2671 N3    ? ? ? 1_555 A  A   2818 N1    ? ? 0 U   2671 0 A   2818 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2564 hydrog ?    ? A  U   2671 O4    ? ? ? 1_555 A  A   2818 N6    ? ? 0 U   2671 0 A   2818 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2565 hydrog ?    ? A  C   2672 N3    ? ? ? 1_555 A  G   2817 N1    ? ? 0 C   2672 0 G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2566 hydrog ?    ? A  C   2672 N4    ? ? ? 1_555 A  G   2817 O6    ? ? 0 C   2672 0 G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2567 hydrog ?    ? A  C   2672 O2    ? ? ? 1_555 A  G   2817 N2    ? ? 0 C   2672 0 G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2568 hydrog ?    ? A  U   2673 N3    ? ? ? 1_555 A  A   2811 N7    ? ? 0 U   2673 0 A   2811 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2569 hydrog ?    ? A  U   2673 O2    ? ? ? 1_555 A  A   2811 N6    ? ? 0 U   2673 0 A   2811 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2570 hydrog ?    ? A  G   2674 N2    ? ? ? 1_555 A  A   2813 N7    ? ? 0 G   2674 0 A   2813 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2571 hydrog ?    ? A  G   2674 N3    ? ? ? 1_555 A  A   2813 N6    ? ? 0 G   2674 0 A   2813 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2572 hydrog ?    ? A  A   2675 N6    ? ? ? 1_555 A  G   2810 N3    ? ? 0 A   2675 0 G   2810 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2573 hydrog ?    ? A  A   2675 N7    ? ? ? 1_555 A  G   2810 N2    ? ? 0 A   2675 0 G   2810 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2574 hydrog ?    ? A  C   2676 N3    ? ? ? 1_555 A  G   2809 N1    ? ? 0 C   2676 0 G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2575 hydrog ?    ? A  C   2676 N4    ? ? ? 1_555 A  G   2809 O6    ? ? 0 C   2676 0 G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2576 hydrog ?    ? A  C   2676 O2    ? ? ? 1_555 A  G   2809 N2    ? ? 0 C   2676 0 G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2577 hydrog ?    ? A  A   2677 N1    ? ? ? 1_555 A  U   2808 N3    ? ? 0 A   2677 0 U   2808 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2578 hydrog ?    ? A  A   2677 N6    ? ? ? 1_555 A  U   2808 O4    ? ? 0 A   2677 0 U   2808 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2579 hydrog ?    ? A  A   2678 N1    ? ? ? 1_555 A  U   2807 N3    ? ? 0 A   2678 0 U   2807 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2580 hydrog ?    ? A  A   2678 N6    ? ? ? 1_555 A  U   2807 O4    ? ? 0 A   2678 0 U   2807 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2581 hydrog ?    ? A  G   2679 N1    ? ? ? 1_555 A  C   2806 N3    ? ? 0 G   2679 0 C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2582 hydrog ?    ? A  G   2679 N2    ? ? ? 1_555 A  C   2806 O2    ? ? 0 G   2679 0 C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2583 hydrog ?    ? A  G   2679 O6    ? ? ? 1_555 A  C   2806 N4    ? ? 0 G   2679 0 C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2584 hydrog ?    ? A  A   2680 N1    ? ? ? 1_555 A  G   2712 N2    ? ? 0 A   2680 0 G   2712 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog2585 hydrog ?    ? A  C   2682 N3    ? ? ? 1_555 A  G   2712 N1    ? ? 0 C   2682 0 G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2586 hydrog ?    ? A  C   2682 N4    ? ? ? 1_555 A  G   2712 O6    ? ? 0 C   2682 0 G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2587 hydrog ?    ? A  C   2682 O2    ? ? ? 1_555 A  G   2712 N2    ? ? 0 C   2682 0 G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2588 hydrog ?    ? A  G   2683 N1    ? ? ? 1_555 A  U   2711 O2    ? ? 0 G   2683 0 U   2711 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2589 hydrog ?    ? A  G   2683 O6    ? ? ? 1_555 A  U   2711 N3    ? ? 0 G   2683 0 U   2711 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2590 hydrog ?    ? A  A   2684 N1    ? ? ? 1_555 A  U   2710 N3    ? ? 0 A   2684 0 U   2710 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2591 hydrog ?    ? A  A   2684 N6    ? ? ? 1_555 A  U   2710 O4    ? ? 0 A   2684 0 U   2710 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2592 hydrog ?    ? A  C   2685 N3    ? ? ? 1_555 A  G   2709 N1    ? ? 0 C   2685 0 G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2593 hydrog ?    ? A  C   2685 N4    ? ? ? 1_555 A  G   2709 O6    ? ? 0 C   2685 0 G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2594 hydrog ?    ? A  C   2685 O2    ? ? ? 1_555 A  G   2709 N2    ? ? 0 C   2685 0 G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2595 hydrog ?    ? A  C   2686 N3    ? ? ? 1_555 A  G   2708 N1    ? ? 0 C   2686 0 G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2596 hydrog ?    ? A  C   2686 N4    ? ? ? 1_555 A  G   2708 O6    ? ? 0 C   2686 0 G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2597 hydrog ?    ? A  C   2686 O2    ? ? ? 1_555 A  G   2708 N2    ? ? 0 C   2686 0 G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2598 hydrog ?    ? A  G   2687 N1    ? ? ? 1_555 A  C   2707 N3    ? ? 0 G   2687 0 C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2599 hydrog ?    ? A  G   2687 N2    ? ? ? 1_555 A  C   2707 O2    ? ? 0 G   2687 0 C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2600 hydrog ?    ? A  G   2687 O6    ? ? ? 1_555 A  C   2707 N4    ? ? 0 G   2687 0 C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2601 hydrog ?    ? A  U   2688 N3    ? ? ? 1_555 A  A   2706 N1    ? ? 0 U   2688 0 A   2706 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2602 hydrog ?    ? A  U   2688 O4    ? ? ? 1_555 A  A   2706 N6    ? ? 0 U   2688 0 A   2706 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2603 hydrog ?    ? A  A   2689 N1    ? ? ? 1_555 A  U   2705 N3    ? ? 0 A   2689 0 U   2705 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2604 hydrog ?    ? A  A   2689 N6    ? ? ? 1_555 A  U   2705 O4    ? ? 0 A   2689 0 U   2705 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2605 hydrog ?    ? A  U   2690 O2    ? ? ? 1_555 A  C   2704 N4    ? ? 0 U   2690 0 C   2704 1_555 ? ? ? ? ? ? 'U-C MISPAIR' 
?     ? ? 
hydrog2606 hydrog ?    ? A  A   2691 N6    ? ? ? 1_555 A  A   2703 N7    ? ? 0 A   2691 0 A   2703 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog2607 hydrog ?    ? A  A   2691 N7    ? ? ? 1_555 A  A   2703 N6    ? ? 0 A   2691 0 A   2703 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog2608 hydrog ?    ? A  G   2692 N2    ? ? ? 1_555 A  U   2693 O4    ? ? 0 G   2692 0 U   2693 1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog2609 hydrog ?    ? A  U   2693 N3    ? ? ? 1_555 A  A   2702 N7    ? ? 0 U   2693 0 A   2702 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2610 hydrog ?    ? A  U   2693 O2    ? ? ? 1_555 A  A   2702 N6    ? ? 0 U   2693 0 A   2702 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2611 hydrog ?    ? A  A   2694 N6    ? ? ? 1_555 A  G   2701 N3    ? ? 0 A   2694 0 G   2701 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2612 hydrog ?    ? A  A   2694 N7    ? ? ? 1_555 A  G   2701 N2    ? ? 0 A   2694 0 G   2701 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2613 hydrog ?    ? A  C   2695 N3    ? ? ? 1_555 A  G   2700 N1    ? ? 0 C   2695 0 G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2614 hydrog ?    ? A  C   2695 N4    ? ? ? 1_555 A  G   2700 O6    ? ? 0 C   2695 0 G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2615 hydrog ?    ? A  C   2695 O2    ? ? ? 1_555 A  G   2700 N2    ? ? 0 C   2695 0 G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2616 hydrog ?    ? A  G   2696 N2    ? ? ? 1_555 A  A   2699 N7    ? ? 0 G   2696 0 A   2699 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog2617 hydrog ?    ? A  G   2713 N1    ? ? ? 1_555 A  C   2767 N3    ? ? 0 G   2713 0 C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2618 hydrog ?    ? A  G   2713 N2    ? ? ? 1_555 A  C   2767 O2    ? ? 0 G   2713 0 C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2619 hydrog ?    ? A  G   2713 O6    ? ? ? 1_555 A  C   2767 N4    ? ? 0 G   2713 0 C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2620 hydrog ?    ? A  U   2714 N3    ? ? ? 1_555 A  A   2766 N1    ? ? 0 U   2714 0 A   2766 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2621 hydrog ?    ? A  U   2714 O4    ? ? ? 1_555 A  A   2766 N6    ? ? 0 U   2714 0 A   2766 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2622 hydrog ?    ? A  G   2715 N1    ? ? ? 1_555 A  C   2765 N3    ? ? 0 G   2715 0 C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2623 hydrog ?    ? A  G   2715 N2    ? ? ? 1_555 A  C   2765 O2    ? ? 0 G   2715 0 C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2624 hydrog ?    ? A  G   2715 O6    ? ? ? 1_555 A  C   2765 N4    ? ? 0 G   2715 0 C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2625 hydrog ?    ? A  G   2716 N1    ? ? ? 1_555 A  C   2764 N3    ? ? 0 G   2716 0 C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2626 hydrog ?    ? A  G   2716 N2    ? ? ? 1_555 A  C   2764 O2    ? ? 0 G   2716 0 C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2627 hydrog ?    ? A  G   2716 O6    ? ? ? 1_555 A  C   2764 N4    ? ? 0 G   2716 0 C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2628 hydrog ?    ? A  C   2717 N3    ? ? ? 1_555 A  G   2763 N1    ? ? 0 C   2717 0 G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2629 hydrog ?    ? A  C   2717 N4    ? ? ? 1_555 A  G   2763 O6    ? ? 0 C   2717 0 G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2630 hydrog ?    ? A  C   2717 O2    ? ? ? 1_555 A  G   2763 N2    ? ? 0 C   2717 0 G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2631 hydrog ?    ? A  C   2718 N3    ? ? ? 1_555 A  A   2761 N6    ? ? 0 C   2718 0 A   2761 1_555 ? ? ? ? ? ? TYPE_25_PAIR 
?     ? ? 
hydrog2632 hydrog ?    ? A  C   2718 N4    ? ? ? 1_555 A  A   2761 N7    ? ? 0 C   2718 0 A   2761 1_555 ? ? ? ? ? ? TYPE_25_PAIR 
?     ? ? 
hydrog2633 hydrog ?    ? A  C   2720 N4    ? ? ? 1_555 A  G   2763 N3    ? ? 0 C   2720 0 G   2763 1_555 ? ? ? ? ? ? 'C-G PAIR' ? 
? ? 
hydrog2634 hydrog ?    ? A  U   2721 N3    ? ? ? 1_555 A  A   2761 N1    ? ? 0 U   2721 0 A   2761 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2635 hydrog ?    ? A  U   2721 O4    ? ? ? 1_555 A  A   2761 N6    ? ? 0 U   2721 0 A   2761 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2636 hydrog ?    ? A  G   2722 N1    ? ? ? 1_555 A  C   2760 N3    ? ? 0 G   2722 0 C   2760 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2637 hydrog ?    ? A  G   2722 N2    ? ? ? 1_555 A  C   2760 O2    ? ? 0 G   2722 0 C   2760 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2638 hydrog ?    ? A  G   2722 O6    ? ? ? 1_555 A  C   2760 N4    ? ? 0 G   2722 0 C   2760 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2639 hydrog ?    ? A  G   2723 N1    ? ? ? 1_555 A  C   2759 N3    ? ? 0 G   2723 0 C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2640 hydrog ?    ? A  G   2723 N2    ? ? ? 1_555 A  C   2759 O2    ? ? 0 G   2723 0 C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2641 hydrog ?    ? A  G   2723 O6    ? ? ? 1_555 A  C   2759 N4    ? ? 0 G   2723 0 C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2642 hydrog ?    ? A  U   2724 N3    ? ? ? 1_555 A  G   2758 O6    ? ? 0 U   2724 0 G   2758 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2643 hydrog ?    ? A  U   2724 O2    ? ? ? 1_555 A  G   2758 N1    ? ? 0 U   2724 0 G   2758 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2644 hydrog ?    ? A  G   2725 N2    ? ? ? 1_555 A  A   2757 N7    ? ? 0 G   2725 0 A   2757 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2645 hydrog ?    ? A  G   2725 N3    ? ? ? 1_555 A  A   2757 N6    ? ? 0 G   2725 0 A   2757 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2646 hydrog ?    ? A  A   2727 N7    ? ? ? 1_555 A  G   2755 N2    ? ? 0 A   2727 0 G   2755 1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog2647 hydrog ?    ? A  C   2728 N3    ? ? ? 1_555 A  G   2754 N1    ? ? 0 C   2728 0 G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2648 hydrog ?    ? A  C   2728 N4    ? ? ? 1_555 A  G   2754 O6    ? ? 0 C   2728 0 G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2649 hydrog ?    ? A  C   2728 O2    ? ? ? 1_555 A  G   2754 N2    ? ? 0 C   2728 0 G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2650 hydrog ?    ? A  C   2729 N3    ? ? ? 1_555 A  G   2753 N1    ? ? 0 C   2729 0 G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2651 hydrog ?    ? A  C   2729 N4    ? ? ? 1_555 A  G   2753 O6    ? ? 0 C   2729 0 G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2652 hydrog ?    ? A  C   2729 O2    ? ? ? 1_555 A  G   2753 N2    ? ? 0 C   2729 0 G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2653 hydrog ?    ? A  G   2730 N1    ? ? ? 1_555 A  C   2752 N3    ? ? 0 G   2730 0 C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2654 hydrog ?    ? A  G   2730 N2    ? ? ? 1_555 A  C   2752 O2    ? ? 0 G   2730 0 C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2655 hydrog ?    ? A  G   2730 O6    ? ? ? 1_555 A  C   2752 N4    ? ? 0 G   2730 0 C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2656 hydrog ?    ? A  G   2731 N1    ? ? ? 1_555 A  C   2751 N3    ? ? 0 G   2731 0 C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2657 hydrog ?    ? A  G   2731 N2    ? ? ? 1_555 A  C   2751 O2    ? ? 0 G   2731 0 C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2658 hydrog ?    ? A  G   2731 O6    ? ? ? 1_555 A  C   2751 N4    ? ? 0 G   2731 0 C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2659 hydrog ?    ? A  U   2732 N3    ? ? ? 1_555 A  G   2750 O6    ? ? 0 U   2732 0 G   2750 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2660 hydrog ?    ? A  U   2732 O2    ? ? ? 1_555 A  G   2750 N1    ? ? 0 U   2732 0 G   2750 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2661 hydrog ?    ? A  U   2733 N3    ? ? ? 1_555 A  A   2746 N1    ? ? 0 U   2733 0 A   2746 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2662 hydrog ?    ? A  U   2733 O4    ? ? ? 1_555 A  A   2746 N6    ? ? 0 U   2733 0 A   2746 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2663 hydrog ?    ? A  G   2734 N1    ? ? ? 1_555 A  C   2745 N3    ? ? 0 G   2734 0 C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2664 hydrog ?    ? A  G   2734 N2    ? ? ? 1_555 A  C   2745 O2    ? ? 0 G   2734 0 C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2665 hydrog ?    ? A  G   2734 O6    ? ? ? 1_555 A  C   2745 N4    ? ? 0 G   2734 0 C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2666 hydrog ?    ? A  U   2735 N3    ? ? ? 1_555 A  G   2744 O6    ? ? 0 U   2735 0 G   2744 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2667 hydrog ?    ? A  U   2735 O2    ? ? ? 1_555 A  G   2744 N1    ? ? 0 U   2735 0 G   2744 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2668 hydrog ?    ? A  U   2736 N3    ? ? ? 1_555 A  A   2743 N1    ? ? 0 U   2736 0 A   2743 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2669 hydrog ?    ? A  U   2736 O4    ? ? ? 1_555 A  A   2743 N6    ? ? 0 U   2736 0 A   2743 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2670 hydrog ?    ? A  C   2737 N3    ? ? ? 1_555 A  G   2742 N1    ? ? 0 C   2737 0 G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2671 hydrog ?    ? A  C   2737 N4    ? ? ? 1_555 A  G   2742 O6    ? ? 0 C   2737 0 G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2672 hydrog ?    ? A  C   2737 O2    ? ? ? 1_555 A  G   2742 N2    ? ? 0 C   2737 0 G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2673 hydrog ?    ? A  U   2756 N3    ? ? ? 1_555 A  A   2896 N1    ? ? 0 U   2756 0 A   2896 1_555 ? ? ? ? ? ? 'U-A PAIR' ? 
? ? 
hydrog2674 hydrog ?    ? A  C   2769 N4    ? ? ? 1_555 A  A   2805 N3    ? ? 0 C   2769 0 A   2805 1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog2675 hydrog ?    ? A  G   2770 N1    ? ? ? 1_555 A  C   2804 N3    ? ? 0 G   2770 0 C   2804 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2676 hydrog ?    ? A  G   2770 N2    ? ? ? 1_555 A  C   2804 O2    ? ? 0 G   2770 0 C   2804 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2677 hydrog ?    ? A  G   2770 O6    ? ? ? 1_555 A  C   2804 N4    ? ? 0 G   2770 0 C   2804 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2678 hydrog ?    ? A  G   2771 N1    ? ? ? 1_555 A  C   2803 N3    ? ? 0 G   2771 0 C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2679 hydrog ?    ? A  G   2771 N2    ? ? ? 1_555 A  C   2803 O2    ? ? 0 G   2771 0 C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2680 hydrog ?    ? A  G   2771 O6    ? ? ? 1_555 A  C   2803 N4    ? ? 0 G   2771 0 C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2681 hydrog ?    ? A  G   2772 N1    ? ? ? 1_555 A  C   2802 N3    ? ? 0 G   2772 0 C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2682 hydrog ?    ? A  G   2772 N2    ? ? ? 1_555 A  C   2802 O2    ? ? 0 G   2772 0 C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2683 hydrog ?    ? A  G   2772 O6    ? ? ? 1_555 A  C   2802 N4    ? ? 0 G   2772 0 C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2684 hydrog ?    ? A  G   2773 N1    ? ? ? 1_555 A  A   2801 N1    ? ? 0 G   2773 0 A   2801 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? 
? ? 
hydrog2685 hydrog ?    ? A  G   2773 O6    ? ? ? 1_555 A  A   2801 N6    ? ? 0 G   2773 0 A   2801 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? 
? ? 
hydrog2686 hydrog ?    ? A  U   2774 N3    ? ? ? 1_555 A  A   2799 N7    ? ? 0 U   2774 0 A   2799 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2687 hydrog ?    ? A  U   2774 O2    ? ? ? 1_555 A  A   2799 N6    ? ? 0 U   2774 0 A   2799 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2688 hydrog ?    ? A  A   2776 N6    ? ? ? 1_555 A  G   2798 N3    ? ? 0 A   2776 0 G   2798 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2689 hydrog ?    ? A  A   2776 N7    ? ? ? 1_555 A  G   2798 N2    ? ? 0 A   2776 0 G   2798 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2690 hydrog ?    ? A  G   2777 N1    ? ? ? 1_555 A  C   2797 N3    ? ? 0 G   2777 0 C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2691 hydrog ?    ? A  G   2777 N2    ? ? ? 1_555 A  C   2797 O2    ? ? 0 G   2777 0 C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2692 hydrog ?    ? A  G   2777 O6    ? ? ? 1_555 A  C   2797 N4    ? ? 0 G   2777 0 C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2693 hydrog ?    ? A  A   2778 N1    ? ? ? 1_555 A  U   2796 N3    ? ? 0 A   2778 0 U   2796 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2694 hydrog ?    ? A  A   2778 N6    ? ? ? 1_555 A  U   2796 O4    ? ? 0 A   2778 0 U   2796 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2695 hydrog ?    ? A  G   2779 N1    ? ? ? 1_555 A  C   2795 N3    ? ? 0 G   2779 0 C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2696 hydrog ?    ? A  G   2779 N2    ? ? ? 1_555 A  C   2795 O2    ? ? 0 G   2779 0 C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2697 hydrog ?    ? A  G   2779 O6    ? ? ? 1_555 A  C   2795 N4    ? ? 0 G   2779 0 C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2698 hydrog ?    ? A  C   2780 N3    ? ? ? 1_555 A  G   2794 N1    ? ? 0 C   2780 0 G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2699 hydrog ?    ? A  C   2780 N4    ? ? ? 1_555 A  G   2794 O6    ? ? 0 C   2780 0 G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2700 hydrog ?    ? A  C   2780 O2    ? ? ? 1_555 A  G   2794 N2    ? ? 0 C   2780 0 G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2701 hydrog ?    ? A  U   2781 N3    ? ? ? 1_555 A  U   2791 O4    ? ? 0 U   2781 0 U   2791 1_555 ? ? ? ? ? ? 'U-U MISPAIR' 
?     ? ? 
hydrog2702 hydrog ?    ? A  U   2781 O2    ? ? ? 1_555 A  A   2793 N6    ? ? 0 U   2781 0 A   2793 1_555 ? ? ? ? ? ? 'U-A PAIR' ? 
? ? 
hydrog2703 hydrog ?    ? A  G   2782 N2    ? ? ? 1_555 A  A   2792 N7    ? ? 0 G   2782 0 A   2792 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2704 hydrog ?    ? A  G   2782 N3    ? ? ? 1_555 A  A   2792 N6    ? ? 0 G   2782 0 A   2792 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2705 hydrog ?    ? A  A   2783 N6    ? ? ? 1_555 A  U   2789 O2    ? ? 0 A   2783 0 U   2789 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2706 hydrog ?    ? A  A   2783 N7    ? ? ? 1_555 A  U   2789 N3    ? ? 0 A   2783 0 U   2789 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2707 hydrog ?    ? A  A   2784 N6    ? ? ? 1_555 A  A   2788 N1    ? ? 0 A   2784 0 A   2788 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? 
? ? 
hydrog2708 hydrog ?    ? A  A   2784 N7    ? ? ? 1_555 A  A   2788 N6    ? ? 0 A   2784 0 A   2788 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? 
? ? 
hydrog2709 hydrog ?    ? A  C   2785 O2    ? ? ? 1_555 A  C   2787 N4    ? ? 0 C   2785 0 C   2787 1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog2710 hydrog ?    ? A  U   2791 N3    ? ? ? 1_555 A  A   2793 N7    ? ? 0 U   2791 0 A   2793 1_555 ? ? ? ? ? ? HOOGSTEEN ? ? 
? 
hydrog2711 hydrog ?    ? A  U   2791 O4    ? ? ? 1_555 A  A   2793 N6    ? ? 0 U   2791 0 A   2793 1_555 ? ? ? ? ? ? HOOGSTEEN ? ? 
? 
hydrog2712 hydrog ?    ? A  A   2812 N1    ? ? ? 1_555 A  A   2814 N6    ? ? 0 A   2812 0 A   2814 1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog2713 hydrog ?    ? A  G   2823 N2    ? ? ? 1_555 A  A   2914 N3    ? ? 0 G   2823 0 A   2914 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog2714 hydrog ?    ? A  G   2826 N2    ? ? ? 1_555 A  A   2914 N7    ? ? 0 G   2826 0 A   2914 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog2715 hydrog ?    ? A  A   2827 N6    ? ? ? 1_555 A  A   2913 N3    ? ? 0 A   2827 0 A   2913 1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog2716 hydrog ?    ? A  G   2828 N1    ? ? ? 1_555 A  C   2912 N3    ? ? 0 G   2828 0 C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2717 hydrog ?    ? A  G   2828 N2    ? ? ? 1_555 A  C   2912 O2    ? ? 0 G   2828 0 C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2718 hydrog ?    ? A  G   2828 O6    ? ? ? 1_555 A  C   2912 N4    ? ? 0 G   2828 0 C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2719 hydrog ?    ? A  G   2829 N1    ? ? ? 1_555 A  C   2911 O2    ? ? 0 G   2829 0 C   2911 1_555 ? ? ? ? ? ? 'G-C PAIR' ? 
? ? 
hydrog2720 hydrog ?    ? A  U   2830 N3    ? ? ? 1_555 A  A   2910 N1    ? ? 0 U   2830 0 A   2910 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2721 hydrog ?    ? A  U   2830 O4    ? ? ? 1_555 A  A   2910 N6    ? ? 0 U   2830 0 A   2910 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2722 hydrog ?    ? A  C   2831 O2    ? ? ? 1_555 A  G   2909 N2    ? ? 0 C   2831 0 G   2909 1_555 ? ? ? ? ? ? 'C-G PAIR' ? 
? ? 
hydrog2723 hydrog ?    ? A  C   2832 N3    ? ? ? 1_555 A  G   2848 N1    ? ? 0 C   2832 0 G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2724 hydrog ?    ? A  C   2832 N4    ? ? ? 1_555 A  G   2848 O6    ? ? 0 C   2832 0 G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2725 hydrog ?    ? A  C   2832 O2    ? ? ? 1_555 A  G   2848 N2    ? ? 0 C   2832 0 G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2726 hydrog ?    ? A  C   2832 O2    ? ? ? 1_555 A  A   2908 N6    ? ? 0 C   2832 0 A   2908 1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog2727 hydrog ?    ? A  C   2833 N3    ? ? ? 1_555 A  G   2847 N1    ? ? 0 C   2833 0 G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2728 hydrog ?    ? A  C   2833 N4    ? ? ? 1_555 A  G   2847 O6    ? ? 0 C   2833 0 G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2729 hydrog ?    ? A  C   2833 O2    ? ? ? 1_555 A  G   2847 N2    ? ? 0 C   2833 0 G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2730 hydrog ?    ? A  G   2834 N1    ? ? ? 1_555 A  C   2846 N3    ? ? 0 G   2834 0 C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2731 hydrog ?    ? A  G   2834 N2    ? ? ? 1_555 A  C   2846 O2    ? ? 0 G   2834 0 C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2732 hydrog ?    ? A  G   2834 O6    ? ? ? 1_555 A  C   2846 N4    ? ? 0 G   2834 0 C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2733 hydrog ?    ? A  C   2835 N3    ? ? ? 1_555 A  G   2845 N1    ? ? 0 C   2835 0 G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2734 hydrog ?    ? A  C   2835 N4    ? ? ? 1_555 A  G   2845 O6    ? ? 0 C   2835 0 G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2735 hydrog ?    ? A  C   2835 O2    ? ? ? 1_555 A  G   2845 N2    ? ? 0 C   2835 0 G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2736 hydrog ?    ? A  G   2836 N1    ? ? ? 1_555 A  C   2844 N3    ? ? 0 G   2836 0 C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2737 hydrog ?    ? A  G   2836 N2    ? ? ? 1_555 A  C   2844 O2    ? ? 0 G   2836 0 C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2738 hydrog ?    ? A  G   2836 O6    ? ? ? 1_555 A  C   2844 N4    ? ? 0 G   2836 0 C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2739 hydrog ?    ? A  A   2838 N3    ? ? ? 1_555 A  A   2843 N6    ? ? 0 A   2838 0 A   2843 1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog2740 hydrog ?    ? A  G   2847 N2    ? ? ? 1_555 A  A   2906 N3    ? ? 0 G   2847 0 A   2906 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog2741 hydrog ?    ? A  G   2851 N2    ? ? ? 1_555 A  A   2906 N7    ? ? 0 G   2851 0 A   2906 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2742 hydrog ?    ? A  G   2851 N3    ? ? ? 1_555 A  A   2906 N6    ? ? 0 G   2851 0 A   2906 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2743 hydrog ?    ? A  A   2852 N1    ? ? ? 1_555 A  C   2903 N4    ? ? 0 A   2852 0 C   2903 1_555 ? ? ? ? ? ? 'A-C MISPAIR' 
?     ? ? 
hydrog2744 hydrog ?    ? A  U   2853 O4    ? ? ? 1_555 A  A   2902 N6    ? ? 0 U   2853 0 A   2902 1_555 ? ? ? ? ? ? 'U-A PAIR' ? 
? ? 
hydrog2745 hydrog ?    ? A  U   2853 N3    ? ? ? 1_555 A  A   2905 N1    ? ? 0 U   2853 0 A   2905 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2746 hydrog ?    ? A  U   2853 O4    ? ? ? 1_555 A  A   2905 N6    ? ? 0 U   2853 0 A   2905 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2747 hydrog ?    ? A  A   2854 N1    ? ? ? 1_555 A  U   2904 N3    ? ? 0 A   2854 0 U   2904 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2748 hydrog ?    ? A  A   2854 N6    ? ? ? 1_555 A  U   2904 O4    ? ? 0 A   2854 0 U   2904 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2749 hydrog ?    ? A  G   2855 N1    ? ? ? 1_555 A  C   2903 N3    ? ? 0 G   2855 0 C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2750 hydrog ?    ? A  G   2855 N2    ? ? ? 1_555 A  C   2903 O2    ? ? 0 G   2855 0 C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2751 hydrog ?    ? A  G   2855 O6    ? ? ? 1_555 A  C   2903 N4    ? ? 0 G   2855 0 C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2752 hydrog ?    ? A  A   2856 N6    ? ? ? 1_555 A  C   2901 O2    ? ? 0 A   2856 0 C   2901 1_555 ? ? ? ? ? ? 'A-C MISPAIR' 
?     ? ? 
hydrog2753 hydrog ?    ? A  C   2857 N3    ? ? ? 1_555 A  G   2900 N1    ? ? 0 C   2857 0 G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2754 hydrog ?    ? A  C   2857 N4    ? ? ? 1_555 A  G   2900 O6    ? ? 0 C   2857 0 G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2755 hydrog ?    ? A  C   2857 O2    ? ? ? 1_555 A  G   2900 N2    ? ? 0 C   2857 0 G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2756 hydrog ?    ? A  U   2858 N3    ? ? ? 1_555 A  A   2899 N1    ? ? 0 U   2858 0 A   2899 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2757 hydrog ?    ? A  U   2858 O4    ? ? ? 1_555 A  A   2899 N6    ? ? 0 U   2858 0 A   2899 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2758 hydrog ?    ? A  C   2859 N3    ? ? ? 1_555 A  G   2898 N1    ? ? 0 C   2859 0 G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2759 hydrog ?    ? A  C   2859 N4    ? ? ? 1_555 A  G   2898 O6    ? ? 0 C   2859 0 G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2760 hydrog ?    ? A  C   2859 O2    ? ? ? 1_555 A  G   2898 N2    ? ? 0 C   2859 0 G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2761 hydrog ?    ? A  G   2860 N1    ? ? ? 1_555 A  C   2897 N3    ? ? 0 G   2860 0 C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2762 hydrog ?    ? A  G   2860 N2    ? ? ? 1_555 A  C   2897 O2    ? ? 0 G   2860 0 C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2763 hydrog ?    ? A  G   2860 O6    ? ? ? 1_555 A  C   2897 N4    ? ? 0 G   2860 0 C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2764 hydrog ?    ? A  G   2861 N1    ? ? ? 1_555 A  C   2895 N3    ? ? 0 G   2861 0 C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2765 hydrog ?    ? A  G   2861 N2    ? ? ? 1_555 A  C   2895 O2    ? ? 0 G   2861 0 C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2766 hydrog ?    ? A  G   2861 O6    ? ? ? 1_555 A  C   2895 N4    ? ? 0 G   2861 0 C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2767 hydrog ?    ? A  G   2862 N1    ? ? ? 1_555 A  C   2894 N3    ? ? 0 G   2862 0 C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2768 hydrog ?    ? A  G   2862 N2    ? ? ? 1_555 A  C   2894 O2    ? ? 0 G   2862 0 C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2769 hydrog ?    ? A  G   2862 O6    ? ? ? 1_555 A  C   2894 N4    ? ? 0 G   2862 0 C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2770 hydrog ?    ? A  G   2863 N1    ? ? ? 1_555 A  C   2893 N3    ? ? 0 G   2863 0 C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2771 hydrog ?    ? A  G   2863 N2    ? ? ? 1_555 A  C   2893 O2    ? ? 0 G   2863 0 C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2772 hydrog ?    ? A  G   2863 O6    ? ? ? 1_555 A  C   2893 N4    ? ? 0 G   2863 0 C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2773 hydrog ?    ? A  U   2864 N3    ? ? ? 1_555 A  G   2892 O6    ? ? 0 U   2864 0 G   2892 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2774 hydrog ?    ? A  U   2864 O2    ? ? ? 1_555 A  G   2892 N1    ? ? 0 U   2864 0 G   2892 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2775 hydrog ?    ? A  G   2865 N2    ? ? ? 1_555 A  A   2891 N7    ? ? 0 G   2865 0 A   2891 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2776 hydrog ?    ? A  G   2865 N3    ? ? ? 1_555 A  A   2891 N6    ? ? 0 G   2865 0 A   2891 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2777 hydrog ?    ? A  C   2868 N4    ? ? ? 1_555 A  U   2889 O4    ? ? 0 C   2868 0 U   2889 1_555 ? ? ? ? ? ? 'C-U MISPAIR' 
?     ? ? 
hydrog2778 hydrog ?    ? A  G   2869 N1    ? ? ? 1_555 A  U   2888 O2    ? ? 0 G   2869 0 U   2888 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2779 hydrog ?    ? A  G   2869 O6    ? ? ? 1_555 A  U   2888 N3    ? ? 0 G   2869 0 U   2888 1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2780 hydrog ?    ? A  C   2870 N3    ? ? ? 1_555 A  G   2887 N1    ? ? 0 C   2870 0 G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2781 hydrog ?    ? A  C   2870 N4    ? ? ? 1_555 A  G   2887 O6    ? ? 0 C   2870 0 G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2782 hydrog ?    ? A  C   2870 O2    ? ? ? 1_555 A  G   2887 N2    ? ? 0 C   2870 0 G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2783 hydrog ?    ? A  G   2871 N1    ? ? ? 1_555 A  C   2886 N3    ? ? 0 G   2871 0 C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2784 hydrog ?    ? A  G   2871 N2    ? ? ? 1_555 A  C   2886 O2    ? ? 0 G   2871 0 C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2785 hydrog ?    ? A  G   2871 O6    ? ? ? 1_555 A  C   2886 N4    ? ? 0 G   2871 0 C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2786 hydrog ?    ? A  U   2872 N3    ? ? ? 1_555 A  A   2885 N1    ? ? 0 U   2872 0 A   2885 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2787 hydrog ?    ? A  U   2872 O4    ? ? ? 1_555 A  A   2885 N6    ? ? 0 U   2872 0 A   2885 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2788 hydrog ?    ? A  C   2873 O2    ? ? ? 1_555 A  G   2884 N2    ? ? 0 C   2873 0 G   2884 1_555 ? ? ? ? ? ? 'C-G PAIR' ? 
? ? 
hydrog2789 hydrog ?    ? A  G   2874 N2    ? ? ? 1_555 A  A   2883 N7    ? ? 0 G   2874 0 A   2883 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2790 hydrog ?    ? A  G   2874 N3    ? ? ? 1_555 A  A   2883 N6    ? ? 0 G   2874 0 A   2883 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2791 hydrog ?    ? A  A   2875 N6    ? ? ? 1_555 A  G   2882 N3    ? ? 0 A   2875 0 G   2882 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2792 hydrog ?    ? A  A   2875 N7    ? ? ? 1_555 A  G   2882 N2    ? ? 0 A   2875 0 G   2882 1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2793 hydrog ?    ? A  G   2876 N1    ? ? ? 1_555 A  C   2881 N3    ? ? 0 G   2876 0 C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2794 hydrog ?    ? A  G   2876 N2    ? ? ? 1_555 A  C   2881 O2    ? ? 0 G   2876 0 C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2795 hydrog ?    ? A  G   2876 O6    ? ? ? 1_555 A  C   2881 N4    ? ? 0 G   2876 0 C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2796 hydrog ?    ? A  G   2877 N2    ? ? ? 1_555 A  A   2880 N7    ? ? 0 G   2877 0 A   2880 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog2797 hydrog ?    ? A  A   2902 N7    ? ? ? 1_555 A  A   2905 N6    ? ? 0 A   2902 0 A   2905 1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog2798 hydrog ?    ? B  A   3    N3    ? ? ? 1_555 B  G   21   N2    ? ? 9 A   3    9 G   21   1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog2799 hydrog ?    ? B  A   3    N6    ? ? ? 1_555 B  G   25   O6    ? ? 9 A   3    9 G   25   1_555 ? ? ? ? ? ? TYPE_9_PAIR ? 
? ? 
hydrog2800 hydrog ?    ? B  A   3    N7    ? ? ? 1_555 B  G   25   N1    ? ? 9 A   3    9 G   25   1_555 ? ? ? ? ? ? TYPE_9_PAIR ? 
? ? 
hydrog2801 hydrog ?    ? B  G   4    N1    ? ? ? 1_555 B  C   119  N3    ? ? 9 G   4    9 C   119  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2802 hydrog ?    ? B  G   4    N2    ? ? ? 1_555 B  C   119  O2    ? ? 9 G   4    9 C   119  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2803 hydrog ?    ? B  G   4    O6    ? ? ? 1_555 B  C   119  N4    ? ? 9 G   4    9 C   119  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2804 hydrog ?    ? B  G   5    N1    ? ? ? 1_555 B  C   118  N3    ? ? 9 G   5    9 C   118  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2805 hydrog ?    ? B  G   5    N2    ? ? ? 1_555 B  C   118  O2    ? ? 9 G   5    9 C   118  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2806 hydrog ?    ? B  G   5    O6    ? ? ? 1_555 B  C   118  N4    ? ? 9 G   5    9 C   118  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2807 hydrog ?    ? B  C   6    N3    ? ? ? 1_555 B  G   117  N1    ? ? 9 C   6    9 G   117  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2808 hydrog ?    ? B  C   6    N4    ? ? ? 1_555 B  G   117  O6    ? ? 9 C   6    9 G   117  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2809 hydrog ?    ? B  C   6    O2    ? ? ? 1_555 B  G   117  N2    ? ? 9 C   6    9 G   117  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2810 hydrog ?    ? B  G   7    N1    ? ? ? 1_555 B  C   116  N3    ? ? 9 G   7    9 C   116  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2811 hydrog ?    ? B  G   7    N2    ? ? ? 1_555 B  C   116  O2    ? ? 9 G   7    9 C   116  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2812 hydrog ?    ? B  G   7    O6    ? ? ? 1_555 B  C   116  N4    ? ? 9 G   7    9 C   116  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2813 hydrog ?    ? B  G   8    N1    ? ? ? 1_555 B  C   115  N3    ? ? 9 G   8    9 C   115  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2814 hydrog ?    ? B  G   8    N2    ? ? ? 1_555 B  C   115  O2    ? ? 9 G   8    9 C   115  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2815 hydrog ?    ? B  G   8    O6    ? ? ? 1_555 B  C   115  N4    ? ? 9 G   8    9 C   115  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2816 hydrog ?    ? B  C   9    N3    ? ? ? 1_555 B  G   114  N1    ? ? 9 C   9    9 G   114  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2817 hydrog ?    ? B  C   9    N4    ? ? ? 1_555 B  G   114  O6    ? ? 9 C   9    9 G   114  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2818 hydrog ?    ? B  C   9    O2    ? ? ? 1_555 B  G   114  N2    ? ? 9 C   9    9 G   114  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2819 hydrog ?    ? B  A   11   N3    ? ? ? 1_555 B  G   68   N2    ? ? 9 A   11   9 G   68   1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog2820 hydrog ?    ? B  G   14   N1    ? ? ? 1_555 B  C   67   N3    ? ? 9 G   14   9 C   67   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2821 hydrog ?    ? B  G   14   N2    ? ? ? 1_555 B  C   67   O2    ? ? 9 G   14   9 C   67   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2822 hydrog ?    ? B  G   14   O6    ? ? ? 1_555 B  C   67   N4    ? ? 9 G   14   9 C   67   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2823 hydrog ?    ? B  C   15   N3    ? ? ? 1_555 B  G   66   N1    ? ? 9 C   15   9 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2824 hydrog ?    ? B  C   15   N4    ? ? ? 1_555 B  G   66   O6    ? ? 9 C   15   9 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2825 hydrog ?    ? B  C   15   O2    ? ? ? 1_555 B  G   66   N2    ? ? 9 C   15   9 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2826 hydrog ?    ? B  C   15   N4    ? ? ? 1_555 B  C   113  O2    ? ? 9 C   15   9 C   113  1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog2827 hydrog ?    ? B  G   16   N1    ? ? ? 1_555 B  C   64   N3    ? ? 9 G   16   9 C   64   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2828 hydrog ?    ? B  G   16   N2    ? ? ? 1_555 B  C   64   O2    ? ? 9 G   16   9 C   64   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2829 hydrog ?    ? B  G   16   O6    ? ? ? 1_555 B  C   64   N4    ? ? 9 G   16   9 C   64   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2830 hydrog ?    ? B  G   17   N1    ? ? ? 1_555 B  C   63   N3    ? ? 9 G   17   9 C   63   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2831 hydrog ?    ? B  G   17   N2    ? ? ? 1_555 B  C   63   O2    ? ? 9 G   17   9 C   63   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2832 hydrog ?    ? B  G   17   O6    ? ? ? 1_555 B  C   63   N4    ? ? 9 G   17   9 C   63   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2833 hydrog ?    ? B  U   18   N3    ? ? ? 1_555 B  A   62   N1    ? ? 9 U   18   9 A   62   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2834 hydrog ?    ? B  U   18   O4    ? ? ? 1_555 B  A   62   N6    ? ? 9 U   18   9 A   62   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2835 hydrog ?    ? B  G   19   N1    ? ? ? 1_555 B  C   61   N3    ? ? 9 G   19   9 C   61   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2836 hydrog ?    ? B  G   19   N2    ? ? ? 1_555 B  C   61   O2    ? ? 9 G   19   9 C   61   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2837 hydrog ?    ? B  G   19   O6    ? ? ? 1_555 B  C   61   N4    ? ? 9 G   19   9 C   61   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2838 hydrog ?    ? B  G   20   N1    ? ? ? 1_555 B  C   60   N3    ? ? 9 G   20   9 C   60   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2839 hydrog ?    ? B  G   20   N2    ? ? ? 1_555 B  C   60   O2    ? ? 9 G   20   9 C   60   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2840 hydrog ?    ? B  G   20   O6    ? ? ? 1_555 B  C   60   N4    ? ? 9 G   20   9 C   60   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2841 hydrog ?    ? B  G   21   N1    ? ? ? 1_555 B  C   59   N3    ? ? 9 G   21   9 C   59   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2842 hydrog ?    ? B  G   21   N2    ? ? ? 1_555 B  C   59   O2    ? ? 9 G   21   9 C   59   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2843 hydrog ?    ? B  G   21   O6    ? ? ? 1_555 B  C   59   N4    ? ? 9 G   21   9 C   59   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2844 hydrog ?    ? B  G   22   N2    ? ? ? 1_555 B  C   26   N3    ? ? 9 G   22   9 C   26   1_555 ? ? ? ? ? ? 'G-C PAIR' ? 
? ? 
hydrog2845 hydrog ?    ? B  C   27   N4    ? ? ? 1_555 B  U   55   O4    ? ? 9 C   27   9 U   55   1_555 ? ? ? ? ? ? 'C-U MISPAIR' 
?     ? ? 
hydrog2846 hydrog ?    ? B  C   27   O2    ? ? ? 1_555 B  G   58   N1    ? ? 9 C   27   9 G   58   1_555 ? ? ? ? ? ? 'C-G PAIR' ? 
? ? 
hydrog2847 hydrog ?    ? B  U   28   N3    ? ? ? 1_555 B  A   54   N1    ? ? 9 U   28   9 A   54   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2848 hydrog ?    ? B  U   28   O4    ? ? ? 1_555 B  A   54   N6    ? ? 9 U   28   9 A   54   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2849 hydrog ?    ? B  U   28   O2    ? ? ? 1_555 B  A   57   N6    ? ? 9 U   28   9 A   57   1_555 ? ? ? ? ? ? 'U-A PAIR' ? 
? ? 
hydrog2850 hydrog ?    ? B  C   29   N3    ? ? ? 1_555 B  G   53   N1    ? ? 9 C   29   9 G   53   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2851 hydrog ?    ? B  C   29   N4    ? ? ? 1_555 B  G   53   O6    ? ? 9 C   29   9 G   53   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2852 hydrog ?    ? B  C   29   O2    ? ? ? 1_555 B  G   53   N2    ? ? 9 C   29   9 G   53   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2853 hydrog ?    ? B  C   29   O2    ? ? ? 1_555 B  A   56   N6    ? ? 9 C   29   9 A   56   1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog2854 hydrog ?    ? B  C   30   N3    ? ? ? 1_555 B  G   50   N1    ? ? 9 C   30   9 G   50   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2855 hydrog ?    ? B  C   30   N4    ? ? ? 1_555 B  G   50   O6    ? ? 9 C   30   9 G   50   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2856 hydrog ?    ? B  C   30   O2    ? ? ? 1_555 B  G   50   N2    ? ? 9 C   30   9 G   50   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2857 hydrog ?    ? B  C   30   O2    ? ? ? 1_555 B  A   52   N6    ? ? 9 C   30   9 A   52   1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog2858 hydrog ?    ? B  C   31   N3    ? ? ? 1_555 B  G   49   N1    ? ? 9 C   31   9 G   49   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2859 hydrog ?    ? B  C   31   N4    ? ? ? 1_555 B  G   49   O6    ? ? 9 C   31   9 G   49   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2860 hydrog ?    ? B  C   31   O2    ? ? ? 1_555 B  G   49   N2    ? ? 9 C   31   9 G   49   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2861 hydrog ?    ? B  G   32   N1    ? ? ? 1_555 B  C   48   N3    ? ? 9 G   32   9 C   48   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2862 hydrog ?    ? B  G   32   N2    ? ? ? 1_555 B  C   48   O2    ? ? 9 G   32   9 C   48   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2863 hydrog ?    ? B  G   32   O6    ? ? ? 1_555 B  C   48   N4    ? ? 9 G   32   9 C   48   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2864 hydrog ?    ? B  U   33   O2    ? ? ? 1_555 B  C   35   N4    ? ? 9 U   33   9 C   35   1_555 ? ? ? ? ? ? 'U-C MISPAIR' 
?     ? ? 
hydrog2865 hydrog ?    ? B  U   33   N3    ? ? ? 1_555 B  A   47   N1    ? ? 9 U   33   9 A   47   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2866 hydrog ?    ? B  U   33   O4    ? ? ? 1_555 B  A   47   N6    ? ? 9 U   33   9 A   47   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2867 hydrog ?    ? B  C   35   N4    ? ? ? 1_555 B  C   48   O2    ? ? 9 C   35   9 C   48   1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog2868 hydrog ?    ? B  C   36   N4    ? ? ? 1_555 B  A   47   N3    ? ? 9 C   36   9 A   47   1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog2869 hydrog ?    ? B  C   37   N3    ? ? ? 1_555 B  G   43   N1    ? ? 9 C   37   9 G   43   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2870 hydrog ?    ? B  C   37   N4    ? ? ? 1_555 B  G   43   O6    ? ? 9 C   37   9 G   43   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2871 hydrog ?    ? B  C   37   O2    ? ? ? 1_555 B  G   43   N2    ? ? 9 C   37   9 G   43   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2872 hydrog ?    ? B  A   38   N3    ? ? ? 1_555 B  A   45   N6    ? ? 9 A   38   9 A   45   1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog2873 hydrog ?    ? B  U   39   O2    ? ? ? 1_555 B  A   44   N6    ? ? 9 U   39   9 A   44   1_555 ? ? ? ? ? ? 'U-A PAIR' ? 
? ? 
hydrog2874 hydrog ?    ? B  G   43   N2    ? ? ? 1_555 B  C   46   N3    ? ? 9 G   43   9 C   46   1_555 ? ? ? ? ? ? 'G-C PAIR' ? 
? ? 
hydrog2875 hydrog ?    ? B  A   51   N3    ? ? ? 1_555 B  A   52   N6    ? ? 9 A   51   9 A   52   1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog2876 hydrog ?    ? B  A   54   N3    ? ? ? 1_555 B  A   56   N6    ? ? 9 A   54   9 A   56   1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog2877 hydrog ?    ? B  A   65   N3    ? ? ? 1_555 B  C   67   N4    ? ? 9 A   65   9 C   67   1_555 ? ? ? ? ? ? 'A-C MISPAIR' 
?     ? ? 
hydrog2878 hydrog ?    ? B  G   66   O6    ? ? ? 1_555 B  C   113  N4    ? ? 9 G   66   9 C   113  1_555 ? ? ? ? ? ? 'G-C PAIR' ? 
? ? 
hydrog2879 hydrog ?    ? B  U   69   N3    ? ? ? 1_555 B  U   112  O2    ? ? 9 U   69   9 U   112  1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog2880 hydrog ?    ? B  U   69   O4    ? ? ? 1_555 B  U   112  N3    ? ? 9 U   69   9 U   112  1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog2881 hydrog ?    ? B  U   70   N3    ? ? ? 1_555 B  U   111  O2    ? ? 9 U   70   9 U   111  1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog2882 hydrog ?    ? B  U   70   O4    ? ? ? 1_555 B  U   111  N3    ? ? 9 U   70   9 U   111  1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog2883 hydrog ?    ? B  C   71   N3    ? ? ? 1_555 B  G   110  N1    ? ? 9 C   71   9 G   110  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2884 hydrog ?    ? B  C   71   N4    ? ? ? 1_555 B  G   110  O6    ? ? 9 C   71   9 G   110  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2885 hydrog ?    ? B  C   71   O2    ? ? ? 1_555 B  G   110  N2    ? ? 9 C   71   9 G   110  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2886 hydrog ?    ? B  C   72   N3    ? ? ? 1_555 B  G   109  N1    ? ? 9 C   72   9 G   109  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2887 hydrog ?    ? B  C   72   N4    ? ? ? 1_555 B  G   109  O6    ? ? 9 C   72   9 G   109  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2888 hydrog ?    ? B  C   72   O2    ? ? ? 1_555 B  G   109  N2    ? ? 9 C   72   9 G   109  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2889 hydrog ?    ? B  A   73   N6    ? ? ? 1_555 B  C   108  N3    ? ? 9 A   73   9 C   108  1_555 ? ? ? ? ? ? 'A-C MISPAIR' 
?     ? ? 
hydrog2890 hydrog ?    ? B  G   74   N1    ? ? ? 1_555 B  C   107  N3    ? ? 9 G   74   9 C   107  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2891 hydrog ?    ? B  G   74   N2    ? ? ? 1_555 B  C   107  O2    ? ? 9 G   74   9 C   107  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2892 hydrog ?    ? B  G   74   O6    ? ? ? 1_555 B  C   107  N4    ? ? 9 G   74   9 C   107  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2893 hydrog ?    ? B  G   75   N1    ? ? ? 1_555 B  U   106  O2    ? ? 9 G   75   9 U   106  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2894 hydrog ?    ? B  G   75   O6    ? ? ? 1_555 B  U   106  N3    ? ? 9 G   75   9 U   106  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2895 hydrog ?    ? B  G   76   N2    ? ? ? 1_555 B  A   105  N7    ? ? 9 G   76   9 A   105  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2896 hydrog ?    ? B  G   76   N3    ? ? ? 1_555 B  A   105  N6    ? ? 9 G   76   9 A   105  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2897 hydrog ?    ? B  A   77   N6    ? ? ? 1_555 B  A   104  N7    ? ? 9 A   77   9 A   104  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog2898 hydrog ?    ? B  A   77   N7    ? ? ? 1_555 B  A   104  N6    ? ? 9 A   77   9 A   104  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog2899 hydrog ?    ? B  G   78   N2    ? ? ? 1_555 B  U   79   O4    ? ? 9 G   78   9 U   79   1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog2900 hydrog ?    ? B  U   79   N3    ? ? ? 1_555 B  A   103  N7    ? ? 9 U   79   9 A   103  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2901 hydrog ?    ? B  U   79   O2    ? ? ? 1_555 B  A   103  N6    ? ? 9 U   79   9 A   103  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2902 hydrog ?    ? B  A   80   N6    ? ? ? 1_555 B  G   102  N3    ? ? 9 A   80   9 G   102  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2903 hydrog ?    ? B  A   80   N7    ? ? ? 1_555 B  G   102  N2    ? ? 9 A   80   9 G   102  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog2904 hydrog ?    ? B  C   81   N3    ? ? ? 1_555 B  G   101  N1    ? ? 9 C   81   9 G   101  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2905 hydrog ?    ? B  C   81   N4    ? ? ? 1_555 B  G   101  O6    ? ? 9 C   81   9 G   101  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2906 hydrog ?    ? B  C   81   O2    ? ? ? 1_555 B  G   101  N2    ? ? 9 C   81   9 G   101  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2907 hydrog ?    ? B  U   82   N3    ? ? ? 1_555 B  G   100  O6    ? ? 9 U   82   9 G   100  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2908 hydrog ?    ? B  U   82   O2    ? ? ? 1_555 B  G   100  N1    ? ? 9 U   82   9 G   100  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2909 hydrog ?    ? B  G   83   N1    ? ? ? 1_555 B  U   99   O2    ? ? 9 G   83   9 U   99   1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2910 hydrog ?    ? B  G   83   O6    ? ? ? 1_555 B  U   99   N3    ? ? 9 G   83   9 U   99   1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog2911 hydrog ?    ? B  G   84   N1    ? ? ? 1_555 B  C   98   N3    ? ? 9 G   84   9 C   98   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2912 hydrog ?    ? B  G   84   N2    ? ? ? 1_555 B  C   98   O2    ? ? 9 G   84   9 C   98   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2913 hydrog ?    ? B  G   84   O6    ? ? ? 1_555 B  C   98   N4    ? ? 9 G   84   9 C   98   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2914 hydrog ?    ? B  A   85   N1    ? ? ? 1_555 B  U   97   N3    ? ? 9 A   85   9 U   97   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2915 hydrog ?    ? B  A   85   N6    ? ? ? 1_555 B  U   97   O4    ? ? 9 A   85   9 U   97   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2916 hydrog ?    ? B  G   86   N1    ? ? ? 1_555 B  C   96   N3    ? ? 9 G   86   9 C   96   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2917 hydrog ?    ? B  G   86   N2    ? ? ? 1_555 B  C   96   O2    ? ? 9 G   86   9 C   96   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2918 hydrog ?    ? B  G   86   O6    ? ? ? 1_555 B  C   96   N4    ? ? 9 G   86   9 C   96   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2919 hydrog ?    ? B  G   88   N1    ? ? ? 1_555 B  C   95   N3    ? ? 9 G   88   9 C   95   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2920 hydrog ?    ? B  G   88   N2    ? ? ? 1_555 B  C   95   O2    ? ? 9 G   88   9 C   95   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2921 hydrog ?    ? B  G   88   O6    ? ? ? 1_555 B  C   95   N4    ? ? 9 G   88   9 C   95   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2922 hydrog ?    ? B  C   89   N3    ? ? ? 1_555 B  G   94   N1    ? ? 9 C   89   9 G   94   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2923 hydrog ?    ? B  C   89   N4    ? ? ? 1_555 B  G   94   O6    ? ? 9 C   89   9 G   94   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2924 hydrog ?    ? B  C   89   O2    ? ? ? 1_555 B  G   94   N2    ? ? 9 C   89   9 G   94   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog2925 hydrog ?    ? B  G   90   N2    ? ? ? 1_555 B  A   93   N7    ? ? 9 G   90   9 A   93   1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TRP 187 C . ? TRP 186 A PRO 188 C ? PRO 187 A 1 0.33  
2 GLY 15  D . ? GLY 14  B PRO 16  D ? PRO 15  B 1 -0.17 
3 ASN 244 D . ? ASN 243 B PRO 245 D ? PRO 244 B 1 0.10  
4 VAL 136 E . ? VAL 136 C PRO 137 E ? PRO 137 C 1 -0.13 
5 GLN 56  H . ? GLN 55  F PRO 57  H ? PRO 56  F 1 0.14  
6 ARG 184 O . ? ARG 184 M PRO 185 O ? PRO 185 M 1 0.02  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 4 ? 
B  ? 6 ? 
C  ? 2 ? 
D  ? 5 ? 
E  ? 5 ? 
F  ? 8 ? 
G  ? 2 ? 
H  ? 6 ? 
I  ? 2 ? 
J  ? 2 ? 
K  ? 5 ? 
L  ? 3 ? 
M  ? 3 ? 
N  ? 4 ? 
O  ? 3 ? 
P  ? 4 ? 
Q  ? 5 ? 
R  ? 3 ? 
S  ? 2 ? 
T  ? 3 ? 
U  ? 2 ? 
V  ? 5 ? 
W  ? 2 ? 
X  ? 6 ? 
Y  ? 2 ? 
Z  ? 3 ? 
AA ? 3 ? 
AB ? 4 ? 
AC ? 4 ? 
AD ? 4 ? 
AE ? 3 ? 
AF ? 2 ? 
AG ? 5 ? 
AH ? 3 ? 
AI ? 2 ? 
AJ ? 2 ? 
AK ? 4 ? 
AL ? 6 ? 
AM ? 2 ? 
AN ? 5 ? 
AO ? 4 ? 
AP ? 2 ? 
AQ ? 2 ? 
AR ? 4 ? 
AS ? 3 ? 
AT ? 2 ? 
AU ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
B  4 5 ? anti-parallel 
B  5 6 ? anti-parallel 
C  1 2 ? parallel      
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
D  4 5 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
E  4 5 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
F  4 5 ? anti-parallel 
F  5 6 ? anti-parallel 
F  6 7 ? anti-parallel 
F  7 8 ? anti-parallel 
G  1 2 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? parallel      
H  3 4 ? parallel      
H  4 5 ? parallel      
H  5 6 ? parallel      
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
K  4 5 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
P  3 4 ? parallel      
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
Q  4 5 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
S  1 2 ? parallel      
T  1 2 ? parallel      
T  2 3 ? parallel      
U  1 2 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
V  3 4 ? parallel      
V  4 5 ? anti-parallel 
W  1 2 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
X  4 5 ? anti-parallel 
X  5 6 ? parallel      
Y  1 2 ? parallel      
Z  1 2 ? parallel      
Z  2 3 ? parallel      
AA 1 2 ? parallel      
AA 2 3 ? parallel      
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? parallel      
AD 1 2 ? parallel      
AD 2 3 ? parallel      
AD 3 4 ? parallel      
AE 1 2 ? parallel      
AE 2 3 ? parallel      
AF 1 2 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AG 4 5 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AK 3 4 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? parallel      
AL 3 4 ? anti-parallel 
AL 4 5 ? anti-parallel 
AL 5 6 ? anti-parallel 
AM 1 2 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? anti-parallel 
AN 4 5 ? parallel      
AO 1 2 ? anti-parallel 
AO 2 3 ? anti-parallel 
AO 3 4 ? parallel      
AP 1 2 ? anti-parallel 
AQ 1 2 ? parallel      
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AR 3 4 ? anti-parallel 
AS 1 2 ? anti-parallel 
AS 2 3 ? anti-parallel 
AT 1 2 ? parallel      
AU 1 2 ? anti-parallel 
AU 2 3 ? anti-parallel 
AU 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 ARG C  66  ? ILE C  69  ? ARG A 65  ILE A 68  
A  2 PRO C  55  ? PHE C  61  ? PRO A 54  PHE A 60  
A  3 ALA C  40  ? HIS C  48  ? ALA A 39  HIS A 47  
A  4 GLU C  80  ? GLN C  82  ? GLU A 79  GLN A 81  
B  1 THR C  94  ? PRO C  96  ? THR A 93  PRO A 95  
B  2 ARG C  154 ? ILE C  157 ? ARG A 153 ILE A 156 
B  3 PRO C  105 ? CYS C  107 ? PRO A 104 CYS A 106 
B  4 ALA C  127 ? THR C  131 ? ALA A 126 THR A 130 
B  5 ALA C  137 ? LYS C  140 ? ALA A 136 LYS A 139 
B  6 MET C  146 ? LEU C  149 ? MET A 145 LEU A 148 
C  1 SER C  215 ? ILE C  216 ? SER A 214 ILE A 215 
C  2 ASP C  228 ? ILE C  229 ? ASP A 227 ILE A 228 
D  1 GLY D  38  ? VAL D  39  ? GLY B 37  VAL B 38  
D  2 VAL D  162 ? GLY D  168 ? VAL B 161 GLY B 167 
D  3 LEU D  138 ? HIS D  146 ? LEU B 137 HIS B 145 
D  4 MET D  80  ? THR D  91  ? MET B 79  THR B 90  
D  5 GLY D  94  ? TRP D  102 ? GLY B 93  TRP B 101 
E  1 GLY D  38  ? VAL D  39  ? GLY B 37  VAL B 38  
E  2 VAL D  162 ? GLY D  168 ? VAL B 161 GLY B 167 
E  3 LEU D  138 ? HIS D  146 ? LEU B 137 HIS B 145 
E  4 MET D  80  ? THR D  91  ? MET B 79  THR B 90  
E  5 GLU D  188 ? HIS D  189 ? GLU B 187 HIS B 188 
F  1 VAL D  328 ? VAL D  331 ? VAL B 327 VAL B 330 
F  2 PHE D  42  ? VAL D  55  ? PHE B 41  VAL B 54  
F  3 LEU D  309 ? PRO D  314 ? LEU B 308 PRO B 313 
F  4 TYR D  200 ? VAL D  206 ? TYR B 199 VAL B 205 
F  5 GLN D  262 ? GLY D  276 ? GLN B 261 GLY B 275 
F  6 GLY D  293 ? LYS D  299 ? GLY B 292 LYS B 298 
F  7 GLU D  67  ? GLU D  76  ? GLU B 66  GLU B 75  
F  8 PHE D  42  ? VAL D  55  ? PHE B 41  VAL B 54  
G  1 GLY D  209 ? GLN D  213 ? GLY B 208 GLN B 212 
G  2 GLY D  256 ? GLY D  259 ? GLY B 255 GLY B 258 
H  1 THR E  12  ? ASP E  17  ? THR C 12  ASP C 17  
H  2 GLN E  2   ? TYR E  6   ? GLN C 2   TYR C 6   
H  3 VAL E  138 ? VAL E  140 ? VAL C 138 VAL C 140 
H  4 THR E  233 ? THR E  236 ? THR C 233 THR C 236 
H  5 LEU E  193 ? THR E  196 ? LEU C 193 THR C 196 
H  6 ASP E  211 ? THR E  214 ? ASP C 211 THR C 214 
I  1 LYS E  72  ? LEU E  73  ? LYS C 72  LEU C 73  
I  2 ARG E  76  ? ALA E  77  ? ARG C 76  ALA C 77  
J  1 LYS E  173 ? ILE E  174 ? LYS C 173 ILE C 174 
J  2 TYR E  186 ? ARG E  187 ? TYR C 186 ARG C 187 
K  1 VAL F  51  ? THR F  53  ? VAL D 50  THR D 52  
K  2 GLY F  71  ? LEU F  76  ? GLY D 70  LEU D 75  
K  3 ARG F  18  ? GLY F  27  ? ARG D 17  GLY D 26  
K  4 ASP F  130 ? VAL F  136 ? ASP D 129 VAL D 135 
K  5 PHE F  105 ? PHE F  107 ? PHE D 104 PHE D 106 
L  1 ARG G  3   ? GLU G  7   ? ARG E 2   GLU E 6   
L  2 THR G  47  ? GLU G  51  ? THR E 46  GLU E 50  
L  3 ASP G  40  ? ASP G  44  ? ASP E 39  ASP E 43  
M  1 ASP G  13  ? ASP G  17  ? ASP E 12  ASP E 16  
M  2 ASP G  20  ? GLY G  25  ? ASP E 19  GLY E 24  
M  3 GLY G  28  ? ARG G  33  ? GLY E 27  ARG E 32  
N  1 ASP G  124 ? ASP G  128 ? ASP E 123 ASP E 127 
N  2 GLU G  131 ? GLY G  136 ? GLU E 130 GLY E 135 
N  3 TRP G  81  ? PHE G  88  ? TRP E 80  PHE E 87  
N  4 GLY G  166 ? ARG G  171 ? GLY E 165 ARG E 170 
O  1 GLN G  95  ? VAL G  98  ? GLN E 94  VAL E 97  
O  2 GLU G  102 ? GLU G  106 ? GLU E 101 GLU E 105 
O  3 ARG G  115 ? THR G  118 ? ARG E 114 THR E 117 
P  1 ALA H  29  ? LYS H  32  ? ALA F 28  LYS F 31  
P  2 ALA H  96  ? THR H  100 ? ALA F 95  THR F 99  
P  3 VAL H  49  ? ALA H  52  ? VAL F 48  ALA F 51  
P  4 PHE H  75  ? VAL H  78  ? PHE F 74  VAL F 77  
Q  1 LYS J  35  ? GLY J  37  ? LYS H 35  GLY H 37  
Q  2 LYS J  87  ? LEU J  90  ? LYS H 87  LEU H 90  
Q  3 GLN J  135 ? CYS J  141 ? GLN H 135 CYS H 141 
Q  4 VAL J  48  ? VAL J  54  ? VAL H 48  VAL H 54  
Q  5 CYS J  164 ? VAL J  168 ? CYS H 164 VAL H 168 
R  1 VAL J  58  ? ARG J  61  ? VAL H 58  ARG H 61  
R  2 LYS J  122 ? VAL J  130 ? LYS H 122 VAL H 130 
R  3 GLN J  96  ? GLU J  100 ? GLN H 96  GLU H 100 
S  1 ALA K  94  ? LEU K  96  ? ALA I 93  LEU I 95  
S  2 VAL K  133 ? ILE K  135 ? VAL I 132 ILE I 134 
T  1 VAL L  10  ? ASP L  13  ? VAL J 10  ASP J 13  
T  2 VAL L  36  ? VAL L  39  ? VAL J 36  VAL J 39  
T  3 VAL L  101 ? VAL L  103 ? VAL J 101 VAL J 103 
U  1 VAL L  45  ? THR L  47  ? VAL J 45  THR J 47  
U  2 PHE L  129 ? THR L  131 ? PHE J 129 THR J 131 
V  1 ASP M  7   ? VAL M  8   ? ASP K 7   VAL K 8   
V  2 ILE M  80  ? ARG M  81  ? ILE K 80  ARG K 81  
V  3 ARG M  87  ? PHE M  90  ? ARG K 87  PHE K 90  
V  4 THR W  19  ? VAL W  22  ? THR U 19  VAL U 22  
V  5 THR W  28  ? PHE W  31  ? THR U 28  PHE U 31  
W  1 LEU M  12  ? GLU M  13  ? LEU K 12  GLU K 13  
W  2 LYS M  46  ? ALA M  47  ? LYS K 46  ALA K 47  
X  1 LEU M  17  ? CYS M  20  ? LEU K 17  CYS K 20  
X  2 ALA M  26  ? VAL M  34  ? ALA K 26  VAL K 34  
X  3 LYS M  52  ? GLY M  60  ? LYS K 52  GLY K 60  
X  4 VAL M  68  ? ARG M  75  ? VAL K 68  ARG K 75  
X  5 ALA M  94  ? VAL M  98  ? ALA K 94  VAL K 98  
X  6 LEU M  17  ? CYS M  20  ? LEU K 17  CYS K 20  
Y  1 PRO M  112 ? ALA M  114 ? PRO K 112 ALA K 114 
Y  2 MET M  130 ? VAL M  132 ? MET K 130 VAL K 132 
Z  1 ALA N  62  ? ASP N  66  ? ALA L 61  ASP L 65  
Z  2 TYR N  106 ? LEU N  110 ? TYR L 105 LEU L 109 
Z  3 ASP N  125 ? PHE N  126 ? ASP L 124 PHE L 125 
AA 1 ARG N  91  ? ASP N  93  ? ARG L 90  ASP L 92  
AA 2 THR N  120 ? ALA N  123 ? THR L 119 ALA L 122 
AA 3 SER N  140 ? LEU N  143 ? SER L 139 LEU L 142 
AB 1 VAL O  37  ? ILE O  40  ? VAL M 37  ILE M 40  
AB 2 VAL O  60  ? ARG O  68  ? VAL M 60  ARG M 68  
AB 3 GLN O  126 ? ILE O  134 ? GLN M 126 ILE M 134 
AB 4 ARG O  113 ? GLN O  122 ? ARG M 113 GLN M 122 
AC 1 ASP P  57  ? HIS P  63  ? ASP N 56  HIS N 62  
AC 2 VAL P  44  ? THR P  50  ? VAL N 43  THR N 49  
AC 3 ARG P  34  ? LYS P  39  ? ARG N 33  LYS N 38  
AC 4 VAL P  102 ? ASP P  104 ? VAL N 101 ASP N 103 
AD 1 ALA Q  42  ? ASN Q  45  ? ALA O 41  ASN O 44  
AD 2 THR Q  58  ? LEU Q  66  ? THR O 57  LEU O 65  
AD 3 THR Q  76  ? PHE Q  82  ? THR O 75  PHE O 81  
AD 4 GLU Q  95  ? SER Q  98  ? GLU O 94  SER O 97  
AE 1 ALA Q  42  ? ASN Q  45  ? ALA O 41  ASN O 44  
AE 2 THR Q  58  ? LEU Q  66  ? THR O 57  LEU O 65  
AE 3 VAL Q  112 ? VAL Q  114 ? VAL O 111 VAL O 113 
AF 1 VAL R  22  ? PHE R  24  ? VAL P 21  PHE P 23  
AF 2 ILE R  50  ? ALA R  52  ? ILE P 49  ALA P 51  
AG 1 LYS S  81  ? VAL S  87  ? LYS Q 80  VAL Q 86  
AG 2 ALA S  71  ? ASP S  78  ? ALA Q 70  ASP Q 77  
AG 3 THR S  61  ? GLN S  68  ? THR Q 60  GLN Q 67  
AG 4 LYS S  39  ? LEU S  42  ? LYS Q 38  LEU Q 41  
AG 5 LEU S  92  ? ARG S  94  ? LEU Q 91  ARG Q 93  
AH 1 THR T  14  ? ARG T  22  ? THR R 13  ARG R 21  
AH 2 SER T  139 ? GLU T  149 ? SER R 138 GLU R 148 
AH 3 THR T  111 ? GLN T  123 ? THR R 110 GLN R 122 
AI 1 VAL T  58  ? PRO T  59  ? VAL R 57  PRO R 58  
AI 2 GLY T  79  ? ARG T  80  ? GLY R 78  ARG R 79  
AJ 1 ARG T  126 ? PRO T  128 ? ARG R 125 PRO R 127 
AJ 2 ALA T  134 ? ALA T  136 ? ALA R 133 ALA R 135 
AK 1 ILE U  6   ? PRO U  9   ? ILE S 5   PRO S 8   
AK 2 LYS U  24  ? VAL U  29  ? LYS S 23  VAL S 28  
AK 3 LYS U  63  ? LEU U  69  ? LYS S 62  LEU S 68  
AK 4 VAL U  50  ? ASN U  57  ? VAL S 49  ASN S 56  
AL 1 ASN V  40  ? ARG V  42  ? ASN T 39  ARG T 41  
AL 2 ARG V  25  ? LEU V  28  ? ARG T 24  LEU T 27  
AL 3 VAL V  97  ? ASP V  101 ? VAL T 96  ASP T 100 
AL 4 THR V  48  ? VAL V  51  ? THR T 47  VAL T 50  
AL 5 GLU V  60  ? ASP V  67  ? GLU T 59  ASP T 66  
AL 6 VAL V  72  ? VAL V  75  ? VAL T 71  VAL T 74  
AM 1 THR V  79  ? GLU V  81  ? THR T 78  GLU T 80  
AM 2 GLU V  87  ? PRO V  89  ? GLU T 86  PRO T 88  
AN 1 THR Y  115 ? ARG Y  117 ? THR W 115 ARG W 117 
AN 2 HIS Y  31  ? VAL Y  35  ? HIS W 31  VAL W 35  
AN 3 HIS Y  2   ? GLN Y  6   ? HIS W 2   GLN W 6   
AN 4 VAL Y  52  ? GLY Y  55  ? VAL W 52  GLY W 55  
AN 5 GLY Y  139 ? LYS Y  140 ? GLY W 139 LYS W 140 
AO 1 ARG Z  9   ? PRO Z  14  ? ARG X 8   PRO X 13  
AO 2 LYS Z  70  ? PHE Z  78  ? LYS X 69  PHE X 77  
AO 3 GLU Z  83  ? ALA Z  88  ? GLU X 82  ALA X 87  
AO 4 VAL Z  49  ? LEU Z  51  ? VAL X 48  LEU X 50  
AP 1 GLU AA 97  ? ALA AA 100 ? GLU Y 96  ALA Y 99  
AP 2 TYR AA 234 ? VAL AA 237 ? TYR Y 233 VAL Y 236 
AQ 1 GLU AA 184 ? VAL AA 188 ? GLU Y 183 VAL Y 187 
AQ 2 GLU AA 202 ? ILE AA 206 ? GLU Y 201 ILE Y 205 
AR 1 HIS BA 28  ? ALA BA 29  ? HIS Z 37  ALA Z 38  
AR 2 ASP BA 36  ? GLY BA 42  ? ASP Z 45  GLY Z 51  
AR 3 ILE BA 45  ? CYS BA 48  ? ILE Z 54  CYS Z 57  
AR 4 LYS BA 54  ? THR BA 56  ? LYS Z 63  THR Z 65  
AS 1 HIS CA 17  ? LYS CA 19  ? HIS 1 16  LYS 1 18  
AS 2 LYS CA 26  ? HIS CA 29  ? LYS 1 25  HIS 1 28  
AS 3 VAL CA 34  ? CYS CA 35  ? VAL 1 33  CYS 1 34  
AT 1 GLN EA 2   ? PRO EA 4   ? GLN 3 2   PRO 3 4   
AT 2 GLU EA 89  ? GLN EA 91  ? GLU 3 89  GLN 3 91  
AU 1 ARG EA 6   ? CYS EA 11  ? ARG 3 6   CYS 3 11  
AU 2 GLU EA 16  ? LYS EA 24  ? GLU 3 16  LYS 3 24  
AU 3 LEU EA 67  ? CYS EA 71  ? LEU 3 67  CYS 3 71  
AU 4 ALA EA 77  ? HIS EA 78  ? ALA 3 77  HIS 3 78  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 O ARG C  67  ? O ARG A 66  N VAL C  59  ? N VAL A 58  
A  2 3 O ALA C  58  ? O ALA A 57  N VAL C  44  ? N VAL A 43  
A  3 4 N GLY C  41  ? N GLY A 40  O LEU C  81  ? O LEU A 80  
B  1 2 N LEU C  95  ? N LEU A 94  O ALA C  155 ? O ALA A 154 
B  2 3 O THR C  156 ? O THR A 155 N CYS C  107 ? N CYS A 106 
B  3 4 N VAL C  106 ? N VAL A 105 O ALA C  127 ? O ALA A 126 
B  4 5 N GLN C  128 ? N GLN A 127 O LYS C  140 ? O LYS A 139 
B  5 6 N VAL C  139 ? N VAL A 138 O LYS C  147 ? O LYS A 146 
C  1 2 N ILE C  216 ? N ILE A 215 O ASP C  228 ? O ASP A 227 
D  1 2 N GLY D  38  ? N GLY B 37  O GLY D  168 ? O GLY B 167 
D  2 3 O VAL D  167 ? O VAL B 166 N LEU D  141 ? N LEU B 140 
D  3 4 O GLY D  139 ? O GLY B 138 N TYR D  88  ? N TYR B 87  
D  4 5 N ALA D  87  ? N ALA B 86  O LEU D  98  ? O LEU B 97  
E  1 2 N GLY D  38  ? N GLY B 37  O GLY D  168 ? O GLY B 167 
E  2 3 O VAL D  167 ? O VAL B 166 N LEU D  141 ? N LEU B 140 
E  3 4 O GLY D  139 ? O GLY B 138 N TYR D  88  ? N TYR B 87  
E  4 5 N MET D  80  ? N MET B 79  O HIS D  189 ? O HIS B 188 
F  1 2 O TYR D  330 ? O TYR B 329 N VAL D  53  ? N VAL B 52  
F  2 3 N PHE D  42  ? N PHE B 41  O PHE D  312 ? O PHE B 311 
F  3 4 O ARG D  313 ? O ARG B 312 N ASP D  202 ? N ASP B 201 
F  4 5 N ALA D  201 ? N ALA B 200 O LYS D  268 ? O LYS B 267 
F  5 6 N ARG D  269 ? N ARG B 268 O LYS D  299 ? O LYS B 298 
F  6 7 O THR D  296 ? O THR B 295 N ILE D  75  ? N ILE B 74  
F  7 8 O VAL D  74  ? O VAL B 73  N GLY D  48  ? N GLY B 47  
G  1 2 N GLN D  213 ? N GLN B 212 O GLY D  256 ? O GLY B 255 
H  1 2 O VAL E  16  ? O VAL C 16  N ALA E  3   ? N ALA C 3   
H  2 3 N TYR E  6   ? N TYR C 6   O VAL E  139 ? O VAL C 139 
H  3 4 N VAL E  138 ? N VAL C 138 O THR E  233 ? O THR C 233 
H  4 5 O VAL E  234 ? O VAL C 234 N VAL E  195 ? N VAL C 195 
H  5 6 N PHE E  194 ? N PHE C 194 O ASP E  211 ? O ASP C 211 
I  1 2 N LEU E  73  ? N LEU C 73  O ARG E  76  ? O ARG C 76  
J  1 2 N LYS E  173 ? N LYS C 173 O ARG E  187 ? O ARG C 187 
K  1 2 N VAL F  51  ? N VAL D 50  O LYS F  73  ? O LYS D 72  
K  2 3 O LEU F  76  ? O LEU D 75  N VAL F  22  ? N VAL D 21  
K  3 4 N LYS F  21  ? N LYS D 20  O ASN F  134 ? O ASN D 133 
K  4 5 O VAL F  131 ? O VAL D 130 N PHE F  107 ? N PHE D 106 
L  1 2 N LEU G  6   ? N LEU E 5   O VAL G  48  ? O VAL E 47  
L  2 3 O VAL G  49  ? O VAL E 48  N SER G  42  ? N SER E 41  
M  1 2 N GLU G  15  ? N GLU E 14  O THR G  22  ? O THR E 21  
M  2 3 N GLY G  25  ? N GLY E 24  O GLY G  28  ? O GLY E 27  
N  1 2 N ASP G  124 ? N ASP E 123 O SER G  135 ? O SER E 134 
N  2 3 O LEU G  132 ? O LEU E 131 N MET G  85  ? N MET E 84  
N  3 4 N GLY G  84  ? N GLY E 83  O THR G  170 ? O THR E 169 
O  1 2 N ASN G  97  ? N ASN E 96  O VAL G  104 ? O VAL E 103 
O  2 3 N ILE G  105 ? N ILE E 104 O ARG G  115 ? O ARG E 114 
P  1 2 N LYS H  31  ? N LYS F 30  O ALA H  98  ? O ALA F 97  
P  2 3 O ALA H  97  ? O ALA F 96  N PHE H  50  ? N PHE F 49  
P  3 4 N VAL H  49  ? N VAL F 48  O ILE H  76  ? O ILE F 75  
Q  1 2 N MET J  36  ? N MET H 36  O MET J  88  ? O MET H 88  
Q  2 3 N LYS J  87  ? N LYS H 87  O TYR J  140 ? O TYR H 140 
Q  3 4 O ALA J  139 ? O ALA H 139 N ILE J  50  ? N ILE H 50  
Q  4 5 N ILE J  53  ? N ILE H 53  O ARG J  165 ? O ARG H 165 
R  1 2 N VAL J  58  ? N VAL H 58  O VAL J  130 ? O VAL H 130 
R  2 3 O GLY J  125 ? O GLY H 125 N LEU J  98  ? N LEU H 98  
S  1 2 N LEU K  96  ? N LEU I 95  O THR K  134 ? O THR I 133 
T  1 2 N VAL L  12  ? N VAL J 12  O VAL L  39  ? O VAL J 39  
T  2 3 N VAL L  38  ? N VAL J 38  O ARG L  102 ? O ARG J 102 
U  1 2 N ILE L  46  ? N ILE J 46  O VAL L  130 ? O VAL J 130 
V  1 2 N ASP M  7   ? N ASP K 7   O ARG M  81  ? O ARG K 81  
V  2 3 N ILE M  80  ? N ILE K 80  O VAL M  88  ? O VAL K 88  
V  3 4 N LYS M  89  ? N LYS K 89  O VAL W  22  ? O VAL U 22  
V  4 5 N THR W  19  ? N THR U 19  O PHE W  31  ? O PHE U 31  
W  1 2 N LEU M  12  ? N LEU K 12  O ALA M  47  ? O ALA K 47  
X  1 2 N ILE M  18  ? N ILE K 18  O LEU M  29  ? O LEU K 29  
X  2 3 N ARG M  27  ? N ARG K 27  O LYS M  59  ? O LYS K 59  
X  3 4 N VAL M  55  ? N VAL K 55  O LEU M  69  ? O LEU K 69  
X  4 5 N VAL M  74  ? N VAL K 74  O ALA M  94  ? O ALA K 94  
X  5 6 O ALA M  95  ? O ALA K 95  N THR M  19  ? N THR K 19  
Y  1 2 N ILE M  113 ? N ILE K 113 O VAL M  132 ? O VAL K 132 
Z  1 2 N ILE N  65  ? N ILE L 64  O LEU N  110 ? O LEU L 109 
Z  2 3 N VAL N  109 ? N VAL L 108 O ASP N  125 ? O ASP L 124 
AA 1 2 N VAL N  92  ? N VAL L 91  O THR N  120 ? O THR L 119 
AA 2 3 N LEU N  121 ? N LEU L 120 O GLU N  142 ? O GLU L 141 
AB 1 2 N GLU O  38  ? N GLU M 38  O ARG O  64  ? O ARG M 64  
AB 2 3 N ILE O  61  ? N ILE M 61  O LEU O  133 ? O LEU M 133 
AB 3 4 O ILE O  132 ? O ILE M 132 N LEU O  115 ? N LEU M 115 
AC 1 2 O ASP P  57  ? O ASP N 56  N THR P  50  ? N THR N 49  
AC 2 3 O GLN P  47  ? O GLN N 46  N VAL P  36  ? N VAL N 35  
AC 3 4 N LEU P  35  ? N LEU N 34  O VAL P  102 ? O VAL N 101 
AD 1 2 N VAL Q  44  ? N VAL O 43  O LEU Q  66  ? O LEU O 65  
AD 2 3 N VAL Q  59  ? N VAL O 58  O ALA Q  78  ? O ALA O 77  
AD 3 4 N VAL Q  77  ? N VAL O 76  O VAL Q  97  ? O VAL O 96  
AE 1 2 N VAL Q  44  ? N VAL O 43  O LEU Q  66  ? O LEU O 65  
AE 2 3 N VAL Q  60  ? N VAL O 59  O ARG Q  113 ? O ARG O 112 
AF 1 2 N TRP R  23  ? N TRP P 22  O GLN R  51  ? O GLN P 50  
AG 1 2 O ILE S  85  ? O ILE Q 84  N VAL S  74  ? N VAL Q 73  
AG 2 3 O LYS S  73  ? O LYS Q 72  N GLU S  65  ? N GLU Q 64  
AG 3 4 O GLY S  62  ? O GLY Q 61  N VAL S  40  ? N VAL Q 39  
AG 4 5 N HIS S  41  ? N HIS Q 40  O ARG S  93  ? O ARG Q 92  
AH 1 2 N ALA T  15  ? N ALA R 14  O LEU T  148 ? O LEU R 147 
AH 2 3 O SER T  139 ? O SER R 138 N GLN T  123 ? N GLN R 122 
AI 1 2 N VAL T  58  ? N VAL R 57  O ARG T  80  ? O ARG R 79  
AJ 1 2 N LYS T  127 ? N LYS R 126 O SER T  135 ? O SER R 134 
AK 1 2 N HIS U  8   ? N HIS S 7   O ALA U  28  ? O ALA S 27  
AK 2 3 N VAL U  29  ? N VAL S 28  O LYS U  63  ? O LYS S 62  
AK 3 4 O VAL U  66  ? O VAL S 65  N ASN U  54  ? N ASN S 53  
AL 1 2 O VAL V  41  ? O VAL T 40  N ALA V  26  ? N ALA T 25  
AL 2 3 N THR V  27  ? N THR T 26  O VAL V  99  ? O VAL T 98  
AL 3 4 O ARG V  98  ? O ARG T 97  N GLU V  50  ? N GLU T 49  
AL 4 5 N VAL V  49  ? N VAL T 48  O GLY V  61  ? O GLY T 60  
AL 5 6 N ILE V  64  ? N ILE T 63  O HIS V  74  ? O HIS T 73  
AM 1 2 N LEU V  80  ? N LEU T 79  O VAL V  88  ? O VAL T 87  
AN 1 2 O LEU Y  116 ? O LEU W 116 N CYS Y  32  ? N CYS W 32  
AN 2 3 O THR Y  33  ? O THR W 33  N LEU Y  4   ? N LEU W 4   
AN 3 4 N ALA Y  3   ? N ALA W 3   O GLY Y  55  ? O GLY W 55  
AN 4 5 N VAL Y  52  ? N VAL W 52  O GLY Y  139 ? O GLY W 139 
AO 1 2 N VAL Z  11  ? N VAL X 10  O VAL Z  73  ? O VAL X 72  
AO 2 3 N ARG Z  74  ? N ARG X 73  O GLU Z  87  ? O GLU X 86  
AO 3 4 O ALA Z  84  ? O ALA X 83  N ARG Z  50  ? N ARG X 49  
AP 1 2 N GLU AA 97  ? N GLU Y 96  O VAL AA 237 ? O VAL Y 236 
AQ 1 2 N VAL AA 188 ? N VAL Y 187 O ARG AA 205 ? O ARG Y 204 
AR 1 2 N HIS BA 28  ? N HIS Z 37  O VAL BA 38  ? O VAL Z 47  
AR 2 3 N GLN BA 41  ? N GLN Z 50  O ILE BA 45  ? O ILE Z 54  
AR 3 4 N TRP BA 46  ? N TRP Z 55  O PHE BA 55  ? O PHE Z 64  
AS 1 2 N THR CA 18  ? N THR 1 17  O TYR CA 28  ? O TYR 1 27  
AS 2 3 N HIS CA 29  ? N HIS 1 28  O VAL CA 34  ? O VAL 1 33  
AT 1 2 N MET EA 3   ? N MET 3 3   O GLN EA 91  ? O GLN 3 91  
AU 1 2 N PHE EA 7   ? N PHE 3 7   O HIS EA 20  ? O HIS 3 20  
AU 2 3 N GLU EA 21  ? N GLU 3 21  O ARG EA 70  ? O ARG 3 70  
AU 3 4 N TYR EA 69  ? N TYR 3 69  O HIS EA 78  ? O HIS 3 78  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software 0 ZIT 9500 ? 8 'BINDING SITE FOR RESIDUE ZIT 0 9500' 
AC2 Software 0 MG  8001 ? 7 'BINDING SITE FOR RESIDUE MG 0 8001'  
AC3 Software 0 MG  8002 ? 6 'BINDING SITE FOR RESIDUE MG 0 8002'  
AC4 Software 0 MG  8003 ? 6 'BINDING SITE FOR RESIDUE MG 0 8003'  
AC5 Software 0 MG  8004 ? 6 'BINDING SITE FOR RESIDUE MG 0 8004'  
AC6 Software 0 MG  8005 ? 6 'BINDING SITE FOR RESIDUE MG 0 8005'  
AC7 Software 0 MG  8006 ? 6 'BINDING SITE FOR RESIDUE MG 0 8006'  
AC8 Software 0 MG  8007 ? 7 'BINDING SITE FOR RESIDUE MG 0 8007'  
AC9 Software 0 MG  8008 ? 6 'BINDING SITE FOR RESIDUE MG 0 8008'  
BC1 Software 0 MG  8009 ? 6 'BINDING SITE FOR RESIDUE MG 0 8009'  
BC2 Software 0 MG  8010 ? 7 'BINDING SITE FOR RESIDUE MG 0 8010'  
BC3 Software 0 MG  8011 ? 6 'BINDING SITE FOR RESIDUE MG 0 8011'  
BC4 Software 0 MG  8012 ? 6 'BINDING SITE FOR RESIDUE MG 0 8012'  
BC5 Software 0 MG  8013 ? 6 'BINDING SITE FOR RESIDUE MG 0 8013'  
BC6 Software 0 MG  8014 ? 6 'BINDING SITE FOR RESIDUE MG 0 8014'  
BC7 Software 0 MG  8015 ? 6 'BINDING SITE FOR RESIDUE MG 0 8015'  
BC8 Software 0 MG  8016 ? 7 'BINDING SITE FOR RESIDUE MG 0 8016'  
BC9 Software 0 MG  8017 ? 3 'BINDING SITE FOR RESIDUE MG 0 8017'  
CC1 Software 0 MG  8018 ? 6 'BINDING SITE FOR RESIDUE MG 0 8018'  
CC2 Software 0 MG  8019 ? 7 'BINDING SITE FOR RESIDUE MG 0 8019'  
CC3 Software 0 MG  8020 ? 6 'BINDING SITE FOR RESIDUE MG 0 8020'  
CC4 Software 0 MG  8021 ? 6 'BINDING SITE FOR RESIDUE MG 0 8021'  
CC5 Software 0 MG  8022 ? 6 'BINDING SITE FOR RESIDUE MG 0 8022'  
CC6 Software 0 MG  8023 ? 6 'BINDING SITE FOR RESIDUE MG 0 8023'  
CC7 Software 0 MG  8024 ? 6 'BINDING SITE FOR RESIDUE MG 0 8024'  
CC8 Software 0 MG  8025 ? 7 'BINDING SITE FOR RESIDUE MG 0 8025'  
CC9 Software 0 MG  8026 ? 6 'BINDING SITE FOR RESIDUE MG 0 8026'  
DC1 Software 0 MG  8027 ? 6 'BINDING SITE FOR RESIDUE MG 0 8027'  
DC2 Software 0 MG  8028 ? 6 'BINDING SITE FOR RESIDUE MG 0 8028'  
DC3 Software 0 MG  8029 ? 7 'BINDING SITE FOR RESIDUE MG 0 8029'  
DC4 Software 0 MG  8030 ? 5 'BINDING SITE FOR RESIDUE MG 0 8030'  
DC5 Software 0 MG  8031 ? 7 'BINDING SITE FOR RESIDUE MG 0 8031'  
DC6 Software 0 MG  8032 ? 6 'BINDING SITE FOR RESIDUE MG 0 8032'  
DC7 Software 0 MG  8033 ? 6 'BINDING SITE FOR RESIDUE MG 0 8033'  
DC8 Software 0 MG  8034 ? 6 'BINDING SITE FOR RESIDUE MG 0 8034'  
DC9 Software 0 MG  8035 ? 5 'BINDING SITE FOR RESIDUE MG 0 8035'  
EC1 Software 0 MG  8036 ? 4 'BINDING SITE FOR RESIDUE MG 0 8036'  
EC2 Software 0 MG  8037 ? 3 'BINDING SITE FOR RESIDUE MG 0 8037'  
EC3 Software 0 MG  8038 ? 2 'BINDING SITE FOR RESIDUE MG 0 8038'  
EC4 Software 0 MG  8039 ? 5 'BINDING SITE FOR RESIDUE MG 0 8039'  
EC5 Software 0 MG  8040 ? 6 'BINDING SITE FOR RESIDUE MG 0 8040'  
EC6 Software 0 MG  8041 ? 6 'BINDING SITE FOR RESIDUE MG 0 8041'  
EC7 Software 0 MG  8043 ? 6 'BINDING SITE FOR RESIDUE MG 0 8043'  
EC8 Software 0 MG  8044 ? 6 'BINDING SITE FOR RESIDUE MG 0 8044'  
EC9 Software 0 MG  8045 ? 6 'BINDING SITE FOR RESIDUE MG 0 8045'  
FC1 Software 0 MG  8046 ? 5 'BINDING SITE FOR RESIDUE MG 0 8046'  
FC2 Software 0 MG  8047 ? 7 'BINDING SITE FOR RESIDUE MG 0 8047'  
FC3 Software 0 MG  8048 ? 6 'BINDING SITE FOR RESIDUE MG 0 8048'  
FC4 Software 0 MG  8049 ? 5 'BINDING SITE FOR RESIDUE MG 0 8049'  
FC5 Software 0 MG  8052 ? 6 'BINDING SITE FOR RESIDUE MG 0 8052'  
FC6 Software 0 MG  8053 ? 7 'BINDING SITE FOR RESIDUE MG 0 8053'  
FC7 Software 0 MG  8055 ? 6 'BINDING SITE FOR RESIDUE MG 0 8055'  
FC8 Software 0 MG  8056 ? 6 'BINDING SITE FOR RESIDUE MG 0 8056'  
FC9 Software 0 MG  8058 ? 6 'BINDING SITE FOR RESIDUE MG 0 8058'  
GC1 Software 0 MG  8059 ? 6 'BINDING SITE FOR RESIDUE MG 0 8059'  
GC2 Software 0 MG  8060 ? 6 'BINDING SITE FOR RESIDUE MG 0 8060'  
GC3 Software 0 MG  8061 ? 6 'BINDING SITE FOR RESIDUE MG 0 8061'  
GC4 Software 0 MG  8062 ? 6 'BINDING SITE FOR RESIDUE MG 0 8062'  
GC5 Software 0 MG  8063 ? 5 'BINDING SITE FOR RESIDUE MG 0 8063'  
GC6 Software 0 MG  8064 ? 6 'BINDING SITE FOR RESIDUE MG 0 8064'  
GC7 Software 0 MG  8065 ? 6 'BINDING SITE FOR RESIDUE MG 0 8065'  
GC8 Software 0 MG  8066 ? 7 'BINDING SITE FOR RESIDUE MG 0 8066'  
GC9 Software 0 MG  8067 ? 6 'BINDING SITE FOR RESIDUE MG 0 8067'  
HC1 Software 0 MG  8068 ? 7 'BINDING SITE FOR RESIDUE MG 0 8068'  
HC2 Software 0 MG  8069 ? 5 'BINDING SITE FOR RESIDUE MG 0 8069'  
HC3 Software 0 MG  8070 ? 7 'BINDING SITE FOR RESIDUE MG 0 8070'  
HC4 Software 0 MG  8071 ? 4 'BINDING SITE FOR RESIDUE MG 0 8071'  
HC5 Software 0 MG  8072 ? 6 'BINDING SITE FOR RESIDUE MG 0 8072'  
HC6 Software 0 MG  8073 ? 4 'BINDING SITE FOR RESIDUE MG 0 8073'  
HC7 Software 0 MG  8075 ? 6 'BINDING SITE FOR RESIDUE MG 0 8075'  
HC8 Software 0 MG  8076 ? 6 'BINDING SITE FOR RESIDUE MG 0 8076'  
HC9 Software 0 MG  8077 ? 6 'BINDING SITE FOR RESIDUE MG 0 8077'  
IC1 Software 0 MG  8078 ? 4 'BINDING SITE FOR RESIDUE MG 0 8078'  
IC2 Software 0 MG  8079 ? 6 'BINDING SITE FOR RESIDUE MG 0 8079'  
IC3 Software 0 MG  8080 ? 6 'BINDING SITE FOR RESIDUE MG 0 8080'  
IC4 Software 0 MG  8081 ? 4 'BINDING SITE FOR RESIDUE MG 0 8081'  
IC5 Software 0 MG  8082 ? 3 'BINDING SITE FOR RESIDUE MG 0 8082'  
IC6 Software 0 MG  8083 ? 7 'BINDING SITE FOR RESIDUE MG 0 8083'  
IC7 Software 0 MG  8084 ? 6 'BINDING SITE FOR RESIDUE MG 0 8084'  
IC8 Software 0 MG  8085 ? 5 'BINDING SITE FOR RESIDUE MG 0 8085'  
IC9 Software 0 MG  8087 ? 6 'BINDING SITE FOR RESIDUE MG 0 8087'  
JC1 Software 0 MG  8088 ? 6 'BINDING SITE FOR RESIDUE MG 0 8088'  
JC2 Software 0 MG  8089 ? 6 'BINDING SITE FOR RESIDUE MG 0 8089'  
JC3 Software 0 MG  8090 ? 5 'BINDING SITE FOR RESIDUE MG 0 8090'  
JC4 Software 0 MG  8091 ? 8 'BINDING SITE FOR RESIDUE MG 0 8091'  
JC5 Software 0 MG  8092 ? 7 'BINDING SITE FOR RESIDUE MG 0 8092'  
JC6 Software 0 MG  8093 ? 6 'BINDING SITE FOR RESIDUE MG 0 8093'  
JC7 Software 0 K   8401 ? 3 'BINDING SITE FOR RESIDUE K 0 8401'   
JC8 Software 0 K   8402 ? 6 'BINDING SITE FOR RESIDUE K 0 8402'   
JC9 Software 0 NA  8501 ? 6 'BINDING SITE FOR RESIDUE NA 0 8501'  
KC1 Software 0 NA  8502 ? 5 'BINDING SITE FOR RESIDUE NA 0 8502'  
KC2 Software 0 NA  8504 ? 6 'BINDING SITE FOR RESIDUE NA 0 8504'  
KC3 Software 0 NA  8505 ? 5 'BINDING SITE FOR RESIDUE NA 0 8505'  
KC4 Software 0 NA  8506 ? 4 'BINDING SITE FOR RESIDUE NA 0 8506'  
KC5 Software 0 NA  8507 ? 6 'BINDING SITE FOR RESIDUE NA 0 8507'  
KC6 Software 0 NA  8508 ? 4 'BINDING SITE FOR RESIDUE NA 0 8508'  
KC7 Software 0 NA  8509 ? 4 'BINDING SITE FOR RESIDUE NA 0 8509'  
KC8 Software 0 NA  8511 ? 5 'BINDING SITE FOR RESIDUE NA 0 8511'  
KC9 Software 0 NA  8512 ? 5 'BINDING SITE FOR RESIDUE NA 0 8512'  
LC1 Software 0 NA  8513 ? 4 'BINDING SITE FOR RESIDUE NA 0 8513'  
LC2 Software 0 NA  8514 ? 4 'BINDING SITE FOR RESIDUE NA 0 8514'  
LC3 Software 0 NA  8515 ? 6 'BINDING SITE FOR RESIDUE NA 0 8515'  
LC4 Software 0 NA  8516 ? 7 'BINDING SITE FOR RESIDUE NA 0 8516'  
LC5 Software 0 NA  8517 ? 7 'BINDING SITE FOR RESIDUE NA 0 8517'  
LC6 Software 0 NA  8519 ? 6 'BINDING SITE FOR RESIDUE NA 0 8519'  
LC7 Software 0 NA  8520 ? 5 'BINDING SITE FOR RESIDUE NA 0 8520'  
LC8 Software 0 NA  8521 ? 7 'BINDING SITE FOR RESIDUE NA 0 8521'  
LC9 Software 0 NA  8522 ? 4 'BINDING SITE FOR RESIDUE NA 0 8522'  
MC1 Software 0 NA  8523 ? 7 'BINDING SITE FOR RESIDUE NA 0 8523'  
MC2 Software 0 NA  8524 ? 6 'BINDING SITE FOR RESIDUE NA 0 8524'  
MC3 Software 0 NA  8525 ? 4 'BINDING SITE FOR RESIDUE NA 0 8525'  
MC4 Software 0 NA  8526 ? 4 'BINDING SITE FOR RESIDUE NA 0 8526'  
MC5 Software 0 NA  8527 ? 5 'BINDING SITE FOR RESIDUE NA 0 8527'  
MC6 Software 0 NA  8528 ? 6 'BINDING SITE FOR RESIDUE NA 0 8528'  
MC7 Software 0 NA  8529 ? 6 'BINDING SITE FOR RESIDUE NA 0 8529'  
MC8 Software 0 NA  8530 ? 6 'BINDING SITE FOR RESIDUE NA 0 8530'  
MC9 Software 0 NA  8531 ? 6 'BINDING SITE FOR RESIDUE NA 0 8531'  
NC1 Software 0 NA  8533 ? 6 'BINDING SITE FOR RESIDUE NA 0 8533'  
NC2 Software 0 NA  8534 ? 7 'BINDING SITE FOR RESIDUE NA 0 8534'  
NC3 Software 0 NA  8535 ? 5 'BINDING SITE FOR RESIDUE NA 0 8535'  
NC4 Software 0 NA  8536 ? 4 'BINDING SITE FOR RESIDUE NA 0 8536'  
NC5 Software 0 NA  8537 ? 7 'BINDING SITE FOR RESIDUE NA 0 8537'  
NC6 Software 0 NA  8541 ? 5 'BINDING SITE FOR RESIDUE NA 0 8541'  
NC7 Software 0 NA  8542 ? 4 'BINDING SITE FOR RESIDUE NA 0 8542'  
NC8 Software 0 NA  8544 ? 4 'BINDING SITE FOR RESIDUE NA 0 8544'  
NC9 Software 0 NA  8545 ? 5 'BINDING SITE FOR RESIDUE NA 0 8545'  
OC1 Software 0 NA  8546 ? 4 'BINDING SITE FOR RESIDUE NA 0 8546'  
OC2 Software 0 NA  8547 ? 5 'BINDING SITE FOR RESIDUE NA 0 8547'  
OC3 Software 0 NA  8548 ? 4 'BINDING SITE FOR RESIDUE NA 0 8548'  
OC4 Software 0 NA  8549 ? 3 'BINDING SITE FOR RESIDUE NA 0 8549'  
OC5 Software 0 NA  8550 ? 6 'BINDING SITE FOR RESIDUE NA 0 8550'  
OC6 Software 0 NA  8551 ? 5 'BINDING SITE FOR RESIDUE NA 0 8551'  
OC7 Software 0 NA  8552 ? 6 'BINDING SITE FOR RESIDUE NA 0 8552'  
OC8 Software 0 NA  8553 ? 6 'BINDING SITE FOR RESIDUE NA 0 8553'  
OC9 Software 0 NA  8554 ? 4 'BINDING SITE FOR RESIDUE NA 0 8554'  
PC1 Software 0 NA  8555 ? 3 'BINDING SITE FOR RESIDUE NA 0 8555'  
PC2 Software 0 NA  8556 ? 6 'BINDING SITE FOR RESIDUE NA 0 8556'  
PC3 Software 0 NA  8557 ? 8 'BINDING SITE FOR RESIDUE NA 0 8557'  
PC4 Software 0 NA  8558 ? 6 'BINDING SITE FOR RESIDUE NA 0 8558'  
PC5 Software 0 NA  8559 ? 3 'BINDING SITE FOR RESIDUE NA 0 8559'  
PC6 Software 0 NA  8560 ? 5 'BINDING SITE FOR RESIDUE NA 0 8560'  
PC7 Software 0 NA  8561 ? 4 'BINDING SITE FOR RESIDUE NA 0 8561'  
PC8 Software 0 NA  8562 ? 5 'BINDING SITE FOR RESIDUE NA 0 8562'  
PC9 Software 0 NA  8563 ? 4 'BINDING SITE FOR RESIDUE NA 0 8563'  
QC1 Software 0 NA  8564 ? 7 'BINDING SITE FOR RESIDUE NA 0 8564'  
QC2 Software 0 NA  8565 ? 4 'BINDING SITE FOR RESIDUE NA 0 8565'  
QC3 Software 0 NA  8566 ? 5 'BINDING SITE FOR RESIDUE NA 0 8566'  
QC4 Software 0 NA  8567 ? 5 'BINDING SITE FOR RESIDUE NA 0 8567'  
QC5 Software 0 NA  8568 ? 7 'BINDING SITE FOR RESIDUE NA 0 8568'  
QC6 Software 0 NA  8569 ? 5 'BINDING SITE FOR RESIDUE NA 0 8569'  
QC7 Software 0 NA  8570 ? 7 'BINDING SITE FOR RESIDUE NA 0 8570'  
QC8 Software 0 NA  8571 ? 2 'BINDING SITE FOR RESIDUE NA 0 8571'  
QC9 Software 0 NA  8573 ? 4 'BINDING SITE FOR RESIDUE NA 0 8573'  
RC1 Software 0 NA  8574 ? 3 'BINDING SITE FOR RESIDUE NA 0 8574'  
RC2 Software 0 CL  8803 ? 3 'BINDING SITE FOR RESIDUE CL 0 8803'  
RC3 Software 0 CL  8805 ? 3 'BINDING SITE FOR RESIDUE CL 0 8805'  
RC4 Software 0 CL  8811 ? 4 'BINDING SITE FOR RESIDUE CL 0 8811'  
RC5 Software 0 CL  8812 ? 6 'BINDING SITE FOR RESIDUE CL 0 8812'  
RC6 Software 0 CL  8813 ? 3 'BINDING SITE FOR RESIDUE CL 0 8813'  
RC7 Software 0 CL  8814 ? 3 'BINDING SITE FOR RESIDUE CL 0 8814'  
RC8 Software 0 CL  8815 ? 3 'BINDING SITE FOR RESIDUE CL 0 8815'  
RC9 Software 0 CL  8816 ? 3 'BINDING SITE FOR RESIDUE CL 0 8816'  
SC1 Software 0 CL  8817 ? 3 'BINDING SITE FOR RESIDUE CL 0 8817'  
SC2 Software 0 CL  8822 ? 3 'BINDING SITE FOR RESIDUE CL 0 8822'  
SC3 Software 0 SR  8901 ? 6 'BINDING SITE FOR RESIDUE SR 0 8901'  
SC4 Software 0 SR  8902 ? 6 'BINDING SITE FOR RESIDUE SR 0 8902'  
SC5 Software 0 SR  8903 ? 6 'BINDING SITE FOR RESIDUE SR 0 8903'  
SC6 Software 0 SR  8904 ? 6 'BINDING SITE FOR RESIDUE SR 0 8904'  
SC7 Software 0 SR  8905 ? 5 'BINDING SITE FOR RESIDUE SR 0 8905'  
SC8 Software 0 SR  8906 ? 4 'BINDING SITE FOR RESIDUE SR 0 8906'  
SC9 Software 0 SR  8907 ? 6 'BINDING SITE FOR RESIDUE SR 0 8907'  
TC1 Software 0 SR  8908 ? 6 'BINDING SITE FOR RESIDUE SR 0 8908'  
TC2 Software 0 SR  8909 ? 6 'BINDING SITE FOR RESIDUE SR 0 8909'  
TC3 Software 0 SR  8910 ? 5 'BINDING SITE FOR RESIDUE SR 0 8910'  
TC4 Software 0 SR  8911 ? 5 'BINDING SITE FOR RESIDUE SR 0 8911'  
TC5 Software 0 SR  8914 ? 3 'BINDING SITE FOR RESIDUE SR 0 8914'  
TC6 Software 0 SR  8915 ? 4 'BINDING SITE FOR RESIDUE SR 0 8915'  
TC7 Software 0 SR  8916 ? 4 'BINDING SITE FOR RESIDUE SR 0 8916'  
TC8 Software 0 SR  8917 ? 3 'BINDING SITE FOR RESIDUE SR 0 8917'  
TC9 Software 0 SR  8918 ? 6 'BINDING SITE FOR RESIDUE SR 0 8918'  
UC1 Software 0 SR  8919 ? 2 'BINDING SITE FOR RESIDUE SR 0 8919'  
UC2 Software 0 SR  8920 ? 2 'BINDING SITE FOR RESIDUE SR 0 8920'  
UC3 Software 0 SR  8921 ? 5 'BINDING SITE FOR RESIDUE SR 0 8921'  
UC4 Software 0 SR  8922 ? 6 'BINDING SITE FOR RESIDUE SR 0 8922'  
UC5 Software 0 SR  8923 ? 6 'BINDING SITE FOR RESIDUE SR 0 8923'  
UC6 Software 0 SR  8924 ? 6 'BINDING SITE FOR RESIDUE SR 0 8924'  
UC7 Software 0 SR  8925 ? 1 'BINDING SITE FOR RESIDUE SR 0 8925'  
UC8 Software 0 SR  8926 ? 3 'BINDING SITE FOR RESIDUE SR 0 8926'  
UC9 Software 0 SR  8927 ? 2 'BINDING SITE FOR RESIDUE SR 0 8927'  
VC1 Software 0 SR  8928 ? 5 'BINDING SITE FOR RESIDUE SR 0 8928'  
VC2 Software 0 SR  8931 ? 3 'BINDING SITE FOR RESIDUE SR 0 8931'  
VC3 Software 0 SR  8933 ? 5 'BINDING SITE FOR RESIDUE SR 0 8933'  
VC4 Software 0 SR  8934 ? 6 'BINDING SITE FOR RESIDUE SR 0 8934'  
VC5 Software 0 SR  8935 ? 5 'BINDING SITE FOR RESIDUE SR 0 8935'  
VC6 Software 0 SR  8936 ? 6 'BINDING SITE FOR RESIDUE SR 0 8936'  
VC7 Software 0 SR  8937 ? 3 'BINDING SITE FOR RESIDUE SR 0 8937'  
VC8 Software 0 SR  8938 ? 2 'BINDING SITE FOR RESIDUE SR 0 8938'  
VC9 Software 0 SR  8939 ? 4 'BINDING SITE FOR RESIDUE SR 0 8939'  
WC1 Software 0 SR  8940 ? 5 'BINDING SITE FOR RESIDUE SR 0 8940'  
WC2 Software 0 SR  8941 ? 5 'BINDING SITE FOR RESIDUE SR 0 8941'  
WC3 Software 0 SR  8942 ? 5 'BINDING SITE FOR RESIDUE SR 0 8942'  
WC4 Software 0 SR  8943 ? 4 'BINDING SITE FOR RESIDUE SR 0 8943'  
WC5 Software 0 SR  8944 ? 2 'BINDING SITE FOR RESIDUE SR 0 8944'  
WC6 Software 0 SR  8945 ? 6 'BINDING SITE FOR RESIDUE SR 0 8945'  
WC7 Software 0 SR  8946 ? 2 'BINDING SITE FOR RESIDUE SR 0 8946'  
WC8 Software 0 SR  8947 ? 3 'BINDING SITE FOR RESIDUE SR 0 8947'  
WC9 Software 0 SR  8948 ? 6 'BINDING SITE FOR RESIDUE SR 0 8948'  
XC1 Software 0 SR  8949 ? 6 'BINDING SITE FOR RESIDUE SR 0 8949'  
XC2 Software 0 SR  8951 ? 1 'BINDING SITE FOR RESIDUE SR 0 8951'  
XC3 Software 0 SR  8953 ? 3 'BINDING SITE FOR RESIDUE SR 0 8953'  
XC4 Software 0 SR  8954 ? 3 'BINDING SITE FOR RESIDUE SR 0 8954'  
XC5 Software 0 SR  8955 ? 3 'BINDING SITE FOR RESIDUE SR 0 8955'  
XC6 Software 0 SR  8956 ? 4 'BINDING SITE FOR RESIDUE SR 0 8956'  
XC7 Software 0 SR  8957 ? 3 'BINDING SITE FOR RESIDUE SR 0 8957'  
XC8 Software 0 SR  8958 ? 4 'BINDING SITE FOR RESIDUE SR 0 8958'  
XC9 Software 0 SR  8959 ? 3 'BINDING SITE FOR RESIDUE SR 0 8959'  
YC1 Software 0 SR  8960 ? 2 'BINDING SITE FOR RESIDUE SR 0 8960'  
YC2 Software 0 SR  8962 ? 5 'BINDING SITE FOR RESIDUE SR 0 8962'  
YC3 Software 0 SR  8963 ? 4 'BINDING SITE FOR RESIDUE SR 0 8963'  
YC4 Software 0 SR  8964 ? 2 'BINDING SITE FOR RESIDUE SR 0 8964'  
YC5 Software 0 SR  8965 ? 6 'BINDING SITE FOR RESIDUE SR 0 8965'  
YC6 Software 0 SR  8966 ? 5 'BINDING SITE FOR RESIDUE SR 0 8966'  
YC7 Software 0 SR  8967 ? 3 'BINDING SITE FOR RESIDUE SR 0 8967'  
YC8 Software 0 SR  8968 ? 3 'BINDING SITE FOR RESIDUE SR 0 8968'  
YC9 Software 0 SR  8969 ? 7 'BINDING SITE FOR RESIDUE SR 0 8969'  
ZC1 Software 0 SR  8970 ? 2 'BINDING SITE FOR RESIDUE SR 0 8970'  
ZC2 Software 0 SR  8973 ? 2 'BINDING SITE FOR RESIDUE SR 0 8973'  
ZC3 Software 0 SR  8974 ? 2 'BINDING SITE FOR RESIDUE SR 0 8974'  
ZC4 Software 0 SR  8975 ? 5 'BINDING SITE FOR RESIDUE SR 0 8975'  
ZC5 Software 0 SR  8976 ? 2 'BINDING SITE FOR RESIDUE SR 0 8976'  
ZC6 Software 0 SR  8978 ? 8 'BINDING SITE FOR RESIDUE SR 0 8978'  
ZC7 Software 0 SR  8979 ? 1 'BINDING SITE FOR RESIDUE SR 0 8979'  
ZC8 Software 0 SR  8981 ? 3 'BINDING SITE FOR RESIDUE SR 0 8981'  
ZC9 Software 0 SR  8982 ? 5 'BINDING SITE FOR RESIDUE SR 0 8982'  
AD1 Software 0 SR  8983 ? 4 'BINDING SITE FOR RESIDUE SR 0 8983'  
AD2 Software 0 SR  8984 ? 5 'BINDING SITE FOR RESIDUE SR 0 8984'  
AD3 Software 0 SR  8985 ? 6 'BINDING SITE FOR RESIDUE SR 0 8985'  
AD4 Software 0 SR  8986 ? 4 'BINDING SITE FOR RESIDUE SR 0 8986'  
AD5 Software 0 SR  8988 ? 2 'BINDING SITE FOR RESIDUE SR 0 8988'  
AD6 Software 0 SR  8989 ? 3 'BINDING SITE FOR RESIDUE SR 0 8989'  
AD7 Software 0 SR  8990 ? 4 'BINDING SITE FOR RESIDUE SR 0 8990'  
AD8 Software 0 SR  8991 ? 2 'BINDING SITE FOR RESIDUE SR 0 8991'  
AD9 Software 0 SR  8992 ? 6 'BINDING SITE FOR RESIDUE SR 0 8992'  
BD1 Software 0 SR  8993 ? 1 'BINDING SITE FOR RESIDUE SR 0 8993'  
BD2 Software 0 SR  8994 ? 2 'BINDING SITE FOR RESIDUE SR 0 8994'  
BD3 Software 0 SR  8995 ? 7 'BINDING SITE FOR RESIDUE SR 0 8995'  
BD4 Software 0 SR  8996 ? 3 'BINDING SITE FOR RESIDUE SR 0 8996'  
BD5 Software 0 SR  8997 ? 3 'BINDING SITE FOR RESIDUE SR 0 8997'  
BD6 Software 0 SR  8998 ? 3 'BINDING SITE FOR RESIDUE SR 0 8998'  
BD7 Software 0 SR  8999 ? 3 'BINDING SITE FOR RESIDUE SR 0 8999'  
BD8 Software 0 SR  9000 ? 1 'BINDING SITE FOR RESIDUE SR 0 9000'  
BD9 Software 0 SR  9001 ? 3 'BINDING SITE FOR RESIDUE SR 0 9001'  
CD1 Software 0 SR  9002 ? 2 'BINDING SITE FOR RESIDUE SR 0 9002'  
CD2 Software 0 SR  9004 ? 2 'BINDING SITE FOR RESIDUE SR 0 9004'  
CD3 Software 0 SR  9006 ? 1 'BINDING SITE FOR RESIDUE SR 0 9006'  
CD4 Software 0 SR  9007 ? 3 'BINDING SITE FOR RESIDUE SR 0 9007'  
CD5 Software 0 SR  9008 ? 4 'BINDING SITE FOR RESIDUE SR 0 9008'  
CD6 Software 9 MG  8074 ? 3 'BINDING SITE FOR RESIDUE MG 9 8074'  
CD7 Software 9 NA  8543 ? 1 'BINDING SITE FOR RESIDUE NA 9 8543'  
CD8 Software 9 NA  8572 ? 6 'BINDING SITE FOR RESIDUE NA 9 8572'  
CD9 Software 9 SR  8980 ? 2 'BINDING SITE FOR RESIDUE SR 9 8980'  
DD1 Software 9 SR  9003 ? 4 'BINDING SITE FOR RESIDUE SR 9 9003'  
DD2 Software A MG  8050 ? 6 'BINDING SITE FOR RESIDUE MG A 8050'  
DD3 Software A MG  8051 ? 6 'BINDING SITE FOR RESIDUE MG A 8051'  
DD4 Software A CL  8809 ? 1 'BINDING SITE FOR RESIDUE CL A 8809'  
DD5 Software A SR  8929 ? 7 'BINDING SITE FOR RESIDUE SR A 8929'  
DD6 Software A SR  8930 ? 5 'BINDING SITE FOR RESIDUE SR A 8930'  
DD7 Software A SR  8977 ? 1 'BINDING SITE FOR RESIDUE SR A 8977'  
DD8 Software B MG  8042 ? 6 'BINDING SITE FOR RESIDUE MG B 8042'  
DD9 Software B CL  8819 ? 4 'BINDING SITE FOR RESIDUE CL B 8819'  
ED1 Software B SR  8950 ? 4 'BINDING SITE FOR RESIDUE SR B 8950'  
ED2 Software B SR  8987 ? 4 'BINDING SITE FOR RESIDUE SR B 8987'  
ED3 Software C NA  8503 ? 4 'BINDING SITE FOR RESIDUE NA C 8503'  
ED4 Software F SR  9005 ? 1 'BINDING SITE FOR RESIDUE SR F 9005'  
ED5 Software H NA  8518 ? 2 'BINDING SITE FOR RESIDUE NA H 8518'  
ED6 Software H SR  8972 ? 6 'BINDING SITE FOR RESIDUE SR H 8972'  
ED7 Software J NA  8538 ? 6 'BINDING SITE FOR RESIDUE NA J 8538'  
ED8 Software J CL  8801 ? 2 'BINDING SITE FOR RESIDUE CL J 8801'  
ED9 Software J CL  8802 ? 2 'BINDING SITE FOR RESIDUE CL J 8802'  
FD1 Software J CL  8821 ? 5 'BINDING SITE FOR RESIDUE CL J 8821'  
FD2 Software K MG  8054 ? 6 'BINDING SITE FOR RESIDUE MG K 8054'  
FD3 Software L CL  8810 ? 1 'BINDING SITE FOR RESIDUE CL L 8810'  
FD4 Software M NA  8539 ? 5 'BINDING SITE FOR RESIDUE NA M 8539'  
FD5 Software M CL  8818 ? 4 'BINDING SITE FOR RESIDUE CL M 8818'  
FD6 Software N CL  8807 ? 4 'BINDING SITE FOR RESIDUE CL N 8807'  
FD7 Software O CD  8705 ? 3 'BINDING SITE FOR RESIDUE CD O 8705'  
FD8 Software O CL  8808 ? 2 'BINDING SITE FOR RESIDUE CL O 8808'  
FD9 Software Q NA  8540 ? 7 'BINDING SITE FOR RESIDUE NA Q 8540'  
GD1 Software R NA  8532 ? 5 'BINDING SITE FOR RESIDUE NA R 8532'  
GD2 Software R NA  8575 ? 5 'BINDING SITE FOR RESIDUE NA R 8575'  
GD3 Software R CL  8806 ? 2 'BINDING SITE FOR RESIDUE CL R 8806'  
GD4 Software R SR  8912 ? 3 'BINDING SITE FOR RESIDUE SR R 8912'  
GD5 Software S NA  8510 ? 3 'BINDING SITE FOR RESIDUE NA S 8510'  
GD6 Software S SR  8961 ? 2 'BINDING SITE FOR RESIDUE SR S 8961'  
GD7 Software T MG  8057 ? 6 'BINDING SITE FOR RESIDUE MG T 8057'  
GD8 Software U CD  8701 ? 4 'BINDING SITE FOR RESIDUE CD U 8701'  
GD9 Software Y MG  8086 ? 7 'BINDING SITE FOR RESIDUE MG Y 8086'  
HD1 Software Y CL  8820 ? 3 'BINDING SITE FOR RESIDUE CL Y 8820'  
HD2 Software Z CD  8703 ? 4 'BINDING SITE FOR RESIDUE CD Z 8703'  
HD3 Software 1 CD  8702 ? 4 'BINDING SITE FOR RESIDUE CD 1 8702'  
HD4 Software 1 SR  8913 ? 6 'BINDING SITE FOR RESIDUE SR 1 8913'  
HD5 Software 1 SR  8952 ? 6 'BINDING SITE FOR RESIDUE SR 1 8952'  
HD6 Software 3 CD  8704 ? 4 'BINDING SITE FOR RESIDUE CD 3 8704'  
HD7 Software 3 CL  8804 ? 1 'BINDING SITE FOR RESIDUE CL 3 8804'  
HD8 Software 3 SR  8932 ? 6 'BINDING SITE FOR RESIDUE SR 3 8932'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1    AC1 8 C   A  839  ? C   0 839  . ? 1_555 ? 
2    AC1 8 A   A  2099 ? A   0 2099 . ? 1_555 ? 
3    AC1 8 A   A  2100 ? A   0 2100 . ? 1_555 ? 
4    AC1 8 A   A  2103 ? A   0 2103 . ? 1_555 ? 
5    AC1 8 A   A  2538 ? A   0 2538 . ? 1_555 ? 
6    AC1 8 G   A  2540 ? G   0 2540 . ? 1_555 ? 
7    AC1 8 U   A  2645 ? U   0 2645 . ? 1_555 ? 
8    AC1 8 G   A  2646 ? G   0 2646 . ? 1_555 ? 
9    AC2 7 G   A  2482 ? G   0 2482 . ? 1_555 ? 
10   AC2 7 A   A  2483 ? A   0 2483 . ? 1_555 ? 
11   AC2 7 C   A  2533 ? C   0 2533 . ? 1_555 ? 
12   AC2 7 C   A  2534 ? C   0 2534 . ? 1_555 ? 
13   AC2 7 HOH ZL .    ? HOH 0 4111 . ? 1_555 ? 
14   AC2 7 HOH ZL .    ? HOH 0 8293 . ? 1_555 ? 
15   AC2 7 HOH ZL .    ? HOH 0 9675 . ? 1_555 ? 
16   AC3 6 G   A  627  ? G   0 627  . ? 1_555 ? 
17   AC3 6 A   A  2483 ? A   0 2483 . ? 1_555 ? 
18   AC3 6 C   A  2534 ? C   0 2534 . ? 1_555 ? 
19   AC3 6 HOH ZL .    ? HOH 0 4813 . ? 1_555 ? 
20   AC3 6 HOH ZL .    ? HOH 0 8271 . ? 1_555 ? 
21   AC3 6 HOH ZL .    ? HOH 0 8272 . ? 1_555 ? 
22   AC4 6 A   A  876  ? A   0 876  . ? 1_555 ? 
23   AC4 6 G   A  877  ? G   0 877  . ? 1_555 ? 
24   AC4 6 A   A  2624 ? A   0 2624 . ? 1_555 ? 
25   AC4 6 HOH ZL .    ? HOH 0 4163 . ? 1_555 ? 
26   AC4 6 HOH BM .    ? HOH A 8980 . ? 1_555 ? 
27   AC4 6 HOH BM .    ? HOH A 8999 . ? 1_555 ? 
28   AC5 6 G   A  456  ? G   0 456  . ? 1_555 ? 
29   AC5 6 A   A  459  ? A   0 459  . ? 1_555 ? 
30   AC5 6 HOH ZL .    ? HOH 0 3279 . ? 1_555 ? 
31   AC5 6 HOH ZL .    ? HOH 0 4278 . ? 1_555 ? 
32   AC5 6 HOH ZL .    ? HOH 0 8278 . ? 1_555 ? 
33   AC5 6 HOH ZL .    ? HOH 0 9545 . ? 1_555 ? 
34   AC6 6 A   A  1836 ? A   0 1836 . ? 1_555 ? 
35   AC6 6 U   A  1838 ? U   0 1838 . ? 1_555 ? 
36   AC6 6 A   A  1839 ? A   0 1839 . ? 1_555 ? 
37   AC6 6 HOH ZL .    ? HOH 0 4108 . ? 1_555 ? 
38   AC6 6 HOH ZL .    ? HOH 0 8294 . ? 1_555 ? 
39   AC6 6 HOH ZL .    ? HOH 0 8295 . ? 1_555 ? 
40   AC7 6 U   A  919  ? U   0 919  . ? 1_555 ? 
41   AC7 6 C   A  2464 ? C   0 2464 . ? 1_555 ? 
42   AC7 6 A   A  2465 ? A   0 2465 . ? 1_555 ? 
43   AC7 6 HOH ZL .    ? HOH 0 4125 . ? 1_555 ? 
44   AC7 6 HOH ZL .    ? HOH 0 8287 . ? 1_555 ? 
45   AC7 6 HOH ZL .    ? HOH 0 8367 . ? 1_555 ? 
46   AC8 7 U   A  2610 ? U   0 2610 . ? 1_555 ? 
47   AC8 7 G   A  2611 ? G   0 2611 . ? 1_555 ? 
48   AC8 7 A   A  2612 ? A   0 2612 . ? 1_555 ? 
49   AC8 7 HOH ZL .    ? HOH 0 4234 . ? 1_555 ? 
50   AC8 7 HOH ZL .    ? HOH 0 7878 . ? 1_555 ? 
51   AC8 7 HOH ZL .    ? HOH 0 8288 . ? 1_555 ? 
52   AC8 7 HOH ZL .    ? HOH 0 8289 . ? 1_555 ? 
53   AC9 6 G   A  28   ? G   0 28   . ? 1_555 ? 
54   AC9 6 HOH ZL .    ? HOH 0 3139 . ? 1_555 ? 
55   AC9 6 HOH ZL .    ? HOH 0 3729 . ? 1_555 ? 
56   AC9 6 HOH ZL .    ? HOH 0 4144 . ? 1_555 ? 
57   AC9 6 HOH ZL .    ? HOH 0 8368 . ? 1_555 ? 
58   AC9 6 HOH ZL .    ? HOH 0 9537 . ? 1_555 ? 
59   BC1 6 G   A  877  ? G   0 877  . ? 1_555 ? 
60   BC1 6 G   A  2623 ? G   0 2623 . ? 1_555 ? 
61   BC1 6 HOH ZL .    ? HOH 0 4138 . ? 1_555 ? 
62   BC1 6 HOH ZL .    ? HOH 0 4151 . ? 1_555 ? 
63   BC1 6 HOH ZL .    ? HOH 0 9519 . ? 1_555 ? 
64   BC1 6 HOH BM .    ? HOH A 9089 . ? 1_555 ? 
65   BC2 7 A   A  2101 ? A   0 2101 . ? 1_555 ? 
66   BC2 7 G   A  2102 ? G   0 2102 . ? 1_555 ? 
67   BC2 7 G   A  2537 ? G   0 2537 . ? 1_555 ? 
68   BC2 7 HOH ZL .    ? HOH 0 4156 . ? 1_555 ? 
69   BC2 7 HOH ZL .    ? HOH 0 4656 . ? 1_555 ? 
70   BC2 7 HOH ZL .    ? HOH 0 8269 . ? 1_555 ? 
71   BC2 7 HOH ZL .    ? HOH 0 9531 . ? 1_555 ? 
72   BC3 6 A   A  844  ? A   0 844  . ? 1_555 ? 
73   BC3 6 A   A  1689 ? A   0 1689 . ? 1_555 ? 
74   BC3 6 HOH ZL .    ? HOH 0 4117 . ? 1_555 ? 
75   BC3 6 HOH ZL .    ? HOH 0 8303 . ? 1_555 ? 
76   BC3 6 HOH ZL .    ? HOH 0 9504 . ? 1_555 ? 
77   BC3 6 HOH ZL .    ? HOH 0 9522 . ? 1_555 ? 
78   BC4 6 G   A  456  ? G   0 456  . ? 1_555 ? 
79   BC4 6 HOH ZL .    ? HOH 0 4435 . ? 1_555 ? 
80   BC4 6 HOH ZL .    ? HOH 0 7845 . ? 1_555 ? 
81   BC4 6 HOH ZL .    ? HOH 0 8279 . ? 1_555 ? 
82   BC4 6 HOH ZL .    ? HOH 0 9915 . ? 1_555 ? 
83   BC4 6 HOH DM .    ? HOH C 8562 . ? 1_555 ? 
84   BC5 6 A   A  2011 ? A   0 2011 . ? 1_555 ? 
85   BC5 6 HOH ZL .    ? HOH 0 4643 . ? 1_555 ? 
86   BC5 6 HOH ZL .    ? HOH 0 7691 . ? 1_555 ? 
87   BC5 6 HOH ZL .    ? HOH 0 8298 . ? 1_555 ? 
88   BC5 6 HOH ZL .    ? HOH 0 8299 . ? 1_555 ? 
89   BC5 6 HOH ZL .    ? HOH 0 8300 . ? 1_555 ? 
90   BC6 6 C   A  1830 ? C   0 1830 . ? 1_555 ? 
91   BC6 6 HOH ZL .    ? HOH 0 8282 . ? 1_555 ? 
92   BC6 6 HOH ZL .    ? HOH 0 8301 . ? 1_555 ? 
93   BC6 6 HOH ZL .    ? HOH 0 9619 . ? 1_555 ? 
94   BC6 6 HOH ZL .    ? HOH 0 9622 . ? 1_555 ? 
95   BC6 6 HOH ZL .    ? HOH 0 9696 . ? 1_555 ? 
96   BC7 6 G   A  2304 ? G   0 2304 . ? 1_555 ? 
97   BC7 6 HOH ZL .    ? HOH 0 3467 . ? 1_555 ? 
98   BC7 6 HOH ZL .    ? HOH 0 4134 . ? 1_555 ? 
99   BC7 6 HOH ZL .    ? HOH 0 4135 . ? 1_555 ? 
100  BC7 6 HOH ZL .    ? HOH 0 8285 . ? 1_555 ? 
101  BC7 6 HOH ZL .    ? HOH 0 8286 . ? 1_555 ? 
102  BC8 7 G   A  2097 ? G   0 2097 . ? 1_555 ? 
103  BC8 7 U   A  2539 ? U   0 2539 . ? 1_555 ? 
104  BC8 7 G   A  2540 ? G   0 2540 . ? 1_555 ? 
105  BC8 7 HOH ZL .    ? HOH 0 4364 . ? 1_555 ? 
106  BC8 7 HOH ZL .    ? HOH 0 8290 . ? 1_555 ? 
107  BC8 7 HOH ZL .    ? HOH 0 9607 . ? 1_555 ? 
108  BC8 7 HOH ZL .    ? HOH 0 9957 . ? 1_555 ? 
109  BC9 3 A   A  1381 ? A   0 1381 . ? 1_555 ? 
110  BC9 3 HOH ZL .    ? HOH 0 3438 . ? 1_555 ? 
111  BC9 3 HOH ZL .    ? HOH 0 5602 . ? 1_555 ? 
112  CC1 6 U   A  1120 ? U   0 1120 . ? 1_555 ? 
113  CC1 6 G   A  1121 ? G   0 1121 . ? 1_555 ? 
114  CC1 6 HOH ZL .    ? HOH 0 4661 . ? 1_555 ? 
115  CC1 6 HOH ZL .    ? HOH 0 8306 . ? 1_555 ? 
116  CC1 6 HOH ZL .    ? HOH 0 8307 . ? 1_555 ? 
117  CC1 6 HOH ZL .    ? HOH 0 8372 . ? 1_555 ? 
118  CC2 7 C   A  2608 ? C   0 2608 . ? 1_555 ? 
119  CC2 7 G   A  2609 ? G   0 2609 . ? 1_555 ? 
120  CC2 7 U   A  2610 ? U   0 2610 . ? 1_555 ? 
121  CC2 7 HOH ZL .    ? HOH 0 8308 . ? 1_555 ? 
122  CC2 7 HOH ZL .    ? HOH 0 8309 . ? 1_555 ? 
123  CC2 7 HOH ZL .    ? HOH 0 8310 . ? 1_555 ? 
124  CC2 7 HOH ZL .    ? HOH 0 9894 . ? 1_555 ? 
125  CC3 6 C   A  240  ? C   0 240  . ? 1_555 ? 
126  CC3 6 G   A  269  ? G   0 269  . ? 1_555 ? 
127  CC3 6 HOH ZL .    ? HOH 0 4367 . ? 1_555 ? 
128  CC3 6 HOH ZL .    ? HOH 0 4508 . ? 1_555 ? 
129  CC3 6 HOH ZL .    ? HOH 0 4648 . ? 1_555 ? 
130  CC3 6 HOH ZL .    ? HOH 0 8373 . ? 1_555 ? 
131  CC4 6 A   A  1448 ? A   0 1448 . ? 1_555 ? 
132  CC4 6 U   A  1677 ? U   0 1677 . ? 1_555 ? 
133  CC4 6 HOH ZL .    ? HOH 0 4175 . ? 1_555 ? 
134  CC4 6 HOH ZL .    ? HOH 0 4196 . ? 1_555 ? 
135  CC4 6 HOH ZL .    ? HOH 0 4207 . ? 1_555 ? 
136  CC4 6 HOH TM .    ? HOH S 8993 . ? 1_555 ? 
137  CC5 6 U   A  1503 ? U   0 1503 . ? 1_555 ? 
138  CC5 6 A   A  1504 ? A   0 1504 . ? 1_555 ? 
139  CC5 6 C   A  1679 ? C   0 1679 . ? 1_555 ? 
140  CC5 6 HOH ZL .    ? HOH 0 8312 . ? 1_555 ? 
141  CC5 6 HOH ZL .    ? HOH 0 8313 . ? 1_555 ? 
142  CC5 6 HOH ZL .    ? HOH 0 8314 . ? 1_555 ? 
143  CC6 6 U   A  1748 ? U   0 1748 . ? 1_555 ? 
144  CC6 6 U   A  1749 ? U   0 1749 . ? 1_555 ? 
145  CC6 6 HOH ZL .    ? HOH 0 4136 . ? 1_555 ? 
146  CC6 6 HOH ZL .    ? HOH 0 8280 . ? 1_555 ? 
147  CC6 6 HOH ZL .    ? HOH 0 8281 . ? 1_555 ? 
148  CC6 6 HOH ZL .    ? HOH 0 8291 . ? 1_555 ? 
149  CC7 6 U   A  777  ? U   0 777  . ? 1_555 ? 
150  CC7 6 C   A  778  ? C   0 778  . ? 1_555 ? 
151  CC7 6 HOH ZL .    ? HOH 0 3777 . ? 1_555 ? 
152  CC7 6 HOH ZL .    ? HOH 0 8317 . ? 1_555 ? 
153  CC7 6 SR  PH .    ? SR  0 8934 . ? 1_555 ? 
154  CC7 6 HOH BN .    ? HOH 1 9002 . ? 1_555 ? 
155  CC8 7 U   A  2115 ? U   0 2115 . ? 1_555 ? 
156  CC8 7 HOH ZL .    ? HOH 0 3492 . ? 1_555 ? 
157  CC8 7 HOH ZL .    ? HOH 0 4284 . ? 1_555 ? 
158  CC8 7 HOH ZL .    ? HOH 0 4682 . ? 1_555 ? 
159  CC8 7 ALA C  197  ? ALA A 196  . ? 1_555 ? 
160  CC8 7 HOH BM .    ? HOH A 9015 . ? 1_555 ? 
161  CC8 7 HOH BM .    ? HOH A 9090 . ? 1_555 ? 
162  CC9 6 G   A  956  ? G   0 956  . ? 1_555 ? 
163  CC9 6 HOH ZL .    ? HOH 0 4167 . ? 1_555 ? 
164  CC9 6 HOH ZL .    ? HOH 0 8321 . ? 1_555 ? 
165  CC9 6 HOH ZL .    ? HOH 0 8322 . ? 1_555 ? 
166  CC9 6 HOH ZL .    ? HOH 0 8323 . ? 1_555 ? 
167  CC9 6 HOH ZL .    ? HOH 0 9866 . ? 1_555 ? 
168  DC1 6 A   A  2553 ? A   0 2553 . ? 1_555 ? 
169  DC1 6 HOH ZL .    ? HOH 0 3637 . ? 1_555 ? 
170  DC1 6 HOH ZL .    ? HOH 0 3713 . ? 1_555 ? 
171  DC1 6 HOH ZL .    ? HOH 0 4145 . ? 1_555 ? 
172  DC1 6 HOH ZL .    ? HOH 0 8377 . ? 1_555 ? 
173  DC1 6 HOH ZL .    ? HOH 0 9574 . ? 1_555 ? 
174  DC2 6 HOH ZL .    ? HOH 0 4121 . ? 1_555 ? 
175  DC2 6 HOH ZL .    ? HOH 0 4146 . ? 1_555 ? 
176  DC2 6 HOH ZL .    ? HOH 0 4168 . ? 1_555 ? 
177  DC2 6 HOH ZL .    ? HOH 0 4170 . ? 1_555 ? 
178  DC2 6 HOH ZL .    ? HOH 0 8325 . ? 1_555 ? 
179  DC2 6 HOH ZL .    ? HOH 0 9780 . ? 1_555 ? 
180  DC3 7 A   A  114  ? A   0 114  . ? 1_555 ? 
181  DC3 7 U   A  115  ? U   0 115  . ? 1_555 ? 
182  DC3 7 HOH ZL .    ? HOH 0 3413 . ? 1_555 ? 
183  DC3 7 HOH ZL .    ? HOH 0 4458 . ? 1_555 ? 
184  DC3 7 HOH ZL .    ? HOH 0 5579 . ? 1_555 ? 
185  DC3 7 HOH ZL .    ? HOH 0 8326 . ? 1_555 ? 
186  DC3 7 HOH ZL .    ? HOH 0 8327 . ? 1_555 ? 
187  DC4 5 U   A  392  ? U   0 392  . ? 1_555 ? 
188  DC4 5 HOH ZL .    ? HOH 0 3193 . ? 1_555 ? 
189  DC4 5 HOH ZL .    ? HOH 0 4285 . ? 1_555 ? 
190  DC4 5 HOH ZL .    ? HOH 0 5133 . ? 1_555 ? 
191  DC4 5 HOH ZL .    ? HOH 0 8379 . ? 1_555 ? 
192  DC5 7 C   A  195  ? C   0 195  . ? 1_555 ? 
193  DC5 7 G   A  196  ? G   0 196  . ? 1_555 ? 
194  DC5 7 A   A  227  ? A   0 227  . ? 1_555 ? 
195  DC5 7 C   A  228  ? C   0 228  . ? 1_555 ? 
196  DC5 7 HOH ZL .    ? HOH 0 4599 . ? 1_555 ? 
197  DC5 7 HOH ZL .    ? HOH 0 4693 . ? 1_555 ? 
198  DC5 7 HOH ZL .    ? HOH 0 5856 . ? 1_555 ? 
199  DC6 6 U   A  1309 ? U   0 1309 . ? 1_555 ? 
200  DC6 6 U   A  1346 ? U   0 1346 . ? 1_555 ? 
201  DC6 6 HOH ZL .    ? HOH 0 4154 . ? 1_555 ? 
202  DC6 6 HOH ZL .    ? HOH 0 4910 . ? 1_555 ? 
203  DC6 6 HOH ZL .    ? HOH 0 8328 . ? 1_555 ? 
204  DC6 6 HOH ZL .    ? HOH 0 9937 . ? 1_555 ? 
205  DC7 6 G   A  816  ? G   0 816  . ? 1_555 ? 
206  DC7 6 G   A  817  ? G   0 817  . ? 1_555 ? 
207  DC7 6 HOH ZL .    ? HOH 0 3315 . ? 1_555 ? 
208  DC7 6 HOH ZL .    ? HOH 0 7869 . ? 1_555 ? 
209  DC7 6 MG  ED .    ? MG  0 8083 . ? 1_555 ? 
210  DC7 6 HOH ZL .    ? HOH 0 8381 . ? 1_555 ? 
211  DC8 6 C   A  2048 ? C   0 2048 . ? 1_555 ? 
212  DC8 6 C   A  2088 ? C   0 2088 . ? 1_555 ? 
213  DC8 6 A   A  2089 ? A   0 2089 . ? 1_555 ? 
214  DC8 6 HOH ZL .    ? HOH 0 3796 . ? 1_555 ? 
215  DC8 6 GLY T  66   ? GLY R 65   . ? 1_555 ? 
216  DC8 6 HOH SM .    ? HOH R 8999 . ? 1_555 ? 
217  DC9 5 G   A  1979 ? G   0 1979 . ? 1_555 ? 
218  DC9 5 HOH ZL .    ? HOH 0 8329 . ? 1_555 ? 
219  DC9 5 HOH ZL .    ? HOH 0 8382 . ? 1_555 ? 
220  DC9 5 HOH ZL .    ? HOH 0 8383 . ? 1_555 ? 
221  DC9 5 HOH ZL .    ? HOH 0 8384 . ? 1_555 ? 
222  EC1 4 G   A  1794 ? G   0 1794 . ? 1_555 ? 
223  EC1 4 HOH ZL .    ? HOH 0 7750 . ? 1_555 ? 
224  EC1 4 HOH ZL .    ? HOH 0 8385 . ? 1_555 ? 
225  EC1 4 HOH ZL .    ? HOH 0 8386 . ? 1_555 ? 
226  EC2 3 A   A  1098 ? A   0 1098 . ? 1_555 ? 
227  EC2 3 HOH ZL .    ? HOH 0 6743 . ? 1_555 ? 
228  EC2 3 HOH ZL .    ? HOH 0 8400 . ? 1_555 ? 
229  EC3 2 C   A  2248 ? C   0 2248 . ? 1_555 ? 
230  EC3 2 HOH ZL .    ? HOH 0 7775 . ? 1_555 ? 
231  EC4 5 G   A  641  ? G   0 641  . ? 1_555 ? 
232  EC4 5 A   A  1355 ? A   0 1355 . ? 1_555 ? 
233  EC4 5 HOH ZL .    ? HOH 0 4594 . ? 1_555 ? 
234  EC4 5 HOH ZL .    ? HOH 0 8330 . ? 1_555 ? 
235  EC4 5 HOH ZL .    ? HOH 0 8331 . ? 1_555 ? 
236  EC5 6 U   A  1125 ? U   0 1125 . ? 1_555 ? 
237  EC5 6 HOH ZL .    ? HOH 0 4119 . ? 1_555 ? 
238  EC5 6 HOH ZL .    ? HOH 0 8404 . ? 1_555 ? 
239  EC5 6 G   B  92   ? G   9 92   . ? 1_555 ? 
240  EC5 6 HOH AM .    ? HOH 9 9010 . ? 1_555 ? 
241  EC5 6 HOH AM .    ? HOH 9 9039 . ? 1_555 ? 
242  EC6 6 C   A  162  ? C   0 162  . ? 1_555 ? 
243  EC6 6 U   A  2276 ? U   0 2276 . ? 1_555 ? 
244  EC6 6 HOH ZL .    ? HOH 0 8284 . ? 1_555 ? 
245  EC6 6 HOH ZL .    ? HOH 0 8332 . ? 1_555 ? 
246  EC6 6 HOH ZL .    ? HOH 0 8333 . ? 1_555 ? 
247  EC6 6 HOH ZL .    ? HOH 0 9933 . ? 1_555 ? 
248  EC7 6 A   A  2757 ? A   0 2757 . ? 1_555 ? 
249  EC7 6 HOH ZL .    ? HOH 0 4165 . ? 1_555 ? 
250  EC7 6 HOH ZL .    ? HOH 0 4467 . ? 1_555 ? 
251  EC7 6 HOH ZL .    ? HOH 0 8351 . ? 1_555 ? 
252  EC7 6 ASN D  336  ? ASN B 335  . ? 1_555 ? 
253  EC7 6 HOH CM .    ? HOH B 9010 . ? 1_555 ? 
254  EC8 6 U   A  1883 ? U   0 1883 . ? 1_555 ? 
255  EC8 6 U   A  2012 ? U   0 2012 . ? 1_555 ? 
256  EC8 6 G   A  2013 ? G   0 2013 . ? 1_555 ? 
257  EC8 6 HOH ZL .    ? HOH 0 5492 . ? 1_555 ? 
258  EC8 6 GLN C  208  ? GLN A 207  . ? 1_555 ? 
259  EC8 6 HOH BM .    ? HOH A 9093 . ? 1_555 ? 
260  EC9 6 G   A  2013 ? G   0 2013 . ? 1_555 ? 
261  EC9 6 HOH ZL .    ? HOH 0 4259 . ? 1_555 ? 
262  EC9 6 HOH ZL .    ? HOH 0 8334 . ? 1_555 ? 
263  EC9 6 HOH ZL .    ? HOH 0 8335 . ? 1_555 ? 
264  EC9 6 HOH BM .    ? HOH A 9091 . ? 1_555 ? 
265  EC9 6 HOH BM .    ? HOH A 9093 . ? 1_555 ? 
266  FC1 5 G   A  2618 ? G   0 2618 . ? 1_555 ? 
267  FC1 5 HOH ZL .    ? HOH 0 4218 . ? 1_555 ? 
268  FC1 5 HOH ZL .    ? HOH 0 4545 . ? 1_555 ? 
269  FC1 5 HOH ZL .    ? HOH 0 9536 . ? 1_555 ? 
270  FC1 5 HOH ZL .    ? HOH 0 9540 . ? 1_555 ? 
271  FC2 7 G   A  175  ? G   0 175  . ? 1_555 ? 
272  FC2 7 U   A  224  ? U   0 224  . ? 1_555 ? 
273  FC2 7 G   A  393  ? G   0 393  . ? 1_555 ? 
274  FC2 7 HOH ZL .    ? HOH 0 8336 . ? 1_555 ? 
275  FC2 7 HOH ZL .    ? HOH 0 8337 . ? 1_555 ? 
276  FC2 7 HOH ZL .    ? HOH 0 8338 . ? 1_555 ? 
277  FC2 7 HOH ZL .    ? HOH 0 9668 . ? 1_555 ? 
278  FC3 6 A   A  1369 ? A   0 1369 . ? 1_555 ? 
279  FC3 6 U   A  2650 ? U   0 2650 . ? 1_555 ? 
280  FC3 6 HOH ZL .    ? HOH 0 3322 . ? 1_555 ? 
281  FC3 6 HOH ZL .    ? HOH 0 8339 . ? 1_555 ? 
282  FC3 6 HOH ZL .    ? HOH 0 8340 . ? 1_555 ? 
283  FC3 6 HOH ZL .    ? HOH 0 8341 . ? 1_555 ? 
284  FC4 5 HOH ZL .    ? HOH 0 4673 . ? 1_555 ? 
285  FC4 5 HOH ZL .    ? HOH 0 7468 . ? 1_555 ? 
286  FC4 5 HOH ZL .    ? HOH 0 7885 . ? 1_555 ? 
287  FC4 5 HOH ZL .    ? HOH 0 8277 . ? 1_555 ? 
288  FC4 5 HOH ZL .    ? HOH 0 8350 . ? 1_555 ? 
289  FC5 6 A   A  1845 ? A   0 1845 . ? 1_555 ? 
290  FC5 6 U   A  1846 ? U   0 1846 . ? 1_555 ? 
291  FC5 6 G   A  1884 ? G   0 1884 . ? 1_555 ? 
292  FC5 6 HOH ZL .    ? HOH 0 8343 . ? 1_555 ? 
293  FC5 6 ASN C  189  ? ASN A 188  . ? 1_555 ? 
294  FC5 6 ARG C  191  ? ARG A 190  . ? 1_555 ? 
295  FC6 7 A   A  2568 ? A   0 2568 . ? 1_555 ? 
296  FC6 7 HOH ZL .    ? HOH 0 3235 . ? 1_555 ? 
297  FC6 7 HOH ZL .    ? HOH 0 4247 . ? 1_555 ? 
298  FC6 7 HOH ZL .    ? HOH 0 5309 . ? 1_555 ? 
299  FC6 7 HOH ZL .    ? HOH 0 6694 . ? 1_555 ? 
300  FC6 7 HOH ZL .    ? HOH 0 7134 . ? 1_555 ? 
301  FC6 7 HOH ZL .    ? HOH 0 8406 . ? 1_555 ? 
302  FC7 6 A   A  166  ? A   0 166  . ? 1_555 ? 
303  FC7 6 G   A  219  ? G   0 219  . ? 1_555 ? 
304  FC7 6 HOH ZL .    ? HOH 0 4310 . ? 1_555 ? 
305  FC7 6 HOH ZL .    ? HOH 0 5440 . ? 1_555 ? 
306  FC7 6 HOH ZL .    ? HOH 0 6072 . ? 1_555 ? 
307  FC7 6 HOH ZL .    ? HOH 0 9620 . ? 1_555 ? 
308  FC8 6 U   A  954  ? U   0 954  . ? 1_555 ? 
309  FC8 6 C   A  2298 ? C   0 2298 . ? 1_555 ? 
310  FC8 6 HOH ZL .    ? HOH 0 4490 . ? 1_555 ? 
311  FC8 6 HOH ZL .    ? HOH 0 7868 . ? 1_555 ? 
312  FC8 6 HOH ZL .    ? HOH 0 8347 . ? 1_555 ? 
313  FC8 6 HOH ZL .    ? HOH 0 8407 . ? 1_555 ? 
314  FC9 6 A   A  1286 ? A   0 1286 . ? 1_555 ? 
315  FC9 6 A   A  1287 ? A   0 1287 . ? 1_555 ? 
316  FC9 6 HOH ZL .    ? HOH 0 8344 . ? 1_555 ? 
317  FC9 6 HOH ZL .    ? HOH 0 8345 . ? 1_555 ? 
318  FC9 6 HOH ZL .    ? HOH 0 8408 . ? 1_555 ? 
319  FC9 6 HOH XM .    ? HOH W 7874 . ? 1_555 ? 
320  GC1 6 A   A  907  ? A   0 907  . ? 1_555 ? 
321  GC1 6 A   A  908  ? A   0 908  . ? 1_555 ? 
322  GC1 6 HOH ZL .    ? HOH 0 4133 . ? 1_555 ? 
323  GC1 6 HOH ZL .    ? HOH 0 4408 . ? 1_555 ? 
324  GC1 6 HOH ZL .    ? HOH 0 5418 . ? 1_555 ? 
325  GC1 6 HOH ZL .    ? HOH 0 8346 . ? 1_555 ? 
326  GC2 6 HOH ZL .    ? HOH 0 7313 . ? 1_555 ? 
327  GC2 6 HOH ZL .    ? HOH 0 8352 . ? 1_555 ? 
328  GC2 6 HOH ZL .    ? HOH 0 8353 . ? 1_555 ? 
329  GC2 6 HOH ZL .    ? HOH 0 8409 . ? 1_555 ? 
330  GC2 6 HOH ZL .    ? HOH 0 8410 . ? 1_555 ? 
331  GC2 6 HOH CN .    ? HOH 2 7875 . ? 1_555 ? 
332  GC3 6 A   A  165  ? A   0 165  . ? 1_555 ? 
333  GC3 6 A   A  167  ? A   0 167  . ? 1_555 ? 
334  GC3 6 C   A  168  ? C   0 168  . ? 1_555 ? 
335  GC3 6 HOH ZL .    ? HOH 0 4107 . ? 1_555 ? 
336  GC3 6 HOH ZL .    ? HOH 0 4112 . ? 1_555 ? 
337  GC3 6 HOH ZL .    ? HOH 0 4124 . ? 1_555 ? 
338  GC4 6 A   A  1684 ? A   0 1684 . ? 1_555 ? 
339  GC4 6 U   A  1724 ? U   0 1724 . ? 1_555 ? 
340  GC4 6 HOH ZL .    ? HOH 0 4697 . ? 1_555 ? 
341  GC4 6 HOH ZL .    ? HOH 0 4981 . ? 1_555 ? 
342  GC4 6 HOH ZL .    ? HOH 0 8356 . ? 1_555 ? 
343  GC4 6 HOH ZL .    ? HOH 0 8413 . ? 1_555 ? 
344  GC5 5 C   A  1436 ? C   0 1436 . ? 1_555 ? 
345  GC5 5 A   A  1437 ? A   0 1437 . ? 1_555 ? 
346  GC5 5 HOH ZL .    ? HOH 0 5637 . ? 1_555 ? 
347  GC5 5 HOH ZL .    ? HOH 0 5721 . ? 1_555 ? 
348  GC5 5 HOH ZL .    ? HOH 0 8421 . ? 1_555 ? 
349  GC6 6 A   A  1754 ? A   0 1754 . ? 1_555 ? 
350  GC6 6 HOH ZL .    ? HOH 0 4204 . ? 1_555 ? 
351  GC6 6 HOH ZL .    ? HOH 0 4644 . ? 1_555 ? 
352  GC6 6 HOH ZL .    ? HOH 0 6828 . ? 1_555 ? 
353  GC6 6 HOH ZL .    ? HOH 0 8357 . ? 1_555 ? 
354  GC6 6 HOH ZL .    ? HOH 0 8414 . ? 1_555 ? 
355  GC7 6 A   A  1742 ? A   0 1742 . ? 1_555 ? 
356  GC7 6 HOH ZL .    ? HOH 0 3254 . ? 1_555 ? 
357  GC7 6 HOH ZL .    ? HOH 0 4130 . ? 1_555 ? 
358  GC7 6 HOH ZL .    ? HOH 0 8358 . ? 1_555 ? 
359  GC7 6 HOH ZL .    ? HOH 0 9749 . ? 1_555 ? 
360  GC7 6 HOH ZL .    ? HOH 0 9873 . ? 1_555 ? 
361  GC8 7 G   A  2617 ? G   0 2617 . ? 1_555 ? 
362  GC8 7 G   A  2618 ? G   0 2618 . ? 1_555 ? 
363  GC8 7 HOH ZL .    ? HOH 0 3104 . ? 1_555 ? 
364  GC8 7 HOH ZL .    ? HOH 0 4283 . ? 1_555 ? 
365  GC8 7 HOH ZL .    ? HOH 0 4848 . ? 1_555 ? 
366  GC8 7 HOH ZL .    ? HOH 0 4974 . ? 1_555 ? 
367  GC8 7 HOH ZL .    ? HOH 0 9536 . ? 1_555 ? 
368  GC9 6 G   A  2540 ? G   0 2540 . ? 1_555 ? 
369  GC9 6 G   A  2611 ? G   0 2611 . ? 1_555 ? 
370  GC9 6 HOH ZL .    ? HOH 0 3546 . ? 1_555 ? 
371  GC9 6 HOH ZL .    ? HOH 0 4781 . ? 1_555 ? 
372  GC9 6 NA  TE .    ? NA  0 8534 . ? 1_555 ? 
373  GC9 6 HOH ZL .    ? HOH 0 9561 . ? 1_555 ? 
374  HC1 7 C   A  515  ? C   0 515  . ? 1_555 ? 
375  HC1 7 A   A  516  ? A   0 516  . ? 1_555 ? 
376  HC1 7 U   A  517  ? U   0 517  . ? 1_555 ? 
377  HC1 7 G   A  518  ? G   0 518  . ? 1_555 ? 
378  HC1 7 HOH ZL .    ? HOH 0 8361 . ? 1_555 ? 
379  HC1 7 HOH ZL .    ? HOH 0 8415 . ? 1_555 ? 
380  HC1 7 HOH ZL .    ? HOH 0 8416 . ? 1_555 ? 
381  HC2 5 A   A  2103 ? A   0 2103 . ? 1_555 ? 
382  HC2 5 U   A  2478 ? U   0 2478 . ? 1_555 ? 
383  HC2 5 HOH ZL .    ? HOH 0 4110 . ? 1_555 ? 
384  HC2 5 HOH ZL .    ? HOH 0 4290 . ? 1_555 ? 
385  HC2 5 HOH ZL .    ? HOH 0 6457 . ? 1_555 ? 
386  HC3 7 G   A  918  ? G   0 918  . ? 1_555 ? 
387  HC3 7 C   A  2294 ? C   0 2294 . ? 1_555 ? 
388  HC3 7 HOH ZL .    ? HOH 0 3049 . ? 1_555 ? 
389  HC3 7 HOH ZL .    ? HOH 0 3824 . ? 1_555 ? 
390  HC3 7 HOH ZL .    ? HOH 0 6950 . ? 1_555 ? 
391  HC3 7 HOH ZL .    ? HOH 0 8362 . ? 1_555 ? 
392  HC3 7 HOH ZL .    ? HOH 0 9588 . ? 1_555 ? 
393  HC4 4 A   A  1843 ? A   0 1843 . ? 1_555 ? 
394  HC4 4 C   A  1844 ? C   0 1844 . ? 1_555 ? 
395  HC4 4 HOH ZL .    ? HOH 0 4141 . ? 1_555 ? 
396  HC4 4 HOH ZL .    ? HOH 0 8417 . ? 1_555 ? 
397  HC5 6 A   A  1070 ? A   0 1070 . ? 1_555 ? 
398  HC5 6 G   A  1071 ? G   0 1071 . ? 1_555 ? 
399  HC5 6 HOH ZL .    ? HOH 0 3186 . ? 1_555 ? 
400  HC5 6 HOH ZL .    ? HOH 0 4147 . ? 1_555 ? 
401  HC5 6 HOH ZL .    ? HOH 0 4179 . ? 1_555 ? 
402  HC5 6 HOH ZL .    ? HOH 0 4219 . ? 1_555 ? 
403  HC6 4 U   A  1096 ? U   0 1096 . ? 1_555 ? 
404  HC6 4 C   A  1257 ? C   0 1257 . ? 1_555 ? 
405  HC6 4 HOH ZL .    ? HOH 0 8363 . ? 1_555 ? 
406  HC6 4 HOH ZL .    ? HOH 0 8418 . ? 1_555 ? 
407  HC7 6 G   A  1848 ? G   0 1848 . ? 1_555 ? 
408  HC7 6 G   A  1849 ? G   0 1849 . ? 1_555 ? 
409  HC7 6 HOH ZL .    ? HOH 0 4160 . ? 1_555 ? 
410  HC7 6 HOH ZL .    ? HOH 0 4197 . ? 1_555 ? 
411  HC7 6 HOH ZL .    ? HOH 0 4328 . ? 1_555 ? 
412  HC7 6 HOH ZL .    ? HOH 0 4359 . ? 1_555 ? 
413  HC8 6 G   A  863  ? G   0 863  . ? 1_555 ? 
414  HC8 6 U   A  864  ? U   0 864  . ? 1_555 ? 
415  HC8 6 HOH ZL .    ? HOH 0 3840 . ? 1_555 ? 
416  HC8 6 HOH ZL .    ? HOH 0 4169 . ? 1_555 ? 
417  HC8 6 HOH ZL .    ? HOH 0 4173 . ? 1_555 ? 
418  HC8 6 HOH ZL .    ? HOH 0 6033 . ? 1_555 ? 
419  HC9 6 A   A  907  ? A   0 907  . ? 1_555 ? 
420  HC9 6 HOH ZL .    ? HOH 0 3444 . ? 1_555 ? 
421  HC9 6 HOH ZL .    ? HOH 0 3868 . ? 1_555 ? 
422  HC9 6 HOH ZL .    ? HOH 0 4181 . ? 1_555 ? 
423  HC9 6 HOH ZL .    ? HOH 0 4243 . ? 1_555 ? 
424  HC9 6 HOH ZM .    ? HOH Y 8867 . ? 1_555 ? 
425  IC1 4 A   A  2612 ? A   0 2612 . ? 1_555 ? 
426  IC1 4 HOH ZL .    ? HOH 0 3515 . ? 1_555 ? 
427  IC1 4 HOH ZL .    ? HOH 0 4164 . ? 1_555 ? 
428  IC1 4 HOH ZL .    ? HOH 0 4176 . ? 1_555 ? 
429  IC2 6 U   A  2107 ? U   0 2107 . ? 1_555 ? 
430  IC2 6 C   A  2281 ? C   0 2281 . ? 1_555 ? 
431  IC2 6 U   A  2282 ? U   0 2282 . ? 1_555 ? 
432  IC2 6 HOH ZL .    ? HOH 0 4242 . ? 1_555 ? 
433  IC2 6 HOH ZL .    ? HOH 0 5111 . ? 1_555 ? 
434  IC2 6 HOH ZL .    ? HOH 0 7369 . ? 1_555 ? 
435  IC3 6 A   A  2434 ? A   0 2434 . ? 1_555 ? 
436  IC3 6 U   A  2458 ? U   0 2458 . ? 1_555 ? 
437  IC3 6 HOH ZL .    ? HOH 0 3395 . ? 1_555 ? 
438  IC3 6 HOH ZL .    ? HOH 0 8426 . ? 1_555 ? 
439  IC3 6 HOH ZL .    ? HOH 0 9752 . ? 1_555 ? 
440  IC3 6 HOH DN .    ? HOH 3 8950 . ? 1_555 ? 
441  IC4 4 A   A  2577 ? A   0 2577 . ? 1_555 ? 
442  IC4 4 G   A  2578 ? G   0 2578 . ? 1_555 ? 
443  IC4 4 G   A  2579 ? G   0 2579 . ? 1_555 ? 
444  IC4 4 HOH ZL .    ? HOH 0 8419 . ? 1_555 ? 
445  IC5 3 C   A  2104 ? C   0 2104 . ? 1_555 ? 
446  IC5 3 C   A  2105 ? C   0 2105 . ? 1_555 ? 
447  IC5 3 HOH ZL .    ? HOH 0 8274 . ? 1_555 ? 
448  IC6 7 G   A  817  ? G   0 817  . ? 1_555 ? 
449  IC6 7 HOH ZL .    ? HOH 0 4096 . ? 1_555 ? 
450  IC6 7 HOH ZL .    ? HOH 0 7864 . ? 1_555 ? 
451  IC6 7 HOH ZL .    ? HOH 0 7869 . ? 1_555 ? 
452  IC6 7 MG  MB .    ? MG  0 8033 . ? 1_555 ? 
453  IC6 7 HOH ZL .    ? HOH 0 8381 . ? 1_555 ? 
454  IC6 7 HOH QM .    ? HOH P 185  . ? 1_555 ? 
455  IC7 6 A   A  1106 ? A   0 1106 . ? 1_555 ? 
456  IC7 6 A   A  1107 ? A   0 1107 . ? 1_555 ? 
457  IC7 6 HOH ZL .    ? HOH 0 8390 . ? 1_555 ? 
458  IC7 6 HOH ZL .    ? HOH 0 8391 . ? 1_555 ? 
459  IC7 6 HOH ZL .    ? HOH 0 8392 . ? 1_555 ? 
460  IC7 6 HOH ZL .    ? HOH 0 8393 . ? 1_555 ? 
461  IC8 5 HOH ZL .    ? HOH 0 6570 . ? 1_555 ? 
462  IC8 5 HOH ZL .    ? HOH 0 7939 . ? 1_555 ? 
463  IC8 5 HOH ZL .    ? HOH 0 8395 . ? 1_555 ? 
464  IC8 5 HOH ZL .    ? HOH 0 8396 . ? 1_555 ? 
465  IC8 5 HOH ZL .    ? HOH 0 8397 . ? 1_555 ? 
466  IC9 6 U   A  903  ? U   0 903  . ? 1_555 ? 
467  IC9 6 A   A  1357 ? A   0 1357 . ? 1_555 ? 
468  IC9 6 HOH ZL .    ? HOH 0 3010 . ? 1_555 ? 
469  IC9 6 HOH ZL .    ? HOH 0 4418 . ? 1_555 ? 
470  IC9 6 HOH ZL .    ? HOH 0 5880 . ? 1_555 ? 
471  IC9 6 HOH ZL .    ? HOH 0 6508 . ? 1_555 ? 
472  JC1 6 A   A  187  ? A   0 187  . ? 1_555 ? 
473  JC1 6 HOH ZL .    ? HOH 0 3071 . ? 1_555 ? 
474  JC1 6 HOH ZL .    ? HOH 0 4222 . ? 1_555 ? 
475  JC1 6 HOH ZL .    ? HOH 0 4263 . ? 1_555 ? 
476  JC1 6 HOH ZL .    ? HOH 0 9626 . ? 1_555 ? 
477  JC1 6 HOH ZL .    ? HOH 0 9828 . ? 1_555 ? 
478  JC2 6 A   A  2112 ? A   0 2112 . ? 1_555 ? 
479  JC2 6 HOH ZL .    ? HOH 0 3092 . ? 1_555 ? 
480  JC2 6 HOH ZL .    ? HOH 0 4248 . ? 1_555 ? 
481  JC2 6 HOH ZL .    ? HOH 0 4416 . ? 1_555 ? 
482  JC2 6 HOH ZL .    ? HOH 0 6602 . ? 1_555 ? 
483  JC2 6 HOH ZL .    ? HOH 0 6868 . ? 1_555 ? 
484  JC3 5 A   A  2430 ? A   0 2430 . ? 1_555 ? 
485  JC3 5 HOH ZL .    ? HOH 0 4457 . ? 1_555 ? 
486  JC3 5 HOH ZL .    ? HOH 0 5305 . ? 1_555 ? 
487  JC3 5 HOH ZL .    ? HOH 0 9848 . ? 1_555 ? 
488  JC3 5 HOH ZL .    ? HOH 0 9951 . ? 1_555 ? 
489  JC4 8 HOH ZL .    ? HOH 0 4774 . ? 1_555 ? 
490  JC4 8 HOH ZL .    ? HOH 0 4790 . ? 1_555 ? 
491  JC4 8 HOH ZL .    ? HOH 0 6878 . ? 1_555 ? 
492  JC4 8 HOH ZL .    ? HOH 0 7066 . ? 1_555 ? 
493  JC4 8 HOH ZL .    ? HOH 0 7197 . ? 1_555 ? 
494  JC4 8 MG  MD .    ? MG  0 8092 . ? 1_555 ? 
495  JC4 8 HOH BM .    ? HOH A 9019 . ? 1_555 ? 
496  JC4 8 HOH BM .    ? HOH A 9094 . ? 1_555 ? 
497  JC5 7 U   A  1850 ? U   0 1850 . ? 1_555 ? 
498  JC5 7 HOH ZL .    ? HOH 0 4160 . ? 1_555 ? 
499  JC5 7 HOH ZL .    ? HOH 0 4186 . ? 1_555 ? 
500  JC5 7 HOH ZL .    ? HOH 0 4359 . ? 1_555 ? 
501  JC5 7 HOH ZL .    ? HOH 0 7197 . ? 1_555 ? 
502  JC5 7 MG  LD .    ? MG  0 8091 . ? 1_555 ? 
503  JC5 7 HOH BM .    ? HOH A 9019 . ? 1_555 ? 
504  JC6 6 A   A  1840 ? A   0 1840 . ? 1_555 ? 
505  JC6 6 C   A  1841 ? C   0 1841 . ? 1_555 ? 
506  JC6 6 A   A  2022 ? A   0 2022 . ? 1_555 ? 
507  JC6 6 HOH ZL .    ? HOH 0 5126 . ? 1_555 ? 
508  JC6 6 HOH ZL .    ? HOH 0 7025 . ? 1_555 ? 
509  JC6 6 HOH ZL .    ? HOH 0 9725 . ? 1_555 ? 
510  JC7 3 G   A  2102 ? G   0 2102 . ? 1_555 ? 
511  JC7 3 G   A  2482 ? G   0 2482 . ? 1_555 ? 
512  JC7 3 C   A  2536 ? C   0 2536 . ? 1_555 ? 
513  JC8 6 C   A  162  ? C   0 162  . ? 1_555 ? 
514  JC8 6 U   A  163  ? U   0 163  . ? 1_555 ? 
515  JC8 6 U   A  172  ? U   0 172  . ? 1_555 ? 
516  JC8 6 HOH ZL .    ? HOH 0 9513 . ? 1_555 ? 
517  JC8 6 HOH ZL .    ? HOH 0 9608 . ? 1_555 ? 
518  JC8 6 ARG O  82   ? ARG M 82   . ? 1_555 ? 
519  JC9 6 C   A  1069 ? C   0 1069 . ? 1_555 ? 
520  JC9 6 G   A  1072 ? G   0 1072 . ? 1_555 ? 
521  JC9 6 G   A  1087 ? G   0 1087 . ? 1_555 ? 
522  JC9 6 HOH ZL .    ? HOH 0 3671 . ? 1_555 ? 
523  JC9 6 HOH ZL .    ? HOH 0 3702 . ? 1_555 ? 
524  JC9 6 HOH ZL .    ? HOH 0 5452 . ? 1_555 ? 
525  KC1 5 G   A  1119 ? G   0 1119 . ? 1_555 ? 
526  KC1 5 U   A  1120 ? U   0 1120 . ? 1_555 ? 
527  KC1 5 G   A  1121 ? G   0 1121 . ? 1_555 ? 
528  KC1 5 U   A  1122 ? U   0 1122 . ? 1_555 ? 
529  KC1 5 HOH ZL .    ? HOH 0 8307 . ? 1_555 ? 
530  KC2 6 A   A  630  ? A   0 630  . ? 1_555 ? 
531  KC2 6 A   A  631  ? A   0 631  . ? 1_555 ? 
532  KC2 6 A   A  2074 ? A   0 2074 . ? 1_555 ? 
533  KC2 6 HOH ZL .    ? HOH 0 4580 . ? 1_555 ? 
534  KC2 6 HOH ZL .    ? HOH 0 5190 . ? 1_555 ? 
535  KC2 6 HOH ZL .    ? HOH 0 6265 . ? 1_555 ? 
536  KC3 5 G   A  2092 ? G   0 2092 . ? 1_555 ? 
537  KC3 5 G   A  2093 ? G   0 2093 . ? 1_555 ? 
538  KC3 5 G   A  2094 ? G   0 2094 . ? 1_555 ? 
539  KC3 5 A   A  2649 ? A   0 2649 . ? 1_555 ? 
540  KC3 5 HOH ZL .    ? HOH 0 9624 . ? 1_555 ? 
541  KC4 4 C   A  40   ? C   0 40   . ? 1_555 ? 
542  KC4 4 G   A  41   ? G   0 41   . ? 1_555 ? 
543  KC4 4 A   A  442  ? A   0 442  . ? 1_555 ? 
544  KC4 4 C   A  443  ? C   0 443  . ? 1_555 ? 
545  KC5 6 C   A  1394 ? C   0 1394 . ? 1_555 ? 
546  KC5 6 U   A  1432 ? U   0 1432 . ? 1_555 ? 
547  KC5 6 G   A  1433 ? G   0 1433 . ? 1_555 ? 
548  KC5 6 U   A  1724 ? U   0 1724 . ? 1_555 ? 
549  KC5 6 HOH ZL .    ? HOH 0 3909 . ? 1_555 ? 
550  KC5 6 SR  OI .    ? SR  0 8962 . ? 1_555 ? 
551  KC6 4 A   A  2577 ? A   0 2577 . ? 1_555 ? 
552  KC6 4 G   A  2578 ? G   0 2578 . ? 1_555 ? 
553  KC6 4 G   A  2579 ? G   0 2579 . ? 1_555 ? 
554  KC6 4 HOH ZL .    ? HOH 0 4993 . ? 1_555 ? 
555  KC7 4 G   A  2524 ? G   0 2524 . ? 1_555 ? 
556  KC7 4 G   A  2525 ? G   0 2525 . ? 1_555 ? 
557  KC7 4 HOH ZL .    ? HOH 0 4072 . ? 1_555 ? 
558  KC7 4 HOH ZL .    ? HOH 0 5144 . ? 1_555 ? 
559  KC8 5 G   A  2399 ? G   0 2399 . ? 1_555 ? 
560  KC8 5 HOH ZL .    ? HOH 0 3455 . ? 1_555 ? 
561  KC8 5 HOH ZL .    ? HOH 0 4329 . ? 1_555 ? 
562  KC8 5 HOH ZL .    ? HOH 0 5552 . ? 1_555 ? 
563  KC8 5 HOH ZL .    ? HOH 0 5599 . ? 1_555 ? 
564  KC9 5 U   A  2541 ? U   0 2541 . ? 1_555 ? 
565  KC9 5 U   A  2607 ? U   0 2607 . ? 1_555 ? 
566  KC9 5 HOH ZL .    ? HOH 0 3632 . ? 1_555 ? 
567  KC9 5 HOH ZL .    ? HOH 0 9829 . ? 1_555 ? 
568  KC9 5 TRP D  243  ? TRP B 242  . ? 1_555 ? 
569  LC1 4 A   A  165  ? A   0 165  . ? 1_555 ? 
570  LC1 4 A   A  166  ? A   0 166  . ? 1_555 ? 
571  LC1 4 A   A  167  ? A   0 167  . ? 1_555 ? 
572  LC1 4 HOH ZL .    ? HOH 0 3189 . ? 1_555 ? 
573  LC2 4 C   A  896  ? C   0 896  . ? 1_555 ? 
574  LC2 4 A   A  897  ? A   0 897  . ? 1_555 ? 
575  LC2 4 HOH ZL .    ? HOH 0 6786 . ? 1_555 ? 
576  LC2 4 HOH ZL .    ? HOH 0 8209 . ? 1_555 ? 
577  LC3 6 G   A  1416 ? G   0 1416 . ? 1_555 ? 
578  LC3 6 G   A  1417 ? G   0 1417 . ? 1_555 ? 
579  LC3 6 HOH ZL .    ? HOH 0 9775 . ? 1_555 ? 
580  LC3 6 TRP DA 43   ? TRP 2 42   . ? 1_555 ? 
581  LC3 6 ASN DA 46   ? ASN 2 45   . ? 1_555 ? 
582  LC3 6 HOH CN .    ? HOH 2 4135 . ? 1_555 ? 
583  LC4 7 G   A  2543 ? G   0 2543 . ? 1_555 ? 
584  LC4 7 G   A  2544 ? G   0 2544 . ? 1_555 ? 
585  LC4 7 HOH ZL .    ? HOH 0 3961 . ? 1_555 ? 
586  LC4 7 HOH ZL .    ? HOH 0 4422 . ? 1_555 ? 
587  LC4 7 HOH ZL .    ? HOH 0 7949 . ? 1_555 ? 
588  LC4 7 NA  EE .    ? NA  0 8517 . ? 1_555 ? 
589  LC4 7 HOH ZL .    ? HOH 0 9711 . ? 1_555 ? 
590  LC5 7 G   A  2543 ? G   0 2543 . ? 1_555 ? 
591  LC5 7 G   A  2544 ? G   0 2544 . ? 1_555 ? 
592  LC5 7 G   A  2611 ? G   0 2611 . ? 1_555 ? 
593  LC5 7 U   A  2615 ? U   0 2615 . ? 1_555 ? 
594  LC5 7 HOH ZL .    ? HOH 0 3245 . ? 1_555 ? 
595  LC5 7 NA  DE .    ? NA  0 8516 . ? 1_555 ? 
596  LC5 7 HOH ZL .    ? HOH 0 9583 . ? 1_555 ? 
597  LC6 6 G   A  885  ? G   0 885  . ? 1_555 ? 
598  LC6 6 A   A  2112 ? A   0 2112 . ? 1_555 ? 
599  LC6 6 G   A  2113 ? G   0 2113 . ? 1_555 ? 
600  LC6 6 C   A  2475 ? C   0 2475 . ? 1_555 ? 
601  LC6 6 C   A  2476 ? C   0 2476 . ? 1_555 ? 
602  LC6 6 HOH ZL .    ? HOH 0 4968 . ? 1_555 ? 
603  LC7 5 C   A  130  ? C   0 130  . ? 1_555 ? 
604  LC7 5 U   A  146  ? U   0 146  . ? 1_555 ? 
605  LC7 5 G   A  147  ? G   0 147  . ? 1_555 ? 
606  LC7 5 HOH ZL .    ? HOH 0 4620 . ? 1_555 ? 
607  LC7 5 HOH ZL .    ? HOH 0 9994 . ? 1_555 ? 
608  LC8 7 A   A  776  ? A   0 776  . ? 1_555 ? 
609  LC8 7 U   A  777  ? U   0 777  . ? 1_555 ? 
610  LC8 7 U   A  779  ? U   0 779  . ? 1_555 ? 
611  LC8 7 HOH ZL .    ? HOH 0 3127 . ? 1_555 ? 
612  LC8 7 HOH ZL .    ? HOH 0 3777 . ? 1_555 ? 
613  LC8 7 HOH ZL .    ? HOH 0 8186 . ? 1_555 ? 
614  LC8 7 SR  PH .    ? SR  0 8934 . ? 1_555 ? 
615  LC9 4 G   A  1971 ? G   0 1971 . ? 1_555 ? 
616  LC9 4 G   A  2009 ? G   0 2009 . ? 1_555 ? 
617  LC9 4 A   A  2010 ? A   0 2010 . ? 1_555 ? 
618  LC9 4 U   A  2012 ? U   0 2012 . ? 1_555 ? 
619  MC1 7 U   A  821  ? U   0 821  . ? 1_555 ? 
620  MC1 7 C   A  853  ? C   0 853  . ? 1_555 ? 
621  MC1 7 G   A  854  ? G   0 854  . ? 1_555 ? 
622  MC1 7 U   A  1831 ? U   0 1831 . ? 1_555 ? 
623  MC1 7 HOH ZL .    ? HOH 0 3231 . ? 1_555 ? 
624  MC1 7 HOH ZL .    ? HOH 0 3707 . ? 1_555 ? 
625  MC1 7 HOH ZL .    ? HOH 0 9535 . ? 1_555 ? 
626  MC2 6 G   A  56   ? G   0 56   . ? 1_555 ? 
627  MC2 6 A   A  59   ? A   0 59   . ? 1_555 ? 
628  MC2 6 A   A  60   ? A   0 60   . ? 1_555 ? 
629  MC2 6 G   A  61   ? G   0 61   . ? 1_555 ? 
630  MC2 6 HOH ZL .    ? HOH 0 5693 . ? 1_555 ? 
631  MC2 6 HOH ZL .    ? HOH 0 6945 . ? 1_555 ? 
632  MC3 4 G   A  66   ? G   0 66   . ? 1_555 ? 
633  MC3 4 U   A  107  ? U   0 107  . ? 1_555 ? 
634  MC3 4 U   A  108  ? U   0 108  . ? 1_555 ? 
635  MC3 4 HOH ZL .    ? HOH 0 7044 . ? 1_555 ? 
636  MC4 4 G   A  140  ? G   0 140  . ? 1_555 ? 
637  MC4 4 C   A  141  ? C   0 141  . ? 1_555 ? 
638  MC4 4 G   A  142  ? G   0 142  . ? 1_555 ? 
639  MC4 4 HOH ZL .    ? HOH 0 9735 . ? 1_555 ? 
640  MC5 5 U   A  170  ? U   0 170  . ? 1_555 ? 
641  MC5 5 C   A  171  ? C   0 171  . ? 1_555 ? 
642  MC5 5 C   A  218  ? C   0 218  . ? 1_555 ? 
643  MC5 5 G   A  221  ? G   0 221  . ? 1_555 ? 
644  MC5 5 HOH ZL .    ? HOH 0 9798 . ? 1_555 ? 
645  MC6 6 G   A  386  ? G   0 386  . ? 1_555 ? 
646  MC6 6 G   A  387  ? G   0 387  . ? 1_555 ? 
647  MC6 6 G   A  388  ? G   0 388  . ? 1_555 ? 
648  MC6 6 C   A  401  ? C   0 401  . ? 1_555 ? 
649  MC6 6 U   A  402  ? U   0 402  . ? 1_555 ? 
650  MC6 6 HOH ZL .    ? HOH 0 7534 . ? 1_555 ? 
651  MC7 6 C   A  1894 ? C   0 1894 . ? 1_555 ? 
652  MC7 6 A   A  1895 ? A   0 1895 . ? 1_555 ? 
653  MC7 6 G   A  1896 ? G   0 1896 . ? 1_555 ? 
654  MC7 6 U   A  1897 ? U   0 1897 . ? 1_555 ? 
655  MC7 6 HOH ZL .    ? HOH 0 5727 . ? 1_555 ? 
656  MC7 6 HOH ZL .    ? HOH 0 8429 . ? 1_555 ? 
657  MC8 6 C   A  621  ? C   0 621  . ? 1_555 ? 
658  MC8 6 G   A  622  ? G   0 622  . ? 1_555 ? 
659  MC8 6 U   A  623  ? U   0 623  . ? 1_555 ? 
660  MC8 6 1MA A  628  ? 1MA 0 628  . ? 1_555 ? 
661  MC8 6 A   A  630  ? A   0 630  . ? 1_555 ? 
662  MC8 6 HOH ZL .    ? HOH 0 3375 . ? 1_555 ? 
663  MC9 6 G   A  1706 ? G   0 1706 . ? 1_555 ? 
664  MC9 6 G   A  1707 ? G   0 1707 . ? 1_555 ? 
665  MC9 6 HOH ZL .    ? HOH 0 3427 . ? 1_555 ? 
666  MC9 6 HOH ZL .    ? HOH 0 5818 . ? 1_555 ? 
667  MC9 6 HOH ZL .    ? HOH 0 7803 . ? 1_555 ? 
668  MC9 6 HOH ZL .    ? HOH 0 8212 . ? 1_555 ? 
669  NC1 6 U   A  2659 ? U   0 2659 . ? 1_555 ? 
670  NC1 6 G   A  2660 ? G   0 2660 . ? 1_555 ? 
671  NC1 6 VAL T  73   ? VAL R 72   . ? 1_555 ? 
672  NC1 6 TRP T  76   ? TRP R 75   . ? 1_555 ? 
673  NC1 6 HOH SM .    ? HOH R 8919 . ? 1_555 ? 
674  NC1 6 HOH SM .    ? HOH R 8930 . ? 1_555 ? 
675  NC2 7 G   A  2540 ? G   0 2540 . ? 1_555 ? 
676  NC2 7 G   A  2611 ? G   0 2611 . ? 1_555 ? 
677  NC2 7 G   A  2616 ? G   0 2616 . ? 1_555 ? 
678  NC2 7 U   A  2645 ? U   0 2645 . ? 1_555 ? 
679  NC2 7 HOH ZL .    ? HOH 0 3530 . ? 1_555 ? 
680  NC2 7 HOH ZL .    ? HOH 0 4781 . ? 1_555 ? 
681  NC2 7 MG  PC .    ? MG  0 8067 . ? 1_555 ? 
682  NC3 5 U   A  1740 ? U   0 1740 . ? 1_555 ? 
683  NC3 5 U   A  1741 ? U   0 1741 . ? 1_555 ? 
684  NC3 5 G   A  2033 ? G   0 2033 . ? 1_555 ? 
685  NC3 5 HOH ZL .    ? HOH 0 3538 . ? 1_555 ? 
686  NC3 5 HOH ZL .    ? HOH 0 6748 . ? 1_555 ? 
687  NC4 4 G   A  681  ? G   0 681  . ? 1_555 ? 
688  NC4 4 A   A  682  ? A   0 682  . ? 1_555 ? 
689  NC4 4 G   A  683  ? G   0 683  . ? 1_555 ? 
690  NC4 4 HOH ZL .    ? HOH 0 8422 . ? 1_555 ? 
691  NC5 7 U   A  308  ? U   0 308  . ? 1_555 ? 
692  NC5 7 U   A  335  ? U   0 335  . ? 1_555 ? 
693  NC5 7 A   A  339  ? A   0 339  . ? 1_555 ? 
694  NC5 7 C   A  342  ? C   0 342  . ? 1_555 ? 
695  NC5 7 SER V  95   ? SER T 94   . ? 1_555 ? 
696  NC5 7 ASN V  96   ? ASN T 95   . ? 1_555 ? 
697  NC5 7 HOH UM .    ? HOH T 1124 . ? 1_555 ? 
698  NC6 5 A   A  914  ? A   0 914  . ? 1_555 ? 
699  NC6 5 C   A  915  ? C   0 915  . ? 1_555 ? 
700  NC6 5 C   A  1043 ? C   0 1043 . ? 1_555 ? 
701  NC6 5 C   A  1044 ? C   0 1044 . ? 1_555 ? 
702  NC6 5 G   A  1045 ? G   0 1045 . ? 1_555 ? 
703  NC7 4 U   A  623  ? U   0 623  . ? 1_555 ? 
704  NC7 4 U   A  624  ? U   0 624  . ? 1_555 ? 
705  NC7 4 G   A  901  ? G   0 901  . ? 1_555 ? 
706  NC7 4 HOH ZL .    ? HOH 0 7423 . ? 1_555 ? 
707  NC8 4 A   A  955  ? A   0 955  . ? 1_555 ? 
708  NC8 4 HOH ZL .    ? HOH 0 7070 . ? 1_555 ? 
709  NC8 4 C   B  81   ? C   9 81   . ? 1_555 ? 
710  NC8 4 U   B  82   ? U   9 82   . ? 1_555 ? 
711  NC9 5 U   A  768  ? U   0 768  . ? 1_555 ? 
712  NC9 5 C   A  769  ? C   0 769  . ? 1_555 ? 
713  NC9 5 G   A  2111 ? G   0 2111 . ? 1_555 ? 
714  NC9 5 A   A  2112 ? A   0 2112 . ? 1_555 ? 
715  NC9 5 HOH ZL .    ? HOH 0 5306 . ? 1_555 ? 
716  OC1 4 G   A  1119 ? G   0 1119 . ? 1_555 ? 
717  OC1 4 C   A  1243 ? C   0 1243 . ? 1_555 ? 
718  OC1 4 HOH ZL .    ? HOH 0 5298 . ? 1_555 ? 
719  OC1 4 THR L  47   ? THR J 47   . ? 1_555 ? 
720  OC2 5 C   A  920  ? C   0 920  . ? 1_555 ? 
721  OC2 5 U   A  2278 ? U   0 2278 . ? 1_555 ? 
722  OC2 5 G   A  2279 ? G   0 2279 . ? 1_555 ? 
723  OC2 5 A   A  2463 ? A   0 2463 . ? 1_555 ? 
724  OC2 5 HOH ZL .    ? HOH 0 9954 . ? 1_555 ? 
725  OC3 4 G   A  941  ? G   0 941  . ? 1_555 ? 
726  OC3 4 U   A  942  ? U   0 942  . ? 1_555 ? 
727  OC3 4 G   A  1024 ? G   0 1024 . ? 1_555 ? 
728  OC3 4 HOH ZL .    ? HOH 0 6747 . ? 1_555 ? 
729  OC4 3 G   A  2611 ? G   0 2611 . ? 1_555 ? 
730  OC4 3 HOH ZL .    ? HOH 0 9985 . ? 1_555 ? 
731  OC4 3 TRP D  243  ? TRP B 242  . ? 1_555 ? 
732  OC5 6 G   A  898  ? G   0 898  . ? 1_555 ? 
733  OC5 6 A   A  922  ? A   0 922  . ? 1_555 ? 
734  OC5 6 A   A  923  ? A   0 923  . ? 1_555 ? 
735  OC5 6 G   A  924  ? G   0 924  . ? 1_555 ? 
736  OC5 6 U   A  2109 ? U   0 2109 . ? 1_555 ? 
737  OC5 6 HOH ZL .    ? HOH 0 6134 . ? 1_555 ? 
738  OC6 5 A   A  453  ? A   0 453  . ? 1_555 ? 
739  OC6 5 U   A  454  ? U   0 454  . ? 1_555 ? 
740  OC6 5 C   A  478  ? C   0 478  . ? 1_555 ? 
741  OC6 5 G   A  479  ? G   0 479  . ? 1_555 ? 
742  OC6 5 HOH ZL .    ? HOH 0 6433 . ? 1_555 ? 
743  OC7 6 U   A  837  ? U   0 837  . ? 1_555 ? 
744  OC7 6 HOH ZL .    ? HOH 0 5079 . ? 1_555 ? 
745  OC7 6 HOH ZL .    ? HOH 0 5388 . ? 1_555 ? 
746  OC7 6 HOH ZL .    ? HOH 0 5578 . ? 1_555 ? 
747  OC7 6 HOH ZL .    ? HOH 0 7792 . ? 1_555 ? 
748  OC7 6 GLN D  231  ? GLN B 230  . ? 1_555 ? 
749  OC8 6 A   A  167  ? A   0 167  . ? 1_555 ? 
750  OC8 6 C   A  168  ? C   0 168  . ? 1_555 ? 
751  OC8 6 G   A  2110 ? G   0 2110 . ? 1_555 ? 
752  OC8 6 G   A  2111 ? G   0 2111 . ? 1_555 ? 
753  OC8 6 U   A  2277 ? U   0 2277 . ? 1_555 ? 
754  OC8 6 HOH ZL .    ? HOH 0 5787 . ? 1_555 ? 
755  OC9 4 U   A  1359 ? U   0 1359 . ? 1_555 ? 
756  OC9 4 C   A  1360 ? C   0 1360 . ? 1_555 ? 
757  OC9 4 HOH ZL .    ? HOH 0 3974 . ? 1_555 ? 
758  OC9 4 HOH ZL .    ? HOH 0 7507 . ? 1_555 ? 
759  PC1 3 U   A  2057 ? U   0 2057 . ? 1_555 ? 
760  PC1 3 G   A  2058 ? G   0 2058 . ? 1_555 ? 
761  PC1 3 HOH ZL .    ? HOH 0 3318 . ? 1_555 ? 
762  PC2 6 U   A  391  ? U   0 391  . ? 1_555 ? 
763  PC2 6 U   A  392  ? U   0 392  . ? 1_555 ? 
764  PC2 6 U   A  398  ? U   0 398  . ? 1_555 ? 
765  PC2 6 C   A  399  ? C   0 399  . ? 1_555 ? 
766  PC2 6 LYS O  193  ? LYS M 193  . ? 1_555 ? 
767  PC2 6 GLY O  194  ? GLY M 194  . ? 1_555 ? 
768  PC3 8 G   A  544  ? G   0 544  . ? 1_555 ? 
769  PC3 8 G   A  545  ? G   0 545  . ? 1_555 ? 
770  PC3 8 G   A  610  ? G   0 610  . ? 1_555 ? 
771  PC3 8 U   A  611  ? U   0 611  . ? 1_555 ? 
772  PC3 8 HOH ZL .    ? HOH 0 3369 . ? 1_555 ? 
773  PC3 8 HOH ZL .    ? HOH 0 3388 . ? 1_555 ? 
774  PC3 8 HOH ZL .    ? HOH 0 4315 . ? 1_555 ? 
775  PC3 8 HOH ZL .    ? HOH 0 4375 . ? 1_555 ? 
776  PC4 6 G   A  464  ? G   0 464  . ? 1_555 ? 
777  PC4 6 G   A  475  ? G   0 475  . ? 1_555 ? 
778  PC4 6 HOH ZL .    ? HOH 0 3332 . ? 1_555 ? 
779  PC4 6 HOH ZL .    ? HOH 0 5092 . ? 1_555 ? 
780  PC4 6 ARG E  55   ? ARG C 55   . ? 1_555 ? 
781  PC4 6 HOH DM .    ? HOH C 8588 . ? 1_555 ? 
782  PC5 3 G   A  798  ? G   0 798  . ? 1_555 ? 
783  PC5 3 G   A  814  ? G   0 814  . ? 1_555 ? 
784  PC5 3 U   A  815  ? U   0 815  . ? 1_555 ? 
785  PC6 5 U   A  391  ? U   0 391  . ? 1_555 ? 
786  PC6 5 U   A  392  ? U   0 392  . ? 1_555 ? 
787  PC6 5 A   A  395  ? A   0 395  . ? 1_555 ? 
788  PC6 5 U   A  398  ? U   0 398  . ? 1_555 ? 
789  PC6 5 HOH ZL .    ? HOH 0 7038 . ? 1_555 ? 
790  PC7 4 G   A  1832 ? G   0 1832 . ? 1_555 ? 
791  PC7 4 A   A  2022 ? A   0 2022 . ? 1_555 ? 
792  PC7 4 HOH ZL .    ? HOH 0 4593 . ? 1_555 ? 
793  PC7 4 HOH ZL .    ? HOH 0 9600 . ? 1_555 ? 
794  PC8 5 G   A  2491 ? G   0 2491 . ? 1_555 ? 
795  PC8 5 U   A  2492 ? U   0 2492 . ? 1_555 ? 
796  PC8 5 G   A  2529 ? G   0 2529 . ? 1_555 ? 
797  PC8 5 C   A  2530 ? C   0 2530 . ? 1_555 ? 
798  PC8 5 HOH ZL .    ? HOH 0 3128 . ? 1_555 ? 
799  PC9 4 U   A  919  ? U   0 919  . ? 1_555 ? 
800  PC9 4 G   A  921  ? G   0 921  . ? 1_555 ? 
801  PC9 4 G   A  924  ? G   0 924  . ? 1_555 ? 
802  PC9 4 HOH ZL .    ? HOH 0 9771 . ? 1_555 ? 
803  QC1 7 G   A  1576 ? G   0 1576 . ? 1_555 ? 
804  QC1 7 U   A  1577 ? U   0 1577 . ? 1_555 ? 
805  QC1 7 G   A  1618 ? G   0 1618 . ? 1_555 ? 
806  QC1 7 G   A  1619 ? G   0 1619 . ? 1_555 ? 
807  QC1 7 C   A  1620 ? C   0 1620 . ? 1_555 ? 
808  QC1 7 HOH ZL .    ? HOH 0 4177 . ? 1_555 ? 
809  QC1 7 HOH ZL .    ? HOH 0 7754 . ? 1_555 ? 
810  QC2 4 C   A  195  ? C   0 195  . ? 1_555 ? 
811  QC2 4 G   A  196  ? G   0 196  . ? 1_555 ? 
812  QC2 4 A   A  415  ? A   0 415  . ? 1_555 ? 
813  QC2 4 G   A  416  ? G   0 416  . ? 1_555 ? 
814  QC3 5 G   A  868  ? G   0 868  . ? 1_555 ? 
815  QC3 5 G   A  869  ? G   0 869  . ? 1_555 ? 
816  QC3 5 A   A  886  ? A   0 886  . ? 1_555 ? 
817  QC3 5 G   A  887  ? G   0 887  . ? 1_555 ? 
818  QC3 5 HOH ZL .    ? HOH 0 9763 . ? 1_555 ? 
819  QC4 5 G   A  911  ? G   0 911  . ? 1_555 ? 
820  QC4 5 U   A  1293 ? U   0 1293 . ? 1_555 ? 
821  QC4 5 A   A  1294 ? A   0 1294 . ? 1_555 ? 
822  QC4 5 G   A  1295 ? G   0 1295 . ? 1_555 ? 
823  QC4 5 HOH ZL .    ? HOH 0 6815 . ? 1_555 ? 
824  QC5 7 C   A  762  ? C   0 762  . ? 1_555 ? 
825  QC5 7 G   A  902  ? G   0 902  . ? 1_555 ? 
826  QC5 7 U   A  903  ? U   0 903  . ? 1_555 ? 
827  QC5 7 HOH ZL .    ? HOH 0 3711 . ? 1_555 ? 
828  QC5 7 HIS N  19   ? HIS L 18   . ? 1_555 ? 
829  QC5 7 HOH MM .    ? HOH L 8826 . ? 1_555 ? 
830  QC5 7 HOH MM .    ? HOH L 8844 . ? 1_555 ? 
831  QC6 5 U   A  831  ? U   0 831  . ? 1_555 ? 
832  QC6 5 U   A  832  ? U   0 832  . ? 1_555 ? 
833  QC6 5 G   A  833  ? G   0 833  . ? 1_555 ? 
834  QC6 5 HOH ZL .    ? HOH 0 4210 . ? 1_555 ? 
835  QC6 5 HOH ZL .    ? HOH 0 4917 . ? 1_555 ? 
836  QC7 7 G   A  2585 ? G   0 2585 . ? 1_555 ? 
837  QC7 7 U   A  2586 ? U   0 2586 . ? 1_555 ? 
838  QC7 7 OMU A  2587 ? OMU 0 2587 . ? 1_555 ? 
839  QC7 7 G   A  2592 ? G   0 2592 . ? 1_555 ? 
840  QC7 7 HOH ZL .    ? HOH 0 4188 . ? 1_555 ? 
841  QC7 7 HOH ZL .    ? HOH 0 7536 . ? 1_555 ? 
842  QC7 7 HOH ZL .    ? HOH 0 9827 . ? 1_555 ? 
843  QC8 2 G   A  2772 ? G   0 2772 . ? 1_555 ? 
844  QC8 2 G   A  2773 ? G   0 2773 . ? 1_555 ? 
845  QC9 4 C   A  197  ? C   0 197  . ? 1_555 ? 
846  QC9 4 HOH ZL .    ? HOH 0 5500 . ? 1_555 ? 
847  QC9 4 HOH ZL .    ? HOH 0 5730 . ? 1_555 ? 
848  QC9 4 HOH ZL .    ? HOH 0 7037 . ? 1_555 ? 
849  RC1 3 G   A  1077 ? G   0 1077 . ? 1_555 ? 
850  RC1 3 A   A  1079 ? A   0 1079 . ? 1_555 ? 
851  RC1 3 HOH ZL .    ? HOH 0 8205 . ? 1_555 ? 
852  RC2 3 G   A  1452 ? G   0 1452 . ? 1_555 ? 
853  RC2 3 G   A  1676 ? G   0 1676 . ? 1_555 ? 
854  RC2 3 LYS DA 3    ? LYS 2 2    . ? 1_555 ? 
855  RC3 3 C   A  197  ? C   0 197  . ? 1_555 ? 
856  RC3 3 G   A  201  ? G   0 201  . ? 1_555 ? 
857  RC3 3 G   A  229  ? G   0 229  . ? 1_555 ? 
858  RC4 4 C   A  2388 ? C   0 2388 . ? 1_555 ? 
859  RC4 4 HOH ZL .    ? HOH 0 3665 . ? 1_555 ? 
860  RC4 4 PHE S  53   ? PHE Q 52   . ? 1_555 ? 
861  RC4 4 HIS S  54   ? HIS Q 53   . ? 1_555 ? 
862  RC5 6 G   A  2582 ? G   0 2582 . ? 1_555 ? 
863  RC5 6 A   A  2596 ? A   0 2596 . ? 1_555 ? 
864  RC5 6 HOH ZL .    ? HOH 0 5576 . ? 1_555 ? 
865  RC5 6 LYS M  14   ? LYS K 14   . ? 1_555 ? 
866  RC5 6 ILE M  32   ? ILE K 32   . ? 1_555 ? 
867  RC5 6 SER M  33   ? SER K 33   . ? 1_555 ? 
868  RC6 3 A   A  1328 ? A   0 1328 . ? 1_555 ? 
869  RC6 3 G   A  1329 ? G   0 1329 . ? 1_555 ? 
870  RC6 3 HOH ZL .    ? HOH 0 5149 . ? 1_555 ? 
871  RC7 3 G   A  644  ? G   0 644  . ? 1_555 ? 
872  RC7 3 HIS N  14   ? HIS L 13   . ? 1_555 ? 
873  RC7 3 HOH MM .    ? HOH L 8880 . ? 1_555 ? 
874  RC8 3 A   A  1597 ? A   0 1597 . ? 1_555 ? 
875  RC8 3 A   A  1598 ? A   0 1598 . ? 1_555 ? 
876  RC8 3 G   A  1646 ? G   0 1646 . ? 1_555 ? 
877  RC9 3 G   A  1119 ? G   0 1119 . ? 1_555 ? 
878  RC9 3 C   A  1243 ? C   0 1243 . ? 1_555 ? 
879  RC9 3 LYS L  56   ? LYS J 56   . ? 1_555 ? 
880  SC1 3 C   A  594  ? C   0 594  . ? 1_555 ? 
881  SC1 3 U   A  595  ? U   0 595  . ? 1_555 ? 
882  SC1 3 HOH ZM .    ? HOH Y 8853 . ? 1_555 ? 
883  SC2 3 G   A  1072 ? G   0 1072 . ? 1_555 ? 
884  SC2 3 G   A  1087 ? G   0 1087 . ? 1_555 ? 
885  SC2 3 A   A  1291 ? A   0 1291 . ? 1_555 ? 
886  SC3 6 G   A  824  ? G   0 824  . ? 1_555 ? 
887  SC3 6 G   A  854  ? G   0 854  . ? 1_555 ? 
888  SC3 6 HOH ZL .    ? HOH 0 4451 . ? 1_555 ? 
889  SC3 6 HOH ZL .    ? HOH 0 4779 . ? 1_555 ? 
890  SC3 6 HOH ZL .    ? HOH 0 4913 . ? 1_555 ? 
891  SC3 6 HOH ZL .    ? HOH 0 5018 . ? 1_555 ? 
892  SC4 6 G   A  836  ? G   0 836  . ? 1_555 ? 
893  SC4 6 U   A  2615 ? U   0 2615 . ? 1_555 ? 
894  SC4 6 HOH ZL .    ? HOH 0 4333 . ? 1_555 ? 
895  SC4 6 HOH ZL .    ? HOH 0 9861 . ? 1_555 ? 
896  SC4 6 GLN D  231  ? GLN B 230  . ? 1_555 ? 
897  SC4 6 HOH CM .    ? HOH B 8994 . ? 1_555 ? 
898  SC5 6 G   A  1489 ? G   0 1489 . ? 1_555 ? 
899  SC5 6 G   A  1491 ? G   0 1491 . ? 1_555 ? 
900  SC5 6 HOH ZL .    ? HOH 0 4128 . ? 1_555 ? 
901  SC5 6 HOH ZL .    ? HOH 0 4449 . ? 1_555 ? 
902  SC5 6 HOH ZL .    ? HOH 0 6644 . ? 1_555 ? 
903  SC5 6 HOH ZL .    ? HOH 0 9897 . ? 1_555 ? 
904  SC6 6 A   A  643  ? A   0 643  . ? 1_555 ? 
905  SC6 6 C   A  1353 ? C   0 1353 . ? 1_555 ? 
906  SC6 6 G   A  1354 ? G   0 1354 . ? 1_555 ? 
907  SC6 6 HOH ZL .    ? HOH 0 7047 . ? 1_555 ? 
908  SC6 6 HOH ZL .    ? HOH 0 8432 . ? 1_555 ? 
909  SC6 6 HOH ZL .    ? HOH 0 9931 . ? 1_555 ? 
910  SC7 5 A   A  1754 ? A   0 1754 . ? 1_555 ? 
911  SC7 5 A   A  1755 ? A   0 1755 . ? 1_555 ? 
912  SC7 5 HOH ZL .    ? HOH 0 7055 . ? 1_555 ? 
913  SC7 5 HOH ZL .    ? HOH 0 7625 . ? 1_555 ? 
914  SC7 5 HOH ZL .    ? HOH 0 8117 . ? 1_555 ? 
915  SC8 4 C   A  893  ? C   0 893  . ? 1_555 ? 
916  SC8 4 HOH ZL .    ? HOH 0 6107 . ? 1_555 ? 
917  SC8 4 HOH ZL .    ? HOH 0 8431 . ? 1_555 ? 
918  SC8 4 HOH DM .    ? HOH C 8547 . ? 1_555 ? 
919  SC9 6 G   A  1055 ? G   0 1055 . ? 1_555 ? 
920  SC9 6 HOH ZL .    ? HOH 0 4321 . ? 1_555 ? 
921  SC9 6 HOH ZL .    ? HOH 0 5315 . ? 1_555 ? 
922  SC9 6 HOH ZL .    ? HOH 0 6803 . ? 1_555 ? 
923  SC9 6 ASP J  13   ? ASP H 13   . ? 1_555 ? 
924  SC9 6 HOH IM .    ? HOH H 8991 . ? 1_555 ? 
925  TC1 6 U   A  146  ? U   0 146  . ? 1_555 ? 
926  TC1 6 G   A  147  ? G   0 147  . ? 1_555 ? 
927  TC1 6 G   A  182  ? G   0 182  . ? 1_555 ? 
928  TC1 6 A   A  183  ? A   0 183  . ? 1_555 ? 
929  TC1 6 ASP O  157  ? ASP M 157  . ? 1_555 ? 
930  TC1 6 HOH NM .    ? HOH M 8939 . ? 1_555 ? 
931  TC2 6 HOH ZL .    ? HOH 0 4262 . ? 1_555 ? 
932  TC2 6 HOH ZL .    ? HOH 0 4739 . ? 1_555 ? 
933  TC2 6 HOH ZL .    ? HOH 0 5986 . ? 1_555 ? 
934  TC2 6 HOH ZL .    ? HOH 0 6625 . ? 1_555 ? 
935  TC2 6 HOH ZL .    ? HOH 0 7059 . ? 1_555 ? 
936  TC2 6 HOH ZL .    ? HOH 0 7353 . ? 1_555 ? 
937  TC3 5 A   A  1747 ? A   0 1747 . ? 1_555 ? 
938  TC3 5 U   A  1748 ? U   0 1748 . ? 1_555 ? 
939  TC3 5 U   A  1749 ? U   0 1749 . ? 1_555 ? 
940  TC3 5 G   A  2585 ? G   0 2585 . ? 1_555 ? 
941  TC3 5 HOH ZL .    ? HOH 0 3179 . ? 1_555 ? 
942  TC4 5 C   A  85   ? C   0 85   . ? 1_555 ? 
943  TC4 5 A   A  86   ? A   0 86   . ? 1_555 ? 
944  TC4 5 C   A  87   ? C   0 87   . ? 1_555 ? 
945  TC4 5 ASP V  69   ? ASP T 68   . ? 1_555 ? 
946  TC4 5 HOH UM .    ? HOH T 4403 . ? 1_555 ? 
947  TC5 3 HOH ZL .    ? HOH 0 4642 . ? 1_555 ? 
948  TC5 3 HOH ZL .    ? HOH 0 5364 . ? 1_555 ? 
949  TC5 3 HOH ZL .    ? HOH 0 5697 . ? 1_555 ? 
950  TC6 4 U   A  664  ? U   0 664  . ? 1_555 ? 
951  TC6 4 G   A  681  ? G   0 681  . ? 1_555 ? 
952  TC6 4 HOH ZL .    ? HOH 0 7392 . ? 1_555 ? 
953  TC6 4 HOH DM .    ? HOH C 8540 . ? 1_555 ? 
954  TC7 4 C   A  1420 ? C   0 1420 . ? 1_555 ? 
955  TC7 4 C   A  1421 ? C   0 1421 . ? 1_555 ? 
956  TC7 4 G   A  1438 ? G   0 1438 . ? 1_555 ? 
957  TC7 4 HOH ZL .    ? HOH 0 6250 . ? 1_555 ? 
958  TC8 3 U   A  454  ? U   0 454  . ? 1_555 ? 
959  TC8 3 C   A  478  ? C   0 478  . ? 1_555 ? 
960  TC8 3 HOH ZL .    ? HOH 0 6127 . ? 1_555 ? 
961  TC9 6 A   A  1504 ? A   0 1504 . ? 1_555 ? 
962  TC9 6 A   A  1678 ? A   0 1678 . ? 1_555 ? 
963  TC9 6 C   A  1679 ? C   0 1679 . ? 1_555 ? 
964  TC9 6 HOH ZL .    ? HOH 0 4241 . ? 1_555 ? 
965  TC9 6 HOH ZL .    ? HOH 0 8296 . ? 1_555 ? 
966  TC9 6 HOH ZL .    ? HOH 0 8315 . ? 1_555 ? 
967  UC1 2 G   A  2543 ? G   0 2543 . ? 1_555 ? 
968  UC1 2 C   A  2608 ? C   0 2608 . ? 1_555 ? 
969  UC2 2 G   A  2632 ? G   0 2632 . ? 1_555 ? 
970  UC2 2 HOH ZL .    ? HOH 0 5032 . ? 1_555 ? 
971  UC3 5 A   A  1717 ? A   0 1717 . ? 1_555 ? 
972  UC3 5 G   A  1718 ? G   0 1718 . ? 1_555 ? 
973  UC3 5 HOH ZL .    ? HOH 0 5042 . ? 1_555 ? 
974  UC3 5 HOH ZL .    ? HOH 0 5822 . ? 1_555 ? 
975  UC3 5 HOH ZL .    ? HOH 0 6855 . ? 1_555 ? 
976  UC4 6 G   A  471  ? G   0 471  . ? 1_555 ? 
977  UC4 6 HOH ZL .    ? HOH 0 3542 . ? 1_555 ? 
978  UC4 6 HOH ZL .    ? HOH 0 4889 . ? 1_555 ? 
979  UC4 6 HOH ZL .    ? HOH 0 6097 . ? 1_555 ? 
980  UC4 6 HOH ZL .    ? HOH 0 9702 . ? 1_555 ? 
981  UC4 6 HOH ZL .    ? HOH 0 9742 . ? 1_555 ? 
982  UC5 6 G   A  1059 ? G   0 1059 . ? 1_555 ? 
983  UC5 6 C   A  1127 ? C   0 1127 . ? 1_555 ? 
984  UC5 6 HOH ZL .    ? HOH 0 4317 . ? 1_555 ? 
985  UC5 6 HOH ZL .    ? HOH 0 5354 . ? 1_555 ? 
986  UC5 6 HOH ZL .    ? HOH 0 5794 . ? 1_555 ? 
987  UC5 6 HOH ZL .    ? HOH 0 9612 . ? 1_555 ? 
988  UC6 6 G   A  2725 ? G   0 2725 . ? 1_555 ? 
989  UC6 6 G   A  2755 ? G   0 2755 . ? 1_555 ? 
990  UC6 6 HOH ZL .    ? HOH 0 3216 . ? 1_555 ? 
991  UC6 6 HOH ZL .    ? HOH 0 4308 . ? 1_555 ? 
992  UC6 6 HOH ZL .    ? HOH 0 6813 . ? 1_555 ? 
993  UC6 6 HOH ZL .    ? HOH 0 7138 . ? 1_555 ? 
994  UC7 1 G   A  503  ? G   0 503  . ? 1_555 ? 
995  UC8 3 HOH ZL .    ? HOH 0 3841 . ? 1_555 ? 
996  UC8 3 HOH ZL .    ? HOH 0 6261 . ? 1_555 ? 
997  UC8 3 HOH ZL .    ? HOH 0 6916 . ? 1_555 ? 
998  UC9 2 A   A  2553 ? A   0 2553 . ? 1_555 ? 
999  UC9 2 HOH ZL .    ? HOH 0 4145 . ? 1_555 ? 
1000 VC1 5 U   A  1109 ? U   0 1109 . ? 1_555 ? 
1001 VC1 5 G   A  1110 ? G   0 1110 . ? 1_555 ? 
1002 VC1 5 A   A  1247 ? A   0 1247 . ? 1_555 ? 
1003 VC1 5 HOH ZL .    ? HOH 0 3950 . ? 1_555 ? 
1004 VC1 5 HOH ZL .    ? HOH 0 7433 . ? 1_555 ? 
1005 VC2 3 G   A  1543 ? G   0 1543 . ? 1_555 ? 
1006 VC2 3 HOH ZL .    ? HOH 0 6557 . ? 1_555 ? 
1007 VC2 3 HOH ZL .    ? HOH 0 6569 . ? 1_555 ? 
1008 VC3 5 A   A  532  ? A   0 532  . ? 1_555 ? 
1009 VC3 5 U   A  533  ? U   0 533  . ? 1_555 ? 
1010 VC3 5 HOH ZL .    ? HOH 0 4228 . ? 1_555 ? 
1011 VC3 5 HOH ZL .    ? HOH 0 4468 . ? 1_555 ? 
1012 VC3 5 HOH ZL .    ? HOH 0 8360 . ? 1_555 ? 
1013 VC4 6 U   A  777  ? U   0 777  . ? 1_555 ? 
1014 VC4 6 C   A  778  ? C   0 778  . ? 1_555 ? 
1015 VC4 6 HOH ZL .    ? HOH 0 3777 . ? 1_555 ? 
1016 VC4 6 MG  DB .    ? MG  0 8024 . ? 1_555 ? 
1017 VC4 6 HOH ZL .    ? HOH 0 8317 . ? 1_555 ? 
1018 VC4 6 NA  HE .    ? NA  0 8521 . ? 1_555 ? 
1019 VC5 5 G   A  2421 ? G   0 2421 . ? 1_555 ? 
1020 VC5 5 U   A  2422 ? U   0 2422 . ? 1_555 ? 
1021 VC5 5 C   A  2423 ? C   0 2423 . ? 1_555 ? 
1022 VC5 5 HOH ZL .    ? HOH 0 8388 . ? 1_555 ? 
1023 VC5 5 HOH ZL .    ? HOH 0 8389 . ? 1_555 ? 
1024 VC6 6 A   A  1291 ? A   0 1291 . ? 1_555 ? 
1025 VC6 6 G   A  1292 ? G   0 1292 . ? 1_555 ? 
1026 VC6 6 HOH ZL .    ? HOH 0 3723 . ? 1_555 ? 
1027 VC6 6 HOH ZL .    ? HOH 0 4109 . ? 1_555 ? 
1028 VC6 6 HOH ZL .    ? HOH 0 7912 . ? 1_555 ? 
1029 VC6 6 HOH ZL .    ? HOH 0 8369 . ? 1_555 ? 
1030 VC7 3 HOH ZL .    ? HOH 0 4782 . ? 1_555 ? 
1031 VC7 3 HOH ZL .    ? HOH 0 6967 . ? 1_555 ? 
1032 VC7 3 HOH ZL .    ? HOH 0 7981 . ? 1_555 ? 
1033 VC8 2 HOH ZL .    ? HOH 0 5499 . ? 1_555 ? 
1034 VC8 2 HOH ZL .    ? HOH 0 5661 . ? 1_555 ? 
1035 VC9 4 G   A  84   ? G   0 84   . ? 1_555 ? 
1036 VC9 4 C   A  85   ? C   0 85   . ? 1_555 ? 
1037 VC9 4 ASP V  69   ? ASP T 68   . ? 1_555 ? 
1038 VC9 4 HOH UM .    ? HOH T 4403 . ? 1_555 ? 
1039 WC1 5 A   A  2465 ? A   0 2465 . ? 1_555 ? 
1040 WC1 5 G   A  2466 ? G   0 2466 . ? 1_555 ? 
1041 WC1 5 HOH ZL .    ? HOH 0 4749 . ? 1_555 ? 
1042 WC1 5 HOH ZL .    ? HOH 0 8428 . ? 1_555 ? 
1043 WC1 5 ASP N  37   ? ASP L 36   . ? 1_555 ? 
1044 WC2 5 G   A  1683 ? G   0 1683 . ? 1_555 ? 
1045 WC2 5 U   A  1696 ? U   0 1696 . ? 1_555 ? 
1046 WC2 5 HOH ZL .    ? HOH 0 3288 . ? 1_555 ? 
1047 WC2 5 HOH ZL .    ? HOH 0 5246 . ? 1_555 ? 
1048 WC2 5 HOH ZL .    ? HOH 0 5326 . ? 1_555 ? 
1049 WC3 5 A   A  2746 ? A   0 2746 . ? 1_555 ? 
1050 WC3 5 U   A  2749 ? U   0 2749 . ? 1_555 ? 
1051 WC3 5 G   A  2750 ? G   0 2750 . ? 1_555 ? 
1052 WC3 5 HOH ZL .    ? HOH 0 6355 . ? 1_555 ? 
1053 WC3 5 HOH ZL .    ? HOH 0 8425 . ? 1_555 ? 
1054 WC4 4 A   A  1885 ? A   0 1885 . ? 1_555 ? 
1055 WC4 4 A   A  1886 ? A   0 1886 . ? 1_555 ? 
1056 WC4 4 U   A  1887 ? U   0 1887 . ? 1_555 ? 
1057 WC4 4 HOH ZL .    ? HOH 0 6593 . ? 1_555 ? 
1058 WC5 2 U   A  2016 ? U   0 2016 . ? 1_555 ? 
1059 WC5 2 HOH ZL .    ? HOH 0 8096 . ? 1_555 ? 
1060 WC6 6 G   A  1484 ? G   0 1484 . ? 1_555 ? 
1061 WC6 6 HOH ZL .    ? HOH 0 4212 . ? 1_555 ? 
1062 WC6 6 HOH ZL .    ? HOH 0 8319 . ? 1_555 ? 
1063 WC6 6 HOH ZL .    ? HOH 0 8320 . ? 1_555 ? 
1064 WC6 6 HOH ZL .    ? HOH 0 8375 . ? 1_555 ? 
1065 WC6 6 HOH ZL .    ? HOH 0 8376 . ? 1_555 ? 
1066 WC7 2 G   A  2091 ? G   0 2091 . ? 1_555 ? 
1067 WC7 2 HOH ZL .    ? HOH 0 6578 . ? 1_555 ? 
1068 WC8 3 C   A  1690 ? C   0 1690 . ? 1_555 ? 
1069 WC8 3 HOH ZL .    ? HOH 0 5196 . ? 1_555 ? 
1070 WC8 3 HOH ZL .    ? HOH 0 9946 . ? 1_555 ? 
1071 WC9 6 A   A  2302 ? A   0 2302 . ? 1_555 ? 
1072 WC9 6 A   A  2303 ? A   0 2303 . ? 1_555 ? 
1073 WC9 6 HOH ZL .    ? HOH 0 4139 . ? 1_555 ? 
1074 WC9 6 HOH ZL .    ? HOH 0 4265 . ? 1_555 ? 
1075 WC9 6 HOH ZL .    ? HOH 0 5351 . ? 1_555 ? 
1076 WC9 6 HOH ZL .    ? HOH 0 8318 . ? 1_555 ? 
1077 XC1 6 U   A  821  ? U   0 821  . ? 1_555 ? 
1078 XC1 6 C   A  822  ? C   0 822  . ? 1_555 ? 
1079 XC1 6 G   A  854  ? G   0 854  . ? 1_555 ? 
1080 XC1 6 HOH ZL .    ? HOH 0 3310 . ? 1_555 ? 
1081 XC1 6 HOH ZL .    ? HOH 0 4113 . ? 1_555 ? 
1082 XC1 6 HOH ZL .    ? HOH 0 4249 . ? 1_555 ? 
1083 XC2 1 G   A  2696 ? G   0 2696 . ? 1_555 ? 
1084 XC3 3 U   A  391  ? U   0 391  . ? 1_555 ? 
1085 XC3 3 ARG EA 42   ? ARG 3 42   . ? 1_555 ? 
1086 XC3 3 HOH DN .    ? HOH 3 8970 . ? 1_555 ? 
1087 XC4 3 G   A  2810 ? G   0 2810 . ? 1_555 ? 
1088 XC4 3 HOH ZL .    ? HOH 0 8126 . ? 1_555 ? 
1089 XC4 3 ASN D  28   ? ASN B 27   . ? 1_555 ? 
1090 XC5 3 U   A  2557 ? U   0 2557 . ? 1_555 ? 
1091 XC5 3 HOH ZL .    ? HOH 0 3559 . ? 1_555 ? 
1092 XC5 3 HOH ZL .    ? HOH 0 7127 . ? 1_555 ? 
1093 XC6 4 A   A  682  ? A   0 682  . ? 1_555 ? 
1094 XC6 4 G   A  683  ? G   0 683  . ? 1_555 ? 
1095 XC6 4 HOH ZL .    ? HOH 0 8422 . ? 1_555 ? 
1096 XC6 4 HOH ZL .    ? HOH 0 8434 . ? 1_555 ? 
1097 XC7 3 C   A  1462 ? C   0 1462 . ? 1_555 ? 
1098 XC7 3 U   A  1463 ? U   0 1463 . ? 1_555 ? 
1099 XC7 3 GLY CA 41   ? GLY 1 40   . ? 1_555 ? 
1100 XC8 4 A   A  1133 ? A   0 1133 . ? 1_555 ? 
1101 XC8 4 G   A  1134 ? G   0 1134 . ? 1_555 ? 
1102 XC8 4 HOH ZL .    ? HOH 0 5280 . ? 1_555 ? 
1103 XC8 4 HOH ZL .    ? HOH 0 9927 . ? 1_555 ? 
1104 XC9 3 U   A  1972 ? U   0 1972 . ? 1_555 ? 
1105 XC9 3 HOH ZL .    ? HOH 0 3172 . ? 1_555 ? 
1106 XC9 3 HOH ZL .    ? HOH 0 3803 . ? 1_555 ? 
1107 YC1 2 G   A  1113 ? G   0 1113 . ? 1_555 ? 
1108 YC1 2 HOH ZL .    ? HOH 0 4191 . ? 1_555 ? 
1109 YC2 5 U   A  1432 ? U   0 1432 . ? 1_555 ? 
1110 YC2 5 G   A  1433 ? G   0 1433 . ? 1_555 ? 
1111 YC2 5 U   A  1724 ? U   0 1724 . ? 1_555 ? 
1112 YC2 5 HOH ZL .    ? HOH 0 4086 . ? 1_555 ? 
1113 YC2 5 NA  VD .    ? NA  0 8507 . ? 1_555 ? 
1114 YC3 4 G   A  2284 ? G   0 2284 . ? 1_555 ? 
1115 YC3 4 G   A  2285 ? G   0 2285 . ? 1_555 ? 
1116 YC3 4 HOH ZL .    ? HOH 0 5998 . ? 1_555 ? 
1117 YC3 4 HOH ZL .    ? HOH 0 7661 . ? 1_555 ? 
1118 YC4 2 G   A  2777 ? G   0 2777 . ? 1_555 ? 
1119 YC4 2 HOH ZL .    ? HOH 0 4690 . ? 1_555 ? 
1120 YC5 6 A   A  1815 ? A   0 1815 . ? 1_555 ? 
1121 YC5 6 HOH ZL .    ? HOH 0 6526 . ? 1_555 ? 
1122 YC5 6 HOH ZL .    ? HOH 0 7873 . ? 1_555 ? 
1123 YC5 6 HOH ZL .    ? HOH 0 7998 . ? 1_555 ? 
1124 YC5 6 HOH ZL .    ? HOH 0 8348 . ? 1_555 ? 
1125 YC5 6 HOH ZL .    ? HOH 0 8349 . ? 1_555 ? 
1126 YC6 5 C   A  235  ? C   0 235  . ? 1_555 ? 
1127 YC6 5 HOH ZL .    ? HOH 0 5191 . ? 1_555 ? 
1128 YC6 5 HOH ZL .    ? HOH 0 5929 . ? 1_555 ? 
1129 YC6 5 HOH ZL .    ? HOH 0 6626 . ? 1_555 ? 
1130 YC6 5 HOH ZL .    ? HOH 0 8050 . ? 1_555 ? 
1131 YC7 3 U   A  2690 ? U   0 2690 . ? 1_555 ? 
1132 YC7 3 HOH ZL .    ? HOH 0 3554 . ? 1_555 ? 
1133 YC7 3 HOH ZL .    ? HOH 0 6016 . ? 1_555 ? 
1134 YC8 3 G   A  2522 ? G   0 2522 . ? 1_555 ? 
1135 YC8 3 C   B  91   ? C   9 91   . ? 1_555 ? 
1136 YC8 3 HOH IM .    ? HOH H 9012 . ? 1_555 ? 
1137 YC9 7 A   A  1040 ? A   0 1040 . ? 1_555 ? 
1138 YC9 7 G   A  1295 ? G   0 1295 . ? 1_555 ? 
1139 YC9 7 A   A  1296 ? A   0 1296 . ? 1_555 ? 
1140 YC9 7 HOH ZL .    ? HOH 0 5360 . ? 1_555 ? 
1141 YC9 7 HOH ZL .    ? HOH 0 9713 . ? 1_555 ? 
1142 YC9 7 GLY N  15   ? GLY L 14   . ? 1_555 ? 
1143 YC9 7 HOH MM .    ? HOH L 8881 . ? 1_555 ? 
1144 ZC1 2 A   A  565  ? A   0 565  . ? 1_555 ? 
1145 ZC1 2 G   A  592  ? G   0 592  . ? 1_555 ? 
1146 ZC2 2 HOH ZL .    ? HOH 0 6920 . ? 1_555 ? 
1147 ZC2 2 HOH ZL .    ? HOH 0 7755 . ? 1_555 ? 
1148 ZC3 2 U   A  1835 ? U   0 1835 . ? 1_555 ? 
1149 ZC3 2 HOH ZL .    ? HOH 0 8130 . ? 1_555 ? 
1150 ZC4 5 C   A  1894 ? C   0 1894 . ? 1_555 ? 
1151 ZC4 5 U   A  1897 ? U   0 1897 . ? 1_555 ? 
1152 ZC4 5 G   A  1898 ? G   0 1898 . ? 1_555 ? 
1153 ZC4 5 U   A  1939 ? U   0 1939 . ? 1_555 ? 
1154 ZC4 5 HOH ZL .    ? HOH 0 8429 . ? 1_555 ? 
1155 ZC5 2 A   A  1375 ? A   0 1375 . ? 1_555 ? 
1156 ZC5 2 G   A  1726 ? G   0 1726 . ? 1_555 ? 
1157 ZC6 8 C   A  1129 ? C   0 1129 . ? 1_555 ? 
1158 ZC6 8 HOH ZL .    ? HOH 0 4119 . ? 1_555 ? 
1159 ZC6 8 HOH ZL .    ? HOH 0 6573 . ? 1_555 ? 
1160 ZC6 8 HOH ZL .    ? HOH 0 7381 . ? 1_555 ? 
1161 ZC6 8 HOH ZL .    ? HOH 0 8404 . ? 1_555 ? 
1162 ZC6 8 C   B  91   ? C   9 91   . ? 1_555 ? 
1163 ZC6 8 G   B  92   ? G   9 92   . ? 1_555 ? 
1164 ZC6 8 HOH AM .    ? HOH 9 9071 . ? 1_555 ? 
1165 ZC7 1 U   A  2640 ? U   0 2640 . ? 1_555 ? 
1166 ZC8 3 G   A  1290 ? G   0 1290 . ? 1_555 ? 
1167 ZC8 3 A   A  1291 ? A   0 1291 . ? 1_555 ? 
1168 ZC8 3 HOH ZL .    ? HOH 0 5445 . ? 1_555 ? 
1169 ZC9 5 A   A  1746 ? A   0 1746 . ? 1_555 ? 
1170 ZC9 5 A   A  1747 ? A   0 1747 . ? 1_555 ? 
1171 ZC9 5 U   A  1748 ? U   0 1748 . ? 1_555 ? 
1172 ZC9 5 U   A  1749 ? U   0 1749 . ? 1_555 ? 
1173 ZC9 5 G   A  1752 ? G   0 1752 . ? 1_555 ? 
1174 AD1 4 A   A  1291 ? A   0 1291 . ? 1_555 ? 
1175 AD1 4 G   A  1292 ? G   0 1292 . ? 1_555 ? 
1176 AD1 4 HOH ZL .    ? HOH 0 3560 . ? 1_555 ? 
1177 AD1 4 HOH ZL .    ? HOH 0 4754 . ? 1_555 ? 
1178 AD2 5 A   A  378  ? A   0 378  . ? 1_555 ? 
1179 AD2 5 G   A  379  ? G   0 379  . ? 1_555 ? 
1180 AD2 5 A   A  429  ? A   0 429  . ? 1_555 ? 
1181 AD2 5 HOH ZL .    ? HOH 0 5055 . ? 1_555 ? 
1182 AD2 5 HOH ZL .    ? HOH 0 7932 . ? 1_555 ? 
1183 AD3 6 U   A  2663 ? U   0 2663 . ? 1_555 ? 
1184 AD3 6 A   A  2811 ? A   0 2811 . ? 1_555 ? 
1185 AD3 6 A   A  2812 ? A   0 2812 . ? 1_555 ? 
1186 AD3 6 A   A  2816 ? A   0 2816 . ? 1_555 ? 
1187 AD3 6 G   A  2817 ? G   0 2817 . ? 1_555 ? 
1188 AD3 6 HOH ZL .    ? HOH 0 8430 . ? 1_555 ? 
1189 AD4 4 C   A  1102 ? C   0 1102 . ? 1_555 ? 
1190 AD4 4 C   A  1103 ? C   0 1103 . ? 1_555 ? 
1191 AD4 4 HOH ZL .    ? HOH 0 3046 . ? 1_555 ? 
1192 AD4 4 GLU L  28   ? GLU J 28   . ? 1_555 ? 
1193 AD5 2 G   A  2700 ? G   0 2700 . ? 1_555 ? 
1194 AD5 2 HOH ZL .    ? HOH 0 4065 . ? 1_555 ? 
1195 AD6 3 A   A  2622 ? A   0 2622 . ? 1_555 ? 
1196 AD6 3 G   A  2623 ? G   0 2623 . ? 1_555 ? 
1197 AD6 3 HOH ZL .    ? HOH 0 6353 . ? 1_555 ? 
1198 AD7 4 G   A  2617 ? G   0 2617 . ? 1_555 ? 
1199 AD7 4 G   A  2618 ? G   0 2618 . ? 1_555 ? 
1200 AD7 4 HOH ZL .    ? HOH 0 4123 . ? 1_555 ? 
1201 AD7 4 HOH ZL .    ? HOH 0 4314 . ? 1_555 ? 
1202 AD8 2 A   A  1427 ? A   0 1427 . ? 1_555 ? 
1203 AD8 2 HOH ZL .    ? HOH 0 8266 . ? 1_555 ? 
1204 AD9 6 U   A  2277 ? U   0 2277 . ? 1_555 ? 
1205 AD9 6 U   A  2278 ? U   0 2278 . ? 1_555 ? 
1206 AD9 6 G   A  2471 ? G   0 2471 . ? 1_555 ? 
1207 AD9 6 HOH ZL .    ? HOH 0 3092 . ? 1_555 ? 
1208 AD9 6 HOH ZL .    ? HOH 0 4248 . ? 1_555 ? 
1209 AD9 6 HOH ZL .    ? HOH 0 4256 . ? 1_555 ? 
1210 BD1 1 GLY C  237  ? GLY A 236  . ? 1_555 ? 
1211 BD2 2 A   A  846  ? A   0 846  . ? 1_555 ? 
1212 BD2 2 G   A  1694 ? G   0 1694 . ? 1_555 ? 
1213 BD3 7 G   A  2609 ? G   0 2609 . ? 1_555 ? 
1214 BD3 7 U   A  2610 ? U   0 2610 . ? 1_555 ? 
1215 BD3 7 HOH ZL .    ? HOH 0 3800 . ? 1_555 ? 
1216 BD3 7 HOH ZL .    ? HOH 0 4194 . ? 1_555 ? 
1217 BD3 7 HOH ZL .    ? HOH 0 4217 . ? 1_555 ? 
1218 BD3 7 HOH ZL .    ? HOH 0 6083 . ? 1_555 ? 
1219 BD3 7 HOH ZL .    ? HOH 0 6228 . ? 1_555 ? 
1220 BD4 3 U   A  1412 ? U   0 1412 . ? 1_555 ? 
1221 BD4 3 A   A  1682 ? A   0 1682 . ? 1_555 ? 
1222 BD4 3 HOH ZL .    ? HOH 0 7546 . ? 1_555 ? 
1223 BD5 3 A   A  790  ? A   0 790  . ? 1_555 ? 
1224 BD5 3 A   A  791  ? A   0 791  . ? 1_555 ? 
1225 BD5 3 HOH ZL .    ? HOH 0 6203 . ? 1_555 ? 
1226 BD6 3 G   A  834  ? G   0 834  . ? 1_555 ? 
1227 BD6 3 U   A  835  ? U   0 835  . ? 1_555 ? 
1228 BD6 3 HOH ZL .    ? HOH 0 4401 . ? 1_555 ? 
1229 BD7 3 U   A  2461 ? U   0 2461 . ? 1_555 ? 
1230 BD7 3 HOH ZL .    ? HOH 0 6713 . ? 1_555 ? 
1231 BD7 3 ASP EA 59   ? ASP 3 59   . ? 1_555 ? 
1232 BD8 1 C   A  1536 ? C   0 1536 . ? 1_555 ? 
1233 BD9 3 C   A  2591 ? C   0 2591 . ? 1_555 ? 
1234 BD9 3 HOH ZL .    ? HOH 0 6077 . ? 1_555 ? 
1235 BD9 3 HOH ZL .    ? HOH 0 6400 . ? 1_555 ? 
1236 CD1 2 A   A  1317 ? A   0 1317 . ? 1_555 ? 
1237 CD1 2 SER AA 208  ? SER Y 207  . ? 1_555 ? 
1238 CD2 2 G   A  2102 ? G   0 2102 . ? 1_555 ? 
1239 CD2 2 A   A  2103 ? A   0 2103 . ? 1_555 ? 
1240 CD3 1 G   A  2639 ? G   0 2639 . ? 1_555 ? 
1241 CD4 3 G   A  1376 ? G   0 1376 . ? 1_555 ? 
1242 CD4 3 A   A  1693 ? A   0 1693 . ? 1_555 ? 
1243 CD4 3 HOH ZL .    ? HOH 0 4970 . ? 1_555 ? 
1244 CD5 4 U   A  1368 ? U   0 1368 . ? 1_555 ? 
1245 CD5 4 HOH ZL .    ? HOH 0 5359 . ? 1_555 ? 
1246 CD5 4 HOH SM .    ? HOH R 8959 . ? 1_555 ? 
1247 CD5 4 HOH SM .    ? HOH R 8960 . ? 1_555 ? 
1248 CD6 3 A   B  56   ? A   9 56   . ? 1_555 ? 
1249 CD6 3 A   B  57   ? A   9 57   . ? 1_555 ? 
1250 CD6 3 HOH AM .    ? HOH 9 9138 . ? 1_555 ? 
1251 CD7 1 C   B  40   ? C   9 40   . ? 1_555 ? 
1252 CD8 6 G   B  21   ? G   9 21   . ? 1_555 ? 
1253 CD8 6 G   B  22   ? G   9 22   . ? 1_555 ? 
1254 CD8 6 U   B  55   ? U   9 55   . ? 1_555 ? 
1255 CD8 6 A   B  57   ? A   9 57   . ? 1_555 ? 
1256 CD8 6 G   B  58   ? G   9 58   . ? 1_555 ? 
1257 CD8 6 C   B  59   ? C   9 59   . ? 1_555 ? 
1258 CD9 2 G   B  78   ? G   9 78   . ? 1_555 ? 
1259 CD9 2 G   B  102  ? G   9 102  . ? 1_555 ? 
1260 DD1 4 A   B  44   ? A   9 44   . ? 1_555 ? 
1261 DD1 4 HOH AM .    ? HOH 9 9032 . ? 1_555 ? 
1262 DD1 4 HOH AM .    ? HOH 9 9082 . ? 1_555 ? 
1263 DD1 4 HOH AM .    ? HOH 9 9107 . ? 1_555 ? 
1264 DD2 6 HOH ZL .    ? HOH 0 4462 . ? 1_555 ? 
1265 DD2 6 HOH BM .    ? HOH A 8988 . ? 1_555 ? 
1266 DD2 6 HOH BM .    ? HOH A 9002 . ? 1_555 ? 
1267 DD2 6 HOH BM .    ? HOH A 9016 . ? 1_555 ? 
1268 DD2 6 HOH BM .    ? HOH A 9063 . ? 1_555 ? 
1269 DD2 6 HOH BM .    ? HOH A 9092 . ? 1_555 ? 
1270 DD3 6 G   A  1873 ? G   0 1873 . ? 1_555 ? 
1271 DD3 6 HOH ZL .    ? HOH 0 4840 . ? 1_555 ? 
1272 DD3 6 ASP C  27   ? ASP A 26   . ? 1_555 ? 
1273 DD3 6 LEU C  28   ? LEU A 27   . ? 1_555 ? 
1274 DD3 6 GLU C  29   ? GLU A 28   . ? 1_555 ? 
1275 DD3 6 ARG C  121  ? ARG A 120  . ? 1_555 ? 
1276 DD4 1 LYS C  179  ? LYS A 178  . ? 1_555 ? 
1277 DD5 7 A   A  2633 ? A   0 2633 . ? 1_555 ? 
1278 DD5 7 PHE C  202  ? PHE A 201  . ? 1_555 ? 
1279 DD5 7 GLY C  203  ? GLY A 202  . ? 1_555 ? 
1280 DD5 7 GLY C  204  ? GLY A 203  . ? 1_555 ? 
1281 DD5 7 HIS C  209  ? HIS A 208  . ? 1_555 ? 
1282 DD5 7 HOH BM .    ? HOH A 9022 . ? 1_555 ? 
1283 DD5 7 HOH BM .    ? HOH A 9095 . ? 1_555 ? 
1284 DD6 5 HOH ZL .    ? HOH 0 4840 . ? 1_555 ? 
1285 DD6 5 HOH ZL .    ? HOH 0 6411 . ? 1_555 ? 
1286 DD6 5 HOH ZL .    ? HOH 0 8420 . ? 1_555 ? 
1287 DD6 5 ASP C  27   ? ASP A 26   . ? 1_555 ? 
1288 DD6 5 GLU C  29   ? GLU A 28   . ? 1_555 ? 
1289 DD7 1 GLU C  29   ? GLU A 28   . ? 1_555 ? 
1290 DD8 6 HOH ZL .    ? HOH 0 4253 . ? 1_555 ? 
1291 DD8 6 HOH ZL .    ? HOH 0 6886 . ? 1_555 ? 
1292 DD8 6 HOH ZL .    ? HOH 0 8236 . ? 1_555 ? 
1293 DD8 6 HOH CM .    ? HOH B 9021 . ? 1_555 ? 
1294 DD8 6 HOH CM .    ? HOH B 9135 . ? 1_555 ? 
1295 DD8 6 HOH CM .    ? HOH B 9136 . ? 1_555 ? 
1296 DD9 4 HOH ZL .    ? HOH 0 3084 . ? 1_555 ? 
1297 DD9 4 ARG D  224  ? ARG B 223  . ? 1_555 ? 
1298 DD9 4 LYS D  225  ? LYS B 224  . ? 1_555 ? 
1299 DD9 4 HIS D  228  ? HIS B 227  . ? 1_555 ? 
1300 ED1 4 HOH ZL .    ? HOH 0 3451 . ? 1_555 ? 
1301 ED1 4 HOH ZL .    ? HOH 0 3748 . ? 1_555 ? 
1302 ED1 4 ASN D  244  ? ASN B 243  . ? 1_555 ? 
1303 ED1 4 SER D  246  ? SER B 245  . ? 1_555 ? 
1304 ED2 4 C   A  2672 ? C   0 2672 . ? 1_555 ? 
1305 ED2 4 ARG D  26   ? ARG B 25   . ? 1_555 ? 
1306 ED2 4 PHE D  27   ? PHE B 26   . ? 1_555 ? 
1307 ED2 4 ARG D  311  ? ARG B 310  . ? 1_555 ? 
1308 ED3 4 ASP E  45   ? ASP C 45   . ? 1_555 ? 
1309 ED3 4 THR E  94   ? THR C 94   . ? 1_555 ? 
1310 ED3 4 GLU E  95   ? GLU C 95   . ? 1_555 ? 
1311 ED3 4 LYS E  96   ? LYS C 96   . ? 1_555 ? 
1312 ED4 1 HOH ZL .    ? HOH 0 5583 . ? 1_555 ? 
1313 ED5 2 C   A  2287 ? C   0 2287 . ? 1_555 ? 
1314 ED5 2 ARG J  117  ? ARG H 117  . ? 1_555 ? 
1315 ED6 6 A   A  1133 ? A   0 1133 . ? 1_555 ? 
1316 ED6 6 G   A  1134 ? G   0 1134 . ? 1_555 ? 
1317 ED6 6 TYR J  157  ? TYR H 157  . ? 1_555 ? 
1318 ED6 6 ILE J  160  ? ILE H 160  . ? 1_555 ? 
1319 ED6 6 THR J  161  ? THR H 161  . ? 1_555 ? 
1320 ED6 6 PRO J  162  ? PRO H 162  . ? 1_555 ? 
1321 ED7 6 HOH ZL .    ? HOH 0 6237 . ? 1_555 ? 
1322 ED7 6 HOH ZL .    ? HOH 0 9984 . ? 1_555 ? 
1323 ED7 6 ARG L  60   ? ARG J 60   . ? 1_555 ? 
1324 ED7 6 VAL L  61   ? VAL J 61   . ? 1_555 ? 
1325 ED7 6 ILE L  63   ? ILE J 63   . ? 1_555 ? 
1326 ED7 6 TYR L  69   ? TYR J 69   . ? 1_555 ? 
1327 ED8 2 ILE L  127  ? ILE J 127  . ? 1_555 ? 
1328 ED8 2 LYS L  128  ? LYS J 128  . ? 1_555 ? 
1329 ED9 2 PRO L  88   ? PRO J 88   . ? 1_555 ? 
1330 ED9 2 LYS L  90   ? LYS J 90   . ? 1_555 ? 
1331 FD1 5 HOH ZL .    ? HOH 0 6237 . ? 1_555 ? 
1332 FD1 5 GLY L  64   ? GLY J 64   . ? 1_555 ? 
1333 FD1 5 ASN L  65   ? ASN J 65   . ? 1_555 ? 
1334 FD1 5 GLY L  68   ? GLY J 68   . ? 1_555 ? 
1335 FD1 5 TYR L  69   ? TYR J 69   . ? 1_555 ? 
1336 FD2 6 HOH ZL .    ? HOH 0 3919 . ? 1_555 ? 
1337 FD2 6 HOH ZL .    ? HOH 0 4731 . ? 1_555 ? 
1338 FD2 6 HOH ZL .    ? HOH 0 6519 . ? 1_555 ? 
1339 FD2 6 ASN M  42   ? ASN K 42   . ? 1_555 ? 
1340 FD2 6 HOH LM .    ? HOH K 2121 . ? 1_555 ? 
1341 FD2 6 HOH LM .    ? HOH K 7871 . ? 1_555 ? 
1342 FD3 1 ARG N  54   ? ARG L 53   . ? 1_555 ? 
1343 FD4 5 SER O  106  ? SER M 106  . ? 1_555 ? 
1344 FD4 5 PHE O  109  ? PHE M 109  . ? 1_555 ? 
1345 FD4 5 PRO O  110  ? PRO M 110  . ? 1_555 ? 
1346 FD4 5 LEU O  112  ? LEU M 112  . ? 1_555 ? 
1347 FD4 5 HOH NM .    ? HOH M 8924 . ? 1_555 ? 
1348 FD5 4 SER O  106  ? SER M 106  . ? 1_555 ? 
1349 FD5 4 ARG O  113  ? ARG M 113  . ? 1_555 ? 
1350 FD5 4 VAL O  114  ? VAL M 114  . ? 1_555 ? 
1351 FD5 4 VAL O  159  ? VAL M 159  . ? 1_555 ? 
1352 FD6 4 LYS F  147  ? LYS D 146  . ? 1_555 ? 
1353 FD6 4 ARG P  38   ? ARG N 37   . ? 1_555 ? 
1354 FD6 4 LYS P  39   ? LYS N 38   . ? 1_555 ? 
1355 FD6 4 ASN P  108  ? ASN N 107  . ? 1_555 ? 
1356 FD7 3 HOH ZL .    ? HOH 0 6492 . ? 1_555 ? 
1357 FD7 3 HOH ZL .    ? HOH 0 6721 . ? 1_555 ? 
1358 FD7 3 HIS Q  41   ? HIS O 40   . ? 1_555 ? 
1359 FD8 2 HOH ZL .    ? HOH 0 7492 . ? 1_555 ? 
1360 FD8 2 ASN Q  45   ? ASN O 44   . ? 1_555 ? 
1361 FD9 7 ASN S  17   ? ASN Q 16   . ? 1_555 ? 
1362 FD9 7 ASP S  21   ? ASP Q 20   . ? 1_555 ? 
1363 FD9 7 GLY S  23   ? GLY Q 22   . ? 1_555 ? 
1364 FD9 7 SER S  25   ? SER Q 24   . ? 1_555 ? 
1365 FD9 7 SER S  47   ? SER Q 46   . ? 1_555 ? 
1366 FD9 7 HOH RM .    ? HOH Q 1795 . ? 1_555 ? 
1367 FD9 7 HOH RM .    ? HOH Q 5427 . ? 1_555 ? 
1368 GD1 5 SER T  71   ? SER R 70   . ? 1_555 ? 
1369 GD1 5 VAL T  73   ? VAL R 72   . ? 1_555 ? 
1370 GD1 5 HOH SM .    ? HOH R 8928 . ? 1_555 ? 
1371 GD1 5 HOH SM .    ? HOH R 8930 . ? 1_555 ? 
1372 GD1 5 HOH SM .    ? HOH R 8964 . ? 1_555 ? 
1373 GD2 5 U   A  12   ? U   0 12   . ? 1_555 ? 
1374 GD2 5 LYS T  61   ? LYS R 60   . ? 1_555 ? 
1375 GD2 5 GLN T  62   ? GLN R 61   . ? 1_555 ? 
1376 GD2 5 ASN T  64   ? ASN R 63   . ? 1_555 ? 
1377 GD2 5 SR  LL .    ? SR  R 8912 . ? 1_555 ? 
1378 GD3 2 HOH ZL .    ? HOH 0 9834 . ? 1_555 ? 
1379 GD3 2 LYS T  119  ? LYS R 118  . ? 1_555 ? 
1380 GD4 3 GLN T  62   ? GLN R 61   . ? 1_555 ? 
1381 GD4 3 ASN T  64   ? ASN R 63   . ? 1_555 ? 
1382 GD4 3 NA  JL .    ? NA  R 8575 . ? 1_555 ? 
1383 GD5 3 HIS U  8    ? HIS S 7    . ? 1_555 ? 
1384 GD5 3 GLU U  62   ? GLU S 61   . ? 1_555 ? 
1385 GD5 3 HOH TM .    ? HOH S 8973 . ? 1_555 ? 
1386 GD6 2 HOH ZL .    ? HOH 0 5796 . ? 1_555 ? 
1387 GD6 2 ASP U  60   ? ASP S 59   . ? 1_555 ? 
1388 GD7 6 GLN V  38   ? GLN T 37   . ? 1_555 ? 
1389 GD7 6 ARG V  112  ? ARG T 111  . ? 1_555 ? 
1390 GD7 6 LEU V  113  ? LEU T 112  . ? 1_555 ? 
1391 GD7 6 SER V  115  ? SER T 114  . ? 1_555 ? 
1392 GD7 6 ASP V  118  ? ASP T 117  . ? 1_555 ? 
1393 GD7 6 HOH UM .    ? HOH T 2868 . ? 1_555 ? 
1394 GD8 4 CYS W  6    ? CYS U 6    . ? 1_555 ? 
1395 GD8 4 CYS W  9    ? CYS U 9    . ? 1_555 ? 
1396 GD8 4 CYS W  32   ? CYS U 32   . ? 1_555 ? 
1397 GD8 4 CYS W  36   ? CYS U 36   . ? 1_555 ? 
1398 GD9 7 HIS AA 134  ? HIS Y 133  . ? 1_555 ? 
1399 GD9 7 LYS AA 137  ? LYS Y 136  . ? 1_555 ? 
1400 GD9 7 LYS AA 138  ? LYS Y 137  . ? 1_555 ? 
1401 GD9 7 VAL AA 140  ? VAL Y 139  . ? 1_555 ? 
1402 GD9 7 HOH ZM .    ? HOH Y 8859 . ? 1_555 ? 
1403 GD9 7 HOH ZM .    ? HOH Y 8880 . ? 1_555 ? 
1404 GD9 7 HOH ZM .    ? HOH Y 8915 . ? 1_555 ? 
1405 HD1 3 G   A  1269 ? G   0 1269 . ? 1_555 ? 
1406 HD1 3 HOH ZL .    ? HOH 0 5418 . ? 1_555 ? 
1407 HD1 3 ARG AA 170  ? ARG Y 169  . ? 1_555 ? 
1408 HD2 4 CYS BA 30   ? CYS Z 39   . ? 1_555 ? 
1409 HD2 4 CYS BA 33   ? CYS Z 42   . ? 1_555 ? 
1410 HD2 4 CYS BA 48   ? CYS Z 57   . ? 1_555 ? 
1411 HD2 4 CYS BA 51   ? CYS Z 60   . ? 1_555 ? 
1412 HD3 4 CYS CA 20   ? CYS 1 19   . ? 1_555 ? 
1413 HD3 4 CYS CA 23   ? CYS 1 22   . ? 1_555 ? 
1414 HD3 4 CYS CA 35   ? CYS 1 34   . ? 1_555 ? 
1415 HD3 4 CYS CA 38   ? CYS 1 37   . ? 1_555 ? 
1416 HD4 6 U   A  862  ? U   0 862  . ? 1_555 ? 
1417 HD4 6 HOH ZL .    ? HOH 0 5368 . ? 1_555 ? 
1418 HD4 6 HOH ZL .    ? HOH 0 9666 . ? 1_555 ? 
1419 HD4 6 LYS CA 11   ? LYS 1 10   . ? 1_555 ? 
1420 HD4 6 ASN CA 13   ? ASN 1 12   . ? 1_555 ? 
1421 HD4 6 HOH BN .    ? HOH 1 8990 . ? 1_555 ? 
1422 HD5 6 HOH ZL .    ? HOH 0 3278 . ? 1_555 ? 
1423 HD5 6 HOH ZL .    ? HOH 0 3731 . ? 1_555 ? 
1424 HD5 6 HOH ZL .    ? HOH 0 4376 . ? 1_555 ? 
1425 HD5 6 HOH ZL .    ? HOH 0 9799 . ? 1_555 ? 
1426 HD5 6 ASP CA 48   ? ASP 1 47   . ? 1_555 ? 
1427 HD5 6 HOH BN .    ? HOH 1 8976 . ? 1_555 ? 
1428 HD6 4 CYS EA 11   ? CYS 3 11   . ? 1_555 ? 
1429 HD6 4 CYS EA 14   ? CYS 3 14   . ? 1_555 ? 
1430 HD6 4 CYS EA 71   ? CYS 3 71   . ? 1_555 ? 
1431 HD6 4 CYS EA 74   ? CYS 3 74   . ? 1_555 ? 
1432 HD7 1 ASP EA 66   ? ASP 3 66   . ? 1_555 ? 
1433 HD8 6 HOH ZL .    ? HOH 0 4450 . ? 1_555 ? 
1434 HD8 6 HOH ZL .    ? HOH 0 8411 . ? 1_555 ? 
1435 HD8 6 HOH ZL .    ? HOH 0 8412 . ? 1_555 ? 
1436 HD8 6 GLY EA 45   ? GLY 3 45   . ? 1_555 ? 
1437 HD8 6 GLY EA 47   ? GLY 3 47   . ? 1_555 ? 
1438 HD8 6 ASP EA 49   ? ASP 3 49   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1YHQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1YHQ 
_atom_sites.fract_transf_matrix[1][1]   0.004715 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003345 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.001740 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CD 
CL 
K  
MG 
N  
NA 
O  
P  
S  
SR 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O5'" . U   A  1  10   ? 16.753  146.238 103.578 1.00 87.33  ? 10   U   0 "O5'" 1 
ATOM   2     C  "C5'" . U   A  1  10   ? 16.658  147.669 103.572 1.00 87.38  ? 10   U   0 "C5'" 1 
ATOM   3     C  "C4'" . U   A  1  10   ? 17.923  148.347 104.057 1.00 86.35  ? 10   U   0 "C4'" 1 
ATOM   4     O  "O4'" . U   A  1  10   ? 18.106  148.112 105.479 1.00 88.11  ? 10   U   0 "O4'" 1 
ATOM   5     C  "C3'" . U   A  1  10   ? 19.218  147.862 103.423 1.00 83.39  ? 10   U   0 "C3'" 1 
ATOM   6     O  "O3'" . U   A  1  10   ? 19.408  148.478 102.151 1.00 76.26  ? 10   U   0 "O3'" 1 
ATOM   7     C  "C2'" . U   A  1  10   ? 20.259  148.249 104.470 1.00 85.08  ? 10   U   0 "C2'" 1 
ATOM   8     O  "O2'" . U   A  1  10   ? 20.596  149.623 104.449 1.00 85.72  ? 10   U   0 "O2'" 1 
ATOM   9     C  "C1'" . U   A  1  10   ? 19.491  147.970 105.766 1.00 87.10  ? 10   U   0 "C1'" 1 
ATOM   10    N  N1    . U   A  1  10   ? 19.696  146.636 106.357 1.00 87.53  ? 10   U   0 N1    1 
ATOM   11    C  C2    . U   A  1  10   ? 19.535  146.516 107.732 1.00 87.88  ? 10   U   0 C2    1 
ATOM   12    O  O2    . U   A  1  10   ? 19.253  147.458 108.462 1.00 90.47  ? 10   U   0 O2    1 
ATOM   13    N  N3    . U   A  1  10   ? 19.714  145.253 108.226 1.00 86.33  ? 10   U   0 N3    1 
ATOM   14    C  C4    . U   A  1  10   ? 20.035  144.123 107.514 1.00 86.26  ? 10   U   0 C4    1 
ATOM   15    O  O4    . U   A  1  10   ? 20.220  143.073 108.118 1.00 86.04  ? 10   U   0 O4    1 
ATOM   16    C  C5    . U   A  1  10   ? 20.190  144.321 106.105 1.00 86.14  ? 10   U   0 C5    1 
ATOM   17    C  C6    . U   A  1  10   ? 20.022  145.539 105.587 1.00 86.65  ? 10   U   0 C6    1 
ATOM   18    P  P     . A   A  1  11   ? 20.675  148.084 101.247 1.00 68.59  ? 11   A   0 P     1 
ATOM   19    O  OP1   . A   A  1  11   ? 20.376  148.519 99.860  1.00 70.17  ? 11   A   0 OP1   1 
ATOM   20    O  OP2   . A   A  1  11   ? 21.067  146.678 101.503 1.00 67.84  ? 11   A   0 OP2   1 
ATOM   21    O  "O5'" . A   A  1  11   ? 21.809  149.039 101.812 1.00 63.87  ? 11   A   0 "O5'" 1 
ATOM   22    C  "C5'" . A   A  1  11   ? 23.115  149.010 101.259 1.00 55.49  ? 11   A   0 "C5'" 1 
ATOM   23    C  "C4'" . A   A  1  11   ? 24.078  149.717 102.168 1.00 49.84  ? 11   A   0 "C4'" 1 
ATOM   24    O  "O4'" . A   A  1  11   ? 23.870  149.298 103.541 1.00 47.17  ? 11   A   0 "O4'" 1 
ATOM   25    C  "C3'" . A   A  1  11   ? 25.511  149.349 101.861 1.00 47.25  ? 11   A   0 "C3'" 1 
ATOM   26    O  "O3'" . A   A  1  11   ? 26.002  150.132 100.790 1.00 45.25  ? 11   A   0 "O3'" 1 
ATOM   27    C  "C2'" . A   A  1  11   ? 26.199  149.569 103.197 1.00 45.95  ? 11   A   0 "C2'" 1 
ATOM   28    O  "O2'" . A   A  1  11   ? 26.455  150.931 103.452 1.00 43.33  ? 11   A   0 "O2'" 1 
ATOM   29    C  "C1'" . A   A  1  11   ? 25.121  149.063 104.164 1.00 45.43  ? 11   A   0 "C1'" 1 
ATOM   30    N  N9    . A   A  1  11   ? 25.204  147.629 104.466 1.00 43.86  ? 11   A   0 N9    1 
ATOM   31    C  C8    . A   A  1  11   ? 24.180  146.708 104.441 1.00 44.58  ? 11   A   0 C8    1 
ATOM   32    N  N7    . A   A  1  11   ? 24.549  145.495 104.776 1.00 43.17  ? 11   A   0 N7    1 
ATOM   33    C  C5    . A   A  1  11   ? 25.905  145.620 105.036 1.00 41.53  ? 11   A   0 C5    1 
ATOM   34    C  C6    . A   A  1  11   ? 26.876  144.692 105.439 1.00 41.52  ? 11   A   0 C6    1 
ATOM   35    N  N6    . A   A  1  11   ? 26.622  143.402 105.665 1.00 41.00  ? 11   A   0 N6    1 
ATOM   36    N  N1    . A   A  1  11   ? 28.137  145.139 105.606 1.00 42.89  ? 11   A   0 N1    1 
ATOM   37    C  C2    . A   A  1  11   ? 28.395  146.434 105.381 1.00 42.77  ? 11   A   0 C2    1 
ATOM   38    N  N3    . A   A  1  11   ? 27.569  147.404 105.001 1.00 41.43  ? 11   A   0 N3    1 
ATOM   39    C  C4    . A   A  1  11   ? 26.324  146.927 104.844 1.00 42.27  ? 11   A   0 C4    1 
ATOM   40    P  P     . U   A  1  12   ? 26.330  149.426 99.390  1.00 46.05  ? 12   U   0 P     1 
ATOM   41    O  OP1   . U   A  1  12   ? 26.825  150.483 98.476  1.00 46.67  ? 12   U   0 OP1   1 
ATOM   42    O  OP2   . U   A  1  12   ? 25.164  148.604 98.993  1.00 46.22  ? 12   U   0 OP2   1 
ATOM   43    O  "O5'" . U   A  1  12   ? 27.532  148.433 99.725  1.00 45.18  ? 12   U   0 "O5'" 1 
ATOM   44    C  "C5'" . U   A  1  12   ? 28.870  148.934 99.913  1.00 44.63  ? 12   U   0 "C5'" 1 
ATOM   45    C  "C4'" . U   A  1  12   ? 29.779  147.845 100.439 1.00 44.92  ? 12   U   0 "C4'" 1 
ATOM   46    O  "O4'" . U   A  1  12   ? 29.299  147.402 101.736 1.00 45.41  ? 12   U   0 "O4'" 1 
ATOM   47    C  "C3'" . U   A  1  12   ? 29.851  146.554 99.638  1.00 45.23  ? 12   U   0 "C3'" 1 
ATOM   48    O  "O3'" . U   A  1  12   ? 30.695  146.631 98.498  1.00 44.54  ? 12   U   0 "O3'" 1 
ATOM   49    C  "C2'" . U   A  1  12   ? 30.401  145.593 100.676 1.00 46.09  ? 12   U   0 "C2'" 1 
ATOM   50    O  "O2'" . U   A  1  12   ? 31.785  145.783 100.913 1.00 48.41  ? 12   U   0 "O2'" 1 
ATOM   51    C  "C1'" . U   A  1  12   ? 29.610  146.026 101.911 1.00 45.79  ? 12   U   0 "C1'" 1 
ATOM   52    N  N1    . U   A  1  12   ? 28.357  145.259 102.023 1.00 46.37  ? 12   U   0 N1    1 
ATOM   53    C  C2    . U   A  1  12   ? 28.446  143.952 102.489 1.00 48.27  ? 12   U   0 C2    1 
ATOM   54    O  O2    . U   A  1  12   ? 29.499  143.435 102.833 1.00 49.73  ? 12   U   0 O2    1 
ATOM   55    N  N3    . U   A  1  12   ? 27.256  143.268 102.530 1.00 47.82  ? 12   U   0 N3    1 
ATOM   56    C  C4    . U   A  1  12   ? 26.017  143.737 102.160 1.00 46.91  ? 12   U   0 C4    1 
ATOM   57    O  O4    . U   A  1  12   ? 25.057  142.968 102.169 1.00 46.79  ? 12   U   0 O4    1 
ATOM   58    C  C5    . U   A  1  12   ? 26.001  145.098 101.710 1.00 45.99  ? 12   U   0 C5    1 
ATOM   59    C  C6    . U   A  1  12   ? 27.141  145.795 101.661 1.00 45.07  ? 12   U   0 C6    1 
ATOM   60    P  P     . G   A  1  13   ? 30.134  146.179 97.059  1.00 44.33  ? 13   G   0 P     1 
ATOM   61    O  OP1   . G   A  1  13   ? 31.326  146.018 96.186  1.00 43.63  ? 13   G   0 OP1   1 
ATOM   62    O  OP2   . G   A  1  13   ? 29.050  147.124 96.666  1.00 42.96  ? 13   G   0 OP2   1 
ATOM   63    O  "O5'" . G   A  1  13   ? 29.480  144.740 97.296  1.00 43.31  ? 13   G   0 "O5'" 1 
ATOM   64    C  "C5'" . G   A  1  13   ? 30.265  143.673 97.837  1.00 41.82  ? 13   G   0 "C5'" 1 
ATOM   65    C  "C4'" . G   A  1  13   ? 29.401  142.488 98.228  1.00 42.34  ? 13   G   0 "C4'" 1 
ATOM   66    O  "O4'" . G   A  1  13   ? 28.296  142.896 99.074  1.00 42.61  ? 13   G   0 "O4'" 1 
ATOM   67    C  "C3'" . G   A  1  13   ? 28.659  141.706 97.158  1.00 40.87  ? 13   G   0 "C3'" 1 
ATOM   68    O  "O3'" . G   A  1  13   ? 29.526  140.872 96.404  1.00 41.07  ? 13   G   0 "O3'" 1 
ATOM   69    C  "C2'" . G   A  1  13   ? 27.766  140.837 98.033  1.00 41.01  ? 13   G   0 "C2'" 1 
ATOM   70    O  "O2'" . G   A  1  13   ? 28.499  139.790 98.642  1.00 40.47  ? 13   G   0 "O2'" 1 
ATOM   71    C  "C1'" . G   A  1  13   ? 27.363  141.828 99.128  1.00 39.90  ? 13   G   0 "C1'" 1 
ATOM   72    N  N9    . G   A  1  13   ? 26.009  142.342 98.941  1.00 39.87  ? 13   G   0 N9    1 
ATOM   73    C  C8    . G   A  1  13   ? 25.620  143.619 98.606  1.00 38.98  ? 13   G   0 C8    1 
ATOM   74    N  N7    . G   A  1  13   ? 24.321  143.752 98.519  1.00 38.00  ? 13   G   0 N7    1 
ATOM   75    C  C5    . G   A  1  13   ? 23.825  142.487 98.817  1.00 37.85  ? 13   G   0 C5    1 
ATOM   76    C  C6    . G   A  1  13   ? 22.489  142.013 98.892  1.00 36.13  ? 13   G   0 C6    1 
ATOM   77    O  O6    . G   A  1  13   ? 21.439  142.634 98.712  1.00 36.97  ? 13   G   0 O6    1 
ATOM   78    N  N1    . G   A  1  13   ? 22.443  140.666 99.220  1.00 36.07  ? 13   G   0 N1    1 
ATOM   79    C  C2    . G   A  1  13   ? 23.535  139.870 99.448  1.00 37.94  ? 13   G   0 C2    1 
ATOM   80    N  N2    . G   A  1  13   ? 23.282  138.589 99.740  1.00 37.75  ? 13   G   0 N2    1 
ATOM   81    N  N3    . G   A  1  13   ? 24.782  140.297 99.391  1.00 38.50  ? 13   G   0 N3    1 
ATOM   82    C  C4    . G   A  1  13   ? 24.853  141.606 99.074  1.00 38.85  ? 13   G   0 C4    1 
ATOM   83    P  P     . C   A  1  14   ? 29.021  140.241 95.014  1.00 40.68  ? 14   C   0 P     1 
ATOM   84    O  OP1   . C   A  1  14   ? 30.230  139.703 94.332  1.00 39.33  ? 14   C   0 OP1   1 
ATOM   85    O  OP2   . C   A  1  14   ? 28.154  141.219 94.308  1.00 38.72  ? 14   C   0 OP2   1 
ATOM   86    O  "O5'" . C   A  1  14   ? 28.114  139.015 95.469  1.00 39.80  ? 14   C   0 "O5'" 1 
ATOM   87    C  "C5'" . C   A  1  14   ? 28.706  137.828 96.020  1.00 40.05  ? 14   C   0 "C5'" 1 
ATOM   88    C  "C4'" . C   A  1  14   ? 27.657  136.759 96.210  1.00 42.32  ? 14   C   0 "C4'" 1 
ATOM   89    O  "O4'" . C   A  1  14   ? 26.670  137.223 97.170  1.00 43.82  ? 14   C   0 "O4'" 1 
ATOM   90    C  "C3'" . C   A  1  14   ? 26.838  136.401 94.979  1.00 43.35  ? 14   C   0 "C3'" 1 
ATOM   91    O  "O3'" . C   A  1  14   ? 27.526  135.469 94.146  1.00 45.63  ? 14   C   0 "O3'" 1 
ATOM   92    C  "C2'" . C   A  1  14   ? 25.587  135.807 95.609  1.00 43.61  ? 14   C   0 "C2'" 1 
ATOM   93    O  "O2'" . C   A  1  14   ? 25.808  134.500 96.101  1.00 45.59  ? 14   C   0 "O2'" 1 
ATOM   94    C  "C1'" . C   A  1  14   ? 25.388  136.740 96.806  1.00 41.53  ? 14   C   0 "C1'" 1 
ATOM   95    N  N1    . C   A  1  14   ? 24.522  137.898 96.507  1.00 39.71  ? 14   C   0 N1    1 
ATOM   96    C  C2    . C   A  1  14   ? 23.136  137.714 96.464  1.00 38.37  ? 14   C   0 C2    1 
ATOM   97    O  O2    . C   A  1  14   ? 22.675  136.582 96.666  1.00 39.78  ? 14   C   0 O2    1 
ATOM   98    N  N3    . C   A  1  14   ? 22.336  138.772 96.198  1.00 36.11  ? 14   C   0 N3    1 
ATOM   99    C  C4    . C   A  1  14   ? 22.871  139.974 95.978  1.00 35.39  ? 14   C   0 C4    1 
ATOM   100   N  N4    . C   A  1  14   ? 22.046  140.994 95.730  1.00 31.77  ? 14   C   0 N4    1 
ATOM   101   C  C5    . C   A  1  14   ? 24.276  140.187 96.006  1.00 37.25  ? 14   C   0 C5    1 
ATOM   102   C  C6    . C   A  1  14   ? 25.057  139.134 96.274  1.00 38.35  ? 14   C   0 C6    1 
ATOM   103   P  P     . C   A  1  15   ? 27.472  135.627 92.543  1.00 46.76  ? 15   C   0 P     1 
ATOM   104   O  OP1   . C   A  1  15   ? 28.558  134.773 91.998  1.00 45.77  ? 15   C   0 OP1   1 
ATOM   105   O  OP2   . C   A  1  15   ? 27.409  137.059 92.176  1.00 45.65  ? 15   C   0 OP2   1 
ATOM   106   O  "O5'" . C   A  1  15   ? 26.082  134.974 92.142  1.00 47.54  ? 15   C   0 "O5'" 1 
ATOM   107   C  "C5'" . C   A  1  15   ? 25.795  133.610 92.478  1.00 47.37  ? 15   C   0 "C5'" 1 
ATOM   108   C  "C4'" . C   A  1  15   ? 24.332  133.326 92.276  1.00 47.81  ? 15   C   0 "C4'" 1 
ATOM   109   O  "O4'" . C   A  1  15   ? 23.555  134.069 93.250  1.00 47.79  ? 15   C   0 "O4'" 1 
ATOM   110   C  "C3'" . C   A  1  15   ? 23.745  133.779 90.949  1.00 48.30  ? 15   C   0 "C3'" 1 
ATOM   111   O  "O3'" . C   A  1  15   ? 24.043  132.890 89.882  1.00 49.60  ? 15   C   0 "O3'" 1 
ATOM   112   C  "C2'" . C   A  1  15   ? 22.261  133.815 91.274  1.00 47.51  ? 15   C   0 "C2'" 1 
ATOM   113   O  "O2'" . C   A  1  15   ? 21.702  132.522 91.335  1.00 47.79  ? 15   C   0 "O2'" 1 
ATOM   114   C  "C1'" . C   A  1  15   ? 22.290  134.393 92.688  1.00 47.21  ? 15   C   0 "C1'" 1 
ATOM   115   N  N1    . C   A  1  15   ? 22.104  135.857 92.700  1.00 45.88  ? 15   C   0 N1    1 
ATOM   116   C  C2    . C   A  1  15   ? 20.797  136.360 92.663  1.00 45.17  ? 15   C   0 C2    1 
ATOM   117   O  O2    . C   A  1  15   ? 19.849  135.561 92.624  1.00 45.79  ? 15   C   0 O2    1 
ATOM   118   N  N3    . C   A  1  15   ? 20.600  137.696 92.668  1.00 43.35  ? 15   C   0 N3    1 
ATOM   119   C  C4    . C   A  1  15   ? 21.644  138.523 92.713  1.00 42.93  ? 15   C   0 C4    1 
ATOM   120   N  N4    . C   A  1  15   ? 21.397  139.833 92.722  1.00 43.24  ? 15   C   0 N4    1 
ATOM   121   C  C5    . C   A  1  15   ? 22.986  138.043 92.752  1.00 42.40  ? 15   C   0 C5    1 
ATOM   122   C  C6    . C   A  1  15   ? 23.170  136.715 92.743  1.00 44.13  ? 15   C   0 C6    1 
ATOM   123   P  P     . A   A  1  16   ? 24.172  133.462 88.385  1.00 51.89  ? 16   A   0 P     1 
ATOM   124   O  OP1   . A   A  1  16   ? 24.733  132.348 87.575  1.00 52.37  ? 16   A   0 OP1   1 
ATOM   125   O  OP2   . A   A  1  16   ? 24.871  134.777 88.406  1.00 50.67  ? 16   A   0 OP2   1 
ATOM   126   O  "O5'" . A   A  1  16   ? 22.666  133.736 87.937  1.00 50.33  ? 16   A   0 "O5'" 1 
ATOM   127   C  "C5'" . A   A  1  16   ? 21.772  132.651 87.636  1.00 48.80  ? 16   A   0 "C5'" 1 
ATOM   128   C  "C4'" . A   A  1  16   ? 20.372  133.173 87.422  1.00 48.76  ? 16   A   0 "C4'" 1 
ATOM   129   O  "O4'" . A   A  1  16   ? 19.942  133.877 88.620  1.00 46.42  ? 16   A   0 "O4'" 1 
ATOM   130   C  "C3'" . A   A  1  16   ? 20.192  134.209 86.322  1.00 49.42  ? 16   A   0 "C3'" 1 
ATOM   131   O  "O3'" . A   A  1  16   ? 20.087  133.640 85.018  1.00 50.85  ? 16   A   0 "O3'" 1 
ATOM   132   C  "C2'" . A   A  1  16   ? 18.893  134.879 86.740  1.00 48.43  ? 16   A   0 "C2'" 1 
ATOM   133   O  "O2'" . A   A  1  16   ? 17.763  134.102 86.411  1.00 50.99  ? 16   A   0 "O2'" 1 
ATOM   134   C  "C1'" . A   A  1  16   ? 19.062  134.931 88.260  1.00 46.86  ? 16   A   0 "C1'" 1 
ATOM   135   N  N9    . A   A  1  16   ? 19.651  136.202 88.680  1.00 45.25  ? 16   A   0 N9    1 
ATOM   136   C  C8    . A   A  1  16   ? 20.976  136.495 88.911  1.00 46.11  ? 16   A   0 C8    1 
ATOM   137   N  N7    . A   A  1  16   ? 21.191  137.747 89.244  1.00 44.39  ? 16   A   0 N7    1 
ATOM   138   C  C5    . A   A  1  16   ? 19.924  138.314 89.239  1.00 42.51  ? 16   A   0 C5    1 
ATOM   139   C  C6    . A   A  1  16   ? 19.472  139.617 89.503  1.00 40.21  ? 16   A   0 C6    1 
ATOM   140   N  N6    . A   A  1  16   ? 20.278  140.631 89.820  1.00 38.13  ? 16   A   0 N6    1 
ATOM   141   N  N1    . A   A  1  16   ? 18.144  139.848 89.422  1.00 40.24  ? 16   A   0 N1    1 
ATOM   142   C  C2    . A   A  1  16   ? 17.337  138.838 89.083  1.00 39.85  ? 16   A   0 C2    1 
ATOM   143   N  N3    . A   A  1  16   ? 17.642  137.573 88.800  1.00 41.88  ? 16   A   0 N3    1 
ATOM   144   C  C4    . A   A  1  16   ? 18.966  137.373 88.901  1.00 43.37  ? 16   A   0 C4    1 
ATOM   145   P  P     . G   A  1  17   ? 20.475  134.524 83.725  1.00 53.40  ? 17   G   0 P     1 
ATOM   146   O  OP1   . G   A  1  17   ? 20.323  133.637 82.538  1.00 52.90  ? 17   G   0 OP1   1 
ATOM   147   O  OP2   . G   A  1  17   ? 21.788  135.165 83.994  1.00 53.95  ? 17   G   0 OP2   1 
ATOM   148   O  "O5'" . G   A  1  17   ? 19.366  135.678 83.663  1.00 48.00  ? 17   G   0 "O5'" 1 
ATOM   149   C  "C5'" . G   A  1  17   ? 18.026  135.381 83.243  1.00 45.65  ? 17   G   0 "C5'" 1 
ATOM   150   C  "C4'" . G   A  1  17   ? 17.093  136.540 83.523  1.00 44.35  ? 17   G   0 "C4'" 1 
ATOM   151   O  "O4'" . G   A  1  17   ? 17.354  137.067 84.847  1.00 45.88  ? 17   G   0 "O4'" 1 
ATOM   152   C  "C3'" . G   A  1  17   ? 17.198  137.792 82.666  1.00 44.38  ? 17   G   0 "C3'" 1 
ATOM   153   O  "O3'" . G   A  1  17   ? 16.552  137.624 81.406  1.00 44.59  ? 17   G   0 "O3'" 1 
ATOM   154   C  "C2'" . G   A  1  17   ? 16.414  138.788 83.510  1.00 45.69  ? 17   G   0 "C2'" 1 
ATOM   155   O  "O2'" . G   A  1  17   ? 15.017  138.599 83.389  1.00 47.77  ? 17   G   0 "O2'" 1 
ATOM   156   C  "C1'" . G   A  1  17   ? 16.836  138.389 84.927  1.00 44.33  ? 17   G   0 "C1'" 1 
ATOM   157   N  N9    . G   A  1  17   ? 17.849  139.279 85.497  1.00 41.82  ? 17   G   0 N9    1 
ATOM   158   C  C8    . G   A  1  17   ? 19.167  138.990 85.751  1.00 39.99  ? 17   G   0 C8    1 
ATOM   159   N  N7    . G   A  1  17   ? 19.826  140.002 86.246  1.00 40.31  ? 17   G   0 N7    1 
ATOM   160   C  C5    . G   A  1  17   ? 18.888  141.020 86.328  1.00 39.76  ? 17   G   0 C5    1 
ATOM   161   C  C6    . G   A  1  17   ? 19.021  142.357 86.787  1.00 41.36  ? 17   G   0 C6    1 
ATOM   162   O  O6    . G   A  1  17   ? 20.033  142.931 87.219  1.00 43.31  ? 17   G   0 O6    1 
ATOM   163   N  N1    . G   A  1  17   ? 17.818  143.049 86.701  1.00 40.11  ? 17   G   0 N1    1 
ATOM   164   C  C2    . G   A  1  17   ? 16.641  142.530 86.229  1.00 41.33  ? 17   G   0 C2    1 
ATOM   165   N  N2    . G   A  1  17   ? 15.590  143.367 86.214  1.00 39.70  ? 17   G   0 N2    1 
ATOM   166   N  N3    . G   A  1  17   ? 16.503  141.283 85.800  1.00 40.62  ? 17   G   0 N3    1 
ATOM   167   C  C4    . G   A  1  17   ? 17.661  140.591 85.877  1.00 40.24  ? 17   G   0 C4    1 
ATOM   168   P  P     . C   A  1  18   ? 16.911  138.603 80.177  1.00 42.98  ? 18   C   0 P     1 
ATOM   169   O  OP1   . C   A  1  18   ? 16.131  138.135 79.002  1.00 43.86  ? 18   C   0 OP1   1 
ATOM   170   O  OP2   . C   A  1  18   ? 18.386  138.713 80.077  1.00 42.56  ? 18   C   0 OP2   1 
ATOM   171   O  "O5'" . C   A  1  18   ? 16.334  140.018 80.621  1.00 39.82  ? 18   C   0 "O5'" 1 
ATOM   172   C  "C5'" . C   A  1  18   ? 14.921  140.269 80.636  1.00 36.47  ? 18   C   0 "C5'" 1 
ATOM   173   C  "C4'" . C   A  1  18   ? 14.651  141.698 81.045  1.00 37.54  ? 18   C   0 "C4'" 1 
ATOM   174   O  "O4'" . C   A  1  18   ? 15.106  141.897 82.408  1.00 37.73  ? 18   C   0 "O4'" 1 
ATOM   175   C  "C3'" . C   A  1  18   ? 15.380  142.775 80.248  1.00 37.16  ? 18   C   0 "C3'" 1 
ATOM   176   O  "O3'" . C   A  1  18   ? 14.698  143.102 79.047  1.00 38.03  ? 18   C   0 "O3'" 1 
ATOM   177   C  "C2'" . C   A  1  18   ? 15.391  143.941 81.224  1.00 37.51  ? 18   C   0 "C2'" 1 
ATOM   178   O  "O2'" . C   A  1  18   ? 14.149  144.613 81.284  1.00 38.34  ? 18   C   0 "O2'" 1 
ATOM   179   C  "C1'" . C   A  1  18   ? 15.628  143.212 82.547  1.00 37.12  ? 18   C   0 "C1'" 1 
ATOM   180   N  N1    . C   A  1  18   ? 17.053  143.114 82.911  1.00 37.61  ? 18   C   0 N1    1 
ATOM   181   C  C2    . C   A  1  18   ? 17.669  144.216 83.508  1.00 39.20  ? 18   C   0 C2    1 
ATOM   182   O  O2    . C   A  1  18   ? 17.009  145.258 83.670  1.00 42.46  ? 18   C   0 O2    1 
ATOM   183   N  N3    . C   A  1  18   ? 18.966  144.120 83.891  1.00 38.82  ? 18   C   0 N3    1 
ATOM   184   C  C4    . C   A  1  18   ? 19.641  142.983 83.688  1.00 38.43  ? 18   C   0 C4    1 
ATOM   185   N  N4    . C   A  1  18   ? 20.908  142.921 84.106  1.00 35.62  ? 18   C   0 N4    1 
ATOM   186   C  C5    . C   A  1  18   ? 19.045  141.858 83.056  1.00 37.13  ? 18   C   0 C5    1 
ATOM   187   C  C6    . C   A  1  18   ? 17.764  141.965 82.687  1.00 38.51  ? 18   C   0 C6    1 
ATOM   188   P  P     . U   A  1  19   ? 15.531  143.440 77.713  1.00 37.57  ? 19   U   0 P     1 
ATOM   189   O  OP1   . U   A  1  19   ? 14.554  143.467 76.596  1.00 40.68  ? 19   U   0 OP1   1 
ATOM   190   O  OP2   . U   A  1  19   ? 16.703  142.538 77.628  1.00 40.27  ? 19   U   0 OP2   1 
ATOM   191   O  "O5'" . U   A  1  19   ? 16.045  144.928 77.952  1.00 39.10  ? 19   U   0 "O5'" 1 
ATOM   192   C  "C5'" . U   A  1  19   ? 15.133  146.045 77.930  1.00 34.70  ? 19   U   0 "C5'" 1 
ATOM   193   C  "C4'" . U   A  1  19   ? 15.853  147.323 78.301  1.00 34.15  ? 19   U   0 "C4'" 1 
ATOM   194   O  "O4'" . U   A  1  19   ? 16.291  147.272 79.690  1.00 34.58  ? 19   U   0 "O4'" 1 
ATOM   195   C  "C3'" . U   A  1  19   ? 17.141  147.601 77.548  1.00 34.12  ? 19   U   0 "C3'" 1 
ATOM   196   O  "O3'" . U   A  1  19   ? 16.933  148.114 76.245  1.00 32.93  ? 19   U   0 "O3'" 1 
ATOM   197   C  "C2'" . U   A  1  19   ? 17.826  148.597 78.466  1.00 32.81  ? 19   U   0 "C2'" 1 
ATOM   198   O  "O2'" . U   A  1  19   ? 17.251  149.881 78.378  1.00 34.98  ? 19   U   0 "O2'" 1 
ATOM   199   C  "C1'" . U   A  1  19   ? 17.511  147.992 79.832  1.00 33.73  ? 19   U   0 "C1'" 1 
ATOM   200   N  N1    . U   A  1  19   ? 18.569  147.059 80.261  1.00 35.46  ? 19   U   0 N1    1 
ATOM   201   C  C2    . U   A  1  19   ? 19.710  147.592 80.868  1.00 34.99  ? 19   U   0 C2    1 
ATOM   202   O  O2    . U   A  1  19   ? 19.863  148.789 81.084  1.00 32.32  ? 19   U   0 O2    1 
ATOM   203   N  N3    . U   A  1  19   ? 20.664  146.667 81.211  1.00 33.47  ? 19   U   0 N3    1 
ATOM   204   C  C4    . U   A  1  19   ? 20.607  145.304 81.026  1.00 35.38  ? 19   U   0 C4    1 
ATOM   205   O  O4    . U   A  1  19   ? 21.567  144.612 81.359  1.00 35.51  ? 19   U   0 O4    1 
ATOM   206   C  C5    . U   A  1  19   ? 19.404  144.830 80.411  1.00 34.89  ? 19   U   0 C5    1 
ATOM   207   C  C6    . U   A  1  19   ? 18.451  145.698 80.059  1.00 35.15  ? 19   U   0 C6    1 
ATOM   208   P  P     . G   A  1  20   ? 18.032  147.835 75.110  1.00 32.92  ? 20   G   0 P     1 
ATOM   209   O  OP1   . G   A  1  20   ? 17.544  148.427 73.841  1.00 30.81  ? 20   G   0 OP1   1 
ATOM   210   O  OP2   . G   A  1  20   ? 18.428  146.402 75.151  1.00 32.00  ? 20   G   0 OP2   1 
ATOM   211   O  "O5'" . G   A  1  20   ? 19.298  148.661 75.607  1.00 33.62  ? 20   G   0 "O5'" 1 
ATOM   212   C  "C5'" . G   A  1  20   ? 19.227  150.078 75.790  1.00 31.58  ? 20   G   0 "C5'" 1 
ATOM   213   C  "C4'" . G   A  1  20   ? 20.523  150.591 76.364  1.00 31.68  ? 20   G   0 "C4'" 1 
ATOM   214   O  "O4'" . G   A  1  20   ? 20.692  150.129 77.732  1.00 30.70  ? 20   G   0 "O4'" 1 
ATOM   215   C  "C3'" . G   A  1  20   ? 21.788  150.116 75.675  1.00 31.09  ? 20   G   0 "C3'" 1 
ATOM   216   O  "O3'" . G   A  1  20   ? 22.018  150.807 74.451  1.00 32.13  ? 20   G   0 "O3'" 1 
ATOM   217   C  "C2'" . G   A  1  20   ? 22.832  150.395 76.749  1.00 30.34  ? 20   G   0 "C2'" 1 
ATOM   218   O  "O2'" . G   A  1  20   ? 23.163  151.762 76.850  1.00 31.31  ? 20   G   0 "O2'" 1 
ATOM   219   C  "C1'" . G   A  1  20   ? 22.073  149.980 78.013  1.00 30.37  ? 20   G   0 "C1'" 1 
ATOM   220   N  N9    . G   A  1  20   ? 22.338  148.585 78.360  1.00 32.06  ? 20   G   0 N9    1 
ATOM   221   C  C8    . G   A  1  20   ? 21.586  147.481 78.033  1.00 30.53  ? 20   G   0 C8    1 
ATOM   222   N  N7    . G   A  1  20   ? 22.126  146.360 78.427  1.00 29.76  ? 20   G   0 N7    1 
ATOM   223   C  C5    . G   A  1  20   ? 23.295  146.746 79.067  1.00 32.51  ? 20   G   0 C5    1 
ATOM   224   C  C6    . G   A  1  20   ? 24.305  145.962 79.694  1.00 33.51  ? 20   G   0 C6    1 
ATOM   225   O  O6    . G   A  1  20   ? 24.372  144.729 79.797  1.00 33.55  ? 20   G   0 O6    1 
ATOM   226   N  N1    . G   A  1  20   ? 25.316  146.762 80.225  1.00 33.10  ? 20   G   0 N1    1 
ATOM   227   C  C2    . G   A  1  20   ? 25.360  148.135 80.152  1.00 34.68  ? 20   G   0 C2    1 
ATOM   228   N  N2    . G   A  1  20   ? 26.426  148.731 80.711  1.00 32.77  ? 20   G   0 N2    1 
ATOM   229   N  N3    . G   A  1  20   ? 24.428  148.873 79.570  1.00 32.53  ? 20   G   0 N3    1 
ATOM   230   C  C4    . G   A  1  20   ? 23.433  148.117 79.052  1.00 32.83  ? 20   G   0 C4    1 
ATOM   231   P  P     . G   A  1  21   ? 23.175  150.303 73.458  1.00 34.96  ? 21   G   0 P     1 
ATOM   232   O  OP1   . G   A  1  21   ? 23.127  151.156 72.244  1.00 34.07  ? 21   G   0 OP1   1 
ATOM   233   O  OP2   . G   A  1  21   ? 23.115  148.830 73.315  1.00 33.23  ? 21   G   0 OP2   1 
ATOM   234   O  "O5'" . G   A  1  21   ? 24.499  150.659 74.269  1.00 35.44  ? 21   G   0 "O5'" 1 
ATOM   235   C  "C5'" . G   A  1  21   ? 25.737  149.978 74.021  1.00 30.14  ? 21   G   0 "C5'" 1 
ATOM   236   C  "C4'" . G   A  1  21   ? 26.687  150.217 75.168  1.00 30.12  ? 21   G   0 "C4'" 1 
ATOM   237   O  "O4'" . G   A  1  21   ? 26.201  149.553 76.363  1.00 31.75  ? 21   G   0 "O4'" 1 
ATOM   238   C  "C3'" . G   A  1  21   ? 28.073  149.642 74.970  1.00 30.99  ? 21   G   0 "C3'" 1 
ATOM   239   O  "O3'" . G   A  1  21   ? 28.851  150.526 74.167  1.00 29.83  ? 21   G   0 "O3'" 1 
ATOM   240   C  "C2'" . G   A  1  21   ? 28.577  149.493 76.402  1.00 29.62  ? 21   G   0 "C2'" 1 
ATOM   241   O  "O2'" . G   A  1  21   ? 29.040  150.703 76.970  1.00 28.81  ? 21   G   0 "O2'" 1 
ATOM   242   C  "C1'" . G   A  1  21   ? 27.297  149.068 77.125  1.00 30.03  ? 21   G   0 "C1'" 1 
ATOM   243   N  N9    . G   A  1  21   ? 27.141  147.624 77.285  1.00 31.50  ? 21   G   0 N9    1 
ATOM   244   C  C8    . G   A  1  21   ? 26.125  146.846 76.785  1.00 32.84  ? 21   G   0 C8    1 
ATOM   245   N  N7    . G   A  1  21   ? 26.241  145.586 77.100  1.00 31.89  ? 21   G   0 N7    1 
ATOM   246   C  C5    . G   A  1  21   ? 27.404  145.525 77.852  1.00 32.07  ? 21   G   0 C5    1 
ATOM   247   C  C6    . G   A  1  21   ? 28.038  144.419 78.466  1.00 33.59  ? 21   G   0 C6    1 
ATOM   248   O  O6    . G   A  1  21   ? 27.678  143.241 78.484  1.00 33.91  ? 21   G   0 O6    1 
ATOM   249   N  N1    . G   A  1  21   ? 29.208  144.794 79.113  1.00 34.48  ? 21   G   0 N1    1 
ATOM   250   C  C2    . G   A  1  21   ? 29.703  146.067 79.168  1.00 33.75  ? 21   G   0 C2    1 
ATOM   251   N  N2    . G   A  1  21   ? 30.855  146.216 79.826  1.00 34.29  ? 21   G   0 N2    1 
ATOM   252   N  N3    . G   A  1  21   ? 29.113  147.114 78.614  1.00 33.56  ? 21   G   0 N3    1 
ATOM   253   C  C4    . G   A  1  21   ? 27.977  146.771 77.973  1.00 32.19  ? 21   G   0 C4    1 
ATOM   254   P  P     . U   A  1  22   ? 29.666  149.944 72.923  1.00 29.45  ? 22   U   0 P     1 
ATOM   255   O  OP1   . U   A  1  22   ? 30.326  151.072 72.222  1.00 29.73  ? 22   U   0 OP1   1 
ATOM   256   O  OP2   . U   A  1  22   ? 28.784  149.022 72.162  1.00 29.47  ? 22   U   0 OP2   1 
ATOM   257   O  "O5'" . U   A  1  22   ? 30.787  149.050 73.613  1.00 29.82  ? 22   U   0 "O5'" 1 
ATOM   258   C  "C5'" . U   A  1  22   ? 31.702  149.610 74.569  1.00 28.09  ? 22   U   0 "C5'" 1 
ATOM   259   C  "C4'" . U   A  1  22   ? 32.432  148.507 75.288  1.00 27.26  ? 22   U   0 "C4'" 1 
ATOM   260   O  "O4'" . U   A  1  22   ? 31.503  147.785 76.133  1.00 30.25  ? 22   U   0 "O4'" 1 
ATOM   261   C  "C3'" . U   A  1  22   ? 33.036  147.438 74.391  1.00 28.92  ? 22   U   0 "C3'" 1 
ATOM   262   O  "O3'" . U   A  1  22   ? 34.316  147.840 73.920  1.00 29.26  ? 22   U   0 "O3'" 1 
ATOM   263   C  "C2'" . U   A  1  22   ? 33.140  146.249 75.334  1.00 30.26  ? 22   U   0 "C2'" 1 
ATOM   264   O  "O2'" . U   A  1  22   ? 34.252  146.354 76.196  1.00 34.10  ? 22   U   0 "O2'" 1 
ATOM   265   C  "C1'" . U   A  1  22   ? 31.871  146.415 76.174  1.00 31.31  ? 22   U   0 "C1'" 1 
ATOM   266   N  N1    . U   A  1  22   ? 30.727  145.586 75.752  1.00 31.89  ? 22   U   0 N1    1 
ATOM   267   C  C2    . U   A  1  22   ? 30.699  144.267 76.181  1.00 32.98  ? 22   U   0 C2    1 
ATOM   268   O  O2    . U   A  1  22   ? 31.598  143.753 76.814  1.00 35.00  ? 22   U   0 O2    1 
ATOM   269   N  N3    . U   A  1  22   ? 29.579  143.564 75.828  1.00 33.95  ? 22   U   0 N3    1 
ATOM   270   C  C4    . U   A  1  22   ? 28.514  144.015 75.091  1.00 33.33  ? 22   U   0 C4    1 
ATOM   271   O  O4    . U   A  1  22   ? 27.526  143.294 74.972  1.00 35.22  ? 22   U   0 O4    1 
ATOM   272   C  C5    . U   A  1  22   ? 28.630  145.370 74.636  1.00 31.90  ? 22   U   0 C5    1 
ATOM   273   C  C6    . U   A  1  22   ? 29.704  146.093 74.976  1.00 31.85  ? 22   U   0 C6    1 
ATOM   274   P  P     . G   A  1  23   ? 34.802  147.426 72.445  1.00 27.86  ? 23   G   0 P     1 
ATOM   275   O  OP1   . G   A  1  23   ? 36.210  147.866 72.330  1.00 33.02  ? 23   G   0 OP1   1 
ATOM   276   O  OP2   . G   A  1  23   ? 33.804  147.906 71.465  1.00 29.15  ? 23   G   0 OP2   1 
ATOM   277   O  "O5'" . G   A  1  23   ? 34.787  145.834 72.437  1.00 29.42  ? 23   G   0 "O5'" 1 
ATOM   278   C  "C5'" . G   A  1  23   ? 35.785  145.063 73.136  1.00 26.55  ? 23   G   0 "C5'" 1 
ATOM   279   C  "C4'" . G   A  1  23   ? 35.433  143.596 73.072  1.00 27.64  ? 23   G   0 "C4'" 1 
ATOM   280   O  "O4'" . G   A  1  23   ? 34.155  143.383 73.734  1.00 28.64  ? 23   G   0 "O4'" 1 
ATOM   281   C  "C3'" . G   A  1  23   ? 35.233  143.053 71.666  1.00 26.96  ? 23   G   0 "C3'" 1 
ATOM   282   O  "O3'" . G   A  1  23   ? 36.484  142.649 71.125  1.00 27.80  ? 23   G   0 "O3'" 1 
ATOM   283   C  "C2'" . G   A  1  23   ? 34.275  141.889 71.894  1.00 26.33  ? 23   G   0 "C2'" 1 
ATOM   284   O  "O2'" . G   A  1  23   ? 34.924  140.759 72.427  1.00 26.94  ? 23   G   0 "O2'" 1 
ATOM   285   C  "C1'" . G   A  1  23   ? 33.382  142.448 73.002  1.00 26.65  ? 23   G   0 "C1'" 1 
ATOM   286   N  N9    . G   A  1  23   ? 32.177  143.128 72.531  1.00 27.98  ? 23   G   0 N9    1 
ATOM   287   C  C8    . G   A  1  23   ? 32.089  144.398 72.005  1.00 26.75  ? 23   G   0 C8    1 
ATOM   288   N  N7    . G   A  1  23   ? 30.870  144.737 71.687  1.00 25.39  ? 23   G   0 N7    1 
ATOM   289   C  C5    . G   A  1  23   ? 30.104  143.628 72.021  1.00 26.15  ? 23   G   0 C5    1 
ATOM   290   C  C6    . G   A  1  23   ? 28.709  143.405 71.898  1.00 24.34  ? 23   G   0 C6    1 
ATOM   291   O  O6    . G   A  1  23   ? 27.848  144.168 71.462  1.00 24.73  ? 23   G   0 O6    1 
ATOM   292   N  N1    . G   A  1  23   ? 28.349  142.137 72.344  1.00 23.67  ? 23   G   0 N1    1 
ATOM   293   C  C2    . G   A  1  23   ? 29.222  141.199 72.841  1.00 26.13  ? 23   G   0 C2    1 
ATOM   294   N  N2    . G   A  1  23   ? 28.691  140.021 73.204  1.00 25.18  ? 23   G   0 N2    1 
ATOM   295   N  N3    . G   A  1  23   ? 30.526  141.396 72.967  1.00 25.87  ? 23   G   0 N3    1 
ATOM   296   C  C4    . G   A  1  23   ? 30.895  142.623 72.539  1.00 27.43  ? 23   G   0 C4    1 
ATOM   297   P  P     . G   A  1  24   ? 36.818  142.916 69.573  1.00 26.95  ? 24   G   0 P     1 
ATOM   298   O  OP1   . G   A  1  24   ? 38.288  142.827 69.422  1.00 28.17  ? 24   G   0 OP1   1 
ATOM   299   O  OP2   . G   A  1  24   ? 36.110  144.154 69.163  1.00 29.43  ? 24   G   0 OP2   1 
ATOM   300   O  "O5'" . G   A  1  24   ? 36.166  141.684 68.805  1.00 24.55  ? 24   G   0 "O5'" 1 
ATOM   301   C  "C5'" . G   A  1  24   ? 36.296  140.337 69.313  1.00 24.31  ? 24   G   0 "C5'" 1 
ATOM   302   C  "C4'" . G   A  1  24   ? 35.160  139.486 68.806  1.00 22.61  ? 24   G   0 "C4'" 1 
ATOM   303   O  "O4'" . G   A  1  24   ? 33.918  140.135 69.191  1.00 23.57  ? 24   G   0 "O4'" 1 
ATOM   304   C  "C3'" . G   A  1  24   ? 35.088  139.314 67.287  1.00 22.46  ? 24   G   0 "C3'" 1 
ATOM   305   O  "O3'" . G   A  1  24   ? 34.443  138.082 67.008  1.00 26.26  ? 24   G   0 "O3'" 1 
ATOM   306   C  "C2'" . G   A  1  24   ? 34.169  140.454 66.884  1.00 22.54  ? 24   G   0 "C2'" 1 
ATOM   307   O  "O2'" . G   A  1  24   ? 33.516  140.260 65.657  1.00 26.95  ? 24   G   0 "O2'" 1 
ATOM   308   C  "C1'" . G   A  1  24   ? 33.167  140.435 68.032  1.00 25.19  ? 24   G   0 "C1'" 1 
ATOM   309   N  N9    . G   A  1  24   ? 32.469  141.704 68.214  1.00 27.15  ? 24   G   0 N9    1 
ATOM   310   C  C8    . G   A  1  24   ? 32.972  142.968 68.004  1.00 27.36  ? 24   G   0 C8    1 
ATOM   311   N  N7    . G   A  1  24   ? 32.076  143.907 68.154  1.00 28.92  ? 24   G   0 N7    1 
ATOM   312   C  C5    . G   A  1  24   ? 30.917  143.223 68.504  1.00 27.78  ? 24   G   0 C5    1 
ATOM   313   C  C6    . G   A  1  24   ? 29.615  143.707 68.764  1.00 26.27  ? 24   G   0 C6    1 
ATOM   314   O  O6    . G   A  1  24   ? 29.203  144.866 68.718  1.00 25.89  ? 24   G   0 O6    1 
ATOM   315   N  N1    . G   A  1  24   ? 28.746  142.681 69.099  1.00 27.38  ? 24   G   0 N1    1 
ATOM   316   C  C2    . G   A  1  24   ? 29.082  141.355 69.173  1.00 29.67  ? 24   G   0 C2    1 
ATOM   317   N  N2    . G   A  1  24   ? 28.096  140.523 69.546  1.00 28.53  ? 24   G   0 N2    1 
ATOM   318   N  N3    . G   A  1  24   ? 30.291  140.882 68.907  1.00 27.07  ? 24   G   0 N3    1 
ATOM   319   C  C4    . G   A  1  24   ? 31.152  141.867 68.581  1.00 26.81  ? 24   G   0 C4    1 
ATOM   320   P  P     . A   A  1  25   ? 34.838  137.227 65.706  1.00 26.24  ? 25   A   0 P     1 
ATOM   321   O  OP1   . A   A  1  25   ? 36.305  137.006 65.703  1.00 28.48  ? 25   A   0 OP1   1 
ATOM   322   O  OP2   . A   A  1  25   ? 34.184  137.795 64.507  1.00 27.36  ? 25   A   0 OP2   1 
ATOM   323   O  "O5'" . A   A  1  25   ? 34.132  135.831 65.996  1.00 27.81  ? 25   A   0 "O5'" 1 
ATOM   324   C  "C5'" . A   A  1  25   ? 34.586  134.987 67.062  1.00 26.88  ? 25   A   0 "C5'" 1 
ATOM   325   C  "C4'" . A   A  1  25   ? 33.416  134.293 67.709  1.00 28.25  ? 25   A   0 "C4'" 1 
ATOM   326   O  "O4'" . A   A  1  25   ? 32.623  135.242 68.472  1.00 30.14  ? 25   A   0 "O4'" 1 
ATOM   327   C  "C3'" . A   A  1  25   ? 32.416  133.671 66.757  1.00 27.86  ? 25   A   0 "C3'" 1 
ATOM   328   O  "O3'" . A   A  1  25   ? 32.860  132.416 66.262  1.00 29.42  ? 25   A   0 "O3'" 1 
ATOM   329   C  "C2'" . A   A  1  25   ? 31.184  133.546 67.638  1.00 29.23  ? 25   A   0 "C2'" 1 
ATOM   330   O  "O2'" . A   A  1  25   ? 31.274  132.449 68.518  1.00 31.84  ? 25   A   0 "O2'" 1 
ATOM   331   C  "C1'" . A   A  1  25   ? 31.261  134.844 68.449  1.00 30.63  ? 25   A   0 "C1'" 1 
ATOM   332   N  N9    . A   A  1  25   ? 30.465  135.927 67.863  1.00 32.44  ? 25   A   0 N9    1 
ATOM   333   C  C8    . A   A  1  25   ? 30.914  137.082 67.266  1.00 33.62  ? 25   A   0 C8    1 
ATOM   334   N  N7    . A   A  1  25   ? 29.954  137.856 66.821  1.00 33.87  ? 25   A   0 N7    1 
ATOM   335   C  C5    . A   A  1  25   ? 28.795  137.168 67.145  1.00 33.30  ? 25   A   0 C5    1 
ATOM   336   C  C6    . A   A  1  25   ? 27.441  137.455 66.933  1.00 33.87  ? 25   A   0 C6    1 
ATOM   337   N  N6    . A   A  1  25   ? 27.007  138.561 66.323  1.00 34.38  ? 25   A   0 N6    1 
ATOM   338   N  N1    . A   A  1  25   ? 26.533  136.556 67.373  1.00 33.19  ? 25   A   0 N1    1 
ATOM   339   C  C2    . A   A  1  25   ? 26.968  135.452 67.986  1.00 30.08  ? 25   A   0 C2    1 
ATOM   340   N  N3    . A   A  1  25   ? 28.210  135.072 68.246  1.00 32.00  ? 25   A   0 N3    1 
ATOM   341   C  C4    . A   A  1  25   ? 29.091  135.983 67.793  1.00 32.73  ? 25   A   0 C4    1 
ATOM   342   P  P     . U   A  1  26   ? 32.366  131.911 64.815  1.00 27.71  ? 26   U   0 P     1 
ATOM   343   O  OP1   . U   A  1  26   ? 32.793  130.500 64.653  1.00 27.72  ? 26   U   0 OP1   1 
ATOM   344   O  OP2   . U   A  1  26   ? 32.770  132.923 63.810  1.00 26.02  ? 26   U   0 OP2   1 
ATOM   345   O  "O5'" . U   A  1  26   ? 30.782  131.933 64.935  1.00 26.83  ? 26   U   0 "O5'" 1 
ATOM   346   C  "C5'" . U   A  1  26   ? 30.089  131.013 65.798  1.00 24.44  ? 26   U   0 "C5'" 1 
ATOM   347   C  "C4'" . U   A  1  26   ? 28.609  131.265 65.724  1.00 23.04  ? 26   U   0 "C4'" 1 
ATOM   348   O  "O4'" . U   A  1  26   ? 28.325  132.598 66.221  1.00 25.55  ? 26   U   0 "O4'" 1 
ATOM   349   C  "C3'" . U   A  1  26   ? 28.059  131.272 64.312  1.00 24.65  ? 26   U   0 "C3'" 1 
ATOM   350   O  "O3'" . U   A  1  26   ? 27.784  129.955 63.888  1.00 26.37  ? 26   U   0 "O3'" 1 
ATOM   351   C  "C2'" . U   A  1  26   ? 26.815  132.134 64.450  1.00 25.14  ? 26   U   0 "C2'" 1 
ATOM   352   O  "O2'" . U   A  1  26   ? 25.738  131.445 65.045  1.00 26.49  ? 26   U   0 "O2'" 1 
ATOM   353   C  "C1'" . U   A  1  26   ? 27.304  133.194 65.438  1.00 23.84  ? 26   U   0 "C1'" 1 
ATOM   354   N  N1    . U   A  1  26   ? 27.841  134.414 64.808  1.00 24.71  ? 26   U   0 N1    1 
ATOM   355   C  C2    . U   A  1  26   ? 26.932  135.356 64.362  1.00 23.58  ? 26   U   0 C2    1 
ATOM   356   O  O2    . U   A  1  26   ? 25.733  135.186 64.402  1.00 26.22  ? 26   U   0 O2    1 
ATOM   357   N  N3    . U   A  1  26   ? 27.481  136.503 63.857  1.00 22.45  ? 26   U   0 N3    1 
ATOM   358   C  C4    . U   A  1  26   ? 28.819  136.800 63.735  1.00 24.76  ? 26   U   0 C4    1 
ATOM   359   O  O4    . U   A  1  26   ? 29.151  137.931 63.373  1.00 24.41  ? 26   U   0 O4    1 
ATOM   360   C  C5    . U   A  1  26   ? 29.705  135.758 64.172  1.00 22.72  ? 26   U   0 C5    1 
ATOM   361   C  C6    . U   A  1  26   ? 29.200  134.631 64.680  1.00 22.59  ? 26   U   0 C6    1 
ATOM   362   P  P     . U   A  1  27   ? 28.005  129.553 62.355  1.00 29.75  ? 27   U   0 P     1 
ATOM   363   O  OP1   . U   A  1  27   ? 27.774  128.092 62.266  1.00 29.73  ? 27   U   0 OP1   1 
ATOM   364   O  OP2   . U   A  1  27   ? 29.289  130.126 61.873  1.00 29.31  ? 27   U   0 OP2   1 
ATOM   365   O  "O5'" . U   A  1  27   ? 26.813  130.285 61.595  1.00 31.44  ? 27   U   0 "O5'" 1 
ATOM   366   C  "C5'" . U   A  1  27   ? 25.454  129.879 61.815  1.00 29.43  ? 27   U   0 "C5'" 1 
ATOM   367   C  "C4'" . U   A  1  27   ? 24.506  130.829 61.131  1.00 28.63  ? 27   U   0 "C4'" 1 
ATOM   368   O  "O4'" . U   A  1  27   ? 24.540  132.127 61.775  1.00 29.01  ? 27   U   0 "O4'" 1 
ATOM   369   C  "C3'" . U   A  1  27   ? 24.813  131.140 59.680  1.00 27.86  ? 27   U   0 "C3'" 1 
ATOM   370   O  "O3'" . U   A  1  27   ? 24.371  130.098 58.828  1.00 27.71  ? 27   U   0 "O3'" 1 
ATOM   371   C  "C2'" . U   A  1  27   ? 24.043  132.433 59.480  1.00 26.59  ? 27   U   0 "C2'" 1 
ATOM   372   O  "O2'" . U   A  1  27   ? 22.658  132.201 59.396  1.00 26.98  ? 27   U   0 "O2'" 1 
ATOM   373   C  "C1'" . U   A  1  27   ? 24.313  133.141 60.806  1.00 28.31  ? 27   U   0 "C1'" 1 
ATOM   374   N  N1    . U   A  1  27   ? 25.487  134.032 60.765  1.00 29.98  ? 27   U   0 N1    1 
ATOM   375   C  C2    . U   A  1  27   ? 25.281  135.358 60.416  1.00 30.06  ? 27   U   0 C2    1 
ATOM   376   O  O2    . U   A  1  27   ? 24.185  135.811 60.139  1.00 32.21  ? 27   U   0 O2    1 
ATOM   377   N  N3    . U   A  1  27   ? 26.410  136.136 60.403  1.00 30.09  ? 27   U   0 N3    1 
ATOM   378   C  C4    . U   A  1  27   ? 27.693  135.738 60.698  1.00 30.19  ? 27   U   0 C4    1 
ATOM   379   O  O4    . U   A  1  27   ? 28.600  136.567 60.676  1.00 30.50  ? 27   U   0 O4    1 
ATOM   380   C  C5    . U   A  1  27   ? 27.829  134.358 61.041  1.00 28.92  ? 27   U   0 C5    1 
ATOM   381   C  C6    . U   A  1  27   ? 26.752  133.571 61.062  1.00 29.53  ? 27   U   0 C6    1 
ATOM   382   P  P     . G   A  1  28   ? 25.145  129.815 57.454  1.00 29.14  ? 28   G   0 P     1 
ATOM   383   O  OP1   . G   A  1  28   ? 24.568  128.586 56.866  1.00 27.63  ? 28   G   0 OP1   1 
ATOM   384   O  OP2   . G   A  1  28   ? 26.605  129.891 57.676  1.00 31.52  ? 28   G   0 OP2   1 
ATOM   385   O  "O5'" . G   A  1  28   ? 24.772  131.073 56.556  1.00 30.05  ? 28   G   0 "O5'" 1 
ATOM   386   C  "C5'" . G   A  1  28   ? 23.411  131.374 56.229  1.00 28.54  ? 28   G   0 "C5'" 1 
ATOM   387   C  "C4'" . G   A  1  28   ? 23.314  132.759 55.644  1.00 27.99  ? 28   G   0 "C4'" 1 
ATOM   388   O  "O4'" . G   A  1  28   ? 23.626  133.742 56.667  1.00 29.30  ? 28   G   0 "O4'" 1 
ATOM   389   C  "C3'" . G   A  1  28   ? 24.299  133.104 54.540  1.00 28.77  ? 28   G   0 "C3'" 1 
ATOM   390   O  "O3'" . G   A  1  28   ? 23.949  132.565 53.280  1.00 28.33  ? 28   G   0 "O3'" 1 
ATOM   391   C  "C2'" . G   A  1  28   ? 24.232  134.620 54.554  1.00 29.11  ? 28   G   0 "C2'" 1 
ATOM   392   O  "O2'" . G   A  1  28   ? 23.029  135.096 53.999  1.00 30.17  ? 28   G   0 "O2'" 1 
ATOM   393   C  "C1'" . G   A  1  28   ? 24.209  134.889 56.058  1.00 30.95  ? 28   G   0 "C1'" 1 
ATOM   394   N  N9    . G   A  1  28   ? 25.565  135.072 56.574  1.00 30.83  ? 28   G   0 N9    1 
ATOM   395   C  C8    . G   A  1  28   ? 26.383  134.122 57.136  1.00 31.86  ? 28   G   0 C8    1 
ATOM   396   N  N7    . G   A  1  28   ? 27.560  134.585 57.459  1.00 30.98  ? 28   G   0 N7    1 
ATOM   397   C  C5    . G   A  1  28   ? 27.515  135.924 57.098  1.00 32.71  ? 28   G   0 C5    1 
ATOM   398   C  C6    . G   A  1  28   ? 28.510  136.946 57.198  1.00 31.22  ? 28   G   0 C6    1 
ATOM   399   O  O6    . G   A  1  28   ? 29.661  136.862 57.638  1.00 31.60  ? 28   G   0 O6    1 
ATOM   400   N  N1    . G   A  1  28   ? 28.044  138.161 56.714  1.00 29.25  ? 28   G   0 N1    1 
ATOM   401   C  C2    . G   A  1  28   ? 26.791  138.378 56.200  1.00 30.53  ? 28   G   0 C2    1 
ATOM   402   N  N2    . G   A  1  28   ? 26.531  139.624 55.797  1.00 28.57  ? 28   G   0 N2    1 
ATOM   403   N  N3    . G   A  1  28   ? 25.857  137.439 56.094  1.00 31.96  ? 28   G   0 N3    1 
ATOM   404   C  C4    . G   A  1  28   ? 26.287  136.244 56.559  1.00 32.33  ? 28   G   0 C4    1 
ATOM   405   P  P     . C   A  1  29   ? 25.106  132.194 52.234  1.00 29.44  ? 29   C   0 P     1 
ATOM   406   O  OP1   . C   A  1  29   ? 24.461  131.669 51.018  1.00 31.24  ? 29   C   0 OP1   1 
ATOM   407   O  OP2   . C   A  1  29   ? 26.152  131.387 52.918  1.00 31.80  ? 29   C   0 OP2   1 
ATOM   408   O  "O5'" . C   A  1  29   ? 25.763  133.590 51.864  1.00 31.75  ? 29   C   0 "O5'" 1 
ATOM   409   C  "C5'" . C   A  1  29   ? 25.025  134.587 51.164  1.00 30.69  ? 29   C   0 "C5'" 1 
ATOM   410   C  "C4'" . C   A  1  29   ? 25.880  135.806 50.962  1.00 31.33  ? 29   C   0 "C4'" 1 
ATOM   411   O  "O4'" . C   A  1  29   ? 26.314  136.300 52.254  1.00 32.87  ? 29   C   0 "O4'" 1 
ATOM   412   C  "C3'" . C   A  1  29   ? 27.189  135.597 50.220  1.00 33.50  ? 29   C   0 "C3'" 1 
ATOM   413   O  "O3'" . C   A  1  29   ? 26.989  135.562 48.810  1.00 33.98  ? 29   C   0 "O3'" 1 
ATOM   414   C  "C2'" . C   A  1  29   ? 27.969  136.835 50.640  1.00 33.42  ? 29   C   0 "C2'" 1 
ATOM   415   O  "O2'" . C   A  1  29   ? 27.539  137.987 49.945  1.00 34.84  ? 29   C   0 "O2'" 1 
ATOM   416   C  "C1'" . C   A  1  29   ? 27.554  136.968 52.108  1.00 31.12  ? 29   C   0 "C1'" 1 
ATOM   417   N  N1    . C   A  1  29   ? 28.539  136.395 53.047  1.00 31.61  ? 29   C   0 N1    1 
ATOM   418   C  C2    . C   A  1  29   ? 29.662  137.164 53.384  1.00 31.53  ? 29   C   0 C2    1 
ATOM   419   O  O2    . C   A  1  29   ? 29.771  138.304 52.913  1.00 32.23  ? 29   C   0 O2    1 
ATOM   420   N  N3    . C   A  1  29   ? 30.600  136.647 54.211  1.00 30.98  ? 29   C   0 N3    1 
ATOM   421   C  C4    . C   A  1  29   ? 30.453  135.416 54.700  1.00 32.02  ? 29   C   0 C4    1 
ATOM   422   N  N4    . C   A  1  29   ? 31.421  134.944 55.486  1.00 30.55  ? 29   C   0 N4    1 
ATOM   423   C  C5    . C   A  1  29   ? 29.309  134.614 54.396  1.00 31.34  ? 29   C   0 C5    1 
ATOM   424   C  C6    . C   A  1  29   ? 28.384  135.140 53.574  1.00 32.10  ? 29   C   0 C6    1 
ATOM   425   P  P     . U   A  1  30   ? 27.891  134.598 47.894  1.00 37.38  ? 30   U   0 P     1 
ATOM   426   O  OP1   . U   A  1  30   ? 27.283  134.590 46.541  1.00 37.10  ? 30   U   0 OP1   1 
ATOM   427   O  OP2   . U   A  1  30   ? 28.094  133.316 48.610  1.00 35.42  ? 30   U   0 OP2   1 
ATOM   428   O  "O5'" . U   A  1  30   ? 29.300  135.342 47.787  1.00 37.62  ? 30   U   0 "O5'" 1 
ATOM   429   C  "C5'" . U   A  1  30   ? 29.373  136.746 47.480  1.00 36.42  ? 30   U   0 "C5'" 1 
ATOM   430   C  "C4'" . U   A  1  30   ? 30.812  137.228 47.499  1.00 37.18  ? 30   U   0 "C4'" 1 
ATOM   431   O  "O4'" . U   A  1  30   ? 31.343  137.170 48.856  1.00 37.22  ? 30   U   0 "O4'" 1 
ATOM   432   C  "C3'" . U   A  1  30   ? 31.813  136.485 46.614  1.00 36.22  ? 30   U   0 "C3'" 1 
ATOM   433   O  "O3'" . U   A  1  30   ? 32.746  137.401 46.054  1.00 38.11  ? 30   U   0 "O3'" 1 
ATOM   434   C  "C2'" . U   A  1  30   ? 32.560  135.606 47.608  1.00 35.56  ? 30   U   0 "C2'" 1 
ATOM   435   O  "O2'" . U   A  1  30   ? 33.875  135.336 47.168  1.00 35.58  ? 30   U   0 "O2'" 1 
ATOM   436   C  "C1'" . U   A  1  30   ? 32.588  136.504 48.843  1.00 35.50  ? 30   U   0 "C1'" 1 
ATOM   437   N  N1    . U   A  1  30   ? 32.771  135.802 50.124  1.00 36.38  ? 30   U   0 N1    1 
ATOM   438   C  C2    . U   A  1  30   ? 33.731  136.295 50.999  1.00 36.71  ? 30   U   0 C2    1 
ATOM   439   O  O2    . U   A  1  30   ? 34.378  137.307 50.779  1.00 37.78  ? 30   U   0 O2    1 
ATOM   440   N  N3    . U   A  1  30   ? 33.900  135.562 52.147  1.00 34.89  ? 30   U   0 N3    1 
ATOM   441   C  C4    . U   A  1  30   ? 33.221  134.422 52.514  1.00 35.55  ? 30   U   0 C4    1 
ATOM   442   O  O4    . U   A  1  30   ? 33.563  133.815 53.533  1.00 34.27  ? 30   U   0 O4    1 
ATOM   443   C  C5    . U   A  1  30   ? 32.222  134.000 51.581  1.00 34.40  ? 30   U   0 C5    1 
ATOM   444   C  C6    . U   A  1  30   ? 32.036  134.684 50.449  1.00 34.69  ? 30   U   0 C6    1 
ATOM   445   P  P     . C   A  1  31   ? 32.531  137.930 44.558  1.00 38.86  ? 31   C   0 P     1 
ATOM   446   O  OP1   . C   A  1  31   ? 31.825  139.232 44.662  1.00 41.26  ? 31   C   0 OP1   1 
ATOM   447   O  OP2   . C   A  1  31   ? 31.949  136.843 43.753  1.00 40.83  ? 31   C   0 OP2   1 
ATOM   448   O  "O5'" . C   A  1  31   ? 33.978  138.193 43.956  1.00 42.08  ? 31   C   0 "O5'" 1 
ATOM   449   C  "C5'" . C   A  1  31   ? 35.177  137.961 44.702  1.00 46.41  ? 31   C   0 "C5'" 1 
ATOM   450   C  "C4'" . C   A  1  31   ? 36.284  138.824 44.141  1.00 48.99  ? 31   C   0 "C4'" 1 
ATOM   451   O  "O4'" . C   A  1  31   ? 35.855  140.213 44.180  1.00 53.28  ? 31   C   0 "O4'" 1 
ATOM   452   C  "C3'" . C   A  1  31   ? 37.618  138.778 44.870  1.00 48.16  ? 31   C   0 "C3'" 1 
ATOM   453   O  "O3'" . C   A  1  31   ? 38.635  139.089 43.926  1.00 40.18  ? 31   C   0 "O3'" 1 
ATOM   454   C  "C2'" . C   A  1  31   ? 37.475  139.931 45.855  1.00 52.94  ? 31   C   0 "C2'" 1 
ATOM   455   O  "O2'" . C   A  1  31   ? 38.709  140.458 46.294  1.00 56.82  ? 31   C   0 "O2'" 1 
ATOM   456   C  "C1'" . C   A  1  31   ? 36.741  140.956 44.993  1.00 56.94  ? 31   C   0 "C1'" 1 
ATOM   457   N  N1    . C   A  1  31   ? 35.966  141.949 45.764  1.00 62.68  ? 31   C   0 N1    1 
ATOM   458   C  C2    . C   A  1  31   ? 36.573  143.182 46.087  1.00 66.08  ? 31   C   0 C2    1 
ATOM   459   O  O2    . C   A  1  31   ? 37.737  143.410 45.696  1.00 66.87  ? 31   C   0 O2    1 
ATOM   460   N  N3    . C   A  1  31   ? 35.875  144.090 46.811  1.00 67.67  ? 31   C   0 N3    1 
ATOM   461   C  C4    . C   A  1  31   ? 34.624  143.818 47.201  1.00 67.50  ? 31   C   0 C4    1 
ATOM   462   N  N4    . C   A  1  31   ? 33.976  144.745 47.915  1.00 67.85  ? 31   C   0 N4    1 
ATOM   463   C  C5    . C   A  1  31   ? 33.983  142.583 46.877  1.00 66.08  ? 31   C   0 C5    1 
ATOM   464   C  C6    . C   A  1  31   ? 34.683  141.687 46.166  1.00 64.18  ? 31   C   0 C6    1 
ATOM   465   P  P     . G   A  1  32   ? 39.601  137.937 43.367  1.00 35.85  ? 32   G   0 P     1 
ATOM   466   O  OP1   . G   A  1  32   ? 40.580  138.596 42.467  1.00 37.29  ? 32   G   0 OP1   1 
ATOM   467   O  OP2   . G   A  1  32   ? 38.786  136.810 42.855  1.00 37.01  ? 32   G   0 OP2   1 
ATOM   468   O  "O5'" . G   A  1  32   ? 40.373  137.421 44.653  1.00 33.31  ? 32   G   0 "O5'" 1 
ATOM   469   C  "C5'" . G   A  1  32   ? 41.130  138.314 45.478  1.00 27.01  ? 32   G   0 "C5'" 1 
ATOM   470   C  "C4'" . G   A  1  32   ? 41.694  137.559 46.653  1.00 26.61  ? 32   G   0 "C4'" 1 
ATOM   471   O  "O4'" . G   A  1  32   ? 40.603  137.097 47.499  1.00 27.78  ? 32   G   0 "O4'" 1 
ATOM   472   C  "C3'" . G   A  1  32   ? 42.439  136.286 46.286  1.00 27.19  ? 32   G   0 "C3'" 1 
ATOM   473   O  "O3'" . G   A  1  32   ? 43.773  136.562 45.879  1.00 26.65  ? 32   G   0 "O3'" 1 
ATOM   474   C  "C2'" . G   A  1  32   ? 42.334  135.475 47.572  1.00 26.95  ? 32   G   0 "C2'" 1 
ATOM   475   O  "O2'" . G   A  1  32   ? 43.241  135.902 48.565  1.00 29.56  ? 32   G   0 "O2'" 1 
ATOM   476   C  "C1'" . G   A  1  32   ? 40.910  135.815 48.020  1.00 27.35  ? 32   G   0 "C1'" 1 
ATOM   477   N  N9    . G   A  1  32   ? 39.922  134.865 47.514  1.00 31.88  ? 32   G   0 N9    1 
ATOM   478   C  C8    . G   A  1  32   ? 39.208  134.950 46.342  1.00 29.60  ? 32   G   0 C8    1 
ATOM   479   N  N7    . G   A  1  32   ? 38.415  133.933 46.151  1.00 32.84  ? 32   G   0 N7    1 
ATOM   480   C  C5    . G   A  1  32   ? 38.610  133.129 47.264  1.00 32.05  ? 32   G   0 C5    1 
ATOM   481   C  C6    . G   A  1  32   ? 38.026  131.886 47.612  1.00 32.17  ? 32   G   0 C6    1 
ATOM   482   O  O6    . G   A  1  32   ? 37.188  131.227 46.984  1.00 32.19  ? 32   G   0 O6    1 
ATOM   483   N  N1    . G   A  1  32   ? 38.513  131.414 48.830  1.00 31.76  ? 32   G   0 N1    1 
ATOM   484   C  C2    . G   A  1  32   ? 39.443  132.058 49.612  1.00 32.02  ? 32   G   0 C2    1 
ATOM   485   N  N2    . G   A  1  32   ? 39.795  131.453 50.752  1.00 29.77  ? 32   G   0 N2    1 
ATOM   486   N  N3    . G   A  1  32   ? 39.990  133.216 49.297  1.00 33.44  ? 32   G   0 N3    1 
ATOM   487   C  C4    . G   A  1  32   ? 39.533  133.691 48.118  1.00 32.83  ? 32   G   0 C4    1 
ATOM   488   P  P     . G   A  1  33   ? 44.704  135.379 45.331  1.00 29.07  ? 33   G   0 P     1 
ATOM   489   O  OP1   . G   A  1  33   ? 46.044  135.943 45.063  1.00 28.55  ? 33   G   0 OP1   1 
ATOM   490   O  OP2   . G   A  1  33   ? 43.976  134.673 44.248  1.00 31.61  ? 33   G   0 OP2   1 
ATOM   491   O  "O5'" . G   A  1  33   ? 44.835  134.407 46.586  1.00 31.19  ? 33   G   0 "O5'" 1 
ATOM   492   C  "C5'" . G   A  1  33   ? 45.179  133.020 46.425  1.00 29.27  ? 33   G   0 "C5'" 1 
ATOM   493   C  "C4'" . G   A  1  33   ? 44.805  132.247 47.665  1.00 29.01  ? 33   G   0 "C4'" 1 
ATOM   494   O  "O4'" . G   A  1  33   ? 43.379  132.380 47.935  1.00 29.84  ? 33   G   0 "O4'" 1 
ATOM   495   C  "C3'" . G   A  1  33   ? 45.028  130.752 47.566  1.00 27.00  ? 33   G   0 "C3'" 1 
ATOM   496   O  "O3'" . G   A  1  33   ? 46.395  130.433 47.815  1.00 26.83  ? 33   G   0 "O3'" 1 
ATOM   497   C  "C2'" . G   A  1  33   ? 44.075  130.223 48.629  1.00 27.53  ? 33   G   0 "C2'" 1 
ATOM   498   O  "O2'" . G   A  1  33   ? 44.570  130.399 49.940  1.00 27.67  ? 33   G   0 "O2'" 1 
ATOM   499   C  "C1'" . G   A  1  33   ? 42.871  131.155 48.448  1.00 28.56  ? 33   G   0 "C1'" 1 
ATOM   500   N  N9    . G   A  1  33   ? 41.863  130.647 47.514  1.00 30.40  ? 33   G   0 N9    1 
ATOM   501   C  C8    . G   A  1  33   ? 41.412  131.276 46.380  1.00 30.63  ? 33   G   0 C8    1 
ATOM   502   N  N7    . G   A  1  33   ? 40.526  130.583 45.724  1.00 30.19  ? 33   G   0 N7    1 
ATOM   503   C  C5    . G   A  1  33   ? 40.369  129.426 46.470  1.00 29.29  ? 33   G   0 C5    1 
ATOM   504   C  C6    . G   A  1  33   ? 39.530  128.298 46.250  1.00 29.47  ? 33   G   0 C6    1 
ATOM   505   O  O6    . G   A  1  33   ? 38.737  128.097 45.328  1.00 28.13  ? 33   G   0 O6    1 
ATOM   506   N  N1    . G   A  1  33   ? 39.682  127.346 47.250  1.00 29.71  ? 33   G   0 N1    1 
ATOM   507   C  C2    . G   A  1  33   ? 40.522  127.462 48.323  1.00 29.91  ? 33   G   0 C2    1 
ATOM   508   N  N2    . G   A  1  33   ? 40.511  126.435 49.178  1.00 29.09  ? 33   G   0 N2    1 
ATOM   509   N  N3    . G   A  1  33   ? 41.310  128.507 48.542  1.00 28.23  ? 33   G   0 N3    1 
ATOM   510   C  C4    . G   A  1  33   ? 41.182  129.445 47.582  1.00 28.81  ? 33   G   0 C4    1 
ATOM   511   P  P     . C   A  1  34   ? 47.184  129.460 46.805  1.00 27.90  ? 34   C   0 P     1 
ATOM   512   O  OP1   . C   A  1  34   ? 48.603  129.427 47.184  1.00 27.25  ? 34   C   0 OP1   1 
ATOM   513   O  OP2   . C   A  1  34   ? 46.811  129.829 45.407  1.00 32.52  ? 34   C   0 OP2   1 
ATOM   514   O  "O5'" . C   A  1  34   ? 46.562  128.024 47.087  1.00 29.40  ? 34   C   0 "O5'" 1 
ATOM   515   C  "C5'" . C   A  1  34   ? 46.631  127.418 48.390  1.00 26.46  ? 34   C   0 "C5'" 1 
ATOM   516   C  "C4'" . C   A  1  34   ? 45.736  126.207 48.437  1.00 26.91  ? 34   C   0 "C4'" 1 
ATOM   517   O  "O4'" . C   A  1  34   ? 44.343  126.618 48.345  1.00 29.80  ? 34   C   0 "O4'" 1 
ATOM   518   C  "C3'" . C   A  1  34   ? 45.906  125.254 47.267  1.00 26.03  ? 34   C   0 "C3'" 1 
ATOM   519   O  "O3'" . C   A  1  34   ? 47.025  124.408 47.454  1.00 24.22  ? 34   C   0 "O3'" 1 
ATOM   520   C  "C2'" . C   A  1  34   ? 44.572  124.525 47.269  1.00 26.59  ? 34   C   0 "C2'" 1 
ATOM   521   O  "O2'" . C   A  1  34   ? 44.456  123.606 48.333  1.00 27.36  ? 34   C   0 "O2'" 1 
ATOM   522   C  "C1'" . C   A  1  34   ? 43.616  125.677 47.568  1.00 26.21  ? 34   C   0 "C1'" 1 
ATOM   523   N  N1    . C   A  1  34   ? 43.112  126.349 46.350  1.00 28.26  ? 34   C   0 N1    1 
ATOM   524   C  C2    . C   A  1  34   ? 42.073  125.745 45.624  1.00 26.85  ? 34   C   0 C2    1 
ATOM   525   O  O2    . C   A  1  34   ? 41.651  124.648 45.984  1.00 29.31  ? 34   C   0 O2    1 
ATOM   526   N  N3    . C   A  1  34   ? 41.568  126.369 44.542  1.00 27.48  ? 34   C   0 N3    1 
ATOM   527   C  C4    . C   A  1  34   ? 42.064  127.545 44.157  1.00 30.21  ? 34   C   0 C4    1 
ATOM   528   N  N4    . C   A  1  34   ? 41.510  128.137 43.093  1.00 27.11  ? 34   C   0 N4    1 
ATOM   529   C  C5    . C   A  1  34   ? 43.145  128.172 44.852  1.00 28.87  ? 34   C   0 C5    1 
ATOM   530   C  C6    . C   A  1  34   ? 43.632  127.546 45.934  1.00 28.35  ? 34   C   0 C6    1 
ATOM   531   P  P     . U   A  1  35   ? 47.914  123.976 46.193  1.00 21.88  ? 35   U   0 P     1 
ATOM   532   O  OP1   . U   A  1  35   ? 49.112  123.277 46.715  1.00 23.08  ? 35   U   0 OP1   1 
ATOM   533   O  OP2   . U   A  1  35   ? 48.077  125.127 45.287  1.00 25.77  ? 35   U   0 OP2   1 
ATOM   534   O  "O5'" . U   A  1  35   ? 47.018  122.912 45.425  1.00 26.65  ? 35   U   0 "O5'" 1 
ATOM   535   C  "C5'" . U   A  1  35   ? 46.667  121.660 46.035  1.00 23.27  ? 35   U   0 "C5'" 1 
ATOM   536   C  "C4'" . U   A  1  35   ? 45.580  120.985 45.240  1.00 23.28  ? 35   U   0 "C4'" 1 
ATOM   537   O  "O4'" . U   A  1  35   ? 44.375  121.801 45.272  1.00 24.44  ? 35   U   0 "O4'" 1 
ATOM   538   C  "C3'" . U   A  1  35   ? 45.836  120.804 43.753  1.00 23.26  ? 35   U   0 "C3'" 1 
ATOM   539   O  "O3'" . U   A  1  35   ? 46.683  119.699 43.495  1.00 24.14  ? 35   U   0 "O3'" 1 
ATOM   540   C  "C2'" . U   A  1  35   ? 44.420  120.601 43.229  1.00 25.24  ? 35   U   0 "C2'" 1 
ATOM   541   O  "O2'" . U   A  1  35   ? 43.884  119.328 43.546  1.00 27.67  ? 35   U   0 "O2'" 1 
ATOM   542   C  "C1'" . U   A  1  35   ? 43.660  121.634 44.056  1.00 23.99  ? 35   U   0 "C1'" 1 
ATOM   543   N  N1    . U   A  1  35   ? 43.577  122.927 43.360  1.00 26.79  ? 35   U   0 N1    1 
ATOM   544   C  C2    . U   A  1  35   ? 42.568  123.073 42.427  1.00 28.68  ? 35   U   0 C2    1 
ATOM   545   O  O2    . U   A  1  35   ? 41.780  122.183 42.165  1.00 31.94  ? 35   U   0 O2    1 
ATOM   546   N  N3    . U   A  1  35   ? 42.522  124.295 41.804  1.00 30.42  ? 35   U   0 N3    1 
ATOM   547   C  C4    . U   A  1  35   ? 43.373  125.365 42.006  1.00 31.58  ? 35   U   0 C4    1 
ATOM   548   O  O4    . U   A  1  35   ? 43.184  126.413 41.382  1.00 30.14  ? 35   U   0 O4    1 
ATOM   549   C  C5    . U   A  1  35   ? 44.402  125.136 42.983  1.00 29.14  ? 35   U   0 C5    1 
ATOM   550   C  C6    . U   A  1  35   ? 44.465  123.958 43.613  1.00 26.91  ? 35   U   0 C6    1 
ATOM   551   P  P     . C   A  1  36   ? 47.381  119.545 42.055  1.00 26.15  ? 36   C   0 P     1 
ATOM   552   O  OP1   . C   A  1  36   ? 48.280  118.368 42.154  1.00 27.19  ? 36   C   0 OP1   1 
ATOM   553   O  OP2   . C   A  1  36   ? 47.926  120.850 41.612  1.00 26.06  ? 36   C   0 OP2   1 
ATOM   554   O  "O5'" . C   A  1  36   ? 46.182  119.180 41.077  1.00 27.05  ? 36   C   0 "O5'" 1 
ATOM   555   C  "C5'" . C   A  1  36   ? 45.470  117.944 41.220  1.00 25.14  ? 36   C   0 "C5'" 1 
ATOM   556   C  "C4'" . C   A  1  36   ? 44.298  117.910 40.277  1.00 25.56  ? 36   C   0 "C4'" 1 
ATOM   557   O  "O4'" . C   A  1  36   ? 43.412  119.026 40.574  1.00 24.56  ? 36   C   0 "O4'" 1 
ATOM   558   C  "C3'" . C   A  1  36   ? 44.619  118.110 38.805  1.00 27.22  ? 36   C   0 "C3'" 1 
ATOM   559   O  "O3'" . C   A  1  36   ? 45.108  116.948 38.164  1.00 30.54  ? 36   C   0 "O3'" 1 
ATOM   560   C  "C2'" . C   A  1  36   ? 43.273  118.544 38.257  1.00 28.16  ? 36   C   0 "C2'" 1 
ATOM   561   O  "O2'" . C   A  1  36   ? 42.368  117.465 38.136  1.00 27.58  ? 36   C   0 "O2'" 1 
ATOM   562   C  "C1'" . C   A  1  36   ? 42.804  119.478 39.371  1.00 26.55  ? 36   C   0 "C1'" 1 
ATOM   563   N  N1    . C   A  1  36   ? 43.218  120.872 39.113  1.00 27.12  ? 36   C   0 N1    1 
ATOM   564   C  C2    . C   A  1  36   ? 42.436  121.641 38.258  1.00 27.19  ? 36   C   0 C2    1 
ATOM   565   O  O2    . C   A  1  36   ? 41.465  121.110 37.697  1.00 27.79  ? 36   C   0 O2    1 
ATOM   566   N  N3    . C   A  1  36   ? 42.759  122.938 38.049  1.00 28.05  ? 36   C   0 N3    1 
ATOM   567   C  C4    . C   A  1  36   ? 43.833  123.464 38.644  1.00 29.15  ? 36   C   0 C4    1 
ATOM   568   N  N4    . C   A  1  36   ? 44.096  124.760 38.425  1.00 27.42  ? 36   C   0 N4    1 
ATOM   569   C  C5    . C   A  1  36   ? 44.679  122.690 39.493  1.00 24.54  ? 36   C   0 C5    1 
ATOM   570   C  C6    . C   A  1  36   ? 44.336  121.411 39.699  1.00 28.11  ? 36   C   0 C6    1 
ATOM   571   P  P     . A   A  1  37   ? 46.130  117.097 36.930  1.00 34.48  ? 37   A   0 P     1 
ATOM   572   O  OP1   . A   A  1  37   ? 46.603  115.729 36.624  1.00 34.83  ? 37   A   0 OP1   1 
ATOM   573   O  OP2   . A   A  1  37   ? 47.117  118.168 37.209  1.00 33.35  ? 37   A   0 OP2   1 
ATOM   574   O  "O5'" . A   A  1  37   ? 45.217  117.626 35.739  1.00 35.19  ? 37   A   0 "O5'" 1 
ATOM   575   C  "C5'" . A   A  1  37   ? 44.127  116.844 35.253  1.00 35.80  ? 37   A   0 "C5'" 1 
ATOM   576   C  "C4'" . A   A  1  37   ? 43.347  117.616 34.221  1.00 36.34  ? 37   A   0 "C4'" 1 
ATOM   577   O  "O4'" . A   A  1  37   ? 42.758  118.794 34.832  1.00 35.66  ? 37   A   0 "O4'" 1 
ATOM   578   C  "C3'" . A   A  1  37   ? 44.135  118.174 33.046  1.00 36.12  ? 37   A   0 "C3'" 1 
ATOM   579   O  "O3'" . A   A  1  37   ? 44.399  117.179 32.064  1.00 36.28  ? 37   A   0 "O3'" 1 
ATOM   580   C  "C2'" . A   A  1  37   ? 43.193  119.260 32.546  1.00 36.57  ? 37   A   0 "C2'" 1 
ATOM   581   O  "O2'" . A   A  1  37   ? 42.091  118.725 31.846  1.00 37.03  ? 37   A   0 "O2'" 1 
ATOM   582   C  "C1'" . A   A  1  37   ? 42.678  119.835 33.867  1.00 36.04  ? 37   A   0 "C1'" 1 
ATOM   583   N  N9    . A   A  1  37   ? 43.474  120.971 34.339  1.00 35.14  ? 37   A   0 N9    1 
ATOM   584   C  C8    . A   A  1  37   ? 44.441  120.989 35.314  1.00 33.75  ? 37   A   0 C8    1 
ATOM   585   N  N7    . A   A  1  37   ? 44.951  122.175 35.530  1.00 32.67  ? 37   A   0 N7    1 
ATOM   586   C  C5    . A   A  1  37   ? 44.282  122.995 34.632  1.00 34.21  ? 37   A   0 C5    1 
ATOM   587   C  C6    . A   A  1  37   ? 44.356  124.381 34.367  1.00 32.38  ? 37   A   0 C6    1 
ATOM   588   N  N6    . A   A  1  37   ? 45.165  125.222 35.009  1.00 30.70  ? 37   A   0 N6    1 
ATOM   589   N  N1    . A   A  1  37   ? 43.554  124.878 33.405  1.00 32.33  ? 37   A   0 N1    1 
ATOM   590   C  C2    . A   A  1  37   ? 42.735  124.041 32.760  1.00 33.63  ? 37   A   0 C2    1 
ATOM   591   N  N3    . A   A  1  37   ? 42.568  122.731 32.920  1.00 34.34  ? 37   A   0 N3    1 
ATOM   592   C  C4    . A   A  1  37   ? 43.379  122.263 33.884  1.00 34.29  ? 37   A   0 C4    1 
ATOM   593   P  P     . G   A  1  38   ? 45.671  117.333 31.090  1.00 38.05  ? 38   G   0 P     1 
ATOM   594   O  OP1   . G   A  1  38   ? 45.849  116.040 30.381  1.00 36.41  ? 38   G   0 OP1   1 
ATOM   595   O  OP2   . G   A  1  38   ? 46.803  117.884 31.867  1.00 38.91  ? 38   G   0 OP2   1 
ATOM   596   O  "O5'" . G   A  1  38   ? 45.197  118.439 30.042  1.00 37.37  ? 38   G   0 "O5'" 1 
ATOM   597   C  "C5'" . G   A  1  38   ? 44.218  118.122 29.039  1.00 38.41  ? 38   G   0 "C5'" 1 
ATOM   598   C  "C4'" . G   A  1  38   ? 43.789  119.364 28.289  1.00 39.13  ? 38   G   0 "C4'" 1 
ATOM   599   O  "O4'" . G   A  1  38   ? 43.200  120.313 29.217  1.00 39.08  ? 38   G   0 "O4'" 1 
ATOM   600   C  "C3'" . G   A  1  38   ? 44.866  120.183 27.594  1.00 39.10  ? 38   G   0 "C3'" 1 
ATOM   601   O  "O3'" . G   A  1  38   ? 45.264  119.642 26.345  1.00 39.07  ? 38   G   0 "O3'" 1 
ATOM   602   C  "C2'" . G   A  1  38   ? 44.153  121.510 27.416  1.00 38.48  ? 38   G   0 "C2'" 1 
ATOM   603   O  "O2'" . G   A  1  38   ? 43.179  121.451 26.395  1.00 38.44  ? 38   G   0 "O2'" 1 
ATOM   604   C  "C1'" . G   A  1  38   ? 43.451  121.634 28.766  1.00 38.13  ? 38   G   0 "C1'" 1 
ATOM   605   N  N9    . G   A  1  38   ? 44.325  122.286 29.733  1.00 38.94  ? 38   G   0 N9    1 
ATOM   606   C  C8    . G   A  1  38   ? 45.026  121.694 30.755  1.00 38.20  ? 38   G   0 C8    1 
ATOM   607   N  N7    . G   A  1  38   ? 45.739  122.542 31.444  1.00 38.90  ? 38   G   0 N7    1 
ATOM   608   C  C5    . G   A  1  38   ? 45.491  123.766 30.842  1.00 37.77  ? 38   G   0 C5    1 
ATOM   609   C  C6    . G   A  1  38   ? 45.985  125.053 31.153  1.00 37.55  ? 38   G   0 C6    1 
ATOM   610   O  O6    . G   A  1  38   ? 46.767  125.382 32.053  1.00 37.93  ? 38   G   0 O6    1 
ATOM   611   N  N1    . G   A  1  38   ? 45.477  126.015 30.287  1.00 38.07  ? 38   G   0 N1    1 
ATOM   612   C  C2    . G   A  1  38   ? 44.612  125.767 29.251  1.00 39.24  ? 38   G   0 C2    1 
ATOM   613   N  N2    . G   A  1  38   ? 44.242  126.822 28.520  1.00 40.51  ? 38   G   0 N2    1 
ATOM   614   N  N3    . G   A  1  38   ? 44.144  124.571 28.954  1.00 39.64  ? 38   G   0 N3    1 
ATOM   615   C  C4    . G   A  1  38   ? 44.620  123.624 29.786  1.00 38.56  ? 38   G   0 C4    1 
ATOM   616   P  P     . G   A  1  39   ? 46.755  119.907 25.803  1.00 39.43  ? 39   G   0 P     1 
ATOM   617   O  OP1   . G   A  1  39   ? 46.873  119.202 24.503  1.00 39.40  ? 39   G   0 OP1   1 
ATOM   618   O  OP2   . G   A  1  39   ? 47.710  119.587 26.893  1.00 40.72  ? 39   G   0 OP2   1 
ATOM   619   O  "O5'" . G   A  1  39   ? 46.803  121.478 25.535  1.00 38.50  ? 39   G   0 "O5'" 1 
ATOM   620   C  "C5'" . G   A  1  39   ? 46.022  122.071 24.484  1.00 38.26  ? 39   G   0 "C5'" 1 
ATOM   621   C  "C4'" . G   A  1  39   ? 46.176  123.576 24.488  1.00 39.03  ? 39   G   0 "C4'" 1 
ATOM   622   O  "O4'" . G   A  1  39   ? 45.825  124.085 25.804  1.00 38.62  ? 39   G   0 "O4'" 1 
ATOM   623   C  "C3'" . G   A  1  39   ? 47.573  124.132 24.240  1.00 39.28  ? 39   G   0 "C3'" 1 
ATOM   624   O  "O3'" . G   A  1  39   ? 47.885  124.192 22.847  1.00 39.02  ? 39   G   0 "O3'" 1 
ATOM   625   C  "C2'" . G   A  1  39   ? 47.468  125.519 24.862  1.00 38.71  ? 39   G   0 "C2'" 1 
ATOM   626   O  "O2'" . G   A  1  39   ? 46.774  126.446 24.052  1.00 37.61  ? 39   G   0 "O2'" 1 
ATOM   627   C  "C1'" . G   A  1  39   ? 46.617  125.225 26.100  1.00 38.93  ? 39   G   0 "C1'" 1 
ATOM   628   N  N9    . G   A  1  39   ? 47.431  124.927 27.272  1.00 38.31  ? 39   G   0 N9    1 
ATOM   629   C  C8    . G   A  1  39   ? 47.662  123.693 27.829  1.00 40.01  ? 39   G   0 C8    1 
ATOM   630   N  N7    . G   A  1  39   ? 48.454  123.738 28.866  1.00 39.84  ? 39   G   0 N7    1 
ATOM   631   C  C5    . G   A  1  39   ? 48.760  125.083 29.006  1.00 38.00  ? 39   G   0 C5    1 
ATOM   632   C  C6    . G   A  1  39   ? 49.573  125.742 29.959  1.00 37.73  ? 39   G   0 C6    1 
ATOM   633   O  O6    . G   A  1  39   ? 50.206  125.253 30.899  1.00 36.65  ? 39   G   0 O6    1 
ATOM   634   N  N1    . G   A  1  39   ? 49.609  127.114 29.738  1.00 36.91  ? 39   G   0 N1    1 
ATOM   635   C  C2    . G   A  1  39   ? 48.948  127.768 28.732  1.00 36.68  ? 39   G   0 C2    1 
ATOM   636   N  N2    . G   A  1  39   ? 49.117  129.094 28.684  1.00 35.59  ? 39   G   0 N2    1 
ATOM   637   N  N3    . G   A  1  39   ? 48.180  127.167 27.838  1.00 37.34  ? 39   G   0 N3    1 
ATOM   638   C  C4    . G   A  1  39   ? 48.133  125.832 28.033  1.00 38.27  ? 39   G   0 C4    1 
ATOM   639   P  P     . C   A  1  40   ? 49.396  123.931 22.345  1.00 40.19  ? 40   C   0 P     1 
ATOM   640   O  OP1   . C   A  1  40   ? 49.361  124.019 20.871  1.00 42.08  ? 40   C   0 OP1   1 
ATOM   641   O  OP2   . C   A  1  40   ? 49.935  122.706 22.985  1.00 38.34  ? 40   C   0 OP2   1 
ATOM   642   O  "O5'" . C   A  1  40   ? 50.225  125.179 22.885  1.00 38.56  ? 40   C   0 "O5'" 1 
ATOM   643   C  "C5'" . C   A  1  40   ? 49.881  126.527 22.513  1.00 38.72  ? 40   C   0 "C5'" 1 
ATOM   644   C  "C4'" . C   A  1  40   ? 50.555  127.505 23.446  1.00 38.55  ? 40   C   0 "C4'" 1 
ATOM   645   O  "O4'" . C   A  1  40   ? 50.134  127.205 24.801  1.00 41.81  ? 40   C   0 "O4'" 1 
ATOM   646   C  "C3'" . C   A  1  40   ? 52.075  127.431 23.488  1.00 38.98  ? 40   C   0 "C3'" 1 
ATOM   647   O  "O3'" . C   A  1  40   ? 52.657  128.247 22.466  1.00 37.79  ? 40   C   0 "O3'" 1 
ATOM   648   C  "C2'" . C   A  1  40   ? 52.393  127.938 24.891  1.00 40.18  ? 40   C   0 "C2'" 1 
ATOM   649   O  "O2'" . C   A  1  40   ? 52.354  129.348 24.982  1.00 40.01  ? 40   C   0 "O2'" 1 
ATOM   650   C  "C1'" . C   A  1  40   ? 51.222  127.365 25.694  1.00 40.11  ? 40   C   0 "C1'" 1 
ATOM   651   N  N1    . C   A  1  40   ? 51.483  126.065 26.342  1.00 41.00  ? 40   C   0 N1    1 
ATOM   652   C  C2    . C   A  1  40   ? 52.091  126.041 27.606  1.00 41.10  ? 40   C   0 C2    1 
ATOM   653   O  O2    . C   A  1  40   ? 52.426  127.112 28.133  1.00 41.28  ? 40   C   0 O2    1 
ATOM   654   N  N3    . C   A  1  40   ? 52.297  124.849 28.219  1.00 42.34  ? 40   C   0 N3    1 
ATOM   655   C  C4    . C   A  1  40   ? 51.920  123.714 27.619  1.00 44.09  ? 40   C   0 C4    1 
ATOM   656   N  N4    . C   A  1  40   ? 52.115  122.557 28.269  1.00 43.89  ? 40   C   0 N4    1 
ATOM   657   C  C5    . C   A  1  40   ? 51.320  123.710 26.326  1.00 42.95  ? 40   C   0 C5    1 
ATOM   658   C  C6    . C   A  1  40   ? 51.125  124.893 25.731  1.00 42.32  ? 40   C   0 C6    1 
ATOM   659   P  P     . G   A  1  41   ? 54.187  128.010 22.018  1.00 37.02  ? 41   G   0 P     1 
ATOM   660   O  OP1   . G   A  1  41   ? 54.513  129.042 21.000  1.00 39.83  ? 41   G   0 OP1   1 
ATOM   661   O  OP2   . G   A  1  41   ? 54.386  126.577 21.691  1.00 36.01  ? 41   G   0 OP2   1 
ATOM   662   O  "O5'" . G   A  1  41   ? 55.035  128.335 23.330  1.00 37.68  ? 41   G   0 "O5'" 1 
ATOM   663   C  "C5'" . G   A  1  41   ? 55.297  129.694 23.743  1.00 35.40  ? 41   G   0 "C5'" 1 
ATOM   664   C  "C4'" . G   A  1  41   ? 56.255  129.706 24.912  1.00 35.75  ? 41   G   0 "C4'" 1 
ATOM   665   O  "O4'" . G   A  1  41   ? 55.609  129.109 26.073  1.00 38.70  ? 41   G   0 "O4'" 1 
ATOM   666   C  "C3'" . G   A  1  41   ? 57.531  128.896 24.721  1.00 35.80  ? 41   G   0 "C3'" 1 
ATOM   667   O  "O3'" . G   A  1  41   ? 58.521  129.663 24.041  1.00 35.88  ? 41   G   0 "O3'" 1 
ATOM   668   C  "C2'" . G   A  1  41   ? 57.927  128.586 26.163  1.00 36.62  ? 41   G   0 "C2'" 1 
ATOM   669   O  "O2'" . G   A  1  41   ? 58.527  129.683 26.822  1.00 39.15  ? 41   G   0 "O2'" 1 
ATOM   670   C  "C1'" . G   A  1  41   ? 56.558  128.358 26.814  1.00 37.35  ? 41   G   0 "C1'" 1 
ATOM   671   N  N9    . G   A  1  41   ? 56.134  126.960 26.810  1.00 38.18  ? 41   G   0 N9    1 
ATOM   672   C  C8    . G   A  1  41   ? 55.589  126.268 25.754  1.00 37.62  ? 41   G   0 C8    1 
ATOM   673   N  N7    . G   A  1  41   ? 55.308  125.028 26.045  1.00 38.34  ? 41   G   0 N7    1 
ATOM   674   C  C5    . G   A  1  41   ? 55.689  124.889 27.371  1.00 37.67  ? 41   G   0 C5    1 
ATOM   675   C  C6    . G   A  1  41   ? 55.623  123.763 28.230  1.00 37.34  ? 41   G   0 C6    1 
ATOM   676   O  O6    . G   A  1  41   ? 55.198  122.634 27.985  1.00 37.36  ? 41   G   0 O6    1 
ATOM   677   N  N1    . G   A  1  41   ? 56.117  124.056 29.496  1.00 39.10  ? 41   G   0 N1    1 
ATOM   678   C  C2    . G   A  1  41   ? 56.599  125.278 29.892  1.00 38.74  ? 41   G   0 C2    1 
ATOM   679   N  N2    . G   A  1  41   ? 57.009  125.361 31.161  1.00 38.83  ? 41   G   0 N2    1 
ATOM   680   N  N3    . G   A  1  41   ? 56.668  126.338 29.101  1.00 38.18  ? 41   G   0 N3    1 
ATOM   681   C  C4    . G   A  1  41   ? 56.200  126.073 27.861  1.00 38.18  ? 41   G   0 C4    1 
ATOM   682   P  P     . C   A  1  42   ? 59.243  129.085 22.720  1.00 37.13  ? 42   C   0 P     1 
ATOM   683   O  OP1   . C   A  1  42   ? 59.181  130.176 21.716  1.00 36.84  ? 42   C   0 OP1   1 
ATOM   684   O  OP2   . C   A  1  42   ? 58.698  127.749 22.374  1.00 40.25  ? 42   C   0 OP2   1 
ATOM   685   O  "O5'" . C   A  1  42   ? 60.765  128.904 23.165  1.00 36.23  ? 42   C   0 "O5'" 1 
ATOM   686   C  "C5'" . C   A  1  42   ? 61.689  130.026 23.161  1.00 32.81  ? 42   C   0 "C5'" 1 
ATOM   687   C  "C4'" . C   A  1  42   ? 61.479  130.905 24.381  1.00 31.58  ? 42   C   0 "C4'" 1 
ATOM   688   O  "O4'" . C   A  1  42   ? 61.771  130.167 25.602  1.00 31.62  ? 42   C   0 "O4'" 1 
ATOM   689   C  "C3'" . C   A  1  42   ? 62.386  132.120 24.482  1.00 30.71  ? 42   C   0 "C3'" 1 
ATOM   690   O  "O3'" . C   A  1  42   ? 61.907  133.192 23.672  1.00 33.92  ? 42   C   0 "O3'" 1 
ATOM   691   C  "C2'" . C   A  1  42   ? 62.303  132.454 25.965  1.00 29.57  ? 42   C   0 "C2'" 1 
ATOM   692   O  "O2'" . C   A  1  42   ? 61.108  133.121 26.304  1.00 32.99  ? 42   C   0 "O2'" 1 
ATOM   693   C  "C1'" . C   A  1  42   ? 62.280  131.057 26.587  1.00 29.07  ? 42   C   0 "C1'" 1 
ATOM   694   N  N1    . C   A  1  42   ? 63.633  130.624 26.996  1.00 26.00  ? 42   C   0 N1    1 
ATOM   695   C  C2    . C   A  1  42   ? 64.184  131.176 28.157  1.00 25.32  ? 42   C   0 C2    1 
ATOM   696   O  O2    . C   A  1  42   ? 63.496  131.957 28.835  1.00 26.47  ? 42   C   0 O2    1 
ATOM   697   N  N3    . C   A  1  42   ? 65.447  130.852 28.515  1.00 26.93  ? 42   C   0 N3    1 
ATOM   698   C  C4    . C   A  1  42   ? 66.154  130.006 27.767  1.00 28.33  ? 42   C   0 C4    1 
ATOM   699   N  N4    . C   A  1  42   ? 67.407  129.733 28.145  1.00 25.37  ? 42   C   0 N4    1 
ATOM   700   C  C5    . C   A  1  42   ? 65.607  129.401 26.594  1.00 27.85  ? 42   C   0 C5    1 
ATOM   701   C  C6    . C   A  1  42   ? 64.353  129.732 26.252  1.00 25.85  ? 42   C   0 C6    1 
ATOM   702   P  P     . U   A  1  43   ? 62.953  134.218 22.996  1.00 34.25  ? 43   U   0 P     1 
ATOM   703   O  OP1   . U   A  1  43   ? 62.180  135.006 22.002  1.00 32.37  ? 43   U   0 OP1   1 
ATOM   704   O  OP2   . U   A  1  43   ? 64.166  133.473 22.567  1.00 31.00  ? 43   U   0 OP2   1 
ATOM   705   O  "O5'" . U   A  1  43   ? 63.375  135.187 24.187  1.00 32.38  ? 43   U   0 "O5'" 1 
ATOM   706   C  "C5'" . U   A  1  43   ? 62.413  136.058 24.803  1.00 30.07  ? 43   U   0 "C5'" 1 
ATOM   707   C  "C4'" . U   A  1  43   ? 63.048  136.820 25.944  1.00 32.89  ? 43   U   0 "C4'" 1 
ATOM   708   O  "O4'" . U   A  1  43   ? 63.393  135.919 27.035  1.00 35.25  ? 43   U   0 "O4'" 1 
ATOM   709   C  "C3'" . U   A  1  43   ? 64.369  137.506 25.648  1.00 31.30  ? 43   U   0 "C3'" 1 
ATOM   710   O  "O3'" . U   A  1  43   ? 64.186  138.707 24.935  1.00 30.18  ? 43   U   0 "O3'" 1 
ATOM   711   C  "C2'" . U   A  1  43   ? 64.902  137.748 27.052  1.00 32.56  ? 43   U   0 "C2'" 1 
ATOM   712   O  "O2'" . U   A  1  43   ? 64.235  138.809 27.705  1.00 35.15  ? 43   U   0 "O2'" 1 
ATOM   713   C  "C1'" . U   A  1  43   ? 64.517  136.435 27.738  1.00 31.28  ? 43   U   0 "C1'" 1 
ATOM   714   N  N1    . U   A  1  43   ? 65.615  135.457 27.681  1.00 28.48  ? 43   U   0 N1    1 
ATOM   715   C  C2    . U   A  1  43   ? 66.661  135.622 28.579  1.00 28.03  ? 43   U   0 C2    1 
ATOM   716   O  O2    . U   A  1  43   ? 66.702  136.535 29.386  1.00 27.27  ? 43   U   0 O2    1 
ATOM   717   N  N3    . U   A  1  43   ? 67.663  134.692 28.481  1.00 25.00  ? 43   U   0 N3    1 
ATOM   718   C  C4    . U   A  1  43   ? 67.738  133.649 27.592  1.00 25.28  ? 43   U   0 C4    1 
ATOM   719   O  O4    . U   A  1  43   ? 68.733  132.923 27.597  1.00 26.31  ? 43   U   0 O4    1 
ATOM   720   C  C5    . U   A  1  43   ? 66.626  133.546 26.696  1.00 25.31  ? 43   U   0 C5    1 
ATOM   721   C  C6    . U   A  1  43   ? 65.625  134.429 26.773  1.00 23.94  ? 43   U   0 C6    1 
ATOM   722   P  P     . G   A  1  44   ? 65.319  139.203 23.913  1.00 32.07  ? 44   G   0 P     1 
ATOM   723   O  OP1   . G   A  1  44   ? 64.772  140.471 23.344  1.00 31.85  ? 44   G   0 OP1   1 
ATOM   724   O  OP2   . G   A  1  44   ? 65.721  138.097 23.011  1.00 29.28  ? 44   G   0 OP2   1 
ATOM   725   O  "O5'" . G   A  1  44   ? 66.581  139.521 24.834  1.00 32.20  ? 44   G   0 "O5'" 1 
ATOM   726   C  "C5'" . G   A  1  44   ? 66.561  140.611 25.769  1.00 28.05  ? 44   G   0 "C5'" 1 
ATOM   727   C  "C4'" . G   A  1  44   ? 67.901  140.742 26.443  1.00 27.87  ? 44   G   0 "C4'" 1 
ATOM   728   O  "O4'" . G   A  1  44   ? 68.097  139.661 27.389  1.00 29.52  ? 44   G   0 "O4'" 1 
ATOM   729   C  "C3'" . G   A  1  44   ? 69.122  140.651 25.550  1.00 27.71  ? 44   G   0 "C3'" 1 
ATOM   730   O  "O3'" . G   A  1  44   ? 69.363  141.862 24.844  1.00 32.59  ? 44   G   0 "O3'" 1 
ATOM   731   C  "C2'" . G   A  1  44   ? 70.211  140.344 26.569  1.00 28.17  ? 44   G   0 "C2'" 1 
ATOM   732   O  "O2'" . G   A  1  44   ? 70.565  141.474 27.338  1.00 26.73  ? 44   G   0 "O2'" 1 
ATOM   733   C  "C1'" . G   A  1  44   ? 69.485  139.355 27.482  1.00 27.88  ? 44   G   0 "C1'" 1 
ATOM   734   N  N9    . G   A  1  44   ? 69.696  137.978 27.040  1.00 27.06  ? 44   G   0 N9    1 
ATOM   735   C  C8    . G   A  1  44   ? 68.838  137.213 26.286  1.00 27.03  ? 44   G   0 C8    1 
ATOM   736   N  N7    . G   A  1  44   ? 69.326  136.039 25.989  1.00 27.49  ? 44   G   0 N7    1 
ATOM   737   C  C5    . G   A  1  44   ? 70.574  136.019 26.594  1.00 23.61  ? 44   G   0 C5    1 
ATOM   738   C  C6    . G   A  1  44   ? 71.570  135.013 26.602  1.00 23.87  ? 44   G   0 C6    1 
ATOM   739   O  O6    . G   A  1  44   ? 71.547  133.895 26.066  1.00 25.56  ? 44   G   0 O6    1 
ATOM   740   N  N1    . G   A  1  44   ? 72.689  135.408 27.328  1.00 25.41  ? 44   G   0 N1    1 
ATOM   741   C  C2    . G   A  1  44   ? 72.828  136.610 27.968  1.00 25.96  ? 44   G   0 C2    1 
ATOM   742   N  N2    . G   A  1  44   ? 73.984  136.788 28.624  1.00 24.56  ? 44   G   0 N2    1 
ATOM   743   N  N3    . G   A  1  44   ? 71.903  137.562 27.968  1.00 24.54  ? 44   G   0 N3    1 
ATOM   744   C  C4    . G   A  1  44   ? 70.812  137.202 27.263  1.00 24.55  ? 44   G   0 C4    1 
ATOM   745   P  P     . A   A  1  45   ? 70.040  141.819 23.380  1.00 35.04  ? 45   A   0 P     1 
ATOM   746   O  OP1   . A   A  1  45   ? 68.974  142.125 22.396  1.00 34.04  ? 45   A   0 OP1   1 
ATOM   747   O  OP2   . A   A  1  45   ? 70.853  140.581 23.210  1.00 32.16  ? 45   A   0 OP2   1 
ATOM   748   O  "O5'" . A   A  1  45   ? 71.076  143.028 23.431  1.00 34.60  ? 45   A   0 "O5'" 1 
ATOM   749   C  "C5'" . A   A  1  45   ? 72.046  143.108 24.486  1.00 33.86  ? 45   A   0 "C5'" 1 
ATOM   750   C  "C4'" . A   A  1  45   ? 73.167  144.048 24.110  1.00 34.77  ? 45   A   0 "C4'" 1 
ATOM   751   O  "O4'" . A   A  1  45   ? 74.084  144.131 25.232  1.00 35.10  ? 45   A   0 "O4'" 1 
ATOM   752   C  "C3'" . A   A  1  45   ? 74.020  143.632 22.915  1.00 35.17  ? 45   A   0 "C3'" 1 
ATOM   753   O  "O3'" . A   A  1  45   ? 74.574  144.817 22.346  1.00 39.72  ? 45   A   0 "O3'" 1 
ATOM   754   C  "C2'" . A   A  1  45   ? 75.125  142.821 23.580  1.00 34.42  ? 45   A   0 "C2'" 1 
ATOM   755   O  "O2'" . A   A  1  45   ? 76.315  142.746 22.823  1.00 35.67  ? 45   A   0 "O2'" 1 
ATOM   756   C  "C1'" . A   A  1  45   ? 75.352  143.634 24.852  1.00 34.89  ? 45   A   0 "C1'" 1 
ATOM   757   N  N9    . A   A  1  45   ? 75.902  142.895 25.988  1.00 34.68  ? 45   A   0 N9    1 
ATOM   758   C  C8    . A   A  1  45   ? 77.006  143.231 26.724  1.00 34.27  ? 45   A   0 C8    1 
ATOM   759   N  N7    . A   A  1  45   ? 77.233  142.432 27.733  1.00 35.21  ? 45   A   0 N7    1 
ATOM   760   C  C5    . A   A  1  45   ? 76.214  141.494 27.653  1.00 37.27  ? 45   A   0 C5    1 
ATOM   761   C  C6    . A   A  1  45   ? 75.882  140.380 28.453  1.00 37.42  ? 45   A   0 C6    1 
ATOM   762   N  N6    . A   A  1  45   ? 76.555  140.028 29.555  1.00 34.94  ? 45   A   0 N6    1 
ATOM   763   N  N1    . A   A  1  45   ? 74.816  139.641 28.082  1.00 36.97  ? 45   A   0 N1    1 
ATOM   764   C  C2    . A   A  1  45   ? 74.126  140.009 26.994  1.00 36.96  ? 45   A   0 C2    1 
ATOM   765   N  N3    . A   A  1  45   ? 74.327  141.037 26.176  1.00 36.02  ? 45   A   0 N3    1 
ATOM   766   C  C4    . A   A  1  45   ? 75.400  141.751 26.566  1.00 36.53  ? 45   A   0 C4    1 
ATOM   767   P  P     . U   A  1  46   ? 74.442  145.100 20.770  1.00 42.11  ? 46   U   0 P     1 
ATOM   768   O  OP1   . U   A  1  46   ? 74.520  143.801 20.056  1.00 43.57  ? 46   U   0 OP1   1 
ATOM   769   O  OP2   . U   A  1  46   ? 75.412  146.173 20.450  1.00 43.32  ? 46   U   0 OP2   1 
ATOM   770   O  "O5'" . U   A  1  46   ? 72.971  145.677 20.584  1.00 40.62  ? 46   U   0 "O5'" 1 
ATOM   771   C  "C5'" . U   A  1  46   ? 72.613  146.978 21.084  1.00 42.56  ? 46   U   0 "C5'" 1 
ATOM   772   C  "C4'" . U   A  1  46   ? 71.112  147.165 21.031  1.00 44.60  ? 46   U   0 "C4'" 1 
ATOM   773   O  "O4'" . U   A  1  46   ? 70.667  147.073 19.646  1.00 48.88  ? 46   U   0 "O4'" 1 
ATOM   774   C  "C3'" . U   A  1  46   ? 70.275  146.147 21.804  1.00 44.97  ? 46   U   0 "C3'" 1 
ATOM   775   O  "O3'" . U   A  1  46   ? 69.094  146.773 22.271  1.00 41.96  ? 46   U   0 "O3'" 1 
ATOM   776   C  "C2'" . U   A  1  46   ? 69.870  145.156 20.720  1.00 48.47  ? 46   U   0 "C2'" 1 
ATOM   777   O  "O2'" . U   A  1  46   ? 68.669  144.463 21.004  1.00 49.91  ? 46   U   0 "O2'" 1 
ATOM   778   C  "C1'" . U   A  1  46   ? 69.657  146.095 19.538  1.00 49.60  ? 46   U   0 "C1'" 1 
ATOM   779   N  N1    . U   A  1  46   ? 69.761  145.436 18.229  1.00 53.07  ? 46   U   0 N1    1 
ATOM   780   C  C2    . U   A  1  46   ? 68.617  145.384 17.450  1.00 56.10  ? 46   U   0 C2    1 
ATOM   781   O  O2    . U   A  1  46   ? 67.553  145.888 17.790  1.00 56.72  ? 46   U   0 O2    1 
ATOM   782   N  N3    . U   A  1  46   ? 68.762  144.723 16.255  1.00 58.91  ? 46   U   0 N3    1 
ATOM   783   C  C4    . U   A  1  46   ? 69.908  144.128 15.767  1.00 60.37  ? 46   U   0 C4    1 
ATOM   784   O  O4    . U   A  1  46   ? 69.877  143.560 14.673  1.00 63.64  ? 46   U   0 O4    1 
ATOM   785   C  C5    . U   A  1  46   ? 71.050  144.239 16.624  1.00 58.81  ? 46   U   0 C5    1 
ATOM   786   C  C6    . U   A  1  46   ? 70.941  144.875 17.794  1.00 55.79  ? 46   U   0 C6    1 
ATOM   787   P  P     . G   A  1  47   ? 69.111  147.558 23.661  1.00 39.54  ? 47   G   0 P     1 
ATOM   788   O  OP1   . G   A  1  47   ? 67.716  147.615 24.151  1.00 37.98  ? 47   G   0 OP1   1 
ATOM   789   O  OP2   . G   A  1  47   ? 69.876  148.813 23.448  1.00 41.03  ? 47   G   0 OP2   1 
ATOM   790   O  "O5'" . G   A  1  47   ? 69.990  146.641 24.619  1.00 38.07  ? 47   G   0 "O5'" 1 
ATOM   791   C  "C5'" . G   A  1  47   ? 69.448  145.461 25.220  1.00 34.78  ? 47   G   0 "C5'" 1 
ATOM   792   C  "C4'" . G   A  1  47   ? 69.838  145.404 26.673  1.00 32.56  ? 47   G   0 "C4'" 1 
ATOM   793   O  "O4'" . G   A  1  47   ? 71.285  145.257 26.759  1.00 32.15  ? 47   G   0 "O4'" 1 
ATOM   794   C  "C3'" . G   A  1  47   ? 69.473  146.639 27.492  1.00 30.20  ? 47   G   0 "C3'" 1 
ATOM   795   O  "O3'" . G   A  1  47   ? 69.073  146.272 28.803  1.00 31.11  ? 47   G   0 "O3'" 1 
ATOM   796   C  "C2'" . G   A  1  47   ? 70.776  147.435 27.513  1.00 31.15  ? 47   G   0 "C2'" 1 
ATOM   797   O  "O2'" . G   A  1  47   ? 70.926  148.257 28.652  1.00 32.13  ? 47   G   0 "O2'" 1 
ATOM   798   C  "C1'" . G   A  1  47   ? 71.839  146.334 27.492  1.00 31.41  ? 47   G   0 "C1'" 1 
ATOM   799   N  N9    . G   A  1  47   ? 73.046  146.772 26.793  1.00 31.32  ? 47   G   0 N9    1 
ATOM   800   C  C8    . G   A  1  47   ? 73.095  147.435 25.586  1.00 31.75  ? 47   G   0 C8    1 
ATOM   801   N  N7    . G   A  1  47   ? 74.308  147.724 25.207  1.00 31.37  ? 47   G   0 N7    1 
ATOM   802   C  C5    . G   A  1  47   ? 75.115  147.223 26.217  1.00 30.66  ? 47   G   0 C5    1 
ATOM   803   C  C6    . G   A  1  47   ? 76.521  147.253 26.360  1.00 32.37  ? 47   G   0 C6    1 
ATOM   804   O  O6    . G   A  1  47   ? 77.357  147.759 25.609  1.00 33.78  ? 47   G   0 O6    1 
ATOM   805   N  N1    . G   A  1  47   ? 76.931  146.618 27.530  1.00 32.98  ? 47   G   0 N1    1 
ATOM   806   C  C2    . G   A  1  47   ? 76.092  146.044 28.449  1.00 30.44  ? 47   G   0 C2    1 
ATOM   807   N  N2    . G   A  1  47   ? 76.681  145.487 29.512  1.00 31.11  ? 47   G   0 N2    1 
ATOM   808   N  N3    . G   A  1  47   ? 74.775  146.019 28.333  1.00 30.10  ? 47   G   0 N3    1 
ATOM   809   C  C4    . G   A  1  47   ? 74.356  146.622 27.202  1.00 30.64  ? 47   G   0 C4    1 
ATOM   810   P  P     . A   A  1  48   ? 67.688  146.838 29.401  1.00 31.85  ? 48   A   0 P     1 
ATOM   811   O  OP1   . A   A  1  48   ? 67.025  147.706 28.393  1.00 33.76  ? 48   A   0 OP1   1 
ATOM   812   O  OP2   . A   A  1  48   ? 67.976  147.386 30.743  1.00 33.60  ? 48   A   0 OP2   1 
ATOM   813   O  "O5'" . A   A  1  48   ? 66.794  145.530 29.581  1.00 33.13  ? 48   A   0 "O5'" 1 
ATOM   814   C  "C5'" . A   A  1  48   ? 66.266  144.815 28.442  1.00 31.29  ? 48   A   0 "C5'" 1 
ATOM   815   C  "C4'" . A   A  1  48   ? 66.102  143.347 28.778  1.00 32.98  ? 48   A   0 "C4'" 1 
ATOM   816   O  "O4'" . A   A  1  48   ? 67.408  142.729 28.895  1.00 34.26  ? 48   A   0 "O4'" 1 
ATOM   817   C  "C3'" . A   A  1  48   ? 65.415  143.068 30.109  1.00 33.39  ? 48   A   0 "C3'" 1 
ATOM   818   O  "O3'" . A   A  1  48   ? 64.000  143.058 29.961  1.00 31.64  ? 48   A   0 "O3'" 1 
ATOM   819   C  "C2'" . A   A  1  48   ? 65.973  141.706 30.500  1.00 33.61  ? 48   A   0 "C2'" 1 
ATOM   820   O  "O2'" . A   A  1  48   ? 65.323  140.642 29.842  1.00 35.26  ? 48   A   0 "O2'" 1 
ATOM   821   C  "C1'" . A   A  1  48   ? 67.401  141.794 29.958  1.00 32.97  ? 48   A   0 "C1'" 1 
ATOM   822   N  N9    . A   A  1  48   ? 68.439  142.180 30.917  1.00 32.99  ? 48   A   0 N9    1 
ATOM   823   C  C8    . A   A  1  48   ? 69.088  143.386 31.017  1.00 32.38  ? 48   A   0 C8    1 
ATOM   824   N  N7    . A   A  1  48   ? 70.053  143.394 31.903  1.00 32.48  ? 48   A   0 N7    1 
ATOM   825   C  C5    . A   A  1  48   ? 70.024  142.116 32.442  1.00 31.01  ? 48   A   0 C5    1 
ATOM   826   C  C6    . A   A  1  48   ? 70.820  141.474 33.413  1.00 30.02  ? 48   A   0 C6    1 
ATOM   827   N  N6    . A   A  1  48   ? 71.855  142.054 34.037  1.00 24.02  ? 48   A   0 N6    1 
ATOM   828   N  N1    . A   A  1  48   ? 70.519  140.194 33.721  1.00 28.84  ? 48   A   0 N1    1 
ATOM   829   C  C2    . A   A  1  48   ? 69.497  139.609 33.098  1.00 30.69  ? 48   A   0 C2    1 
ATOM   830   N  N3    . A   A  1  48   ? 68.684  140.100 32.165  1.00 31.73  ? 48   A   0 N3    1 
ATOM   831   C  C4    . A   A  1  48   ? 69.010  141.370 31.871  1.00 32.24  ? 48   A   0 C4    1 
ATOM   832   P  P     . A   A  1  49   ? 63.083  143.816 31.036  1.00 35.85  ? 49   A   0 P     1 
ATOM   833   O  OP1   . A   A  1  49   ? 61.686  143.836 30.506  1.00 36.26  ? 49   A   0 OP1   1 
ATOM   834   O  OP2   . A   A  1  49   ? 63.744  145.094 31.403  1.00 37.04  ? 49   A   0 OP2   1 
ATOM   835   O  "O5'" . A   A  1  49   ? 63.148  142.866 32.314  1.00 37.03  ? 49   A   0 "O5'" 1 
ATOM   836   C  "C5'" . A   A  1  49   ? 62.663  141.514 32.259  1.00 31.88  ? 49   A   0 "C5'" 1 
ATOM   837   C  "C4'" . A   A  1  49   ? 63.193  140.716 33.428  1.00 30.31  ? 49   A   0 "C4'" 1 
ATOM   838   O  "O4'" . A   A  1  49   ? 64.617  140.489 33.274  1.00 30.32  ? 49   A   0 "O4'" 1 
ATOM   839   C  "C3'" . A   A  1  49   ? 63.078  141.358 34.800  1.00 29.58  ? 49   A   0 "C3'" 1 
ATOM   840   O  "O3'" . A   A  1  49   ? 61.777  141.233 35.354  1.00 28.98  ? 49   A   0 "O3'" 1 
ATOM   841   C  "C2'" . A   A  1  49   ? 64.110  140.574 35.596  1.00 31.00  ? 49   A   0 "C2'" 1 
ATOM   842   O  "O2'" . A   A  1  49   ? 63.648  139.309 36.016  1.00 31.78  ? 49   A   0 "O2'" 1 
ATOM   843   C  "C1'" . A   A  1  49   ? 65.221  140.397 34.556  1.00 31.70  ? 49   A   0 "C1'" 1 
ATOM   844   N  N9    . A   A  1  49   ? 66.228  141.452 34.689  1.00 33.90  ? 49   A   0 N9    1 
ATOM   845   C  C8    . A   A  1  49   ? 66.281  142.673 34.061  1.00 34.64  ? 49   A   0 C8    1 
ATOM   846   N  N7    . A   A  1  49   ? 67.278  143.426 34.455  1.00 35.71  ? 49   A   0 N7    1 
ATOM   847   C  C5    . A   A  1  49   ? 67.935  142.647 35.396  1.00 35.42  ? 49   A   0 C5    1 
ATOM   848   C  C6    . A   A  1  49   ? 69.064  142.885 36.206  1.00 36.62  ? 49   A   0 C6    1 
ATOM   849   N  N6    . A   A  1  49   ? 69.747  144.029 36.211  1.00 36.05  ? 49   A   0 N6    1 
ATOM   850   N  N1    . A   A  1  49   ? 69.465  141.892 37.031  1.00 37.37  ? 49   A   0 N1    1 
ATOM   851   C  C2    . A   A  1  49   ? 68.766  140.751 37.047  1.00 37.71  ? 49   A   0 C2    1 
ATOM   852   N  N3    . A   A  1  49   ? 67.682  140.416 36.348  1.00 37.75  ? 49   A   0 N3    1 
ATOM   853   C  C4    . A   A  1  49   ? 67.313  141.420 35.532  1.00 35.21  ? 49   A   0 C4    1 
ATOM   854   P  P     . G   A  1  50   ? 61.129  142.465 36.159  1.00 29.78  ? 50   G   0 P     1 
ATOM   855   O  OP1   . G   A  1  50   ? 59.854  141.996 36.756  1.00 28.96  ? 50   G   0 OP1   1 
ATOM   856   O  OP2   . G   A  1  50   ? 61.129  143.666 35.287  1.00 32.15  ? 50   G   0 OP2   1 
ATOM   857   O  "O5'" . G   A  1  50   ? 62.160  142.744 37.335  1.00 29.56  ? 50   G   0 "O5'" 1 
ATOM   858   C  "C5'" . G   A  1  50   ? 62.339  141.813 38.400  1.00 27.54  ? 50   G   0 "C5'" 1 
ATOM   859   C  "C4'" . G   A  1  50   ? 63.502  142.233 39.263  1.00 29.47  ? 50   G   0 "C4'" 1 
ATOM   860   O  "O4'" . G   A  1  50   ? 64.718  142.266 38.460  1.00 31.05  ? 50   G   0 "O4'" 1 
ATOM   861   C  "C3'" . G   A  1  50   ? 63.439  143.632 39.858  1.00 28.96  ? 50   G   0 "C3'" 1 
ATOM   862   O  "O3'" . G   A  1  50   ? 62.617  143.704 41.014  1.00 29.15  ? 50   G   0 "O3'" 1 
ATOM   863   C  "C2'" . G   A  1  50   ? 64.901  143.868 40.186  1.00 29.31  ? 50   G   0 "C2'" 1 
ATOM   864   O  "O2'" . G   A  1  50   ? 65.307  143.117 41.310  1.00 31.49  ? 50   G   0 "O2'" 1 
ATOM   865   C  "C1'" . G   A  1  50   ? 65.574  143.294 38.936  1.00 30.73  ? 50   G   0 "C1'" 1 
ATOM   866   N  N9    . G   A  1  50   ? 65.697  144.326 37.903  1.00 32.73  ? 50   G   0 N9    1 
ATOM   867   C  C8    . G   A  1  50   ? 64.912  144.489 36.785  1.00 32.04  ? 50   G   0 C8    1 
ATOM   868   N  N7    . G   A  1  50   ? 65.219  145.554 36.095  1.00 32.58  ? 50   G   0 N7    1 
ATOM   869   C  C5    . G   A  1  50   ? 66.278  146.123 36.790  1.00 33.28  ? 50   G   0 C5    1 
ATOM   870   C  C6    . G   A  1  50   ? 67.017  147.316 36.539  1.00 32.59  ? 50   G   0 C6    1 
ATOM   871   O  O6    . G   A  1  50   ? 66.871  148.143 35.630  1.00 31.61  ? 50   G   0 O6    1 
ATOM   872   N  N1    . G   A  1  50   ? 68.008  147.508 37.488  1.00 32.47  ? 50   G   0 N1    1 
ATOM   873   C  C2    . G   A  1  50   ? 68.265  146.671 38.541  1.00 33.12  ? 50   G   0 C2    1 
ATOM   874   N  N2    . G   A  1  50   ? 69.297  147.012 39.326  1.00 31.82  ? 50   G   0 N2    1 
ATOM   875   N  N3    . G   A  1  50   ? 67.575  145.577 38.801  1.00 32.77  ? 50   G   0 N3    1 
ATOM   876   C  C4    . G   A  1  50   ? 66.603  145.364 37.892  1.00 32.40  ? 50   G   0 C4    1 
ATOM   877   P  P     . G   A  1  51   ? 61.796  145.053 41.330  1.00 31.80  ? 51   G   0 P     1 
ATOM   878   O  OP1   . G   A  1  51   ? 60.918  144.762 42.503  1.00 31.16  ? 51   G   0 OP1   1 
ATOM   879   O  OP2   . G   A  1  51   ? 61.191  145.563 40.075  1.00 29.60  ? 51   G   0 OP2   1 
ATOM   880   O  "O5'" . G   A  1  51   ? 62.919  146.090 41.795  1.00 31.29  ? 51   G   0 "O5'" 1 
ATOM   881   C  "C5'" . G   A  1  51   ? 63.698  145.850 42.983  1.00 29.01  ? 51   G   0 "C5'" 1 
ATOM   882   C  "C4'" . G   A  1  51   ? 64.893  146.773 43.038  1.00 27.98  ? 51   G   0 "C4'" 1 
ATOM   883   O  "O4'" . G   A  1  51   ? 65.657  146.640 41.810  1.00 29.16  ? 51   G   0 "O4'" 1 
ATOM   884   C  "C3'" . G   A  1  51   ? 64.627  148.266 43.117  1.00 28.07  ? 51   G   0 "C3'" 1 
ATOM   885   O  "O3'" . G   A  1  51   ? 64.320  148.683 44.437  1.00 27.80  ? 51   G   0 "O3'" 1 
ATOM   886   C  "C2'" . G   A  1  51   ? 65.958  148.829 42.657  1.00 27.85  ? 51   G   0 "C2'" 1 
ATOM   887   O  "O2'" . G   A  1  51   ? 66.951  148.725 43.648  1.00 29.87  ? 51   G   0 "O2'" 1 
ATOM   888   C  "C1'" . G   A  1  51   ? 66.309  147.867 41.524  1.00 29.39  ? 51   G   0 "C1'" 1 
ATOM   889   N  N9    . G   A  1  51   ? 65.817  148.382 40.250  1.00 32.83  ? 51   G   0 N9    1 
ATOM   890   C  C8    . G   A  1  51   ? 64.784  147.896 39.482  1.00 32.98  ? 51   G   0 C8    1 
ATOM   891   N  N7    . G   A  1  51   ? 64.550  148.623 38.423  1.00 31.50  ? 51   G   0 N7    1 
ATOM   892   C  C5    . G   A  1  51   ? 65.491  149.640 38.490  1.00 32.42  ? 51   G   0 C5    1 
ATOM   893   C  C6    . G   A  1  51   ? 65.714  150.741 37.630  1.00 33.12  ? 51   G   0 C6    1 
ATOM   894   O  O6    . G   A  1  51   ? 65.106  151.044 36.599  1.00 34.72  ? 51   G   0 O6    1 
ATOM   895   N  N1    . G   A  1  51   ? 66.766  151.537 38.079  1.00 32.89  ? 51   G   0 N1    1 
ATOM   896   C  C2    . G   A  1  51   ? 67.505  151.301 39.213  1.00 32.44  ? 51   G   0 C2    1 
ATOM   897   N  N2    . G   A  1  51   ? 68.470  152.181 39.491  1.00 31.33  ? 51   G   0 N2    1 
ATOM   898   N  N3    . G   A  1  51   ? 67.309  150.276 40.018  1.00 32.23  ? 51   G   0 N3    1 
ATOM   899   C  C4    . G   A  1  51   ? 66.290  149.495 39.602  1.00 32.44  ? 51   G   0 C4    1 
ATOM   900   P  P     . A   A  1  52   ? 63.510  150.054 44.681  1.00 28.76  ? 52   A   0 P     1 
ATOM   901   O  OP1   . A   A  1  52   ? 63.323  150.166 46.154  1.00 29.57  ? 52   A   0 OP1   1 
ATOM   902   O  OP2   . A   A  1  52   ? 62.322  150.124 43.785  1.00 26.77  ? 52   A   0 OP2   1 
ATOM   903   O  "O5'" . A   A  1  52   ? 64.524  151.199 44.237  1.00 27.37  ? 52   A   0 "O5'" 1 
ATOM   904   C  "C5'" . A   A  1  52   ? 65.743  151.432 44.967  1.00 27.88  ? 52   A   0 "C5'" 1 
ATOM   905   C  "C4'" . A   A  1  52   ? 66.520  152.561 44.335  1.00 28.55  ? 52   A   0 "C4'" 1 
ATOM   906   O  "O4'" . A   A  1  52   ? 66.842  152.218 42.959  1.00 29.67  ? 52   A   0 "O4'" 1 
ATOM   907   C  "C3'" . A   A  1  52   ? 65.776  153.879 44.219  1.00 29.04  ? 52   A   0 "C3'" 1 
ATOM   908   O  "O3'" . A   A  1  52   ? 65.819  154.613 45.437  1.00 27.72  ? 52   A   0 "O3'" 1 
ATOM   909   C  "C2'" . A   A  1  52   ? 66.527  154.568 43.091  1.00 30.40  ? 52   A   0 "C2'" 1 
ATOM   910   O  "O2'" . A   A  1  52   ? 67.757  155.116 43.517  1.00 34.43  ? 52   A   0 "O2'" 1 
ATOM   911   C  "C1'" . A   A  1  52   ? 66.808  153.389 42.157  1.00 30.22  ? 52   A   0 "C1'" 1 
ATOM   912   N  N9    . A   A  1  52   ? 65.777  153.216 41.131  1.00 31.91  ? 52   A   0 N9    1 
ATOM   913   C  C8    . A   A  1  52   ? 64.770  152.283 41.083  1.00 30.86  ? 52   A   0 C8    1 
ATOM   914   N  N7    . A   A  1  52   ? 64.007  152.385 40.026  1.00 30.21  ? 52   A   0 N7    1 
ATOM   915   C  C5    . A   A  1  52   ? 64.544  153.455 39.329  1.00 30.92  ? 52   A   0 C5    1 
ATOM   916   C  C6    . A   A  1  52   ? 64.188  154.067 38.117  1.00 31.90  ? 52   A   0 C6    1 
ATOM   917   N  N6    . A   A  1  52   ? 63.169  153.671 37.356  1.00 30.98  ? 52   A   0 N6    1 
ATOM   918   N  N1    . A   A  1  52   ? 64.927  155.117 37.706  1.00 33.55  ? 52   A   0 N1    1 
ATOM   919   C  C2    . A   A  1  52   ? 65.951  155.515 38.465  1.00 33.92  ? 52   A   0 C2    1 
ATOM   920   N  N3    . A   A  1  52   ? 66.384  155.022 39.618  1.00 33.59  ? 52   A   0 N3    1 
ATOM   921   C  C4    . A   A  1  52   ? 65.630  153.980 39.999  1.00 31.45  ? 52   A   0 C4    1 
ATOM   922   P  P     . C   A  1  53   ? 64.558  155.502 45.872  1.00 30.82  ? 53   C   0 P     1 
ATOM   923   O  OP1   . C   A  1  53   ? 64.878  156.113 47.187  1.00 28.37  ? 53   C   0 OP1   1 
ATOM   924   O  OP2   . C   A  1  53   ? 63.307  154.703 45.717  1.00 31.93  ? 53   C   0 OP2   1 
ATOM   925   O  "O5'" . C   A  1  53   ? 64.519  156.650 44.772  1.00 32.01  ? 53   C   0 "O5'" 1 
ATOM   926   C  "C5'" . C   A  1  53   ? 65.598  157.586 44.662  1.00 33.09  ? 53   C   0 "C5'" 1 
ATOM   927   C  "C4'" . C   A  1  53   ? 65.438  158.429 43.428  1.00 32.57  ? 53   C   0 "C4'" 1 
ATOM   928   O  "O4'" . C   A  1  53   ? 65.598  157.602 42.241  1.00 36.26  ? 53   C   0 "O4'" 1 
ATOM   929   C  "C3'" . C   A  1  53   ? 64.087  159.086 43.206  1.00 32.54  ? 53   C   0 "C3'" 1 
ATOM   930   O  "O3'" . C   A  1  53   ? 63.884  160.236 44.019  1.00 31.39  ? 53   C   0 "O3'" 1 
ATOM   931   C  "C2'" . C   A  1  53   ? 64.179  159.420 41.726  1.00 32.81  ? 53   C   0 "C2'" 1 
ATOM   932   O  "O2'" . C   A  1  53   ? 65.075  160.486 41.501  1.00 34.66  ? 53   C   0 "O2'" 1 
ATOM   933   C  "C1'" . C   A  1  53   ? 64.823  158.144 41.179  1.00 33.73  ? 53   C   0 "C1'" 1 
ATOM   934   N  N1    . C   A  1  53   ? 63.798  157.160 40.767  1.00 34.64  ? 53   C   0 N1    1 
ATOM   935   C  C2    . C   A  1  53   ? 63.267  157.232 39.458  1.00 34.29  ? 53   C   0 C2    1 
ATOM   936   O  O2    . C   A  1  53   ? 63.714  158.079 38.665  1.00 35.33  ? 53   C   0 O2    1 
ATOM   937   N  N3    . C   A  1  53   ? 62.286  156.376 39.095  1.00 33.20  ? 53   C   0 N3    1 
ATOM   938   C  C4    . C   A  1  53   ? 61.838  155.465 39.965  1.00 33.37  ? 53   C   0 C4    1 
ATOM   939   N  N4    . C   A  1  53   ? 60.864  154.649 39.565  1.00 29.89  ? 53   C   0 N4    1 
ATOM   940   C  C5    . C   A  1  53   ? 62.372  155.351 41.285  1.00 32.27  ? 53   C   0 C5    1 
ATOM   941   C  C6    . C   A  1  53   ? 63.342  156.207 41.640  1.00 33.18  ? 53   C   0 C6    1 
ATOM   942   P  P     . G   A  1  54   ? 62.477  161.022 43.956  1.00 33.73  ? 54   G   0 P     1 
ATOM   943   O  OP1   . G   A  1  54   ? 62.465  161.975 45.089  1.00 36.01  ? 54   G   0 OP1   1 
ATOM   944   O  OP2   . G   A  1  54   ? 61.352  160.065 43.806  1.00 34.85  ? 54   G   0 OP2   1 
ATOM   945   O  "O5'" . G   A  1  54   ? 62.589  161.848 42.601  1.00 32.05  ? 54   G   0 "O5'" 1 
ATOM   946   C  "C5'" . G   A  1  54   ? 61.417  162.298 41.909  1.00 30.57  ? 54   G   0 "C5'" 1 
ATOM   947   C  "C4'" . G   A  1  54   ? 61.679  162.345 40.427  1.00 30.32  ? 54   G   0 "C4'" 1 
ATOM   948   O  "O4'" . G   A  1  54   ? 62.166  161.056 39.976  1.00 29.83  ? 54   G   0 "O4'" 1 
ATOM   949   C  "C3'" . G   A  1  54   ? 60.456  162.655 39.573  1.00 31.62  ? 54   G   0 "C3'" 1 
ATOM   950   O  "O3'" . G   A  1  54   ? 60.337  164.056 39.368  1.00 32.02  ? 54   G   0 "O3'" 1 
ATOM   951   C  "C2'" . G   A  1  54   ? 60.757  161.917 38.278  1.00 32.28  ? 54   G   0 "C2'" 1 
ATOM   952   O  "O2'" . G   A  1  54   ? 61.656  162.626 37.456  1.00 32.24  ? 54   G   0 "O2'" 1 
ATOM   953   C  "C1'" . G   A  1  54   ? 61.464  160.667 38.808  1.00 32.79  ? 54   G   0 "C1'" 1 
ATOM   954   N  N9    . G   A  1  54   ? 60.568  159.569 39.168  1.00 34.23  ? 54   G   0 N9    1 
ATOM   955   C  C8    . G   A  1  54   ? 60.449  158.981 40.406  1.00 34.54  ? 54   G   0 C8    1 
ATOM   956   N  N7    . G   A  1  54   ? 59.618  157.978 40.417  1.00 35.16  ? 54   G   0 N7    1 
ATOM   957   C  C5    . G   A  1  54   ? 59.149  157.903 39.115  1.00 33.75  ? 54   G   0 C5    1 
ATOM   958   C  C6    . G   A  1  54   ? 58.243  156.995 38.523  1.00 34.19  ? 54   G   0 C6    1 
ATOM   959   O  O6    . G   A  1  54   ? 57.670  156.033 39.042  1.00 34.71  ? 54   G   0 O6    1 
ATOM   960   N  N1    . G   A  1  54   ? 58.034  157.285 37.180  1.00 33.14  ? 54   G   0 N1    1 
ATOM   961   C  C2    . G   A  1  54   ? 58.634  158.305 36.493  1.00 33.44  ? 54   G   0 C2    1 
ATOM   962   N  N2    . G   A  1  54   ? 58.306  158.414 35.201  1.00 34.31  ? 54   G   0 N2    1 
ATOM   963   N  N3    . G   A  1  54   ? 59.493  159.153 37.030  1.00 32.80  ? 54   G   0 N3    1 
ATOM   964   C  C4    . G   A  1  54   ? 59.705  158.893 38.335  1.00 33.46  ? 54   G   0 C4    1 
ATOM   965   P  P     . U   A  1  55   ? 58.952  164.800 39.691  1.00 35.23  ? 55   U   0 P     1 
ATOM   966   O  OP1   . U   A  1  55   ? 59.181  166.257 39.509  1.00 35.03  ? 55   U   0 OP1   1 
ATOM   967   O  OP2   . U   A  1  55   ? 58.404  164.297 40.978  1.00 35.52  ? 55   U   0 OP2   1 
ATOM   968   O  "O5'" . U   A  1  55   ? 57.979  164.310 38.538  1.00 34.31  ? 55   U   0 "O5'" 1 
ATOM   969   C  "C5'" . U   A  1  55   ? 58.314  164.495 37.161  1.00 34.52  ? 55   U   0 "C5'" 1 
ATOM   970   C  "C4'" . U   A  1  55   ? 57.373  163.693 36.306  1.00 36.82  ? 55   U   0 "C4'" 1 
ATOM   971   O  "O4'" . U   A  1  55   ? 57.667  162.275 36.428  1.00 35.71  ? 55   U   0 "O4'" 1 
ATOM   972   C  "C3'" . U   A  1  55   ? 55.911  163.817 36.705  1.00 35.95  ? 55   U   0 "C3'" 1 
ATOM   973   O  "O3'" . U   A  1  55   ? 55.348  164.983 36.124  1.00 37.29  ? 55   U   0 "O3'" 1 
ATOM   974   C  "C2'" . U   A  1  55   ? 55.314  162.539 36.135  1.00 35.53  ? 55   U   0 "C2'" 1 
ATOM   975   O  "O2'" . U   A  1  55   ? 55.093  162.635 34.744  1.00 37.32  ? 55   U   0 "O2'" 1 
ATOM   976   C  "C1'" . U   A  1  55   ? 56.453  161.541 36.377  1.00 36.01  ? 55   U   0 "C1'" 1 
ATOM   977   N  N1    . U   A  1  55   ? 56.319  160.772 37.624  1.00 35.56  ? 55   U   0 N1    1 
ATOM   978   C  C2    . U   A  1  55   ? 55.642  159.565 37.568  1.00 34.17  ? 55   U   0 C2    1 
ATOM   979   O  O2    . U   A  1  55   ? 55.140  159.135 36.550  1.00 32.12  ? 55   U   0 O2    1 
ATOM   980   N  N3    . U   A  1  55   ? 55.574  158.884 38.755  1.00 35.19  ? 55   U   0 N3    1 
ATOM   981   C  C4    . U   A  1  55   ? 56.095  159.279 39.970  1.00 36.04  ? 55   U   0 C4    1 
ATOM   982   O  O4    . U   A  1  55   ? 55.995  158.532 40.942  1.00 36.98  ? 55   U   0 O4    1 
ATOM   983   C  C5    . U   A  1  55   ? 56.765  160.543 39.950  1.00 36.33  ? 55   U   0 C5    1 
ATOM   984   C  C6    . U   A  1  55   ? 56.852  161.229 38.809  1.00 35.42  ? 55   U   0 C6    1 
ATOM   985   P  P     . G   A  1  56   ? 54.405  165.941 36.999  1.00 38.32  ? 56   G   0 P     1 
ATOM   986   O  OP1   . G   A  1  56   ? 54.210  167.161 36.188  1.00 40.21  ? 56   G   0 OP1   1 
ATOM   987   O  OP2   . G   A  1  56   ? 54.929  166.052 38.377  1.00 38.08  ? 56   G   0 OP2   1 
ATOM   988   O  "O5'" . G   A  1  56   ? 53.015  165.171 37.052  1.00 39.44  ? 56   G   0 "O5'" 1 
ATOM   989   C  "C5'" . G   A  1  56   ? 52.337  164.825 35.841  1.00 38.93  ? 56   G   0 "C5'" 1 
ATOM   990   C  "C4'" . G   A  1  56   ? 50.851  164.822 36.057  1.00 39.77  ? 56   G   0 "C4'" 1 
ATOM   991   O  "O4'" . G   A  1  56   ? 50.503  163.706 36.917  1.00 40.40  ? 56   G   0 "O4'" 1 
ATOM   992   C  "C3'" . G   A  1  56   ? 50.258  166.066 36.715  1.00 41.78  ? 56   G   0 "C3'" 1 
ATOM   993   O  "O3'" . G   A  1  56   ? 48.988  166.315 36.128  1.00 45.03  ? 56   G   0 "O3'" 1 
ATOM   994   C  "C2'" . G   A  1  56   ? 50.067  165.622 38.164  1.00 40.62  ? 56   G   0 "C2'" 1 
ATOM   995   O  "O2'" . G   A  1  56   ? 49.030  166.313 38.823  1.00 38.50  ? 56   G   0 "O2'" 1 
ATOM   996   C  "C1'" . G   A  1  56   ? 49.668  164.165 37.957  1.00 41.72  ? 56   G   0 "C1'" 1 
ATOM   997   N  N9    . G   A  1  56   ? 49.787  163.253 39.093  1.00 42.07  ? 56   G   0 N9    1 
ATOM   998   C  C8    . G   A  1  56   ? 50.497  163.430 40.260  1.00 41.69  ? 56   G   0 C8    1 
ATOM   999   N  N7    . G   A  1  56   ? 50.406  162.413 41.074  1.00 40.61  ? 56   G   0 N7    1 
ATOM   1000  C  C5    . G   A  1  56   ? 49.586  161.512 40.405  1.00 40.60  ? 56   G   0 C5    1 
ATOM   1001  C  C6    . G   A  1  56   ? 49.132  160.226 40.784  1.00 39.25  ? 56   G   0 C6    1 
ATOM   1002  O  O6    . G   A  1  56   ? 49.376  159.597 41.817  1.00 37.64  ? 56   G   0 O6    1 
ATOM   1003  N  N1    . G   A  1  56   ? 48.312  159.666 39.808  1.00 40.34  ? 56   G   0 N1    1 
ATOM   1004  C  C2    . G   A  1  56   ? 47.976  160.263 38.621  1.00 38.74  ? 56   G   0 C2    1 
ATOM   1005  N  N2    . G   A  1  56   ? 47.177  159.566 37.811  1.00 38.48  ? 56   G   0 N2    1 
ATOM   1006  N  N3    . G   A  1  56   ? 48.395  161.455 38.255  1.00 39.84  ? 56   G   0 N3    1 
ATOM   1007  C  C4    . G   A  1  56   ? 49.191  162.019 39.186  1.00 40.98  ? 56   G   0 C4    1 
ATOM   1008  P  P     . C   A  1  57   ? 48.714  167.715 35.393  1.00 48.21  ? 57   C   0 P     1 
ATOM   1009  O  OP1   . C   A  1  57   ? 47.355  167.670 34.791  1.00 48.44  ? 57   C   0 OP1   1 
ATOM   1010  O  OP2   . C   A  1  57   ? 49.892  167.990 34.528  1.00 48.29  ? 57   C   0 OP2   1 
ATOM   1011  O  "O5'" . C   A  1  57   ? 48.678  168.759 36.593  1.00 47.47  ? 57   C   0 "O5'" 1 
ATOM   1012  C  "C5'" . C   A  1  57   ? 49.093  170.120 36.413  1.00 48.34  ? 57   C   0 "C5'" 1 
ATOM   1013  C  "C4'" . C   A  1  57   ? 48.487  170.985 37.489  1.00 48.40  ? 57   C   0 "C4'" 1 
ATOM   1014  O  "O4'" . C   A  1  57   ? 47.055  171.091 37.286  1.00 47.80  ? 57   C   0 "O4'" 1 
ATOM   1015  C  "C3'" . C   A  1  57   ? 48.618  170.431 38.895  1.00 49.27  ? 57   C   0 "C3'" 1 
ATOM   1016  O  "O3'" . C   A  1  57   ? 49.892  170.716 39.443  1.00 52.53  ? 57   C   0 "O3'" 1 
ATOM   1017  C  "C2'" . C   A  1  57   ? 47.481  171.125 39.629  1.00 48.86  ? 57   C   0 "C2'" 1 
ATOM   1018  O  "O2'" . C   A  1  57   ? 47.794  172.457 39.992  1.00 50.80  ? 57   C   0 "O2'" 1 
ATOM   1019  C  "C1'" . C   A  1  57   ? 46.399  171.144 38.545  1.00 47.05  ? 57   C   0 "C1'" 1 
ATOM   1020  N  N1    . C   A  1  57   ? 45.416  170.042 38.619  1.00 43.96  ? 57   C   0 N1    1 
ATOM   1021  C  C2    . C   A  1  57   ? 44.401  170.106 39.585  1.00 43.93  ? 57   C   0 C2    1 
ATOM   1022  O  O2    . C   A  1  57   ? 44.395  171.046 40.397  1.00 46.21  ? 57   C   0 O2    1 
ATOM   1023  N  N3    . C   A  1  57   ? 43.457  169.139 39.617  1.00 41.84  ? 57   C   0 N3    1 
ATOM   1024  C  C4    . C   A  1  57   ? 43.503  168.132 38.745  1.00 41.02  ? 57   C   0 C4    1 
ATOM   1025  N  N4    . C   A  1  57   ? 42.531  167.222 38.797  1.00 40.85  ? 57   C   0 N4    1 
ATOM   1026  C  C5    . C   A  1  57   ? 44.543  168.018 37.777  1.00 40.75  ? 57   C   0 C5    1 
ATOM   1027  C  C6    . C   A  1  57   ? 45.471  168.985 37.751  1.00 43.70  ? 57   C   0 C6    1 
ATOM   1028  P  P     . C   A  1  58   ? 50.536  169.709 40.510  1.00 55.36  ? 58   C   0 P     1 
ATOM   1029  O  OP1   . C   A  1  58   ? 51.847  170.281 40.912  1.00 55.30  ? 58   C   0 OP1   1 
ATOM   1030  O  OP2   . C   A  1  58   ? 50.471  168.329 39.973  1.00 55.22  ? 58   C   0 OP2   1 
ATOM   1031  O  "O5'" . C   A  1  58   ? 49.545  169.800 41.746  1.00 55.80  ? 58   C   0 "O5'" 1 
ATOM   1032  C  "C5'" . C   A  1  58   ? 49.454  171.004 42.512  1.00 58.87  ? 58   C   0 "C5'" 1 
ATOM   1033  C  "C4'" . C   A  1  58   ? 48.397  170.864 43.569  1.00 60.58  ? 58   C   0 "C4'" 1 
ATOM   1034  O  "O4'" . C   A  1  58   ? 47.102  170.732 42.937  1.00 61.15  ? 58   C   0 "O4'" 1 
ATOM   1035  C  "C3'" . C   A  1  58   ? 48.484  169.603 44.409  1.00 61.58  ? 58   C   0 "C3'" 1 
ATOM   1036  O  "O3'" . C   A  1  58   ? 49.480  169.700 45.413  1.00 62.55  ? 58   C   0 "O3'" 1 
ATOM   1037  C  "C2'" . C   A  1  58   ? 47.079  169.516 44.987  1.00 62.43  ? 58   C   0 "C2'" 1 
ATOM   1038  O  "O2'" . C   A  1  58   ? 46.884  170.372 46.095  1.00 63.24  ? 58   C   0 "O2'" 1 
ATOM   1039  C  "C1'" . C   A  1  58   ? 46.241  170.012 43.803  1.00 62.14  ? 58   C   0 "C1'" 1 
ATOM   1040  N  N1    . C   A  1  58   ? 45.592  168.922 43.055  1.00 60.46  ? 58   C   0 N1    1 
ATOM   1041  C  C2    . C   A  1  58   ? 44.308  168.537 43.439  1.00 60.30  ? 58   C   0 C2    1 
ATOM   1042  O  O2    . C   A  1  58   ? 43.753  169.151 44.365  1.00 60.49  ? 58   C   0 O2    1 
ATOM   1043  N  N3    . C   A  1  58   ? 43.701  167.512 42.797  1.00 60.28  ? 58   C   0 N3    1 
ATOM   1044  C  C4    . C   A  1  58   ? 44.327  166.886 41.801  1.00 59.73  ? 58   C   0 C4    1 
ATOM   1045  N  N4    . C   A  1  58   ? 43.692  165.872 41.207  1.00 58.10  ? 58   C   0 N4    1 
ATOM   1046  C  C5    . C   A  1  58   ? 45.633  167.270 41.373  1.00 60.60  ? 58   C   0 C5    1 
ATOM   1047  C  C6    . C   A  1  58   ? 46.223  168.285 42.021  1.00 60.57  ? 58   C   0 C6    1 
ATOM   1048  P  P     . A   A  1  59   ? 50.776  168.755 45.330  1.00 63.36  ? 59   A   0 P     1 
ATOM   1049  O  OP1   . A   A  1  59   ? 51.517  168.900 46.620  1.00 61.92  ? 59   A   0 OP1   1 
ATOM   1050  O  OP2   . A   A  1  59   ? 51.474  169.037 44.042  1.00 61.10  ? 59   A   0 OP2   1 
ATOM   1051  O  "O5'" . A   A  1  59   ? 50.163  167.284 45.240  1.00 60.95  ? 59   A   0 "O5'" 1 
ATOM   1052  C  "C5'" . A   A  1  59   ? 49.543  166.670 46.382  1.00 54.43  ? 59   A   0 "C5'" 1 
ATOM   1053  C  "C4'" . A   A  1  59   ? 49.707  165.166 46.332  1.00 51.54  ? 59   A   0 "C4'" 1 
ATOM   1054  O  "O4'" . A   A  1  59   ? 48.627  164.556 45.571  1.00 49.40  ? 59   A   0 "O4'" 1 
ATOM   1055  C  "C3'" . A   A  1  59   ? 51.012  164.623 45.748  1.00 48.12  ? 59   A   0 "C3'" 1 
ATOM   1056  O  "O3'" . A   A  1  59   ? 51.523  163.584 46.569  1.00 46.52  ? 59   A   0 "O3'" 1 
ATOM   1057  C  "C2'" . A   A  1  59   ? 50.572  164.048 44.402  1.00 47.81  ? 59   A   0 "C2'" 1 
ATOM   1058  O  "O2'" . A   A  1  59   ? 51.373  162.967 43.963  1.00 46.44  ? 59   A   0 "O2'" 1 
ATOM   1059  C  "C1'" . A   A  1  59   ? 49.162  163.562 44.726  1.00 47.30  ? 59   A   0 "C1'" 1 
ATOM   1060  N  N9    . A   A  1  59   ? 48.290  163.424 43.561  1.00 46.55  ? 59   A   0 N9    1 
ATOM   1061  C  C8    . A   A  1  59   ? 48.134  164.300 42.514  1.00 46.34  ? 59   A   0 C8    1 
ATOM   1062  N  N7    . A   A  1  59   ? 47.284  163.892 41.605  1.00 46.55  ? 59   A   0 N7    1 
ATOM   1063  C  C5    . A   A  1  59   ? 46.847  162.665 42.084  1.00 46.18  ? 59   A   0 C5    1 
ATOM   1064  C  C6    . A   A  1  59   ? 45.943  161.720 41.572  1.00 45.30  ? 59   A   0 C6    1 
ATOM   1065  N  N6    . A   A  1  59   ? 45.312  161.862 40.407  1.00 43.86  ? 59   A   0 N6    1 
ATOM   1066  N  N1    . A   A  1  59   ? 45.716  160.605 42.302  1.00 44.78  ? 59   A   0 N1    1 
ATOM   1067  C  C2    . A   A  1  59   ? 46.373  160.452 43.456  1.00 44.02  ? 59   A   0 C2    1 
ATOM   1068  N  N3    . A   A  1  59   ? 47.258  161.261 44.036  1.00 45.54  ? 59   A   0 N3    1 
ATOM   1069  C  C4    . A   A  1  59   ? 47.452  162.366 43.291  1.00 46.21  ? 59   A   0 C4    1 
ATOM   1070  P  P     . A   A  1  60   ? 53.040  163.666 47.083  1.00 45.40  ? 60   A   0 P     1 
ATOM   1071  O  OP1   . A   A  1  60   ? 53.106  164.762 48.078  1.00 45.67  ? 60   A   0 OP1   1 
ATOM   1072  O  OP2   . A   A  1  60   ? 53.937  163.692 45.901  1.00 46.44  ? 60   A   0 OP2   1 
ATOM   1073  O  "O5'" . A   A  1  60   ? 53.255  162.291 47.843  1.00 44.85  ? 60   A   0 "O5'" 1 
ATOM   1074  C  "C5'" . A   A  1  60   ? 53.927  162.242 49.107  1.00 42.72  ? 60   A   0 "C5'" 1 
ATOM   1075  C  "C4'" . A   A  1  60   ? 53.293  161.191 49.978  1.00 41.67  ? 60   A   0 "C4'" 1 
ATOM   1076  O  "O4'" . A   A  1  60   ? 51.957  161.614 50.362  1.00 41.92  ? 60   A   0 "O4'" 1 
ATOM   1077  C  "C3'" . A   A  1  60   ? 53.065  159.856 49.293  1.00 40.36  ? 60   A   0 "C3'" 1 
ATOM   1078  O  "O3'" . A   A  1  60   ? 54.244  159.076 49.250  1.00 38.19  ? 60   A   0 "O3'" 1 
ATOM   1079  C  "C2'" . A   A  1  60   ? 51.964  159.251 50.146  1.00 40.98  ? 60   A   0 "C2'" 1 
ATOM   1080  O  "O2'" . A   A  1  60   ? 52.452  158.747 51.372  1.00 42.17  ? 60   A   0 "O2'" 1 
ATOM   1081  C  "C1'" . A   A  1  60   ? 51.095  160.485 50.410  1.00 41.45  ? 60   A   0 "C1'" 1 
ATOM   1082  N  N9    . A   A  1  60   ? 50.067  160.657 49.383  1.00 42.47  ? 60   A   0 N9    1 
ATOM   1083  C  C8    . A   A  1  60   ? 49.957  161.667 48.456  1.00 43.08  ? 60   A   0 C8    1 
ATOM   1084  N  N7    . A   A  1  60   ? 48.950  161.522 47.633  1.00 43.95  ? 60   A   0 N7    1 
ATOM   1085  C  C5    . A   A  1  60   ? 48.345  160.345 48.051  1.00 45.35  ? 60   A   0 C5    1 
ATOM   1086  C  C6    . A   A  1  60   ? 47.225  159.638 47.579  1.00 45.97  ? 60   A   0 C6    1 
ATOM   1087  N  N6    . A   A  1  60   ? 46.478  160.039 46.551  1.00 46.42  ? 60   A   0 N6    1 
ATOM   1088  N  N1    . A   A  1  60   ? 46.893  158.491 48.212  1.00 47.15  ? 60   A   0 N1    1 
ATOM   1089  C  C2    . A   A  1  60   ? 47.636  158.095 49.256  1.00 46.96  ? 60   A   0 C2    1 
ATOM   1090  N  N3    . A   A  1  60   ? 48.707  158.676 49.796  1.00 45.97  ? 60   A   0 N3    1 
ATOM   1091  C  C4    . A   A  1  60   ? 49.016  159.808 49.136  1.00 44.59  ? 60   A   0 C4    1 
ATOM   1092  P  P     . G   A  1  61   ? 54.463  158.042 48.045  1.00 39.19  ? 61   G   0 P     1 
ATOM   1093  O  OP1   . G   A  1  61   ? 55.817  157.453 48.203  1.00 40.73  ? 61   G   0 OP1   1 
ATOM   1094  O  OP2   . G   A  1  61   ? 54.097  158.689 46.760  1.00 38.69  ? 61   G   0 OP2   1 
ATOM   1095  O  "O5'" . G   A  1  61   ? 53.396  156.905 48.349  1.00 38.76  ? 61   G   0 "O5'" 1 
ATOM   1096  C  "C5'" . G   A  1  61   ? 53.492  156.110 49.539  1.00 37.60  ? 61   G   0 "C5'" 1 
ATOM   1097  C  "C4'" . G   A  1  61   ? 52.422  155.048 49.542  1.00 37.68  ? 61   G   0 "C4'" 1 
ATOM   1098  O  "O4'" . G   A  1  61   ? 51.115  155.676 49.609  1.00 37.30  ? 61   G   0 "O4'" 1 
ATOM   1099  C  "C3'" . G   A  1  61   ? 52.352  154.193 48.291  1.00 37.73  ? 61   G   0 "C3'" 1 
ATOM   1100  O  "O3'" . G   A  1  61   ? 53.319  153.159 48.297  1.00 38.14  ? 61   G   0 "O3'" 1 
ATOM   1101  C  "C2'" . G   A  1  61   ? 50.925  153.677 48.340  1.00 39.09  ? 61   G   0 "C2'" 1 
ATOM   1102  O  "O2'" . G   A  1  61   ? 50.756  152.609 49.251  1.00 40.44  ? 61   G   0 "O2'" 1 
ATOM   1103  C  "C1'" . G   A  1  61   ? 50.186  154.915 48.853  1.00 38.38  ? 61   G   0 "C1'" 1 
ATOM   1104  N  N9    . G   A  1  61   ? 49.683  155.750 47.766  1.00 38.79  ? 61   G   0 N9    1 
ATOM   1105  C  C8    . G   A  1  61   ? 50.153  156.980 47.365  1.00 38.86  ? 61   G   0 C8    1 
ATOM   1106  N  N7    . G   A  1  61   ? 49.491  157.477 46.357  1.00 38.43  ? 61   G   0 N7    1 
ATOM   1107  C  C5    . G   A  1  61   ? 48.529  156.516 46.074  1.00 39.41  ? 61   G   0 C5    1 
ATOM   1108  C  C6    . G   A  1  61   ? 47.524  156.489 45.079  1.00 39.08  ? 61   G   0 C6    1 
ATOM   1109  O  O6    . G   A  1  61   ? 47.269  157.337 44.219  1.00 40.55  ? 61   G   0 O6    1 
ATOM   1110  N  N1    . G   A  1  61   ? 46.774  155.322 45.144  1.00 39.57  ? 61   G   0 N1    1 
ATOM   1111  C  C2    . G   A  1  61   ? 46.965  154.310 46.049  1.00 40.03  ? 61   G   0 C2    1 
ATOM   1112  N  N2    . G   A  1  61   ? 46.141  153.259 45.951  1.00 41.80  ? 61   G   0 N2    1 
ATOM   1113  N  N3    . G   A  1  61   ? 47.895  154.325 46.980  1.00 39.28  ? 61   G   0 N3    1 
ATOM   1114  C  C4    . G   A  1  61   ? 48.636  155.447 46.935  1.00 38.56  ? 61   G   0 C4    1 
ATOM   1115  P  P     . C   A  1  62   ? 53.951  152.659 46.910  1.00 41.50  ? 62   C   0 P     1 
ATOM   1116  O  OP1   . C   A  1  62   ? 54.932  151.588 47.237  1.00 40.19  ? 62   C   0 OP1   1 
ATOM   1117  O  OP2   . C   A  1  62   ? 54.385  153.821 46.100  1.00 40.72  ? 62   C   0 OP2   1 
ATOM   1118  O  "O5'" . C   A  1  62   ? 52.709  152.001 46.168  1.00 40.85  ? 62   C   0 "O5'" 1 
ATOM   1119  C  "C5'" . C   A  1  62   ? 52.057  150.854 46.724  1.00 38.48  ? 62   C   0 "C5'" 1 
ATOM   1120  C  "C4'" . C   A  1  62   ? 50.886  150.464 45.871  1.00 39.51  ? 62   C   0 "C4'" 1 
ATOM   1121  O  "O4'" . C   A  1  62   ? 49.899  151.527 45.903  1.00 39.66  ? 62   C   0 "O4'" 1 
ATOM   1122  C  "C3'" . C   A  1  62   ? 51.164  150.285 44.389  1.00 39.00  ? 62   C   0 "C3'" 1 
ATOM   1123  O  "O3'" . C   A  1  62   ? 51.742  149.023 44.101  1.00 39.18  ? 62   C   0 "O3'" 1 
ATOM   1124  C  "C2'" . C   A  1  62   ? 49.768  150.424 43.806  1.00 39.84  ? 62   C   0 "C2'" 1 
ATOM   1125  O  "O2'" . C   A  1  62   ? 48.980  149.268 44.009  1.00 36.72  ? 62   C   0 "O2'" 1 
ATOM   1126  C  "C1'" . C   A  1  62   ? 49.207  151.558 44.667  1.00 40.75  ? 62   C   0 "C1'" 1 
ATOM   1127  N  N1    . C   A  1  62   ? 49.396  152.882 44.049  1.00 44.25  ? 62   C   0 N1    1 
ATOM   1128  C  C2    . C   A  1  62   ? 48.451  153.323 43.115  1.00 45.23  ? 62   C   0 C2    1 
ATOM   1129  O  O2    . C   A  1  62   ? 47.498  152.579 42.834  1.00 45.95  ? 62   C   0 O2    1 
ATOM   1130  N  N3    . C   A  1  62   ? 48.602  154.542 42.544  1.00 45.92  ? 62   C   0 N3    1 
ATOM   1131  C  C4    . C   A  1  62   ? 49.646  155.308 42.874  1.00 45.66  ? 62   C   0 C4    1 
ATOM   1132  N  N4    . C   A  1  62   ? 49.749  156.510 42.300  1.00 44.81  ? 62   C   0 N4    1 
ATOM   1133  C  C5    . C   A  1  62   ? 50.630  154.879 43.811  1.00 43.90  ? 62   C   0 C5    1 
ATOM   1134  C  C6    . C   A  1  62   ? 50.468  153.672 44.370  1.00 44.04  ? 62   C   0 C6    1 
ATOM   1135  P  P     . U   A  1  63   ? 52.676  148.848 42.803  1.00 43.20  ? 63   U   0 P     1 
ATOM   1136  O  OP1   . U   A  1  63   ? 53.037  147.405 42.714  1.00 42.75  ? 63   U   0 OP1   1 
ATOM   1137  O  OP2   . U   A  1  63   ? 53.754  149.871 42.834  1.00 42.30  ? 63   U   0 OP2   1 
ATOM   1138  O  "O5'" . U   A  1  63   ? 51.712  149.184 41.578  1.00 41.01  ? 63   U   0 "O5'" 1 
ATOM   1139  C  "C5'" . U   A  1  63   ? 50.697  148.256 41.163  1.00 38.75  ? 63   U   0 "C5'" 1 
ATOM   1140  C  "C4'" . U   A  1  63   ? 49.867  148.843 40.045  1.00 37.55  ? 63   U   0 "C4'" 1 
ATOM   1141  O  "O4'" . U   A  1  63   ? 49.235  150.065 40.510  1.00 37.84  ? 63   U   0 "O4'" 1 
ATOM   1142  C  "C3'" . U   A  1  63   ? 50.625  149.293 38.807  1.00 37.59  ? 63   U   0 "C3'" 1 
ATOM   1143  O  "O3'" . U   A  1  63   ? 50.952  148.230 37.932  1.00 36.96  ? 63   U   0 "O3'" 1 
ATOM   1144  C  "C2'" . U   A  1  63   ? 49.649  150.273 38.183  1.00 37.02  ? 63   U   0 "C2'" 1 
ATOM   1145  O  "O2'" . U   A  1  63   ? 48.582  149.621 37.526  1.00 36.51  ? 63   U   0 "O2'" 1 
ATOM   1146  C  "C1'" . U   A  1  63   ? 49.126  150.985 39.431  1.00 38.03  ? 63   U   0 "C1'" 1 
ATOM   1147  N  N1    . U   A  1  63   ? 49.910  152.192 39.751  1.00 38.30  ? 63   U   0 N1    1 
ATOM   1148  C  C2    . U   A  1  63   ? 49.555  153.370 39.115  1.00 37.91  ? 63   U   0 C2    1 
ATOM   1149  O  O2    . U   A  1  63   ? 48.627  153.445 38.327  1.00 37.75  ? 63   U   0 O2    1 
ATOM   1150  N  N3    . U   A  1  63   ? 50.330  154.458 39.437  1.00 37.52  ? 63   U   0 N3    1 
ATOM   1151  C  C4    . U   A  1  63   ? 51.397  154.494 40.309  1.00 36.07  ? 63   U   0 C4    1 
ATOM   1152  O  O4    . U   A  1  63   ? 51.987  155.559 40.497  1.00 34.98  ? 63   U   0 O4    1 
ATOM   1153  C  C5    . U   A  1  63   ? 51.700  153.242 40.931  1.00 35.46  ? 63   U   0 C5    1 
ATOM   1154  C  C6    . U   A  1  63   ? 50.968  152.162 40.642  1.00 36.61  ? 63   U   0 C6    1 
ATOM   1155  P  P     . G   A  1  64   ? 52.295  148.320 37.056  1.00 39.42  ? 64   G   0 P     1 
ATOM   1156  O  OP1   . G   A  1  64   ? 52.415  147.059 36.276  1.00 38.39  ? 64   G   0 OP1   1 
ATOM   1157  O  OP2   . G   A  1  64   ? 53.413  148.741 37.939  1.00 37.63  ? 64   G   0 OP2   1 
ATOM   1158  O  "O5'" . G   A  1  64   ? 52.001  149.510 36.037  1.00 39.83  ? 64   G   0 "O5'" 1 
ATOM   1159  C  "C5'" . G   A  1  64   ? 50.903  149.432 35.110  1.00 36.06  ? 64   G   0 "C5'" 1 
ATOM   1160  C  "C4'" . G   A  1  64   ? 50.742  150.740 34.376  1.00 36.95  ? 64   G   0 "C4'" 1 
ATOM   1161  O  "O4'" . G   A  1  64   ? 50.380  151.796 35.308  1.00 36.79  ? 64   G   0 "O4'" 1 
ATOM   1162  C  "C3'" . G   A  1  64   ? 51.982  151.283 33.683  1.00 36.57  ? 64   G   0 "C3'" 1 
ATOM   1163  O  "O3'" . G   A  1  64   ? 52.203  150.658 32.428  1.00 36.34  ? 64   G   0 "O3'" 1 
ATOM   1164  C  "C2'" . G   A  1  64   ? 51.619  152.750 33.521  1.00 36.91  ? 64   G   0 "C2'" 1 
ATOM   1165  O  "O2'" . G   A  1  64   ? 50.703  152.950 32.467  1.00 35.14  ? 64   G   0 "O2'" 1 
ATOM   1166  C  "C1'" . G   A  1  64   ? 50.915  153.029 34.851  1.00 38.12  ? 64   G   0 "C1'" 1 
ATOM   1167  N  N9    . G   A  1  64   ? 51.834  153.549 35.861  1.00 40.19  ? 64   G   0 N9    1 
ATOM   1168  C  C8    . G   A  1  64   ? 52.392  152.868 36.917  1.00 40.51  ? 64   G   0 C8    1 
ATOM   1169  N  N7    . G   A  1  64   ? 53.191  153.606 37.638  1.00 40.20  ? 64   G   0 N7    1 
ATOM   1170  C  C5    . G   A  1  64   ? 53.157  154.851 37.023  1.00 41.33  ? 64   G   0 C5    1 
ATOM   1171  C  C6    . G   A  1  64   ? 53.830  156.057 37.348  1.00 41.21  ? 64   G   0 C6    1 
ATOM   1172  O  O6    . G   A  1  64   ? 54.625  156.274 38.271  1.00 39.61  ? 64   G   0 O6    1 
ATOM   1173  N  N1    . G   A  1  64   ? 53.507  157.077 36.457  1.00 41.70  ? 64   G   0 N1    1 
ATOM   1174  C  C2    . G   A  1  64   ? 52.661  156.952 35.389  1.00 40.59  ? 64   G   0 C2    1 
ATOM   1175  N  N2    . G   A  1  64   ? 52.489  158.043 34.643  1.00 39.52  ? 64   G   0 N2    1 
ATOM   1176  N  N3    . G   A  1  64   ? 52.030  155.836 35.075  1.00 41.13  ? 64   G   0 N3    1 
ATOM   1177  C  C4    . G   A  1  64   ? 52.322  154.833 35.928  1.00 40.33  ? 64   G   0 C4    1 
ATOM   1178  P  P     . C   A  1  65   ? 53.702  150.391 31.927  1.00 37.93  ? 65   C   0 P     1 
ATOM   1179  O  OP1   . C   A  1  65   ? 53.622  149.633 30.650  1.00 40.08  ? 65   C   0 OP1   1 
ATOM   1180  O  OP2   . C   A  1  65   ? 54.492  149.838 33.051  1.00 38.84  ? 65   C   0 OP2   1 
ATOM   1181  O  "O5'" . C   A  1  65   ? 54.260  151.847 31.595  1.00 39.30  ? 65   C   0 "O5'" 1 
ATOM   1182  C  "C5'" . C   A  1  65   ? 53.660  152.659 30.562  1.00 36.34  ? 65   C   0 "C5'" 1 
ATOM   1183  C  "C4'" . C   A  1  65   ? 54.079  154.101 30.720  1.00 36.25  ? 65   C   0 "C4'" 1 
ATOM   1184  O  "O4'" . C   A  1  65   ? 53.683  154.555 32.040  1.00 36.67  ? 65   C   0 "O4'" 1 
ATOM   1185  C  "C3'" . C   A  1  65   ? 55.574  154.393 30.661  1.00 35.47  ? 65   C   0 "C3'" 1 
ATOM   1186  O  "O3'" . C   A  1  65   ? 56.020  154.542 29.320  1.00 34.95  ? 65   C   0 "O3'" 1 
ATOM   1187  C  "C2'" . C   A  1  65   ? 55.670  155.708 31.420  1.00 36.46  ? 65   C   0 "C2'" 1 
ATOM   1188  O  "O2'" . C   A  1  65   ? 55.258  156.815 30.636  1.00 37.65  ? 65   C   0 "O2'" 1 
ATOM   1189  C  "C1'" . C   A  1  65   ? 54.640  155.483 32.530  1.00 37.31  ? 65   C   0 "C1'" 1 
ATOM   1190  N  N1    . C   A  1  65   ? 55.226  154.958 33.781  1.00 37.81  ? 65   C   0 N1    1 
ATOM   1191  C  C2    . C   A  1  65   ? 55.866  155.855 34.653  1.00 37.80  ? 65   C   0 C2    1 
ATOM   1192  O  O2    . C   A  1  65   ? 55.922  157.056 34.349  1.00 38.72  ? 65   C   0 O2    1 
ATOM   1193  N  N3    . C   A  1  65   ? 56.408  155.389 35.799  1.00 36.42  ? 65   C   0 N3    1 
ATOM   1194  C  C4    . C   A  1  65   ? 56.336  154.088 36.090  1.00 36.36  ? 65   C   0 C4    1 
ATOM   1195  N  N4    . C   A  1  65   ? 56.890  153.675 37.228  1.00 34.93  ? 65   C   0 N4    1 
ATOM   1196  C  C5    . C   A  1  65   ? 55.694  153.154 35.224  1.00 35.62  ? 65   C   0 C5    1 
ATOM   1197  C  C6    . C   A  1  65   ? 55.157  153.626 34.093  1.00 36.82  ? 65   C   0 C6    1 
ATOM   1198  P  P     . G   A  1  66   ? 57.562  154.277 28.947  1.00 36.72  ? 66   G   0 P     1 
ATOM   1199  O  OP1   . G   A  1  66   ? 57.633  154.191 27.466  1.00 35.84  ? 66   G   0 OP1   1 
ATOM   1200  O  OP2   . G   A  1  66   ? 58.065  153.145 29.765  1.00 36.37  ? 66   G   0 OP2   1 
ATOM   1201  O  "O5'" . G   A  1  66   ? 58.344  155.584 29.439  1.00 36.67  ? 66   G   0 "O5'" 1 
ATOM   1202  C  "C5'" . G   A  1  66   ? 57.935  156.915 29.041  1.00 33.81  ? 66   G   0 "C5'" 1 
ATOM   1203  C  "C4'" . G   A  1  66   ? 58.889  157.955 29.609  1.00 33.89  ? 66   G   0 "C4'" 1 
ATOM   1204  O  "O4'" . G   A  1  66   ? 58.894  157.882 31.061  1.00 33.17  ? 66   G   0 "O4'" 1 
ATOM   1205  C  "C3'" . G   A  1  66   ? 60.349  157.821 29.195  1.00 33.71  ? 66   G   0 "C3'" 1 
ATOM   1206  O  "O3'" . G   A  1  66   ? 60.969  159.105 29.266  1.00 34.45  ? 66   G   0 "O3'" 1 
ATOM   1207  C  "C2'" . G   A  1  66   ? 60.918  156.956 30.311  1.00 32.80  ? 66   G   0 "C2'" 1 
ATOM   1208  O  "O2'" . G   A  1  66   ? 62.311  157.117 30.435  1.00 34.01  ? 66   G   0 "O2'" 1 
ATOM   1209  C  "C1'" . G   A  1  66   ? 60.188  157.535 31.520  1.00 31.99  ? 66   G   0 "C1'" 1 
ATOM   1210  N  N9    . G   A  1  66   ? 60.032  156.630 32.656  1.00 32.25  ? 66   G   0 N9    1 
ATOM   1211  C  C8    . G   A  1  66   ? 59.197  155.541 32.734  1.00 33.27  ? 66   G   0 C8    1 
ATOM   1212  N  N7    . G   A  1  66   ? 59.221  154.958 33.901  1.00 33.62  ? 66   G   0 N7    1 
ATOM   1213  C  C5    . G   A  1  66   ? 60.137  155.699 34.636  1.00 32.91  ? 66   G   0 C5    1 
ATOM   1214  C  C6    . G   A  1  66   ? 60.572  155.548 35.975  1.00 31.63  ? 66   G   0 C6    1 
ATOM   1215  O  O6    . G   A  1  66   ? 60.228  154.705 36.803  1.00 31.53  ? 66   G   0 O6    1 
ATOM   1216  N  N1    . G   A  1  66   ? 61.506  156.512 36.319  1.00 30.93  ? 66   G   0 N1    1 
ATOM   1217  C  C2    . G   A  1  66   ? 61.973  157.492 35.484  1.00 31.74  ? 66   G   0 C2    1 
ATOM   1218  N  N2    . G   A  1  66   ? 62.897  158.321 36.004  1.00 31.15  ? 66   G   0 N2    1 
ATOM   1219  N  N3    . G   A  1  66   ? 61.574  157.647 34.234  1.00 31.11  ? 66   G   0 N3    1 
ATOM   1220  C  C4    . G   A  1  66   ? 60.660  156.724 33.879  1.00 31.18  ? 66   G   0 C4    1 
ATOM   1221  P  P     . A   A  1  67   ? 60.773  160.168 28.075  1.00 34.24  ? 67   A   0 P     1 
ATOM   1222  O  OP1   . A   A  1  67   ? 59.873  159.551 27.061  1.00 34.31  ? 67   A   0 OP1   1 
ATOM   1223  O  OP2   . A   A  1  67   ? 62.102  160.674 27.671  1.00 31.91  ? 67   A   0 OP2   1 
ATOM   1224  O  "O5'" . A   A  1  67   ? 59.991  161.376 28.756  1.00 33.42  ? 67   A   0 "O5'" 1 
ATOM   1225  C  "C5'" . A   A  1  67   ? 60.475  161.981 29.965  1.00 35.89  ? 67   A   0 "C5'" 1 
ATOM   1226  C  "C4'" . A   A  1  67   ? 60.825  163.435 29.726  1.00 37.24  ? 67   A   0 "C4'" 1 
ATOM   1227  O  "O4'" . A   A  1  67   ? 61.256  164.025 30.984  1.00 37.58  ? 67   A   0 "O4'" 1 
ATOM   1228  C  "C3'" . A   A  1  67   ? 61.966  163.680 28.744  1.00 36.86  ? 67   A   0 "C3'" 1 
ATOM   1229  O  "O3'" . A   A  1  67   ? 61.785  164.951 28.107  1.00 35.36  ? 67   A   0 "O3'" 1 
ATOM   1230  C  "C2'" . A   A  1  67   ? 63.181  163.694 29.667  1.00 37.95  ? 67   A   0 "C2'" 1 
ATOM   1231  O  "O2'" . A   A  1  67   ? 64.283  164.405 29.147  1.00 42.11  ? 67   A   0 "O2'" 1 
ATOM   1232  C  "C1'" . A   A  1  67   ? 62.619  164.398 30.899  1.00 38.00  ? 67   A   0 "C1'" 1 
ATOM   1233  N  N9    . A   A  1  67   ? 63.265  164.000 32.151  1.00 41.37  ? 67   A   0 N9    1 
ATOM   1234  C  C8    . A   A  1  67   ? 63.921  164.802 33.052  1.00 40.91  ? 67   A   0 C8    1 
ATOM   1235  N  N7    . A   A  1  67   ? 64.369  164.160 34.103  1.00 42.05  ? 67   A   0 N7    1 
ATOM   1236  C  C5    . A   A  1  67   ? 63.989  162.844 33.876  1.00 42.06  ? 67   A   0 C5    1 
ATOM   1237  C  C6    . A   A  1  67   ? 64.162  161.666 34.624  1.00 42.62  ? 67   A   0 C6    1 
ATOM   1238  N  N6    . A   A  1  67   ? 64.781  161.619 35.804  1.00 40.79  ? 67   A   0 N6    1 
ATOM   1239  N  N1    . A   A  1  67   ? 63.667  160.522 34.113  1.00 44.02  ? 67   A   0 N1    1 
ATOM   1240  C  C2    . A   A  1  67   ? 63.036  160.570 32.933  1.00 43.81  ? 67   A   0 C2    1 
ATOM   1241  N  N3    . A   A  1  67   ? 62.807  161.610 32.142  1.00 41.23  ? 67   A   0 N3    1 
ATOM   1242  C  C4    . A   A  1  67   ? 63.316  162.730 32.676  1.00 40.94  ? 67   A   0 C4    1 
ATOM   1243  P  P     . U   A  1  68   ? 61.755  165.056 26.498  1.00 33.96  ? 68   U   0 P     1 
ATOM   1244  O  OP1   . U   A  1  68   ? 62.693  164.066 25.907  1.00 30.48  ? 68   U   0 OP1   1 
ATOM   1245  O  OP2   . U   A  1  68   ? 61.905  166.491 26.163  1.00 35.98  ? 68   U   0 OP2   1 
ATOM   1246  O  "O5'" . U   A  1  68   ? 60.263  164.637 26.123  1.00 34.20  ? 68   U   0 "O5'" 1 
ATOM   1247  C  "C5'" . U   A  1  68   ? 59.164  165.543 26.339  1.00 34.26  ? 68   U   0 "C5'" 1 
ATOM   1248  C  "C4'" . U   A  1  68   ? 57.858  164.855 26.035  1.00 34.90  ? 68   U   0 "C4'" 1 
ATOM   1249  O  "O4'" . U   A  1  68   ? 57.916  164.341 24.675  1.00 36.64  ? 68   U   0 "O4'" 1 
ATOM   1250  C  "C3'" . U   A  1  68   ? 57.519  163.649 26.916  1.00 36.21  ? 68   U   0 "C3'" 1 
ATOM   1251  O  "O3'" . U   A  1  68   ? 56.096  163.532 26.974  1.00 34.51  ? 68   U   0 "O3'" 1 
ATOM   1252  C  "C2'" . U   A  1  68   ? 58.061  162.490 26.086  1.00 36.41  ? 68   U   0 "C2'" 1 
ATOM   1253  O  "O2'" . U   A  1  68   ? 57.468  161.250 26.405  1.00 37.65  ? 68   U   0 "O2'" 1 
ATOM   1254  C  "C1'" . U   A  1  68   ? 57.641  162.955 24.695  1.00 36.93  ? 68   U   0 "C1'" 1 
ATOM   1255  N  N1    . U   A  1  68   ? 58.254  162.311 23.523  1.00 35.14  ? 68   U   0 N1    1 
ATOM   1256  C  C2    . U   A  1  68   ? 57.433  161.495 22.758  1.00 34.67  ? 68   U   0 C2    1 
ATOM   1257  O  O2    . U   A  1  68   ? 56.265  161.276 23.044  1.00 35.00  ? 68   U   0 O2    1 
ATOM   1258  N  N3    . U   A  1  68   ? 58.029  160.942 21.653  1.00 33.26  ? 68   U   0 N3    1 
ATOM   1259  C  C4    . U   A  1  68   ? 59.340  161.103 21.247  1.00 36.11  ? 68   U   0 C4    1 
ATOM   1260  O  O4    . U   A  1  68   ? 59.732  160.534 20.226  1.00 35.65  ? 68   U   0 O4    1 
ATOM   1261  C  C5    . U   A  1  68   ? 60.131  161.948 22.099  1.00 35.07  ? 68   U   0 C5    1 
ATOM   1262  C  C6    . U   A  1  68   ? 59.574  162.509 23.181  1.00 35.23  ? 68   U   0 C6    1 
ATOM   1263  P  P     . A   A  1  69   ? 55.298  163.985 28.293  1.00 39.33  ? 69   A   0 P     1 
ATOM   1264  O  OP1   . A   A  1  69   ? 53.955  164.504 27.904  1.00 36.71  ? 69   A   0 OP1   1 
ATOM   1265  O  OP2   . A   A  1  69   ? 56.201  164.840 29.116  1.00 37.97  ? 69   A   0 OP2   1 
ATOM   1266  O  "O5'" . A   A  1  69   ? 55.040  162.609 29.048  1.00 38.27  ? 69   A   0 "O5'" 1 
ATOM   1267  C  "C5'" . A   A  1  69   ? 56.122  161.727 29.279  1.00 38.49  ? 69   A   0 "C5'" 1 
ATOM   1268  C  "C4'" . A   A  1  69   ? 55.728  160.591 30.177  1.00 34.60  ? 69   A   0 "C4'" 1 
ATOM   1269  O  "O4'" . A   A  1  69   ? 57.005  160.071 30.622  1.00 37.00  ? 69   A   0 "O4'" 1 
ATOM   1270  C  "C3'" . A   A  1  69   ? 54.957  160.943 31.453  1.00 34.51  ? 69   A   0 "C3'" 1 
ATOM   1271  O  "O3'" . A   A  1  69   ? 53.579  160.564 31.353  1.00 32.61  ? 69   A   0 "O3'" 1 
ATOM   1272  C  "C2'" . A   A  1  69   ? 55.669  160.123 32.517  1.00 35.92  ? 69   A   0 "C2'" 1 
ATOM   1273  O  "O2'" . A   A  1  69   ? 55.262  158.771 32.503  1.00 36.18  ? 69   A   0 "O2'" 1 
ATOM   1274  C  "C1'" . A   A  1  69   ? 57.106  160.197 32.019  1.00 37.55  ? 69   A   0 "C1'" 1 
ATOM   1275  N  N9    . A   A  1  69   ? 57.793  161.455 32.340  1.00 38.18  ? 69   A   0 N9    1 
ATOM   1276  C  C8    . A   A  1  69   ? 57.556  162.728 31.877  1.00 34.85  ? 69   A   0 C8    1 
ATOM   1277  N  N7    . A   A  1  69   ? 58.334  163.637 32.412  1.00 36.68  ? 69   A   0 N7    1 
ATOM   1278  C  C5    . A   A  1  69   ? 59.146  162.916 33.281  1.00 36.96  ? 69   A   0 C5    1 
ATOM   1279  C  C6    . A   A  1  69   ? 60.175  163.298 34.166  1.00 36.70  ? 69   A   0 C6    1 
ATOM   1280  N  N6    . A   A  1  69   ? 60.580  164.554 34.348  1.00 34.79  ? 69   A   0 N6    1 
ATOM   1281  N  N1    . A   A  1  69   ? 60.781  162.325 34.879  1.00 39.10  ? 69   A   0 N1    1 
ATOM   1282  C  C2    . A   A  1  69   ? 60.373  161.064 34.719  1.00 39.24  ? 69   A   0 C2    1 
ATOM   1283  N  N3    . A   A  1  69   ? 59.417  160.582 33.933  1.00 38.30  ? 69   A   0 N3    1 
ATOM   1284  C  C4    . A   A  1  69   ? 58.834  161.570 33.233  1.00 38.05  ? 69   A   0 C4    1 
ATOM   1285  P  P     . A   A  1  70   ? 52.554  160.865 32.565  1.00 34.79  ? 70   A   0 P     1 
ATOM   1286  O  OP1   . A   A  1  70   ? 51.885  162.173 32.334  1.00 35.73  ? 70   A   0 OP1   1 
ATOM   1287  O  OP2   . A   A  1  70   ? 53.232  160.624 33.860  1.00 32.98  ? 70   A   0 OP2   1 
ATOM   1288  O  "O5'" . A   A  1  70   ? 51.455  159.721 32.399  1.00 34.95  ? 70   A   0 "O5'" 1 
ATOM   1289  C  "C5'" . A   A  1  70   ? 50.059  159.992 32.619  1.00 36.47  ? 70   A   0 "C5'" 1 
ATOM   1290  C  "C4'" . A   A  1  70   ? 49.260  158.709 32.558  1.00 39.43  ? 70   A   0 "C4'" 1 
ATOM   1291  O  "O4'" . A   A  1  70   ? 49.711  157.801 33.597  1.00 38.94  ? 70   A   0 "O4'" 1 
ATOM   1292  C  "C3'" . A   A  1  70   ? 47.763  158.866 32.779  1.00 40.98  ? 70   A   0 "C3'" 1 
ATOM   1293  O  "O3'" . A   A  1  70   ? 47.106  157.824 32.072  1.00 44.57  ? 70   A   0 "O3'" 1 
ATOM   1294  C  "C2'" . A   A  1  70   ? 47.627  158.655 34.281  1.00 40.66  ? 70   A   0 "C2'" 1 
ATOM   1295  O  "O2'" . A   A  1  70   ? 46.338  158.220 34.659  1.00 40.94  ? 70   A   0 "O2'" 1 
ATOM   1296  C  "C1'" . A   A  1  70   ? 48.663  157.559 34.516  1.00 39.21  ? 70   A   0 "C1'" 1 
ATOM   1297  N  N9    . A   A  1  70   ? 49.259  157.566 35.847  1.00 39.77  ? 70   A   0 N9    1 
ATOM   1298  C  C8    . A   A  1  70   ? 49.305  156.536 36.750  1.00 40.46  ? 70   A   0 C8    1 
ATOM   1299  N  N7    . A   A  1  70   ? 50.004  156.806 37.824  1.00 39.65  ? 70   A   0 N7    1 
ATOM   1300  C  C5    . A   A  1  70   ? 50.429  158.111 37.625  1.00 39.89  ? 70   A   0 C5    1 
ATOM   1301  C  C6    . A   A  1  70   ? 51.227  158.968 38.393  1.00 39.88  ? 70   A   0 C6    1 
ATOM   1302  N  N6    . A   A  1  70   ? 51.780  158.616 39.558  1.00 39.74  ? 70   A   0 N6    1 
ATOM   1303  N  N1    . A   A  1  70   ? 51.450  160.212 37.915  1.00 38.55  ? 70   A   0 N1    1 
ATOM   1304  C  C2    . A   A  1  70   ? 50.913  160.550 36.739  1.00 38.42  ? 70   A   0 C2    1 
ATOM   1305  N  N3    . A   A  1  70   ? 50.158  159.829 35.919  1.00 38.25  ? 70   A   0 N3    1 
ATOM   1306  C  C4    . A   A  1  70   ? 49.952  158.602 36.426  1.00 39.50  ? 70   A   0 C4    1 
ATOM   1307  P  P     . G   A  1  71   ? 46.340  158.153 30.702  1.00 49.17  ? 71   G   0 P     1 
ATOM   1308  O  OP1   . G   A  1  71   ? 45.097  158.914 31.022  1.00 47.48  ? 71   G   0 OP1   1 
ATOM   1309  O  OP2   . G   A  1  71   ? 46.251  156.883 29.927  1.00 49.04  ? 71   G   0 OP2   1 
ATOM   1310  O  "O5'" . G   A  1  71   ? 47.331  159.157 29.968  1.00 47.05  ? 71   G   0 "O5'" 1 
ATOM   1311  C  "C5'" . G   A  1  71   ? 47.825  158.896 28.653  1.00 44.94  ? 71   G   0 "C5'" 1 
ATOM   1312  C  "C4'" . G   A  1  71   ? 49.142  159.595 28.467  1.00 43.94  ? 71   G   0 "C4'" 1 
ATOM   1313  O  "O4'" . G   A  1  71   ? 50.180  158.880 29.191  1.00 41.83  ? 71   G   0 "O4'" 1 
ATOM   1314  C  "C3'" . G   A  1  71   ? 49.662  159.649 27.045  1.00 43.32  ? 71   G   0 "C3'" 1 
ATOM   1315  O  "O3'" . G   A  1  71   ? 49.012  160.700 26.327  1.00 43.30  ? 71   G   0 "O3'" 1 
ATOM   1316  C  "C2'" . G   A  1  71   ? 51.148  159.892 27.275  1.00 42.09  ? 71   G   0 "C2'" 1 
ATOM   1317  O  "O2'" . G   A  1  71   ? 51.422  161.227 27.649  1.00 44.89  ? 71   G   0 "O2'" 1 
ATOM   1318  C  "C1'" . G   A  1  71   ? 51.409  158.994 28.489  1.00 40.12  ? 71   G   0 "C1'" 1 
ATOM   1319  N  N9    . G   A  1  71   ? 51.856  157.656 28.112  1.00 37.00  ? 71   G   0 N9    1 
ATOM   1320  C  C8    . G   A  1  71   ? 51.182  156.468 28.279  1.00 36.26  ? 71   G   0 C8    1 
ATOM   1321  N  N7    . G   A  1  71   ? 51.838  155.439 27.812  1.00 36.46  ? 71   G   0 N7    1 
ATOM   1322  C  C5    . G   A  1  71   ? 53.014  155.979 27.310  1.00 34.76  ? 71   G   0 C5    1 
ATOM   1323  C  C6    . G   A  1  71   ? 54.114  155.353 26.668  1.00 36.17  ? 71   G   0 C6    1 
ATOM   1324  O  O6    . G   A  1  71   ? 54.268  154.158 26.387  1.00 37.00  ? 71   G   0 O6    1 
ATOM   1325  N  N1    . G   A  1  71   ? 55.100  156.274 26.333  1.00 35.60  ? 71   G   0 N1    1 
ATOM   1326  C  C2    . G   A  1  71   ? 55.032  157.622 26.573  1.00 35.87  ? 71   G   0 C2    1 
ATOM   1327  N  N2    . G   A  1  71   ? 56.080  158.352 26.168  1.00 34.63  ? 71   G   0 N2    1 
ATOM   1328  N  N3    . G   A  1  71   ? 54.010  158.216 27.164  1.00 35.57  ? 71   G   0 N3    1 
ATOM   1329  C  C4    . G   A  1  71   ? 53.045  157.343 27.501  1.00 34.31  ? 71   G   0 C4    1 
ATOM   1330  P  P     . C   A  1  72   ? 48.459  160.432 24.836  1.00 43.16  ? 72   C   0 P     1 
ATOM   1331  O  OP1   . C   A  1  72   ? 47.487  161.515 24.542  1.00 40.84  ? 72   C   0 OP1   1 
ATOM   1332  O  OP2   . C   A  1  72   ? 48.036  159.018 24.697  1.00 42.94  ? 72   C   0 OP2   1 
ATOM   1333  O  "O5'" . C   A  1  72   ? 49.749  160.620 23.924  1.00 40.62  ? 72   C   0 "O5'" 1 
ATOM   1334  C  "C5'" . C   A  1  72   ? 50.296  161.923 23.674  1.00 40.24  ? 72   C   0 "C5'" 1 
ATOM   1335  C  "C4'" . C   A  1  72   ? 51.314  161.840 22.570  1.00 41.18  ? 72   C   0 "C4'" 1 
ATOM   1336  O  "O4'" . C   A  1  72   ? 52.453  161.068 23.033  1.00 40.92  ? 72   C   0 "O4'" 1 
ATOM   1337  C  "C3'" . C   A  1  72   ? 50.841  161.088 21.339  1.00 40.92  ? 72   C   0 "C3'" 1 
ATOM   1338  O  "O3'" . C   A  1  72   ? 50.038  161.884 20.477  1.00 41.98  ? 72   C   0 "O3'" 1 
ATOM   1339  C  "C2'" . C   A  1  72   ? 52.149  160.625 20.719  1.00 40.11  ? 72   C   0 "C2'" 1 
ATOM   1340  O  "O2'" . C   A  1  72   ? 52.814  161.648 20.011  1.00 40.44  ? 72   C   0 "O2'" 1 
ATOM   1341  C  "C1'" . C   A  1  72   ? 52.951  160.263 21.972  1.00 41.08  ? 72   C   0 "C1'" 1 
ATOM   1342  N  N1    . C   A  1  72   ? 52.807  158.843 22.358  1.00 42.47  ? 72   C   0 N1    1 
ATOM   1343  C  C2    . C   A  1  72   ? 53.414  157.855 21.561  1.00 42.22  ? 72   C   0 C2    1 
ATOM   1344  O  O2    . C   A  1  72   ? 54.084  158.199 20.573  1.00 42.98  ? 72   C   0 O2    1 
ATOM   1345  N  N3    . C   A  1  72   ? 53.260  156.554 21.895  1.00 40.10  ? 72   C   0 N3    1 
ATOM   1346  C  C4    . C   A  1  72   ? 52.550  156.222 22.976  1.00 40.13  ? 72   C   0 C4    1 
ATOM   1347  N  N4    . C   A  1  72   ? 52.418  154.928 23.263  1.00 39.46  ? 72   C   0 N4    1 
ATOM   1348  C  C5    . C   A  1  72   ? 51.940  157.201 23.810  1.00 40.03  ? 72   C   0 C5    1 
ATOM   1349  C  C6    . C   A  1  72   ? 52.089  158.485 23.467  1.00 40.92  ? 72   C   0 C6    1 
ATOM   1350  P  P     . U   A  1  73   ? 48.904  161.177 19.581  1.00 43.67  ? 73   U   0 P     1 
ATOM   1351  O  OP1   . U   A  1  73   ? 48.154  162.238 18.881  1.00 42.17  ? 73   U   0 OP1   1 
ATOM   1352  O  OP2   . U   A  1  73   ? 48.171  160.203 20.432  1.00 41.40  ? 73   U   0 OP2   1 
ATOM   1353  O  "O5'" . U   A  1  73   ? 49.745  160.362 18.499  1.00 43.01  ? 73   U   0 "O5'" 1 
ATOM   1354  C  "C5'" . U   A  1  73   ? 50.582  161.052 17.553  1.00 42.75  ? 73   U   0 "C5'" 1 
ATOM   1355  C  "C4'" . U   A  1  73   ? 51.095  160.093 16.510  1.00 42.71  ? 73   U   0 "C4'" 1 
ATOM   1356  O  "O4'" . U   A  1  73   ? 51.989  159.144 17.138  1.00 43.93  ? 73   U   0 "O4'" 1 
ATOM   1357  C  "C3'" . U   A  1  73   ? 50.049  159.224 15.831  1.00 42.72  ? 73   U   0 "C3'" 1 
ATOM   1358  O  "O3'" . U   A  1  73   ? 49.391  159.914 14.778  1.00 44.05  ? 73   U   0 "O3'" 1 
ATOM   1359  C  "C2'" . U   A  1  73   ? 50.880  158.048 15.344  1.00 42.78  ? 73   U   0 "C2'" 1 
ATOM   1360  O  "O2'" . U   A  1  73   ? 51.614  158.337 14.174  1.00 41.63  ? 73   U   0 "O2'" 1 
ATOM   1361  C  "C1'" . U   A  1  73   ? 51.858  157.880 16.508  1.00 43.97  ? 73   U   0 "C1'" 1 
ATOM   1362  N  N1    . U   A  1  73   ? 51.412  156.905 17.515  1.00 44.24  ? 73   U   0 N1    1 
ATOM   1363  C  C2    . U   A  1  73   ? 51.570  155.566 17.226  1.00 44.13  ? 73   U   0 C2    1 
ATOM   1364  O  O2    . U   A  1  73   ? 52.033  155.167 16.173  1.00 46.41  ? 73   U   0 O2    1 
ATOM   1365  N  N3    . U   A  1  73   ? 51.164  154.708 18.217  1.00 44.86  ? 73   U   0 N3    1 
ATOM   1366  C  C4    . U   A  1  73   ? 50.621  155.047 19.436  1.00 43.52  ? 73   U   0 C4    1 
ATOM   1367  O  O4    . U   A  1  73   ? 50.327  154.159 20.232  1.00 44.49  ? 73   U   0 O4    1 
ATOM   1368  C  C5    . U   A  1  73   ? 50.473  156.450 19.656  1.00 43.77  ? 73   U   0 C5    1 
ATOM   1369  C  C6    . U   A  1  73   ? 50.861  157.309 18.714  1.00 44.89  ? 73   U   0 C6    1 
ATOM   1370  P  P     . G   A  1  74   ? 47.940  159.426 14.283  1.00 43.67  ? 74   G   0 P     1 
ATOM   1371  O  OP1   . G   A  1  74   ? 47.493  160.412 13.273  1.00 43.90  ? 74   G   0 OP1   1 
ATOM   1372  O  OP2   . G   A  1  74   ? 47.073  159.139 15.448  1.00 44.03  ? 74   G   0 OP2   1 
ATOM   1373  O  "O5'" . G   A  1  74   ? 48.247  158.048 13.549  1.00 43.30  ? 74   G   0 "O5'" 1 
ATOM   1374  C  "C5'" . G   A  1  74   ? 49.051  158.010 12.359  1.00 42.52  ? 74   G   0 "C5'" 1 
ATOM   1375  C  "C4'" . G   A  1  74   ? 49.200  156.588 11.874  1.00 45.33  ? 74   G   0 "C4'" 1 
ATOM   1376  O  "O4'" . G   A  1  74   ? 49.955  155.816 12.844  1.00 45.72  ? 74   G   0 "O4'" 1 
ATOM   1377  C  "C3'" . G   A  1  74   ? 47.910  155.799 11.717  1.00 46.03  ? 74   G   0 "C3'" 1 
ATOM   1378  O  "O3'" . G   A  1  74   ? 47.242  156.099 10.503  1.00 46.20  ? 74   G   0 "O3'" 1 
ATOM   1379  C  "C2'" . G   A  1  74   ? 48.409  154.363 11.770  1.00 45.76  ? 74   G   0 "C2'" 1 
ATOM   1380  O  "O2'" . G   A  1  74   ? 48.976  153.929 10.550  1.00 46.52  ? 74   G   0 "O2'" 1 
ATOM   1381  C  "C1'" . G   A  1  74   ? 49.504  154.470 12.835  1.00 45.13  ? 74   G   0 "C1'" 1 
ATOM   1382  N  N9    . G   A  1  74   ? 49.019  154.132 14.170  1.00 44.28  ? 74   G   0 N9    1 
ATOM   1383  C  C8    . G   A  1  74   ? 48.632  154.996 15.166  1.00 44.79  ? 74   G   0 C8    1 
ATOM   1384  N  N7    . G   A  1  74   ? 48.230  154.386 16.246  1.00 44.27  ? 74   G   0 N7    1 
ATOM   1385  C  C5    . G   A  1  74   ? 48.367  153.038 15.947  1.00 45.46  ? 74   G   0 C5    1 
ATOM   1386  C  C6    . G   A  1  74   ? 48.094  151.887 16.734  1.00 45.72  ? 74   G   0 C6    1 
ATOM   1387  O  O6    . G   A  1  74   ? 47.675  151.830 17.895  1.00 45.92  ? 74   G   0 O6    1 
ATOM   1388  N  N1    . G   A  1  74   ? 48.367  150.716 16.037  1.00 45.57  ? 74   G   0 N1    1 
ATOM   1389  C  C2    . G   A  1  74   ? 48.851  150.656 14.754  1.00 45.24  ? 74   G   0 C2    1 
ATOM   1390  N  N2    . G   A  1  74   ? 49.060  149.433 14.256  1.00 46.35  ? 74   G   0 N2    1 
ATOM   1391  N  N3    . G   A  1  74   ? 49.115  151.718 14.015  1.00 45.07  ? 74   G   0 N3    1 
ATOM   1392  C  C4    . G   A  1  74   ? 48.851  152.867 14.669  1.00 44.25  ? 74   G   0 C4    1 
ATOM   1393  P  P     . U   A  1  75   ? 45.641  156.004 10.433  1.00 47.91  ? 75   U   0 P     1 
ATOM   1394  O  OP1   . U   A  1  75   ? 45.237  156.601 9.131   1.00 48.66  ? 75   U   0 OP1   1 
ATOM   1395  O  OP2   . U   A  1  75   ? 45.064  156.534 11.688  1.00 45.85  ? 75   U   0 OP2   1 
ATOM   1396  O  "O5'" . U   A  1  75   ? 45.366  154.437 10.388  1.00 47.53  ? 75   U   0 "O5'" 1 
ATOM   1397  C  "C5'" . U   A  1  75   ? 45.817  153.642 9.278   1.00 48.06  ? 75   U   0 "C5'" 1 
ATOM   1398  C  "C4'" . U   A  1  75   ? 45.558  152.176 9.540   1.00 49.49  ? 75   U   0 "C4'" 1 
ATOM   1399  O  "O4'" . U   A  1  75   ? 46.412  151.706 10.618  1.00 49.69  ? 75   U   0 "O4'" 1 
ATOM   1400  C  "C3'" . U   A  1  75   ? 44.156  151.817 10.005  1.00 49.17  ? 75   U   0 "C3'" 1 
ATOM   1401  O  "O3'" . U   A  1  75   ? 43.224  151.736 8.942   1.00 49.96  ? 75   U   0 "O3'" 1 
ATOM   1402  C  "C2'" . U   A  1  75   ? 44.388  150.473 10.669  1.00 50.46  ? 75   U   0 "C2'" 1 
ATOM   1403  O  "O2'" . U   A  1  75   ? 44.549  149.433 9.727   1.00 52.20  ? 75   U   0 "O2'" 1 
ATOM   1404  C  "C1'" . U   A  1  75   ? 45.718  150.728 11.381  1.00 50.20  ? 75   U   0 "C1'" 1 
ATOM   1405  N  N1    . U   A  1  75   ? 45.513  151.252 12.743  1.00 49.77  ? 75   U   0 N1    1 
ATOM   1406  C  C2    . U   A  1  75   ? 45.417  150.339 13.787  1.00 50.01  ? 75   U   0 C2    1 
ATOM   1407  O  O2    . U   A  1  75   ? 45.502  149.129 13.629  1.00 50.97  ? 75   U   0 O2    1 
ATOM   1408  N  N3    . U   A  1  75   ? 45.210  150.897 15.024  1.00 47.85  ? 75   U   0 N3    1 
ATOM   1409  C  C4    . U   A  1  75   ? 45.086  152.237 15.322  1.00 47.49  ? 75   U   0 C4    1 
ATOM   1410  O  O4    . U   A  1  75   ? 44.882  152.582 16.484  1.00 45.30  ? 75   U   0 O4    1 
ATOM   1411  C  C5    . U   A  1  75   ? 45.198  153.110 14.198  1.00 47.98  ? 75   U   0 C5    1 
ATOM   1412  C  C6    . U   A  1  75   ? 45.405  152.604 12.981  1.00 49.11  ? 75   U   0 C6    1 
ATOM   1413  P  P     . G   A  1  76   ? 41.674  152.083 9.213   1.00 54.61  ? 76   G   0 P     1 
ATOM   1414  O  OP1   . G   A  1  76   ? 40.999  152.034 7.887   1.00 55.28  ? 76   G   0 OP1   1 
ATOM   1415  O  OP2   . G   A  1  76   ? 41.561  153.311 10.043  1.00 52.10  ? 76   G   0 OP2   1 
ATOM   1416  O  "O5'" . G   A  1  76   ? 41.151  150.853 10.082  1.00 54.34  ? 76   G   0 "O5'" 1 
ATOM   1417  C  "C5'" . G   A  1  76   ? 41.020  149.549 9.491   1.00 56.04  ? 76   G   0 "C5'" 1 
ATOM   1418  C  "C4'" . G   A  1  76   ? 40.778  148.499 10.550  1.00 56.21  ? 76   G   0 "C4'" 1 
ATOM   1419  O  "O4'" . G   A  1  76   ? 41.911  148.460 11.461  1.00 55.21  ? 76   G   0 "O4'" 1 
ATOM   1420  C  "C3'" . G   A  1  76   ? 39.588  148.696 11.477  1.00 56.24  ? 76   G   0 "C3'" 1 
ATOM   1421  O  "O3'" . G   A  1  76   ? 38.338  148.333 10.898  1.00 56.31  ? 76   G   0 "O3'" 1 
ATOM   1422  C  "C2'" . G   A  1  76   ? 39.962  147.787 12.636  1.00 55.50  ? 76   G   0 "C2'" 1 
ATOM   1423  O  "O2'" . G   A  1  76   ? 39.760  146.423 12.333  1.00 56.15  ? 76   G   0 "O2'" 1 
ATOM   1424  C  "C1'" . G   A  1  76   ? 41.462  148.068 12.752  1.00 54.96  ? 76   G   0 "C1'" 1 
ATOM   1425  N  N9    . G   A  1  76   ? 41.712  149.158 13.694  1.00 54.00  ? 76   G   0 N9    1 
ATOM   1426  C  C8    . G   A  1  76   ? 42.048  150.462 13.410  1.00 51.92  ? 76   G   0 C8    1 
ATOM   1427  N  N7    . G   A  1  76   ? 42.145  151.207 14.477  1.00 51.33  ? 76   G   0 N7    1 
ATOM   1428  C  C5    . G   A  1  76   ? 41.868  150.344 15.529  1.00 50.97  ? 76   G   0 C5    1 
ATOM   1429  C  C6    . G   A  1  76   ? 41.805  150.582 16.928  1.00 50.13  ? 76   G   0 C6    1 
ATOM   1430  O  O6    . G   A  1  76   ? 41.974  151.640 17.539  1.00 50.31  ? 76   G   0 O6    1 
ATOM   1431  N  N1    . G   A  1  76   ? 41.497  149.423 17.628  1.00 51.17  ? 76   G   0 N1    1 
ATOM   1432  C  C2    . G   A  1  76   ? 41.268  148.194 17.061  1.00 51.68  ? 76   G   0 C2    1 
ATOM   1433  N  N2    . G   A  1  76   ? 40.986  147.192 17.901  1.00 50.86  ? 76   G   0 N2    1 
ATOM   1434  N  N3    . G   A  1  76   ? 41.311  147.962 15.765  1.00 52.21  ? 76   G   0 N3    1 
ATOM   1435  C  C4    . G   A  1  76   ? 41.616  149.073 15.063  1.00 52.41  ? 76   G   0 C4    1 
ATOM   1436  P  P     . G   A  1  77   ? 36.993  149.092 11.370  1.00 58.65  ? 77   G   0 P     1 
ATOM   1437  O  OP1   . G   A  1  77   ? 35.912  148.691 10.438  1.00 57.10  ? 77   G   0 OP1   1 
ATOM   1438  O  OP2   . G   A  1  77   ? 37.298  150.537 11.565  1.00 58.06  ? 77   G   0 OP2   1 
ATOM   1439  O  "O5'" . G   A  1  77   ? 36.675  148.497 12.815  1.00 56.08  ? 77   G   0 "O5'" 1 
ATOM   1440  C  "C5'" . G   A  1  77   ? 36.583  147.078 13.032  1.00 53.38  ? 77   G   0 "C5'" 1 
ATOM   1441  C  "C4'" . G   A  1  77   ? 36.595  146.767 14.511  1.00 51.09  ? 77   G   0 "C4'" 1 
ATOM   1442  O  "O4'" . G   A  1  77   ? 37.846  147.222 15.092  1.00 51.57  ? 77   G   0 "O4'" 1 
ATOM   1443  C  "C3'" . G   A  1  77   ? 35.551  147.460 15.371  1.00 50.74  ? 77   G   0 "C3'" 1 
ATOM   1444  O  "O3'" . G   A  1  77   ? 34.272  146.849 15.312  1.00 49.22  ? 77   G   0 "O3'" 1 
ATOM   1445  C  "C2'" . G   A  1  77   ? 36.158  147.323 16.757  1.00 50.55  ? 77   G   0 "C2'" 1 
ATOM   1446  O  "O2'" . G   A  1  77   ? 36.002  146.021 17.285  1.00 52.60  ? 77   G   0 "O2'" 1 
ATOM   1447  C  "C1'" . G   A  1  77   ? 37.636  147.568 16.455  1.00 50.73  ? 77   G   0 "C1'" 1 
ATOM   1448  N  N9    . G   A  1  77   ? 38.005  148.967 16.666  1.00 50.36  ? 77   G   0 N9    1 
ATOM   1449  C  C8    . G   A  1  77   ? 38.304  149.916 15.717  1.00 48.44  ? 77   G   0 C8    1 
ATOM   1450  N  N7    . G   A  1  77   ? 38.574  151.085 16.232  1.00 47.73  ? 77   G   0 N7    1 
ATOM   1451  C  C5    . G   A  1  77   ? 38.453  150.896 17.602  1.00 49.31  ? 77   G   0 C5    1 
ATOM   1452  C  C6    . G   A  1  77   ? 38.624  151.808 18.680  1.00 49.36  ? 77   G   0 C6    1 
ATOM   1453  O  O6    . G   A  1  77   ? 38.940  152.998 18.639  1.00 49.90  ? 77   G   0 O6    1 
ATOM   1454  N  N1    . G   A  1  77   ? 38.387  151.199 19.908  1.00 49.04  ? 77   G   0 N1    1 
ATOM   1455  C  C2    . G   A  1  77   ? 38.037  149.884 20.082  1.00 48.91  ? 77   G   0 C2    1 
ATOM   1456  N  N2    . G   A  1  77   ? 37.842  149.482 21.349  1.00 48.40  ? 77   G   0 N2    1 
ATOM   1457  N  N3    . G   A  1  77   ? 37.885  149.025 19.090  1.00 48.68  ? 77   G   0 N3    1 
ATOM   1458  C  C4    . G   A  1  77   ? 38.105  149.595 17.886  1.00 49.74  ? 77   G   0 C4    1 
ATOM   1459  P  P     . G   A  1  78   ? 32.957  147.749 15.517  1.00 51.21  ? 78   G   0 P     1 
ATOM   1460  O  OP1   . G   A  1  78   ? 31.798  146.824 15.622  1.00 50.69  ? 78   G   0 OP1   1 
ATOM   1461  O  OP2   . G   A  1  78   ? 32.951  148.824 14.488  1.00 50.06  ? 78   G   0 OP2   1 
ATOM   1462  O  "O5'" . G   A  1  78   ? 33.175  148.469 16.923  1.00 50.16  ? 78   G   0 "O5'" 1 
ATOM   1463  C  "C5'" . G   A  1  78   ? 33.115  147.742 18.167  1.00 47.84  ? 78   G   0 "C5'" 1 
ATOM   1464  C  "C4'" . G   A  1  78   ? 33.236  148.701 19.328  1.00 47.79  ? 78   G   0 "C4'" 1 
ATOM   1465  O  "O4'" . G   A  1  78   ? 34.533  149.349 19.276  1.00 49.55  ? 78   G   0 "O4'" 1 
ATOM   1466  C  "C3'" . G   A  1  78   ? 32.234  149.843 19.314  1.00 48.14  ? 78   G   0 "C3'" 1 
ATOM   1467  O  "O3'" . G   A  1  78   ? 31.018  149.438 19.933  1.00 46.26  ? 78   G   0 "O3'" 1 
ATOM   1468  C  "C2'" . G   A  1  78   ? 32.957  150.937 20.090  1.00 49.13  ? 78   G   0 "C2'" 1 
ATOM   1469  O  "O2'" . G   A  1  78   ? 32.875  150.757 21.487  1.00 50.13  ? 78   G   0 "O2'" 1 
ATOM   1470  C  "C1'" . G   A  1  78   ? 34.408  150.710 19.655  1.00 50.65  ? 78   G   0 "C1'" 1 
ATOM   1471  N  N9    . G   A  1  78   ? 34.858  151.536 18.535  1.00 52.81  ? 78   G   0 N9    1 
ATOM   1472  C  C8    . G   A  1  78   ? 34.775  151.226 17.198  1.00 53.05  ? 78   G   0 C8    1 
ATOM   1473  N  N7    . G   A  1  78   ? 35.281  152.148 16.424  1.00 53.83  ? 78   G   0 N7    1 
ATOM   1474  C  C5    . G   A  1  78   ? 35.720  153.131 17.299  1.00 53.40  ? 78   G   0 C5    1 
ATOM   1475  C  C6    . G   A  1  78   ? 36.359  154.369 17.038  1.00 53.63  ? 78   G   0 C6    1 
ATOM   1476  O  O6    . G   A  1  78   ? 36.663  154.862 15.946  1.00 54.90  ? 78   G   0 O6    1 
ATOM   1477  N  N1    . G   A  1  78   ? 36.643  155.056 18.213  1.00 53.18  ? 78   G   0 N1    1 
ATOM   1478  C  C2    . G   A  1  78   ? 36.349  154.612 19.478  1.00 52.87  ? 78   G   0 C2    1 
ATOM   1479  N  N2    . G   A  1  78   ? 36.709  155.420 20.482  1.00 50.83  ? 78   G   0 N2    1 
ATOM   1480  N  N3    . G   A  1  78   ? 35.748  153.461 19.737  1.00 53.04  ? 78   G   0 N3    1 
ATOM   1481  C  C4    . G   A  1  78   ? 35.465  152.774 18.607  1.00 53.56  ? 78   G   0 C4    1 
ATOM   1482  P  P     . G   A  1  79   ? 29.611  149.958 19.358  1.00 46.61  ? 79   G   0 P     1 
ATOM   1483  O  OP1   . G   A  1  79   ? 28.544  149.096 19.936  1.00 47.93  ? 79   G   0 OP1   1 
ATOM   1484  O  OP2   . G   A  1  79   ? 29.734  150.078 17.882  1.00 47.75  ? 79   G   0 OP2   1 
ATOM   1485  O  "O5'" . G   A  1  79   ? 29.456  151.406 19.992  1.00 43.10  ? 79   G   0 "O5'" 1 
ATOM   1486  C  "C5'" . G   A  1  79   ? 29.544  151.594 21.414  1.00 41.62  ? 79   G   0 "C5'" 1 
ATOM   1487  C  "C4'" . G   A  1  79   ? 29.919  153.016 21.723  1.00 40.87  ? 79   G   0 "C4'" 1 
ATOM   1488  O  "O4'" . G   A  1  79   ? 31.239  153.287 21.188  1.00 42.67  ? 79   G   0 "O4'" 1 
ATOM   1489  C  "C3'" . G   A  1  79   ? 29.024  154.067 21.087  1.00 40.70  ? 79   G   0 "C3'" 1 
ATOM   1490  O  "O3'" . G   A  1  79   ? 27.870  154.272 21.896  1.00 41.50  ? 79   G   0 "O3'" 1 
ATOM   1491  C  "C2'" . G   A  1  79   ? 29.948  155.277 21.013  1.00 40.43  ? 79   G   0 "C2'" 1 
ATOM   1492  O  "O2'" . G   A  1  79   ? 30.082  155.933 22.252  1.00 39.55  ? 79   G   0 "O2'" 1 
ATOM   1493  C  "C1'" . G   A  1  79   ? 31.287  154.613 20.685  1.00 42.24  ? 79   G   0 "C1'" 1 
ATOM   1494  N  N9    . G   A  1  79   ? 31.614  154.549 19.261  1.00 43.54  ? 79   G   0 N9    1 
ATOM   1495  C  C8    . G   A  1  79   ? 31.123  153.661 18.333  1.00 43.57  ? 79   G   0 C8    1 
ATOM   1496  N  N7    . G   A  1  79   ? 31.650  153.816 17.148  1.00 44.92  ? 79   G   0 N7    1 
ATOM   1497  C  C5    . G   A  1  79   ? 32.532  154.879 17.298  1.00 44.11  ? 79   G   0 C5    1 
ATOM   1498  C  C6    . G   A  1  79   ? 33.403  155.496 16.358  1.00 44.15  ? 79   G   0 C6    1 
ATOM   1499  O  O6    . G   A  1  79   ? 33.591  155.207 15.169  1.00 43.99  ? 79   G   0 O6    1 
ATOM   1500  N  N1    . G   A  1  79   ? 34.112  156.544 16.933  1.00 44.61  ? 79   G   0 N1    1 
ATOM   1501  C  C2    . G   A  1  79   ? 34.011  156.943 18.241  1.00 45.20  ? 79   G   0 C2    1 
ATOM   1502  N  N2    . G   A  1  79   ? 34.790  157.975 18.611  1.00 43.49  ? 79   G   0 N2    1 
ATOM   1503  N  N3    . G   A  1  79   ? 33.210  156.373 19.126  1.00 44.08  ? 79   G   0 N3    1 
ATOM   1504  C  C4    . G   A  1  79   ? 32.507  155.355 18.591  1.00 43.32  ? 79   G   0 C4    1 
ATOM   1505  P  P     . A   A  1  80   ? 26.771  155.370 21.483  1.00 45.05  ? 80   A   0 P     1 
ATOM   1506  O  OP1   . A   A  1  80   ? 25.434  154.846 21.874  1.00 43.13  ? 80   A   0 OP1   1 
ATOM   1507  O  OP2   . A   A  1  80   ? 27.018  155.786 20.070  1.00 45.31  ? 80   A   0 OP2   1 
ATOM   1508  O  "O5'" . A   A  1  80   ? 27.101  156.615 22.423  1.00 44.05  ? 80   A   0 "O5'" 1 
ATOM   1509  C  "C5'" . A   A  1  80   ? 27.223  156.450 23.848  1.00 43.52  ? 80   A   0 "C5'" 1 
ATOM   1510  C  "C4'" . A   A  1  80   ? 27.726  157.723 24.490  1.00 42.55  ? 80   A   0 "C4'" 1 
ATOM   1511  O  "O4'" . A   A  1  80   ? 29.004  158.094 23.898  1.00 43.16  ? 80   A   0 "O4'" 1 
ATOM   1512  C  "C3'" . A   A  1  80   ? 26.834  158.951 24.354  1.00 41.37  ? 80   A   0 "C3'" 1 
ATOM   1513  O  "O3'" . A   A  1  80   ? 27.037  159.774 25.499  1.00 41.55  ? 80   A   0 "O3'" 1 
ATOM   1514  C  "C2'" . A   A  1  80   ? 27.444  159.656 23.147  1.00 42.15  ? 80   A   0 "C2'" 1 
ATOM   1515  O  "O2'" . A   A  1  80   ? 27.188  161.044 23.093  1.00 43.54  ? 80   A   0 "O2'" 1 
ATOM   1516  C  "C1'" . A   A  1  80   ? 28.926  159.416 23.406  1.00 42.95  ? 80   A   0 "C1'" 1 
ATOM   1517  N  N9    . A   A  1  80   ? 29.794  159.533 22.239  1.00 42.64  ? 80   A   0 N9    1 
ATOM   1518  C  C8    . A   A  1  80   ? 29.601  159.036 20.976  1.00 42.91  ? 80   A   0 C8    1 
ATOM   1519  N  N7    . A   A  1  80   ? 30.585  159.295 20.152  1.00 43.06  ? 80   A   0 N7    1 
ATOM   1520  C  C5    . A   A  1  80   ? 31.482  160.019 20.922  1.00 41.82  ? 80   A   0 C5    1 
ATOM   1521  C  C6    . A   A  1  80   ? 32.727  160.594 20.626  1.00 42.78  ? 80   A   0 C6    1 
ATOM   1522  N  N6    . A   A  1  80   ? 33.292  160.545 19.418  1.00 42.80  ? 80   A   0 N6    1 
ATOM   1523  N  N1    . A   A  1  80   ? 33.376  161.238 21.622  1.00 43.88  ? 80   A   0 N1    1 
ATOM   1524  C  C2    . A   A  1  80   ? 32.791  161.310 22.824  1.00 45.39  ? 80   A   0 C2    1 
ATOM   1525  N  N3    . A   A  1  80   ? 31.615  160.821 23.220  1.00 45.41  ? 80   A   0 N3    1 
ATOM   1526  C  C4    . A   A  1  80   ? 31.007  160.176 22.209  1.00 43.51  ? 80   A   0 C4    1 
ATOM   1527  P  P     . G   A  1  81   ? 26.252  159.458 26.862  1.00 44.48  ? 81   G   0 P     1 
ATOM   1528  O  OP1   . G   A  1  81   ? 25.005  158.705 26.531  1.00 44.47  ? 81   G   0 OP1   1 
ATOM   1529  O  OP2   . G   A  1  81   ? 26.165  160.711 27.641  1.00 41.73  ? 81   G   0 OP2   1 
ATOM   1530  O  "O5'" . G   A  1  81   ? 27.219  158.452 27.631  1.00 43.65  ? 81   G   0 "O5'" 1 
ATOM   1531  C  "C5'" . G   A  1  81   ? 28.308  158.929 28.441  1.00 40.25  ? 81   G   0 "C5'" 1 
ATOM   1532  C  "C4'" . G   A  1  81   ? 29.627  158.543 27.811  1.00 40.81  ? 81   G   0 "C4'" 1 
ATOM   1533  O  "O4'" . G   A  1  81   ? 29.806  159.260 26.557  1.00 38.59  ? 81   G   0 "O4'" 1 
ATOM   1534  C  "C3'" . G   A  1  81   ? 30.866  158.869 28.627  1.00 39.40  ? 81   G   0 "C3'" 1 
ATOM   1535  O  "O3'" . G   A  1  81   ? 31.167  157.836 29.556  1.00 40.20  ? 81   G   0 "O3'" 1 
ATOM   1536  C  "C2'" . G   A  1  81   ? 31.924  159.045 27.552  1.00 37.69  ? 81   G   0 "C2'" 1 
ATOM   1537  O  "O2'" . G   A  1  81   ? 32.372  157.812 27.033  1.00 37.46  ? 81   G   0 "O2'" 1 
ATOM   1538  C  "C1'" . G   A  1  81   ? 31.116  159.800 26.497  1.00 37.41  ? 81   G   0 "C1'" 1 
ATOM   1539  N  N9    . G   A  1  81   ? 31.033  161.221 26.829  1.00 35.05  ? 81   G   0 N9    1 
ATOM   1540  C  C8    . G   A  1  81   ? 29.918  161.919 27.226  1.00 33.67  ? 81   G   0 C8    1 
ATOM   1541  N  N7    . G   A  1  81   ? 30.172  163.167 27.515  1.00 34.53  ? 81   G   0 N7    1 
ATOM   1542  C  C5    . G   A  1  81   ? 31.532  163.304 27.281  1.00 33.68  ? 81   G   0 C5    1 
ATOM   1543  C  C6    . G   A  1  81   ? 32.380  164.432 27.431  1.00 35.88  ? 81   G   0 C6    1 
ATOM   1544  O  O6    . G   A  1  81   ? 32.086  165.572 27.824  1.00 38.51  ? 81   G   0 O6    1 
ATOM   1545  N  N1    . G   A  1  81   ? 33.694  164.134 27.074  1.00 32.74  ? 81   G   0 N1    1 
ATOM   1546  C  C2    . G   A  1  81   ? 34.131  162.910 26.634  1.00 32.81  ? 81   G   0 C2    1 
ATOM   1547  N  N2    . G   A  1  81   ? 35.423  162.820 26.325  1.00 33.60  ? 81   G   0 N2    1 
ATOM   1548  N  N3    . G   A  1  81   ? 33.353  161.849 26.502  1.00 33.42  ? 81   G   0 N3    1 
ATOM   1549  C  C4    . G   A  1  81   ? 32.074  162.117 26.840  1.00 33.81  ? 81   G   0 C4    1 
ATOM   1550  P  P     . C   A  1  82   ? 31.657  158.220 31.036  1.00 41.20  ? 82   C   0 P     1 
ATOM   1551  O  OP1   . C   A  1  82   ? 31.427  157.026 31.896  1.00 42.18  ? 82   C   0 OP1   1 
ATOM   1552  O  OP2   . C   A  1  82   ? 31.045  159.522 31.412  1.00 37.77  ? 82   C   0 OP2   1 
ATOM   1553  O  "O5'" . C   A  1  82   ? 33.225  158.439 30.871  1.00 39.02  ? 82   C   0 "O5'" 1 
ATOM   1554  C  "C5'" . C   A  1  82   ? 34.020  157.559 30.048  1.00 38.72  ? 82   C   0 "C5'" 1 
ATOM   1555  C  "C4'" . C   A  1  82   ? 35.290  158.263 29.617  1.00 40.33  ? 82   C   0 "C4'" 1 
ATOM   1556  O  "O4'" . C   A  1  82   ? 34.948  159.444 28.839  1.00 38.89  ? 82   C   0 "O4'" 1 
ATOM   1557  C  "C3'" . C   A  1  82   ? 36.145  158.812 30.750  1.00 39.89  ? 82   C   0 "C3'" 1 
ATOM   1558  O  "O3'" . C   A  1  82   ? 36.995  157.819 31.309  1.00 41.50  ? 82   C   0 "O3'" 1 
ATOM   1559  C  "C2'" . C   A  1  82   ? 36.936  159.915 30.063  1.00 38.86  ? 82   C   0 "C2'" 1 
ATOM   1560  O  "O2'" . C   A  1  82   ? 38.041  159.420 29.336  1.00 38.49  ? 82   C   0 "O2'" 1 
ATOM   1561  C  "C1'" . C   A  1  82   ? 35.886  160.478 29.103  1.00 37.91  ? 82   C   0 "C1'" 1 
ATOM   1562  N  N1    . C   A  1  82   ? 35.164  161.659 29.625  1.00 35.88  ? 82   C   0 N1    1 
ATOM   1563  C  C2    . C   A  1  82   ? 35.852  162.889 29.731  1.00 35.22  ? 82   C   0 C2    1 
ATOM   1564  O  O2    . C   A  1  82   ? 37.047  162.946 29.399  1.00 34.35  ? 82   C   0 O2    1 
ATOM   1565  N  N3    . C   A  1  82   ? 35.193  163.977 30.191  1.00 34.40  ? 82   C   0 N3    1 
ATOM   1566  C  C4    . C   A  1  82   ? 33.906  163.880 30.537  1.00 33.69  ? 82   C   0 C4    1 
ATOM   1567  N  N4    . C   A  1  82   ? 33.297  164.976 30.980  1.00 32.06  ? 82   C   0 N4    1 
ATOM   1568  C  C5    . C   A  1  82   ? 33.187  162.651 30.445  1.00 33.46  ? 82   C   0 C5    1 
ATOM   1569  C  C6    . C   A  1  82   ? 33.849  161.575 29.993  1.00 34.02  ? 82   C   0 C6    1 
ATOM   1570  P  P     . C   A  1  83   ? 37.471  157.950 32.836  1.00 41.55  ? 83   C   0 P     1 
ATOM   1571  O  OP1   . C   A  1  83   ? 38.254  156.721 33.112  1.00 42.13  ? 83   C   0 OP1   1 
ATOM   1572  O  OP2   . C   A  1  83   ? 36.311  158.301 33.694  1.00 41.40  ? 83   C   0 OP2   1 
ATOM   1573  O  "O5'" . C   A  1  83   ? 38.455  159.200 32.832  1.00 42.79  ? 83   C   0 "O5'" 1 
ATOM   1574  C  "C5'" . C   A  1  83   ? 39.754  159.105 32.225  1.00 42.18  ? 83   C   0 "C5'" 1 
ATOM   1575  C  "C4'" . C   A  1  83   ? 40.545  160.359 32.485  1.00 40.26  ? 83   C   0 "C4'" 1 
ATOM   1576  O  "O4'" . C   A  1  83   ? 39.916  161.479 31.814  1.00 41.78  ? 83   C   0 "O4'" 1 
ATOM   1577  C  "C3'" . C   A  1  83   ? 40.630  160.808 33.933  1.00 40.62  ? 83   C   0 "C3'" 1 
ATOM   1578  O  "O3'" . C   A  1  83   ? 41.630  160.067 34.639  1.00 41.12  ? 83   C   0 "O3'" 1 
ATOM   1579  C  "C2'" . C   A  1  83   ? 41.000  162.280 33.775  1.00 39.96  ? 83   C   0 "C2'" 1 
ATOM   1580  O  "O2'" . C   A  1  83   ? 42.366  162.463 33.479  1.00 40.71  ? 83   C   0 "O2'" 1 
ATOM   1581  C  "C1'" . C   A  1  83   ? 40.190  162.670 32.534  1.00 39.60  ? 83   C   0 "C1'" 1 
ATOM   1582  N  N1    . C   A  1  83   ? 38.923  163.366 32.836  1.00 37.74  ? 83   C   0 N1    1 
ATOM   1583  C  C2    . C   A  1  83   ? 38.962  164.744 33.081  1.00 38.24  ? 83   C   0 C2    1 
ATOM   1584  O  O2    . C   A  1  83   ? 40.050  165.336 33.009  1.00 39.52  ? 83   C   0 O2    1 
ATOM   1585  N  N3    . C   A  1  83   ? 37.818  165.397 33.388  1.00 37.49  ? 83   C   0 N3    1 
ATOM   1586  C  C4    . C   A  1  83   ? 36.665  164.729 33.447  1.00 38.19  ? 83   C   0 C4    1 
ATOM   1587  N  N4    . C   A  1  83   ? 35.560  165.419 33.763  1.00 38.38  ? 83   C   0 N4    1 
ATOM   1588  C  C5    . C   A  1  83   ? 36.592  163.328 33.188  1.00 35.62  ? 83   C   0 C5    1 
ATOM   1589  C  C6    . C   A  1  83   ? 37.733  162.693 32.889  1.00 36.32  ? 83   C   0 C6    1 
ATOM   1590  P  P     . G   A  1  84   ? 41.353  159.554 36.146  1.00 41.14  ? 84   G   0 P     1 
ATOM   1591  O  OP1   . G   A  1  84   ? 39.895  159.613 36.451  1.00 39.04  ? 84   G   0 OP1   1 
ATOM   1592  O  OP2   . G   A  1  84   ? 42.312  160.255 37.037  1.00 41.45  ? 84   G   0 OP2   1 
ATOM   1593  O  "O5'" . G   A  1  84   ? 41.782  158.018 36.099  1.00 39.08  ? 84   G   0 "O5'" 1 
ATOM   1594  C  "C5'" . G   A  1  84   ? 41.046  157.061 35.302  1.00 40.50  ? 84   G   0 "C5'" 1 
ATOM   1595  C  "C4'" . G   A  1  84   ? 41.399  155.651 35.717  1.00 40.33  ? 84   G   0 "C4'" 1 
ATOM   1596  O  "O4'" . G   A  1  84   ? 42.823  155.437 35.532  1.00 40.96  ? 84   G   0 "O4'" 1 
ATOM   1597  C  "C3'" . G   A  1  84   ? 41.152  155.336 37.183  1.00 40.86  ? 84   G   0 "C3'" 1 
ATOM   1598  O  "O3'" . G   A  1  84   ? 39.808  154.930 37.393  1.00 42.11  ? 84   G   0 "O3'" 1 
ATOM   1599  C  "C2'" . G   A  1  84   ? 42.139  154.211 37.444  1.00 40.26  ? 84   G   0 "C2'" 1 
ATOM   1600  O  "O2'" . G   A  1  84   ? 41.685  152.977 36.939  1.00 39.66  ? 84   G   0 "O2'" 1 
ATOM   1601  C  "C1'" . G   A  1  84   ? 43.335  154.666 36.606  1.00 40.62  ? 84   G   0 "C1'" 1 
ATOM   1602  N  N9    . G   A  1  84   ? 44.292  155.486 37.347  1.00 41.18  ? 84   G   0 N9    1 
ATOM   1603  C  C8    . G   A  1  84   ? 44.604  156.807 37.121  1.00 42.32  ? 84   G   0 C8    1 
ATOM   1604  N  N7    . G   A  1  84   ? 45.514  157.267 37.936  1.00 40.51  ? 84   G   0 N7    1 
ATOM   1605  C  C5    . G   A  1  84   ? 45.821  156.189 38.753  1.00 41.91  ? 84   G   0 C5    1 
ATOM   1606  C  C6    . G   A  1  84   ? 46.743  156.083 39.821  1.00 41.15  ? 84   G   0 C6    1 
ATOM   1607  O  O6    . G   A  1  84   ? 47.505  156.946 40.266  1.00 39.86  ? 84   G   0 O6    1 
ATOM   1608  N  N1    . G   A  1  84   ? 46.730  154.813 40.380  1.00 40.75  ? 84   G   0 N1    1 
ATOM   1609  C  C2    . G   A  1  84   ? 45.940  153.774 39.962  1.00 40.08  ? 84   G   0 C2    1 
ATOM   1610  N  N2    . G   A  1  84   ? 46.082  152.624 40.623  1.00 39.89  ? 84   G   0 N2    1 
ATOM   1611  N  N3    . G   A  1  84   ? 45.078  153.856 38.967  1.00 39.75  ? 84   G   0 N3    1 
ATOM   1612  C  C4    . G   A  1  84   ? 45.071  155.083 38.409  1.00 41.70  ? 84   G   0 C4    1 
ATOM   1613  P  P     . C   A  1  85   ? 39.098  155.217 38.802  1.00 45.47  ? 85   C   0 P     1 
ATOM   1614  O  OP1   . C   A  1  85   ? 37.698  154.755 38.677  1.00 45.93  ? 85   C   0 OP1   1 
ATOM   1615  O  OP2   . C   A  1  85   ? 39.366  156.626 39.185  1.00 45.81  ? 85   C   0 OP2   1 
ATOM   1616  O  "O5'" . C   A  1  85   ? 39.845  154.242 39.820  1.00 46.43  ? 85   C   0 "O5'" 1 
ATOM   1617  C  "C5'" . C   A  1  85   ? 39.714  152.810 39.701  1.00 47.82  ? 85   C   0 "C5'" 1 
ATOM   1618  C  "C4'" . C   A  1  85   ? 40.555  152.108 40.745  1.00 50.71  ? 85   C   0 "C4'" 1 
ATOM   1619  O  "O4'" . C   A  1  85   ? 41.953  152.436 40.537  1.00 51.00  ? 85   C   0 "O4'" 1 
ATOM   1620  C  "C3'" . C   A  1  85   ? 40.300  152.480 42.201  1.00 51.43  ? 85   C   0 "C3'" 1 
ATOM   1621  O  "O3'" . C   A  1  85   ? 39.211  151.754 42.758  1.00 52.41  ? 85   C   0 "O3'" 1 
ATOM   1622  C  "C2'" . C   A  1  85   ? 41.608  152.068 42.863  1.00 51.37  ? 85   C   0 "C2'" 1 
ATOM   1623  O  "O2'" . C   A  1  85   ? 41.703  150.674 43.081  1.00 49.40  ? 85   C   0 "O2'" 1 
ATOM   1624  C  "C1'" . C   A  1  85   ? 42.621  152.465 41.788  1.00 50.63  ? 85   C   0 "C1'" 1 
ATOM   1625  N  N1    . C   A  1  85   ? 43.178  153.811 42.001  1.00 51.19  ? 85   C   0 N1    1 
ATOM   1626  C  C2    . C   A  1  85   ? 44.157  153.981 42.987  1.00 51.51  ? 85   C   0 C2    1 
ATOM   1627  O  O2    . C   A  1  85   ? 44.499  153.001 43.671  1.00 51.12  ? 85   C   0 O2    1 
ATOM   1628  N  N3    . C   A  1  85   ? 44.699  155.207 43.176  1.00 51.09  ? 85   C   0 N3    1 
ATOM   1629  C  C4    . C   A  1  85   ? 44.293  156.238 42.433  1.00 50.11  ? 85   C   0 C4    1 
ATOM   1630  N  N4    . C   A  1  85   ? 44.862  157.421 42.647  1.00 50.19  ? 85   C   0 N4    1 
ATOM   1631  C  C5    . C   A  1  85   ? 43.285  156.099 41.435  1.00 50.35  ? 85   C   0 C5    1 
ATOM   1632  C  C6    . C   A  1  85   ? 42.760  154.880 41.253  1.00 51.01  ? 85   C   0 C6    1 
ATOM   1633  P  P     . A   A  1  86   ? 37.793  152.473 42.963  1.00 53.32  ? 86   A   0 P     1 
ATOM   1634  O  OP1   . A   A  1  86   ? 36.948  151.585 43.792  1.00 54.30  ? 86   A   0 OP1   1 
ATOM   1635  O  OP2   . A   A  1  86   ? 37.324  152.886 41.622  1.00 55.75  ? 86   A   0 OP2   1 
ATOM   1636  O  "O5'" . A   A  1  86   ? 38.116  153.779 43.808  1.00 52.36  ? 86   A   0 "O5'" 1 
ATOM   1637  C  "C5'" . A   A  1  86   ? 37.053  154.629 44.262  1.00 54.66  ? 86   A   0 "C5'" 1 
ATOM   1638  C  "C4'" . A   A  1  86   ? 37.374  156.078 43.977  1.00 57.30  ? 86   A   0 "C4'" 1 
ATOM   1639  O  "O4'" . A   A  1  86   ? 38.466  156.528 44.826  1.00 56.79  ? 86   A   0 "O4'" 1 
ATOM   1640  C  "C3'" . A   A  1  86   ? 37.793  156.401 42.550  1.00 58.39  ? 86   A   0 "C3'" 1 
ATOM   1641  O  "O3'" . A   A  1  86   ? 37.348  157.722 42.265  1.00 64.90  ? 86   A   0 "O3'" 1 
ATOM   1642  C  "C2'" . A   A  1  86   ? 39.317  156.362 42.642  1.00 57.11  ? 86   A   0 "C2'" 1 
ATOM   1643  O  "O2'" . A   A  1  86   ? 39.957  157.134 41.652  1.00 53.59  ? 86   A   0 "O2'" 1 
ATOM   1644  C  "C1'" . A   A  1  86   ? 39.543  156.977 44.023  1.00 56.20  ? 86   A   0 "C1'" 1 
ATOM   1645  N  N9    . A   A  1  86   ? 40.788  156.596 44.692  1.00 54.87  ? 86   A   0 N9    1 
ATOM   1646  C  C8    . A   A  1  86   ? 41.126  155.366 45.206  1.00 54.08  ? 86   A   0 C8    1 
ATOM   1647  N  N7    . A   A  1  86   ? 42.282  155.349 45.821  1.00 53.27  ? 86   A   0 N7    1 
ATOM   1648  C  C5    . A   A  1  86   ? 42.745  156.651 45.694  1.00 52.64  ? 86   A   0 C5    1 
ATOM   1649  C  C6    . A   A  1  86   ? 43.908  157.285 46.151  1.00 51.79  ? 86   A   0 C6    1 
ATOM   1650  N  N6    . A   A  1  86   ? 44.844  156.675 46.877  1.00 50.82  ? 86   A   0 N6    1 
ATOM   1651  N  N1    . A   A  1  86   ? 44.077  158.586 45.841  1.00 52.13  ? 86   A   0 N1    1 
ATOM   1652  C  C2    . A   A  1  86   ? 43.127  159.203 45.128  1.00 52.43  ? 86   A   0 C2    1 
ATOM   1653  N  N3    . A   A  1  86   ? 41.983  158.720 44.655  1.00 53.20  ? 86   A   0 N3    1 
ATOM   1654  C  C4    . A   A  1  86   ? 41.848  157.423 44.977  1.00 53.45  ? 86   A   0 C4    1 
ATOM   1655  P  P     . C   A  1  87   ? 36.141  157.957 41.231  1.00 69.18  ? 87   C   0 P     1 
ATOM   1656  O  OP1   . C   A  1  87   ? 35.668  156.654 40.690  1.00 66.93  ? 87   C   0 OP1   1 
ATOM   1657  O  OP2   . C   A  1  87   ? 36.608  159.016 40.296  1.00 68.40  ? 87   C   0 OP2   1 
ATOM   1658  O  "O5'" . C   A  1  87   ? 34.966  158.580 42.112  1.00 72.04  ? 87   C   0 "O5'" 1 
ATOM   1659  C  "C5'" . C   A  1  87   ? 33.856  159.225 41.460  1.00 79.69  ? 87   C   0 "C5'" 1 
ATOM   1660  C  "C4'" . C   A  1  87   ? 32.832  159.713 42.459  1.00 83.29  ? 87   C   0 "C4'" 1 
ATOM   1661  O  "O4'" . C   A  1  87   ? 32.176  158.588 43.104  1.00 86.65  ? 87   C   0 "O4'" 1 
ATOM   1662  C  "C3'" . C   A  1  87   ? 33.303  160.639 43.573  1.00 84.51  ? 87   C   0 "C3'" 1 
ATOM   1663  O  "O3'" . C   A  1  87   ? 32.309  161.631 43.767  1.00 82.89  ? 87   C   0 "O3'" 1 
ATOM   1664  C  "C2'" . C   A  1  87   ? 33.357  159.710 44.783  1.00 86.70  ? 87   C   0 "C2'" 1 
ATOM   1665  O  "O2'" . C   A  1  87   ? 33.147  160.383 46.006  1.00 87.54  ? 87   C   0 "O2'" 1 
ATOM   1666  C  "C1'" . C   A  1  87   ? 32.180  158.783 44.502  1.00 88.59  ? 87   C   0 "C1'" 1 
ATOM   1667  N  N1    . C   A  1  87   ? 32.234  157.464 45.164  1.00 92.22  ? 87   C   0 N1    1 
ATOM   1668  C  C2    . C   A  1  87   ? 31.057  156.956 45.745  1.00 94.22  ? 87   C   0 C2    1 
ATOM   1669  O  O2    . C   A  1  87   ? 30.010  157.627 45.680  1.00 95.64  ? 87   C   0 O2    1 
ATOM   1670  N  N3    . C   A  1  87   ? 31.090  155.749 46.360  1.00 95.30  ? 87   C   0 N3    1 
ATOM   1671  C  C4    . C   A  1  87   ? 32.229  155.054 46.407  1.00 95.40  ? 87   C   0 C4    1 
ATOM   1672  N  N4    . C   A  1  87   ? 32.210  153.868 47.028  1.00 95.44  ? 87   C   0 N4    1 
ATOM   1673  C  C5    . C   A  1  87   ? 33.438  155.543 45.822  1.00 94.23  ? 87   C   0 C5    1 
ATOM   1674  C  C6    . C   A  1  87   ? 33.396  156.739 45.218  1.00 92.67  ? 87   C   0 C6    1 
ATOM   1675  P  P     . G   A  1  88   ? 32.577  163.131 43.256  1.00 84.48  ? 88   G   0 P     1 
ATOM   1676  O  OP1   . G   A  1  88   ? 31.281  163.660 42.746  1.00 83.81  ? 88   G   0 OP1   1 
ATOM   1677  O  OP2   . G   A  1  88   ? 33.772  163.127 42.361  1.00 82.10  ? 88   G   0 OP2   1 
ATOM   1678  O  "O5'" . G   A  1  88   ? 32.944  163.929 44.588  1.00 81.86  ? 88   G   0 "O5'" 1 
ATOM   1679  C  "C5'" . G   A  1  88   ? 34.234  163.775 45.202  1.00 77.00  ? 88   G   0 "C5'" 1 
ATOM   1680  C  "C4'" . G   A  1  88   ? 34.664  165.059 45.874  1.00 73.44  ? 88   G   0 "C4'" 1 
ATOM   1681  O  "O4'" . G   A  1  88   ? 36.042  164.895 46.301  1.00 71.75  ? 88   G   0 "O4'" 1 
ATOM   1682  C  "C3'" . G   A  1  88   ? 34.654  166.306 44.993  1.00 73.01  ? 88   G   0 "C3'" 1 
ATOM   1683  O  "O3'" . G   A  1  88   ? 33.414  167.010 45.107  1.00 73.95  ? 88   G   0 "O3'" 1 
ATOM   1684  C  "C2'" . G   A  1  88   ? 35.842  167.108 45.513  1.00 70.49  ? 88   G   0 "C2'" 1 
ATOM   1685  O  "O2'" . G   A  1  88   ? 35.553  167.823 46.699  1.00 70.35  ? 88   G   0 "O2'" 1 
ATOM   1686  C  "C1'" . G   A  1  88   ? 36.822  165.985 45.846  1.00 68.01  ? 88   G   0 "C1'" 1 
ATOM   1687  N  N9    . G   A  1  88   ? 37.643  165.525 44.728  1.00 63.24  ? 88   G   0 N9    1 
ATOM   1688  C  C8    . G   A  1  88   ? 37.401  164.454 43.899  1.00 62.01  ? 88   G   0 C8    1 
ATOM   1689  N  N7    . G   A  1  88   ? 38.344  164.265 43.017  1.00 59.96  ? 88   G   0 N7    1 
ATOM   1690  C  C5    . G   A  1  88   ? 39.259  165.275 43.272  1.00 59.12  ? 88   G   0 C5    1 
ATOM   1691  C  C6    . G   A  1  88   ? 40.496  165.575 42.645  1.00 59.75  ? 88   G   0 C6    1 
ATOM   1692  O  O6    . G   A  1  88   ? 41.055  164.979 41.711  1.00 60.10  ? 88   G   0 O6    1 
ATOM   1693  N  N1    . G   A  1  88   ? 41.097  166.693 43.214  1.00 59.39  ? 88   G   0 N1    1 
ATOM   1694  C  C2    . G   A  1  88   ? 40.578  167.427 44.255  1.00 59.16  ? 88   G   0 C2    1 
ATOM   1695  N  N2    . G   A  1  88   ? 41.293  168.485 44.657  1.00 57.72  ? 88   G   0 N2    1 
ATOM   1696  N  N3    . G   A  1  88   ? 39.435  167.147 44.855  1.00 58.78  ? 88   G   0 N3    1 
ATOM   1697  C  C4    . G   A  1  88   ? 38.833  166.069 44.317  1.00 60.42  ? 88   G   0 C4    1 
ATOM   1698  P  P     . G   A  1  89   ? 32.913  167.969 43.911  1.00 75.12  ? 89   G   0 P     1 
ATOM   1699  O  OP1   . G   A  1  89   ? 31.597  168.514 44.340  1.00 74.43  ? 89   G   0 OP1   1 
ATOM   1700  O  OP2   . G   A  1  89   ? 33.023  167.236 42.619  1.00 74.60  ? 89   G   0 OP2   1 
ATOM   1701  O  "O5'" . G   A  1  89   ? 33.963  169.167 43.886  1.00 71.40  ? 89   G   0 "O5'" 1 
ATOM   1702  C  "C5'" . G   A  1  89   ? 33.955  170.176 44.911  1.00 68.68  ? 89   G   0 "C5'" 1 
ATOM   1703  C  "C4'" . G   A  1  89   ? 35.158  171.077 44.765  1.00 66.56  ? 89   G   0 "C4'" 1 
ATOM   1704  O  "O4'" . G   A  1  89   ? 36.368  170.283 44.887  1.00 65.59  ? 89   G   0 "O4'" 1 
ATOM   1705  C  "C3'" . G   A  1  89   ? 35.317  171.754 43.416  1.00 65.50  ? 89   G   0 "C3'" 1 
ATOM   1706  O  "O3'" . G   A  1  89   ? 34.505  172.909 43.295  1.00 66.33  ? 89   G   0 "O3'" 1 
ATOM   1707  C  "C2'" . G   A  1  89   ? 36.804  172.077 43.391  1.00 63.91  ? 89   G   0 "C2'" 1 
ATOM   1708  O  "O2'" . G   A  1  89   ? 37.151  173.212 44.161  1.00 62.52  ? 89   G   0 "O2'" 1 
ATOM   1709  C  "C1'" . G   A  1  89   ? 37.378  170.823 44.048  1.00 62.35  ? 89   G   0 "C1'" 1 
ATOM   1710  N  N9    . G   A  1  89   ? 37.772  169.808 43.075  1.00 58.96  ? 89   G   0 N9    1 
ATOM   1711  C  C8    . G   A  1  89   ? 37.064  168.693 42.684  1.00 56.98  ? 89   G   0 C8    1 
ATOM   1712  N  N7    . G   A  1  89   ? 37.701  167.967 41.805  1.00 55.97  ? 89   G   0 N7    1 
ATOM   1713  C  C5    . G   A  1  89   ? 38.897  168.644 41.603  1.00 54.65  ? 89   G   0 C5    1 
ATOM   1714  C  C6    . G   A  1  89   ? 39.999  168.334 40.772  1.00 53.94  ? 89   G   0 C6    1 
ATOM   1715  O  O6    . G   A  1  89   ? 40.150  167.367 40.024  1.00 54.17  ? 89   G   0 O6    1 
ATOM   1716  N  N1    . G   A  1  89   ? 40.998  169.293 40.870  1.00 54.96  ? 89   G   0 N1    1 
ATOM   1717  C  C2    . G   A  1  89   ? 40.947  170.411 41.665  1.00 55.15  ? 89   G   0 C2    1 
ATOM   1718  N  N2    . G   A  1  89   ? 42.005  171.233 41.606  1.00 53.13  ? 89   G   0 N2    1 
ATOM   1719  N  N3    . G   A  1  89   ? 39.932  170.705 42.453  1.00 55.31  ? 89   G   0 N3    1 
ATOM   1720  C  C4    . G   A  1  89   ? 38.949  169.785 42.373  1.00 55.80  ? 89   G   0 C4    1 
ATOM   1721  P  P     . A   A  1  90   ? 33.861  173.277 41.872  1.00 67.14  ? 90   A   0 P     1 
ATOM   1722  O  OP1   . A   A  1  90   ? 32.957  174.432 42.125  1.00 67.58  ? 90   A   0 OP1   1 
ATOM   1723  O  OP2   . A   A  1  90   ? 33.317  172.032 41.257  1.00 66.15  ? 90   A   0 OP2   1 
ATOM   1724  O  "O5'" . A   A  1  90   ? 35.096  173.773 40.989  1.00 66.14  ? 90   A   0 "O5'" 1 
ATOM   1725  C  "C5'" . A   A  1  90   ? 35.768  175.010 41.295  1.00 66.28  ? 90   A   0 "C5'" 1 
ATOM   1726  C  "C4'" . A   A  1  90   ? 37.073  175.118 40.535  1.00 66.43  ? 90   A   0 "C4'" 1 
ATOM   1727  O  "O4'" . A   A  1  90   ? 37.941  174.002 40.880  1.00 66.31  ? 90   A   0 "O4'" 1 
ATOM   1728  C  "C3'" . A   A  1  90   ? 37.007  175.048 39.019  1.00 66.21  ? 90   A   0 "C3'" 1 
ATOM   1729  O  "O3'" . A   A  1  90   ? 36.612  176.281 38.431  1.00 67.06  ? 90   A   0 "O3'" 1 
ATOM   1730  C  "C2'" . A   A  1  90   ? 38.447  174.699 38.669  1.00 65.33  ? 90   A   0 "C2'" 1 
ATOM   1731  O  "O2'" . A   A  1  90   ? 39.312  175.811 38.761  1.00 66.83  ? 90   A   0 "O2'" 1 
ATOM   1732  C  "C1'" . A   A  1  90   ? 38.790  173.702 39.779  1.00 63.91  ? 90   A   0 "C1'" 1 
ATOM   1733  N  N9    . A   A  1  90   ? 38.549  172.321 39.350  1.00 61.00  ? 90   A   0 N9    1 
ATOM   1734  C  C8    . A   A  1  90   ? 37.410  171.563 39.492  1.00 59.38  ? 90   A   0 C8    1 
ATOM   1735  N  N7    . A   A  1  90   ? 37.488  170.382 38.928  1.00 58.58  ? 90   A   0 N7    1 
ATOM   1736  C  C5    . A   A  1  90   ? 38.767  170.353 38.389  1.00 57.84  ? 90   A   0 C5    1 
ATOM   1737  C  C6    . A   A  1  90   ? 39.457  169.383 37.643  1.00 57.12  ? 90   A   0 C6    1 
ATOM   1738  N  N6    . A   A  1  90   ? 38.925  168.215 37.276  1.00 57.49  ? 90   A   0 N6    1 
ATOM   1739  N  N1    . A   A  1  90   ? 40.725  169.661 37.272  1.00 56.48  ? 90   A   0 N1    1 
ATOM   1740  C  C2    . A   A  1  90   ? 41.251  170.840 37.622  1.00 56.86  ? 90   A   0 C2    1 
ATOM   1741  N  N3    . A   A  1  90   ? 40.701  171.838 38.307  1.00 58.07  ? 90   A   0 N3    1 
ATOM   1742  C  C4    . A   A  1  90   ? 39.441  171.529 38.664  1.00 59.00  ? 90   A   0 C4    1 
ATOM   1743  P  P     . G   A  1  91   ? 35.803  176.276 37.038  1.00 68.81  ? 91   G   0 P     1 
ATOM   1744  O  OP1   . G   A  1  91   ? 35.638  177.700 36.640  1.00 68.73  ? 91   G   0 OP1   1 
ATOM   1745  O  OP2   . G   A  1  91   ? 34.600  175.409 37.194  1.00 66.67  ? 91   G   0 OP2   1 
ATOM   1746  O  "O5'" . G   A  1  91   ? 36.795  175.582 35.997  1.00 63.56  ? 91   G   0 "O5'" 1 
ATOM   1747  C  "C5'" . G   A  1  91   ? 38.015  176.233 35.603  1.00 58.57  ? 91   G   0 "C5'" 1 
ATOM   1748  C  "C4'" . G   A  1  91   ? 38.976  175.245 34.974  1.00 56.13  ? 91   G   0 "C4'" 1 
ATOM   1749  O  "O4'" . G   A  1  91   ? 39.097  174.083 35.843  1.00 53.36  ? 91   G   0 "O4'" 1 
ATOM   1750  C  "C3'" . G   A  1  91   ? 38.600  174.624 33.636  1.00 54.57  ? 91   G   0 "C3'" 1 
ATOM   1751  O  "O3'" . G   A  1  91   ? 38.839  175.477 32.515  1.00 55.71  ? 91   G   0 "O3'" 1 
ATOM   1752  C  "C2'" . G   A  1  91   ? 39.516  173.409 33.611  1.00 53.34  ? 91   G   0 "C2'" 1 
ATOM   1753  O  "O2'" . G   A  1  91   ? 40.861  173.743 33.321  1.00 53.95  ? 91   G   0 "O2'" 1 
ATOM   1754  C  "C1'" . G   A  1  91   ? 39.408  172.935 35.062  1.00 51.02  ? 91   G   0 "C1'" 1 
ATOM   1755  N  N9    . G   A  1  91   ? 38.338  171.946 35.205  1.00 45.85  ? 91   G   0 N9    1 
ATOM   1756  C  C8    . G   A  1  91   ? 37.093  172.122 35.762  1.00 43.67  ? 91   G   0 C8    1 
ATOM   1757  N  N7    . G   A  1  91   ? 36.340  171.058 35.678  1.00 42.15  ? 91   G   0 N7    1 
ATOM   1758  C  C5    . G   A  1  91   ? 37.139  170.119 35.040  1.00 42.16  ? 91   G   0 C5    1 
ATOM   1759  C  C6    . G   A  1  91   ? 36.864  168.776 34.659  1.00 42.12  ? 91   G   0 C6    1 
ATOM   1760  O  O6    . G   A  1  91   ? 35.818  168.126 34.810  1.00 43.03  ? 91   G   0 O6    1 
ATOM   1761  N  N1    . G   A  1  91   ? 37.959  168.188 34.039  1.00 39.21  ? 91   G   0 N1    1 
ATOM   1762  C  C2    . G   A  1  91   ? 39.160  168.804 33.812  1.00 39.64  ? 91   G   0 C2    1 
ATOM   1763  N  N2    . G   A  1  91   ? 40.088  168.067 33.200  1.00 39.45  ? 91   G   0 N2    1 
ATOM   1764  N  N3    . G   A  1  91   ? 39.430  170.049 34.157  1.00 40.39  ? 91   G   0 N3    1 
ATOM   1765  C  C4    . G   A  1  91   ? 38.381  170.645 34.759  1.00 42.87  ? 91   G   0 C4    1 
ATOM   1766  P  P     . G   A  1  92   ? 38.036  175.230 31.131  1.00 55.43  ? 92   G   0 P     1 
ATOM   1767  O  OP1   . G   A  1  92   ? 38.351  176.382 30.248  1.00 54.99  ? 92   G   0 OP1   1 
ATOM   1768  O  OP2   . G   A  1  92   ? 36.617  174.902 31.440  1.00 54.77  ? 92   G   0 OP2   1 
ATOM   1769  O  "O5'" . G   A  1  92   ? 38.693  173.924 30.495  1.00 52.30  ? 92   G   0 "O5'" 1 
ATOM   1770  C  "C5'" . G   A  1  92   ? 40.093  173.882 30.194  1.00 50.38  ? 92   G   0 "C5'" 1 
ATOM   1771  C  "C4'" . G   A  1  92   ? 40.541  172.463 29.934  1.00 48.83  ? 92   G   0 "C4'" 1 
ATOM   1772  O  "O4'" . G   A  1  92   ? 40.135  171.615 31.045  1.00 47.81  ? 92   G   0 "O4'" 1 
ATOM   1773  C  "C3'" . G   A  1  92   ? 39.957  171.743 28.729  1.00 47.21  ? 92   G   0 "C3'" 1 
ATOM   1774  O  "O3'" . G   A  1  92   ? 40.566  172.136 27.501  1.00 45.61  ? 92   G   0 "O3'" 1 
ATOM   1775  C  "C2'" . G   A  1  92   ? 40.255  170.291 29.085  1.00 45.82  ? 92   G   0 "C2'" 1 
ATOM   1776  O  "O2'" . G   A  1  92   ? 41.624  169.964 28.947  1.00 44.77  ? 92   G   0 "O2'" 1 
ATOM   1777  C  "C1'" . G   A  1  92   ? 39.925  170.288 30.576  1.00 45.81  ? 92   G   0 "C1'" 1 
ATOM   1778  N  N9    . G   A  1  92   ? 38.537  169.904 30.834  1.00 43.35  ? 92   G   0 N9    1 
ATOM   1779  C  C8    . G   A  1  92   ? 37.520  170.708 31.289  1.00 42.01  ? 92   G   0 C8    1 
ATOM   1780  N  N7    . G   A  1  92   ? 36.382  170.079 31.404  1.00 41.55  ? 92   G   0 N7    1 
ATOM   1781  C  C5    . G   A  1  92   ? 36.663  168.780 31.003  1.00 39.78  ? 92   G   0 C5    1 
ATOM   1782  C  C6    . G   A  1  92   ? 35.819  167.643 30.917  1.00 38.85  ? 92   G   0 C6    1 
ATOM   1783  O  O6    . G   A  1  92   ? 34.615  167.558 31.185  1.00 38.94  ? 92   G   0 O6    1 
ATOM   1784  N  N1    . G   A  1  92   ? 36.512  166.522 30.471  1.00 37.51  ? 92   G   0 N1    1 
ATOM   1785  C  C2    . G   A  1  92   ? 37.848  166.497 30.156  1.00 39.51  ? 92   G   0 C2    1 
ATOM   1786  N  N2    . G   A  1  92   ? 38.345  165.315 29.763  1.00 39.01  ? 92   G   0 N2    1 
ATOM   1787  N  N3    . G   A  1  92   ? 38.644  167.553 30.226  1.00 40.64  ? 92   G   0 N3    1 
ATOM   1788  C  C4    . G   A  1  92   ? 37.989  168.652 30.653  1.00 40.78  ? 92   G   0 C4    1 
ATOM   1789  P  P     . C   A  1  93   ? 39.751  171.972 26.119  1.00 47.19  ? 93   C   0 P     1 
ATOM   1790  O  OP1   . C   A  1  93   ? 40.535  172.662 25.058  1.00 45.09  ? 93   C   0 OP1   1 
ATOM   1791  O  OP2   . C   A  1  93   ? 38.322  172.339 26.335  1.00 44.93  ? 93   C   0 OP2   1 
ATOM   1792  O  "O5'" . C   A  1  93   ? 39.794  170.407 25.830  1.00 45.46  ? 93   C   0 "O5'" 1 
ATOM   1793  C  "C5'" . C   A  1  93   ? 41.047  169.716 25.704  1.00 45.11  ? 93   C   0 "C5'" 1 
ATOM   1794  C  "C4'" . C   A  1  93   ? 40.813  168.235 25.542  1.00 45.68  ? 93   C   0 "C4'" 1 
ATOM   1795  O  "O4'" . C   A  1  93   ? 40.214  167.694 26.753  1.00 47.01  ? 93   C   0 "O4'" 1 
ATOM   1796  C  "C3'" . C   A  1  93   ? 39.821  167.836 24.465  1.00 46.03  ? 93   C   0 "C3'" 1 
ATOM   1797  O  "O3'" . C   A  1  93   ? 40.361  167.874 23.155  1.00 45.55  ? 93   C   0 "O3'" 1 
ATOM   1798  C  "C2'" . C   A  1  93   ? 39.440  166.432 24.904  1.00 45.48  ? 93   C   0 "C2'" 1 
ATOM   1799  O  "O2'" . C   A  1  93   ? 40.444  165.476 24.612  1.00 45.83  ? 93   C   0 "O2'" 1 
ATOM   1800  C  "C1'" . C   A  1  93   ? 39.333  166.632 26.416  1.00 43.79  ? 93   C   0 "C1'" 1 
ATOM   1801  N  N1    . C   A  1  93   ? 37.962  167.003 26.817  1.00 41.84  ? 93   C   0 N1    1 
ATOM   1802  C  C2    . C   A  1  93   ? 36.974  166.011 26.817  1.00 41.57  ? 93   C   0 C2    1 
ATOM   1803  O  O2    . C   A  1  93   ? 37.279  164.858 26.479  1.00 41.89  ? 93   C   0 O2    1 
ATOM   1804  N  N3    . C   A  1  93   ? 35.712  166.331 27.181  1.00 40.79  ? 93   C   0 N3    1 
ATOM   1805  C  C4    . C   A  1  93   ? 35.416  167.581 27.533  1.00 40.70  ? 93   C   0 C4    1 
ATOM   1806  N  N4    . C   A  1  93   ? 34.155  167.844 27.888  1.00 41.73  ? 93   C   0 N4    1 
ATOM   1807  C  C5    . C   A  1  93   ? 36.398  168.615 27.540  1.00 40.90  ? 93   C   0 C5    1 
ATOM   1808  C  C6    . C   A  1  93   ? 37.648  168.285 27.179  1.00 41.87  ? 93   C   0 C6    1 
ATOM   1809  P  P     . G   A  1  94   ? 39.389  168.196 21.917  1.00 43.56  ? 94   G   0 P     1 
ATOM   1810  O  OP1   . G   A  1  94   ? 40.213  168.094 20.683  1.00 41.10  ? 94   G   0 OP1   1 
ATOM   1811  O  OP2   . G   A  1  94   ? 38.631  169.442 22.210  1.00 39.92  ? 94   G   0 OP2   1 
ATOM   1812  O  "O5'" . G   A  1  94   ? 38.355  166.987 21.914  1.00 44.57  ? 94   G   0 "O5'" 1 
ATOM   1813  C  "C5'" . G   A  1  94   ? 38.784  165.661 21.565  1.00 45.15  ? 94   G   0 "C5'" 1 
ATOM   1814  C  "C4'" . G   A  1  94   ? 37.610  164.719 21.567  1.00 45.46  ? 94   G   0 "C4'" 1 
ATOM   1815  O  "O4'" . G   A  1  94   ? 37.065  164.609 22.909  1.00 45.63  ? 94   G   0 "O4'" 1 
ATOM   1816  C  "C3'" . G   A  1  94   ? 36.408  165.167 20.758  1.00 45.75  ? 94   G   0 "C3'" 1 
ATOM   1817  O  "O3'" . G   A  1  94   ? 36.592  164.971 19.364  1.00 49.96  ? 94   G   0 "O3'" 1 
ATOM   1818  C  "C2'" . G   A  1  94   ? 35.309  164.296 21.348  1.00 43.49  ? 94   G   0 "C2'" 1 
ATOM   1819  O  "O2'" . G   A  1  94   ? 35.388  162.950 20.922  1.00 42.19  ? 94   G   0 "O2'" 1 
ATOM   1820  C  "C1'" . G   A  1  94   ? 35.667  164.358 22.831  1.00 43.57  ? 94   G   0 "C1'" 1 
ATOM   1821  N  N9    . G   A  1  94   ? 34.950  165.438 23.500  1.00 41.29  ? 94   G   0 N9    1 
ATOM   1822  C  C8    . G   A  1  94   ? 35.419  166.686 23.831  1.00 41.06  ? 94   G   0 C8    1 
ATOM   1823  N  N7    . G   A  1  94   ? 34.513  167.441 24.389  1.00 40.95  ? 94   G   0 N7    1 
ATOM   1824  C  C5    . G   A  1  94   ? 33.379  166.642 24.432  1.00 40.32  ? 94   G   0 C5    1 
ATOM   1825  C  C6    . G   A  1  94   ? 32.075  166.921 24.911  1.00 40.80  ? 94   G   0 C6    1 
ATOM   1826  O  O6    . G   A  1  94   ? 31.643  167.972 25.404  1.00 42.99  ? 94   G   0 O6    1 
ATOM   1827  N  N1    . G   A  1  94   ? 31.231  165.821 24.768  1.00 40.36  ? 94   G   0 N1    1 
ATOM   1828  C  C2    . G   A  1  94   ? 31.598  164.608 24.227  1.00 40.63  ? 94   G   0 C2    1 
ATOM   1829  N  N2    . G   A  1  94   ? 30.651  163.654 24.181  1.00 39.96  ? 94   G   0 N2    1 
ATOM   1830  N  N3    . G   A  1  94   ? 32.806  164.345 23.766  1.00 40.39  ? 94   G   0 N3    1 
ATOM   1831  C  C4    . G   A  1  94   ? 33.639  165.398 23.900  1.00 40.88  ? 94   G   0 C4    1 
ATOM   1832  P  P     . A   A  1  95   ? 36.329  166.192 18.349  1.00 49.90  ? 95   A   0 P     1 
ATOM   1833  O  OP1   . A   A  1  95   ? 37.650  166.716 17.939  1.00 51.11  ? 95   A   0 OP1   1 
ATOM   1834  O  OP2   . A   A  1  95   ? 35.324  167.114 18.943  1.00 49.85  ? 95   A   0 OP2   1 
ATOM   1835  O  "O5'" . A   A  1  95   ? 35.649  165.491 17.094  1.00 52.47  ? 95   A   0 "O5'" 1 
ATOM   1836  C  "C5'" . A   A  1  95   ? 34.468  164.678 17.250  1.00 53.17  ? 95   A   0 "C5'" 1 
ATOM   1837  C  "C4'" . A   A  1  95   ? 33.598  164.799 16.025  1.00 54.39  ? 95   A   0 "C4'" 1 
ATOM   1838  O  "O4'" . A   A  1  95   ? 32.507  163.844 16.099  1.00 53.41  ? 95   A   0 "O4'" 1 
ATOM   1839  C  "C3'" . A   A  1  95   ? 32.958  166.167 15.827  1.00 55.27  ? 95   A   0 "C3'" 1 
ATOM   1840  O  "O3'" . A   A  1  95   ? 32.846  166.440 14.434  1.00 58.71  ? 95   A   0 "O3'" 1 
ATOM   1841  C  "C2'" . A   A  1  95   ? 31.573  165.971 16.429  1.00 55.19  ? 95   A   0 "C2'" 1 
ATOM   1842  O  "O2'" . A   A  1  95   ? 30.620  166.876 15.901  1.00 55.15  ? 95   A   0 "O2'" 1 
ATOM   1843  C  "C1'" . A   A  1  95   ? 31.275  164.527 16.019  1.00 54.57  ? 95   A   0 "C1'" 1 
ATOM   1844  N  N9    . A   A  1  95   ? 30.306  163.836 16.872  1.00 55.25  ? 95   A   0 N9    1 
ATOM   1845  C  C8    . A   A  1  95   ? 29.127  163.254 16.471  1.00 55.14  ? 95   A   0 C8    1 
ATOM   1846  N  N7    . A   A  1  95   ? 28.434  162.730 17.451  1.00 54.19  ? 95   A   0 N7    1 
ATOM   1847  C  C5    . A   A  1  95   ? 29.208  162.974 18.576  1.00 55.33  ? 95   A   0 C5    1 
ATOM   1848  C  C6    . A   A  1  95   ? 29.014  162.682 19.938  1.00 54.87  ? 95   A   0 C6    1 
ATOM   1849  N  N6    . A   A  1  95   ? 27.940  162.050 20.412  1.00 55.14  ? 95   A   0 N6    1 
ATOM   1850  N  N1    . A   A  1  95   ? 29.973  163.070 20.806  1.00 55.45  ? 95   A   0 N1    1 
ATOM   1851  C  C2    . A   A  1  95   ? 31.053  163.705 20.327  1.00 55.25  ? 95   A   0 C2    1 
ATOM   1852  N  N3    . A   A  1  95   ? 31.349  164.038 19.070  1.00 54.85  ? 95   A   0 N3    1 
ATOM   1853  C  C4    . A   A  1  95   ? 30.372  163.644 18.234  1.00 55.50  ? 95   A   0 C4    1 
ATOM   1854  P  P     . A   A  1  96   ? 33.593  167.719 13.806  1.00 60.34  ? 96   A   0 P     1 
ATOM   1855  O  OP1   . A   A  1  96   ? 33.570  168.833 14.797  1.00 59.34  ? 96   A   0 OP1   1 
ATOM   1856  O  OP2   . A   A  1  96   ? 32.983  167.914 12.464  1.00 60.53  ? 96   A   0 OP2   1 
ATOM   1857  O  "O5'" . A   A  1  96   ? 35.106  167.245 13.617  1.00 58.16  ? 96   A   0 "O5'" 1 
ATOM   1858  C  "C5'" . A   A  1  96   ? 35.465  166.338 12.560  1.00 56.72  ? 96   A   0 "C5'" 1 
ATOM   1859  C  "C4'" . A   A  1  96   ? 36.925  165.959 12.656  1.00 57.66  ? 96   A   0 "C4'" 1 
ATOM   1860  O  "O4'" . A   A  1  96   ? 37.749  167.144 12.462  1.00 58.75  ? 96   A   0 "O4'" 1 
ATOM   1861  C  "C3'" . A   A  1  96   ? 37.385  165.336 13.974  1.00 58.35  ? 96   A   0 "C3'" 1 
ATOM   1862  O  "O3'" . A   A  1  96   ? 38.406  164.378 13.712  1.00 57.31  ? 96   A   0 "O3'" 1 
ATOM   1863  C  "C2'" . A   A  1  96   ? 38.024  166.519 14.691  1.00 59.65  ? 96   A   0 "C2'" 1 
ATOM   1864  O  "O2'" . A   A  1  96   ? 39.004  166.145 15.638  1.00 59.08  ? 96   A   0 "O2'" 1 
ATOM   1865  C  "C1'" . A   A  1  96   ? 38.683  167.232 13.515  1.00 60.71  ? 96   A   0 "C1'" 1 
ATOM   1866  N  N9    . A   A  1  96   ? 39.029  168.634 13.747  1.00 62.65  ? 96   A   0 N9    1 
ATOM   1867  C  C8    . A   A  1  96   ? 38.312  169.615 14.391  1.00 63.83  ? 96   A   0 C8    1 
ATOM   1868  N  N7    . A   A  1  96   ? 38.936  170.768 14.459  1.00 64.10  ? 96   A   0 N7    1 
ATOM   1869  C  C5    . A   A  1  96   ? 40.141  170.532 13.809  1.00 64.63  ? 96   A   0 C5    1 
ATOM   1870  C  C6    . A   A  1  96   ? 41.255  171.355 13.545  1.00 65.15  ? 96   A   0 C6    1 
ATOM   1871  N  N6    . A   A  1  96   ? 41.346  172.630 13.935  1.00 65.65  ? 96   A   0 N6    1 
ATOM   1872  N  N1    . A   A  1  96   ? 42.289  170.812 12.864  1.00 64.98  ? 96   A   0 N1    1 
ATOM   1873  C  C2    . A   A  1  96   ? 42.206  169.526 12.488  1.00 64.70  ? 96   A   0 C2    1 
ATOM   1874  N  N3    . A   A  1  96   ? 41.221  168.652 12.683  1.00 63.64  ? 96   A   0 N3    1 
ATOM   1875  C  C4    . A   A  1  96   ? 40.206  169.225 13.356  1.00 63.79  ? 96   A   0 C4    1 
ATOM   1876  P  P     . G   A  1  97   ? 38.051  162.815 13.699  1.00 55.66  ? 97   G   0 P     1 
ATOM   1877  O  OP1   . G   A  1  97   ? 39.296  162.049 13.974  1.00 55.66  ? 97   G   0 OP1   1 
ATOM   1878  O  OP2   . G   A  1  97   ? 37.290  162.545 12.457  1.00 56.39  ? 97   G   0 OP2   1 
ATOM   1879  O  "O5'" . G   A  1  97   ? 37.037  162.638 14.914  1.00 56.22  ? 97   G   0 "O5'" 1 
ATOM   1880  C  "C5'" . G   A  1  97   ? 37.469  162.770 16.281  1.00 52.80  ? 97   G   0 "C5'" 1 
ATOM   1881  C  "C4'" . G   A  1  97   ? 36.900  161.640 17.110  1.00 51.96  ? 97   G   0 "C4'" 1 
ATOM   1882  O  "O4'" . G   A  1  97   ? 35.447  161.695 17.052  1.00 50.51  ? 97   G   0 "O4'" 1 
ATOM   1883  C  "C3'" . G   A  1  97   ? 37.282  160.242 16.637  1.00 49.89  ? 97   G   0 "C3'" 1 
ATOM   1884  O  "O3'" . G   A  1  97   ? 37.339  159.364 17.752  1.00 48.45  ? 97   G   0 "O3'" 1 
ATOM   1885  C  "C2'" . G   A  1  97   ? 36.124  159.874 15.718  1.00 49.93  ? 97   G   0 "C2'" 1 
ATOM   1886  O  "O2'" . G   A  1  97   ? 35.939  158.480 15.569  1.00 49.64  ? 97   G   0 "O2'" 1 
ATOM   1887  C  "C1'" . G   A  1  97   ? 34.944  160.522 16.440  1.00 50.68  ? 97   G   0 "C1'" 1 
ATOM   1888  N  N9    . G   A  1  97   ? 33.873  160.919 15.530  1.00 53.98  ? 9