data_1YHQ
# 
_entry.id   1YHQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.387 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1YHQ         pdb_00001yhq 10.2210/pdb1yhq/pdb 
NDB   RR0112       ?            ?                   
RCSB  RCSB031524   ?            ?                   
WWPDB D_1000031524 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-04-26 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-10-20 
5 'Structure model' 1 4 2024-02-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
6 5 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2             
2 4 'Structure model' pdbx_struct_conn_angle 
3 4 'Structure model' struct_conn            
4 4 'Structure model' struct_ref_seq_dif     
5 4 'Structure model' struct_site            
6 5 'Structure model' chem_comp_atom         
7 5 'Structure model' chem_comp_bond         
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_database_2.pdbx_DOI'                
2  4 'Structure model' '_database_2.pdbx_database_accession' 
3  4 'Structure model' '_struct_conn.pdbx_dist_value'        
4  4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
5  4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'     
6  4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'     
7  4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'      
8  4 'Structure model' '_struct_conn.ptnr1_label_asym_id'    
9  4 'Structure model' '_struct_conn.ptnr1_label_atom_id'    
10 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'    
11 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'     
12 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'     
13 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'     
14 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'      
15 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'    
16 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'    
17 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'    
18 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'     
19 4 'Structure model' '_struct_ref_seq_dif.details'         
20 4 'Structure model' '_struct_site.pdbx_auth_asym_id'      
21 4 'Structure model' '_struct_site.pdbx_auth_comp_id'      
22 4 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1YHQ 
_pdbx_database_status.recvd_initial_deposition_date   2005-01-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1YI2 . unspecified 
PDB 1YIJ . unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tu, D.'       1 
'Blaha, G.'    2 
'Moore, P.B.'  3 
'Steitz, T.A.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            121 
_citation.page_first                257 
_citation.page_last                 270 
_citation.year                      2005 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15851032 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2005.02.005 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Tu, D.'       1 ? 
primary 'Blaha, G.'    2 ? 
primary 'Moore, P.B.'  3 ? 
primary 'Steitz, T.A.' 4 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat '23S Ribosomal RNA'                   946141.375 1    ? G2099A ? 'encoded by rrnA operon' 
2  polymer     nat '5S Ribosomal RNA'                    39303.402  1    ? ?      ? ?                        
3  polymer     nat '50S ribosomal protein L2P'           25354.688  1    ? ?      ? ?                        
4  polymer     nat '50S ribosomal protein L3P'           37396.395  1    ? ?      ? ?                        
5  polymer     nat '50S ribosomal protein L4E'           26442.098  1    ? ?      ? ?                        
6  polymer     nat '50S ribosomal protein L5P'           19551.693  1    ? ?      ? ?                        
7  polymer     nat '50S ribosomal protein L6P'           19961.719  1    ? ?      ? ?                        
8  polymer     nat '50S ribosomal protein L7AE'          12791.941  1    ? ?      ? ?                        
9  polymer     nat 'ACIDIC RIBOSOMAL PROTEIN P0 HOMOLOG' 37213.805  1    ? ?      ? ?                        
10 polymer     nat '50S RIBOSOMAL PROTEIN L10E'          19942.734  1    ? ?      ? ?                        
11 polymer     nat '50S RIBOSOMAL PROTEIN L11P'          17097.547  1    ? ?      ? ?                        
12 polymer     nat '50S ribosomal protein L13P'          16249.214  1    ? ?      ? ?                        
13 polymer     nat '50S ribosomal protein L14P'          14191.243  1    ? ?      ? ?                        
14 polymer     nat '50S ribosomal protein L15P'          18005.367  1    ? ?      ? ?                        
15 polymer     nat '50S Ribosomal Protein L15E'          22143.859  1    ? ?      ? ?                        
16 polymer     nat '50S ribosomal protein L18P'          20640.939  1    ? ?      ? ?                        
17 polymer     nat '50S ribosomal protein L18e'          12438.915  1    ? ?      ? ?                        
18 polymer     nat '50S ribosomal protein L19E'          16796.514  1    ? ?      ? ?                        
19 polymer     nat '50S ribosomal protein L21e'          10567.801  1    ? ?      ? ?                        
20 polymer     nat '50S ribosomal protein L22P'          16966.945  1    ? ?      ? ?                        
21 polymer     nat '50S ribosomal protein L23P'          9612.537   1    ? ?      ? ?                        
22 polymer     nat '50S ribosomal protein L24P'          13670.955  1    ? ?      ? ?                        
23 polymer     nat '50S ribosomal protein L24E'          7233.720   1    ? ?      ? ?                        
24 polymer     nat '50S ribosomal protein L29P'          7889.863   1    ? ?      ? ?                        
25 polymer     nat '50S ribosomal protein L30P'          17062.885  1    ? ?      ? ?                        
26 polymer     nat '50S ribosomal protein L31e'          10384.613  1    ? ?      ? ?                        
27 polymer     nat '50S ribosomal protein L32E'          26455.727  1    ? ?      ? ?                        
28 polymer     nat '50S ribosomal protein L37Ae'         9409.338   1    ? ?      ? ?                        
29 polymer     nat '50S ribosomal protein L37e'          6330.203   1    ? ?      ? ?                        
30 polymer     nat '50S ribosomal protein L39e'          6133.090   1    ? ?      ? ?                        
31 polymer     nat '50S ribosomal protein L44E'          10815.245  1    ? ?      ? ?                        
32 non-polymer syn AZITHROMYCIN                          748.984    1    ? ?      ? ?                        
33 non-polymer syn 'MAGNESIUM ION'                       24.305     93   ? ?      ? ?                        
34 non-polymer syn 'POTASSIUM ION'                       39.098     2    ? ?      ? ?                        
35 non-polymer syn 'SODIUM ION'                          22.990     75   ? ?      ? ?                        
36 non-polymer syn 'CHLORIDE ION'                        35.453     22   ? ?      ? ?                        
37 non-polymer syn 'STRONTIUM ION'                       87.620     108  ? ?      ? ?                        
38 non-polymer syn 'CADMIUM ION'                         112.411    5    ? ?      ? ?                        
39 water       nat water                                 18.015     7763 ? ?      ? ?                        
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  polyribonucleotide no yes 
;GUUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCUGUGGGGA
GCCGCACGGAGGCGAAGAACCACAGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGA
ACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAACGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCC
AAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUUCACGAAGUCUCUUGGAAUAG
AGCGUGAUACAGGGUGACAACCCCGUACUGAAGACCAGUACGCUGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCC
CUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGC
UGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUU
GACGAAUGACCGAGACGCGAGUCUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUG(1MA)AAAACGAG
CCAGGGAGUGUGUCUGUAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUG
CCCGAGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGA
AGCGUGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAA
GGCCCAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAG
AGCGACCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCUGUUUGACGCG
GGGAUUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUU
AAGUGUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGC
GUAACAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACU
CAUACUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGCAGGGGCGAGAGCUCCUGUGGACCGAUUAGUGACGAA
AAUCCUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUC
AGCUGAGGGUUAGCCGGUCCUAAGUCUCACCGCAACUCGACUGAGACGAAAUGGGAAACAGGUUAAUAUUCCUGUGCCAU
CAUGCAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCCGGGCAUUCGCCCGGUCGAACCGUCCAACUCCGUGGAAGCCGU
AAUGGCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUGAUGUCCG
UACCGAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAG
UUAGUCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUA
GUAACAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUC
GUACAAGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGU
AGCGGCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGU
CUGGAGACACCCAGGGGGAAGCAAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAG
CAUAGGUAGGAGUCGUUACAGAGGUACCCGCGCUAGCGGGCCACCCAGACAACAGUGAAAUACUACCCGUCGGUGACUGC
GACUCUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCG
CCCUAUGGUCAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUGACUUGACAGUGUUCUUCCCAAC
GAGGAACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACC
CUAGGGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCC
UGCCCGUGCAGAAGCGGGCAAGGGUGAGGU(OMU)(OMG)UUCGCCUAUUAAAGGAGGUCGUGAGCUGGG(UR3)U
(PSU)AGACCGUCGUGAGACAGGUCGGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACG
AGAGGAACUACGGUUGGUGGCCACUGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAA
GAGCUGAACGCAUCUAAGCUCGAAACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGA
CUCGGGGUGUGCGCGUCGAGGUAACGAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCA
;
;GUUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCUGUGGGGA
GCCGCACGGAGGCGAAGAACCACAGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGA
ACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAACGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCC
AAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUUCACGAAGUCUCUUGGAAUAG
AGCGUGAUACAGGGUGACAACCCCGUACUGAAGACCAGUACGCUGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCC
CUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGC
UGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUU
GACGAAUGACCGAGACGCGAGUCUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAG
GGAGUGUGUCUGUAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCG
AGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCG
UGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCC
CAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCG
ACCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCUGUUUGACGCGGGGA
UUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGU
GUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAA
CAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUA
CUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGCAGGGGCGAGAGCUCCUGUGGACCGAUUAGUGACGAAAAUC
CUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCU
GAGGGUUAGCCGGUCCUAAGUCUCACCGCAACUCGACUGAGACGAAAUGGGAAACAGGUUAAUAUUCCUGUGCCAUCAUG
CAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCCGGGCAUUCGCCCGGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUG
GCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUGAUGUCCGUACC
GAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAG
UCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAA
CAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUAC
AAGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCG
GCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGG
AGACACCCAGGGGGAAGCAAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUA
GGUAGGAGUCGUUACAGAGGUACCCGCGCUAGCGGGCCACCCAGACAACAGUGAAAUACUACCCGUCGGUGACUGCGACU
CUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCU
AUGGUCAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUGACUUGACAGUGUUCUUCCCAACGAGG
AACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAG
GGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCC
CGUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGU
CGGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCAC
UGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAA
ACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAA
CGAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCA
;
0 ? 
2  polyribonucleotide no no  
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCAGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAAUCCGGUUCGCCGCCACC
;
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCAGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAAUCCGGUUCGCCGCCACC
;
9 ? 
3  'polypeptide(L)'   no no  
;MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDE
LQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVV
AGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
;MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDE
LQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVV
AGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
A ? 
4  'polypeptide(L)'   no no  
;MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPM
RAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKP
DVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPND
QPRLDPEVRYVSNESNQG
;
;MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPM
RAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKP
DVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPND
QPRLDPEVRYVSNESNQG
;
B ? 
5  'polypeptide(L)'   no no  
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
C ? 
6  'polypeptide(L)'   no no  
;MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEM
AEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNP
ADAVAFIESTYDVEVSE
;
;MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEM
AEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNP
ADAVAFIESTYDVEVSE
;
D ? 
7  'polypeptide(L)'   no no  
;MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
WEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDV
RVFQDGVYITRKPNRGDA
;
;MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
WEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDV
RVFQDGVYITRKPNRGDA
;
E ? 
8  'polypeptide(L)'   no no  
;MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQ
QDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
;
;MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQ
QDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
;
F ? 
9  'polypeptide(L)'   no no  
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
G ? 
10 'polypeptide(L)'   no no  
;MSDKPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKEL
GEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKI
TPSCRIKVERGEELLIA
;
;MSDKPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKEL
GEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKI
TPSCRIKVERGEELLIA
;
H ? 
11 'polypeptide(L)'   no no  
;MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAG
FETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEA
QA
;
;MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAG
FETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEA
QA
;
I ? 
12 'polypeptide(L)'   no no  
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
J ? 
13 'polypeptide(L)'   no no  
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRLPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRLPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
K ? 
14 'polypeptide(L)'   no no  
;MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAAD
DVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDA
DADEE
;
;MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAAD
DVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDA
DADEE
;
L ? 
15 'polypeptide(L)'   no no  
;ARSAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAG
RRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVF
RGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG
;
;ARSAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAG
RRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVF
RGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG
;
M ? 
16 'polypeptide(L)'   no no  
;MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMP
SAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLY
SGDFDAADLPEHFDELRETLLDGDIEL
;
;MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMP
SAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLY
SGDFDAADLPEHFDELRETLLDGDIEL
;
N ? 
17 'polypeptide(L)'   no no  
;MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAV
DFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
;MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAV
DFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
O ? 
18 'polypeptide(L)'   no no  
;MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGS
RKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
;MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGS
RKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
P ? 
19 'polypeptide(L)'   no no  
;MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGG
KEKTIIVTAAHLRRQE
;
;MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGG
KEKTIIVTAAHLRRQE
;
Q ? 
20 'polypeptide(L)'   no no  
;MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGR
YPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
;MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGR
YPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
R ? 
21 'polypeptide(L)'   no no  
;MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVAS
RIGVF
;
;MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVAS
RIGVF
;
S ? 
22 'polypeptide(L)'   no no  
;MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTL
EKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
;MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTL
EKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
T ? 
23 'polypeptide(L)'   no no  PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA 
PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA U ? 
24 'polypeptide(L)'   no no  MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE 
MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE V ? 
25 'polypeptide(L)'   no no  
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
W ? 
26 'polypeptide(L)'   no no  
;MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEE
EGEAIVEAETAE
;
;MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEE
EGEAIVEAETAE
;
X ? 
27 'polypeptide(L)'   no no  
;MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAE
VEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKG
KGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVS
E
;
;MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAE
VEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKG
KGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVS
E
;
Y ? 
28 'polypeptide(L)'   no no  
;RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRSIRAALSE
DEE
;
;RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRSIRAALSE
DEE
;
Z ? 
29 'polypeptide(L)'   no no  MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 
MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 1 ? 
30 'polypeptide(L)'   no no  MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE 
2 ? 
31 'polypeptide(L)'   no no  
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
3 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
32 AZITHROMYCIN    ZIT 
33 'MAGNESIUM ION' MG  
34 'POTASSIUM ION' K   
35 'SODIUM ION'    NA  
36 'CHLORIDE ION'  CL  
37 'STRONTIUM ION' SR  
38 'CADMIUM ION'   CD  
39 water           HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    G   n 
1  2    U   n 
1  3    U   n 
1  4    G   n 
1  5    G   n 
1  6    C   n 
1  7    U   n 
1  8    A   n 
1  9    C   n 
1  10   U   n 
1  11   A   n 
1  12   U   n 
1  13   G   n 
1  14   C   n 
1  15   C   n 
1  16   A   n 
1  17   G   n 
1  18   C   n 
1  19   U   n 
1  20   G   n 
1  21   G   n 
1  22   U   n 
1  23   G   n 
1  24   G   n 
1  25   A   n 
1  26   U   n 
1  27   U   n 
1  28   G   n 
1  29   C   n 
1  30   U   n 
1  31   C   n 
1  32   G   n 
1  33   G   n 
1  34   C   n 
1  35   U   n 
1  36   C   n 
1  37   A   n 
1  38   G   n 
1  39   G   n 
1  40   C   n 
1  41   G   n 
1  42   C   n 
1  43   U   n 
1  44   G   n 
1  45   A   n 
1  46   U   n 
1  47   G   n 
1  48   A   n 
1  49   A   n 
1  50   G   n 
1  51   G   n 
1  52   A   n 
1  53   C   n 
1  54   G   n 
1  55   U   n 
1  56   G   n 
1  57   C   n 
1  58   C   n 
1  59   A   n 
1  60   A   n 
1  61   G   n 
1  62   C   n 
1  63   U   n 
1  64   G   n 
1  65   C   n 
1  66   G   n 
1  67   A   n 
1  68   U   n 
1  69   A   n 
1  70   A   n 
1  71   G   n 
1  72   C   n 
1  73   U   n 
1  74   G   n 
1  75   U   n 
1  76   G   n 
1  77   G   n 
1  78   G   n 
1  79   G   n 
1  80   A   n 
1  81   G   n 
1  82   C   n 
1  83   C   n 
1  84   G   n 
1  85   C   n 
1  86   A   n 
1  87   C   n 
1  88   G   n 
1  89   G   n 
1  90   A   n 
1  91   G   n 
1  92   G   n 
1  93   C   n 
1  94   G   n 
1  95   A   n 
1  96   A   n 
1  97   G   n 
1  98   A   n 
1  99   A   n 
1  100  C   n 
1  101  C   n 
1  102  A   n 
1  103  C   n 
1  104  A   n 
1  105  G   n 
1  106  A   n 
1  107  U   n 
1  108  U   n 
1  109  U   n 
1  110  C   n 
1  111  C   n 
1  112  G   n 
1  113  A   n 
1  114  A   n 
1  115  U   n 
1  116  G   n 
1  117  A   n 
1  118  G   n 
1  119  A   n 
1  120  A   n 
1  121  U   n 
1  122  C   n 
1  123  U   n 
1  124  C   n 
1  125  U   n 
1  126  C   n 
1  127  U   n 
1  128  A   n 
1  129  A   n 
1  130  C   n 
1  131  A   n 
1  132  A   n 
1  133  U   n 
1  134  U   n 
1  135  G   n 
1  136  C   n 
1  137  U   n 
1  138  U   n 
1  139  C   n 
1  140  G   n 
1  141  C   n 
1  142  G   n 
1  143  C   n 
1  144  A   n 
1  145  A   n 
1  146  U   n 
1  147  G   n 
1  148  A   n 
1  149  G   n 
1  150  G   n 
1  151  A   n 
1  152  A   n 
1  153  C   n 
1  154  C   n 
1  155  C   n 
1  156  C   n 
1  157  G   n 
1  158  A   n 
1  159  G   n 
1  160  A   n 
1  161  A   n 
1  162  C   n 
1  163  U   n 
1  164  G   n 
1  165  A   n 
1  166  A   n 
1  167  A   n 
1  168  C   n 
1  169  A   n 
1  170  U   n 
1  171  C   n 
1  172  U   n 
1  173  C   n 
1  174  A   n 
1  175  G   n 
1  176  U   n 
1  177  A   n 
1  178  U   n 
1  179  C   n 
1  180  G   n 
1  181  G   n 
1  182  G   n 
1  183  A   n 
1  184  G   n 
1  185  G   n 
1  186  A   n 
1  187  A   n 
1  188  C   n 
1  189  A   n 
1  190  G   n 
1  191  A   n 
1  192  A   n 
1  193  A   n 
1  194  A   n 
1  195  C   n 
1  196  G   n 
1  197  C   n 
1  198  A   n 
1  199  A   n 
1  200  C   n 
1  201  G   n 
1  202  U   n 
1  203  G   n 
1  204  A   n 
1  205  U   n 
1  206  G   n 
1  207  U   n 
1  208  C   n 
1  209  G   n 
1  210  U   n 
1  211  U   n 
1  212  A   n 
1  213  G   n 
1  214  U   n 
1  215  A   n 
1  216  A   n 
1  217  C   n 
1  218  C   n 
1  219  G   n 
1  220  C   n 
1  221  G   n 
1  222  A   n 
1  223  G   n 
1  224  U   n 
1  225  G   n 
1  226  A   n 
1  227  A   n 
1  228  C   n 
1  229  G   n 
1  230  C   n 
1  231  G   n 
1  232  A   n 
1  233  U   n 
1  234  A   n 
1  235  C   n 
1  236  A   n 
1  237  G   n 
1  238  C   n 
1  239  C   n 
1  240  C   n 
1  241  A   n 
1  242  A   n 
1  243  A   n 
1  244  C   n 
1  245  C   n 
1  246  G   n 
1  247  A   n 
1  248  A   n 
1  249  G   n 
1  250  C   n 
1  251  C   n 
1  252  C   n 
1  253  U   n 
1  254  C   n 
1  255  A   n 
1  256  C   n 
1  257  G   n 
1  258  G   n 
1  259  G   n 
1  260  C   n 
1  261  A   n 
1  262  A   n 
1  263  U   n 
1  264  G   n 
1  265  U   n 
1  266  G   n 
1  267  G   n 
1  268  U   n 
1  269  G   n 
1  270  U   n 
1  271  C   n 
1  272  A   n 
1  273  G   n 
1  274  G   n 
1  275  G   n 
1  276  C   n 
1  277  U   n 
1  278  A   n 
1  279  C   n 
1  280  C   n 
1  281  U   n 
1  282  C   n 
1  283  U   n 
1  284  C   n 
1  285  A   n 
1  286  U   n 
1  287  C   n 
1  288  A   n 
1  289  G   n 
1  290  C   n 
1  291  C   n 
1  292  G   n 
1  293  A   n 
1  294  C   n 
1  295  C   n 
1  296  G   n 
1  297  U   n 
1  298  C   n 
1  299  U   n 
1  300  U   n 
1  301  C   n 
1  302  A   n 
1  303  C   n 
1  304  G   n 
1  305  A   n 
1  306  A   n 
1  307  G   n 
1  308  U   n 
1  309  C   n 
1  310  U   n 
1  311  C   n 
1  312  U   n 
1  313  U   n 
1  314  G   n 
1  315  G   n 
1  316  A   n 
1  317  A   n 
1  318  U   n 
1  319  A   n 
1  320  G   n 
1  321  A   n 
1  322  G   n 
1  323  C   n 
1  324  G   n 
1  325  U   n 
1  326  G   n 
1  327  A   n 
1  328  U   n 
1  329  A   n 
1  330  C   n 
1  331  A   n 
1  332  G   n 
1  333  G   n 
1  334  G   n 
1  335  U   n 
1  336  G   n 
1  337  A   n 
1  338  C   n 
1  339  A   n 
1  340  A   n 
1  341  C   n 
1  342  C   n 
1  343  C   n 
1  344  C   n 
1  345  G   n 
1  346  U   n 
1  347  A   n 
1  348  C   n 
1  349  U   n 
1  350  G   n 
1  351  A   n 
1  352  A   n 
1  353  G   n 
1  354  A   n 
1  355  C   n 
1  356  C   n 
1  357  A   n 
1  358  G   n 
1  359  U   n 
1  360  A   n 
1  361  C   n 
1  362  G   n 
1  363  C   n 
1  364  U   n 
1  365  G   n 
1  366  U   n 
1  367  G   n 
1  368  C   n 
1  369  G   n 
1  370  G   n 
1  371  U   n 
1  372  A   n 
1  373  G   n 
1  374  U   n 
1  375  G   n 
1  376  C   n 
1  377  C   n 
1  378  A   n 
1  379  G   n 
1  380  A   n 
1  381  G   n 
1  382  U   n 
1  383  A   n 
1  384  G   n 
1  385  C   n 
1  386  G   n 
1  387  G   n 
1  388  G   n 
1  389  G   n 
1  390  G   n 
1  391  U   n 
1  392  U   n 
1  393  G   n 
1  394  G   n 
1  395  A   n 
1  396  U   n 
1  397  A   n 
1  398  U   n 
1  399  C   n 
1  400  C   n 
1  401  C   n 
1  402  U   n 
1  403  C   n 
1  404  G   n 
1  405  C   n 
1  406  G   n 
1  407  A   n 
1  408  A   n 
1  409  U   n 
1  410  A   n 
1  411  A   n 
1  412  C   n 
1  413  G   n 
1  414  C   n 
1  415  A   n 
1  416  G   n 
1  417  G   n 
1  418  C   n 
1  419  A   n 
1  420  U   n 
1  421  C   n 
1  422  G   n 
1  423  A   n 
1  424  C   n 
1  425  U   n 
1  426  G   n 
1  427  C   n 
1  428  G   n 
1  429  A   n 
1  430  A   n 
1  431  G   n 
1  432  G   n 
1  433  C   n 
1  434  U   n 
1  435  A   n 
1  436  A   n 
1  437  A   n 
1  438  C   n 
1  439  A   n 
1  440  C   n 
1  441  A   n 
1  442  A   n 
1  443  C   n 
1  444  C   n 
1  445  U   n 
1  446  G   n 
1  447  A   n 
1  448  G   n 
1  449  A   n 
1  450  C   n 
1  451  C   n 
1  452  G   n 
1  453  A   n 
1  454  U   n 
1  455  A   n 
1  456  G   n 
1  457  U   n 
1  458  G   n 
1  459  A   n 
1  460  A   n 
1  461  C   n 
1  462  A   n 
1  463  A   n 
1  464  G   n 
1  465  U   n 
1  466  A   n 
1  467  G   n 
1  468  U   n 
1  469  G   n 
1  470  U   n 
1  471  G   n 
1  472  A   n 
1  473  A   n 
1  474  C   n 
1  475  G   n 
1  476  A   n 
1  477  A   n 
1  478  C   n 
1  479  G   n 
1  480  C   n 
1  481  U   n 
1  482  G   n 
1  483  C   n 
1  484  A   n 
1  485  A   n 
1  486  A   n 
1  487  G   n 
1  488  U   n 
1  489  A   n 
1  490  C   n 
1  491  C   n 
1  492  C   n 
1  493  U   n 
1  494  C   n 
1  495  A   n 
1  496  G   n 
1  497  A   n 
1  498  A   n 
1  499  G   n 
1  500  G   n 
1  501  G   n 
1  502  A   n 
1  503  G   n 
1  504  G   n 
1  505  C   n 
1  506  G   n 
1  507  A   n 
1  508  A   n 
1  509  A   n 
1  510  U   n 
1  511  A   n 
1  512  G   n 
1  513  A   n 
1  514  G   n 
1  515  C   n 
1  516  A   n 
1  517  U   n 
1  518  G   n 
1  519  A   n 
1  520  A   n 
1  521  A   n 
1  522  U   n 
1  523  C   n 
1  524  A   n 
1  525  G   n 
1  526  U   n 
1  527  U   n 
1  528  G   n 
1  529  G   n 
1  530  C   n 
1  531  G   n 
1  532  A   n 
1  533  U   n 
1  534  C   n 
1  535  G   n 
1  536  A   n 
1  537  G   n 
1  538  C   n 
1  539  G   n 
1  540  A   n 
1  541  C   n 
1  542  A   n 
1  543  G   n 
1  544  G   n 
1  545  G   n 
1  546  C   n 
1  547  A   n 
1  548  U   n 
1  549  A   n 
1  550  C   n 
1  551  A   n 
1  552  A   n 
1  553  G   n 
1  554  G   n 
1  555  U   n 
1  556  C   n 
1  557  C   n 
1  558  C   n 
1  559  U   n 
1  560  U   n 
1  561  G   n 
1  562  A   n 
1  563  C   n 
1  564  G   n 
1  565  A   n 
1  566  A   n 
1  567  U   n 
1  568  G   n 
1  569  A   n 
1  570  C   n 
1  571  C   n 
1  572  G   n 
1  573  A   n 
1  574  G   n 
1  575  A   n 
1  576  C   n 
1  577  G   n 
1  578  C   n 
1  579  G   n 
1  580  A   n 
1  581  G   n 
1  582  U   n 
1  583  C   n 
1  584  U   n 
1  585  C   n 
1  586  C   n 
1  587  A   n 
1  588  G   n 
1  589  U   n 
1  590  A   n 
1  591  A   n 
1  592  G   n 
1  593  A   n 
1  594  C   n 
1  595  U   n 
1  596  C   n 
1  597  A   n 
1  598  C   n 
1  599  G   n 
1  600  G   n 
1  601  G   n 
1  602  A   n 
1  603  A   n 
1  604  G   n 
1  605  C   n 
1  606  C   n 
1  607  G   n 
1  608  A   n 
1  609  U   n 
1  610  G   n 
1  611  U   n 
1  612  U   n 
1  613  C   n 
1  614  U   n 
1  615  G   n 
1  616  U   n 
1  617  C   n 
1  618  G   n 
1  619  U   n 
1  620  A   n 
1  621  C   n 
1  622  G   n 
1  623  U   n 
1  624  U   n 
1  625  U   n 
1  626  U   n 
1  627  G   n 
1  628  1MA n 
1  629  A   n 
1  630  A   n 
1  631  A   n 
1  632  A   n 
1  633  C   n 
1  634  G   n 
1  635  A   n 
1  636  G   n 
1  637  C   n 
1  638  C   n 
1  639  A   n 
1  640  G   n 
1  641  G   n 
1  642  G   n 
1  643  A   n 
1  644  G   n 
1  645  U   n 
1  646  G   n 
1  647  U   n 
1  648  G   n 
1  649  U   n 
1  650  C   n 
1  651  U   n 
1  652  G   n 
1  653  U   n 
1  654  A   n 
1  655  U   n 
1  656  G   n 
1  657  G   n 
1  658  C   n 
1  659  A   n 
1  660  A   n 
1  661  G   n 
1  662  U   n 
1  663  C   n 
1  664  U   n 
1  665  A   n 
1  666  A   n 
1  667  C   n 
1  668  C   n 
1  669  G   n 
1  670  G   n 
1  671  A   n 
1  672  G   n 
1  673  U   n 
1  674  A   n 
1  675  U   n 
1  676  C   n 
1  677  C   n 
1  678  G   n 
1  679  G   n 
1  680  G   n 
1  681  G   n 
1  682  A   n 
1  683  G   n 
1  684  G   n 
1  685  C   n 
1  686  A   n 
1  687  C   n 
1  688  A   n 
1  689  G   n 
1  690  G   n 
1  691  G   n 
1  692  A   n 
1  693  A   n 
1  694  A   n 
1  695  C   n 
1  696  C   n 
1  697  G   n 
1  698  A   n 
1  699  C   n 
1  700  A   n 
1  701  U   n 
1  702  G   n 
1  703  G   n 
1  704  C   n 
1  705  C   n 
1  706  G   n 
1  707  C   n 
1  708  A   n 
1  709  G   n 
1  710  G   n 
1  711  G   n 
1  712  C   n 
1  713  U   n 
1  714  U   n 
1  715  U   n 
1  716  G   n 
1  717  C   n 
1  718  C   n 
1  719  C   n 
1  720  G   n 
1  721  A   n 
1  722  G   n 
1  723  G   n 
1  724  G   n 
1  725  C   n 
1  726  C   n 
1  727  G   n 
1  728  C   n 
1  729  C   n 
1  730  G   n 
1  731  U   n 
1  732  C   n 
1  733  U   n 
1  734  U   n 
1  735  C   n 
1  736  A   n 
1  737  A   n 
1  738  G   n 
1  739  G   n 
1  740  G   n 
1  741  C   n 
1  742  G   n 
1  743  G   n 
1  744  G   n 
1  745  G   n 
1  746  A   n 
1  747  G   n 
1  748  C   n 
1  749  C   n 
1  750  A   n 
1  751  U   n 
1  752  G   n 
1  753  U   n 
1  754  G   n 
1  755  G   n 
1  756  A   n 
1  757  C   n 
1  758  A   n 
1  759  C   n 
1  760  G   n 
1  761  A   n 
1  762  C   n 
1  763  C   n 
1  764  C   n 
1  765  G   n 
1  766  A   n 
1  767  A   n 
1  768  U   n 
1  769  C   n 
1  770  C   n 
1  771  G   n 
1  772  G   n 
1  773  A   n 
1  774  C   n 
1  775  G   n 
1  776  A   n 
1  777  U   n 
1  778  C   n 
1  779  U   n 
1  780  A   n 
1  781  C   n 
1  782  G   n 
1  783  C   n 
1  784  A   n 
1  785  U   n 
1  786  G   n 
1  787  G   n 
1  788  A   n 
1  789  C   n 
1  790  A   n 
1  791  A   n 
1  792  G   n 
1  793  A   n 
1  794  U   n 
1  795  G   n 
1  796  A   n 
1  797  A   n 
1  798  G   n 
1  799  C   n 
1  800  G   n 
1  801  U   n 
1  802  G   n 
1  803  C   n 
1  804  C   n 
1  805  G   n 
1  806  A   n 
1  807  A   n 
1  808  A   n 
1  809  G   n 
1  810  G   n 
1  811  C   n 
1  812  A   n 
1  813  C   n 
1  814  G   n 
1  815  U   n 
1  816  G   n 
1  817  G   n 
1  818  A   n 
1  819  A   n 
1  820  G   n 
1  821  U   n 
1  822  C   n 
1  823  U   n 
1  824  G   n 
1  825  U   n 
1  826  U   n 
1  827  A   n 
1  828  G   n 
1  829  A   n 
1  830  G   n 
1  831  U   n 
1  832  U   n 
1  833  G   n 
1  834  G   n 
1  835  U   n 
1  836  G   n 
1  837  U   n 
1  838  C   n 
1  839  C   n 
1  840  U   n 
1  841  A   n 
1  842  C   n 
1  843  A   n 
1  844  A   n 
1  845  U   n 
1  846  A   n 
1  847  C   n 
1  848  C   n 
1  849  C   n 
1  850  U   n 
1  851  C   n 
1  852  U   n 
1  853  C   n 
1  854  G   n 
1  855  U   n 
1  856  G   n 
1  857  A   n 
1  858  U   n 
1  859  C   n 
1  860  U   n 
1  861  A   n 
1  862  U   n 
1  863  G   n 
1  864  U   n 
1  865  G   n 
1  866  U   n 
1  867  A   n 
1  868  G   n 
1  869  G   n 
1  870  G   n 
1  871  G   n 
1  872  U   n 
1  873  G   n 
1  874  A   n 
1  875  A   n 
1  876  A   n 
1  877  G   n 
1  878  G   n 
1  879  C   n 
1  880  C   n 
1  881  C   n 
1  882  A   n 
1  883  U   n 
1  884  C   n 
1  885  G   n 
1  886  A   n 
1  887  G   n 
1  888  U   n 
1  889  C   n 
1  890  C   n 
1  891  G   n 
1  892  G   n 
1  893  C   n 
1  894  A   n 
1  895  A   n 
1  896  C   n 
1  897  A   n 
1  898  G   n 
1  899  C   n 
1  900  U   n 
1  901  G   n 
1  902  G   n 
1  903  U   n 
1  904  U   n 
1  905  C   n 
1  906  C   n 
1  907  A   n 
1  908  A   n 
1  909  U   n 
1  910  C   n 
1  911  G   n 
1  912  A   n 
1  913  A   n 
1  914  A   n 
1  915  C   n 
1  916  A   n 
1  917  U   n 
1  918  G   n 
1  919  U   n 
1  920  C   n 
1  921  G   n 
1  922  A   n 
1  923  A   n 
1  924  G   n 
1  925  C   n 
1  926  A   n 
1  927  U   n 
1  928  G   n 
1  929  A   n 
1  930  C   n 
1  931  C   n 
1  932  U   n 
1  933  C   n 
1  934  C   n 
1  935  G   n 
1  936  C   n 
1  937  C   n 
1  938  G   n 
1  939  A   n 
1  940  G   n 
1  941  G   n 
1  942  U   n 
1  943  A   n 
1  944  G   n 
1  945  U   n 
1  946  C   n 
1  947  U   n 
1  948  G   n 
1  949  U   n 
1  950  G   n 
1  951  A   n 
1  952  G   n 
1  953  G   n 
1  954  U   n 
1  955  A   n 
1  956  G   n 
1  957  A   n 
1  958  G   n 
1  959  C   n 
1  960  G   n 
1  961  A   n 
1  962  C   n 
1  963  C   n 
1  964  G   n 
1  965  A   n 
1  966  U   n 
1  967  U   n 
1  968  G   n 
1  969  G   n 
1  970  U   n 
1  971  G   n 
1  972  U   n 
1  973  G   n 
1  974  U   n 
1  975  C   n 
1  976  C   n 
1  977  G   n 
1  978  C   n 
1  979  C   n 
1  980  U   n 
1  981  C   n 
1  982  C   n 
1  983  G   n 
1  984  A   n 
1  985  G   n 
1  986  A   n 
1  987  G   n 
1  988  G   n 
1  989  A   n 
1  990  G   n 
1  991  U   n 
1  992  C   n 
1  993  G   n 
1  994  G   n 
1  995  C   n 
1  996  A   n 
1  997  C   n 
1  998  A   n 
1  999  C   n 
1  1000 C   n 
1  1001 U   n 
1  1002 G   n 
1  1003 U   n 
1  1004 C   n 
1  1005 A   n 
1  1006 A   n 
1  1007 A   n 
1  1008 C   n 
1  1009 U   n 
1  1010 C   n 
1  1011 C   n 
1  1012 A   n 
1  1013 A   n 
1  1014 A   n 
1  1015 C   n 
1  1016 U   n 
1  1017 U   n 
1  1018 A   n 
1  1019 C   n 
1  1020 A   n 
1  1021 G   n 
1  1022 A   n 
1  1023 C   n 
1  1024 G   n 
1  1025 C   n 
1  1026 U   n 
1  1027 G   n 
1  1028 U   n 
1  1029 U   n 
1  1030 U   n 
1  1031 G   n 
1  1032 A   n 
1  1033 C   n 
1  1034 G   n 
1  1035 C   n 
1  1036 G   n 
1  1037 G   n 
1  1038 G   n 
1  1039 G   n 
1  1040 A   n 
1  1041 U   n 
1  1042 U   n 
1  1043 C   n 
1  1044 C   n 
1  1045 G   n 
1  1046 G   n 
1  1047 U   n 
1  1048 G   n 
1  1049 C   n 
1  1050 G   n 
1  1051 C   n 
1  1052 G   n 
1  1053 G   n 
1  1054 G   n 
1  1055 G   n 
1  1056 U   n 
1  1057 A   n 
1  1058 A   n 
1  1059 G   n 
1  1060 C   n 
1  1061 C   n 
1  1062 U   n 
1  1063 G   n 
1  1064 U   n 
1  1065 G   n 
1  1066 U   n 
1  1067 A   n 
1  1068 C   n 
1  1069 C   n 
1  1070 A   n 
1  1071 G   n 
1  1072 G   n 
1  1073 A   n 
1  1074 G   n 
1  1075 G   n 
1  1076 G   n 
1  1077 G   n 
1  1078 A   n 
1  1079 A   n 
1  1080 C   n 
1  1081 A   n 
1  1082 A   n 
1  1083 C   n 
1  1084 C   n 
1  1085 C   n 
1  1086 A   n 
1  1087 G   n 
1  1088 A   n 
1  1089 G   n 
1  1090 A   n 
1  1091 U   n 
1  1092 A   n 
1  1093 G   n 
1  1094 G   n 
1  1095 U   n 
1  1096 U   n 
1  1097 A   n 
1  1098 A   n 
1  1099 G   n 
1  1100 G   n 
1  1101 U   n 
1  1102 C   n 
1  1103 C   n 
1  1104 C   n 
1  1105 C   n 
1  1106 A   n 
1  1107 A   n 
1  1108 G   n 
1  1109 U   n 
1  1110 G   n 
1  1111 U   n 
1  1112 G   n 
1  1113 G   n 
1  1114 A   n 
1  1115 U   n 
1  1116 U   n 
1  1117 A   n 
1  1118 A   n 
1  1119 G   n 
1  1120 U   n 
1  1121 G   n 
1  1122 U   n 
1  1123 A   n 
1  1124 A   n 
1  1125 U   n 
1  1126 C   n 
1  1127 C   n 
1  1128 U   n 
1  1129 C   n 
1  1130 U   n 
1  1131 G   n 
1  1132 A   n 
1  1133 A   n 
1  1134 G   n 
1  1135 G   n 
1  1136 U   n 
1  1137 G   n 
1  1138 G   n 
1  1139 U   n 
1  1140 C   n 
1  1141 U   n 
1  1142 C   n 
1  1143 G   n 
1  1144 A   n 
1  1145 G   n 
1  1146 C   n 
1  1147 C   n 
1  1148 C   n 
1  1149 U   n 
1  1150 A   n 
1  1151 G   n 
1  1152 A   n 
1  1153 C   n 
1  1154 A   n 
1  1155 G   n 
1  1156 C   n 
1  1157 C   n 
1  1158 G   n 
1  1159 G   n 
1  1160 G   n 
1  1161 A   n 
1  1162 G   n 
1  1163 G   n 
1  1164 U   n 
1  1165 G   n 
1  1166 A   n 
1  1167 G   n 
1  1168 C   n 
1  1169 U   n 
1  1170 U   n 
1  1171 A   n 
1  1172 G   n 
1  1173 A   n 
1  1174 A   n 
1  1175 G   n 
1  1176 C   n 
1  1177 A   n 
1  1178 G   n 
1  1179 C   n 
1  1180 U   n 
1  1181 A   n 
1  1182 C   n 
1  1183 C   n 
1  1184 C   n 
1  1185 U   n 
1  1186 C   n 
1  1187 U   n 
1  1188 A   n 
1  1189 A   n 
1  1190 G   n 
1  1191 A   n 
1  1192 A   n 
1  1193 A   n 
1  1194 A   n 
1  1195 G   n 
1  1196 C   n 
1  1197 G   n 
1  1198 U   n 
1  1199 A   n 
1  1200 A   n 
1  1201 C   n 
1  1202 A   n 
1  1203 G   n 
1  1204 C   n 
1  1205 U   n 
1  1206 U   n 
1  1207 A   n 
1  1208 C   n 
1  1209 C   n 
1  1210 G   n 
1  1211 G   n 
1  1212 C   n 
1  1213 C   n 
1  1214 G   n 
1  1215 A   n 
1  1216 G   n 
1  1217 G   n 
1  1218 U   n 
1  1219 U   n 
1  1220 U   n 
1  1221 G   n 
1  1222 A   n 
1  1223 G   n 
1  1224 G   n 
1  1225 C   n 
1  1226 G   n 
1  1227 C   n 
1  1228 C   n 
1  1229 C   n 
1  1230 A   n 
1  1231 A   n 
1  1232 A   n 
1  1233 A   n 
1  1234 U   n 
1  1235 G   n 
1  1236 A   n 
1  1237 U   n 
1  1238 C   n 
1  1239 G   n 
1  1240 G   n 
1  1241 G   n 
1  1242 A   n 
1  1243 C   n 
1  1244 U   n 
1  1245 C   n 
1  1246 A   n 
1  1247 A   n 
1  1248 A   n 
1  1249 U   n 
1  1250 C   n 
1  1251 C   n 
1  1252 A   n 
1  1253 C   n 
1  1254 C   n 
1  1255 A   n 
1  1256 C   n 
1  1257 C   n 
1  1258 G   n 
1  1259 A   n 
1  1260 G   n 
1  1261 A   n 
1  1262 C   n 
1  1263 C   n 
1  1264 U   n 
1  1265 G   n 
1  1266 U   n 
1  1267 C   n 
1  1268 C   n 
1  1269 G   n 
1  1270 U   n 
1  1271 A   n 
1  1272 C   n 
1  1273 C   n 
1  1274 A   n 
1  1275 C   n 
1  1276 U   n 
1  1277 C   n 
1  1278 A   n 
1  1279 U   n 
1  1280 A   n 
1  1281 C   n 
1  1282 U   n 
1  1283 G   n 
1  1284 G   n 
1  1285 U   n 
1  1286 A   n 
1  1287 A   n 
1  1288 U   n 
1  1289 C   n 
1  1290 G   n 
1  1291 A   n 
1  1292 G   n 
1  1293 U   n 
1  1294 A   n 
1  1295 G   n 
1  1296 A   n 
1  1297 U   n 
1  1298 U   n 
1  1299 G   n 
1  1300 G   n 
1  1301 C   n 
1  1302 G   n 
1  1303 C   n 
1  1304 U   n 
1  1305 C   n 
1  1306 U   n 
1  1307 A   n 
1  1308 A   n 
1  1309 U   n 
1  1310 U   n 
1  1311 G   n 
1  1312 G   n 
1  1313 A   n 
1  1314 U   n 
1  1315 G   n 
1  1316 G   n 
1  1317 A   n 
1  1318 A   n 
1  1319 G   n 
1  1320 C   n 
1  1321 A   n 
1  1322 G   n 
1  1323 G   n 
1  1324 G   n 
1  1325 G   n 
1  1326 C   n 
1  1327 G   n 
1  1328 A   n 
1  1329 G   n 
1  1330 A   n 
1  1331 G   n 
1  1332 C   n 
1  1333 U   n 
1  1334 C   n 
1  1335 C   n 
1  1336 U   n 
1  1337 G   n 
1  1338 U   n 
1  1339 G   n 
1  1340 G   n 
1  1341 A   n 
1  1342 C   n 
1  1343 C   n 
1  1344 G   n 
1  1345 A   n 
1  1346 U   n 
1  1347 U   n 
1  1348 A   n 
1  1349 G   n 
1  1350 U   n 
1  1351 G   n 
1  1352 A   n 
1  1353 C   n 
1  1354 G   n 
1  1355 A   n 
1  1356 A   n 
1  1357 A   n 
1  1358 A   n 
1  1359 U   n 
1  1360 C   n 
1  1361 C   n 
1  1362 U   n 
1  1363 G   n 
1  1364 G   n 
1  1365 C   n 
1  1366 C   n 
1  1367 A   n 
1  1368 U   n 
1  1369 A   n 
1  1370 G   n 
1  1371 U   n 
1  1372 A   n 
1  1373 G   n 
1  1374 C   n 
1  1375 A   n 
1  1376 G   n 
1  1377 C   n 
1  1378 G   n 
1  1379 A   n 
1  1380 U   n 
1  1381 A   n 
1  1382 G   n 
1  1383 U   n 
1  1384 C   n 
1  1385 G   n 
1  1386 G   n 
1  1387 G   n 
1  1388 U   n 
1  1389 G   n 
1  1390 A   n 
1  1391 G   n 
1  1392 A   n 
1  1393 A   n 
1  1394 C   n 
1  1395 C   n 
1  1396 C   n 
1  1397 C   n 
1  1398 G   n 
1  1399 A   n 
1  1400 C   n 
1  1401 G   n 
1  1402 G   n 
1  1403 C   n 
1  1404 C   n 
1  1405 U   n 
1  1406 A   n 
1  1407 A   n 
1  1408 U   n 
1  1409 G   n 
1  1410 G   n 
1  1411 A   n 
1  1412 U   n 
1  1413 A   n 
1  1414 A   n 
1  1415 G   n 
1  1416 G   n 
1  1417 G   n 
1  1418 U   n 
1  1419 U   n 
1  1420 C   n 
1  1421 C   n 
1  1422 U   n 
1  1423 C   n 
1  1424 A   n 
1  1425 G   n 
1  1426 C   n 
1  1427 A   n 
1  1428 C   n 
1  1429 U   n 
1  1430 G   n 
1  1431 C   n 
1  1432 U   n 
1  1433 G   n 
1  1434 A   n 
1  1435 U   n 
1  1436 C   n 
1  1437 A   n 
1  1438 G   n 
1  1439 C   n 
1  1440 U   n 
1  1441 G   n 
1  1442 A   n 
1  1443 G   n 
1  1444 G   n 
1  1445 G   n 
1  1446 U   n 
1  1447 U   n 
1  1448 A   n 
1  1449 G   n 
1  1450 C   n 
1  1451 C   n 
1  1452 G   n 
1  1453 G   n 
1  1454 U   n 
1  1455 C   n 
1  1456 C   n 
1  1457 U   n 
1  1458 A   n 
1  1459 A   n 
1  1460 G   n 
1  1461 U   n 
1  1462 C   n 
1  1463 U   n 
1  1464 C   n 
1  1465 A   n 
1  1466 C   n 
1  1467 C   n 
1  1468 G   n 
1  1469 C   n 
1  1470 A   n 
1  1471 A   n 
1  1472 C   n 
1  1473 U   n 
1  1474 C   n 
1  1475 G   n 
1  1476 A   n 
1  1477 C   n 
1  1478 U   n 
1  1479 G   n 
1  1480 A   n 
1  1481 G   n 
1  1482 A   n 
1  1483 C   n 
1  1484 G   n 
1  1485 A   n 
1  1486 A   n 
1  1487 A   n 
1  1488 U   n 
1  1489 G   n 
1  1490 G   n 
1  1491 G   n 
1  1492 A   n 
1  1493 A   n 
1  1494 A   n 
1  1495 C   n 
1  1496 A   n 
1  1497 G   n 
1  1498 G   n 
1  1499 U   n 
1  1500 U   n 
1  1501 A   n 
1  1502 A   n 
1  1503 U   n 
1  1504 A   n 
1  1505 U   n 
1  1506 U   n 
1  1507 C   n 
1  1508 C   n 
1  1509 U   n 
1  1510 G   n 
1  1511 U   n 
1  1512 G   n 
1  1513 C   n 
1  1514 C   n 
1  1515 A   n 
1  1516 U   n 
1  1517 C   n 
1  1518 A   n 
1  1519 U   n 
1  1520 G   n 
1  1521 C   n 
1  1522 A   n 
1  1523 G   n 
1  1524 U   n 
1  1525 G   n 
1  1526 A   n 
1  1527 A   n 
1  1528 A   n 
1  1529 G   n 
1  1530 U   n 
1  1531 U   n 
1  1532 G   n 
1  1533 A   n 
1  1534 C   n 
1  1535 G   n 
1  1536 C   n 
1  1537 C   n 
1  1538 C   n 
1  1539 U   n 
1  1540 G   n 
1  1541 G   n 
1  1542 G   n 
1  1543 G   n 
1  1544 U   n 
1  1545 C   n 
1  1546 G   n 
1  1547 A   n 
1  1548 U   n 
1  1549 C   n 
1  1550 A   n 
1  1551 C   n 
1  1552 G   n 
1  1553 C   n 
1  1554 C   n 
1  1555 G   n 
1  1556 G   n 
1  1557 G   n 
1  1558 C   n 
1  1559 A   n 
1  1560 U   n 
1  1561 U   n 
1  1562 C   n 
1  1563 G   n 
1  1564 C   n 
1  1565 C   n 
1  1566 C   n 
1  1567 G   n 
1  1568 G   n 
1  1569 U   n 
1  1570 C   n 
1  1571 G   n 
1  1572 A   n 
1  1573 A   n 
1  1574 C   n 
1  1575 C   n 
1  1576 G   n 
1  1577 U   n 
1  1578 C   n 
1  1579 C   n 
1  1580 A   n 
1  1581 A   n 
1  1582 C   n 
1  1583 U   n 
1  1584 C   n 
1  1585 C   n 
1  1586 G   n 
1  1587 U   n 
1  1588 G   n 
1  1589 G   n 
1  1590 A   n 
1  1591 A   n 
1  1592 G   n 
1  1593 C   n 
1  1594 C   n 
1  1595 G   n 
1  1596 U   n 
1  1597 A   n 
1  1598 A   n 
1  1599 U   n 
1  1600 G   n 
1  1601 G   n 
1  1602 C   n 
1  1603 A   n 
1  1604 G   n 
1  1605 G   n 
1  1606 A   n 
1  1607 A   n 
1  1608 G   n 
1  1609 C   n 
1  1610 G   n 
1  1611 G   n 
1  1612 A   n 
1  1613 C   n 
1  1614 G   n 
1  1615 A   n 
1  1616 A   n 
1  1617 C   n 
1  1618 G   n 
1  1619 G   n 
1  1620 C   n 
1  1621 G   n 
1  1622 G   n 
1  1623 C   n 
1  1624 A   n 
1  1625 U   n 
1  1626 A   n 
1  1627 G   n 
1  1628 G   n 
1  1629 G   n 
1  1630 A   n 
1  1631 A   n 
1  1632 A   n 
1  1633 C   n 
1  1634 G   n 
1  1635 U   n 
1  1636 G   n 
1  1637 A   n 
1  1638 U   n 
1  1639 U   n 
1  1640 C   n 
1  1641 A   n 
1  1642 A   n 
1  1643 C   n 
1  1644 C   n 
1  1645 U   n 
1  1646 G   n 
1  1647 G   n 
1  1648 G   n 
1  1649 G   n 
1  1650 C   n 
1  1651 C   n 
1  1652 C   n 
1  1653 A   n 
1  1654 U   n 
1  1655 G   n 
1  1656 A   n 
1  1657 A   n 
1  1658 A   n 
1  1659 A   n 
1  1660 G   n 
1  1661 A   n 
1  1662 C   n 
1  1663 G   n 
1  1664 A   n 
1  1665 G   n 
1  1666 C   n 
1  1667 A   n 
1  1668 U   n 
1  1669 G   n 
1  1670 A   n 
1  1671 U   n 
1  1672 G   n 
1  1673 U   n 
1  1674 C   n 
1  1675 C   n 
1  1676 G   n 
1  1677 U   n 
1  1678 A   n 
1  1679 C   n 
1  1680 C   n 
1  1681 G   n 
1  1682 A   n 
1  1683 G   n 
1  1684 A   n 
1  1685 A   n 
1  1686 C   n 
1  1687 C   n 
1  1688 G   n 
1  1689 A   n 
1  1690 C   n 
1  1691 A   n 
1  1692 C   n 
1  1693 A   n 
1  1694 G   n 
1  1695 G   n 
1  1696 U   n 
1  1697 G   n 
1  1698 U   n 
1  1699 C   n 
1  1700 C   n 
1  1701 A   n 
1  1702 U   n 
1  1703 G   n 
1  1704 G   n 
1  1705 C   n 
1  1706 G   n 
1  1707 G   n 
1  1708 C   n 
1  1709 G   n 
1  1710 A   n 
1  1711 A   n 
1  1712 A   n 
1  1713 G   n 
1  1714 C   n 
1  1715 C   n 
1  1716 A   n 
1  1717 A   n 
1  1718 G   n 
1  1719 G   n 
1  1720 C   n 
1  1721 C   n 
1  1722 U   n 
1  1723 G   n 
1  1724 U   n 
1  1725 C   n 
1  1726 G   n 
1  1727 G   n 
1  1728 G   n 
1  1729 A   n 
1  1730 G   n 
1  1731 C   n 
1  1732 A   n 
1  1733 A   n 
1  1734 C   n 
1  1735 C   n 
1  1736 A   n 
1  1737 A   n 
1  1738 C   n 
1  1739 G   n 
1  1740 U   n 
1  1741 U   n 
1  1742 A   n 
1  1743 G   n 
1  1744 G   n 
1  1745 G   n 
1  1746 A   n 
1  1747 A   n 
1  1748 U   n 
1  1749 U   n 
1  1750 C   n 
1  1751 G   n 
1  1752 G   n 
1  1753 C   n 
1  1754 A   n 
1  1755 A   n 
1  1756 G   n 
1  1757 U   n 
1  1758 U   n 
1  1759 A   n 
1  1760 G   n 
1  1761 U   n 
1  1762 C   n 
1  1763 C   n 
1  1764 C   n 
1  1765 G   n 
1  1766 U   n 
1  1767 A   n 
1  1768 C   n 
1  1769 C   n 
1  1770 U   n 
1  1771 U   n 
1  1772 C   n 
1  1773 G   n 
1  1774 G   n 
1  1775 A   n 
1  1776 A   n 
1  1777 G   n 
1  1778 A   n 
1  1779 A   n 
1  1780 G   n 
1  1781 G   n 
1  1782 G   n 
1  1783 A   n 
1  1784 U   n 
1  1785 G   n 
1  1786 C   n 
1  1787 C   n 
1  1788 U   n 
1  1789 G   n 
1  1790 C   n 
1  1791 U   n 
1  1792 C   n 
1  1793 C   n 
1  1794 G   n 
1  1795 G   n 
1  1796 A   n 
1  1797 A   n 
1  1798 C   n 
1  1799 G   n 
1  1800 G   n 
1  1801 A   n 
1  1802 G   n 
1  1803 C   n 
1  1804 A   n 
1  1805 G   n 
1  1806 G   n 
1  1807 U   n 
1  1808 C   n 
1  1809 G   n 
1  1810 C   n 
1  1811 A   n 
1  1812 G   n 
1  1813 U   n 
1  1814 G   n 
1  1815 A   n 
1  1816 C   n 
1  1817 U   n 
1  1818 C   n 
1  1819 G   n 
1  1820 G   n 
1  1821 A   n 
1  1822 A   n 
1  1823 G   n 
1  1824 C   n 
1  1825 U   n 
1  1826 C   n 
1  1827 G   n 
1  1828 G   n 
1  1829 A   n 
1  1830 C   n 
1  1831 U   n 
1  1832 G   n 
1  1833 U   n 
1  1834 C   n 
1  1835 U   n 
1  1836 A   n 
1  1837 G   n 
1  1838 U   n 
1  1839 A   n 
1  1840 A   n 
1  1841 C   n 
1  1842 A   n 
1  1843 A   n 
1  1844 C   n 
1  1845 A   n 
1  1846 U   n 
1  1847 A   n 
1  1848 G   n 
1  1849 G   n 
1  1850 U   n 
1  1851 G   n 
1  1852 A   n 
1  1853 C   n 
1  1854 C   n 
1  1855 G   n 
1  1856 C   n 
1  1857 A   n 
1  1858 A   n 
1  1859 A   n 
1  1860 U   n 
1  1861 C   n 
1  1862 C   n 
1  1863 G   n 
1  1864 C   n 
1  1865 A   n 
1  1866 A   n 
1  1867 G   n 
1  1868 G   n 
1  1869 A   n 
1  1870 C   n 
1  1871 U   n 
1  1872 C   n 
1  1873 G   n 
1  1874 U   n 
1  1875 A   n 
1  1876 C   n 
1  1877 G   n 
1  1878 G   n 
1  1879 U   n 
1  1880 C   n 
1  1881 A   n 
1  1882 C   n 
1  1883 U   n 
1  1884 G   n 
1  1885 A   n 
1  1886 A   n 
1  1887 U   n 
1  1888 C   n 
1  1889 C   n 
1  1890 U   n 
1  1891 G   n 
1  1892 C   n 
1  1893 C   n 
1  1894 C   n 
1  1895 A   n 
1  1896 G   n 
1  1897 U   n 
1  1898 G   n 
1  1899 C   n 
1  1900 A   n 
1  1901 G   n 
1  1902 G   n 
1  1903 U   n 
1  1904 A   n 
1  1905 U   n 
1  1906 C   n 
1  1907 U   n 
1  1908 G   n 
1  1909 A   n 
1  1910 A   n 
1  1911 C   n 
1  1912 A   n 
1  1913 C   n 
1  1914 C   n 
1  1915 U   n 
1  1916 C   n 
1  1917 G   n 
1  1918 U   n 
1  1919 A   n 
1  1920 C   n 
1  1921 A   n 
1  1922 A   n 
1  1923 G   n 
1  1924 A   n 
1  1925 G   n 
1  1926 G   n 
1  1927 A   n 
1  1928 C   n 
1  1929 G   n 
1  1930 A   n 
1  1931 A   n 
1  1932 G   n 
1  1933 G   n 
1  1934 A   n 
1  1935 C   n 
1  1936 C   n 
1  1937 U   n 
1  1938 G   n 
1  1939 U   n 
1  1940 C   n 
1  1941 A   n 
1  1942 A   n 
1  1943 C   n 
1  1944 G   n 
1  1945 G   n 
1  1946 C   n 
1  1947 G   n 
1  1948 G   n 
1  1949 G   n 
1  1950 G   n 
1  1951 G   n 
1  1952 U   n 
1  1953 A   n 
1  1954 A   n 
1  1955 C   n 
1  1956 U   n 
1  1957 A   n 
1  1958 U   n 
1  1959 G   n 
1  1960 A   n 
1  1961 C   n 
1  1962 C   n 
1  1963 C   n 
1  1964 U   n 
1  1965 C   n 
1  1966 U   n 
1  1967 U   n 
1  1968 A   n 
1  1969 A   n 
1  1970 G   n 
1  1971 G   n 
1  1972 U   n 
1  1973 A   n 
1  1974 G   n 
1  1975 C   n 
1  1976 G   n 
1  1977 U   n 
1  1978 A   n 
1  1979 G   n 
1  1980 U   n 
1  1981 A   n 
1  1982 C   n 
1  1983 C   n 
1  1984 U   n 
1  1985 U   n 
1  1986 G   n 
1  1987 C   n 
1  1988 C   n 
1  1989 G   n 
1  1990 C   n 
1  1991 A   n 
1  1992 U   n 
1  1993 C   n 
1  1994 A   n 
1  1995 G   n 
1  1996 U   n 
1  1997 A   n 
1  1998 G   n 
1  1999 C   n 
1  2000 G   n 
1  2001 G   n 
1  2002 C   n 
1  2003 U   n 
1  2004 U   n 
1  2005 G   n 
1  2006 C   n 
1  2007 A   n 
1  2008 U   n 
1  2009 G   n 
1  2010 A   n 
1  2011 A   n 
1  2012 U   n 
1  2013 G   n 
1  2014 G   n 
1  2015 A   n 
1  2016 U   n 
1  2017 U   n 
1  2018 A   n 
1  2019 A   n 
1  2020 C   n 
1  2021 C   n 
1  2022 A   n 
1  2023 G   n 
1  2024 A   n 
1  2025 G   n 
1  2026 C   n 
1  2027 U   n 
1  2028 U   n 
1  2029 C   n 
1  2030 A   n 
1  2031 C   n 
1  2032 U   n 
1  2033 G   n 
1  2034 U   n 
1  2035 C   n 
1  2036 C   n 
1  2037 C   n 
1  2038 A   n 
1  2039 A   n 
1  2040 C   n 
1  2041 G   n 
1  2042 U   n 
1  2043 U   n 
1  2044 G   n 
1  2045 G   n 
1  2046 G   n 
1  2047 C   n 
1  2048 C   n 
1  2049 C   n 
1  2050 G   n 
1  2051 G   n 
1  2052 U   n 
1  2053 G   n 
1  2054 A   n 
1  2055 A   n 
1  2056 C   n 
1  2057 U   n 
1  2058 G   n 
1  2059 U   n 
1  2060 A   n 
1  2061 C   n 
1  2062 A   n 
1  2063 U   n 
1  2064 U   n 
1  2065 C   n 
1  2066 C   n 
1  2067 A   n 
1  2068 G   n 
1  2069 U   n 
1  2070 G   n 
1  2071 C   n 
1  2072 G   n 
1  2073 G   n 
1  2074 A   n 
1  2075 G   n 
1  2076 U   n 
1  2077 C   n 
1  2078 U   n 
1  2079 G   n 
1  2080 G   n 
1  2081 A   n 
1  2082 G   n 
1  2083 A   n 
1  2084 C   n 
1  2085 A   n 
1  2086 C   n 
1  2087 C   n 
1  2088 C   n 
1  2089 A   n 
1  2090 G   n 
1  2091 G   n 
1  2092 G   n 
1  2093 G   n 
1  2094 G   n 
1  2095 A   n 
1  2096 A   n 
1  2097 G   n 
1  2098 C   n 
1  2099 A   n 
1  2100 A   n 
1  2101 A   n 
1  2102 G   n 
1  2103 A   n 
1  2104 C   n 
1  2105 C   n 
1  2106 C   n 
1  2107 U   n 
1  2108 A   n 
1  2109 U   n 
1  2110 G   n 
1  2111 G   n 
1  2112 A   n 
1  2113 G   n 
1  2114 C   n 
1  2115 U   n 
1  2116 U   n 
1  2117 U   n 
1  2118 A   n 
1  2119 C   n 
1  2120 U   n 
1  2121 G   n 
1  2122 C   n 
1  2123 A   n 
1  2124 G   n 
1  2125 G   n 
1  2126 C   n 
1  2127 U   n 
1  2128 G   n 
1  2129 U   n 
1  2130 C   n 
1  2131 G   n 
1  2132 C   n 
1  2133 U   n 
1  2134 G   n 
1  2135 A   n 
1  2136 G   n 
1  2137 A   n 
1  2138 C   n 
1  2139 G   n 
1  2140 U   n 
1  2141 G   n 
1  2142 G   n 
1  2143 U   n 
1  2144 C   n 
1  2145 G   n 
1  2146 C   n 
1  2147 C   n 
1  2148 G   n 
1  2149 A   n 
1  2150 U   n 
1  2151 G   n 
1  2152 U   n 
1  2153 G   n 
1  2154 C   n 
1  2155 A   n 
1  2156 G   n 
1  2157 C   n 
1  2158 A   n 
1  2159 U   n 
1  2160 A   n 
1  2161 G   n 
1  2162 G   n 
1  2163 U   n 
1  2164 A   n 
1  2165 G   n 
1  2166 G   n 
1  2167 A   n 
1  2168 G   n 
1  2169 U   n 
1  2170 C   n 
1  2171 G   n 
1  2172 U   n 
1  2173 U   n 
1  2174 A   n 
1  2175 C   n 
1  2176 A   n 
1  2177 G   n 
1  2178 A   n 
1  2179 G   n 
1  2180 G   n 
1  2181 U   n 
1  2182 A   n 
1  2183 C   n 
1  2184 C   n 
1  2185 C   n 
1  2186 G   n 
1  2187 C   n 
1  2188 G   n 
1  2189 C   n 
1  2190 U   n 
1  2191 A   n 
1  2192 G   n 
1  2193 C   n 
1  2194 G   n 
1  2195 G   n 
1  2196 G   n 
1  2197 C   n 
1  2198 C   n 
1  2199 A   n 
1  2200 C   n 
1  2201 C   n 
1  2202 C   n 
1  2203 A   n 
1  2204 G   n 
1  2205 A   n 
1  2206 C   n 
1  2207 A   n 
1  2208 A   n 
1  2209 C   n 
1  2210 A   n 
1  2211 G   n 
1  2212 U   n 
1  2213 G   n 
1  2214 A   n 
1  2215 A   n 
1  2216 A   n 
1  2217 U   n 
1  2218 A   n 
1  2219 C   n 
1  2220 U   n 
1  2221 A   n 
1  2222 C   n 
1  2223 C   n 
1  2224 C   n 
1  2225 G   n 
1  2226 U   n 
1  2227 C   n 
1  2228 G   n 
1  2229 G   n 
1  2230 U   n 
1  2231 G   n 
1  2232 A   n 
1  2233 C   n 
1  2234 U   n 
1  2235 G   n 
1  2236 C   n 
1  2237 G   n 
1  2238 A   n 
1  2239 C   n 
1  2240 U   n 
1  2241 C   n 
1  2242 U   n 
1  2243 C   n 
1  2244 A   n 
1  2245 C   n 
1  2246 U   n 
1  2247 C   n 
1  2248 C   n 
1  2249 G   n 
1  2250 G   n 
1  2251 G   n 
1  2252 A   n 
1  2253 G   n 
1  2254 G   n 
1  2255 A   n 
1  2256 G   n 
1  2257 G   n 
1  2258 A   n 
1  2259 C   n 
1  2260 A   n 
1  2261 C   n 
1  2262 C   n 
1  2263 G   n 
1  2264 A   n 
1  2265 U   n 
1  2266 A   n 
1  2267 G   n 
1  2268 C   n 
1  2269 C   n 
1  2270 G   n 
1  2271 G   n 
1  2272 G   n 
1  2273 C   n 
1  2274 A   n 
1  2275 G   n 
1  2276 U   n 
1  2277 U   n 
1  2278 U   n 
1  2279 G   n 
1  2280 A   n 
1  2281 C   n 
1  2282 U   n 
1  2283 G   n 
1  2284 G   n 
1  2285 G   n 
1  2286 G   n 
1  2287 C   n 
1  2288 G   n 
1  2289 G   n 
1  2290 U   n 
1  2291 A   n 
1  2292 C   n 
1  2293 G   n 
1  2294 C   n 
1  2295 G   n 
1  2296 C   n 
1  2297 U   n 
1  2298 C   n 
1  2299 G   n 
1  2300 A   n 
1  2301 A   n 
1  2302 A   n 
1  2303 A   n 
1  2304 G   n 
1  2305 A   n 
1  2306 U   n 
1  2307 A   n 
1  2308 U   n 
1  2309 C   n 
1  2310 G   n 
1  2311 A   n 
1  2312 G   n 
1  2313 C   n 
1  2314 G   n 
1  2315 C   n 
1  2316 G   n 
1  2317 C   n 
1  2318 C   n 
1  2319 C   n 
1  2320 U   n 
1  2321 A   n 
1  2322 U   n 
1  2323 G   n 
1  2324 G   n 
1  2325 U   n 
1  2326 C   n 
1  2327 A   n 
1  2328 U   n 
1  2329 C   n 
1  2330 U   n 
1  2331 C   n 
1  2332 A   n 
1  2333 G   n 
1  2334 C   n 
1  2335 C   n 
1  2336 G   n 
1  2337 G   n 
1  2338 G   n 
1  2339 A   n 
1  2340 C   n 
1  2341 A   n 
1  2342 G   n 
1  2343 A   n 
1  2344 G   n 
1  2345 A   n 
1  2346 C   n 
1  2347 C   n 
1  2348 C   n 
1  2349 G   n 
1  2350 G   n 
1  2351 C   n 
1  2352 G   n 
1  2353 A   n 
1  2354 A   n 
1  2355 G   n 
1  2356 A   n 
1  2357 G   n 
1  2358 U   n 
1  2359 G   n 
1  2360 C   n 
1  2361 A   n 
1  2362 A   n 
1  2363 G   n 
1  2364 A   n 
1  2365 G   n 
1  2366 C   n 
1  2367 A   n 
1  2368 A   n 
1  2369 A   n 
1  2370 A   n 
1  2371 G   n 
1  2372 A   n 
1  2373 U   n 
1  2374 G   n 
1  2375 A   n 
1  2376 C   n 
1  2377 U   n 
1  2378 U   n 
1  2379 G   n 
1  2380 A   n 
1  2381 C   n 
1  2382 A   n 
1  2383 G   n 
1  2384 U   n 
1  2385 G   n 
1  2386 U   n 
1  2387 U   n 
1  2388 C   n 
1  2389 U   n 
1  2390 U   n 
1  2391 C   n 
1  2392 C   n 
1  2393 C   n 
1  2394 A   n 
1  2395 A   n 
1  2396 C   n 
1  2397 G   n 
1  2398 A   n 
1  2399 G   n 
1  2400 G   n 
1  2401 A   n 
1  2402 A   n 
1  2403 C   n 
1  2404 G   n 
1  2405 C   n 
1  2406 U   n 
1  2407 G   n 
1  2408 A   n 
1  2409 C   n 
1  2410 G   n 
1  2411 C   n 
1  2412 G   n 
1  2413 A   n 
1  2414 A   n 
1  2415 A   n 
1  2416 G   n 
1  2417 C   n 
1  2418 G   n 
1  2419 U   n 
1  2420 G   n 
1  2421 G   n 
1  2422 U   n 
1  2423 C   n 
1  2424 U   n 
1  2425 A   n 
1  2426 G   n 
1  2427 C   n 
1  2428 G   n 
1  2429 A   n 
1  2430 A   n 
1  2431 C   n 
1  2432 C   n 
1  2433 A   n 
1  2434 A   n 
1  2435 U   n 
1  2436 U   n 
1  2437 A   n 
1  2438 G   n 
1  2439 C   n 
1  2440 C   n 
1  2441 U   n 
1  2442 G   n 
1  2443 C   n 
1  2444 U   n 
1  2445 U   n 
1  2446 G   n 
1  2447 A   n 
1  2448 U   n 
1  2449 G   n 
1  2450 C   n 
1  2451 G   n 
1  2452 G   n 
1  2453 G   n 
1  2454 C   n 
1  2455 A   n 
1  2456 A   n 
1  2457 U   n 
1  2458 U   n 
1  2459 G   n 
1  2460 A   n 
1  2461 U   n 
1  2462 G   n 
1  2463 A   n 
1  2464 C   n 
1  2465 A   n 
1  2466 G   n 
1  2467 A   n 
1  2468 A   n 
1  2469 A   n 
1  2470 A   n 
1  2471 G   n 
1  2472 C   n 
1  2473 U   n 
1  2474 A   n 
1  2475 C   n 
1  2476 C   n 
1  2477 C   n 
1  2478 U   n 
1  2479 A   n 
1  2480 G   n 
1  2481 G   n 
1  2482 G   n 
1  2483 A   n 
1  2484 U   n 
1  2485 A   n 
1  2486 A   n 
1  2487 C   n 
1  2488 A   n 
1  2489 G   n 
1  2490 A   n 
1  2491 G   n 
1  2492 U   n 
1  2493 C   n 
1  2494 G   n 
1  2495 U   n 
1  2496 C   n 
1  2497 A   n 
1  2498 C   n 
1  2499 U   n 
1  2500 C   n 
1  2501 G   n 
1  2502 C   n 
1  2503 A   n 
1  2504 A   n 
1  2505 G   n 
1  2506 A   n 
1  2507 G   n 
1  2508 C   n 
1  2509 A   n 
1  2510 C   n 
1  2511 A   n 
1  2512 U   n 
1  2513 A   n 
1  2514 U   n 
1  2515 C   n 
1  2516 G   n 
1  2517 A   n 
1  2518 C   n 
1  2519 C   n 
1  2520 G   n 
1  2521 A   n 
1  2522 G   n 
1  2523 U   n 
1  2524 G   n 
1  2525 G   n 
1  2526 C   n 
1  2527 U   n 
1  2528 U   n 
1  2529 G   n 
1  2530 C   n 
1  2531 U   n 
1  2532 A   n 
1  2533 C   n 
1  2534 C   n 
1  2535 U   n 
1  2536 C   n 
1  2537 G   n 
1  2538 A   n 
1  2539 U   n 
1  2540 G   n 
1  2541 U   n 
1  2542 C   n 
1  2543 G   n 
1  2544 G   n 
1  2545 U   n 
1  2546 U   n 
1  2547 C   n 
1  2548 C   n 
1  2549 C   n 
1  2550 U   n 
1  2551 C   n 
1  2552 C   n 
1  2553 A   n 
1  2554 U   n 
1  2555 C   n 
1  2556 C   n 
1  2557 U   n 
1  2558 G   n 
1  2559 C   n 
1  2560 C   n 
1  2561 C   n 
1  2562 G   n 
1  2563 U   n 
1  2564 G   n 
1  2565 C   n 
1  2566 A   n 
1  2567 G   n 
1  2568 A   n 
1  2569 A   n 
1  2570 G   n 
1  2571 C   n 
1  2572 G   n 
1  2573 G   n 
1  2574 G   n 
1  2575 C   n 
1  2576 A   n 
1  2577 A   n 
1  2578 G   n 
1  2579 G   n 
1  2580 G   n 
1  2581 U   n 
1  2582 G   n 
1  2583 A   n 
1  2584 G   n 
1  2585 G   n 
1  2586 U   n 
1  2587 OMU n 
1  2588 OMG n 
1  2589 U   n 
1  2590 U   n 
1  2591 C   n 
1  2592 G   n 
1  2593 C   n 
1  2594 C   n 
1  2595 U   n 
1  2596 A   n 
1  2597 U   n 
1  2598 U   n 
1  2599 A   n 
1  2600 A   n 
1  2601 A   n 
1  2602 G   n 
1  2603 G   n 
1  2604 A   n 
1  2605 G   n 
1  2606 G   n 
1  2607 U   n 
1  2608 C   n 
1  2609 G   n 
1  2610 U   n 
1  2611 G   n 
1  2612 A   n 
1  2613 G   n 
1  2614 C   n 
1  2615 U   n 
1  2616 G   n 
1  2617 G   n 
1  2618 G   n 
1  2619 UR3 n 
1  2620 U   n 
1  2621 PSU n 
1  2622 A   n 
1  2623 G   n 
1  2624 A   n 
1  2625 C   n 
1  2626 C   n 
1  2627 G   n 
1  2628 U   n 
1  2629 C   n 
1  2630 G   n 
1  2631 U   n 
1  2632 G   n 
1  2633 A   n 
1  2634 G   n 
1  2635 A   n 
1  2636 C   n 
1  2637 A   n 
1  2638 G   n 
1  2639 G   n 
1  2640 U   n 
1  2641 C   n 
1  2642 G   n 
1  2643 G   n 
1  2644 C   n 
1  2645 U   n 
1  2646 G   n 
1  2647 C   n 
1  2648 U   n 
1  2649 A   n 
1  2650 U   n 
1  2651 C   n 
1  2652 U   n 
1  2653 A   n 
1  2654 C   n 
1  2655 U   n 
1  2656 G   n 
1  2657 G   n 
1  2658 G   n 
1  2659 U   n 
1  2660 G   n 
1  2661 U   n 
1  2662 G   n 
1  2663 U   n 
1  2664 A   n 
1  2665 A   n 
1  2666 U   n 
1  2667 G   n 
1  2668 G   n 
1  2669 U   n 
1  2670 G   n 
1  2671 U   n 
1  2672 C   n 
1  2673 U   n 
1  2674 G   n 
1  2675 A   n 
1  2676 C   n 
1  2677 A   n 
1  2678 A   n 
1  2679 G   n 
1  2680 A   n 
1  2681 A   n 
1  2682 C   n 
1  2683 G   n 
1  2684 A   n 
1  2685 C   n 
1  2686 C   n 
1  2687 G   n 
1  2688 U   n 
1  2689 A   n 
1  2690 U   n 
1  2691 A   n 
1  2692 G   n 
1  2693 U   n 
1  2694 A   n 
1  2695 C   n 
1  2696 G   n 
1  2697 A   n 
1  2698 G   n 
1  2699 A   n 
1  2700 G   n 
1  2701 G   n 
1  2702 A   n 
1  2703 A   n 
1  2704 C   n 
1  2705 U   n 
1  2706 A   n 
1  2707 C   n 
1  2708 G   n 
1  2709 G   n 
1  2710 U   n 
1  2711 U   n 
1  2712 G   n 
1  2713 G   n 
1  2714 U   n 
1  2715 G   n 
1  2716 G   n 
1  2717 C   n 
1  2718 C   n 
1  2719 A   n 
1  2720 C   n 
1  2721 U   n 
1  2722 G   n 
1  2723 G   n 
1  2724 U   n 
1  2725 G   n 
1  2726 U   n 
1  2727 A   n 
1  2728 C   n 
1  2729 C   n 
1  2730 G   n 
1  2731 G   n 
1  2732 U   n 
1  2733 U   n 
1  2734 G   n 
1  2735 U   n 
1  2736 U   n 
1  2737 C   n 
1  2738 G   n 
1  2739 A   n 
1  2740 G   n 
1  2741 A   n 
1  2742 G   n 
1  2743 A   n 
1  2744 G   n 
1  2745 C   n 
1  2746 A   n 
1  2747 C   n 
1  2748 G   n 
1  2749 U   n 
1  2750 G   n 
1  2751 C   n 
1  2752 C   n 
1  2753 G   n 
1  2754 G   n 
1  2755 G   n 
1  2756 U   n 
1  2757 A   n 
1  2758 G   n 
1  2759 C   n 
1  2760 C   n 
1  2761 A   n 
1  2762 C   n 
1  2763 G   n 
1  2764 C   n 
1  2765 C   n 
1  2766 A   n 
1  2767 C   n 
1  2768 A   n 
1  2769 C   n 
1  2770 G   n 
1  2771 G   n 
1  2772 G   n 
1  2773 G   n 
1  2774 U   n 
1  2775 A   n 
1  2776 A   n 
1  2777 G   n 
1  2778 A   n 
1  2779 G   n 
1  2780 C   n 
1  2781 U   n 
1  2782 G   n 
1  2783 A   n 
1  2784 A   n 
1  2785 C   n 
1  2786 G   n 
1  2787 C   n 
1  2788 A   n 
1  2789 U   n 
1  2790 C   n 
1  2791 U   n 
1  2792 A   n 
1  2793 A   n 
1  2794 G   n 
1  2795 C   n 
1  2796 U   n 
1  2797 C   n 
1  2798 G   n 
1  2799 A   n 
1  2800 A   n 
1  2801 A   n 
1  2802 C   n 
1  2803 C   n 
1  2804 C   n 
1  2805 A   n 
1  2806 C   n 
1  2807 U   n 
1  2808 U   n 
1  2809 G   n 
1  2810 G   n 
1  2811 A   n 
1  2812 A   n 
1  2813 A   n 
1  2814 A   n 
1  2815 G   n 
1  2816 A   n 
1  2817 G   n 
1  2818 A   n 
1  2819 C   n 
1  2820 A   n 
1  2821 C   n 
1  2822 C   n 
1  2823 G   n 
1  2824 C   n 
1  2825 C   n 
1  2826 G   n 
1  2827 A   n 
1  2828 G   n 
1  2829 G   n 
1  2830 U   n 
1  2831 C   n 
1  2832 C   n 
1  2833 C   n 
1  2834 G   n 
1  2835 C   n 
1  2836 G   n 
1  2837 U   n 
1  2838 A   n 
1  2839 C   n 
1  2840 A   n 
1  2841 A   n 
1  2842 G   n 
1  2843 A   n 
1  2844 C   n 
1  2845 G   n 
1  2846 C   n 
1  2847 G   n 
1  2848 G   n 
1  2849 U   n 
1  2850 C   n 
1  2851 G   n 
1  2852 A   n 
1  2853 U   n 
1  2854 A   n 
1  2855 G   n 
1  2856 A   n 
1  2857 C   n 
1  2858 U   n 
1  2859 C   n 
1  2860 G   n 
1  2861 G   n 
1  2862 G   n 
1  2863 G   n 
1  2864 U   n 
1  2865 G   n 
1  2866 U   n 
1  2867 G   n 
1  2868 C   n 
1  2869 G   n 
1  2870 C   n 
1  2871 G   n 
1  2872 U   n 
1  2873 C   n 
1  2874 G   n 
1  2875 A   n 
1  2876 G   n 
1  2877 G   n 
1  2878 U   n 
1  2879 A   n 
1  2880 A   n 
1  2881 C   n 
1  2882 G   n 
1  2883 A   n 
1  2884 G   n 
1  2885 A   n 
1  2886 C   n 
1  2887 G   n 
1  2888 U   n 
1  2889 U   n 
1  2890 A   n 
1  2891 A   n 
1  2892 G   n 
1  2893 C   n 
1  2894 C   n 
1  2895 C   n 
1  2896 A   n 
1  2897 C   n 
1  2898 G   n 
1  2899 A   n 
1  2900 G   n 
1  2901 C   n 
1  2902 A   n 
1  2903 C   n 
1  2904 U   n 
1  2905 A   n 
1  2906 A   n 
1  2907 C   n 
1  2908 A   n 
1  2909 G   n 
1  2910 A   n 
1  2911 C   n 
1  2912 C   n 
1  2913 A   n 
1  2914 A   n 
1  2915 A   n 
1  2916 G   n 
1  2917 C   n 
1  2918 C   n 
1  2919 A   n 
1  2920 U   n 
1  2921 C   n 
1  2922 A   n 
2  1    U   n 
2  2    U   n 
2  3    A   n 
2  4    G   n 
2  5    G   n 
2  6    C   n 
2  7    G   n 
2  8    G   n 
2  9    C   n 
2  10   C   n 
2  11   A   n 
2  12   C   n 
2  13   A   n 
2  14   G   n 
2  15   C   n 
2  16   G   n 
2  17   G   n 
2  18   U   n 
2  19   G   n 
2  20   G   n 
2  21   G   n 
2  22   G   n 
2  23   U   n 
2  24   U   n 
2  25   G   n 
2  26   C   n 
2  27   C   n 
2  28   U   n 
2  29   C   n 
2  30   C   n 
2  31   C   n 
2  32   G   n 
2  33   U   n 
2  34   A   n 
2  35   C   n 
2  36   C   n 
2  37   C   n 
2  38   A   n 
2  39   U   n 
2  40   C   n 
2  41   C   n 
2  42   C   n 
2  43   G   n 
2  44   A   n 
2  45   A   n 
2  46   C   n 
2  47   A   n 
2  48   C   n 
2  49   G   n 
2  50   G   n 
2  51   A   n 
2  52   A   n 
2  53   G   n 
2  54   A   n 
2  55   U   n 
2  56   A   n 
2  57   A   n 
2  58   G   n 
2  59   C   n 
2  60   C   n 
2  61   C   n 
2  62   A   n 
2  63   C   n 
2  64   C   n 
2  65   A   n 
2  66   G   n 
2  67   C   n 
2  68   G   n 
2  69   U   n 
2  70   U   n 
2  71   C   n 
2  72   C   n 
2  73   A   n 
2  74   G   n 
2  75   G   n 
2  76   G   n 
2  77   A   n 
2  78   G   n 
2  79   U   n 
2  80   A   n 
2  81   C   n 
2  82   U   n 
2  83   G   n 
2  84   G   n 
2  85   A   n 
2  86   G   n 
2  87   U   n 
2  88   G   n 
2  89   C   n 
2  90   G   n 
2  91   C   n 
2  92   G   n 
2  93   A   n 
2  94   G   n 
2  95   C   n 
2  96   C   n 
2  97   U   n 
2  98   C   n 
2  99   U   n 
2  100  G   n 
2  101  G   n 
2  102  G   n 
2  103  A   n 
2  104  A   n 
2  105  A   n 
2  106  U   n 
2  107  C   n 
2  108  C   n 
2  109  G   n 
2  110  G   n 
2  111  U   n 
2  112  U   n 
2  113  C   n 
2  114  G   n 
2  115  C   n 
2  116  C   n 
2  117  G   n 
2  118  C   n 
2  119  C   n 
2  120  A   n 
2  121  C   n 
2  122  C   n 
3  1    MET n 
3  2    GLY n 
3  3    ARG n 
3  4    ARG n 
3  5    ILE n 
3  6    GLN n 
3  7    GLY n 
3  8    GLN n 
3  9    ARG n 
3  10   ARG n 
3  11   GLY n 
3  12   ARG n 
3  13   GLY n 
3  14   THR n 
3  15   SER n 
3  16   THR n 
3  17   PHE n 
3  18   ARG n 
3  19   ALA n 
3  20   PRO n 
3  21   SER n 
3  22   HIS n 
3  23   ARG n 
3  24   TYR n 
3  25   LYS n 
3  26   ALA n 
3  27   ASP n 
3  28   LEU n 
3  29   GLU n 
3  30   HIS n 
3  31   ARG n 
3  32   LYS n 
3  33   VAL n 
3  34   GLU n 
3  35   ASP n 
3  36   GLY n 
3  37   ASP n 
3  38   VAL n 
3  39   ILE n 
3  40   ALA n 
3  41   GLY n 
3  42   THR n 
3  43   VAL n 
3  44   VAL n 
3  45   ASP n 
3  46   ILE n 
3  47   GLU n 
3  48   HIS n 
3  49   ASP n 
3  50   PRO n 
3  51   ALA n 
3  52   ARG n 
3  53   SER n 
3  54   ALA n 
3  55   PRO n 
3  56   VAL n 
3  57   ALA n 
3  58   ALA n 
3  59   VAL n 
3  60   GLU n 
3  61   PHE n 
3  62   GLU n 
3  63   ASP n 
3  64   GLY n 
3  65   ASP n 
3  66   ARG n 
3  67   ARG n 
3  68   LEU n 
3  69   ILE n 
3  70   LEU n 
3  71   ALA n 
3  72   PRO n 
3  73   GLU n 
3  74   GLY n 
3  75   VAL n 
3  76   GLY n 
3  77   VAL n 
3  78   GLY n 
3  79   ASP n 
3  80   GLU n 
3  81   LEU n 
3  82   GLN n 
3  83   VAL n 
3  84   GLY n 
3  85   VAL n 
3  86   SER n 
3  87   ALA n 
3  88   GLU n 
3  89   ILE n 
3  90   ALA n 
3  91   PRO n 
3  92   GLY n 
3  93   ASN n 
3  94   THR n 
3  95   LEU n 
3  96   PRO n 
3  97   LEU n 
3  98   ALA n 
3  99   GLU n 
3  100  ILE n 
3  101  PRO n 
3  102  GLU n 
3  103  GLY n 
3  104  VAL n 
3  105  PRO n 
3  106  VAL n 
3  107  CYS n 
3  108  ASN n 
3  109  VAL n 
3  110  GLU n 
3  111  SER n 
3  112  SER n 
3  113  PRO n 
3  114  GLY n 
3  115  ASP n 
3  116  GLY n 
3  117  GLY n 
3  118  LYS n 
3  119  PHE n 
3  120  ALA n 
3  121  ARG n 
3  122  ALA n 
3  123  SER n 
3  124  GLY n 
3  125  VAL n 
3  126  ASN n 
3  127  ALA n 
3  128  GLN n 
3  129  LEU n 
3  130  LEU n 
3  131  THR n 
3  132  HIS n 
3  133  ASP n 
3  134  ARG n 
3  135  ASN n 
3  136  VAL n 
3  137  ALA n 
3  138  VAL n 
3  139  VAL n 
3  140  LYS n 
3  141  LEU n 
3  142  PRO n 
3  143  SER n 
3  144  GLY n 
3  145  GLU n 
3  146  MET n 
3  147  LYS n 
3  148  ARG n 
3  149  LEU n 
3  150  ASP n 
3  151  PRO n 
3  152  GLN n 
3  153  CYS n 
3  154  ARG n 
3  155  ALA n 
3  156  THR n 
3  157  ILE n 
3  158  GLY n 
3  159  VAL n 
3  160  VAL n 
3  161  ALA n 
3  162  GLY n 
3  163  GLY n 
3  164  GLY n 
3  165  ARG n 
3  166  THR n 
3  167  ASP n 
3  168  LYS n 
3  169  PRO n 
3  170  PHE n 
3  171  VAL n 
3  172  LYS n 
3  173  ALA n 
3  174  GLY n 
3  175  ASN n 
3  176  LYS n 
3  177  HIS n 
3  178  HIS n 
3  179  LYS n 
3  180  MET n 
3  181  LYS n 
3  182  ALA n 
3  183  ARG n 
3  184  GLY n 
3  185  THR n 
3  186  LYS n 
3  187  TRP n 
3  188  PRO n 
3  189  ASN n 
3  190  VAL n 
3  191  ARG n 
3  192  GLY n 
3  193  VAL n 
3  194  ALA n 
3  195  MET n 
3  196  ASN n 
3  197  ALA n 
3  198  VAL n 
3  199  ASP n 
3  200  HIS n 
3  201  PRO n 
3  202  PHE n 
3  203  GLY n 
3  204  GLY n 
3  205  GLY n 
3  206  GLY n 
3  207  ARG n 
3  208  GLN n 
3  209  HIS n 
3  210  PRO n 
3  211  GLY n 
3  212  LYS n 
3  213  PRO n 
3  214  LYS n 
3  215  SER n 
3  216  ILE n 
3  217  SER n 
3  218  ARG n 
3  219  ASN n 
3  220  ALA n 
3  221  PRO n 
3  222  PRO n 
3  223  GLY n 
3  224  ARG n 
3  225  LYS n 
3  226  VAL n 
3  227  GLY n 
3  228  ASP n 
3  229  ILE n 
3  230  ALA n 
3  231  SER n 
3  232  LYS n 
3  233  ARG n 
3  234  THR n 
3  235  GLY n 
3  236  ARG n 
3  237  GLY n 
3  238  GLY n 
3  239  ASN n 
3  240  GLU n 
4  1    MET n 
4  2    PRO n 
4  3    GLN n 
4  4    PRO n 
4  5    SER n 
4  6    ARG n 
4  7    PRO n 
4  8    ARG n 
4  9    LYS n 
4  10   GLY n 
4  11   SER n 
4  12   LEU n 
4  13   GLY n 
4  14   PHE n 
4  15   GLY n 
4  16   PRO n 
4  17   ARG n 
4  18   LYS n 
4  19   ARG n 
4  20   SER n 
4  21   THR n 
4  22   SER n 
4  23   GLU n 
4  24   THR n 
4  25   PRO n 
4  26   ARG n 
4  27   PHE n 
4  28   ASN n 
4  29   SER n 
4  30   TRP n 
4  31   PRO n 
4  32   SER n 
4  33   ASP n 
4  34   ASP n 
4  35   GLY n 
4  36   GLN n 
4  37   PRO n 
4  38   GLY n 
4  39   VAL n 
4  40   GLN n 
4  41   GLY n 
4  42   PHE n 
4  43   ALA n 
4  44   GLY n 
4  45   TYR n 
4  46   LYS n 
4  47   ALA n 
4  48   GLY n 
4  49   MET n 
4  50   THR n 
4  51   HIS n 
4  52   VAL n 
4  53   VAL n 
4  54   LEU n 
4  55   VAL n 
4  56   ASN n 
4  57   ASP n 
4  58   GLU n 
4  59   PRO n 
4  60   ASN n 
4  61   SER n 
4  62   PRO n 
4  63   ARG n 
4  64   GLU n 
4  65   GLY n 
4  66   MET n 
4  67   GLU n 
4  68   GLU n 
4  69   THR n 
4  70   VAL n 
4  71   PRO n 
4  72   VAL n 
4  73   THR n 
4  74   VAL n 
4  75   ILE n 
4  76   GLU n 
4  77   THR n 
4  78   PRO n 
4  79   PRO n 
4  80   MET n 
4  81   ARG n 
4  82   ALA n 
4  83   VAL n 
4  84   ALA n 
4  85   LEU n 
4  86   ARG n 
4  87   ALA n 
4  88   TYR n 
4  89   GLU n 
4  90   ASP n 
4  91   THR n 
4  92   PRO n 
4  93   TYR n 
4  94   GLY n 
4  95   GLN n 
4  96   ARG n 
4  97   PRO n 
4  98   LEU n 
4  99   THR n 
4  100  GLU n 
4  101  VAL n 
4  102  TRP n 
4  103  THR n 
4  104  ASP n 
4  105  GLU n 
4  106  PHE n 
4  107  HIS n 
4  108  SER n 
4  109  GLU n 
4  110  LEU n 
4  111  ASP n 
4  112  ARG n 
4  113  THR n 
4  114  LEU n 
4  115  ASP n 
4  116  VAL n 
4  117  PRO n 
4  118  GLU n 
4  119  ASP n 
4  120  HIS n 
4  121  ASP n 
4  122  PRO n 
4  123  ASP n 
4  124  ALA n 
4  125  ALA n 
4  126  GLU n 
4  127  GLU n 
4  128  GLN n 
4  129  ILE n 
4  130  ARG n 
4  131  ASP n 
4  132  ALA n 
4  133  HIS n 
4  134  GLU n 
4  135  ALA n 
4  136  GLY n 
4  137  ASP n 
4  138  LEU n 
4  139  GLY n 
4  140  ASP n 
4  141  LEU n 
4  142  ARG n 
4  143  LEU n 
4  144  ILE n 
4  145  THR n 
4  146  HIS n 
4  147  THR n 
4  148  VAL n 
4  149  PRO n 
4  150  ASP n 
4  151  ALA n 
4  152  VAL n 
4  153  PRO n 
4  154  SER n 
4  155  VAL n 
4  156  PRO n 
4  157  LYS n 
4  158  LYS n 
4  159  LYS n 
4  160  PRO n 
4  161  ASP n 
4  162  VAL n 
4  163  MET n 
4  164  GLU n 
4  165  THR n 
4  166  ARG n 
4  167  VAL n 
4  168  GLY n 
4  169  GLY n 
4  170  GLY n 
4  171  SER n 
4  172  VAL n 
4  173  SER n 
4  174  ASP n 
4  175  ARG n 
4  176  LEU n 
4  177  ASP n 
4  178  HIS n 
4  179  ALA n 
4  180  LEU n 
4  181  ASP n 
4  182  ILE n 
4  183  VAL n 
4  184  GLU n 
4  185  ASP n 
4  186  GLY n 
4  187  GLY n 
4  188  GLU n 
4  189  HIS n 
4  190  ALA n 
4  191  MET n 
4  192  ASN n 
4  193  ASP n 
4  194  ILE n 
4  195  PHE n 
4  196  ARG n 
4  197  ALA n 
4  198  GLY n 
4  199  GLU n 
4  200  TYR n 
4  201  ALA n 
4  202  ASP n 
4  203  VAL n 
4  204  ALA n 
4  205  GLY n 
4  206  VAL n 
4  207  THR n 
4  208  LYS n 
4  209  GLY n 
4  210  LYS n 
4  211  GLY n 
4  212  THR n 
4  213  GLN n 
4  214  GLY n 
4  215  PRO n 
4  216  VAL n 
4  217  LYS n 
4  218  ARG n 
4  219  TRP n 
4  220  GLY n 
4  221  VAL n 
4  222  GLN n 
4  223  LYS n 
4  224  ARG n 
4  225  LYS n 
4  226  GLY n 
4  227  LYS n 
4  228  HIS n 
4  229  ALA n 
4  230  ARG n 
4  231  GLN n 
4  232  GLY n 
4  233  TRP n 
4  234  ARG n 
4  235  ARG n 
4  236  ARG n 
4  237  ILE n 
4  238  GLY n 
4  239  ASN n 
4  240  LEU n 
4  241  GLY n 
4  242  PRO n 
4  243  TRP n 
4  244  ASN n 
4  245  PRO n 
4  246  SER n 
4  247  ARG n 
4  248  VAL n 
4  249  ARG n 
4  250  SER n 
4  251  THR n 
4  252  VAL n 
4  253  PRO n 
4  254  GLN n 
4  255  GLN n 
4  256  GLY n 
4  257  GLN n 
4  258  THR n 
4  259  GLY n 
4  260  TYR n 
4  261  HIS n 
4  262  GLN n 
4  263  ARG n 
4  264  THR n 
4  265  GLU n 
4  266  LEU n 
4  267  ASN n 
4  268  LYS n 
4  269  ARG n 
4  270  LEU n 
4  271  ILE n 
4  272  ASP n 
4  273  ILE n 
4  274  GLY n 
4  275  GLU n 
4  276  GLY n 
4  277  ASP n 
4  278  GLU n 
4  279  PRO n 
4  280  THR n 
4  281  VAL n 
4  282  ASP n 
4  283  GLY n 
4  284  GLY n 
4  285  PHE n 
4  286  VAL n 
4  287  ASN n 
4  288  TYR n 
4  289  GLY n 
4  290  GLU n 
4  291  VAL n 
4  292  ASP n 
4  293  GLY n 
4  294  PRO n 
4  295  TYR n 
4  296  THR n 
4  297  LEU n 
4  298  VAL n 
4  299  LYS n 
4  300  GLY n 
4  301  SER n 
4  302  VAL n 
4  303  PRO n 
4  304  GLY n 
4  305  PRO n 
4  306  ASP n 
4  307  LYS n 
4  308  ARG n 
4  309  LEU n 
4  310  VAL n 
4  311  ARG n 
4  312  PHE n 
4  313  ARG n 
4  314  PRO n 
4  315  ALA n 
4  316  VAL n 
4  317  ARG n 
4  318  PRO n 
4  319  ASN n 
4  320  ASP n 
4  321  GLN n 
4  322  PRO n 
4  323  ARG n 
4  324  LEU n 
4  325  ASP n 
4  326  PRO n 
4  327  GLU n 
4  328  VAL n 
4  329  ARG n 
4  330  TYR n 
4  331  VAL n 
4  332  SER n 
4  333  ASN n 
4  334  GLU n 
4  335  SER n 
4  336  ASN n 
4  337  GLN n 
4  338  GLY n 
5  1    MET n 
5  2    GLN n 
5  3    ALA n 
5  4    THR n 
5  5    ILE n 
5  6    TYR n 
5  7    ASP n 
5  8    LEU n 
5  9    ASP n 
5  10   GLY n 
5  11   ASN n 
5  12   THR n 
5  13   ASP n 
5  14   GLY n 
5  15   GLU n 
5  16   VAL n 
5  17   ASP n 
5  18   LEU n 
5  19   PRO n 
5  20   ASP n 
5  21   VAL n 
5  22   PHE n 
5  23   GLU n 
5  24   THR n 
5  25   PRO n 
5  26   VAL n 
5  27   ARG n 
5  28   SER n 
5  29   ASP n 
5  30   LEU n 
5  31   ILE n 
5  32   GLY n 
5  33   LYS n 
5  34   ALA n 
5  35   VAL n 
5  36   ARG n 
5  37   ALA n 
5  38   ALA n 
5  39   GLN n 
5  40   ALA n 
5  41   ASN n 
5  42   ARG n 
5  43   LYS n 
5  44   GLN n 
5  45   ASP n 
5  46   TYR n 
5  47   GLY n 
5  48   SER n 
5  49   ASP n 
5  50   GLU n 
5  51   TYR n 
5  52   ALA n 
5  53   GLY n 
5  54   LEU n 
5  55   ARG n 
5  56   THR n 
5  57   PRO n 
5  58   ALA n 
5  59   GLU n 
5  60   SER n 
5  61   PHE n 
5  62   GLY n 
5  63   SER n 
5  64   GLY n 
5  65   ARG n 
5  66   GLY n 
5  67   GLN n 
5  68   ALA n 
5  69   HIS n 
5  70   VAL n 
5  71   PRO n 
5  72   LYS n 
5  73   LEU n 
5  74   ASP n 
5  75   GLY n 
5  76   ARG n 
5  77   ALA n 
5  78   ARG n 
5  79   ARG n 
5  80   VAL n 
5  81   PRO n 
5  82   GLN n 
5  83   ALA n 
5  84   VAL n 
5  85   LYS n 
5  86   GLY n 
5  87   ARG n 
5  88   SER n 
5  89   ALA n 
5  90   HIS n 
5  91   PRO n 
5  92   PRO n 
5  93   LYS n 
5  94   THR n 
5  95   GLU n 
5  96   LYS n 
5  97   ASP n 
5  98   ARG n 
5  99   SER n 
5  100  LEU n 
5  101  ASP n 
5  102  LEU n 
5  103  ASN n 
5  104  ASP n 
5  105  LYS n 
5  106  GLU n 
5  107  ARG n 
5  108  GLN n 
5  109  LEU n 
5  110  ALA n 
5  111  VAL n 
5  112  ARG n 
5  113  SER n 
5  114  ALA n 
5  115  LEU n 
5  116  ALA n 
5  117  ALA n 
5  118  THR n 
5  119  ALA n 
5  120  ASP n 
5  121  ALA n 
5  122  ASP n 
5  123  LEU n 
5  124  VAL n 
5  125  ALA n 
5  126  ASP n 
5  127  ARG n 
5  128  GLY n 
5  129  HIS n 
5  130  GLU n 
5  131  PHE n 
5  132  ASP n 
5  133  ARG n 
5  134  ASP n 
5  135  GLU n 
5  136  VAL n 
5  137  PRO n 
5  138  VAL n 
5  139  VAL n 
5  140  VAL n 
5  141  SER n 
5  142  ASP n 
5  143  ASP n 
5  144  PHE n 
5  145  GLU n 
5  146  ASP n 
5  147  LEU n 
5  148  VAL n 
5  149  LYS n 
5  150  THR n 
5  151  GLN n 
5  152  GLU n 
5  153  VAL n 
5  154  VAL n 
5  155  SER n 
5  156  LEU n 
5  157  LEU n 
5  158  GLU n 
5  159  ALA n 
5  160  LEU n 
5  161  ASP n 
5  162  VAL n 
5  163  HIS n 
5  164  ALA n 
5  165  ASP n 
5  166  ILE n 
5  167  ASP n 
5  168  ARG n 
5  169  ALA n 
5  170  ASP n 
5  171  GLU n 
5  172  THR n 
5  173  LYS n 
5  174  ILE n 
5  175  LYS n 
5  176  ALA n 
5  177  GLY n 
5  178  GLN n 
5  179  GLY n 
5  180  SER n 
5  181  ALA n 
5  182  ARG n 
5  183  GLY n 
5  184  ARG n 
5  185  LYS n 
5  186  TYR n 
5  187  ARG n 
5  188  ARG n 
5  189  PRO n 
5  190  ALA n 
5  191  SER n 
5  192  ILE n 
5  193  LEU n 
5  194  PHE n 
5  195  VAL n 
5  196  THR n 
5  197  SER n 
5  198  ASP n 
5  199  GLU n 
5  200  PRO n 
5  201  SER n 
5  202  THR n 
5  203  ALA n 
5  204  ALA n 
5  205  ARG n 
5  206  ASN n 
5  207  LEU n 
5  208  ALA n 
5  209  GLY n 
5  210  ALA n 
5  211  ASP n 
5  212  VAL n 
5  213  ALA n 
5  214  THR n 
5  215  ALA n 
5  216  SER n 
5  217  GLU n 
5  218  VAL n 
5  219  ASN n 
5  220  THR n 
5  221  GLU n 
5  222  ASP n 
5  223  LEU n 
5  224  ALA n 
5  225  PRO n 
5  226  GLY n 
5  227  GLY n 
5  228  ALA n 
5  229  PRO n 
5  230  GLY n 
5  231  ARG n 
5  232  LEU n 
5  233  THR n 
5  234  VAL n 
5  235  PHE n 
5  236  THR n 
5  237  GLU n 
5  238  SER n 
5  239  ALA n 
5  240  LEU n 
5  241  ALA n 
5  242  GLU n 
5  243  VAL n 
5  244  ALA n 
5  245  GLU n 
5  246  ARG n 
6  1    MET n 
6  2    SER n 
6  3    SER n 
6  4    GLU n 
6  5    SER n 
6  6    GLU n 
6  7    SER n 
6  8    GLY n 
6  9    GLY n 
6  10   ASP n 
6  11   PHE n 
6  12   HIS n 
6  13   GLU n 
6  14   MET n 
6  15   ARG n 
6  16   GLU n 
6  17   PRO n 
6  18   ARG n 
6  19   ILE n 
6  20   GLU n 
6  21   LYS n 
6  22   VAL n 
6  23   VAL n 
6  24   VAL n 
6  25   HIS n 
6  26   MET n 
6  27   GLY n 
6  28   ILE n 
6  29   GLY n 
6  30   HIS n 
6  31   GLY n 
6  32   GLY n 
6  33   ARG n 
6  34   ASP n 
6  35   LEU n 
6  36   ALA n 
6  37   ASN n 
6  38   ALA n 
6  39   GLU n 
6  40   ASP n 
6  41   ILE n 
6  42   LEU n 
6  43   GLY n 
6  44   GLU n 
6  45   ILE n 
6  46   THR n 
6  47   GLY n 
6  48   GLN n 
6  49   MET n 
6  50   PRO n 
6  51   VAL n 
6  52   ARG n 
6  53   THR n 
6  54   LYS n 
6  55   ALA n 
6  56   LYS n 
6  57   ARG n 
6  58   THR n 
6  59   VAL n 
6  60   GLY n 
6  61   GLU n 
6  62   PHE n 
6  63   ASP n 
6  64   ILE n 
6  65   ARG n 
6  66   GLU n 
6  67   GLY n 
6  68   ASP n 
6  69   PRO n 
6  70   ILE n 
6  71   GLY n 
6  72   ALA n 
6  73   LYS n 
6  74   VAL n 
6  75   THR n 
6  76   LEU n 
6  77   ARG n 
6  78   ASP n 
6  79   GLU n 
6  80   MET n 
6  81   ALA n 
6  82   GLU n 
6  83   GLU n 
6  84   PHE n 
6  85   LEU n 
6  86   GLN n 
6  87   THR n 
6  88   ALA n 
6  89   LEU n 
6  90   PRO n 
6  91   LEU n 
6  92   ALA n 
6  93   GLU n 
6  94   LEU n 
6  95   ALA n 
6  96   THR n 
6  97   SER n 
6  98   GLN n 
6  99   PHE n 
6  100  ASP n 
6  101  ASP n 
6  102  THR n 
6  103  GLY n 
6  104  ASN n 
6  105  PHE n 
6  106  SER n 
6  107  PHE n 
6  108  GLY n 
6  109  VAL n 
6  110  GLU n 
6  111  GLU n 
6  112  HIS n 
6  113  THR n 
6  114  GLU n 
6  115  PHE n 
6  116  PRO n 
6  117  SER n 
6  118  GLN n 
6  119  GLU n 
6  120  TYR n 
6  121  ASP n 
6  122  PRO n 
6  123  SER n 
6  124  ILE n 
6  125  GLY n 
6  126  ILE n 
6  127  TYR n 
6  128  GLY n 
6  129  LEU n 
6  130  ASP n 
6  131  VAL n 
6  132  THR n 
6  133  VAL n 
6  134  ASN n 
6  135  LEU n 
6  136  VAL n 
6  137  ARG n 
6  138  PRO n 
6  139  GLY n 
6  140  TYR n 
6  141  ARG n 
6  142  VAL n 
6  143  ALA n 
6  144  LYS n 
6  145  ARG n 
6  146  ASP n 
6  147  LYS n 
6  148  ALA n 
6  149  SER n 
6  150  ARG n 
6  151  SER n 
6  152  ILE n 
6  153  PRO n 
6  154  THR n 
6  155  LYS n 
6  156  HIS n 
6  157  ARG n 
6  158  LEU n 
6  159  ASN n 
6  160  PRO n 
6  161  ALA n 
6  162  ASP n 
6  163  ALA n 
6  164  VAL n 
6  165  ALA n 
6  166  PHE n 
6  167  ILE n 
6  168  GLU n 
6  169  SER n 
6  170  THR n 
6  171  TYR n 
6  172  ASP n 
6  173  VAL n 
6  174  GLU n 
6  175  VAL n 
6  176  SER n 
6  177  GLU n 
7  1    MET n 
7  2    PRO n 
7  3    ARG n 
7  4    VAL n 
7  5    GLU n 
7  6    LEU n 
7  7    GLU n 
7  8    ILE n 
7  9    PRO n 
7  10   GLU n 
7  11   ASP n 
7  12   VAL n 
7  13   ASP n 
7  14   ALA n 
7  15   GLU n 
7  16   GLN n 
7  17   ASP n 
7  18   HIS n 
7  19   LEU n 
7  20   ASP n 
7  21   ILE n 
7  22   THR n 
7  23   VAL n 
7  24   GLU n 
7  25   GLY n 
7  26   ASP n 
7  27   ASN n 
7  28   GLY n 
7  29   SER n 
7  30   VAL n 
7  31   THR n 
7  32   ARG n 
7  33   ARG n 
7  34   LEU n 
7  35   TRP n 
7  36   TYR n 
7  37   PRO n 
7  38   ASP n 
7  39   ILE n 
7  40   ASP n 
7  41   VAL n 
7  42   SER n 
7  43   VAL n 
7  44   ASP n 
7  45   GLY n 
7  46   ASP n 
7  47   THR n 
7  48   VAL n 
7  49   VAL n 
7  50   ILE n 
7  51   GLU n 
7  52   SER n 
7  53   ASP n 
7  54   GLU n 
7  55   ASP n 
7  56   ASN n 
7  57   ALA n 
7  58   LYS n 
7  59   THR n 
7  60   MET n 
7  61   SER n 
7  62   THR n 
7  63   ILE n 
7  64   GLY n 
7  65   THR n 
7  66   PHE n 
7  67   GLN n 
7  68   SER n 
7  69   HIS n 
7  70   ILE n 
7  71   GLU n 
7  72   ASN n 
7  73   MET n 
7  74   PHE n 
7  75   HIS n 
7  76   GLY n 
7  77   VAL n 
7  78   THR n 
7  79   GLU n 
7  80   GLY n 
7  81   TRP n 
7  82   GLU n 
7  83   TYR n 
7  84   GLY n 
7  85   MET n 
7  86   GLU n 
7  87   VAL n 
7  88   PHE n 
7  89   TYR n 
7  90   SER n 
7  91   HIS n 
7  92   PHE n 
7  93   PRO n 
7  94   MET n 
7  95   GLN n 
7  96   VAL n 
7  97   ASN n 
7  98   VAL n 
7  99   GLU n 
7  100  GLY n 
7  101  ASP n 
7  102  GLU n 
7  103  VAL n 
7  104  VAL n 
7  105  ILE n 
7  106  GLU n 
7  107  ASN n 
7  108  PHE n 
7  109  LEU n 
7  110  GLY n 
7  111  GLU n 
7  112  LYS n 
7  113  ALA n 
7  114  PRO n 
7  115  ARG n 
7  116  ARG n 
7  117  THR n 
7  118  THR n 
7  119  ILE n 
7  120  HIS n 
7  121  GLY n 
7  122  ASP n 
7  123  THR n 
7  124  ASP n 
7  125  VAL n 
7  126  GLU n 
7  127  ILE n 
7  128  ASP n 
7  129  GLY n 
7  130  GLU n 
7  131  GLU n 
7  132  LEU n 
7  133  THR n 
7  134  VAL n 
7  135  SER n 
7  136  GLY n 
7  137  PRO n 
7  138  ASP n 
7  139  ILE n 
7  140  GLU n 
7  141  ALA n 
7  142  VAL n 
7  143  GLY n 
7  144  GLN n 
7  145  THR n 
7  146  ALA n 
7  147  ALA n 
7  148  ASP n 
7  149  ILE n 
7  150  GLU n 
7  151  GLN n 
7  152  LEU n 
7  153  THR n 
7  154  ARG n 
7  155  ILE n 
7  156  ASN n 
7  157  ASP n 
7  158  LYS n 
7  159  ASP n 
7  160  VAL n 
7  161  ARG n 
7  162  VAL n 
7  163  PHE n 
7  164  GLN n 
7  165  ASP n 
7  166  GLY n 
7  167  VAL n 
7  168  TYR n 
7  169  ILE n 
7  170  THR n 
7  171  ARG n 
7  172  LYS n 
7  173  PRO n 
7  174  ASN n 
7  175  ARG n 
7  176  GLY n 
7  177  ASP n 
7  178  ALA n 
8  1    MET n 
8  2    PRO n 
8  3    VAL n 
8  4    TYR n 
8  5    VAL n 
8  6    ASP n 
8  7    PHE n 
8  8    ASP n 
8  9    VAL n 
8  10   PRO n 
8  11   ALA n 
8  12   ASP n 
8  13   LEU n 
8  14   GLU n 
8  15   ASP n 
8  16   ASP n 
8  17   ALA n 
8  18   LEU n 
8  19   GLU n 
8  20   ALA n 
8  21   LEU n 
8  22   GLU n 
8  23   VAL n 
8  24   ALA n 
8  25   ARG n 
8  26   ASP n 
8  27   THR n 
8  28   GLY n 
8  29   ALA n 
8  30   VAL n 
8  31   LYS n 
8  32   LYS n 
8  33   GLY n 
8  34   THR n 
8  35   ASN n 
8  36   GLU n 
8  37   THR n 
8  38   THR n 
8  39   LYS n 
8  40   SER n 
8  41   ILE n 
8  42   GLU n 
8  43   ARG n 
8  44   GLY n 
8  45   SER n 
8  46   ALA n 
8  47   GLU n 
8  48   LEU n 
8  49   VAL n 
8  50   PHE n 
8  51   VAL n 
8  52   ALA n 
8  53   GLU n 
8  54   ASP n 
8  55   VAL n 
8  56   GLN n 
8  57   PRO n 
8  58   GLU n 
8  59   GLU n 
8  60   ILE n 
8  61   VAL n 
8  62   MET n 
8  63   HIS n 
8  64   ILE n 
8  65   PRO n 
8  66   GLU n 
8  67   LEU n 
8  68   ALA n 
8  69   ASP n 
8  70   GLU n 
8  71   LYS n 
8  72   GLY n 
8  73   VAL n 
8  74   PRO n 
8  75   PHE n 
8  76   ILE n 
8  77   PHE n 
8  78   VAL n 
8  79   GLU n 
8  80   GLN n 
8  81   GLN n 
8  82   ASP n 
8  83   ASP n 
8  84   LEU n 
8  85   GLY n 
8  86   HIS n 
8  87   ALA n 
8  88   ALA n 
8  89   GLY n 
8  90   LEU n 
8  91   GLU n 
8  92   VAL n 
8  93   GLY n 
8  94   SER n 
8  95   ALA n 
8  96   ALA n 
8  97   ALA n 
8  98   ALA n 
8  99   VAL n 
8  100  THR n 
8  101  ASP n 
8  102  ALA n 
8  103  GLY n 
8  104  GLU n 
8  105  ALA n 
8  106  ASP n 
8  107  ALA n 
8  108  ASP n 
8  109  VAL n 
8  110  GLU n 
8  111  ASP n 
8  112  ILE n 
8  113  ALA n 
8  114  ASP n 
8  115  LYS n 
8  116  VAL n 
8  117  GLU n 
8  118  GLU n 
8  119  LEU n 
8  120  ARG n 
9  1    MET n 
9  2    SER n 
9  3    ALA n 
9  4    GLU n 
9  5    SER n 
9  6    GLU n 
9  7    ARG n 
9  8    LYS n 
9  9    THR n 
9  10   GLU n 
9  11   THR n 
9  12   ILE n 
9  13   PRO n 
9  14   GLU n 
9  15   TRP n 
9  16   LYS n 
9  17   GLN n 
9  18   GLU n 
9  19   GLU n 
9  20   VAL n 
9  21   ASP n 
9  22   ALA n 
9  23   ILE n 
9  24   VAL n 
9  25   GLU n 
9  26   MET n 
9  27   ILE n 
9  28   GLU n 
9  29   SER n 
9  30   TYR n 
9  31   GLU n 
9  32   SER n 
9  33   VAL n 
9  34   GLY n 
9  35   VAL n 
9  36   VAL n 
9  37   ASN n 
9  38   ILE n 
9  39   ALA n 
9  40   GLY n 
9  41   ILE n 
9  42   PRO n 
9  43   SER n 
9  44   ARG n 
9  45   GLN n 
9  46   LEU n 
9  47   GLN n 
9  48   ASP n 
9  49   MET n 
9  50   ARG n 
9  51   ARG n 
9  52   ASP n 
9  53   LEU n 
9  54   HIS n 
9  55   GLY n 
9  56   THR n 
9  57   ALA n 
9  58   GLU n 
9  59   LEU n 
9  60   ARG n 
9  61   VAL n 
9  62   SER n 
9  63   ARG n 
9  64   ASN n 
9  65   THR n 
9  66   LEU n 
9  67   LEU n 
9  68   GLU n 
9  69   ARG n 
9  70   ALA n 
9  71   LEU n 
9  72   ASP n 
9  73   ASP n 
9  74   VAL n 
9  75   ASP n 
9  76   ASP n 
9  77   GLY n 
9  78   LEU n 
9  79   GLU n 
9  80   ASP n 
9  81   LEU n 
9  82   ASN n 
9  83   GLY n 
9  84   TYR n 
9  85   ILE n 
9  86   THR n 
9  87   GLY n 
9  88   GLN n 
9  89   VAL n 
9  90   GLY n 
9  91   LEU n 
9  92   ILE n 
9  93   GLY n 
9  94   THR n 
9  95   ASP n 
9  96   ASP n 
9  97   ASN n 
9  98   PRO n 
9  99   PHE n 
9  100  SER n 
9  101  LEU n 
9  102  PHE n 
9  103  GLN n 
9  104  GLU n 
9  105  LEU n 
9  106  GLU n 
9  107  ALA n 
9  108  SER n 
9  109  LYS n 
9  110  THR n 
9  111  PRO n 
9  112  ALA n 
9  113  PRO n 
9  114  ILE n 
9  115  GLY n 
9  116  ALA n 
9  117  GLY n 
9  118  GLU n 
9  119  VAL n 
9  120  ALA n 
9  121  PRO n 
9  122  ASN n 
9  123  ASP n 
9  124  ILE n 
9  125  VAL n 
9  126  ILE n 
9  127  PRO n 
9  128  GLU n 
9  129  GLY n 
9  130  ASP n 
9  131  THR n 
9  132  GLY n 
9  133  VAL n 
9  134  ASP n 
9  135  PRO n 
9  136  GLY n 
9  137  PRO n 
9  138  PHE n 
9  139  VAL n 
9  140  GLY n 
9  141  GLU n 
9  142  LEU n 
9  143  GLN n 
9  144  SER n 
9  145  VAL n 
9  146  GLY n 
9  147  ALA n 
9  148  ASP n 
9  149  ALA n 
9  150  ARG n 
9  151  ILE n 
9  152  GLN n 
9  153  GLU n 
9  154  GLY n 
9  155  SER n 
9  156  ILE n 
9  157  GLN n 
9  158  VAL n 
9  159  LEU n 
9  160  SER n 
9  161  ASP n 
9  162  SER n 
9  163  THR n 
9  164  VAL n 
9  165  LEU n 
9  166  ASP n 
9  167  THR n 
9  168  GLY n 
9  169  GLU n 
9  170  GLU n 
9  171  VAL n 
9  172  SER n 
9  173  GLN n 
9  174  GLU n 
9  175  LEU n 
9  176  SER n 
9  177  ASN n 
9  178  VAL n 
9  179  LEU n 
9  180  ASN n 
9  181  GLU n 
9  182  LEU n 
9  183  GLY n 
9  184  ILE n 
9  185  GLU n 
9  186  PRO n 
9  187  LYS n 
9  188  GLU n 
9  189  VAL n 
9  190  GLY n 
9  191  LEU n 
9  192  ASP n 
9  193  LEU n 
9  194  ARG n 
9  195  ALA n 
9  196  VAL n 
9  197  PHE n 
9  198  ALA n 
9  199  ASP n 
9  200  GLY n 
9  201  VAL n 
9  202  LEU n 
9  203  PHE n 
9  204  GLU n 
9  205  PRO n 
9  206  GLU n 
9  207  GLU n 
9  208  LEU n 
9  209  GLU n 
9  210  LEU n 
9  211  ASP n 
9  212  ILE n 
9  213  ASP n 
9  214  GLU n 
9  215  TYR n 
9  216  ARG n 
9  217  SER n 
9  218  ASP n 
9  219  ILE n 
9  220  GLN n 
9  221  ALA n 
9  222  ALA n 
9  223  ALA n 
9  224  GLY n 
9  225  ARG n 
9  226  ALA n 
9  227  PHE n 
9  228  ASN n 
9  229  LEU n 
9  230  SER n 
9  231  VAL n 
9  232  ASN n 
9  233  ALA n 
9  234  ASP n 
9  235  TYR n 
9  236  PRO n 
9  237  THR n 
9  238  ALA n 
9  239  THR n 
9  240  THR n 
9  241  ALA n 
9  242  PRO n 
9  243  THR n 
9  244  MET n 
9  245  LEU n 
9  246  GLN n 
9  247  SER n 
9  248  ASP n 
9  249  ARG n 
9  250  GLY n 
9  251  ASN n 
9  252  ALA n 
9  253  LYS n 
9  254  SER n 
9  255  LEU n 
9  256  ALA n 
9  257  LEU n 
9  258  GLN n 
9  259  ALA n 
9  260  ALA n 
9  261  ILE n 
9  262  GLU n 
9  263  ASP n 
9  264  PRO n 
9  265  GLU n 
9  266  VAL n 
9  267  VAL n 
9  268  PRO n 
9  269  ASP n 
9  270  LEU n 
9  271  VAL n 
9  272  SER n 
9  273  LYS n 
9  274  ALA n 
9  275  ASP n 
9  276  ALA n 
9  277  GLN n 
9  278  VAL n 
9  279  ARG n 
9  280  ALA n 
9  281  LEU n 
9  282  ALA n 
9  283  SER n 
9  284  GLN n 
9  285  ILE n 
9  286  ASP n 
9  287  ASP n 
9  288  GLU n 
9  289  GLU n 
9  290  ALA n 
9  291  LEU n 
9  292  PRO n 
9  293  GLU n 
9  294  GLU n 
9  295  LEU n 
9  296  GLN n 
9  297  GLY n 
9  298  VAL n 
9  299  GLU n 
9  300  ALA n 
9  301  ASP n 
9  302  VAL n 
9  303  ALA n 
9  304  THR n 
9  305  GLU n 
9  306  GLU n 
9  307  PRO n 
9  308  THR n 
9  309  ASP n 
9  310  ASP n 
9  311  GLN n 
9  312  ASP n 
9  313  ASP n 
9  314  ASP n 
9  315  THR n 
9  316  ALA n 
9  317  SER n 
9  318  GLU n 
9  319  ASP n 
9  320  ASP n 
9  321  ALA n 
9  322  ASP n 
9  323  ALA n 
9  324  ASP n 
9  325  ASP n 
9  326  ALA n 
9  327  ALA n 
9  328  GLU n 
9  329  GLU n 
9  330  ALA n 
9  331  ASP n 
9  332  ASP n 
9  333  ASP n 
9  334  ASP n 
9  335  ASP n 
9  336  ASP n 
9  337  ASP n 
9  338  GLU n 
9  339  ASP n 
9  340  ALA n 
9  341  GLY n 
9  342  ASP n 
9  343  ALA n 
9  344  LEU n 
9  345  GLY n 
9  346  ALA n 
9  347  MET n 
9  348  PHE n 
10 1    MET n 
10 2    SER n 
10 3    ASP n 
10 4    LYS n 
10 5    PRO n 
10 6    ALA n 
10 7    SER n 
10 8    MET n 
10 9    TYR n 
10 10   ARG n 
10 11   ASP n 
10 12   ILE n 
10 13   ASP n 
10 14   LYS n 
10 15   PRO n 
10 16   ALA n 
10 17   TYR n 
10 18   THR n 
10 19   ARG n 
10 20   ARG n 
10 21   GLU n 
10 22   TYR n 
10 23   ILE n 
10 24   THR n 
10 25   GLY n 
10 26   ILE n 
10 27   PRO n 
10 28   GLY n 
10 29   SER n 
10 30   LYS n 
10 31   ILE n 
10 32   ALA n 
10 33   GLN n 
10 34   HIS n 
10 35   LYS n 
10 36   MET n 
10 37   GLY n 
10 38   ARG n 
10 39   LYS n 
10 40   GLN n 
10 41   LYS n 
10 42   ASP n 
10 43   ALA n 
10 44   ASP n 
10 45   ASP n 
10 46   TYR n 
10 47   PRO n 
10 48   VAL n 
10 49   GLN n 
10 50   ILE n 
10 51   SER n 
10 52   LEU n 
10 53   ILE n 
10 54   VAL n 
10 55   GLU n 
10 56   GLU n 
10 57   THR n 
10 58   VAL n 
10 59   GLN n 
10 60   LEU n 
10 61   ARG n 
10 62   HIS n 
10 63   GLY n 
10 64   SER n 
10 65   LEU n 
10 66   GLU n 
10 67   ALA n 
10 68   SER n 
10 69   ARG n 
10 70   LEU n 
10 71   SER n 
10 72   ALA n 
10 73   ASN n 
10 74   ARG n 
10 75   HIS n 
10 76   LEU n 
10 77   ILE n 
10 78   LYS n 
10 79   GLU n 
10 80   LEU n 
10 81   GLY n 
10 82   GLU n 
10 83   GLU n 
10 84   GLY n 
10 85   ASP n 
10 86   TYR n 
10 87   LYS n 
10 88   MET n 
10 89   THR n 
10 90   LEU n 
10 91   ARG n 
10 92   LYS n 
10 93   PHE n 
10 94   PRO n 
10 95   HIS n 
10 96   GLN n 
10 97   VAL n 
10 98   LEU n 
10 99   ARG n 
10 100  GLU n 
10 101  ASN n 
10 102  LYS n 
10 103  GLN n 
10 104  ALA n 
10 105  THR n 
10 106  GLY n 
10 107  ALA n 
10 108  GLY n 
10 109  ALA n 
10 110  ASP n 
10 111  ARG n 
10 112  VAL n 
10 113  SER n 
10 114  ASP n 
10 115  GLY n 
10 116  MET n 
10 117  ARG n 
10 118  ALA n 
10 119  ALA n 
10 120  PHE n 
10 121  GLY n 
10 122  LYS n 
10 123  ILE n 
10 124  VAL n 
10 125  GLY n 
10 126  THR n 
10 127  ALA n 
10 128  ALA n 
10 129  ARG n 
10 130  VAL n 
10 131  GLN n 
10 132  ALA n 
10 133  GLY n 
10 134  GLU n 
10 135  GLN n 
10 136  LEU n 
10 137  PHE n 
10 138  THR n 
10 139  ALA n 
10 140  TYR n 
10 141  CYS n 
10 142  ASN n 
10 143  VAL n 
10 144  GLU n 
10 145  ASP n 
10 146  ALA n 
10 147  GLU n 
10 148  HIS n 
10 149  VAL n 
10 150  LYS n 
10 151  GLU n 
10 152  ALA n 
10 153  PHE n 
10 154  ARG n 
10 155  ARG n 
10 156  ALA n 
10 157  TYR n 
10 158  ASN n 
10 159  LYS n 
10 160  ILE n 
10 161  THR n 
10 162  PRO n 
10 163  SER n 
10 164  CYS n 
10 165  ARG n 
10 166  ILE n 
10 167  LYS n 
10 168  VAL n 
10 169  GLU n 
10 170  ARG n 
10 171  GLY n 
10 172  GLU n 
10 173  GLU n 
10 174  LEU n 
10 175  LEU n 
10 176  ILE n 
10 177  ALA n 
11 1    MET n 
11 2    ALA n 
11 3    GLY n 
11 4    THR n 
11 5    ILE n 
11 6    GLU n 
11 7    VAL n 
11 8    LEU n 
11 9    VAL n 
11 10   PRO n 
11 11   GLY n 
11 12   GLY n 
11 13   GLU n 
11 14   ALA n 
11 15   ASN n 
11 16   PRO n 
11 17   GLY n 
11 18   PRO n 
11 19   PRO n 
11 20   LEU n 
11 21   GLY n 
11 22   PRO n 
11 23   GLU n 
11 24   LEU n 
11 25   GLY n 
11 26   PRO n 
11 27   THR n 
11 28   PRO n 
11 29   VAL n 
11 30   ASP n 
11 31   VAL n 
11 32   GLN n 
11 33   ALA n 
11 34   VAL n 
11 35   VAL n 
11 36   GLN n 
11 37   GLU n 
11 38   ILE n 
11 39   ASN n 
11 40   ASP n 
11 41   GLN n 
11 42   THR n 
11 43   ALA n 
11 44   ALA n 
11 45   PHE n 
11 46   ASP n 
11 47   GLY n 
11 48   THR n 
11 49   GLU n 
11 50   VAL n 
11 51   PRO n 
11 52   VAL n 
11 53   THR n 
11 54   VAL n 
11 55   LYS n 
11 56   TYR n 
11 57   ASP n 
11 58   ASP n 
11 59   ASP n 
11 60   GLY n 
11 61   SER n 
11 62   PHE n 
11 63   GLU n 
11 64   ILE n 
11 65   GLU n 
11 66   VAL n 
11 67   GLY n 
11 68   VAL n 
11 69   PRO n 
11 70   PRO n 
11 71   THR n 
11 72   ALA n 
11 73   GLU n 
11 74   LEU n 
11 75   ILE n 
11 76   LYS n 
11 77   ASP n 
11 78   GLU n 
11 79   ALA n 
11 80   GLY n 
11 81   PHE n 
11 82   GLU n 
11 83   THR n 
11 84   GLY n 
11 85   SER n 
11 86   GLY n 
11 87   GLU n 
11 88   PRO n 
11 89   GLN n 
11 90   GLU n 
11 91   ASP n 
11 92   PHE n 
11 93   VAL n 
11 94   ALA n 
11 95   ASP n 
11 96   LEU n 
11 97   SER n 
11 98   VAL n 
11 99   ASP n 
11 100  GLN n 
11 101  VAL n 
11 102  LYS n 
11 103  GLN n 
11 104  ILE n 
11 105  ALA n 
11 106  GLU n 
11 107  GLN n 
11 108  LYS n 
11 109  HIS n 
11 110  PRO n 
11 111  ASP n 
11 112  LEU n 
11 113  LEU n 
11 114  SER n 
11 115  TYR n 
11 116  ASP n 
11 117  LEU n 
11 118  THR n 
11 119  ASN n 
11 120  ALA n 
11 121  ALA n 
11 122  LYS n 
11 123  GLU n 
11 124  VAL n 
11 125  VAL n 
11 126  GLY n 
11 127  THR n 
11 128  CYS n 
11 129  THR n 
11 130  SER n 
11 131  LEU n 
11 132  GLY n 
11 133  VAL n 
11 134  THR n 
11 135  ILE n 
11 136  GLU n 
11 137  GLY n 
11 138  GLU n 
11 139  ASN n 
11 140  PRO n 
11 141  ARG n 
11 142  GLU n 
11 143  PHE n 
11 144  LYS n 
11 145  GLU n 
11 146  ARG n 
11 147  ILE n 
11 148  ASP n 
11 149  ALA n 
11 150  GLY n 
11 151  GLU n 
11 152  TYR n 
11 153  ASP n 
11 154  ASP n 
11 155  VAL n 
11 156  PHE n 
11 157  ALA n 
11 158  ALA n 
11 159  GLU n 
11 160  ALA n 
11 161  GLN n 
11 162  ALA n 
12 1    MET n 
12 2    SER n 
12 3    VAL n 
12 4    ALA n 
12 5    GLU n 
12 6    PHE n 
12 7    ASP n 
12 8    ALA n 
12 9    ASP n 
12 10   VAL n 
12 11   ILE n 
12 12   VAL n 
12 13   ASP n 
12 14   ALA n 
12 15   ARG n 
12 16   ASP n 
12 17   CYS n 
12 18   ILE n 
12 19   MET n 
12 20   GLY n 
12 21   ARG n 
12 22   VAL n 
12 23   ALA n 
12 24   SER n 
12 25   GLN n 
12 26   VAL n 
12 27   ALA n 
12 28   GLU n 
12 29   GLN n 
12 30   ALA n 
12 31   LEU n 
12 32   ASP n 
12 33   GLY n 
12 34   GLU n 
12 35   THR n 
12 36   VAL n 
12 37   ALA n 
12 38   VAL n 
12 39   VAL n 
12 40   ASN n 
12 41   ALA n 
12 42   GLU n 
12 43   ARG n 
12 44   ALA n 
12 45   VAL n 
12 46   ILE n 
12 47   THR n 
12 48   GLY n 
12 49   ARG n 
12 50   GLU n 
12 51   GLU n 
12 52   GLN n 
12 53   ILE n 
12 54   VAL n 
12 55   GLU n 
12 56   LYS n 
12 57   TYR n 
12 58   GLU n 
12 59   LYS n 
12 60   ARG n 
12 61   VAL n 
12 62   ASP n 
12 63   ILE n 
12 64   GLY n 
12 65   ASN n 
12 66   ASP n 
12 67   ASN n 
12 68   GLY n 
12 69   TYR n 
12 70   PHE n 
12 71   TYR n 
12 72   PRO n 
12 73   LYS n 
12 74   ARG n 
12 75   PRO n 
12 76   ASP n 
12 77   GLY n 
12 78   ILE n 
12 79   PHE n 
12 80   LYS n 
12 81   ARG n 
12 82   THR n 
12 83   ILE n 
12 84   ARG n 
12 85   GLY n 
12 86   MET n 
12 87   LEU n 
12 88   PRO n 
12 89   HIS n 
12 90   LYS n 
12 91   LYS n 
12 92   GLN n 
12 93   ARG n 
12 94   GLY n 
12 95   ARG n 
12 96   GLU n 
12 97   ALA n 
12 98   PHE n 
12 99   GLU n 
12 100  SER n 
12 101  VAL n 
12 102  ARG n 
12 103  VAL n 
12 104  TYR n 
12 105  LEU n 
12 106  GLY n 
12 107  ASN n 
12 108  PRO n 
12 109  TYR n 
12 110  ASP n 
12 111  GLU n 
12 112  ASP n 
12 113  GLY n 
12 114  GLU n 
12 115  VAL n 
12 116  LEU n 
12 117  ASP n 
12 118  GLY n 
12 119  THR n 
12 120  SER n 
12 121  LEU n 
12 122  ASP n 
12 123  ARG n 
12 124  LEU n 
12 125  SER n 
12 126  ASN n 
12 127  ILE n 
12 128  LYS n 
12 129  PHE n 
12 130  VAL n 
12 131  THR n 
12 132  LEU n 
12 133  GLY n 
12 134  GLU n 
12 135  ILE n 
12 136  SER n 
12 137  GLU n 
12 138  THR n 
12 139  LEU n 
12 140  GLY n 
12 141  ALA n 
12 142  ASN n 
12 143  LYS n 
12 144  THR n 
12 145  TRP n 
13 1    MET n 
13 2    GLU n 
13 3    ALA n 
13 4    LEU n 
13 5    GLY n 
13 6    ALA n 
13 7    ASP n 
13 8    VAL n 
13 9    THR n 
13 10   GLN n 
13 11   GLY n 
13 12   LEU n 
13 13   GLU n 
13 14   LYS n 
13 15   GLY n 
13 16   SER n 
13 17   LEU n 
13 18   ILE n 
13 19   THR n 
13 20   CYS n 
13 21   ALA n 
13 22   ASP n 
13 23   ASN n 
13 24   THR n 
13 25   GLY n 
13 26   ALA n 
13 27   ARG n 
13 28   GLU n 
13 29   LEU n 
13 30   LYS n 
13 31   VAL n 
13 32   ILE n 
13 33   SER n 
13 34   VAL n 
13 35   HIS n 
13 36   GLY n 
13 37   TYR n 
13 38   SER n 
13 39   GLY n 
13 40   THR n 
13 41   LYS n 
13 42   ASN n 
13 43   ARG n 
13 44   LEU n 
13 45   PRO n 
13 46   LYS n 
13 47   ALA n 
13 48   GLY n 
13 49   LEU n 
13 50   GLY n 
13 51   ASP n 
13 52   LYS n 
13 53   ILE n 
13 54   THR n 
13 55   VAL n 
13 56   SER n 
13 57   VAL n 
13 58   THR n 
13 59   LYS n 
13 60   GLY n 
13 61   THR n 
13 62   PRO n 
13 63   GLU n 
13 64   MET n 
13 65   ARG n 
13 66   ARG n 
13 67   GLN n 
13 68   VAL n 
13 69   LEU n 
13 70   GLU n 
13 71   ALA n 
13 72   VAL n 
13 73   VAL n 
13 74   VAL n 
13 75   ARG n 
13 76   GLN n 
13 77   ARG n 
13 78   LYS n 
13 79   PRO n 
13 80   ILE n 
13 81   ARG n 
13 82   ARG n 
13 83   PRO n 
13 84   ASP n 
13 85   GLY n 
13 86   THR n 
13 87   ARG n 
13 88   VAL n 
13 89   LYS n 
13 90   PHE n 
13 91   GLU n 
13 92   ASP n 
13 93   ASN n 
13 94   ALA n 
13 95   ALA n 
13 96   VAL n 
13 97   ILE n 
13 98   VAL n 
13 99   ASP n 
13 100  GLU n 
13 101  ASN n 
13 102  GLU n 
13 103  ASP n 
13 104  PRO n 
13 105  ARG n 
13 106  GLY n 
13 107  THR n 
13 108  GLU n 
13 109  LEU n 
13 110  LYS n 
13 111  GLY n 
13 112  PRO n 
13 113  ILE n 
13 114  ALA n 
13 115  ARG n 
13 116  GLU n 
13 117  VAL n 
13 118  ALA n 
13 119  GLN n 
13 120  ARG n 
13 121  PHE n 
13 122  GLY n 
13 123  SER n 
13 124  VAL n 
13 125  ALA n 
13 126  SER n 
13 127  ALA n 
13 128  ALA n 
13 129  THR n 
13 130  MET n 
13 131  ILE n 
13 132  VAL n 
14 1    MET n 
14 2    THR n 
14 3    SER n 
14 4    LYS n 
14 5    LYS n 
14 6    LYS n 
14 7    ARG n 
14 8    GLN n 
14 9    ARG n 
14 10   GLY n 
14 11   SER n 
14 12   ARG n 
14 13   THR n 
14 14   HIS n 
14 15   GLY n 
14 16   GLY n 
14 17   GLY n 
14 18   SER n 
14 19   HIS n 
14 20   LYS n 
14 21   ASN n 
14 22   ARG n 
14 23   ARG n 
14 24   GLY n 
14 25   ALA n 
14 26   GLY n 
14 27   HIS n 
14 28   ARG n 
14 29   GLY n 
14 30   GLY n 
14 31   ARG n 
14 32   GLY n 
14 33   ASP n 
14 34   ALA n 
14 35   GLY n 
14 36   ARG n 
14 37   ASP n 
14 38   LYS n 
14 39   HIS n 
14 40   GLU n 
14 41   PHE n 
14 42   HIS n 
14 43   ASN n 
14 44   HIS n 
14 45   GLU n 
14 46   PRO n 
14 47   LEU n 
14 48   GLY n 
14 49   LYS n 
14 50   SER n 
14 51   GLY n 
14 52   PHE n 
14 53   LYS n 
14 54   ARG n 
14 55   PRO n 
14 56   GLN n 
14 57   LYS n 
14 58   VAL n 
14 59   GLN n 
14 60   GLU n 
14 61   GLU n 
14 62   ALA n 
14 63   ALA n 
14 64   THR n 
14 65   ILE n 
14 66   ASP n 
14 67   VAL n 
14 68   ARG n 
14 69   GLU n 
14 70   ILE n 
14 71   ASP n 
14 72   GLU n 
14 73   ASN n 
14 74   VAL n 
14 75   THR n 
14 76   LEU n 
14 77   LEU n 
14 78   ALA n 
14 79   ALA n 
14 80   ASP n 
14 81   ASP n 
14 82   VAL n 
14 83   ALA n 
14 84   GLU n 
14 85   VAL n 
14 86   GLU n 
14 87   ASP n 
14 88   GLY n 
14 89   GLY n 
14 90   PHE n 
14 91   ARG n 
14 92   VAL n 
14 93   ASP n 
14 94   VAL n 
14 95   ARG n 
14 96   ASP n 
14 97   VAL n 
14 98   VAL n 
14 99   GLU n 
14 100  GLU n 
14 101  ALA n 
14 102  ASP n 
14 103  ASP n 
14 104  ALA n 
14 105  ASP n 
14 106  TYR n 
14 107  VAL n 
14 108  LYS n 
14 109  VAL n 
14 110  LEU n 
14 111  GLY n 
14 112  ALA n 
14 113  GLY n 
14 114  GLN n 
14 115  VAL n 
14 116  ARG n 
14 117  HIS n 
14 118  GLU n 
14 119  LEU n 
14 120  THR n 
14 121  LEU n 
14 122  ILE n 
14 123  ALA n 
14 124  ASP n 
14 125  ASP n 
14 126  PHE n 
14 127  SER n 
14 128  GLU n 
14 129  GLY n 
14 130  ALA n 
14 131  ARG n 
14 132  GLU n 
14 133  LYS n 
14 134  VAL n 
14 135  GLU n 
14 136  GLY n 
14 137  ALA n 
14 138  GLY n 
14 139  GLY n 
14 140  SER n 
14 141  VAL n 
14 142  GLU n 
14 143  LEU n 
14 144  THR n 
14 145  ASP n 
14 146  LEU n 
14 147  GLY n 
14 148  GLU n 
14 149  GLU n 
14 150  ARG n 
14 151  GLN n 
14 152  ALA n 
14 153  GLU n 
14 154  ALA n 
14 155  GLU n 
14 156  GLU n 
14 157  THR n 
14 158  GLU n 
14 159  ASP n 
14 160  ALA n 
14 161  ASP n 
14 162  ALA n 
14 163  ASP n 
14 164  GLU n 
14 165  GLU n 
15 1    ALA n 
15 2    ARG n 
15 3    SER n 
15 4    ALA n 
15 5    TYR n 
15 6    SER n 
15 7    TYR n 
15 8    ILE n 
15 9    ARG n 
15 10   ASP n 
15 11   ALA n 
15 12   TRP n 
15 13   GLU n 
15 14   ASN n 
15 15   PRO n 
15 16   GLY n 
15 17   ASP n 
15 18   GLY n 
15 19   GLN n 
15 20   LEU n 
15 21   ALA n 
15 22   GLU n 
15 23   LEU n 
15 24   GLN n 
15 25   TRP n 
15 26   GLN n 
15 27   ARG n 
15 28   GLN n 
15 29   GLN n 
15 30   GLU n 
15 31   TRP n 
15 32   ARG n 
15 33   ASN n 
15 34   GLU n 
15 35   GLY n 
15 36   ALA n 
15 37   VAL n 
15 38   GLU n 
15 39   ARG n 
15 40   ILE n 
15 41   GLU n 
15 42   ARG n 
15 43   PRO n 
15 44   THR n 
15 45   ARG n 
15 46   LEU n 
15 47   ASP n 
15 48   LYS n 
15 49   ALA n 
15 50   ARG n 
15 51   SER n 
15 52   GLN n 
15 53   GLY n 
15 54   TYR n 
15 55   LYS n 
15 56   ALA n 
15 57   LYS n 
15 58   GLN n 
15 59   GLY n 
15 60   VAL n 
15 61   ILE n 
15 62   VAL n 
15 63   ALA n 
15 64   ARG n 
15 65   VAL n 
15 66   SER n 
15 67   VAL n 
15 68   ARG n 
15 69   LYS n 
15 70   GLY n 
15 71   SER n 
15 72   ALA n 
15 73   ARG n 
15 74   LYS n 
15 75   ARG n 
15 76   ARG n 
15 77   HIS n 
15 78   LYS n 
15 79   ALA n 
15 80   GLY n 
15 81   ARG n 
15 82   ARG n 
15 83   SER n 
15 84   LYS n 
15 85   ARG n 
15 86   GLN n 
15 87   GLY n 
15 88   VAL n 
15 89   THR n 
15 90   ARG n 
15 91   ILE n 
15 92   THR n 
15 93   ARG n 
15 94   ARG n 
15 95   LYS n 
15 96   ASP n 
15 97   ILE n 
15 98   GLN n 
15 99   ARG n 
15 100  VAL n 
15 101  ALA n 
15 102  GLU n 
15 103  GLU n 
15 104  ARG n 
15 105  ALA n 
15 106  SER n 
15 107  ARG n 
15 108  THR n 
15 109  PHE n 
15 110  PRO n 
15 111  ASN n 
15 112  LEU n 
15 113  ARG n 
15 114  VAL n 
15 115  LEU n 
15 116  ASN n 
15 117  SER n 
15 118  TYR n 
15 119  SER n 
15 120  VAL n 
15 121  GLY n 
15 122  GLN n 
15 123  ASP n 
15 124  GLY n 
15 125  ARG n 
15 126  GLN n 
15 127  LYS n 
15 128  TRP n 
15 129  HIS n 
15 130  GLU n 
15 131  VAL n 
15 132  ILE n 
15 133  LEU n 
15 134  ILE n 
15 135  ASP n 
15 136  PRO n 
15 137  ASN n 
15 138  HIS n 
15 139  PRO n 
15 140  ALA n 
15 141  ILE n 
15 142  GLN n 
15 143  ASN n 
15 144  ASP n 
15 145  ASP n 
15 146  ASP n 
15 147  LEU n 
15 148  SER n 
15 149  TRP n 
15 150  ILE n 
15 151  CYS n 
15 152  ALA n 
15 153  ASP n 
15 154  ASP n 
15 155  GLN n 
15 156  ALA n 
15 157  ASP n 
15 158  ARG n 
15 159  VAL n 
15 160  PHE n 
15 161  ARG n 
15 162  GLY n 
15 163  LEU n 
15 164  THR n 
15 165  GLY n 
15 166  ALA n 
15 167  GLY n 
15 168  ARG n 
15 169  ARG n 
15 170  ASN n 
15 171  ARG n 
15 172  GLY n 
15 173  LEU n 
15 174  SER n 
15 175  GLY n 
15 176  LYS n 
15 177  GLY n 
15 178  LYS n 
15 179  GLY n 
15 180  SER n 
15 181  GLU n 
15 182  LYS n 
15 183  THR n 
15 184  ARG n 
15 185  PRO n 
15 186  SER n 
15 187  LEU n 
15 188  ARG n 
15 189  SER n 
15 190  ASN n 
15 191  GLY n 
15 192  GLY n 
15 193  LYS n 
15 194  GLY n 
16 1    MET n 
16 2    ALA n 
16 3    THR n 
16 4    GLY n 
16 5    PRO n 
16 6    ARG n 
16 7    TYR n 
16 8    LYS n 
16 9    VAL n 
16 10   PRO n 
16 11   MET n 
16 12   ARG n 
16 13   ARG n 
16 14   ARG n 
16 15   ARG n 
16 16   GLU n 
16 17   ALA n 
16 18   ARG n 
16 19   THR n 
16 20   ASP n 
16 21   TYR n 
16 22   HIS n 
16 23   GLN n 
16 24   ARG n 
16 25   LEU n 
16 26   ARG n 
16 27   LEU n 
16 28   LEU n 
16 29   LYS n 
16 30   SER n 
16 31   GLY n 
16 32   LYS n 
16 33   PRO n 
16 34   ARG n 
16 35   LEU n 
16 36   VAL n 
16 37   ALA n 
16 38   ARG n 
16 39   LYS n 
16 40   SER n 
16 41   ASN n 
16 42   LYS n 
16 43   HIS n 
16 44   VAL n 
16 45   ARG n 
16 46   ALA n 
16 47   GLN n 
16 48   LEU n 
16 49   VAL n 
16 50   THR n 
16 51   LEU n 
16 52   GLY n 
16 53   PRO n 
16 54   ASN n 
16 55   GLY n 
16 56   ASP n 
16 57   ASP n 
16 58   THR n 
16 59   LEU n 
16 60   ALA n 
16 61   SER n 
16 62   ALA n 
16 63   HIS n 
16 64   SER n 
16 65   SER n 
16 66   ASP n 
16 67   LEU n 
16 68   ALA n 
16 69   GLU n 
16 70   TYR n 
16 71   GLY n 
16 72   TRP n 
16 73   GLU n 
16 74   ALA n 
16 75   PRO n 
16 76   THR n 
16 77   GLY n 
16 78   ASN n 
16 79   MET n 
16 80   PRO n 
16 81   SER n 
16 82   ALA n 
16 83   TYR n 
16 84   LEU n 
16 85   THR n 
16 86   GLY n 
16 87   LEU n 
16 88   LEU n 
16 89   ALA n 
16 90   GLY n 
16 91   LEU n 
16 92   ARG n 
16 93   ALA n 
16 94   GLN n 
16 95   GLU n 
16 96   ALA n 
16 97   GLY n 
16 98   VAL n 
16 99   GLU n 
16 100  GLU n 
16 101  ALA n 
16 102  VAL n 
16 103  LEU n 
16 104  ASP n 
16 105  ILE n 
16 106  GLY n 
16 107  LEU n 
16 108  ASN n 
16 109  SER n 
16 110  PRO n 
16 111  THR n 
16 112  PRO n 
16 113  GLY n 
16 114  SER n 
16 115  LYS n 
16 116  VAL n 
16 117  PHE n 
16 118  ALA n 
16 119  ILE n 
16 120  GLN n 
16 121  GLU n 
16 122  GLY n 
16 123  ALA n 
16 124  ILE n 
16 125  ASP n 
16 126  ALA n 
16 127  GLY n 
16 128  LEU n 
16 129  ASP n 
16 130  ILE n 
16 131  PRO n 
16 132  HIS n 
16 133  ASN n 
16 134  ASP n 
16 135  ASP n 
16 136  VAL n 
16 137  LEU n 
16 138  ALA n 
16 139  ASP n 
16 140  TRP n 
16 141  GLN n 
16 142  ARG n 
16 143  THR n 
16 144  ARG n 
16 145  GLY n 
16 146  ALA n 
16 147  HIS n 
16 148  ILE n 
16 149  ALA n 
16 150  GLU n 
16 151  TYR n 
16 152  ASP n 
16 153  GLU n 
16 154  GLN n 
16 155  LEU n 
16 156  GLU n 
16 157  GLU n 
16 158  PRO n 
16 159  LEU n 
16 160  TYR n 
16 161  SER n 
16 162  GLY n 
16 163  ASP n 
16 164  PHE n 
16 165  ASP n 
16 166  ALA n 
16 167  ALA n 
16 168  ASP n 
16 169  LEU n 
16 170  PRO n 
16 171  GLU n 
16 172  HIS n 
16 173  PHE n 
16 174  ASP n 
16 175  GLU n 
16 176  LEU n 
16 177  ARG n 
16 178  GLU n 
16 179  THR n 
16 180  LEU n 
16 181  LEU n 
16 182  ASP n 
16 183  GLY n 
16 184  ASP n 
16 185  ILE n 
16 186  GLU n 
16 187  LEU n 
17 1    MET n 
17 2    SER n 
17 3    LYS n 
17 4    THR n 
17 5    ASN n 
17 6    PRO n 
17 7    ARG n 
17 8    LEU n 
17 9    SER n 
17 10   SER n 
17 11   LEU n 
17 12   ILE n 
17 13   ALA n 
17 14   ASP n 
17 15   LEU n 
17 16   LYS n 
17 17   SER n 
17 18   ALA n 
17 19   ALA n 
17 20   ARG n 
17 21   SER n 
17 22   SER n 
17 23   GLY n 
17 24   GLY n 
17 25   ALA n 
17 26   VAL n 
17 27   TRP n 
17 28   GLY n 
17 29   ASP n 
17 30   VAL n 
17 31   ALA n 
17 32   GLU n 
17 33   ARG n 
17 34   LEU n 
17 35   GLU n 
17 36   LYS n 
17 37   PRO n 
17 38   ARG n 
17 39   ARG n 
17 40   THR n 
17 41   HIS n 
17 42   ALA n 
17 43   GLU n 
17 44   VAL n 
17 45   ASN n 
17 46   LEU n 
17 47   GLY n 
17 48   ARG n 
17 49   ILE n 
17 50   GLU n 
17 51   ARG n 
17 52   TYR n 
17 53   ALA n 
17 54   GLN n 
17 55   GLU n 
17 56   ASP n 
17 57   GLU n 
17 58   THR n 
17 59   VAL n 
17 60   VAL n 
17 61   VAL n 
17 62   PRO n 
17 63   GLY n 
17 64   LYS n 
17 65   VAL n 
17 66   LEU n 
17 67   GLY n 
17 68   SER n 
17 69   GLY n 
17 70   VAL n 
17 71   LEU n 
17 72   GLN n 
17 73   LYS n 
17 74   ASP n 
17 75   VAL n 
17 76   THR n 
17 77   VAL n 
17 78   ALA n 
17 79   ALA n 
17 80   VAL n 
17 81   ASP n 
17 82   PHE n 
17 83   SER n 
17 84   GLY n 
17 85   THR n 
17 86   ALA n 
17 87   GLU n 
17 88   THR n 
17 89   LYS n 
17 90   ILE n 
17 91   ASP n 
17 92   GLN n 
17 93   VAL n 
17 94   GLY n 
17 95   GLU n 
17 96   ALA n 
17 97   VAL n 
17 98   SER n 
17 99   LEU n 
17 100  GLU n 
17 101  GLN n 
17 102  ALA n 
17 103  ILE n 
17 104  GLU n 
17 105  ASN n 
17 106  ASN n 
17 107  PRO n 
17 108  GLU n 
17 109  GLY n 
17 110  SER n 
17 111  HIS n 
17 112  VAL n 
17 113  ARG n 
17 114  VAL n 
17 115  ILE n 
17 116  ARG n 
18 1    MET n 
18 2    THR n 
18 3    ASP n 
18 4    LEU n 
18 5    SER n 
18 6    ALA n 
18 7    GLN n 
18 8    LYS n 
18 9    ARG n 
18 10   LEU n 
18 11   ALA n 
18 12   ALA n 
18 13   ASP n 
18 14   VAL n 
18 15   LEU n 
18 16   ASP n 
18 17   VAL n 
18 18   GLY n 
18 19   LYS n 
18 20   ASN n 
18 21   ARG n 
18 22   VAL n 
18 23   TRP n 
18 24   PHE n 
18 25   ASN n 
18 26   PRO n 
18 27   GLU n 
18 28   ARG n 
18 29   GLN n 
18 30   GLY n 
18 31   ASP n 
18 32   ILE n 
18 33   ALA n 
18 34   ASP n 
18 35   ALA n 
18 36   ILE n 
18 37   THR n 
18 38   ARG n 
18 39   GLU n 
18 40   ASP n 
18 41   VAL n 
18 42   ARG n 
18 43   GLU n 
18 44   LEU n 
18 45   VAL n 
18 46   ASP n 
18 47   GLU n 
18 48   GLY n 
18 49   ALA n 
18 50   ILE n 
18 51   GLN n 
18 52   ALA n 
18 53   LYS n 
18 54   ASP n 
18 55   LYS n 
18 56   LYS n 
18 57   GLY n 
18 58   ASN n 
18 59   SER n 
18 60   ARG n 
18 61   GLY n 
18 62   ARG n 
18 63   ALA n 
18 64   ARG n 
18 65   GLU n 
18 66   ARG n 
18 67   GLN n 
18 68   LYS n 
18 69   LYS n 
18 70   ARG n 
18 71   ALA n 
18 72   TYR n 
18 73   GLY n 
18 74   HIS n 
18 75   GLN n 
18 76   LYS n 
18 77   GLY n 
18 78   ALA n 
18 79   GLY n 
18 80   SER n 
18 81   ARG n 
18 82   LYS n 
18 83   GLY n 
18 84   LYS n 
18 85   ALA n 
18 86   GLY n 
18 87   ALA n 
18 88   ARG n 
18 89   GLN n 
18 90   ASN n 
18 91   SER n 
18 92   LYS n 
18 93   GLU n 
18 94   ASP n 
18 95   TRP n 
18 96   GLU n 
18 97   SER n 
18 98   ARG n 
18 99   ILE n 
18 100  ARG n 
18 101  ALA n 
18 102  GLN n 
18 103  ARG n 
18 104  THR n 
18 105  LYS n 
18 106  LEU n 
18 107  ARG n 
18 108  GLU n 
18 109  LEU n 
18 110  ARG n 
18 111  ASP n 
18 112  GLU n 
18 113  GLY n 
18 114  THR n 
18 115  LEU n 
18 116  SER n 
18 117  SER n 
18 118  SER n 
18 119  GLN n 
18 120  TYR n 
18 121  ARG n 
18 122  ASP n 
18 123  LEU n 
18 124  TYR n 
18 125  ASP n 
18 126  LYS n 
18 127  ALA n 
18 128  GLY n 
18 129  GLY n 
18 130  GLY n 
18 131  GLU n 
18 132  PHE n 
18 133  ASP n 
18 134  SER n 
18 135  VAL n 
18 136  ALA n 
18 137  ASP n 
18 138  LEU n 
18 139  GLU n 
18 140  ARG n 
18 141  TYR n 
18 142  ILE n 
18 143  ASP n 
18 144  ALA n 
18 145  ASN n 
18 146  HIS n 
18 147  GLY n 
18 148  ASP n 
18 149  ALA n 
19 1    MET n 
19 2    PRO n 
19 3    SER n 
19 4    SER n 
19 5    ASN n 
19 6    GLY n 
19 7    PRO n 
19 8    LEU n 
19 9    GLU n 
19 10   GLY n 
19 11   THR n 
19 12   ARG n 
19 13   GLY n 
19 14   LYS n 
19 15   LEU n 
19 16   LYS n 
19 17   ASN n 
19 18   LYS n 
19 19   PRO n 
19 20   ARG n 
19 21   ASP n 
19 22   ARG n 
19 23   GLY n 
19 24   THR n 
19 25   SER n 
19 26   PRO n 
19 27   PRO n 
19 28   GLN n 
19 29   ARG n 
19 30   ALA n 
19 31   VAL n 
19 32   GLU n 
19 33   GLU n 
19 34   PHE n 
19 35   ASP n 
19 36   ASP n 
19 37   GLY n 
19 38   GLU n 
19 39   LYS n 
19 40   VAL n 
19 41   HIS n 
19 42   LEU n 
19 43   LYS n 
19 44   ILE n 
19 45   ASP n 
19 46   PRO n 
19 47   SER n 
19 48   VAL n 
19 49   PRO n 
19 50   ASN n 
19 51   GLY n 
19 52   ARG n 
19 53   PHE n 
19 54   HIS n 
19 55   PRO n 
19 56   ARG n 
19 57   PHE n 
19 58   ASP n 
19 59   GLY n 
19 60   GLN n 
19 61   THR n 
19 62   GLY n 
19 63   THR n 
19 64   VAL n 
19 65   GLU n 
19 66   GLY n 
19 67   LYS n 
19 68   GLN n 
19 69   GLY n 
19 70   ASP n 
19 71   ALA n 
19 72   TYR n 
19 73   LYS n 
19 74   VAL n 
19 75   ASP n 
19 76   ILE n 
19 77   VAL n 
19 78   ASP n 
19 79   GLY n 
19 80   GLY n 
19 81   LYS n 
19 82   GLU n 
19 83   LYS n 
19 84   THR n 
19 85   ILE n 
19 86   ILE n 
19 87   VAL n 
19 88   THR n 
19 89   ALA n 
19 90   ALA n 
19 91   HIS n 
19 92   LEU n 
19 93   ARG n 
19 94   ARG n 
19 95   GLN n 
19 96   GLU n 
20 1    MET n 
20 2    GLY n 
20 3    ILE n 
20 4    SER n 
20 5    TYR n 
20 6    SER n 
20 7    VAL n 
20 8    GLU n 
20 9    ALA n 
20 10   ASP n 
20 11   PRO n 
20 12   ASP n 
20 13   THR n 
20 14   THR n 
20 15   ALA n 
20 16   LYS n 
20 17   ALA n 
20 18   MET n 
20 19   LEU n 
20 20   ARG n 
20 21   GLU n 
20 22   ARG n 
20 23   GLN n 
20 24   MET n 
20 25   SER n 
20 26   PHE n 
20 27   LYS n 
20 28   HIS n 
20 29   SER n 
20 30   LYS n 
20 31   ALA n 
20 32   ILE n 
20 33   ALA n 
20 34   ARG n 
20 35   GLU n 
20 36   ILE n 
20 37   LYS n 
20 38   GLY n 
20 39   LYS n 
20 40   THR n 
20 41   ALA n 
20 42   GLY n 
20 43   GLU n 
20 44   ALA n 
20 45   VAL n 
20 46   ASP n 
20 47   TYR n 
20 48   LEU n 
20 49   GLU n 
20 50   ALA n 
20 51   VAL n 
20 52   ILE n 
20 53   GLU n 
20 54   GLY n 
20 55   ASP n 
20 56   GLN n 
20 57   PRO n 
20 58   VAL n 
20 59   PRO n 
20 60   PHE n 
20 61   LYS n 
20 62   GLN n 
20 63   HIS n 
20 64   ASN n 
20 65   SER n 
20 66   GLY n 
20 67   VAL n 
20 68   GLY n 
20 69   HIS n 
20 70   LYS n 
20 71   SER n 
20 72   LYS n 
20 73   VAL n 
20 74   ASP n 
20 75   GLY n 
20 76   TRP n 
20 77   ASP n 
20 78   ALA n 
20 79   GLY n 
20 80   ARG n 
20 81   TYR n 
20 82   PRO n 
20 83   GLU n 
20 84   LYS n 
20 85   ALA n 
20 86   SER n 
20 87   LYS n 
20 88   ALA n 
20 89   PHE n 
20 90   LEU n 
20 91   ASP n 
20 92   LEU n 
20 93   LEU n 
20 94   GLU n 
20 95   ASN n 
20 96   ALA n 
20 97   VAL n 
20 98   GLY n 
20 99   ASN n 
20 100  ALA n 
20 101  ASP n 
20 102  HIS n 
20 103  GLN n 
20 104  GLY n 
20 105  PHE n 
20 106  ASP n 
20 107  GLY n 
20 108  GLU n 
20 109  ALA n 
20 110  MET n 
20 111  THR n 
20 112  ILE n 
20 113  LYS n 
20 114  HIS n 
20 115  VAL n 
20 116  ALA n 
20 117  ALA n 
20 118  HIS n 
20 119  LYS n 
20 120  VAL n 
20 121  GLY n 
20 122  GLU n 
20 123  GLN n 
20 124  GLN n 
20 125  GLY n 
20 126  ARG n 
20 127  LYS n 
20 128  PRO n 
20 129  ARG n 
20 130  ALA n 
20 131  MET n 
20 132  GLY n 
20 133  ARG n 
20 134  ALA n 
20 135  SER n 
20 136  ALA n 
20 137  TRP n 
20 138  ASN n 
20 139  SER n 
20 140  PRO n 
20 141  GLN n 
20 142  VAL n 
20 143  ASP n 
20 144  VAL n 
20 145  GLU n 
20 146  LEU n 
20 147  ILE n 
20 148  LEU n 
20 149  GLU n 
20 150  GLU n 
20 151  PRO n 
20 152  GLU n 
20 153  VAL n 
20 154  GLU n 
20 155  ASP n 
21 1    MET n 
21 2    SER n 
21 3    TRP n 
21 4    ASP n 
21 5    VAL n 
21 6    ILE n 
21 7    LYS n 
21 8    HIS n 
21 9    PRO n 
21 10   HIS n 
21 11   VAL n 
21 12   THR n 
21 13   GLU n 
21 14   LYS n 
21 15   ALA n 
21 16   MET n 
21 17   ASN n 
21 18   ASP n 
21 19   MET n 
21 20   ASP n 
21 21   PHE n 
21 22   GLN n 
21 23   ASN n 
21 24   LYS n 
21 25   LEU n 
21 26   GLN n 
21 27   PHE n 
21 28   ALA n 
21 29   VAL n 
21 30   ASP n 
21 31   ASP n 
21 32   ARG n 
21 33   ALA n 
21 34   SER n 
21 35   LYS n 
21 36   GLY n 
21 37   GLU n 
21 38   VAL n 
21 39   ALA n 
21 40   ASP n 
21 41   ALA n 
21 42   VAL n 
21 43   GLU n 
21 44   GLU n 
21 45   GLN n 
21 46   TYR n 
21 47   ASP n 
21 48   VAL n 
21 49   THR n 
21 50   VAL n 
21 51   GLU n 
21 52   GLN n 
21 53   VAL n 
21 54   ASN n 
21 55   THR n 
21 56   GLN n 
21 57   ASN n 
21 58   THR n 
21 59   MET n 
21 60   ASP n 
21 61   GLY n 
21 62   GLU n 
21 63   LYS n 
21 64   LYS n 
21 65   ALA n 
21 66   VAL n 
21 67   VAL n 
21 68   ARG n 
21 69   LEU n 
21 70   SER n 
21 71   GLU n 
21 72   ASP n 
21 73   ASP n 
21 74   ASP n 
21 75   ALA n 
21 76   GLN n 
21 77   GLU n 
21 78   VAL n 
21 79   ALA n 
21 80   SER n 
21 81   ARG n 
21 82   ILE n 
21 83   GLY n 
21 84   VAL n 
21 85   PHE n 
22 1    MET n 
22 2    SER n 
22 3    LYS n 
22 4    GLN n 
22 5    PRO n 
22 6    ASP n 
22 7    LYS n 
22 8    GLN n 
22 9    ARG n 
22 10   LYS n 
22 11   SER n 
22 12   GLN n 
22 13   ARG n 
22 14   ARG n 
22 15   ALA n 
22 16   PRO n 
22 17   LEU n 
22 18   HIS n 
22 19   GLU n 
22 20   ARG n 
22 21   HIS n 
22 22   LYS n 
22 23   GLN n 
22 24   VAL n 
22 25   ARG n 
22 26   ALA n 
22 27   THR n 
22 28   LEU n 
22 29   SER n 
22 30   ALA n 
22 31   ASP n 
22 32   LEU n 
22 33   ARG n 
22 34   GLU n 
22 35   GLU n 
22 36   TYR n 
22 37   GLY n 
22 38   GLN n 
22 39   ARG n 
22 40   ASN n 
22 41   VAL n 
22 42   ARG n 
22 43   VAL n 
22 44   ASN n 
22 45   ALA n 
22 46   GLY n 
22 47   ASP n 
22 48   THR n 
22 49   VAL n 
22 50   GLU n 
22 51   VAL n 
22 52   LEU n 
22 53   ARG n 
22 54   GLY n 
22 55   ASP n 
22 56   PHE n 
22 57   ALA n 
22 58   GLY n 
22 59   GLU n 
22 60   GLU n 
22 61   GLY n 
22 62   GLU n 
22 63   VAL n 
22 64   ILE n 
22 65   ASN n 
22 66   VAL n 
22 67   ASP n 
22 68   LEU n 
22 69   ASP n 
22 70   LYS n 
22 71   ALA n 
22 72   VAL n 
22 73   ILE n 
22 74   HIS n 
22 75   VAL n 
22 76   GLU n 
22 77   ASP n 
22 78   VAL n 
22 79   THR n 
22 80   LEU n 
22 81   GLU n 
22 82   LYS n 
22 83   THR n 
22 84   ASP n 
22 85   GLY n 
22 86   GLU n 
22 87   GLU n 
22 88   VAL n 
22 89   PRO n 
22 90   ARG n 
22 91   PRO n 
22 92   LEU n 
22 93   ASP n 
22 94   THR n 
22 95   SER n 
22 96   ASN n 
22 97   VAL n 
22 98   ARG n 
22 99   VAL n 
22 100  THR n 
22 101  ASP n 
22 102  LEU n 
22 103  ASP n 
22 104  LEU n 
22 105  GLU n 
22 106  ASP n 
22 107  GLU n 
22 108  LYS n 
22 109  ARG n 
22 110  GLU n 
22 111  ALA n 
22 112  ARG n 
22 113  LEU n 
22 114  GLU n 
22 115  SER n 
22 116  GLU n 
22 117  ASP n 
22 118  ASP n 
22 119  SER n 
22 120  ALA n 
23 1    PRO n 
23 2    ARG n 
23 3    THR n 
23 4    ARG n 
23 5    GLU n 
23 6    CYS n 
23 7    ASP n 
23 8    TYR n 
23 9    CYS n 
23 10   GLY n 
23 11   THR n 
23 12   ASP n 
23 13   ILE n 
23 14   GLU n 
23 15   PRO n 
23 16   GLY n 
23 17   THR n 
23 18   GLY n 
23 19   THR n 
23 20   MET n 
23 21   PHE n 
23 22   VAL n 
23 23   HIS n 
23 24   LYS n 
23 25   ASP n 
23 26   GLY n 
23 27   ALA n 
23 28   THR n 
23 29   THR n 
23 30   HIS n 
23 31   PHE n 
23 32   CYS n 
23 33   SER n 
23 34   SER n 
23 35   LYS n 
23 36   CYS n 
23 37   GLU n 
23 38   ASN n 
23 39   ASN n 
23 40   ALA n 
23 41   ASP n 
23 42   LEU n 
23 43   GLY n 
23 44   ARG n 
23 45   GLU n 
23 46   ALA n 
23 47   ARG n 
23 48   ASN n 
23 49   LEU n 
23 50   GLU n 
23 51   TRP n 
23 52   THR n 
23 53   ASP n 
23 54   THR n 
23 55   ALA n 
23 56   ARG n 
23 57   GLY n 
23 58   GLU n 
23 59   ALA n 
23 60   GLY n 
23 61   GLU n 
23 62   ALA n 
23 63   GLU n 
23 64   ASP n 
23 65   GLU n 
23 66   ALA n 
24 1    MET n 
24 2    THR n 
24 3    VAL n 
24 4    LEU n 
24 5    HIS n 
24 6    VAL n 
24 7    GLN n 
24 8    GLU n 
24 9    ILE n 
24 10   ARG n 
24 11   ASP n 
24 12   MET n 
24 13   THR n 
24 14   PRO n 
24 15   ALA n 
24 16   GLU n 
24 17   ARG n 
24 18   GLU n 
24 19   ALA n 
24 20   GLU n 
24 21   LEU n 
24 22   ASP n 
24 23   ASP n 
24 24   LEU n 
24 25   LYS n 
24 26   THR n 
24 27   GLU n 
24 28   LEU n 
24 29   LEU n 
24 30   ASN n 
24 31   ALA n 
24 32   ARG n 
24 33   ALA n 
24 34   VAL n 
24 35   GLN n 
24 36   ALA n 
24 37   ALA n 
24 38   GLY n 
24 39   GLY n 
24 40   ALA n 
24 41   PRO n 
24 42   GLU n 
24 43   ASN n 
24 44   PRO n 
24 45   GLY n 
24 46   ARG n 
24 47   ILE n 
24 48   LYS n 
24 49   GLU n 
24 50   LEU n 
24 51   ARG n 
24 52   LYS n 
24 53   ALA n 
24 54   ILE n 
24 55   ALA n 
24 56   ARG n 
24 57   ILE n 
24 58   LYS n 
24 59   THR n 
24 60   ILE n 
24 61   GLN n 
24 62   GLY n 
24 63   GLU n 
24 64   GLU n 
24 65   GLY n 
24 66   ASP n 
24 67   LEU n 
24 68   GLN n 
24 69   GLU n 
24 70   ASN n 
24 71   GLU n 
25 1    MET n 
25 2    HIS n 
25 3    ALA n 
25 4    LEU n 
25 5    VAL n 
25 6    GLN n 
25 7    LEU n 
25 8    ARG n 
25 9    GLY n 
25 10   GLU n 
25 11   VAL n 
25 12   ASN n 
25 13   MET n 
25 14   HIS n 
25 15   THR n 
25 16   ASP n 
25 17   ILE n 
25 18   GLN n 
25 19   ASP n 
25 20   THR n 
25 21   LEU n 
25 22   GLU n 
25 23   MET n 
25 24   LEU n 
25 25   ASN n 
25 26   ILE n 
25 27   HIS n 
25 28   HIS n 
25 29   VAL n 
25 30   ASN n 
25 31   HIS n 
25 32   CYS n 
25 33   THR n 
25 34   LEU n 
25 35   VAL n 
25 36   PRO n 
25 37   GLU n 
25 38   THR n 
25 39   ASP n 
25 40   ALA n 
25 41   TYR n 
25 42   ARG n 
25 43   GLY n 
25 44   MET n 
25 45   VAL n 
25 46   ALA n 
25 47   LYS n 
25 48   VAL n 
25 49   ASN n 
25 50   ASP n 
25 51   PHE n 
25 52   VAL n 
25 53   ALA n 
25 54   PHE n 
25 55   GLY n 
25 56   GLU n 
25 57   PRO n 
25 58   SER n 
25 59   GLN n 
25 60   GLU n 
25 61   THR n 
25 62   LEU n 
25 63   GLU n 
25 64   THR n 
25 65   VAL n 
25 66   LEU n 
25 67   ALA n 
25 68   THR n 
25 69   ARG n 
25 70   ALA n 
25 71   GLU n 
25 72   PRO n 
25 73   LEU n 
25 74   GLU n 
25 75   GLY n 
25 76   ASP n 
25 77   ALA n 
25 78   ASP n 
25 79   VAL n 
25 80   ASP n 
25 81   ASP n 
25 82   GLU n 
25 83   TRP n 
25 84   VAL n 
25 85   ALA n 
25 86   GLU n 
25 87   HIS n 
25 88   THR n 
25 89   ASP n 
25 90   TYR n 
25 91   ASP n 
25 92   ASP n 
25 93   ILE n 
25 94   SER n 
25 95   GLY n 
25 96   LEU n 
25 97   ALA n 
25 98   PHE n 
25 99   ALA n 
25 100  LEU n 
25 101  LEU n 
25 102  SER n 
25 103  GLU n 
25 104  GLU n 
25 105  THR n 
25 106  THR n 
25 107  LEU n 
25 108  ARG n 
25 109  GLU n 
25 110  GLN n 
25 111  GLY n 
25 112  LEU n 
25 113  SER n 
25 114  PRO n 
25 115  THR n 
25 116  LEU n 
25 117  ARG n 
25 118  LEU n 
25 119  HIS n 
25 120  PRO n 
25 121  PRO n 
25 122  ARG n 
25 123  GLY n 
25 124  GLY n 
25 125  HIS n 
25 126  ASP n 
25 127  GLY n 
25 128  VAL n 
25 129  LYS n 
25 130  HIS n 
25 131  PRO n 
25 132  VAL n 
25 133  LYS n 
25 134  GLU n 
25 135  GLY n 
25 136  GLY n 
25 137  GLN n 
25 138  LEU n 
25 139  GLY n 
25 140  LYS n 
25 141  HIS n 
25 142  ASP n 
25 143  THR n 
25 144  GLU n 
25 145  GLY n 
25 146  ILE n 
25 147  ASP n 
25 148  ASP n 
25 149  LEU n 
25 150  LEU n 
25 151  GLU n 
25 152  ALA n 
25 153  MET n 
25 154  ARG n 
26 1    MET n 
26 2    SER n 
26 3    ALA n 
26 4    SER n 
26 5    ASP n 
26 6    PHE n 
26 7    GLU n 
26 8    GLU n 
26 9    ARG n 
26 10   VAL n 
26 11   VAL n 
26 12   THR n 
26 13   ILE n 
26 14   PRO n 
26 15   LEU n 
26 16   ARG n 
26 17   ASP n 
26 18   ALA n 
26 19   ARG n 
26 20   ALA n 
26 21   GLU n 
26 22   PRO n 
26 23   ASN n 
26 24   HIS n 
26 25   LYS n 
26 26   ARG n 
26 27   ALA n 
26 28   ASP n 
26 29   LYS n 
26 30   ALA n 
26 31   MET n 
26 32   ILE n 
26 33   LEU n 
26 34   ILE n 
26 35   ARG n 
26 36   GLU n 
26 37   HIS n 
26 38   LEU n 
26 39   ALA n 
26 40   LYS n 
26 41   HIS n 
26 42   PHE n 
26 43   SER n 
26 44   VAL n 
26 45   ASP n 
26 46   GLU n 
26 47   ASP n 
26 48   ALA n 
26 49   VAL n 
26 50   ARG n 
26 51   LEU n 
26 52   ASP n 
26 53   PRO n 
26 54   SER n 
26 55   ILE n 
26 56   ASN n 
26 57   GLU n 
26 58   ALA n 
26 59   ALA n 
26 60   TRP n 
26 61   ALA n 
26 62   ARG n 
26 63   GLY n 
26 64   ARG n 
26 65   ALA n 
26 66   ASN n 
26 67   THR n 
26 68   PRO n 
26 69   SER n 
26 70   LYS n 
26 71   ILE n 
26 72   ARG n 
26 73   VAL n 
26 74   ARG n 
26 75   ALA n 
26 76   ALA n 
26 77   ARG n 
26 78   PHE n 
26 79   GLU n 
26 80   GLU n 
26 81   GLU n 
26 82   GLY n 
26 83   GLU n 
26 84   ALA n 
26 85   ILE n 
26 86   VAL n 
26 87   GLU n 
26 88   ALA n 
26 89   GLU n 
26 90   THR n 
26 91   ALA n 
26 92   GLU n 
27 1    MET n 
27 2    ALA n 
27 3    ASP n 
27 4    ASN n 
27 5    GLU n 
27 6    GLU n 
27 7    ASP n 
27 8    VAL n 
27 9    GLU n 
27 10   ALA n 
27 11   GLU n 
27 12   GLU n 
27 13   GLU n 
27 14   TYR n 
27 15   THR n 
27 16   GLU n 
27 17   LEU n 
27 18   THR n 
27 19   ASP n 
27 20   ILE n 
27 21   SER n 
27 22   GLY n 
27 23   VAL n 
27 24   GLY n 
27 25   PRO n 
27 26   SER n 
27 27   LYS n 
27 28   ALA n 
27 29   GLU n 
27 30   SER n 
27 31   LEU n 
27 32   ARG n 
27 33   GLU n 
27 34   ALA n 
27 35   GLY n 
27 36   PHE n 
27 37   GLU n 
27 38   SER n 
27 39   VAL n 
27 40   GLU n 
27 41   ASP n 
27 42   VAL n 
27 43   ARG n 
27 44   GLY n 
27 45   ALA n 
27 46   ASP n 
27 47   GLN n 
27 48   SER n 
27 49   ALA n 
27 50   LEU n 
27 51   ALA n 
27 52   ASP n 
27 53   VAL n 
27 54   SER n 
27 55   GLY n 
27 56   ILE n 
27 57   GLY n 
27 58   ASN n 
27 59   ALA n 
27 60   LEU n 
27 61   ALA n 
27 62   ALA n 
27 63   ARG n 
27 64   ILE n 
27 65   LYS n 
27 66   ALA n 
27 67   ASP n 
27 68   VAL n 
27 69   GLY n 
27 70   GLY n 
27 71   LEU n 
27 72   GLU n 
27 73   VAL n 
27 74   GLU n 
27 75   SER n 
27 76   GLU n 
27 77   THR n 
27 78   GLU n 
27 79   ALA n 
27 80   GLU n 
27 81   VAL n 
27 82   GLU n 
27 83   GLU n 
27 84   GLU n 
27 85   GLY n 
27 86   GLY n 
27 87   GLU n 
27 88   GLU n 
27 89   ALA n 
27 90   PRO n 
27 91   ASP n 
27 92   GLU n 
27 93   ASP n 
27 94   VAL n 
27 95   GLU n 
27 96   THR n 
27 97   GLU n 
27 98   LEU n 
27 99   GLN n 
27 100  ALA n 
27 101  ARG n 
27 102  GLY n 
27 103  LEU n 
27 104  THR n 
27 105  GLU n 
27 106  LYS n 
27 107  THR n 
27 108  PRO n 
27 109  ASP n 
27 110  LEU n 
27 111  SER n 
27 112  ASP n 
27 113  GLU n 
27 114  ASP n 
27 115  ALA n 
27 116  ARG n 
27 117  LEU n 
27 118  LEU n 
27 119  THR n 
27 120  GLN n 
27 121  ARG n 
27 122  HIS n 
27 123  ARG n 
27 124  VAL n 
27 125  GLY n 
27 126  LYS n 
27 127  PRO n 
27 128  GLN n 
27 129  PHE n 
27 130  ASN n 
27 131  ARG n 
27 132  GLN n 
27 133  ASP n 
27 134  HIS n 
27 135  HIS n 
27 136  LYS n 
27 137  LYS n 
27 138  LYS n 
27 139  ARG n 
27 140  VAL n 
27 141  SER n 
27 142  THR n 
27 143  SER n 
27 144  TRP n 
27 145  ARG n 
27 146  LYS n 
27 147  PRO n 
27 148  ARG n 
27 149  GLY n 
27 150  GLN n 
27 151  LEU n 
27 152  SER n 
27 153  LYS n 
27 154  GLN n 
27 155  ARG n 
27 156  ARG n 
27 157  GLY n 
27 158  ILE n 
27 159  LYS n 
27 160  GLY n 
27 161  LYS n 
27 162  GLY n 
27 163  ASP n 
27 164  THR n 
27 165  VAL n 
27 166  GLU n 
27 167  ALA n 
27 168  GLY n 
27 169  PHE n 
27 170  ARG n 
27 171  SER n 
27 172  PRO n 
27 173  THR n 
27 174  ALA n 
27 175  VAL n 
27 176  ARG n 
27 177  GLY n 
27 178  LYS n 
27 179  HIS n 
27 180  PRO n 
27 181  SER n 
27 182  GLY n 
27 183  PHE n 
27 184  GLU n 
27 185  GLU n 
27 186  VAL n 
27 187  ARG n 
27 188  VAL n 
27 189  HIS n 
27 190  ASN n 
27 191  VAL n 
27 192  ASP n 
27 193  ASP n 
27 194  LEU n 
27 195  GLU n 
27 196  GLY n 
27 197  VAL n 
27 198  ASP n 
27 199  GLY n 
27 200  ASP n 
27 201  THR n 
27 202  GLU n 
27 203  ALA n 
27 204  VAL n 
27 205  ARG n 
27 206  ILE n 
27 207  ALA n 
27 208  SER n 
27 209  LYS n 
27 210  VAL n 
27 211  GLY n 
27 212  ALA n 
27 213  ARG n 
27 214  LYS n 
27 215  ARG n 
27 216  GLU n 
27 217  ARG n 
27 218  ILE n 
27 219  GLU n 
27 220  GLU n 
27 221  GLU n 
27 222  ALA n 
27 223  GLU n 
27 224  ASP n 
27 225  ALA n 
27 226  GLY n 
27 227  ILE n 
27 228  ARG n 
27 229  VAL n 
27 230  LEU n 
27 231  ASN n 
27 232  PRO n 
27 233  THR n 
27 234  TYR n 
27 235  VAL n 
27 236  GLU n 
27 237  VAL n 
27 238  GLU n 
27 239  VAL n 
27 240  SER n 
27 241  GLU n 
28 1    ARG n 
28 2    SER n 
28 3    GLY n 
28 4    ARG n 
28 5    PHE n 
28 6    GLY n 
28 7    ALA n 
28 8    ARG n 
28 9    TYR n 
28 10   GLY n 
28 11   ARG n 
28 12   VAL n 
28 13   SER n 
28 14   ARG n 
28 15   ARG n 
28 16   ARG n 
28 17   VAL n 
28 18   ALA n 
28 19   GLU n 
28 20   ILE n 
28 21   GLU n 
28 22   SER n 
28 23   GLU n 
28 24   MET n 
28 25   ASN n 
28 26   GLU n 
28 27   ASP n 
28 28   HIS n 
28 29   ALA n 
28 30   CYS n 
28 31   PRO n 
28 32   ASN n 
28 33   CYS n 
28 34   GLY n 
28 35   GLU n 
28 36   ASP n 
28 37   ARG n 
28 38   VAL n 
28 39   ASP n 
28 40   ARG n 
28 41   GLN n 
28 42   GLY n 
28 43   THR n 
28 44   GLY n 
28 45   ILE n 
28 46   TRP n 
28 47   GLN n 
28 48   CYS n 
28 49   SER n 
28 50   TYR n 
28 51   CYS n 
28 52   ASP n 
28 53   TYR n 
28 54   LYS n 
28 55   PHE n 
28 56   THR n 
28 57   GLY n 
28 58   GLY n 
28 59   SER n 
28 60   TYR n 
28 61   LYS n 
28 62   PRO n 
28 63   GLU n 
28 64   THR n 
28 65   PRO n 
28 66   GLY n 
28 67   GLY n 
28 68   LYS n 
28 69   THR n 
28 70   VAL n 
28 71   ARG n 
28 72   ARG n 
28 73   SER n 
28 74   ILE n 
28 75   ARG n 
28 76   ALA n 
28 77   ALA n 
28 78   LEU n 
28 79   SER n 
28 80   GLU n 
28 81   ASP n 
28 82   GLU n 
28 83   GLU n 
29 1    MET n 
29 2    THR n 
29 3    GLY n 
29 4    ALA n 
29 5    GLY n 
29 6    THR n 
29 7    PRO n 
29 8    SER n 
29 9    GLN n 
29 10   GLY n 
29 11   LYS n 
29 12   LYS n 
29 13   ASN n 
29 14   THR n 
29 15   THR n 
29 16   THR n 
29 17   HIS n 
29 18   THR n 
29 19   LYS n 
29 20   CYS n 
29 21   ARG n 
29 22   ARG n 
29 23   CYS n 
29 24   GLY n 
29 25   GLU n 
29 26   LYS n 
29 27   SER n 
29 28   TYR n 
29 29   HIS n 
29 30   THR n 
29 31   LYS n 
29 32   LYS n 
29 33   LYS n 
29 34   VAL n 
29 35   CYS n 
29 36   SER n 
29 37   SER n 
29 38   CYS n 
29 39   GLY n 
29 40   PHE n 
29 41   GLY n 
29 42   LYS n 
29 43   SER n 
29 44   ALA n 
29 45   LYS n 
29 46   ARG n 
29 47   ARG n 
29 48   ASP n 
29 49   TYR n 
29 50   GLU n 
29 51   TRP n 
29 52   GLN n 
29 53   SER n 
29 54   LYS n 
29 55   ALA n 
29 56   GLY n 
29 57   GLU n 
30 1    MET n 
30 2    GLY n 
30 3    LYS n 
30 4    LYS n 
30 5    SER n 
30 6    LYS n 
30 7    ALA n 
30 8    THR n 
30 9    LYS n 
30 10   LYS n 
30 11   ARG n 
30 12   LEU n 
30 13   ALA n 
30 14   LYS n 
30 15   LEU n 
30 16   ASP n 
30 17   ASN n 
30 18   GLN n 
30 19   ASN n 
30 20   SER n 
30 21   ARG n 
30 22   VAL n 
30 23   PRO n 
30 24   ALA n 
30 25   TRP n 
30 26   VAL n 
30 27   MET n 
30 28   LEU n 
30 29   LYS n 
30 30   THR n 
30 31   ASP n 
30 32   ARG n 
30 33   GLU n 
30 34   VAL n 
30 35   GLN n 
30 36   ARG n 
30 37   ASN n 
30 38   HIS n 
30 39   LYS n 
30 40   ARG n 
30 41   ARG n 
30 42   HIS n 
30 43   TRP n 
30 44   ARG n 
30 45   ARG n 
30 46   ASN n 
30 47   ASP n 
30 48   THR n 
30 49   ASP n 
30 50   GLU n 
31 1    MET n 
31 2    GLN n 
31 3    MET n 
31 4    PRO n 
31 5    ARG n 
31 6    ARG n 
31 7    PHE n 
31 8    ASN n 
31 9    THR n 
31 10   TYR n 
31 11   CYS n 
31 12   PRO n 
31 13   HIS n 
31 14   CYS n 
31 15   ASN n 
31 16   GLU n 
31 17   HIS n 
31 18   GLN n 
31 19   GLU n 
31 20   HIS n 
31 21   GLU n 
31 22   VAL n 
31 23   GLU n 
31 24   LYS n 
31 25   VAL n 
31 26   ARG n 
31 27   SER n 
31 28   GLY n 
31 29   ARG n 
31 30   GLN n 
31 31   THR n 
31 32   GLY n 
31 33   MET n 
31 34   LYS n 
31 35   TRP n 
31 36   ILE n 
31 37   ASP n 
31 38   ARG n 
31 39   GLN n 
31 40   ARG n 
31 41   GLU n 
31 42   ARG n 
31 43   ASN n 
31 44   SER n 
31 45   GLY n 
31 46   ILE n 
31 47   GLY n 
31 48   ASN n 
31 49   ASP n 
31 50   GLY n 
31 51   LYS n 
31 52   PHE n 
31 53   SER n 
31 54   LYS n 
31 55   VAL n 
31 56   PRO n 
31 57   GLY n 
31 58   GLY n 
31 59   ASP n 
31 60   LYS n 
31 61   PRO n 
31 62   THR n 
31 63   LYS n 
31 64   LYS n 
31 65   THR n 
31 66   ASP n 
31 67   LEU n 
31 68   LYS n 
31 69   TYR n 
31 70   ARG n 
31 71   CYS n 
31 72   GLY n 
31 73   GLU n 
31 74   CYS n 
31 75   GLY n 
31 76   LYS n 
31 77   ALA n 
31 78   HIS n 
31 79   LEU n 
31 80   ARG n 
31 81   GLU n 
31 82   GLY n 
31 83   TRP n 
31 84   ARG n 
31 85   ALA n 
31 86   GLY n 
31 87   ARG n 
31 88   LEU n 
31 89   GLU n 
31 90   PHE n 
31 91   GLN n 
31 92   GLU n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
15 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
16 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
17 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
18 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
19 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
20 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
21 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
22 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
23 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
24 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
25 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
26 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
27 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
28 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
29 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
30 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
31 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT41 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1MA 'RNA linking'       n "6-HYDRO-1-METHYLADENOSINE-5'-MONOPHOSPHATE" ? 'C11 H16 N5 O7 P' 361.248 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"                 ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                  ? 'C9 H14 N3 O8 P'  323.197 
CD  non-polymer         . 'CADMIUM ION'                                ? 'Cd 2'            112.411 
CL  non-polymer         . 'CHLORIDE ION'                               ? 'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE                                     ? 'C3 H7 N O2 S'    121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"                 ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                   ? 'C6 H13 N O2'     131.173 
K   non-polymer         . 'POTASSIUM ION'                              ? 'K 1'             39.098  
LEU 'L-peptide linking' y LEUCINE                                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                   ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                              ? 'Mg 2'            24.305  
NA  non-polymer         . 'SODIUM ION'                                 ? 'Na 1'            22.990  
OMG 'RNA linking'       n "O2'-METHYLGUANOSINE-5'-MONOPHOSPHATE"       ? 'C11 H16 N5 O8 P' 377.247 
OMU 'RNA linking'       n 
;O2'-METHYLURIDINE 5'-MONOPHOSPHATE
;
? 'C10 H15 N2 O9 P' 338.208 
PHE 'L-peptide linking' y PHENYLALANINE                                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                      ? 'C5 H9 N O2'      115.130 
PSU 'RNA linking'       n "PSEUDOURIDINE-5'-MONOPHOSPHATE"             ? 'C9 H13 N2 O9 P'  324.181 
SER 'L-peptide linking' y SERINE                                       ? 'C3 H7 N O3'      105.093 
SR  non-polymer         . 'STRONTIUM ION'                              ? 'Sr 2'            87.620  
THR 'L-peptide linking' y THREONINE                                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                   ? 'C9 H13 N2 O9 P'  324.181 
UR3 'RNA linking'       n "3-METHYLURIDINE-5'-MONOPHOSHATE"            ? 'C10 H15 N2 O9 P' 338.208 
VAL 'L-peptide linking' y VALINE                                       ? 'C5 H11 N O2'     117.146 
ZIT non-polymer         . AZITHROMYCIN                                 ? 'C38 H72 N2 O12'  748.984 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A  1  1    G   1    1    ?    ?   ?   0 . n 
A  1  2    U   2    2    ?    ?   ?   0 . n 
A  1  3    U   3    3    ?    ?   ?   0 . n 
A  1  4    G   4    4    ?    ?   ?   0 . n 
A  1  5    G   5    5    ?    ?   ?   0 . n 
A  1  6    C   6    6    ?    ?   ?   0 . n 
A  1  7    U   7    7    ?    ?   ?   0 . n 
A  1  8    A   8    8    ?    ?   ?   0 . n 
A  1  9    C   9    9    ?    ?   ?   0 . n 
A  1  10   U   10   10   10   U   U   0 . n 
A  1  11   A   11   11   11   A   A   0 . n 
A  1  12   U   12   12   12   U   U   0 . n 
A  1  13   G   13   13   13   G   G   0 . n 
A  1  14   C   14   14   14   C   C   0 . n 
A  1  15   C   15   15   15   C   C   0 . n 
A  1  16   A   16   16   16   A   A   0 . n 
A  1  17   G   17   17   17   G   G   0 . n 
A  1  18   C   18   18   18   C   C   0 . n 
A  1  19   U   19   19   19   U   U   0 . n 
A  1  20   G   20   20   20   G   G   0 . n 
A  1  21   G   21   21   21   G   G   0 . n 
A  1  22   U   22   22   22   U   U   0 . n 
A  1  23   G   23   23   23   G   G   0 . n 
A  1  24   G   24   24   24   G   G   0 . n 
A  1  25   A   25   25   25   A   A   0 . n 
A  1  26   U   26   26   26   U   U   0 . n 
A  1  27   U   27   27   27   U   U   0 . n 
A  1  28   G   28   28   28   G   G   0 . n 
A  1  29   C   29   29   29   C   C   0 . n 
A  1  30   U   30   30   30   U   U   0 . n 
A  1  31   C   31   31   31   C   C   0 . n 
A  1  32   G   32   32   32   G   G   0 . n 
A  1  33   G   33   33   33   G   G   0 . n 
A  1  34   C   34   34   34   C   C   0 . n 
A  1  35   U   35   35   35   U   U   0 . n 
A  1  36   C   36   36   36   C   C   0 . n 
A  1  37   A   37   37   37   A   A   0 . n 
A  1  38   G   38   38   38   G   G   0 . n 
A  1  39   G   39   39   39   G   G   0 . n 
A  1  40   C   40   40   40   C   C   0 . n 
A  1  41   G   41   41   41   G   G   0 . n 
A  1  42   C   42   42   42   C   C   0 . n 
A  1  43   U   43   43   43   U   U   0 . n 
A  1  44   G   44   44   44   G   G   0 . n 
A  1  45   A   45   45   45   A   A   0 . n 
A  1  46   U   46   46   46   U   U   0 . n 
A  1  47   G   47   47   47   G   G   0 . n 
A  1  48   A   48   48   48   A   A   0 . n 
A  1  49   A   49   49   49   A   A   0 . n 
A  1  50   G   50   50   50   G   G   0 . n 
A  1  51   G   51   51   51   G   G   0 . n 
A  1  52   A   52   52   52   A   A   0 . n 
A  1  53   C   53   53   53   C   C   0 . n 
A  1  54   G   54   54   54   G   G   0 . n 
A  1  55   U   55   55   55   U   U   0 . n 
A  1  56   G   56   56   56   G   G   0 . n 
A  1  57   C   57   57   57   C   C   0 . n 
A  1  58   C   58   58   58   C   C   0 . n 
A  1  59   A   59   59   59   A   A   0 . n 
A  1  60   A   60   60   60   A   A   0 . n 
A  1  61   G   61   61   61   G   G   0 . n 
A  1  62   C   62   62   62   C   C   0 . n 
A  1  63   U   63   63   63   U   U   0 . n 
A  1  64   G   64   64   64   G   G   0 . n 
A  1  65   C   65   65   65   C   C   0 . n 
A  1  66   G   66   66   66   G   G   0 . n 
A  1  67   A   67   67   67   A   A   0 . n 
A  1  68   U   68   68   68   U   U   0 . n 
A  1  69   A   69   69   69   A   A   0 . n 
A  1  70   A   70   70   70   A   A   0 . n 
A  1  71   G   71   71   71   G   G   0 . n 
A  1  72   C   72   72   72   C   C   0 . n 
A  1  73   U   73   73   73   U   U   0 . n 
A  1  74   G   74   74   74   G   G   0 . n 
A  1  75   U   75   75   75   U   U   0 . n 
A  1  76   G   76   76   76   G   G   0 . n 
A  1  77   G   77   77   77   G   G   0 . n 
A  1  78   G   78   78   78   G   G   0 . n 
A  1  79   G   79   79   79   G   G   0 . n 
A  1  80   A   80   80   80   A   A   0 . n 
A  1  81   G   81   81   81   G   G   0 . n 
A  1  82   C   82   82   82   C   C   0 . n 
A  1  83   C   83   83   83   C   C   0 . n 
A  1  84   G   84   84   84   G   G   0 . n 
A  1  85   C   85   85   85   C   C   0 . n 
A  1  86   A   86   86   86   A   A   0 . n 
A  1  87   C   87   87   87   C   C   0 . n 
A  1  88   G   88   88   88   G   G   0 . n 
A  1  89   G   89   89   89   G   G   0 . n 
A  1  90   A   90   90   90   A   A   0 . n 
A  1  91   G   91   91   91   G   G   0 . n 
A  1  92   G   92   92   92   G   G   0 . n 
A  1  93   C   93   93   93   C   C   0 . n 
A  1  94   G   94   94   94   G   G   0 . n 
A  1  95   A   95   95   95   A   A   0 . n 
A  1  96   A   96   96   96   A   A   0 . n 
A  1  97   G   97   97   97   G   G   0 . n 
A  1  98   A   98   98   98   A   A   0 . n 
A  1  99   A   99   99   99   A   A   0 . n 
A  1  100  C   100  100  100  C   C   0 . n 
A  1  101  C   101  101  101  C   C   0 . n 
A  1  102  A   102  102  102  A   A   0 . n 
A  1  103  C   103  103  103  C   C   0 . n 
A  1  104  A   104  104  104  A   A   0 . n 
A  1  105  G   105  105  105  G   G   0 . n 
A  1  106  A   106  106  106  A   A   0 . n 
A  1  107  U   107  107  107  U   U   0 . n 
A  1  108  U   108  108  108  U   U   0 . n 
A  1  109  U   109  109  109  U   U   0 . n 
A  1  110  C   110  110  110  C   C   0 . n 
A  1  111  C   111  111  111  C   C   0 . n 
A  1  112  G   112  112  112  G   G   0 . n 
A  1  113  A   113  113  113  A   A   0 . n 
A  1  114  A   114  114  114  A   A   0 . n 
A  1  115  U   115  115  115  U   U   0 . n 
A  1  116  G   116  116  116  G   G   0 . n 
A  1  117  A   117  117  117  A   A   0 . n 
A  1  118  G   118  118  118  G   G   0 . n 
A  1  119  A   119  119  119  A   A   0 . n 
A  1  120  A   120  120  120  A   A   0 . n 
A  1  121  U   121  121  121  U   U   0 . n 
A  1  122  C   122  122  122  C   C   0 . n 
A  1  123  U   123  123  123  U   U   0 . n 
A  1  124  C   124  124  124  C   C   0 . n 
A  1  125  U   125  125  125  U   U   0 . n 
A  1  126  C   126  126  ?    ?   ?   0 . n 
A  1  127  U   127  127  ?    ?   ?   0 . n 
A  1  128  A   128  128  128  A   A   0 . n 
A  1  129  A   129  129  129  A   A   0 . n 
A  1  130  C   130  130  130  C   C   0 . n 
A  1  131  A   131  131  131  A   A   0 . n 
A  1  132  A   132  132  132  A   A   0 . n 
A  1  133  U   133  133  133  U   U   0 . n 
A  1  134  U   134  134  134  U   U   0 . n 
A  1  135  G   135  135  135  G   G   0 . n 
A  1  136  C   136  136  136  C   C   0 . n 
A  1  137  U   137  137  137  U   U   0 . n 
A  1  138  U   138  138  138  U   U   0 . n 
A  1  139  C   139  139  139  C   C   0 . n 
A  1  140  G   140  140  140  G   G   0 . n 
A  1  141  C   141  141  141  C   C   0 . n 
A  1  142  G   142  142  142  G   G   0 . n 
A  1  143  C   143  143  143  C   C   0 . n 
A  1  144  A   144  144  144  A   A   0 . n 
A  1  145  A   145  145  145  A   A   0 . n 
A  1  146  U   146  146  146  U   U   0 . n 
A  1  147  G   147  147  147  G   G   0 . n 
A  1  148  A   148  148  148  A   A   0 . n 
A  1  149  G   149  149  149  G   G   0 . n 
A  1  150  G   150  150  150  G   G   0 . n 
A  1  151  A   151  151  151  A   A   0 . n 
A  1  152  A   152  152  152  A   A   0 . n 
A  1  153  C   153  153  153  C   C   0 . n 
A  1  154  C   154  154  154  C   C   0 . n 
A  1  155  C   155  155  155  C   C   0 . n 
A  1  156  C   156  156  156  C   C   0 . n 
A  1  157  G   157  157  157  G   G   0 . n 
A  1  158  A   158  158  158  A   A   0 . n 
A  1  159  G   159  159  159  G   G   0 . n 
A  1  160  A   160  160  160  A   A   0 . n 
A  1  161  A   161  161  161  A   A   0 . n 
A  1  162  C   162  162  162  C   C   0 . n 
A  1  163  U   163  163  163  U   U   0 . n 
A  1  164  G   164  164  164  G   G   0 . n 
A  1  165  A   165  165  165  A   A   0 . n 
A  1  166  A   166  166  166  A   A   0 . n 
A  1  167  A   167  167  167  A   A   0 . n 
A  1  168  C   168  168  168  C   C   0 . n 
A  1  169  A   169  169  169  A   A   0 . n 
A  1  170  U   170  170  170  U   U   0 . n 
A  1  171  C   171  171  171  C   C   0 . n 
A  1  172  U   172  172  172  U   U   0 . n 
A  1  173  C   173  173  173  C   C   0 . n 
A  1  174  A   174  174  174  A   A   0 . n 
A  1  175  G   175  175  175  G   G   0 . n 
A  1  176  U   176  176  176  U   U   0 . n 
A  1  177  A   177  177  177  A   A   0 . n 
A  1  178  U   178  178  178  U   U   0 . n 
A  1  179  C   179  179  179  C   C   0 . n 
A  1  180  G   180  180  180  G   G   0 . n 
A  1  181  G   181  181  181  G   G   0 . n 
A  1  182  G   182  182  182  G   G   0 . n 
A  1  183  A   183  183  183  A   A   0 . n 
A  1  184  G   184  184  184  G   G   0 . n 
A  1  185  G   185  185  185  G   G   0 . n 
A  1  186  A   186  186  186  A   A   0 . n 
A  1  187  A   187  187  187  A   A   0 . n 
A  1  188  C   188  188  188  C   C   0 . n 
A  1  189  A   189  189  189  A   A   0 . n 
A  1  190  G   190  190  190  G   G   0 . n 
A  1  191  A   191  191  191  A   A   0 . n 
A  1  192  A   192  192  192  A   A   0 . n 
A  1  193  A   193  193  193  A   A   0 . n 
A  1  194  A   194  194  194  A   A   0 . n 
A  1  195  C   195  195  195  C   C   0 . n 
A  1  196  G   196  196  196  G   G   0 . n 
A  1  197  C   197  197  197  C   C   0 . n 
A  1  198  A   198  198  198  A   A   0 . n 
A  1  199  A   199  199  199  A   A   0 . n 
A  1  200  C   200  200  200  C   C   0 . n 
A  1  201  G   201  201  201  G   G   0 . n 
A  1  202  U   202  202  202  U   U   0 . n 
A  1  203  G   203  203  203  G   G   0 . n 
A  1  204  A   204  204  204  A   A   0 . n 
A  1  205  U   205  205  205  U   U   0 . n 
A  1  206  G   206  206  206  G   G   0 . n 
A  1  207  U   207  207  207  U   U   0 . n 
A  1  208  C   208  208  208  C   C   0 . n 
A  1  209  G   209  209  209  G   G   0 . n 
A  1  210  U   210  210  210  U   U   0 . n 
A  1  211  U   211  211  211  U   U   0 . n 
A  1  212  A   212  212  212  A   A   0 . n 
A  1  213  G   213  213  213  G   G   0 . n 
A  1  214  U   214  214  214  U   U   0 . n 
A  1  215  A   215  215  215  A   A   0 . n 
A  1  216  A   216  216  216  A   A   0 . n 
A  1  217  C   217  217  217  C   C   0 . n 
A  1  218  C   218  218  218  C   C   0 . n 
A  1  219  G   219  219  219  G   G   0 . n 
A  1  220  C   220  220  220  C   C   0 . n 
A  1  221  G   221  221  221  G   G   0 . n 
A  1  222  A   222  222  222  A   A   0 . n 
A  1  223  G   223  223  223  G   G   0 . n 
A  1  224  U   224  224  224  U   U   0 . n 
A  1  225  G   225  225  225  G   G   0 . n 
A  1  226  A   226  226  226  A   A   0 . n 
A  1  227  A   227  227  227  A   A   0 . n 
A  1  228  C   228  228  228  C   C   0 . n 
A  1  229  G   229  229  229  G   G   0 . n 
A  1  230  C   230  230  230  C   C   0 . n 
A  1  231  G   231  231  231  G   G   0 . n 
A  1  232  A   232  232  232  A   A   0 . n 
A  1  233  U   233  233  233  U   U   0 . n 
A  1  234  A   234  234  234  A   A   0 . n 
A  1  235  C   235  235  235  C   C   0 . n 
A  1  236  A   236  236  236  A   A   0 . n 
A  1  237  G   237  237  237  G   G   0 . n 
A  1  238  C   238  238  238  C   C   0 . n 
A  1  239  C   239  239  239  C   C   0 . n 
A  1  240  C   240  240  240  C   C   0 . n 
A  1  241  A   241  241  241  A   A   0 . n 
A  1  242  A   242  242  242  A   A   0 . n 
A  1  243  A   243  243  243  A   A   0 . n 
A  1  244  C   244  244  244  C   C   0 . n 
A  1  245  C   245  245  245  C   C   0 . n 
A  1  246  G   246  246  246  G   G   0 . n 
A  1  247  A   247  247  247  A   A   0 . n 
A  1  248  A   248  248  248  A   A   0 . n 
A  1  249  G   249  249  249  G   G   0 . n 
A  1  250  C   250  250  250  C   C   0 . n 
A  1  251  C   251  251  251  C   C   0 . n 
A  1  252  C   252  252  252  C   C   0 . n 
A  1  253  U   253  253  253  U   U   0 . n 
A  1  254  C   254  254  254  C   C   0 . n 
A  1  255  A   255  255  255  A   A   0 . n 
A  1  256  C   256  256  256  C   C   0 . n 
A  1  257  G   257  257  257  G   G   0 . n 
A  1  258  G   258  258  258  G   G   0 . n 
A  1  259  G   259  259  259  G   G   0 . n 
A  1  260  C   260  260  260  C   C   0 . n 
A  1  261  A   261  261  261  A   A   0 . n 
A  1  262  A   262  262  262  A   A   0 . n 
A  1  263  U   263  263  263  U   U   0 . n 
A  1  264  G   264  264  264  G   G   0 . n 
A  1  265  U   265  265  265  U   U   0 . n 
A  1  266  G   266  266  266  G   G   0 . n 
A  1  267  G   267  267  267  G   G   0 . n 
A  1  268  U   268  268  268  U   U   0 . n 
A  1  269  G   269  269  269  G   G   0 . n 
A  1  270  U   270  270  270  U   U   0 . n 
A  1  271  C   271  271  271  C   C   0 . n 
A  1  272  A   272  272  272  A   A   0 . n 
A  1  273  G   273  273  273  G   G   0 . n 
A  1  274  G   274  274  274  G   G   0 . n 
A  1  275  G   275  275  275  G   G   0 . n 
A  1  276  C   276  276  276  C   C   0 . n 
A  1  277  U   277  277  277  U   U   0 . n 
A  1  278  A   278  278  278  A   A   0 . n 
A  1  279  C   279  279  279  C   C   0 . n 
A  1  280  C   280  280  280  C   C   0 . n 
A  1  281  U   281  281  281  U   U   0 . n 
A  1  282  C   282  282  282  C   C   0 . n 
A  1  283  U   283  283  283  U   U   0 . n 
A  1  284  C   284  284  284  C   C   0 . n 
A  1  285  A   285  285  285  A   A   0 . n 
A  1  286  U   286  286  286  U   U   0 . n 
A  1  287  C   287  287  287  C   C   0 . n 
A  1  288  A   288  288  288  A   A   0 . n 
A  1  289  G   289  289  289  G   G   0 . n 
A  1  290  C   290  290  290  C   C   0 . n 
A  1  291  C   291  291  291  C   C   0 . n 
A  1  292  G   292  292  292  G   G   0 . n 
A  1  293  A   293  293  293  A   A   0 . n 
A  1  294  C   294  294  294  C   C   0 . n 
A  1  295  C   295  295  295  C   C   0 . n 
A  1  296  G   296  296  296  G   G   0 . n 
A  1  297  U   297  297  297  U   U   0 . n 
A  1  298  C   298  298  298  C   C   0 . n 
A  1  299  U   299  299  299  U   U   0 . n 
A  1  300  U   300  300  300  U   U   0 . n 
A  1  301  C   301  301  301  C   C   0 . n 
A  1  302  A   302  302  302  A   A   0 . n 
A  1  303  C   303  303  303  C   C   0 . n 
A  1  304  G   304  304  304  G   G   0 . n 
A  1  305  A   305  305  305  A   A   0 . n 
A  1  306  A   306  306  306  A   A   0 . n 
A  1  307  G   307  307  307  G   G   0 . n 
A  1  308  U   308  308  308  U   U   0 . n 
A  1  309  C   309  309  309  C   C   0 . n 
A  1  310  U   310  310  310  U   U   0 . n 
A  1  311  C   311  311  311  C   C   0 . n 
A  1  312  U   312  312  312  U   U   0 . n 
A  1  313  U   313  313  313  U   U   0 . n 
A  1  314  G   314  314  314  G   G   0 . n 
A  1  315  G   315  315  315  G   G   0 . n 
A  1  316  A   316  316  316  A   A   0 . n 
A  1  317  A   317  317  317  A   A   0 . n 
A  1  318  U   318  318  318  U   U   0 . n 
A  1  319  A   319  319  319  A   A   0 . n 
A  1  320  G   320  320  320  G   G   0 . n 
A  1  321  A   321  321  321  A   A   0 . n 
A  1  322  G   322  322  322  G   G   0 . n 
A  1  323  C   323  323  323  C   C   0 . n 
A  1  324  G   324  324  324  G   G   0 . n 
A  1  325  U   325  325  325  U   U   0 . n 
A  1  326  G   326  326  326  G   G   0 . n 
A  1  327  A   327  327  327  A   A   0 . n 
A  1  328  U   328  328  328  U   U   0 . n 
A  1  329  A   329  329  329  A   A   0 . n 
A  1  330  C   330  330  330  C   C   0 . n 
A  1  331  A   331  331  331  A   A   0 . n 
A  1  332  G   332  332  332  G   G   0 . n 
A  1  333  G   333  333  333  G   G   0 . n 
A  1  334  G   334  334  334  G   G   0 . n 
A  1  335  U   335  335  335  U   U   0 . n 
A  1  336  G   336  336  336  G   G   0 . n 
A  1  337  A   337  337  337  A   A   0 . n 
A  1  338  C   338  338  338  C   C   0 . n 
A  1  339  A   339  339  339  A   A   0 . n 
A  1  340  A   340  340  340  A   A   0 . n 
A  1  341  C   341  341  341  C   C   0 . n 
A  1  342  C   342  342  342  C   C   0 . n 
A  1  343  C   343  343  343  C   C   0 . n 
A  1  344  C   344  344  344  C   C   0 . n 
A  1  345  G   345  345  345  G   G   0 . n 
A  1  346  U   346  346  346  U   U   0 . n 
A  1  347  A   347  347  347  A   A   0 . n 
A  1  348  C   348  348  348  C   C   0 . n 
A  1  349  U   349  349  349  U   U   0 . n 
A  1  350  G   350  350  350  G   G   0 . n 
A  1  351  A   351  351  351  A   A   0 . n 
A  1  352  A   352  352  352  A   A   0 . n 
A  1  353  G   353  353  353  G   G   0 . n 
A  1  354  A   354  354  354  A   A   0 . n 
A  1  355  C   355  355  355  C   C   0 . n 
A  1  356  C   356  356  356  C   C   0 . n 
A  1  357  A   357  357  357  A   A   0 . n 
A  1  358  G   358  358  358  G   G   0 . n 
A  1  359  U   359  359  359  U   U   0 . n 
A  1  360  A   360  360  360  A   A   0 . n 
A  1  361  C   361  361  361  C   C   0 . n 
A  1  362  G   362  362  362  G   G   0 . n 
A  1  363  C   363  363  363  C   C   0 . n 
A  1  364  U   364  364  364  U   U   0 . n 
A  1  365  G   365  365  365  G   G   0 . n 
A  1  366  U   366  366  366  U   U   0 . n 
A  1  367  G   367  367  367  G   G   0 . n 
A  1  368  C   368  368  368  C   C   0 . n 
A  1  369  G   369  369  369  G   G   0 . n 
A  1  370  G   370  370  370  G   G   0 . n 
A  1  371  U   371  371  371  U   U   0 . n 
A  1  372  A   372  372  372  A   A   0 . n 
A  1  373  G   373  373  373  G   G   0 . n 
A  1  374  U   374  374  374  U   U   0 . n 
A  1  375  G   375  375  375  G   G   0 . n 
A  1  376  C   376  376  376  C   C   0 . n 
A  1  377  C   377  377  377  C   C   0 . n 
A  1  378  A   378  378  378  A   A   0 . n 
A  1  379  G   379  379  379  G   G   0 . n 
A  1  380  A   380  380  380  A   A   0 . n 
A  1  381  G   381  381  381  G   G   0 . n 
A  1  382  U   382  382  382  U   U   0 . n 
A  1  383  A   383  383  383  A   A   0 . n 
A  1  384  G   384  384  384  G   G   0 . n 
A  1  385  C   385  385  385  C   C   0 . n 
A  1  386  G   386  386  386  G   G   0 . n 
A  1  387  G   387  387  387  G   G   0 . n 
A  1  388  G   388  388  388  G   G   0 . n 
A  1  389  G   389  389  389  G   G   0 . n 
A  1  390  G   390  390  390  G   G   0 . n 
A  1  391  U   391  391  391  U   U   0 . n 
A  1  392  U   392  392  392  U   U   0 . n 
A  1  393  G   393  393  393  G   G   0 . n 
A  1  394  G   394  394  394  G   G   0 . n 
A  1  395  A   395  395  395  A   A   0 . n 
A  1  396  U   396  396  396  U   U   0 . n 
A  1  397  A   397  397  397  A   A   0 . n 
A  1  398  U   398  398  398  U   U   0 . n 
A  1  399  C   399  399  399  C   C   0 . n 
A  1  400  C   400  400  400  C   C   0 . n 
A  1  401  C   401  401  401  C   C   0 . n 
A  1  402  U   402  402  402  U   U   0 . n 
A  1  403  C   403  403  403  C   C   0 . n 
A  1  404  G   404  404  404  G   G   0 . n 
A  1  405  C   405  405  405  C   C   0 . n 
A  1  406  G   406  406  406  G   G   0 . n 
A  1  407  A   407  407  407  A   A   0 . n 
A  1  408  A   408  408  408  A   A   0 . n 
A  1  409  U   409  409  409  U   U   0 . n 
A  1  410  A   410  410  410  A   A   0 . n 
A  1  411  A   411  411  411  A   A   0 . n 
A  1  412  C   412  412  412  C   C   0 . n 
A  1  413  G   413  413  413  G   G   0 . n 
A  1  414  C   414  414  414  C   C   0 . n 
A  1  415  A   415  415  415  A   A   0 . n 
A  1  416  G   416  416  416  G   G   0 . n 
A  1  417  G   417  417  417  G   G   0 . n 
A  1  418  C   418  418  418  C   C   0 . n 
A  1  419  A   419  419  419  A   A   0 . n 
A  1  420  U   420  420  420  U   U   0 . n 
A  1  421  C   421  421  421  C   C   0 . n 
A  1  422  G   422  422  422  G   G   0 . n 
A  1  423  A   423  423  423  A   A   0 . n 
A  1  424  C   424  424  424  C   C   0 . n 
A  1  425  U   425  425  425  U   U   0 . n 
A  1  426  G   426  426  426  G   G   0 . n 
A  1  427  C   427  427  427  C   C   0 . n 
A  1  428  G   428  428  428  G   G   0 . n 
A  1  429  A   429  429  429  A   A   0 . n 
A  1  430  A   430  430  430  A   A   0 . n 
A  1  431  G   431  431  431  G   G   0 . n 
A  1  432  G   432  432  432  G   G   0 . n 
A  1  433  C   433  433  433  C   C   0 . n 
A  1  434  U   434  434  434  U   U   0 . n 
A  1  435  A   435  435  435  A   A   0 . n 
A  1  436  A   436  436  436  A   A   0 . n 
A  1  437  A   437  437  437  A   A   0 . n 
A  1  438  C   438  438  438  C   C   0 . n 
A  1  439  A   439  439  439  A   A   0 . n 
A  1  440  C   440  440  440  C   C   0 . n 
A  1  441  A   441  441  441  A   A   0 . n 
A  1  442  A   442  442  442  A   A   0 . n 
A  1  443  C   443  443  443  C   C   0 . n 
A  1  444  C   444  444  444  C   C   0 . n 
A  1  445  U   445  445  445  U   U   0 . n 
A  1  446  G   446  446  446  G   G   0 . n 
A  1  447  A   447  447  447  A   A   0 . n 
A  1  448  G   448  448  448  G   G   0 . n 
A  1  449  A   449  449  449  A   A   0 . n 
A  1  450  C   450  450  450  C   C   0 . n 
A  1  451  C   451  451  451  C   C   0 . n 
A  1  452  G   452  452  452  G   G   0 . n 
A  1  453  A   453  453  453  A   A   0 . n 
A  1  454  U   454  454  454  U   U   0 . n 
A  1  455  A   455  455  455  A   A   0 . n 
A  1  456  G   456  456  456  G   G   0 . n 
A  1  457  U   457  457  457  U   U   0 . n 
A  1  458  G   458  458  458  G   G   0 . n 
A  1  459  A   459  459  459  A   A   0 . n 
A  1  460  A   460  460  460  A   A   0 . n 
A  1  461  C   461  461  461  C   C   0 . n 
A  1  462  A   462  462  462  A   A   0 . n 
A  1  463  A   463  463  463  A   A   0 . n 
A  1  464  G   464  464  464  G   G   0 . n 
A  1  465  U   465  465  465  U   U   0 . n 
A  1  466  A   466  466  466  A   A   0 . n 
A  1  467  G   467  467  467  G   G   0 . n 
A  1  468  U   468  468  468  U   U   0 . n 
A  1  469  G   469  469  469  G   G   0 . n 
A  1  470  U   470  470  470  U   U   0 . n 
A  1  471  G   471  471  471  G   G   0 . n 
A  1  472  A   472  472  472  A   A   0 . n 
A  1  473  A   473  473  473  A   A   0 . n 
A  1  474  C   474  474  474  C   C   0 . n 
A  1  475  G   475  475  475  G   G   0 . n 
A  1  476  A   476  476  476  A   A   0 . n 
A  1  477  A   477  477  477  A   A   0 . n 
A  1  478  C   478  478  478  C   C   0 . n 
A  1  479  G   479  479  479  G   G   0 . n 
A  1  480  C   480  480  480  C   C   0 . n 
A  1  481  U   481  481  481  U   U   0 . n 
A  1  482  G   482  482  482  G   G   0 . n 
A  1  483  C   483  483  483  C   C   0 . n 
A  1  484  A   484  484  484  A   A   0 . n 
A  1  485  A   485  485  485  A   A   0 . n 
A  1  486  A   486  486  486  A   A   0 . n 
A  1  487  G   487  487  487  G   G   0 . n 
A  1  488  U   488  488  488  U   U   0 . n 
A  1  489  A   489  489  489  A   A   0 . n 
A  1  490  C   490  490  490  C   C   0 . n 
A  1  491  C   491  491  491  C   C   0 . n 
A  1  492  C   492  492  492  C   C   0 . n 
A  1  493  U   493  493  493  U   U   0 . n 
A  1  494  C   494  494  494  C   C   0 . n 
A  1  495  A   495  495  495  A   A   0 . n 
A  1  496  G   496  496  496  G   G   0 . n 
A  1  497  A   497  497  497  A   A   0 . n 
A  1  498  A   498  498  498  A   A   0 . n 
A  1  499  G   499  499  499  G   G   0 . n 
A  1  500  G   500  500  500  G   G   0 . n 
A  1  501  G   501  501  501  G   G   0 . n 
A  1  502  A   502  502  502  A   A   0 . n 
A  1  503  G   503  503  503  G   G   0 . n 
A  1  504  G   504  504  504  G   G   0 . n 
A  1  505  C   505  505  505  C   C   0 . n 
A  1  506  G   506  506  506  G   G   0 . n 
A  1  507  A   507  507  507  A   A   0 . n 
A  1  508  A   508  508  508  A   A   0 . n 
A  1  509  A   509  509  509  A   A   0 . n 
A  1  510  U   510  510  510  U   U   0 . n 
A  1  511  A   511  511  511  A   A   0 . n 
A  1  512  G   512  512  512  G   G   0 . n 
A  1  513  A   513  513  513  A   A   0 . n 
A  1  514  G   514  514  514  G   G   0 . n 
A  1  515  C   515  515  515  C   C   0 . n 
A  1  516  A   516  516  516  A   A   0 . n 
A  1  517  U   517  517  517  U   U   0 . n 
A  1  518  G   518  518  518  G   G   0 . n 
A  1  519  A   519  519  519  A   A   0 . n 
A  1  520  A   520  520  520  A   A   0 . n 
A  1  521  A   521  521  521  A   A   0 . n 
A  1  522  U   522  522  522  U   U   0 . n 
A  1  523  C   523  523  523  C   C   0 . n 
A  1  524  A   524  524  524  A   A   0 . n 
A  1  525  G   525  525  525  G   G   0 . n 
A  1  526  U   526  526  526  U   U   0 . n 
A  1  527  U   527  527  527  U   U   0 . n 
A  1  528  G   528  528  528  G   G   0 . n 
A  1  529  G   529  529  529  G   G   0 . n 
A  1  530  C   530  530  530  C   C   0 . n 
A  1  531  G   531  531  531  G   G   0 . n 
A  1  532  A   532  532  532  A   A   0 . n 
A  1  533  U   533  533  533  U   U   0 . n 
A  1  534  C   534  534  534  C   C   0 . n 
A  1  535  G   535  535  535  G   G   0 . n 
A  1  536  A   536  536  536  A   A   0 . n 
A  1  537  G   537  537  537  G   G   0 . n 
A  1  538  C   538  538  538  C   C   0 . n 
A  1  539  G   539  539  539  G   G   0 . n 
A  1  540  A   540  540  540  A   A   0 . n 
A  1  541  C   541  541  541  C   C   0 . n 
A  1  542  A   542  542  542  A   A   0 . n 
A  1  543  G   543  543  543  G   G   0 . n 
A  1  544  G   544  544  544  G   G   0 . n 
A  1  545  G   545  545  545  G   G   0 . n 
A  1  546  C   546  546  546  C   C   0 . n 
A  1  547  A   547  547  547  A   A   0 . n 
A  1  548  U   548  548  548  U   U   0 . n 
A  1  549  A   549  549  549  A   A   0 . n 
A  1  550  C   550  550  550  C   C   0 . n 
A  1  551  A   551  551  551  A   A   0 . n 
A  1  552  A   552  552  552  A   A   0 . n 
A  1  553  G   553  553  553  G   G   0 . n 
A  1  554  G   554  554  554  G   G   0 . n 
A  1  555  U   555  555  555  U   U   0 . n 
A  1  556  C   556  556  556  C   C   0 . n 
A  1  557  C   557  557  557  C   C   0 . n 
A  1  558  C   558  558  558  C   C   0 . n 
A  1  559  U   559  559  559  U   U   0 . n 
A  1  560  U   560  560  560  U   U   0 . n 
A  1  561  G   561  561  561  G   G   0 . n 
A  1  562  A   562  562  562  A   A   0 . n 
A  1  563  C   563  563  563  C   C   0 . n 
A  1  564  G   564  564  564  G   G   0 . n 
A  1  565  A   565  565  565  A   A   0 . n 
A  1  566  A   566  566  566  A   A   0 . n 
A  1  567  U   567  567  567  U   U   0 . n 
A  1  568  G   568  568  568  G   G   0 . n 
A  1  569  A   569  569  569  A   A   0 . n 
A  1  570  C   570  570  570  C   C   0 . n 
A  1  571  C   571  571  571  C   C   0 . n 
A  1  572  G   572  572  572  G   G   0 . n 
A  1  573  A   573  573  573  A   A   0 . n 
A  1  574  G   574  574  574  G   G   0 . n 
A  1  575  A   575  575  575  A   A   0 . n 
A  1  576  C   576  576  576  C   C   0 . n 
A  1  577  G   577  577  577  G   G   0 . n 
A  1  578  C   578  578  578  C   C   0 . n 
A  1  579  G   579  579  579  G   G   0 . n 
A  1  580  A   580  580  580  A   A   0 . n 
A  1  581  G   581  581  581  G   G   0 . n 
A  1  582  U   582  582  582  U   U   0 . n 
A  1  583  C   583  583  583  C   C   0 . n 
A  1  584  U   584  584  584  U   U   0 . n 
A  1  585  C   585  585  585  C   C   0 . n 
A  1  586  C   586  586  586  C   C   0 . n 
A  1  587  A   587  587  587  A   A   0 . n 
A  1  588  G   588  588  588  G   G   0 . n 
A  1  589  U   589  589  589  U   U   0 . n 
A  1  590  A   590  590  590  A   A   0 . n 
A  1  591  A   591  591  591  A   A   0 . n 
A  1  592  G   592  592  592  G   G   0 . n 
A  1  593  A   593  593  593  A   A   0 . n 
A  1  594  C   594  594  594  C   C   0 . n 
A  1  595  U   595  595  595  U   U   0 . n 
A  1  596  C   596  596  596  C   C   0 . n 
A  1  597  A   597  597  597  A   A   0 . n 
A  1  598  C   598  598  598  C   C   0 . n 
A  1  599  G   599  599  599  G   G   0 . n 
A  1  600  G   600  600  600  G   G   0 . n 
A  1  601  G   601  601  601  G   G   0 . n 
A  1  602  A   602  602  602  A   A   0 . n 
A  1  603  A   603  603  603  A   A   0 . n 
A  1  604  G   604  604  604  G   G   0 . n 
A  1  605  C   605  605  605  C   C   0 . n 
A  1  606  C   606  606  606  C   C   0 . n 
A  1  607  G   607  607  607  G   G   0 . n 
A  1  608  A   608  608  608  A   A   0 . n 
A  1  609  U   609  609  609  U   U   0 . n 
A  1  610  G   610  610  610  G   G   0 . n 
A  1  611  U   611  611  611  U   U   0 . n 
A  1  612  U   612  612  612  U   U   0 . n 
A  1  613  C   613  613  613  C   C   0 . n 
A  1  614  U   614  614  614  U   U   0 . n 
A  1  615  G   615  615  615  G   G   0 . n 
A  1  616  U   616  616  616  U   U   0 . n 
A  1  617  C   617  617  617  C   C   0 . n 
A  1  618  G   618  618  618  G   G   0 . n 
A  1  619  U   619  619  619  U   U   0 . n 
A  1  620  A   620  620  620  A   A   0 . n 
A  1  621  C   621  621  621  C   C   0 . n 
A  1  622  G   622  622  622  G   G   0 . n 
A  1  623  U   623  623  623  U   U   0 . n 
A  1  624  U   624  624  624  U   U   0 . n 
A  1  625  U   625  625  625  U   U   0 . n 
A  1  626  U   626  626  626  U   U   0 . n 
A  1  627  G   627  627  627  G   G   0 . n 
A  1  628  1MA 628  628  628  1MA 1MA 0 . n 
A  1  629  A   629  629  629  A   A   0 . n 
A  1  630  A   630  630  630  A   A   0 . n 
A  1  631  A   631  631  631  A   A   0 . n 
A  1  632  A   632  632  632  A   A   0 . n 
A  1  633  C   633  633  633  C   C   0 . n 
A  1  634  G   634  634  634  G   G   0 . n 
A  1  635  A   635  635  635  A   A   0 . n 
A  1  636  G   636  636  636  G   G   0 . n 
A  1  637  C   637  637  637  C   C   0 . n 
A  1  638  C   638  638  638  C   C   0 . n 
A  1  639  A   639  639  639  A   A   0 . n 
A  1  640  G   640  640  640  G   G   0 . n 
A  1  641  G   641  641  641  G   G   0 . n 
A  1  642  G   642  642  642  G   G   0 . n 
A  1  643  A   643  643  643  A   A   0 . n 
A  1  644  G   644  644  644  G   G   0 . n 
A  1  645  U   645  645  645  U   U   0 . n 
A  1  646  G   646  646  646  G   G   0 . n 
A  1  647  U   647  647  647  U   U   0 . n 
A  1  648  G   648  648  648  G   G   0 . n 
A  1  649  U   649  649  649  U   U   0 . n 
A  1  650  C   650  650  650  C   C   0 . n 
A  1  651  U   651  651  651  U   U   0 . n 
A  1  652  G   652  652  652  G   G   0 . n 
A  1  653  U   653  653  653  U   U   0 . n 
A  1  654  A   654  654  654  A   A   0 . n 
A  1  655  U   655  655  655  U   U   0 . n 
A  1  656  G   656  656  656  G   G   0 . n 
A  1  657  G   657  657  657  G   G   0 . n 
A  1  658  C   658  658  658  C   C   0 . n 
A  1  659  A   659  659  659  A   A   0 . n 
A  1  660  A   660  660  660  A   A   0 . n 
A  1  661  G   661  661  661  G   G   0 . n 
A  1  662  U   662  662  662  U   U   0 . n 
A  1  663  C   663  663  663  C   C   0 . n 
A  1  664  U   664  664  664  U   U   0 . n 
A  1  665  A   665  665  665  A   A   0 . n 
A  1  666  A   666  666  666  A   A   0 . n 
A  1  667  C   667  667  667  C   C   0 . n 
A  1  668  C   668  668  668  C   C   0 . n 
A  1  669  G   669  669  669  G   G   0 . n 
A  1  670  G   670  670  670  G   G   0 . n 
A  1  671  A   671  671  671  A   A   0 . n 
A  1  672  G   672  672  672  G   G   0 . n 
A  1  673  U   673  673  673  U   U   0 . n 
A  1  674  A   674  674  674  A   A   0 . n 
A  1  675  U   675  675  675  U   U   0 . n 
A  1  676  C   676  676  676  C   C   0 . n 
A  1  677  C   677  677  677  C   C   0 . n 
A  1  678  G   678  678  678  G   G   0 . n 
A  1  679  G   679  679  679  G   G   0 . n 
A  1  680  G   680  680  680  G   G   0 . n 
A  1  681  G   681  681  681  G   G   0 . n 
A  1  682  A   682  682  682  A   A   0 . n 
A  1  683  G   683  683  683  G   G   0 . n 
A  1  684  G   684  684  684  G   G   0 . n 
A  1  685  C   685  685  685  C   C   0 . n 
A  1  686  A   686  686  686  A   A   0 . n 
A  1  687  C   687  687  687  C   C   0 . n 
A  1  688  A   688  688  688  A   A   0 . n 
A  1  689  G   689  689  689  G   G   0 . n 
A  1  690  G   690  690  690  G   G   0 . n 
A  1  691  G   691  691  691  G   G   0 . n 
A  1  692  A   692  692  692  A   A   0 . n 
A  1  693  A   693  693  693  A   A   0 . n 
A  1  694  A   694  694  694  A   A   0 . n 
A  1  695  C   695  695  695  C   C   0 . n 
A  1  696  C   696  696  696  C   C   0 . n 
A  1  697  G   697  697  697  G   G   0 . n 
A  1  698  A   698  698  698  A   A   0 . n 
A  1  699  C   699  699  699  C   C   0 . n 
A  1  700  A   700  700  700  A   A   0 . n 
A  1  701  U   701  701  701  U   U   0 . n 
A  1  702  G   702  702  702  G   G   0 . n 
A  1  703  G   703  703  703  G   G   0 . n 
A  1  704  C   704  704  704  C   C   0 . n 
A  1  705  C   705  705  705  C   C   0 . n 
A  1  706  G   706  706  706  G   G   0 . n 
A  1  707  C   707  707  707  C   C   0 . n 
A  1  708  A   708  708  708  A   A   0 . n 
A  1  709  G   709  709  709  G   G   0 . n 
A  1  710  G   710  710  710  G   G   0 . n 
A  1  711  G   711  711  711  G   G   0 . n 
A  1  712  C   712  712  712  C   C   0 . n 
A  1  713  U   713  713  713  U   U   0 . n 
A  1  714  U   714  714  714  U   U   0 . n 
A  1  715  U   715  715  ?    ?   ?   0 . n 
A  1  716  G   716  716  716  G   G   0 . n 
A  1  717  C   717  717  717  C   C   0 . n 
A  1  718  C   718  718  718  C   C   0 . n 
A  1  719  C   719  719  719  C   C   0 . n 
A  1  720  G   720  720  720  G   G   0 . n 
A  1  721  A   721  721  721  A   A   0 . n 
A  1  722  G   722  722  722  G   G   0 . n 
A  1  723  G   723  723  723  G   G   0 . n 
A  1  724  G   724  724  724  G   G   0 . n 
A  1  725  C   725  725  725  C   C   0 . n 
A  1  726  C   726  726  726  C   C   0 . n 
A  1  727  G   727  727  727  G   G   0 . n 
A  1  728  C   728  728  728  C   C   0 . n 
A  1  729  C   729  729  729  C   C   0 . n 
A  1  730  G   730  730  730  G   G   0 . n 
A  1  731  U   731  731  731  U   U   0 . n 
A  1  732  C   732  732  732  C   C   0 . n 
A  1  733  U   733  733  733  U   U   0 . n 
A  1  734  U   734  734  734  U   U   0 . n 
A  1  735  C   735  735  735  C   C   0 . n 
A  1  736  A   736  736  736  A   A   0 . n 
A  1  737  A   737  737  737  A   A   0 . n 
A  1  738  G   738  738  738  G   G   0 . n 
A  1  739  G   739  739  739  G   G   0 . n 
A  1  740  G   740  740  740  G   G   0 . n 
A  1  741  C   741  741  741  C   C   0 . n 
A  1  742  G   742  742  742  G   G   0 . n 
A  1  743  G   743  743  743  G   G   0 . n 
A  1  744  G   744  744  744  G   G   0 . n 
A  1  745  G   745  745  745  G   G   0 . n 
A  1  746  A   746  746  746  A   A   0 . n 
A  1  747  G   747  747  747  G   G   0 . n 
A  1  748  C   748  748  748  C   C   0 . n 
A  1  749  C   749  749  749  C   C   0 . n 
A  1  750  A   750  750  750  A   A   0 . n 
A  1  751  U   751  751  751  U   U   0 . n 
A  1  752  G   752  752  752  G   G   0 . n 
A  1  753  U   753  753  753  U   U   0 . n 
A  1  754  G   754  754  754  G   G   0 . n 
A  1  755  G   755  755  755  G   G   0 . n 
A  1  756  A   756  756  756  A   A   0 . n 
A  1  757  C   757  757  757  C   C   0 . n 
A  1  758  A   758  758  758  A   A   0 . n 
A  1  759  C   759  759  759  C   C   0 . n 
A  1  760  G   760  760  760  G   G   0 . n 
A  1  761  A   761  761  761  A   A   0 . n 
A  1  762  C   762  762  762  C   C   0 . n 
A  1  763  C   763  763  763  C   C   0 . n 
A  1  764  C   764  764  764  C   C   0 . n 
A  1  765  G   765  765  765  G   G   0 . n 
A  1  766  A   766  766  766  A   A   0 . n 
A  1  767  A   767  767  767  A   A   0 . n 
A  1  768  U   768  768  768  U   U   0 . n 
A  1  769  C   769  769  769  C   C   0 . n 
A  1  770  C   770  770  770  C   C   0 . n 
A  1  771  G   771  771  771  G   G   0 . n 
A  1  772  G   772  772  772  G   G   0 . n 
A  1  773  A   773  773  773  A   A   0 . n 
A  1  774  C   774  774  774  C   C   0 . n 
A  1  775  G   775  775  775  G   G   0 . n 
A  1  776  A   776  776  776  A   A   0 . n 
A  1  777  U   777  777  777  U   U   0 . n 
A  1  778  C   778  778  778  C   C   0 . n 
A  1  779  U   779  779  779  U   U   0 . n 
A  1  780  A   780  780  780  A   A   0 . n 
A  1  781  C   781  781  781  C   C   0 . n 
A  1  782  G   782  782  782  G   G   0 . n 
A  1  783  C   783  783  783  C   C   0 . n 
A  1  784  A   784  784  784  A   A   0 . n 
A  1  785  U   785  785  785  U   U   0 . n 
A  1  786  G   786  786  786  G   G   0 . n 
A  1  787  G   787  787  787  G   G   0 . n 
A  1  788  A   788  788  788  A   A   0 . n 
A  1  789  C   789  789  789  C   C   0 . n 
A  1  790  A   790  790  790  A   A   0 . n 
A  1  791  A   791  791  791  A   A   0 . n 
A  1  792  G   792  792  792  G   G   0 . n 
A  1  793  A   793  793  793  A   A   0 . n 
A  1  794  U   794  794  794  U   U   0 . n 
A  1  795  G   795  795  795  G   G   0 . n 
A  1  796  A   796  796  796  A   A   0 . n 
A  1  797  A   797  797  797  A   A   0 . n 
A  1  798  G   798  798  798  G   G   0 . n 
A  1  799  C   799  799  799  C   C   0 . n 
A  1  800  G   800  800  800  G   G   0 . n 
A  1  801  U   801  801  801  U   U   0 . n 
A  1  802  G   802  802  802  G   G   0 . n 
A  1  803  C   803  803  803  C   C   0 . n 
A  1  804  C   804  804  804  C   C   0 . n 
A  1  805  G   805  805  805  G   G   0 . n 
A  1  806  A   806  806  806  A   A   0 . n 
A  1  807  A   807  807  807  A   A   0 . n 
A  1  808  A   808  808  808  A   A   0 . n 
A  1  809  G   809  809  809  G   G   0 . n 
A  1  810  G   810  810  810  G   G   0 . n 
A  1  811  C   811  811  811  C   C   0 . n 
A  1  812  A   812  812  812  A   A   0 . n 
A  1  813  C   813  813  813  C   C   0 . n 
A  1  814  G   814  814  814  G   G   0 . n 
A  1  815  U   815  815  815  U   U   0 . n 
A  1  816  G   816  816  816  G   G   0 . n 
A  1  817  G   817  817  817  G   G   0 . n 
A  1  818  A   818  818  818  A   A   0 . n 
A  1  819  A   819  819  819  A   A   0 . n 
A  1  820  G   820  820  820  G   G   0 . n 
A  1  821  U   821  821  821  U   U   0 . n 
A  1  822  C   822  822  822  C   C   0 . n 
A  1  823  U   823  823  823  U   U   0 . n 
A  1  824  G   824  824  824  G   G   0 . n 
A  1  825  U   825  825  825  U   U   0 . n 
A  1  826  U   826  826  826  U   U   0 . n 
A  1  827  A   827  827  827  A   A   0 . n 
A  1  828  G   828  828  828  G   G   0 . n 
A  1  829  A   829  829  829  A   A   0 . n 
A  1  830  G   830  830  830  G   G   0 . n 
A  1  831  U   831  831  831  U   U   0 . n 
A  1  832  U   832  832  832  U   U   0 . n 
A  1  833  G   833  833  833  G   G   0 . n 
A  1  834  G   834  834  834  G   G   0 . n 
A  1  835  U   835  835  835  U   U   0 . n 
A  1  836  G   836  836  836  G   G   0 . n 
A  1  837  U   837  837  837  U   U   0 . n 
A  1  838  C   838  838  838  C   C   0 . n 
A  1  839  C   839  839  839  C   C   0 . n 
A  1  840  U   840  840  840  U   U   0 . n 
A  1  841  A   841  841  841  A   A   0 . n 
A  1  842  C   842  842  842  C   C   0 . n 
A  1  843  A   843  843  843  A   A   0 . n 
A  1  844  A   844  844  844  A   A   0 . n 
A  1  845  U   845  845  845  U   U   0 . n 
A  1  846  A   846  846  846  A   A   0 . n 
A  1  847  C   847  847  847  C   C   0 . n 
A  1  848  C   848  848  848  C   C   0 . n 
A  1  849  C   849  849  849  C   C   0 . n 
A  1  850  U   850  850  850  U   U   0 . n 
A  1  851  C   851  851  851  C   C   0 . n 
A  1  852  U   852  852  852  U   U   0 . n 
A  1  853  C   853  853  853  C   C   0 . n 
A  1  854  G   854  854  854  G   G   0 . n 
A  1  855  U   855  855  855  U   U   0 . n 
A  1  856  G   856  856  856  G   G   0 . n 
A  1  857  A   857  857  857  A   A   0 . n 
A  1  858  U   858  858  858  U   U   0 . n 
A  1  859  C   859  859  859  C   C   0 . n 
A  1  860  U   860  860  860  U   U   0 . n 
A  1  861  A   861  861  861  A   A   0 . n 
A  1  862  U   862  862  862  U   U   0 . n 
A  1  863  G   863  863  863  G   G   0 . n 
A  1  864  U   864  864  864  U   U   0 . n 
A  1  865  G   865  865  865  G   G   0 . n 
A  1  866  U   866  866  866  U   U   0 . n 
A  1  867  A   867  867  867  A   A   0 . n 
A  1  868  G   868  868  868  G   G   0 . n 
A  1  869  G   869  869  869  G   G   0 . n 
A  1  870  G   870  870  870  G   G   0 . n 
A  1  871  G   871  871  871  G   G   0 . n 
A  1  872  U   872  872  872  U   U   0 . n 
A  1  873  G   873  873  873  G   G   0 . n 
A  1  874  A   874  874  874  A   A   0 . n 
A  1  875  A   875  875  875  A   A   0 . n 
A  1  876  A   876  876  876  A   A   0 . n 
A  1  877  G   877  877  877  G   G   0 . n 
A  1  878  G   878  878  878  G   G   0 . n 
A  1  879  C   879  879  879  C   C   0 . n 
A  1  880  C   880  880  880  C   C   0 . n 
A  1  881  C   881  881  881  C   C   0 . n 
A  1  882  A   882  882  882  A   A   0 . n 
A  1  883  U   883  883  883  U   U   0 . n 
A  1  884  C   884  884  884  C   C   0 . n 
A  1  885  G   885  885  885  G   G   0 . n 
A  1  886  A   886  886  886  A   A   0 . n 
A  1  887  G   887  887  887  G   G   0 . n 
A  1  888  U   888  888  888  U   U   0 . n 
A  1  889  C   889  889  889  C   C   0 . n 
A  1  890  C   890  890  890  C   C   0 . n 
A  1  891  G   891  891  891  G   G   0 . n 
A  1  892  G   892  892  892  G   G   0 . n 
A  1  893  C   893  893  893  C   C   0 . n 
A  1  894  A   894  894  894  A   A   0 . n 
A  1  895  A   895  895  895  A   A   0 . n 
A  1  896  C   896  896  896  C   C   0 . n 
A  1  897  A   897  897  897  A   A   0 . n 
A  1  898  G   898  898  898  G   G   0 . n 
A  1  899  C   899  899  899  C   C   0 . n 
A  1  900  U   900  900  900  U   U   0 . n 
A  1  901  G   901  901  901  G   G   0 . n 
A  1  902  G   902  902  902  G   G   0 . n 
A  1  903  U   903  903  903  U   U   0 . n 
A  1  904  U   904  904  904  U   U   0 . n 
A  1  905  C   905  905  905  C   C   0 . n 
A  1  906  C   906  906  906  C   C   0 . n 
A  1  907  A   907  907  907  A   A   0 . n 
A  1  908  A   908  908  908  A   A   0 . n 
A  1  909  U   909  909  909  U   U   0 . n 
A  1  910  C   910  910  910  C   C   0 . n 
A  1  911  G   911  911  911  G   G   0 . n 
A  1  912  A   912  912  912  A   A   0 . n 
A  1  913  A   913  913  913  A   A   0 . n 
A  1  914  A   914  914  914  A   A   0 . n 
A  1  915  C   915  915  915  C   C   0 . n 
A  1  916  A   916  916  916  A   A   0 . n 
A  1  917  U   917  917  917  U   U   0 . n 
A  1  918  G   918  918  918  G   G   0 . n 
A  1  919  U   919  919  919  U   U   0 . n 
A  1  920  C   920  920  920  C   C   0 . n 
A  1  921  G   921  921  921  G   G   0 . n 
A  1  922  A   922  922  922  A   A   0 . n 
A  1  923  A   923  923  923  A   A   0 . n 
A  1  924  G   924  924  924  G   G   0 . n 
A  1  925  C   925  925  925  C   C   0 . n 
A  1  926  A   926  926  926  A   A   0 . n 
A  1  927  U   927  927  927  U   U   0 . n 
A  1  928  G   928  928  928  G   G   0 . n 
A  1  929  A   929  929  929  A   A   0 . n 
A  1  930  C   930  930  930  C   C   0 . n 
A  1  931  C   931  931  931  C   C   0 . n 
A  1  932  U   932  932  932  U   U   0 . n 
A  1  933  C   933  933  933  C   C   0 . n 
A  1  934  C   934  934  934  C   C   0 . n 
A  1  935  G   935  935  935  G   G   0 . n 
A  1  936  C   936  936  936  C   C   0 . n 
A  1  937  C   937  937  937  C   C   0 . n 
A  1  938  G   938  938  938  G   G   0 . n 
A  1  939  A   939  939  939  A   A   0 . n 
A  1  940  G   940  940  940  G   G   0 . n 
A  1  941  G   941  941  941  G   G   0 . n 
A  1  942  U   942  942  942  U   U   0 . n 
A  1  943  A   943  943  943  A   A   0 . n 
A  1  944  G   944  944  944  G   G   0 . n 
A  1  945  U   945  945  945  U   U   0 . n 
A  1  946  C   946  946  946  C   C   0 . n 
A  1  947  U   947  947  947  U   U   0 . n 
A  1  948  G   948  948  948  G   G   0 . n 
A  1  949  U   949  949  949  U   U   0 . n 
A  1  950  G   950  950  950  G   G   0 . n 
A  1  951  A   951  951  951  A   A   0 . n 
A  1  952  G   952  952  952  G   G   0 . n 
A  1  953  G   953  953  953  G   G   0 . n 
A  1  954  U   954  954  954  U   U   0 . n 
A  1  955  A   955  955  955  A   A   0 . n 
A  1  956  G   956  956  956  G   G   0 . n 
A  1  957  A   957  957  957  A   A   0 . n 
A  1  958  G   958  958  958  G   G   0 . n 
A  1  959  C   959  959  959  C   C   0 . n 
A  1  960  G   960  960  960  G   G   0 . n 
A  1  961  A   961  961  961  A   A   0 . n 
A  1  962  C   962  962  962  C   C   0 . n 
A  1  963  C   963  963  963  C   C   0 . n 
A  1  964  G   964  964  964  G   G   0 . n 
A  1  965  A   965  965  965  A   A   0 . n 
A  1  966  U   966  966  966  U   U   0 . n 
A  1  967  U   967  967  967  U   U   0 . n 
A  1  968  G   968  968  968  G   G   0 . n 
A  1  969  G   969  969  969  G   G   0 . n 
A  1  970  U   970  970  970  U   U   0 . n 
A  1  971  G   971  971  ?    ?   ?   0 . n 
A  1  972  U   972  972  ?    ?   ?   0 . n 
A  1  973  G   973  973  ?    ?   ?   0 . n 
A  1  974  U   974  974  ?    ?   ?   0 . n 
A  1  975  C   975  975  ?    ?   ?   0 . n 
A  1  976  C   976  976  ?    ?   ?   0 . n 
A  1  977  G   977  977  ?    ?   ?   0 . n 
A  1  978  C   978  978  ?    ?   ?   0 . n 
A  1  979  C   979  979  ?    ?   ?   0 . n 
A  1  980  U   980  980  ?    ?   ?   0 . n 
A  1  981  C   981  981  ?    ?   ?   0 . n 
A  1  982  C   982  982  ?    ?   ?   0 . n 
A  1  983  G   983  983  ?    ?   ?   0 . n 
A  1  984  A   984  984  ?    ?   ?   0 . n 
A  1  985  G   985  985  ?    ?   ?   0 . n 
A  1  986  A   986  986  ?    ?   ?   0 . n 
A  1  987  G   987  987  ?    ?   ?   0 . n 
A  1  988  G   988  988  ?    ?   ?   0 . n 
A  1  989  A   989  989  ?    ?   ?   0 . n 
A  1  990  G   990  990  ?    ?   ?   0 . n 
A  1  991  U   991  991  ?    ?   ?   0 . n 
A  1  992  C   992  992  ?    ?   ?   0 . n 
A  1  993  G   993  993  ?    ?   ?   0 . n 
A  1  994  G   994  994  ?    ?   ?   0 . n 
A  1  995  C   995  995  ?    ?   ?   0 . n 
A  1  996  A   996  996  ?    ?   ?   0 . n 
A  1  997  C   997  997  ?    ?   ?   0 . n 
A  1  998  A   998  998  ?    ?   ?   0 . n 
A  1  999  C   999  999  999  C   C   0 . n 
A  1  1000 C   1000 1000 1000 C   C   0 . n 
A  1  1001 U   1001 1001 1001 U   U   0 . n 
A  1  1002 G   1002 1002 1002 G   G   0 . n 
A  1  1003 U   1003 1003 1003 U   U   0 . n 
A  1  1004 C   1004 1004 1004 C   C   0 . n 
A  1  1005 A   1005 1005 1005 A   A   0 . n 
A  1  1006 A   1006 1006 1006 A   A   0 . n 
A  1  1007 A   1007 1007 1007 A   A   0 . n 
A  1  1008 C   1008 1008 1008 C   C   0 . n 
A  1  1009 U   1009 1009 1009 U   U   0 . n 
A  1  1010 C   1010 1010 1010 C   C   0 . n 
A  1  1011 C   1011 1011 1011 C   C   0 . n 
A  1  1012 A   1012 1012 1012 A   A   0 . n 
A  1  1013 A   1013 1013 1013 A   A   0 . n 
A  1  1014 A   1014 1014 1014 A   A   0 . n 
A  1  1015 C   1015 1015 1015 C   C   0 . n 
A  1  1016 U   1016 1016 1016 U   U   0 . n 
A  1  1017 U   1017 1017 1017 U   U   0 . n 
A  1  1018 A   1018 1018 1018 A   A   0 . n 
A  1  1019 C   1019 1019 1019 C   C   0 . n 
A  1  1020 A   1020 1020 1020 A   A   0 . n 
A  1  1021 G   1021 1021 1021 G   G   0 . n 
A  1  1022 A   1022 1022 1022 A   A   0 . n 
A  1  1023 C   1023 1023 1023 C   C   0 . n 
A  1  1024 G   1024 1024 1024 G   G   0 . n 
A  1  1025 C   1025 1025 1025 C   C   0 . n 
A  1  1026 U   1026 1026 1026 U   U   0 . n 
A  1  1027 G   1027 1027 1027 G   G   0 . n 
A  1  1028 U   1028 1028 1028 U   U   0 . n 
A  1  1029 U   1029 1029 1029 U   U   0 . n 
A  1  1030 U   1030 1030 1030 U   U   0 . n 
A  1  1031 G   1031 1031 1031 G   G   0 . n 
A  1  1032 A   1032 1032 1032 A   A   0 . n 
A  1  1033 C   1033 1033 1033 C   C   0 . n 
A  1  1034 G   1034 1034 1034 G   G   0 . n 
A  1  1035 C   1035 1035 1035 C   C   0 . n 
A  1  1036 G   1036 1036 1036 G   G   0 . n 
A  1  1037 G   1037 1037 1037 G   G   0 . n 
A  1  1038 G   1038 1038 1038 G   G   0 . n 
A  1  1039 G   1039 1039 1039 G   G   0 . n 
A  1  1040 A   1040 1040 1040 A   A   0 . n 
A  1  1041 U   1041 1041 1041 U   U   0 . n 
A  1  1042 U   1042 1042 1042 U   U   0 . n 
A  1  1043 C   1043 1043 1043 C   C   0 . n 
A  1  1044 C   1044 1044 1044 C   C   0 . n 
A  1  1045 G   1045 1045 1045 G   G   0 . n 
A  1  1046 G   1046 1046 1046 G   G   0 . n 
A  1  1047 U   1047 1047 1047 U   U   0 . n 
A  1  1048 G   1048 1048 1048 G   G   0 . n 
A  1  1049 C   1049 1049 1049 C   C   0 . n 
A  1  1050 G   1050 1050 1050 G   G   0 . n 
A  1  1051 C   1051 1051 1051 C   C   0 . n 
A  1  1052 G   1052 1052 1052 G   G   0 . n 
A  1  1053 G   1053 1053 1053 G   G   0 . n 
A  1  1054 G   1054 1054 1054 G   G   0 . n 
A  1  1055 G   1055 1055 1055 G   G   0 . n 
A  1  1056 U   1056 1056 1056 U   U   0 . n 
A  1  1057 A   1057 1057 1057 A   A   0 . n 
A  1  1058 A   1058 1058 1058 A   A   0 . n 
A  1  1059 G   1059 1059 1059 G   G   0 . n 
A  1  1060 C   1060 1060 1060 C   C   0 . n 
A  1  1061 C   1061 1061 1061 C   C   0 . n 
A  1  1062 U   1062 1062 1062 U   U   0 . n 
A  1  1063 G   1063 1063 1063 G   G   0 . n 
A  1  1064 U   1064 1064 1064 U   U   0 . n 
A  1  1065 G   1065 1065 1065 G   G   0 . n 
A  1  1066 U   1066 1066 1066 U   U   0 . n 
A  1  1067 A   1067 1067 1067 A   A   0 . n 
A  1  1068 C   1068 1068 1068 C   C   0 . n 
A  1  1069 C   1069 1069 1069 C   C   0 . n 
A  1  1070 A   1070 1070 1070 A   A   0 . n 
A  1  1071 G   1071 1071 1071 G   G   0 . n 
A  1  1072 G   1072 1072 1072 G   G   0 . n 
A  1  1073 A   1073 1073 1073 A   A   0 . n 
A  1  1074 G   1074 1074 1074 G   G   0 . n 
A  1  1075 G   1075 1075 1075 G   G   0 . n 
A  1  1076 G   1076 1076 1076 G   G   0 . n 
A  1  1077 G   1077 1077 1077 G   G   0 . n 
A  1  1078 A   1078 1078 1078 A   A   0 . n 
A  1  1079 A   1079 1079 1079 A   A   0 . n 
A  1  1080 C   1080 1080 1080 C   C   0 . n 
A  1  1081 A   1081 1081 1081 A   A   0 . n 
A  1  1082 A   1082 1082 1082 A   A   0 . n 
A  1  1083 C   1083 1083 1083 C   C   0 . n 
A  1  1084 C   1084 1084 1084 C   C   0 . n 
A  1  1085 C   1085 1085 1085 C   C   0 . n 
A  1  1086 A   1086 1086 1086 A   A   0 . n 
A  1  1087 G   1087 1087 1087 G   G   0 . n 
A  1  1088 A   1088 1088 1088 A   A   0 . n 
A  1  1089 G   1089 1089 1089 G   G   0 . n 
A  1  1090 A   1090 1090 1090 A   A   0 . n 
A  1  1091 U   1091 1091 1091 U   U   0 . n 
A  1  1092 A   1092 1092 1092 A   A   0 . n 
A  1  1093 G   1093 1093 1093 G   G   0 . n 
A  1  1094 G   1094 1094 1094 G   G   0 . n 
A  1  1095 U   1095 1095 1095 U   U   0 . n 
A  1  1096 U   1096 1096 1096 U   U   0 . n 
A  1  1097 A   1097 1097 1097 A   A   0 . n 
A  1  1098 A   1098 1098 1098 A   A   0 . n 
A  1  1099 G   1099 1099 1099 G   G   0 . n 
A  1  1100 G   1100 1100 1100 G   G   0 . n 
A  1  1101 U   1101 1101 1101 U   U   0 . n 
A  1  1102 C   1102 1102 1102 C   C   0 . n 
A  1  1103 C   1103 1103 1103 C   C   0 . n 
A  1  1104 C   1104 1104 1104 C   C   0 . n 
A  1  1105 C   1105 1105 1105 C   C   0 . n 
A  1  1106 A   1106 1106 1106 A   A   0 . n 
A  1  1107 A   1107 1107 1107 A   A   0 . n 
A  1  1108 G   1108 1108 1108 G   G   0 . n 
A  1  1109 U   1109 1109 1109 U   U   0 . n 
A  1  1110 G   1110 1110 1110 G   G   0 . n 
A  1  1111 U   1111 1111 1111 U   U   0 . n 
A  1  1112 G   1112 1112 1112 G   G   0 . n 
A  1  1113 G   1113 1113 1113 G   G   0 . n 
A  1  1114 A   1114 1114 1114 A   A   0 . n 
A  1  1115 U   1115 1115 1115 U   U   0 . n 
A  1  1116 U   1116 1116 1116 U   U   0 . n 
A  1  1117 A   1117 1117 1117 A   A   0 . n 
A  1  1118 A   1118 1118 1118 A   A   0 . n 
A  1  1119 G   1119 1119 1119 G   G   0 . n 
A  1  1120 U   1120 1120 1120 U   U   0 . n 
A  1  1121 G   1121 1121 1121 G   G   0 . n 
A  1  1122 U   1122 1122 1122 U   U   0 . n 
A  1  1123 A   1123 1123 1123 A   A   0 . n 
A  1  1124 A   1124 1124 1124 A   A   0 . n 
A  1  1125 U   1125 1125 1125 U   U   0 . n 
A  1  1126 C   1126 1126 1126 C   C   0 . n 
A  1  1127 C   1127 1127 1127 C   C   0 . n 
A  1  1128 U   1128 1128 1128 U   U   0 . n 
A  1  1129 C   1129 1129 1129 C   C   0 . n 
A  1  1130 U   1130 1130 1130 U   U   0 . n 
A  1  1131 G   1131 1131 1131 G   G   0 . n 
A  1  1132 A   1132 1132 1132 A   A   0 . n 
A  1  1133 A   1133 1133 1133 A   A   0 . n 
A  1  1134 G   1134 1134 1134 G   G   0 . n 
A  1  1135 G   1135 1135 1135 G   G   0 . n 
A  1  1136 U   1136 1136 1136 U   U   0 . n 
A  1  1137 G   1137 1137 1137 G   G   0 . n 
A  1  1138 G   1138 1138 1138 G   G   0 . n 
A  1  1139 U   1139 1139 1139 U   U   0 . n 
A  1  1140 C   1140 1140 1140 C   C   0 . n 
A  1  1141 U   1141 1141 1141 U   U   0 . n 
A  1  1142 C   1142 1142 1142 C   C   0 . n 
A  1  1143 G   1143 1143 1143 G   G   0 . n 
A  1  1144 A   1144 1144 1144 A   A   0 . n 
A  1  1145 G   1145 1145 1145 G   G   0 . n 
A  1  1146 C   1146 1146 1146 C   C   0 . n 
A  1  1147 C   1147 1147 1147 C   C   0 . n 
A  1  1148 C   1148 1148 1148 C   C   0 . n 
A  1  1149 U   1149 1149 1149 U   U   0 . n 
A  1  1150 A   1150 1150 1150 A   A   0 . n 
A  1  1151 G   1151 1151 1151 G   G   0 . n 
A  1  1152 A   1152 1152 1152 A   A   0 . n 
A  1  1153 C   1153 1153 1153 C   C   0 . n 
A  1  1154 A   1154 1154 1154 A   A   0 . n 
A  1  1155 G   1155 1155 1155 G   G   0 . n 
A  1  1156 C   1156 1156 1156 C   C   0 . n 
A  1  1157 C   1157 1157 1157 C   C   0 . n 
A  1  1158 G   1158 1158 1158 G   G   0 . n 
A  1  1159 G   1159 1159 1159 G   G   0 . n 
A  1  1160 G   1160 1160 1160 G   G   0 . n 
A  1  1161 A   1161 1161 1161 A   A   0 . n 
A  1  1162 G   1162 1162 1162 G   G   0 . n 
A  1  1163 G   1163 1163 1163 G   G   0 . n 
A  1  1164 U   1164 1164 1164 U   U   0 . n 
A  1  1165 G   1165 1165 1165 G   G   0 . n 
A  1  1166 A   1166 1166 1166 A   A   0 . n 
A  1  1167 G   1167 1167 1167 G   G   0 . n 
A  1  1168 C   1168 1168 1168 C   C   0 . n 
A  1  1169 U   1169 1169 1169 U   U   0 . n 
A  1  1170 U   1170 1170 1170 U   U   0 . n 
A  1  1171 A   1171 1171 1171 A   A   0 . n 
A  1  1172 G   1172 1172 1172 G   G   0 . n 
A  1  1173 A   1173 1173 1173 A   A   0 . n 
A  1  1174 A   1174 1174 1174 A   A   0 . n 
A  1  1175 G   1175 1175 1175 G   G   0 . n 
A  1  1176 C   1176 1176 1176 C   C   0 . n 
A  1  1177 A   1177 1177 1177 A   A   0 . n 
A  1  1178 G   1178 1178 1178 G   G   0 . n 
A  1  1179 C   1179 1179 1179 C   C   0 . n 
A  1  1180 U   1180 1180 1180 U   U   0 . n 
A  1  1181 A   1181 1181 1181 A   A   0 . n 
A  1  1182 C   1182 1182 1182 C   C   0 . n 
A  1  1183 C   1183 1183 1183 C   C   0 . n 
A  1  1184 C   1184 1184 1184 C   C   0 . n 
A  1  1185 U   1185 1185 1185 U   U   0 . n 
A  1  1186 C   1186 1186 1186 C   C   0 . n 
A  1  1187 U   1187 1187 1187 U   U   0 . n 
A  1  1188 A   1188 1188 1188 A   A   0 . n 
A  1  1189 A   1189 1189 1189 A   A   0 . n 
A  1  1190 G   1190 1190 1190 G   G   0 . n 
A  1  1191 A   1191 1191 1191 A   A   0 . n 
A  1  1192 A   1192 1192 1192 A   A   0 . n 
A  1  1193 A   1193 1193 1193 A   A   0 . n 
A  1  1194 A   1194 1194 1194 A   A   0 . n 
A  1  1195 G   1195 1195 1195 G   G   0 . n 
A  1  1196 C   1196 1196 1196 C   C   0 . n 
A  1  1197 G   1197 1197 1197 G   G   0 . n 
A  1  1198 U   1198 1198 1198 U   U   0 . n 
A  1  1199 A   1199 1199 1199 A   A   0 . n 
A  1  1200 A   1200 1200 1200 A   A   0 . n 
A  1  1201 C   1201 1201 1201 C   C   0 . n 
A  1  1202 A   1202 1202 1202 A   A   0 . n 
A  1  1203 G   1203 1203 1203 G   G   0 . n 
A  1  1204 C   1204 1204 1204 C   C   0 . n 
A  1  1205 U   1205 1205 1205 U   U   0 . n 
A  1  1206 U   1206 1206 1206 U   U   0 . n 
A  1  1207 A   1207 1207 1207 A   A   0 . n 
A  1  1208 C   1208 1208 1208 C   C   0 . n 
A  1  1209 C   1209 1209 1209 C   C   0 . n 
A  1  1210 G   1210 1210 1210 G   G   0 . n 
A  1  1211 G   1211 1211 1211 G   G   0 . n 
A  1  1212 C   1212 1212 1212 C   C   0 . n 
A  1  1213 C   1213 1213 1213 C   C   0 . n 
A  1  1214 G   1214 1214 1214 G   G   0 . n 
A  1  1215 A   1215 1215 1215 A   A   0 . n 
A  1  1216 G   1216 1216 1216 G   G   0 . n 
A  1  1217 G   1217 1217 1217 G   G   0 . n 
A  1  1218 U   1218 1218 1218 U   U   0 . n 
A  1  1219 U   1219 1219 1219 U   U   0 . n 
A  1  1220 U   1220 1220 1220 U   U   0 . n 
A  1  1221 G   1221 1221 1221 G   G   0 . n 
A  1  1222 A   1222 1222 1222 A   A   0 . n 
A  1  1223 G   1223 1223 1223 G   G   0 . n 
A  1  1224 G   1224 1224 1224 G   G   0 . n 
A  1  1225 C   1225 1225 1225 C   C   0 . n 
A  1  1226 G   1226 1226 1226 G   G   0 . n 
A  1  1227 C   1227 1227 1227 C   C   0 . n 
A  1  1228 C   1228 1228 1228 C   C   0 . n 
A  1  1229 C   1229 1229 1229 C   C   0 . n 
A  1  1230 A   1230 1230 1230 A   A   0 . n 
A  1  1231 A   1231 1231 1231 A   A   0 . n 
A  1  1232 A   1232 1232 1232 A   A   0 . n 
A  1  1233 A   1233 1233 1233 A   A   0 . n 
A  1  1234 U   1234 1234 1234 U   U   0 . n 
A  1  1235 G   1235 1235 1235 G   G   0 . n 
A  1  1236 A   1236 1236 1236 A   A   0 . n 
A  1  1237 U   1237 1237 1237 U   U   0 . n 
A  1  1238 C   1238 1238 1238 C   C   0 . n 
A  1  1239 G   1239 1239 1239 G   G   0 . n 
A  1  1240 G   1240 1240 1240 G   G   0 . n 
A  1  1241 G   1241 1241 1241 G   G   0 . n 
A  1  1242 A   1242 1242 1242 A   A   0 . n 
A  1  1243 C   1243 1243 1243 C   C   0 . n 
A  1  1244 U   1244 1244 1244 U   U   0 . n 
A  1  1245 C   1245 1245 1245 C   C   0 . n 
A  1  1246 A   1246 1246 1246 A   A   0 . n 
A  1  1247 A   1247 1247 1247 A   A   0 . n 
A  1  1248 A   1248 1248 1248 A   A   0 . n 
A  1  1249 U   1249 1249 1249 U   U   0 . n 
A  1  1250 C   1250 1250 1250 C   C   0 . n 
A  1  1251 C   1251 1251 1251 C   C   0 . n 
A  1  1252 A   1252 1252 1252 A   A   0 . n 
A  1  1253 C   1253 1253 1253 C   C   0 . n 
A  1  1254 C   1254 1254 1254 C   C   0 . n 
A  1  1255 A   1255 1255 1255 A   A   0 . n 
A  1  1256 C   1256 1256 1256 C   C   0 . n 
A  1  1257 C   1257 1257 1257 C   C   0 . n 
A  1  1258 G   1258 1258 1258 G   G   0 . n 
A  1  1259 A   1259 1259 1259 A   A   0 . n 
A  1  1260 G   1260 1260 1260 G   G   0 . n 
A  1  1261 A   1261 1261 1261 A   A   0 . n 
A  1  1262 C   1262 1262 1262 C   C   0 . n 
A  1  1263 C   1263 1263 1263 C   C   0 . n 
A  1  1264 U   1264 1264 1264 U   U   0 . n 
A  1  1265 G   1265 1265 1265 G   G   0 . n 
A  1  1266 U   1266 1266 1266 U   U   0 . n 
A  1  1267 C   1267 1267 1267 C   C   0 . n 
A  1  1268 C   1268 1268 1268 C   C   0 . n 
A  1  1269 G   1269 1269 1269 G   G   0 . n 
A  1  1270 U   1270 1270 1270 U   U   0 . n 
A  1  1271 A   1271 1271 1271 A   A   0 . n 
A  1  1272 C   1272 1272 1272 C   C   0 . n 
A  1  1273 C   1273 1273 1273 C   C   0 . n 
A  1  1274 A   1274 1274 1274 A   A   0 . n 
A  1  1275 C   1275 1275 1275 C   C   0 . n 
A  1  1276 U   1276 1276 1276 U   U   0 . n 
A  1  1277 C   1277 1277 1277 C   C   0 . n 
A  1  1278 A   1278 1278 1278 A   A   0 . n 
A  1  1279 U   1279 1279 1279 U   U   0 . n 
A  1  1280 A   1280 1280 1280 A   A   0 . n 
A  1  1281 C   1281 1281 1281 C   C   0 . n 
A  1  1282 U   1282 1282 1282 U   U   0 . n 
A  1  1283 G   1283 1283 1283 G   G   0 . n 
A  1  1284 G   1284 1284 1284 G   G   0 . n 
A  1  1285 U   1285 1285 1285 U   U   0 . n 
A  1  1286 A   1286 1286 1286 A   A   0 . n 
A  1  1287 A   1287 1287 1287 A   A   0 . n 
A  1  1288 U   1288 1288 1288 U   U   0 . n 
A  1  1289 C   1289 1289 1289 C   C   0 . n 
A  1  1290 G   1290 1290 1290 G   G   0 . n 
A  1  1291 A   1291 1291 1291 A   A   0 . n 
A  1  1292 G   1292 1292 1292 G   G   0 . n 
A  1  1293 U   1293 1293 1293 U   U   0 . n 
A  1  1294 A   1294 1294 1294 A   A   0 . n 
A  1  1295 G   1295 1295 1295 G   G   0 . n 
A  1  1296 A   1296 1296 1296 A   A   0 . n 
A  1  1297 U   1297 1297 1297 U   U   0 . n 
A  1  1298 U   1298 1298 1298 U   U   0 . n 
A  1  1299 G   1299 1299 1299 G   G   0 . n 
A  1  1300 G   1300 1300 1300 G   G   0 . n 
A  1  1301 C   1301 1301 1301 C   C   0 . n 
A  1  1302 G   1302 1302 1302 G   G   0 . n 
A  1  1303 C   1303 1303 1303 C   C   0 . n 
A  1  1304 U   1304 1304 1304 U   U   0 . n 
A  1  1305 C   1305 1305 1305 C   C   0 . n 
A  1  1306 U   1306 1306 1306 U   U   0 . n 
A  1  1307 A   1307 1307 1307 A   A   0 . n 
A  1  1308 A   1308 1308 1308 A   A   0 . n 
A  1  1309 U   1309 1309 1309 U   U   0 . n 
A  1  1310 U   1310 1310 1310 U   U   0 . n 
A  1  1311 G   1311 1311 1311 G   G   0 . n 
A  1  1312 G   1312 1312 1312 G   G   0 . n 
A  1  1313 A   1313 1313 1313 A   A   0 . n 
A  1  1314 U   1314 1314 1314 U   U   0 . n 
A  1  1315 G   1315 1315 1315 G   G   0 . n 
A  1  1316 G   1316 1316 1316 G   G   0 . n 
A  1  1317 A   1317 1317 1317 A   A   0 . n 
A  1  1318 A   1318 1318 1318 A   A   0 . n 
A  1  1319 G   1319 1319 1319 G   G   0 . n 
A  1  1320 C   1320 1320 1320 C   C   0 . n 
A  1  1321 A   1321 1321 1321 A   A   0 . n 
A  1  1322 G   1322 1322 1322 G   G   0 . n 
A  1  1323 G   1323 1323 1323 G   G   0 . n 
A  1  1324 G   1324 1324 1324 G   G   0 . n 
A  1  1325 G   1325 1325 1325 G   G   0 . n 
A  1  1326 C   1326 1326 1326 C   C   0 . n 
A  1  1327 G   1327 1327 1327 G   G   0 . n 
A  1  1328 A   1328 1328 1328 A   A   0 . n 
A  1  1329 G   1329 1329 1329 G   G   0 . n 
A  1  1330 A   1330 1330 1330 A   A   0 . n 
A  1  1331 G   1331 1331 1331 G   G   0 . n 
A  1  1332 C   1332 1332 1332 C   C   0 . n 
A  1  1333 U   1333 1333 1333 U   U   0 . n 
A  1  1334 C   1334 1334 1334 C   C   0 . n 
A  1  1335 C   1335 1335 1335 C   C   0 . n 
A  1  1336 U   1336 1336 1336 U   U   0 . n 
A  1  1337 G   1337 1337 1337 G   G   0 . n 
A  1  1338 U   1338 1338 1338 U   U   0 . n 
A  1  1339 G   1339 1339 1339 G   G   0 . n 
A  1  1340 G   1340 1340 1340 G   G   0 . n 
A  1  1341 A   1341 1341 1341 A   A   0 . n 
A  1  1342 C   1342 1342 1342 C   C   0 . n 
A  1  1343 C   1343 1343 1343 C   C   0 . n 
A  1  1344 G   1344 1344 1344 G   G   0 . n 
A  1  1345 A   1345 1345 1345 A   A   0 . n 
A  1  1346 U   1346 1346 1346 U   U   0 . n 
A  1  1347 U   1347 1347 1347 U   U   0 . n 
A  1  1348 A   1348 1348 1348 A   A   0 . n 
A  1  1349 G   1349 1349 1349 G   G   0 . n 
A  1  1350 U   1350 1350 1350 U   U   0 . n 
A  1  1351 G   1351 1351 1351 G   G   0 . n 
A  1  1352 A   1352 1352 1352 A   A   0 . n 
A  1  1353 C   1353 1353 1353 C   C   0 . n 
A  1  1354 G   1354 1354 1354 G   G   0 . n 
A  1  1355 A   1355 1355 1355 A   A   0 . n 
A  1  1356 A   1356 1356 1356 A   A   0 . n 
A  1  1357 A   1357 1357 1357 A   A   0 . n 
A  1  1358 A   1358 1358 1358 A   A   0 . n 
A  1  1359 U   1359 1359 1359 U   U   0 . n 
A  1  1360 C   1360 1360 1360 C   C   0 . n 
A  1  1361 C   1361 1361 1361 C   C   0 . n 
A  1  1362 U   1362 1362 1362 U   U   0 . n 
A  1  1363 G   1363 1363 1363 G   G   0 . n 
A  1  1364 G   1364 1364 1364 G   G   0 . n 
A  1  1365 C   1365 1365 1365 C   C   0 . n 
A  1  1366 C   1366 1366 1366 C   C   0 . n 
A  1  1367 A   1367 1367 1367 A   A   0 . n 
A  1  1368 U   1368 1368 1368 U   U   0 . n 
A  1  1369 A   1369 1369 1369 A   A   0 . n 
A  1  1370 G   1370 1370 1370 G   G   0 . n 
A  1  1371 U   1371 1371 1371 U   U   0 . n 
A  1  1372 A   1372 1372 1372 A   A   0 . n 
A  1  1373 G   1373 1373 1373 G   G   0 . n 
A  1  1374 C   1374 1374 1374 C   C   0 . n 
A  1  1375 A   1375 1375 1375 A   A   0 . n 
A  1  1376 G   1376 1376 1376 G   G   0 . n 
A  1  1377 C   1377 1377 1377 C   C   0 . n 
A  1  1378 G   1378 1378 1378 G   G   0 . n 
A  1  1379 A   1379 1379 1379 A   A   0 . n 
A  1  1380 U   1380 1380 1380 U   U   0 . n 
A  1  1381 A   1381 1381 1381 A   A   0 . n 
A  1  1382 G   1382 1382 1382 G   G   0 . n 
A  1  1383 U   1383 1383 1383 U   U   0 . n 
A  1  1384 C   1384 1384 1384 C   C   0 . n 
A  1  1385 G   1385 1385 1385 G   G   0 . n 
A  1  1386 G   1386 1386 1386 G   G   0 . n 
A  1  1387 G   1387 1387 1387 G   G   0 . n 
A  1  1388 U   1388 1388 1388 U   U   0 . n 
A  1  1389 G   1389 1389 1389 G   G   0 . n 
A  1  1390 A   1390 1390 1390 A   A   0 . n 
A  1  1391 G   1391 1391 1391 G   G   0 . n 
A  1  1392 A   1392 1392 1392 A   A   0 . n 
A  1  1393 A   1393 1393 1393 A   A   0 . n 
A  1  1394 C   1394 1394 1394 C   C   0 . n 
A  1  1395 C   1395 1395 1395 C   C   0 . n 
A  1  1396 C   1396 1396 1396 C   C   0 . n 
A  1  1397 C   1397 1397 1397 C   C   0 . n 
A  1  1398 G   1398 1398 1398 G   G   0 . n 
A  1  1399 A   1399 1399 1399 A   A   0 . n 
A  1  1400 C   1400 1400 1400 C   C   0 . n 
A  1  1401 G   1401 1401 1401 G   G   0 . n 
A  1  1402 G   1402 1402 1402 G   G   0 . n 
A  1  1403 C   1403 1403 1403 C   C   0 . n 
A  1  1404 C   1404 1404 1404 C   C   0 . n 
A  1  1405 U   1405 1405 1405 U   U   0 . n 
A  1  1406 A   1406 1406 1406 A   A   0 . n 
A  1  1407 A   1407 1407 1407 A   A   0 . n 
A  1  1408 U   1408 1408 1408 U   U   0 . n 
A  1  1409 G   1409 1409 1409 G   G   0 . n 
A  1  1410 G   1410 1410 1410 G   G   0 . n 
A  1  1411 A   1411 1411 1411 A   A   0 . n 
A  1  1412 U   1412 1412 1412 U   U   0 . n 
A  1  1413 A   1413 1413 1413 A   A   0 . n 
A  1  1414 A   1414 1414 1414 A   A   0 . n 
A  1  1415 G   1415 1415 1415 G   G   0 . n 
A  1  1416 G   1416 1416 1416 G   G   0 . n 
A  1  1417 G   1417 1417 1417 G   G   0 . n 
A  1  1418 U   1418 1418 1418 U   U   0 . n 
A  1  1419 U   1419 1419 1419 U   U   0 . n 
A  1  1420 C   1420 1420 1420 C   C   0 . n 
A  1  1421 C   1421 1421 1421 C   C   0 . n 
A  1  1422 U   1422 1422 1422 U   U   0 . n 
A  1  1423 C   1423 1423 1423 C   C   0 . n 
A  1  1424 A   1424 1424 1424 A   A   0 . n 
A  1  1425 G   1425 1425 1425 G   G   0 . n 
A  1  1426 C   1426 1426 1426 C   C   0 . n 
A  1  1427 A   1427 1427 1427 A   A   0 . n 
A  1  1428 C   1428 1428 1428 C   C   0 . n 
A  1  1429 U   1429 1429 1429 U   U   0 . n 
A  1  1430 G   1430 1430 1430 G   G   0 . n 
A  1  1431 C   1431 1431 1431 C   C   0 . n 
A  1  1432 U   1432 1432 1432 U   U   0 . n 
A  1  1433 G   1433 1433 1433 G   G   0 . n 
A  1  1434 A   1434 1434 1434 A   A   0 . n 
A  1  1435 U   1435 1435 1435 U   U   0 . n 
A  1  1436 C   1436 1436 1436 C   C   0 . n 
A  1  1437 A   1437 1437 1437 A   A   0 . n 
A  1  1438 G   1438 1438 1438 G   G   0 . n 
A  1  1439 C   1439 1439 1439 C   C   0 . n 
A  1  1440 U   1440 1440 1440 U   U   0 . n 
A  1  1441 G   1441 1441 1441 G   G   0 . n 
A  1  1442 A   1442 1442 1442 A   A   0 . n 
A  1  1443 G   1443 1443 1443 G   G   0 . n 
A  1  1444 G   1444 1444 1444 G   G   0 . n 
A  1  1445 G   1445 1445 1445 G   G   0 . n 
A  1  1446 U   1446 1446 1446 U   U   0 . n 
A  1  1447 U   1447 1447 1447 U   U   0 . n 
A  1  1448 A   1448 1448 1448 A   A   0 . n 
A  1  1449 G   1449 1449 1449 G   G   0 . n 
A  1  1450 C   1450 1450 1450 C   C   0 . n 
A  1  1451 C   1451 1451 1451 C   C   0 . n 
A  1  1452 G   1452 1452 1452 G   G   0 . n 
A  1  1453 G   1453 1453 1453 G   G   0 . n 
A  1  1454 U   1454 1454 1454 U   U   0 . n 
A  1  1455 C   1455 1455 1455 C   C   0 . n 
A  1  1456 C   1456 1456 1456 C   C   0 . n 
A  1  1457 U   1457 1457 1457 U   U   0 . n 
A  1  1458 A   1458 1458 1458 A   A   0 . n 
A  1  1459 A   1459 1459 1459 A   A   0 . n 
A  1  1460 G   1460 1460 1460 G   G   0 . n 
A  1  1461 U   1461 1461 1461 U   U   0 . n 
A  1  1462 C   1462 1462 1462 C   C   0 . n 
A  1  1463 U   1463 1463 1463 U   U   0 . n 
A  1  1464 C   1464 1464 1464 C   C   0 . n 
A  1  1465 A   1465 1465 1465 A   A   0 . n 
A  1  1466 C   1466 1466 1466 C   C   0 . n 
A  1  1467 C   1467 1467 1467 C   C   0 . n 
A  1  1468 G   1468 1468 1468 G   G   0 . n 
A  1  1469 C   1469 1469 1469 C   C   0 . n 
A  1  1470 A   1470 1470 1470 A   A   0 . n 
A  1  1471 A   1471 1471 1471 A   A   0 . n 
A  1  1472 C   1472 1472 1472 C   C   0 . n 
A  1  1473 U   1473 1473 1473 U   U   0 . n 
A  1  1474 C   1474 1474 1474 C   C   0 . n 
A  1  1475 G   1475 1475 1475 G   G   0 . n 
A  1  1476 A   1476 1476 1476 A   A   0 . n 
A  1  1477 C   1477 1477 1477 C   C   0 . n 
A  1  1478 U   1478 1478 1478 U   U   0 . n 
A  1  1479 G   1479 1479 1479 G   G   0 . n 
A  1  1480 A   1480 1480 1480 A   A   0 . n 
A  1  1481 G   1481 1481 1481 G   G   0 . n 
A  1  1482 A   1482 1482 1482 A   A   0 . n 
A  1  1483 C   1483 1483 1483 C   C   0 . n 
A  1  1484 G   1484 1484 1484 G   G   0 . n 
A  1  1485 A   1485 1485 1485 A   A   0 . n 
A  1  1486 A   1486 1486 1486 A   A   0 . n 
A  1  1487 A   1487 1487 1487 A   A   0 . n 
A  1  1488 U   1488 1488 1488 U   U   0 . n 
A  1  1489 G   1489 1489 1489 G   G   0 . n 
A  1  1490 G   1490 1490 1490 G   G   0 . n 
A  1  1491 G   1491 1491 1491 G   G   0 . n 
A  1  1492 A   1492 1492 1492 A   A   0 . n 
A  1  1493 A   1493 1493 1493 A   A   0 . n 
A  1  1494 A   1494 1494 1494 A   A   0 . n 
A  1  1495 C   1495 1495 1495 C   C   0 . n 
A  1  1496 A   1496 1496 1496 A   A   0 . n 
A  1  1497 G   1497 1497 1497 G   G   0 . n 
A  1  1498 G   1498 1498 1498 G   G   0 . n 
A  1  1499 U   1499 1499 1499 U   U   0 . n 
A  1  1500 U   1500 1500 1500 U   U   0 . n 
A  1  1501 A   1501 1501 1501 A   A   0 . n 
A  1  1502 A   1502 1502 1502 A   A   0 . n 
A  1  1503 U   1503 1503 1503 U   U   0 . n 
A  1  1504 A   1504 1504 1504 A   A   0 . n 
A  1  1505 U   1505 1505 1505 U   U   0 . n 
A  1  1506 U   1506 1506 1506 U   U   0 . n 
A  1  1507 C   1507 1507 1507 C   C   0 . n 
A  1  1508 C   1508 1508 1508 C   C   0 . n 
A  1  1509 U   1509 1509 1509 U   U   0 . n 
A  1  1510 G   1510 1510 1510 G   G   0 . n 
A  1  1511 U   1511 1511 1511 U   U   0 . n 
A  1  1512 G   1512 1512 1512 G   G   0 . n 
A  1  1513 C   1513 1513 1513 C   C   0 . n 
A  1  1514 C   1514 1514 1514 C   C   0 . n 
A  1  1515 A   1515 1515 1515 A   A   0 . n 
A  1  1516 U   1516 1516 1516 U   U   0 . n 
A  1  1517 C   1517 1517 1517 C   C   0 . n 
A  1  1518 A   1518 1518 1518 A   A   0 . n 
A  1  1519 U   1519 1519 1519 U   U   0 . n 
A  1  1520 G   1520 1520 1520 G   G   0 . n 
A  1  1521 C   1521 1521 1521 C   C   0 . n 
A  1  1522 A   1522 1522 1522 A   A   0 . n 
A  1  1523 G   1523 1523 1523 G   G   0 . n 
A  1  1524 U   1524 1524 1524 U   U   0 . n 
A  1  1525 G   1525 1525 1525 G   G   0 . n 
A  1  1526 A   1526 1526 1526 A   A   0 . n 
A  1  1527 A   1527 1527 1527 A   A   0 . n 
A  1  1528 A   1528 1528 1528 A   A   0 . n 
A  1  1529 G   1529 1529 1529 G   G   0 . n 
A  1  1530 U   1530 1530 1530 U   U   0 . n 
A  1  1531 U   1531 1531 1531 U   U   0 . n 
A  1  1532 G   1532 1532 1532 G   G   0 . n 
A  1  1533 A   1533 1533 1533 A   A   0 . n 
A  1  1534 C   1534 1534 1534 C   C   0 . n 
A  1  1535 G   1535 1535 1535 G   G   0 . n 
A  1  1536 C   1536 1536 1536 C   C   0 . n 
A  1  1537 C   1537 1537 1537 C   C   0 . n 
A  1  1538 C   1538 1538 1538 C   C   0 . n 
A  1  1539 U   1539 1539 1539 U   U   0 . n 
A  1  1540 G   1540 1540 1540 G   G   0 . n 
A  1  1541 G   1541 1541 1541 G   G   0 . n 
A  1  1542 G   1542 1542 1542 G   G   0 . n 
A  1  1543 G   1543 1543 1543 G   G   0 . n 
A  1  1544 U   1544 1544 1544 U   U   0 . n 
A  1  1545 C   1545 1545 1545 C   C   0 . n 
A  1  1546 G   1546 1546 1546 G   G   0 . n 
A  1  1547 A   1547 1547 1547 A   A   0 . n 
A  1  1548 U   1548 1548 1548 U   U   0 . n 
A  1  1549 C   1549 1549 1549 C   C   0 . n 
A  1  1550 A   1550 1550 1550 A   A   0 . n 
A  1  1551 C   1551 1551 1551 C   C   0 . n 
A  1  1552 G   1552 1552 1552 G   G   0 . n 
A  1  1553 C   1553 1553 1553 C   C   0 . n 
A  1  1554 C   1554 1554 1554 C   C   0 . n 
A  1  1555 G   1555 1555 1555 G   G   0 . n 
A  1  1556 G   1556 1556 1556 G   G   0 . n 
A  1  1557 G   1557 1557 1557 G   G   0 . n 
A  1  1558 C   1558 1558 1558 C   C   0 . n 
A  1  1559 A   1559 1559 1559 A   A   0 . n 
A  1  1560 U   1560 1560 ?    ?   ?   0 . n 
A  1  1561 U   1561 1561 1561 U   U   0 . n 
A  1  1562 C   1562 1562 1562 C   C   0 . n 
A  1  1563 G   1563 1563 1563 G   G   0 . n 
A  1  1564 C   1564 1564 1564 C   C   0 . n 
A  1  1565 C   1565 1565 1565 C   C   0 . n 
A  1  1566 C   1566 1566 1566 C   C   0 . n 
A  1  1567 G   1567 1567 1567 G   G   0 . n 
A  1  1568 G   1568 1568 1568 G   G   0 . n 
A  1  1569 U   1569 1569 1569 U   U   0 . n 
A  1  1570 C   1570 1570 1570 C   C   0 . n 
A  1  1571 G   1571 1571 1571 G   G   0 . n 
A  1  1572 A   1572 1572 1572 A   A   0 . n 
A  1  1573 A   1573 1573 1573 A   A   0 . n 
A  1  1574 C   1574 1574 1574 C   C   0 . n 
A  1  1575 C   1575 1575 1575 C   C   0 . n 
A  1  1576 G   1576 1576 1576 G   G   0 . n 
A  1  1577 U   1577 1577 1577 U   U   0 . n 
A  1  1578 C   1578 1578 1578 C   C   0 . n 
A  1  1579 C   1579 1579 1579 C   C   0 . n 
A  1  1580 A   1580 1580 1580 A   A   0 . n 
A  1  1581 A   1581 1581 1581 A   A   0 . n 
A  1  1582 C   1582 1582 1582 C   C   0 . n 
A  1  1583 U   1583 1583 1583 U   U   0 . n 
A  1  1584 C   1584 1584 1584 C   C   0 . n 
A  1  1585 C   1585 1585 1585 C   C   0 . n 
A  1  1586 G   1586 1586 1586 G   G   0 . n 
A  1  1587 U   1587 1587 1587 U   U   0 . n 
A  1  1588 G   1588 1588 1588 G   G   0 . n 
A  1  1589 G   1589 1589 1589 G   G   0 . n 
A  1  1590 A   1590 1590 1590 A   A   0 . n 
A  1  1591 A   1591 1591 1591 A   A   0 . n 
A  1  1592 G   1592 1592 1592 G   G   0 . n 
A  1  1593 C   1593 1593 1593 C   C   0 . n 
A  1  1594 C   1594 1594 1594 C   C   0 . n 
A  1  1595 G   1595 1595 1595 G   G   0 . n 
A  1  1596 U   1596 1596 1596 U   U   0 . n 
A  1  1597 A   1597 1597 1597 A   A   0 . n 
A  1  1598 A   1598 1598 1598 A   A   0 . n 
A  1  1599 U   1599 1599 1599 U   U   0 . n 
A  1  1600 G   1600 1600 1600 G   G   0 . n 
A  1  1601 G   1601 1601 1601 G   G   0 . n 
A  1  1602 C   1602 1602 1602 C   C   0 . n 
A  1  1603 A   1603 1603 1603 A   A   0 . n 
A  1  1604 G   1604 1604 1604 G   G   0 . n 
A  1  1605 G   1605 1605 1605 G   G   0 . n 
A  1  1606 A   1606 1606 1606 A   A   0 . n 
A  1  1607 A   1607 1607 1607 A   A   0 . n 
A  1  1608 G   1608 1608 1608 G   G   0 . n 
A  1  1609 C   1609 1609 1609 C   C   0 . n 
A  1  1610 G   1610 1610 1610 G   G   0 . n 
A  1  1611 G   1611 1611 1611 G   G   0 . n 
A  1  1612 A   1612 1612 1612 A   A   0 . n 
A  1  1613 C   1613 1613 1613 C   C   0 . n 
A  1  1614 G   1614 1614 1614 G   G   0 . n 
A  1  1615 A   1615 1615 1615 A   A   0 . n 
A  1  1616 A   1616 1616 1616 A   A   0 . n 
A  1  1617 C   1617 1617 1617 C   C   0 . n 
A  1  1618 G   1618 1618 1618 G   G   0 . n 
A  1  1619 G   1619 1619 1619 G   G   0 . n 
A  1  1620 C   1620 1620 1620 C   C   0 . n 
A  1  1621 G   1621 1621 1621 G   G   0 . n 
A  1  1622 G   1622 1622 1622 G   G   0 . n 
A  1  1623 C   1623 1623 1623 C   C   0 . n 
A  1  1624 A   1624 1624 1624 A   A   0 . n 
A  1  1625 U   1625 1625 1625 U   U   0 . n 
A  1  1626 A   1626 1626 1626 A   A   0 . n 
A  1  1627 G   1627 1627 1627 G   G   0 . n 
A  1  1628 G   1628 1628 1628 G   G   0 . n 
A  1  1629 G   1629 1629 1629 G   G   0 . n 
A  1  1630 A   1630 1630 1630 A   A   0 . n 
A  1  1631 A   1631 1631 1631 A   A   0 . n 
A  1  1632 A   1632 1632 1632 A   A   0 . n 
A  1  1633 C   1633 1633 1633 C   C   0 . n 
A  1  1634 G   1634 1634 1634 G   G   0 . n 
A  1  1635 U   1635 1635 1635 U   U   0 . n 
A  1  1636 G   1636 1636 1636 G   G   0 . n 
A  1  1637 A   1637 1637 1637 A   A   0 . n 
A  1  1638 U   1638 1638 1638 U   U   0 . n 
A  1  1639 U   1639 1639 1639 U   U   0 . n 
A  1  1640 C   1640 1640 1640 C   C   0 . n 
A  1  1641 A   1641 1641 1641 A   A   0 . n 
A  1  1642 A   1642 1642 1642 A   A   0 . n 
A  1  1643 C   1643 1643 1643 C   C   0 . n 
A  1  1644 C   1644 1644 1644 C   C   0 . n 
A  1  1645 U   1645 1645 1645 U   U   0 . n 
A  1  1646 G   1646 1646 1646 G   G   0 . n 
A  1  1647 G   1647 1647 1647 G   G   0 . n 
A  1  1648 G   1648 1648 1648 G   G   0 . n 
A  1  1649 G   1649 1649 1649 G   G   0 . n 
A  1  1650 C   1650 1650 1650 C   C   0 . n 
A  1  1651 C   1651 1651 1651 C   C   0 . n 
A  1  1652 C   1652 1652 1652 C   C   0 . n 
A  1  1653 A   1653 1653 1653 A   A   0 . n 
A  1  1654 U   1654 1654 1654 U   U   0 . n 
A  1  1655 G   1655 1655 1655 G   G   0 . n 
A  1  1656 A   1656 1656 1656 A   A   0 . n 
A  1  1657 A   1657 1657 1657 A   A   0 . n 
A  1  1658 A   1658 1658 1658 A   A   0 . n 
A  1  1659 A   1659 1659 1659 A   A   0 . n 
A  1  1660 G   1660 1660 1660 G   G   0 . n 
A  1  1661 A   1661 1661 1661 A   A   0 . n 
A  1  1662 C   1662 1662 1662 C   C   0 . n 
A  1  1663 G   1663 1663 1663 G   G   0 . n 
A  1  1664 A   1664 1664 1664 A   A   0 . n 
A  1  1665 G   1665 1665 1665 G   G   0 . n 
A  1  1666 C   1666 1666 1666 C   C   0 . n 
A  1  1667 A   1667 1667 1667 A   A   0 . n 
A  1  1668 U   1668 1668 1668 U   U   0 . n 
A  1  1669 G   1669 1669 1669 G   G   0 . n 
A  1  1670 A   1670 1670 1670 A   A   0 . n 
A  1  1671 U   1671 1671 1671 U   U   0 . n 
A  1  1672 G   1672 1672 1672 G   G   0 . n 
A  1  1673 U   1673 1673 1673 U   U   0 . n 
A  1  1674 C   1674 1674 1674 C   C   0 . n 
A  1  1675 C   1675 1675 1675 C   C   0 . n 
A  1  1676 G   1676 1676 1676 G   G   0 . n 
A  1  1677 U   1677 1677 1677 U   U   0 . n 
A  1  1678 A   1678 1678 1678 A   A   0 . n 
A  1  1679 C   1679 1679 1679 C   C   0 . n 
A  1  1680 C   1680 1680 1680 C   C   0 . n 
A  1  1681 G   1681 1681 1681 G   G   0 . n 
A  1  1682 A   1682 1682 1682 A   A   0 . n 
A  1  1683 G   1683 1683 1683 G   G   0 . n 
A  1  1684 A   1684 1684 1684 A   A   0 . n 
A  1  1685 A   1685 1685 1685 A   A   0 . n 
A  1  1686 C   1686 1686 1686 C   C   0 . n 
A  1  1687 C   1687 1687 1687 C   C   0 . n 
A  1  1688 G   1688 1688 1688 G   G   0 . n 
A  1  1689 A   1689 1689 1689 A   A   0 . n 
A  1  1690 C   1690 1690 1690 C   C   0 . n 
A  1  1691 A   1691 1691 1691 A   A   0 . n 
A  1  1692 C   1692 1692 1692 C   C   0 . n 
A  1  1693 A   1693 1693 1693 A   A   0 . n 
A  1  1694 G   1694 1694 1694 G   G   0 . n 
A  1  1695 G   1695 1695 1695 G   G   0 . n 
A  1  1696 U   1696 1696 1696 U   U   0 . n 
A  1  1697 G   1697 1697 1697 G   G   0 . n 
A  1  1698 U   1698 1698 1698 U   U   0 . n 
A  1  1699 C   1699 1699 1699 C   C   0 . n 
A  1  1700 C   1700 1700 1700 C   C   0 . n 
A  1  1701 A   1701 1701 1701 A   A   0 . n 
A  1  1702 U   1702 1702 1702 U   U   0 . n 
A  1  1703 G   1703 1703 1703 G   G   0 . n 
A  1  1704 G   1704 1704 1704 G   G   0 . n 
A  1  1705 C   1705 1705 1705 C   C   0 . n 
A  1  1706 G   1706 1706 1706 G   G   0 . n 
A  1  1707 G   1707 1707 1707 G   G   0 . n 
A  1  1708 C   1708 1708 1708 C   C   0 . n 
A  1  1709 G   1709 1709 1709 G   G   0 . n 
A  1  1710 A   1710 1710 1710 A   A   0 . n 
A  1  1711 A   1711 1711 1711 A   A   0 . n 
A  1  1712 A   1712 1712 1712 A   A   0 . n 
A  1  1713 G   1713 1713 1713 G   G   0 . n 
A  1  1714 C   1714 1714 1714 C   C   0 . n 
A  1  1715 C   1715 1715 1715 C   C   0 . n 
A  1  1716 A   1716 1716 1716 A   A   0 . n 
A  1  1717 A   1717 1717 1717 A   A   0 . n 
A  1  1718 G   1718 1718 1718 G   G   0 . n 
A  1  1719 G   1719 1719 1719 G   G   0 . n 
A  1  1720 C   1720 1720 1720 C   C   0 . n 
A  1  1721 C   1721 1721 1721 C   C   0 . n 
A  1  1722 U   1722 1722 1722 U   U   0 . n 
A  1  1723 G   1723 1723 1723 G   G   0 . n 
A  1  1724 U   1724 1724 1724 U   U   0 . n 
A  1  1725 C   1725 1725 1725 C   C   0 . n 
A  1  1726 G   1726 1726 1726 G   G   0 . n 
A  1  1727 G   1727 1727 1727 G   G   0 . n 
A  1  1728 G   1728 1728 1728 G   G   0 . n 
A  1  1729 A   1729 1729 1729 A   A   0 . n 
A  1  1730 G   1730 1730 1730 G   G   0 . n 
A  1  1731 C   1731 1731 1731 C   C   0 . n 
A  1  1732 A   1732 1732 1732 A   A   0 . n 
A  1  1733 A   1733 1733 1733 A   A   0 . n 
A  1  1734 C   1734 1734 1734 C   C   0 . n 
A  1  1735 C   1735 1735 1735 C   C   0 . n 
A  1  1736 A   1736 1736 1736 A   A   0 . n 
A  1  1737 A   1737 1737 1737 A   A   0 . n 
A  1  1738 C   1738 1738 1738 C   C   0 . n 
A  1  1739 G   1739 1739 1739 G   G   0 . n 
A  1  1740 U   1740 1740 1740 U   U   0 . n 
A  1  1741 U   1741 1741 1741 U   U   0 . n 
A  1  1742 A   1742 1742 1742 A   A   0 . n 
A  1  1743 G   1743 1743 1743 G   G   0 . n 
A  1  1744 G   1744 1744 1744 G   G   0 . n 
A  1  1745 G   1745 1745 1745 G   G   0 . n 
A  1  1746 A   1746 1746 1746 A   A   0 . n 
A  1  1747 A   1747 1747 1747 A   A   0 . n 
A  1  1748 U   1748 1748 1748 U   U   0 . n 
A  1  1749 U   1749 1749 1749 U   U   0 . n 
A  1  1750 C   1750 1750 1750 C   C   0 . n 
A  1  1751 G   1751 1751 1751 G   G   0 . n 
A  1  1752 G   1752 1752 1752 G   G   0 . n 
A  1  1753 C   1753 1753 1753 C   C   0 . n 
A  1  1754 A   1754 1754 1754 A   A   0 . n 
A  1  1755 A   1755 1755 1755 A   A   0 . n 
A  1  1756 G   1756 1756 1756 G   G   0 . n 
A  1  1757 U   1757 1757 1757 U   U   0 . n 
A  1  1758 U   1758 1758 1758 U   U   0 . n 
A  1  1759 A   1759 1759 1759 A   A   0 . n 
A  1  1760 G   1760 1760 1760 G   G   0 . n 
A  1  1761 U   1761 1761 1761 U   U   0 . n 
A  1  1762 C   1762 1762 1762 C   C   0 . n 
A  1  1763 C   1763 1763 1763 C   C   0 . n 
A  1  1764 C   1764 1764 1764 C   C   0 . n 
A  1  1765 G   1765 1765 1765 G   G   0 . n 
A  1  1766 U   1766 1766 1766 U   U   0 . n 
A  1  1767 A   1767 1767 1767 A   A   0 . n 
A  1  1768 C   1768 1768 1768 C   C   0 . n 
A  1  1769 C   1769 1769 1769 C   C   0 . n 
A  1  1770 U   1770 1770 1770 U   U   0 . n 
A  1  1771 U   1771 1771 1771 U   U   0 . n 
A  1  1772 C   1772 1772 1772 C   C   0 . n 
A  1  1773 G   1773 1773 1773 G   G   0 . n 
A  1  1774 G   1774 1774 1774 G   G   0 . n 
A  1  1775 A   1775 1775 1775 A   A   0 . n 
A  1  1776 A   1776 1776 1776 A   A   0 . n 
A  1  1777 G   1777 1777 1777 G   G   0 . n 
A  1  1778 A   1778 1778 1778 A   A   0 . n 
A  1  1779 A   1779 1779 1779 A   A   0 . n 
A  1  1780 G   1780 1780 1780 G   G   0 . n 
A  1  1781 G   1781 1781 1781 G   G   0 . n 
A  1  1782 G   1782 1782 1782 G   G   0 . n 
A  1  1783 A   1783 1783 1783 A   A   0 . n 
A  1  1784 U   1784 1784 1784 U   U   0 . n 
A  1  1785 G   1785 1785 1785 G   G   0 . n 
A  1  1786 C   1786 1786 1786 C   C   0 . n 
A  1  1787 C   1787 1787 1787 C   C   0 . n 
A  1  1788 U   1788 1788 1788 U   U   0 . n 
A  1  1789 G   1789 1789 1789 G   G   0 . n 
A  1  1790 C   1790 1790 1790 C   C   0 . n 
A  1  1791 U   1791 1791 1791 U   U   0 . n 
A  1  1792 C   1792 1792 1792 C   C   0 . n 
A  1  1793 C   1793 1793 1793 C   C   0 . n 
A  1  1794 G   1794 1794 1794 G   G   0 . n 
A  1  1795 G   1795 1795 1795 G   G   0 . n 
A  1  1796 A   1796 1796 1796 A   A   0 . n 
A  1  1797 A   1797 1797 1797 A   A   0 . n 
A  1  1798 C   1798 1798 1798 C   C   0 . n 
A  1  1799 G   1799 1799 1799 G   G   0 . n 
A  1  1800 G   1800 1800 1800 G   G   0 . n 
A  1  1801 A   1801 1801 1801 A   A   0 . n 
A  1  1802 G   1802 1802 1802 G   G   0 . n 
A  1  1803 C   1803 1803 1803 C   C   0 . n 
A  1  1804 A   1804 1804 1804 A   A   0 . n 
A  1  1805 G   1805 1805 1805 G   G   0 . n 
A  1  1806 G   1806 1806 1806 G   G   0 . n 
A  1  1807 U   1807 1807 1807 U   U   0 . n 
A  1  1808 C   1808 1808 1808 C   C   0 . n 
A  1  1809 G   1809 1809 1809 G   G   0 . n 
A  1  1810 C   1810 1810 1810 C   C   0 . n 
A  1  1811 A   1811 1811 1811 A   A   0 . n 
A  1  1812 G   1812 1812 1812 G   G   0 . n 
A  1  1813 U   1813 1813 1813 U   U   0 . n 
A  1  1814 G   1814 1814 1814 G   G   0 . n 
A  1  1815 A   1815 1815 1815 A   A   0 . n 
A  1  1816 C   1816 1816 1816 C   C   0 . n 
A  1  1817 U   1817 1817 1817 U   U   0 . n 
A  1  1818 C   1818 1818 1818 C   C   0 . n 
A  1  1819 G   1819 1819 1819 G   G   0 . n 
A  1  1820 G   1820 1820 1820 G   G   0 . n 
A  1  1821 A   1821 1821 1821 A   A   0 . n 
A  1  1822 A   1822 1822 1822 A   A   0 . n 
A  1  1823 G   1823 1823 1823 G   G   0 . n 
A  1  1824 C   1824 1824 1824 C   C   0 . n 
A  1  1825 U   1825 1825 1825 U   U   0 . n 
A  1  1826 C   1826 1826 1826 C   C   0 . n 
A  1  1827 G   1827 1827 1827 G   G   0 . n 
A  1  1828 G   1828 1828 1828 G   G   0 . n 
A  1  1829 A   1829 1829 1829 A   A   0 . n 
A  1  1830 C   1830 1830 1830 C   C   0 . n 
A  1  1831 U   1831 1831 1831 U   U   0 . n 
A  1  1832 G   1832 1832 1832 G   G   0 . n 
A  1  1833 U   1833 1833 1833 U   U   0 . n 
A  1  1834 C   1834 1834 1834 C   C   0 . n 
A  1  1835 U   1835 1835 1835 U   U   0 . n 
A  1  1836 A   1836 1836 1836 A   A   0 . n 
A  1  1837 G   1837 1837 1837 G   G   0 . n 
A  1  1838 U   1838 1838 1838 U   U   0 . n 
A  1  1839 A   1839 1839 1839 A   A   0 . n 
A  1  1840 A   1840 1840 1840 A   A   0 . n 
A  1  1841 C   1841 1841 1841 C   C   0 . n 
A  1  1842 A   1842 1842 1842 A   A   0 . n 
A  1  1843 A   1843 1843 1843 A   A   0 . n 
A  1  1844 C   1844 1844 1844 C   C   0 . n 
A  1  1845 A   1845 1845 1845 A   A   0 . n 
A  1  1846 U   1846 1846 1846 U   U   0 . n 
A  1  1847 A   1847 1847 1847 A   A   0 . n 
A  1  1848 G   1848 1848 1848 G   G   0 . n 
A  1  1849 G   1849 1849 1849 G   G   0 . n 
A  1  1850 U   1850 1850 1850 U   U   0 . n 
A  1  1851 G   1851 1851 1851 G   G   0 . n 
A  1  1852 A   1852 1852 1852 A   A   0 . n 
A  1  1853 C   1853 1853 1853 C   C   0 . n 
A  1  1854 C   1854 1854 1854 C   C   0 . n 
A  1  1855 G   1855 1855 1855 G   G   0 . n 
A  1  1856 C   1856 1856 1856 C   C   0 . n 
A  1  1857 A   1857 1857 1857 A   A   0 . n 
A  1  1858 A   1858 1858 1858 A   A   0 . n 
A  1  1859 A   1859 1859 1859 A   A   0 . n 
A  1  1860 U   1860 1860 1860 U   U   0 . n 
A  1  1861 C   1861 1861 1861 C   C   0 . n 
A  1  1862 C   1862 1862 1862 C   C   0 . n 
A  1  1863 G   1863 1863 1863 G   G   0 . n 
A  1  1864 C   1864 1864 1864 C   C   0 . n 
A  1  1865 A   1865 1865 1865 A   A   0 . n 
A  1  1866 A   1866 1866 1866 A   A   0 . n 
A  1  1867 G   1867 1867 1867 G   G   0 . n 
A  1  1868 G   1868 1868 1868 G   G   0 . n 
A  1  1869 A   1869 1869 1869 A   A   0 . n 
A  1  1870 C   1870 1870 1870 C   C   0 . n 
A  1  1871 U   1871 1871 1871 U   U   0 . n 
A  1  1872 C   1872 1872 1872 C   C   0 . n 
A  1  1873 G   1873 1873 1873 G   G   0 . n 
A  1  1874 U   1874 1874 1874 U   U   0 . n 
A  1  1875 A   1875 1875 1875 A   A   0 . n 
A  1  1876 C   1876 1876 1876 C   C   0 . n 
A  1  1877 G   1877 1877 1877 G   G   0 . n 
A  1  1878 G   1878 1878 1878 G   G   0 . n 
A  1  1879 U   1879 1879 1879 U   U   0 . n 
A  1  1880 C   1880 1880 1880 C   C   0 . n 
A  1  1881 A   1881 1881 1881 A   A   0 . n 
A  1  1882 C   1882 1882 1882 C   C   0 . n 
A  1  1883 U   1883 1883 1883 U   U   0 . n 
A  1  1884 G   1884 1884 1884 G   G   0 . n 
A  1  1885 A   1885 1885 1885 A   A   0 . n 
A  1  1886 A   1886 1886 1886 A   A   0 . n 
A  1  1887 U   1887 1887 1887 U   U   0 . n 
A  1  1888 C   1888 1888 1888 C   C   0 . n 
A  1  1889 C   1889 1889 1889 C   C   0 . n 
A  1  1890 U   1890 1890 1890 U   U   0 . n 
A  1  1891 G   1891 1891 1891 G   G   0 . n 
A  1  1892 C   1892 1892 1892 C   C   0 . n 
A  1  1893 C   1893 1893 1893 C   C   0 . n 
A  1  1894 C   1894 1894 1894 C   C   0 . n 
A  1  1895 A   1895 1895 1895 A   A   0 . n 
A  1  1896 G   1896 1896 1896 G   G   0 . n 
A  1  1897 U   1897 1897 1897 U   U   0 . n 
A  1  1898 G   1898 1898 1898 G   G   0 . n 
A  1  1899 C   1899 1899 1899 C   C   0 . n 
A  1  1900 A   1900 1900 1900 A   A   0 . n 
A  1  1901 G   1901 1901 1901 G   G   0 . n 
A  1  1902 G   1902 1902 1902 G   G   0 . n 
A  1  1903 U   1903 1903 1903 U   U   0 . n 
A  1  1904 A   1904 1904 1904 A   A   0 . n 
A  1  1905 U   1905 1905 1905 U   U   0 . n 
A  1  1906 C   1906 1906 1906 C   C   0 . n 
A  1  1907 U   1907 1907 1907 U   U   0 . n 
A  1  1908 G   1908 1908 1908 G   G   0 . n 
A  1  1909 A   1909 1909 1909 A   A   0 . n 
A  1  1910 A   1910 1910 1910 A   A   0 . n 
A  1  1911 C   1911 1911 1911 C   C   0 . n 
A  1  1912 A   1912 1912 1912 A   A   0 . n 
A  1  1913 C   1913 1913 1913 C   C   0 . n 
A  1  1914 C   1914 1914 1914 C   C   0 . n 
A  1  1915 U   1915 1915 1915 U   U   0 . n 
A  1  1916 C   1916 1916 1916 C   C   0 . n 
A  1  1917 G   1917 1917 1917 G   G   0 . n 
A  1  1918 U   1918 1918 1918 U   U   0 . n 
A  1  1919 A   1919 1919 1919 A   A   0 . n 
A  1  1920 C   1920 1920 1920 C   C   0 . n 
A  1  1921 A   1921 1921 1921 A   A   0 . n 
A  1  1922 A   1922 1922 1922 A   A   0 . n 
A  1  1923 G   1923 1923 1923 G   G   0 . n 
A  1  1924 A   1924 1924 1924 A   A   0 . n 
A  1  1925 G   1925 1925 1925 G   G   0 . n 
A  1  1926 G   1926 1926 1926 G   G   0 . n 
A  1  1927 A   1927 1927 1927 A   A   0 . n 
A  1  1928 C   1928 1928 1928 C   C   0 . n 
A  1  1929 G   1929 1929 1929 G   G   0 . n 
A  1  1930 A   1930 1930 1930 A   A   0 . n 
A  1  1931 A   1931 1931 1931 A   A   0 . n 
A  1  1932 G   1932 1932 1932 G   G   0 . n 
A  1  1933 G   1933 1933 1933 G   G   0 . n 
A  1  1934 A   1934 1934 1934 A   A   0 . n 
A  1  1935 C   1935 1935 1935 C   C   0 . n 
A  1  1936 C   1936 1936 1936 C   C   0 . n 
A  1  1937 U   1937 1937 1937 U   U   0 . n 
A  1  1938 G   1938 1938 1938 G   G   0 . n 
A  1  1939 U   1939 1939 1939 U   U   0 . n 
A  1  1940 C   1940 1940 1940 C   C   0 . n 
A  1  1941 A   1941 1941 1941 A   A   0 . n 
A  1  1942 A   1942 1942 1942 A   A   0 . n 
A  1  1943 C   1943 1943 1943 C   C   0 . n 
A  1  1944 G   1944 1944 1944 G   G   0 . n 
A  1  1945 G   1945 1945 1945 G   G   0 . n 
A  1  1946 C   1946 1946 1946 C   C   0 . n 
A  1  1947 G   1947 1947 1947 G   G   0 . n 
A  1  1948 G   1948 1948 1948 G   G   0 . n 
A  1  1949 G   1949 1949 1949 G   G   0 . n 
A  1  1950 G   1950 1950 1950 G   G   0 . n 
A  1  1951 G   1951 1951 1951 G   G   0 . n 
A  1  1952 U   1952 1952 ?    ?   ?   0 . n 
A  1  1953 A   1953 1953 ?    ?   ?   0 . n 
A  1  1954 A   1954 1954 ?    ?   ?   0 . n 
A  1  1955 C   1955 1955 ?    ?   ?   0 . n 
A  1  1956 U   1956 1956 ?    ?   ?   0 . n 
A  1  1957 A   1957 1957 ?    ?   ?   0 . n 
A  1  1958 U   1958 1958 ?    ?   ?   0 . n 
A  1  1959 G   1959 1959 ?    ?   ?   0 . n 
A  1  1960 A   1960 1960 ?    ?   ?   0 . n 
A  1  1961 C   1961 1961 ?    ?   ?   0 . n 
A  1  1962 C   1962 1962 ?    ?   ?   0 . n 
A  1  1963 C   1963 1963 ?    ?   ?   0 . n 
A  1  1964 U   1964 1964 1964 U   U   0 . n 
A  1  1965 C   1965 1965 1965 C   C   0 . n 
A  1  1966 U   1966 1966 1966 U   U   0 . n 
A  1  1967 U   1967 1967 1967 U   U   0 . n 
A  1  1968 A   1968 1968 1968 A   A   0 . n 
A  1  1969 A   1969 1969 1969 A   A   0 . n 
A  1  1970 G   1970 1970 1970 G   G   0 . n 
A  1  1971 G   1971 1971 1971 G   G   0 . n 
A  1  1972 U   1972 1972 1972 U   U   0 . n 
A  1  1973 A   1973 1973 1973 A   A   0 . n 
A  1  1974 G   1974 1974 1974 G   G   0 . n 
A  1  1975 C   1975 1975 1975 C   C   0 . n 
A  1  1976 G   1976 1976 1976 G   G   0 . n 
A  1  1977 U   1977 1977 1977 U   U   0 . n 
A  1  1978 A   1978 1978 1978 A   A   0 . n 
A  1  1979 G   1979 1979 1979 G   G   0 . n 
A  1  1980 U   1980 1980 1980 U   U   0 . n 
A  1  1981 A   1981 1981 1981 A   A   0 . n 
A  1  1982 C   1982 1982 1982 C   C   0 . n 
A  1  1983 C   1983 1983 1983 C   C   0 . n 
A  1  1984 U   1984 1984 1984 U   U   0 . n 
A  1  1985 U   1985 1985 1985 U   U   0 . n 
A  1  1986 G   1986 1986 1986 G   G   0 . n 
A  1  1987 C   1987 1987 1987 C   C   0 . n 
A  1  1988 C   1988 1988 1988 C   C   0 . n 
A  1  1989 G   1989 1989 1989 G   G   0 . n 
A  1  1990 C   1990 1990 1990 C   C   0 . n 
A  1  1991 A   1991 1991 1991 A   A   0 . n 
A  1  1992 U   1992 1992 1992 U   U   0 . n 
A  1  1993 C   1993 1993 1993 C   C   0 . n 
A  1  1994 A   1994 1994 1994 A   A   0 . n 
A  1  1995 G   1995 1995 1995 G   G   0 . n 
A  1  1996 U   1996 1996 1996 U   U   0 . n 
A  1  1997 A   1997 1997 1997 A   A   0 . n 
A  1  1998 G   1998 1998 1998 G   G   0 . n 
A  1  1999 C   1999 1999 1999 C   C   0 . n 
A  1  2000 G   2000 2000 2000 G   G   0 . n 
A  1  2001 G   2001 2001 2001 G   G   0 . n 
A  1  2002 C   2002 2002 2002 C   C   0 . n 
A  1  2003 U   2003 2003 2003 U   U   0 . n 
A  1  2004 U   2004 2004 2004 U   U   0 . n 
A  1  2005 G   2005 2005 2005 G   G   0 . n 
A  1  2006 C   2006 2006 2006 C   C   0 . n 
A  1  2007 A   2007 2007 2007 A   A   0 . n 
A  1  2008 U   2008 2008 2008 U   U   0 . n 
A  1  2009 G   2009 2009 2009 G   G   0 . n 
A  1  2010 A   2010 2010 2010 A   A   0 . n 
A  1  2011 A   2011 2011 2011 A   A   0 . n 
A  1  2012 U   2012 2012 2012 U   U   0 . n 
A  1  2013 G   2013 2013 2013 G   G   0 . n 
A  1  2014 G   2014 2014 2014 G   G   0 . n 
A  1  2015 A   2015 2015 2015 A   A   0 . n 
A  1  2016 U   2016 2016 2016 U   U   0 . n 
A  1  2017 U   2017 2017 2017 U   U   0 . n 
A  1  2018 A   2018 2018 2018 A   A   0 . n 
A  1  2019 A   2019 2019 2019 A   A   0 . n 
A  1  2020 C   2020 2020 2020 C   C   0 . n 
A  1  2021 C   2021 2021 2021 C   C   0 . n 
A  1  2022 A   2022 2022 2022 A   A   0 . n 
A  1  2023 G   2023 2023 2023 G   G   0 . n 
A  1  2024 A   2024 2024 2024 A   A   0 . n 
A  1  2025 G   2025 2025 2025 G   G   0 . n 
A  1  2026 C   2026 2026 2026 C   C   0 . n 
A  1  2027 U   2027 2027 2027 U   U   0 . n 
A  1  2028 U   2028 2028 2028 U   U   0 . n 
A  1  2029 C   2029 2029 2029 C   C   0 . n 
A  1  2030 A   2030 2030 2030 A   A   0 . n 
A  1  2031 C   2031 2031 2031 C   C   0 . n 
A  1  2032 U   2032 2032 2032 U   U   0 . n 
A  1  2033 G   2033 2033 2033 G   G   0 . n 
A  1  2034 U   2034 2034 2034 U   U   0 . n 
A  1  2035 C   2035 2035 2035 C   C   0 . n 
A  1  2036 C   2036 2036 2036 C   C   0 . n 
A  1  2037 C   2037 2037 2037 C   C   0 . n 
A  1  2038 A   2038 2038 2038 A   A   0 . n 
A  1  2039 A   2039 2039 2039 A   A   0 . n 
A  1  2040 C   2040 2040 2040 C   C   0 . n 
A  1  2041 G   2041 2041 2041 G   G   0 . n 
A  1  2042 U   2042 2042 2042 U   U   0 . n 
A  1  2043 U   2043 2043 2043 U   U   0 . n 
A  1  2044 G   2044 2044 2044 G   G   0 . n 
A  1  2045 G   2045 2045 2045 G   G   0 . n 
A  1  2046 G   2046 2046 2046 G   G   0 . n 
A  1  2047 C   2047 2047 2047 C   C   0 . n 
A  1  2048 C   2048 2048 2048 C   C   0 . n 
A  1  2049 C   2049 2049 2049 C   C   0 . n 
A  1  2050 G   2050 2050 2050 G   G   0 . n 
A  1  2051 G   2051 2051 2051 G   G   0 . n 
A  1  2052 U   2052 2052 2052 U   U   0 . n 
A  1  2053 G   2053 2053 2053 G   G   0 . n 
A  1  2054 A   2054 2054 2054 A   A   0 . n 
A  1  2055 A   2055 2055 2055 A   A   0 . n 
A  1  2056 C   2056 2056 2056 C   C   0 . n 
A  1  2057 U   2057 2057 2057 U   U   0 . n 
A  1  2058 G   2058 2058 2058 G   G   0 . n 
A  1  2059 U   2059 2059 2059 U   U   0 . n 
A  1  2060 A   2060 2060 2060 A   A   0 . n 
A  1  2061 C   2061 2061 2061 C   C   0 . n 
A  1  2062 A   2062 2062 2062 A   A   0 . n 
A  1  2063 U   2063 2063 2063 U   U   0 . n 
A  1  2064 U   2064 2064 2064 U   U   0 . n 
A  1  2065 C   2065 2065 2065 C   C   0 . n 
A  1  2066 C   2066 2066 2066 C   C   0 . n 
A  1  2067 A   2067 2067 2067 A   A   0 . n 
A  1  2068 G   2068 2068 2068 G   G   0 . n 
A  1  2069 U   2069 2069 2069 U   U   0 . n 
A  1  2070 G   2070 2070 2070 G   G   0 . n 
A  1  2071 C   2071 2071 2071 C   C   0 . n 
A  1  2072 G   2072 2072 2072 G   G   0 . n 
A  1  2073 G   2073 2073 2073 G   G   0 . n 
A  1  2074 A   2074 2074 2074 A   A   0 . n 
A  1  2075 G   2075 2075 2075 G   G   0 . n 
A  1  2076 U   2076 2076 2076 U   U   0 . n 
A  1  2077 C   2077 2077 2077 C   C   0 . n 
A  1  2078 U   2078 2078 2078 U   U   0 . n 
A  1  2079 G   2079 2079 2079 G   G   0 . n 
A  1  2080 G   2080 2080 2080 G   G   0 . n 
A  1  2081 A   2081 2081 2081 A   A   0 . n 
A  1  2082 G   2082 2082 2082 G   G   0 . n 
A  1  2083 A   2083 2083 2083 A   A   0 . n 
A  1  2084 C   2084 2084 2084 C   C   0 . n 
A  1  2085 A   2085 2085 2085 A   A   0 . n 
A  1  2086 C   2086 2086 2086 C   C   0 . n 
A  1  2087 C   2087 2087 2087 C   C   0 . n 
A  1  2088 C   2088 2088 2088 C   C   0 . n 
A  1  2089 A   2089 2089 2089 A   A   0 . n 
A  1  2090 G   2090 2090 2090 G   G   0 . n 
A  1  2091 G   2091 2091 2091 G   G   0 . n 
A  1  2092 G   2092 2092 2092 G   G   0 . n 
A  1  2093 G   2093 2093 2093 G   G   0 . n 
A  1  2094 G   2094 2094 2094 G   G   0 . n 
A  1  2095 A   2095 2095 2095 A   A   0 . n 
A  1  2096 A   2096 2096 2096 A   A   0 . n 
A  1  2097 G   2097 2097 2097 G   G   0 . n 
A  1  2098 C   2098 2098 2098 C   C   0 . n 
A  1  2099 A   2099 2099 2099 A   A   0 . n 
A  1  2100 A   2100 2100 2100 A   A   0 . n 
A  1  2101 A   2101 2101 2101 A   A   0 . n 
A  1  2102 G   2102 2102 2102 G   G   0 . n 
A  1  2103 A   2103 2103 2103 A   A   0 . n 
A  1  2104 C   2104 2104 2104 C   C   0 . n 
A  1  2105 C   2105 2105 2105 C   C   0 . n 
A  1  2106 C   2106 2106 2106 C   C   0 . n 
A  1  2107 U   2107 2107 2107 U   U   0 . n 
A  1  2108 A   2108 2108 2108 A   A   0 . n 
A  1  2109 U   2109 2109 2109 U   U   0 . n 
A  1  2110 G   2110 2110 2110 G   G   0 . n 
A  1  2111 G   2111 2111 2111 G   G   0 . n 
A  1  2112 A   2112 2112 2112 A   A   0 . n 
A  1  2113 G   2113 2113 2113 G   G   0 . n 
A  1  2114 C   2114 2114 2114 C   C   0 . n 
A  1  2115 U   2115 2115 2115 U   U   0 . n 
A  1  2116 U   2116 2116 2116 U   U   0 . n 
A  1  2117 U   2117 2117 2117 U   U   0 . n 
A  1  2118 A   2118 2118 2118 A   A   0 . n 
A  1  2119 C   2119 2119 2119 C   C   0 . n 
A  1  2120 U   2120 2120 2120 U   U   0 . n 
A  1  2121 G   2121 2121 2121 G   G   0 . n 
A  1  2122 C   2122 2122 2122 C   C   0 . n 
A  1  2123 A   2123 2123 2123 A   A   0 . n 
A  1  2124 G   2124 2124 2124 G   G   0 . n 
A  1  2125 G   2125 2125 2125 G   G   0 . n 
A  1  2126 C   2126 2126 2126 C   C   0 . n 
A  1  2127 U   2127 2127 2127 U   U   0 . n 
A  1  2128 G   2128 2128 2128 G   G   0 . n 
A  1  2129 U   2129 2129 2129 U   U   0 . n 
A  1  2130 C   2130 2130 2130 C   C   0 . n 
A  1  2131 G   2131 2131 2131 G   G   0 . n 
A  1  2132 C   2132 2132 2132 C   C   0 . n 
A  1  2133 U   2133 2133 2133 U   U   0 . n 
A  1  2134 G   2134 2134 2134 G   G   0 . n 
A  1  2135 A   2135 2135 2135 A   A   0 . n 
A  1  2136 G   2136 2136 2136 G   G   0 . n 
A  1  2137 A   2137 2137 ?    ?   ?   0 . n 
A  1  2138 C   2138 2138 ?    ?   ?   0 . n 
A  1  2139 G   2139 2139 ?    ?   ?   0 . n 
A  1  2140 U   2140 2140 ?    ?   ?   0 . n 
A  1  2141 G   2141 2141 ?    ?   ?   0 . n 
A  1  2142 G   2142 2142 ?    ?   ?   0 . n 
A  1  2143 U   2143 2143 ?    ?   ?   0 . n 
A  1  2144 C   2144 2144 ?    ?   ?   0 . n 
A  1  2145 G   2145 2145 ?    ?   ?   0 . n 
A  1  2146 C   2146 2146 ?    ?   ?   0 . n 
A  1  2147 C   2147 2147 ?    ?   ?   0 . n 
A  1  2148 G   2148 2148 ?    ?   ?   0 . n 
A  1  2149 A   2149 2149 ?    ?   ?   0 . n 
A  1  2150 U   2150 2150 ?    ?   ?   0 . n 
A  1  2151 G   2151 2151 ?    ?   ?   0 . n 
A  1  2152 U   2152 2152 ?    ?   ?   0 . n 
A  1  2153 G   2153 2153 ?    ?   ?   0 . n 
A  1  2154 C   2154 2154 ?    ?   ?   0 . n 
A  1  2155 A   2155 2155 ?    ?   ?   0 . n 
A  1  2156 G   2156 2156 ?    ?   ?   0 . n 
A  1  2157 C   2157 2157 ?    ?   ?   0 . n 
A  1  2158 A   2158 2158 ?    ?   ?   0 . n 
A  1  2159 U   2159 2159 ?    ?   ?   0 . n 
A  1  2160 A   2160 2160 ?    ?   ?   0 . n 
A  1  2161 G   2161 2161 ?    ?   ?   0 . n 
A  1  2162 G   2162 2162 ?    ?   ?   0 . n 
A  1  2163 U   2163 2163 ?    ?   ?   0 . n 
A  1  2164 A   2164 2164 ?    ?   ?   0 . n 
A  1  2165 G   2165 2165 ?    ?   ?   0 . n 
A  1  2166 G   2166 2166 ?    ?   ?   0 . n 
A  1  2167 A   2167 2167 ?    ?   ?   0 . n 
A  1  2168 G   2168 2168 ?    ?   ?   0 . n 
A  1  2169 U   2169 2169 ?    ?   ?   0 . n 
A  1  2170 C   2170 2170 ?    ?   ?   0 . n 
A  1  2171 G   2171 2171 ?    ?   ?   0 . n 
A  1  2172 U   2172 2172 ?    ?   ?   0 . n 
A  1  2173 U   2173 2173 ?    ?   ?   0 . n 
A  1  2174 A   2174 2174 ?    ?   ?   0 . n 
A  1  2175 C   2175 2175 ?    ?   ?   0 . n 
A  1  2176 A   2176 2176 ?    ?   ?   0 . n 
A  1  2177 G   2177 2177 ?    ?   ?   0 . n 
A  1  2178 A   2178 2178 ?    ?   ?   0 . n 
A  1  2179 G   2179 2179 ?    ?   ?   0 . n 
A  1  2180 G   2180 2180 ?    ?   ?   0 . n 
A  1  2181 U   2181 2181 ?    ?   ?   0 . n 
A  1  2182 A   2182 2182 ?    ?   ?   0 . n 
A  1  2183 C   2183 2183 ?    ?   ?   0 . n 
A  1  2184 C   2184 2184 ?    ?   ?   0 . n 
A  1  2185 C   2185 2185 ?    ?   ?   0 . n 
A  1  2186 G   2186 2186 ?    ?   ?   0 . n 
A  1  2187 C   2187 2187 ?    ?   ?   0 . n 
A  1  2188 G   2188 2188 ?    ?   ?   0 . n 
A  1  2189 C   2189 2189 ?    ?   ?   0 . n 
A  1  2190 U   2190 2190 ?    ?   ?   0 . n 
A  1  2191 A   2191 2191 ?    ?   ?   0 . n 
A  1  2192 G   2192 2192 ?    ?   ?   0 . n 
A  1  2193 C   2193 2193 ?    ?   ?   0 . n 
A  1  2194 G   2194 2194 ?    ?   ?   0 . n 
A  1  2195 G   2195 2195 ?    ?   ?   0 . n 
A  1  2196 G   2196 2196 ?    ?   ?   0 . n 
A  1  2197 C   2197 2197 ?    ?   ?   0 . n 
A  1  2198 C   2198 2198 ?    ?   ?   0 . n 
A  1  2199 A   2199 2199 ?    ?   ?   0 . n 
A  1  2200 C   2200 2200 ?    ?   ?   0 . n 
A  1  2201 C   2201 2201 ?    ?   ?   0 . n 
A  1  2202 C   2202 2202 ?    ?   ?   0 . n 
A  1  2203 A   2203 2203 ?    ?   ?   0 . n 
A  1  2204 G   2204 2204 ?    ?   ?   0 . n 
A  1  2205 A   2205 2205 ?    ?   ?   0 . n 
A  1  2206 C   2206 2206 ?    ?   ?   0 . n 
A  1  2207 A   2207 2207 ?    ?   ?   0 . n 
A  1  2208 A   2208 2208 ?    ?   ?   0 . n 
A  1  2209 C   2209 2209 ?    ?   ?   0 . n 
A  1  2210 A   2210 2210 ?    ?   ?   0 . n 
A  1  2211 G   2211 2211 ?    ?   ?   0 . n 
A  1  2212 U   2212 2212 ?    ?   ?   0 . n 
A  1  2213 G   2213 2213 ?    ?   ?   0 . n 
A  1  2214 A   2214 2214 ?    ?   ?   0 . n 
A  1  2215 A   2215 2215 ?    ?   ?   0 . n 
A  1  2216 A   2216 2216 ?    ?   ?   0 . n 
A  1  2217 U   2217 2217 ?    ?   ?   0 . n 
A  1  2218 A   2218 2218 ?    ?   ?   0 . n 
A  1  2219 C   2219 2219 ?    ?   ?   0 . n 
A  1  2220 U   2220 2220 ?    ?   ?   0 . n 
A  1  2221 A   2221 2221 ?    ?   ?   0 . n 
A  1  2222 C   2222 2222 ?    ?   ?   0 . n 
A  1  2223 C   2223 2223 ?    ?   ?   0 . n 
A  1  2224 C   2224 2224 ?    ?   ?   0 . n 
A  1  2225 G   2225 2225 ?    ?   ?   0 . n 
A  1  2226 U   2226 2226 ?    ?   ?   0 . n 
A  1  2227 C   2227 2227 ?    ?   ?   0 . n 
A  1  2228 G   2228 2228 ?    ?   ?   0 . n 
A  1  2229 G   2229 2229 ?    ?   ?   0 . n 
A  1  2230 U   2230 2230 ?    ?   ?   0 . n 
A  1  2231 G   2231 2231 ?    ?   ?   0 . n 
A  1  2232 A   2232 2232 ?    ?   ?   0 . n 
A  1  2233 C   2233 2233 ?    ?   ?   0 . n 
A  1  2234 U   2234 2234 ?    ?   ?   0 . n 
A  1  2235 G   2235 2235 ?    ?   ?   0 . n 
A  1  2236 C   2236 2236 ?    ?   ?   0 . n 
A  1  2237 G   2237 2237 2237 G   G   0 . n 
A  1  2238 A   2238 2238 2238 A   A   0 . n 
A  1  2239 C   2239 2239 2239 C   C   0 . n 
A  1  2240 U   2240 2240 2240 U   U   0 . n 
A  1  2241 C   2241 2241 2241 C   C   0 . n 
A  1  2242 U   2242 2242 2242 U   U   0 . n 
A  1  2243 C   2243 2243 2243 C   C   0 . n 
A  1  2244 A   2244 2244 2244 A   A   0 . n 
A  1  2245 C   2245 2245 2245 C   C   0 . n 
A  1  2246 U   2246 2246 2246 U   U   0 . n 
A  1  2247 C   2247 2247 2247 C   C   0 . n 
A  1  2248 C   2248 2248 2248 C   C   0 . n 
A  1  2249 G   2249 2249 2249 G   G   0 . n 
A  1  2250 G   2250 2250 2250 G   G   0 . n 
A  1  2251 G   2251 2251 2251 G   G   0 . n 
A  1  2252 A   2252 2252 2252 A   A   0 . n 
A  1  2253 G   2253 2253 2253 G   G   0 . n 
A  1  2254 G   2254 2254 2254 G   G   0 . n 
A  1  2255 A   2255 2255 2255 A   A   0 . n 
A  1  2256 G   2256 2256 2256 G   G   0 . n 
A  1  2257 G   2257 2257 2257 G   G   0 . n 
A  1  2258 A   2258 2258 2258 A   A   0 . n 
A  1  2259 C   2259 2259 2259 C   C   0 . n 
A  1  2260 A   2260 2260 2260 A   A   0 . n 
A  1  2261 C   2261 2261 2261 C   C   0 . n 
A  1  2262 C   2262 2262 2262 C   C   0 . n 
A  1  2263 G   2263 2263 2263 G   G   0 . n 
A  1  2264 A   2264 2264 2264 A   A   0 . n 
A  1  2265 U   2265 2265 2265 U   U   0 . n 
A  1  2266 A   2266 2266 2266 A   A   0 . n 
A  1  2267 G   2267 2267 2267 G   G   0 . n 
A  1  2268 C   2268 2268 2268 C   C   0 . n 
A  1  2269 C   2269 2269 2269 C   C   0 . n 
A  1  2270 G   2270 2270 2270 G   G   0 . n 
A  1  2271 G   2271 2271 2271 G   G   0 . n 
A  1  2272 G   2272 2272 2272 G   G   0 . n 
A  1  2273 C   2273 2273 2273 C   C   0 . n 
A  1  2274 A   2274 2274 2274 A   A   0 . n 
A  1  2275 G   2275 2275 2275 G   G   0 . n 
A  1  2276 U   2276 2276 2276 U   U   0 . n 
A  1  2277 U   2277 2277 2277 U   U   0 . n 
A  1  2278 U   2278 2278 2278 U   U   0 . n 
A  1  2279 G   2279 2279 2279 G   G   0 . n 
A  1  2280 A   2280 2280 2280 A   A   0 . n 
A  1  2281 C   2281 2281 2281 C   C   0 . n 
A  1  2282 U   2282 2282 2282 U   U   0 . n 
A  1  2283 G   2283 2283 2283 G   G   0 . n 
A  1  2284 G   2284 2284 2284 G   G   0 . n 
A  1  2285 G   2285 2285 2285 G   G   0 . n 
A  1  2286 G   2286 2286 2286 G   G   0 . n 
A  1  2287 C   2287 2287 2287 C   C   0 . n 
A  1  2288 G   2288 2288 2288 G   G   0 . n 
A  1  2289 G   2289 2289 2289 G   G   0 . n 
A  1  2290 U   2290 2290 2290 U   U   0 . n 
A  1  2291 A   2291 2291 2291 A   A   0 . n 
A  1  2292 C   2292 2292 2292 C   C   0 . n 
A  1  2293 G   2293 2293 2293 G   G   0 . n 
A  1  2294 C   2294 2294 2294 C   C   0 . n 
A  1  2295 G   2295 2295 2295 G   G   0 . n 
A  1  2296 C   2296 2296 2296 C   C   0 . n 
A  1  2297 U   2297 2297 2297 U   U   0 . n 
A  1  2298 C   2298 2298 2298 C   C   0 . n 
A  1  2299 G   2299 2299 2299 G   G   0 . n 
A  1  2300 A   2300 2300 2300 A   A   0 . n 
A  1  2301 A   2301 2301 2301 A   A   0 . n 
A  1  2302 A   2302 2302 2302 A   A   0 . n 
A  1  2303 A   2303 2303 2303 A   A   0 . n 
A  1  2304 G   2304 2304 2304 G   G   0 . n 
A  1  2305 A   2305 2305 2305 A   A   0 . n 
A  1  2306 U   2306 2306 2306 U   U   0 . n 
A  1  2307 A   2307 2307 2307 A   A   0 . n 
A  1  2308 U   2308 2308 2308 U   U   0 . n 
A  1  2309 C   2309 2309 2309 C   C   0 . n 
A  1  2310 G   2310 2310 2310 G   G   0 . n 
A  1  2311 A   2311 2311 2311 A   A   0 . n 
A  1  2312 G   2312 2312 2312 G   G   0 . n 
A  1  2313 C   2313 2313 2313 C   C   0 . n 
A  1  2314 G   2314 2314 2314 G   G   0 . n 
A  1  2315 C   2315 2315 2315 C   C   0 . n 
A  1  2316 G   2316 2316 2316 G   G   0 . n 
A  1  2317 C   2317 2317 2317 C   C   0 . n 
A  1  2318 C   2318 2318 2318 C   C   0 . n 
A  1  2319 C   2319 2319 2319 C   C   0 . n 
A  1  2320 U   2320 2320 2320 U   U   0 . n 
A  1  2321 A   2321 2321 2321 A   A   0 . n 
A  1  2322 U   2322 2322 2322 U   U   0 . n 
A  1  2323 G   2323 2323 2323 G   G   0 . n 
A  1  2324 G   2324 2324 2324 G   G   0 . n 
A  1  2325 U   2325 2325 2325 U   U   0 . n 
A  1  2326 C   2326 2326 2326 C   C   0 . n 
A  1  2327 A   2327 2327 2327 A   A   0 . n 
A  1  2328 U   2328 2328 2328 U   U   0 . n 
A  1  2329 C   2329 2329 2329 C   C   0 . n 
A  1  2330 U   2330 2330 2330 U   U   0 . n 
A  1  2331 C   2331 2331 2331 C   C   0 . n 
A  1  2332 A   2332 2332 2332 A   A   0 . n 
A  1  2333 G   2333 2333 2333 G   G   0 . n 
A  1  2334 C   2334 2334 2334 C   C   0 . n 
A  1  2335 C   2335 2335 2335 C   C   0 . n 
A  1  2336 G   2336 2336 2336 G   G   0 . n 
A  1  2337 G   2337 2337 2337 G   G   0 . n 
A  1  2338 G   2338 2338 2338 G   G   0 . n 
A  1  2339 A   2339 2339 ?    ?   ?   0 . n 
A  1  2340 C   2340 2340 ?    ?   ?   0 . n 
A  1  2341 A   2341 2341 ?    ?   ?   0 . n 
A  1  2342 G   2342 2342 ?    ?   ?   0 . n 
A  1  2343 A   2343 2343 ?    ?   ?   0 . n 
A  1  2344 G   2344 2344 2344 G   G   0 . n 
A  1  2345 A   2345 2345 2345 A   A   0 . n 
A  1  2346 C   2346 2346 2346 C   C   0 . n 
A  1  2347 C   2347 2347 2347 C   C   0 . n 
A  1  2348 C   2348 2348 2348 C   C   0 . n 
A  1  2349 G   2349 2349 2349 G   G   0 . n 
A  1  2350 G   2350 2350 2350 G   G   0 . n 
A  1  2351 C   2351 2351 2351 C   C   0 . n 
A  1  2352 G   2352 2352 2352 G   G   0 . n 
A  1  2353 A   2353 2353 2353 A   A   0 . n 
A  1  2354 A   2354 2354 2354 A   A   0 . n 
A  1  2355 G   2355 2355 2355 G   G   0 . n 
A  1  2356 A   2356 2356 2356 A   A   0 . n 
A  1  2357 G   2357 2357 2357 G   G   0 . n 
A  1  2358 U   2358 2358 2358 U   U   0 . n 
A  1  2359 G   2359 2359 2359 G   G   0 . n 
A  1  2360 C   2360 2360 2360 C   C   0 . n 
A  1  2361 A   2361 2361 2361 A   A   0 . n 
A  1  2362 A   2362 2362 2362 A   A   0 . n 
A  1  2363 G   2363 2363 2363 G   G   0 . n 
A  1  2364 A   2364 2364 2364 A   A   0 . n 
A  1  2365 G   2365 2365 2365 G   G   0 . n 
A  1  2366 C   2366 2366 2366 C   C   0 . n 
A  1  2367 A   2367 2367 2367 A   A   0 . n 
A  1  2368 A   2368 2368 2368 A   A   0 . n 
A  1  2369 A   2369 2369 2369 A   A   0 . n 
A  1  2370 A   2370 2370 2370 A   A   0 . n 
A  1  2371 G   2371 2371 2371 G   G   0 . n 
A  1  2372 A   2372 2372 2372 A   A   0 . n 
A  1  2373 U   2373 2373 2373 U   U   0 . n 
A  1  2374 G   2374 2374 2374 G   G   0 . n 
A  1  2375 A   2375 2375 2375 A   A   0 . n 
A  1  2376 C   2376 2376 2376 C   C   0 . n 
A  1  2377 U   2377 2377 2377 U   U   0 . n 
A  1  2378 U   2378 2378 2378 U   U   0 . n 
A  1  2379 G   2379 2379 2379 G   G   0 . n 
A  1  2380 A   2380 2380 2380 A   A   0 . n 
A  1  2381 C   2381 2381 2381 C   C   0 . n 
A  1  2382 A   2382 2382 2382 A   A   0 . n 
A  1  2383 G   2383 2383 2383 G   G   0 . n 
A  1  2384 U   2384 2384 2384 U   U   0 . n 
A  1  2385 G   2385 2385 2385 G   G   0 . n 
A  1  2386 U   2386 2386 2386 U   U   0 . n 
A  1  2387 U   2387 2387 2387 U   U   0 . n 
A  1  2388 C   2388 2388 2388 C   C   0 . n 
A  1  2389 U   2389 2389 2389 U   U   0 . n 
A  1  2390 U   2390 2390 2390 U   U   0 . n 
A  1  2391 C   2391 2391 2391 C   C   0 . n 
A  1  2392 C   2392 2392 2392 C   C   0 . n 
A  1  2393 C   2393 2393 2393 C   C   0 . n 
A  1  2394 A   2394 2394 2394 A   A   0 . n 
A  1  2395 A   2395 2395 2395 A   A   0 . n 
A  1  2396 C   2396 2396 2396 C   C   0 . n 
A  1  2397 G   2397 2397 2397 G   G   0 . n 
A  1  2398 A   2398 2398 2398 A   A   0 . n 
A  1  2399 G   2399 2399 2399 G   G   0 . n 
A  1  2400 G   2400 2400 2400 G   G   0 . n 
A  1  2401 A   2401 2401 2401 A   A   0 . n 
A  1  2402 A   2402 2402 2402 A   A   0 . n 
A  1  2403 C   2403 2403 2403 C   C   0 . n 
A  1  2404 G   2404 2404 2404 G   G   0 . n 
A  1  2405 C   2405 2405 2405 C   C   0 . n 
A  1  2406 U   2406 2406 2406 U   U   0 . n 
A  1  2407 G   2407 2407 2407 G   G   0 . n 
A  1  2408 A   2408 2408 2408 A   A   0 . n 
A  1  2409 C   2409 2409 2409 C   C   0 . n 
A  1  2410 G   2410 2410 2410 G   G   0 . n 
A  1  2411 C   2411 2411 2411 C   C   0 . n 
A  1  2412 G   2412 2412 2412 G   G   0 . n 
A  1  2413 A   2413 2413 2413 A   A   0 . n 
A  1  2414 A   2414 2414 2414 A   A   0 . n 
A  1  2415 A   2415 2415 2415 A   A   0 . n 
A  1  2416 G   2416 2416 2416 G   G   0 . n 
A  1  2417 C   2417 2417 2417 C   C   0 . n 
A  1  2418 G   2418 2418 2418 G   G   0 . n 
A  1  2419 U   2419 2419 2419 U   U   0 . n 
A  1  2420 G   2420 2420 2420 G   G   0 . n 
A  1  2421 G   2421 2421 2421 G   G   0 . n 
A  1  2422 U   2422 2422 2422 U   U   0 . n 
A  1  2423 C   2423 2423 2423 C   C   0 . n 
A  1  2424 U   2424 2424 2424 U   U   0 . n 
A  1  2425 A   2425 2425 2425 A   A   0 . n 
A  1  2426 G   2426 2426 2426 G   G   0 . n 
A  1  2427 C   2427 2427 2427 C   C   0 . n 
A  1  2428 G   2428 2428 2428 G   G   0 . n 
A  1  2429 A   2429 2429 2429 A   A   0 . n 
A  1  2430 A   2430 2430 2430 A   A   0 . n 
A  1  2431 C   2431 2431 2431 C   C   0 . n 
A  1  2432 C   2432 2432 2432 C   C   0 . n 
A  1  2433 A   2433 2433 2433 A   A   0 . n 
A  1  2434 A   2434 2434 2434 A   A   0 . n 
A  1  2435 U   2435 2435 2435 U   U   0 . n 
A  1  2436 U   2436 2436 2436 U   U   0 . n 
A  1  2437 A   2437 2437 2437 A   A   0 . n 
A  1  2438 G   2438 2438 2438 G   G   0 . n 
A  1  2439 C   2439 2439 2439 C   C   0 . n 
A  1  2440 C   2440 2440 2440 C   C   0 . n 
A  1  2441 U   2441 2441 2441 U   U   0 . n 
A  1  2442 G   2442 2442 2442 G   G   0 . n 
A  1  2443 C   2443 2443 2443 C   C   0 . n 
A  1  2444 U   2444 2444 2444 U   U   0 . n 
A  1  2445 U   2445 2445 2445 U   U   0 . n 
A  1  2446 G   2446 2446 2446 G   G   0 . n 
A  1  2447 A   2447 2447 2447 A   A   0 . n 
A  1  2448 U   2448 2448 2448 U   U   0 . n 
A  1  2449 G   2449 2449 2449 G   G   0 . n 
A  1  2450 C   2450 2450 2450 C   C   0 . n 
A  1  2451 G   2451 2451 2451 G   G   0 . n 
A  1  2452 G   2452 2452 2452 G   G   0 . n 
A  1  2453 G   2453 2453 2453 G   G   0 . n 
A  1  2454 C   2454 2454 2454 C   C   0 . n 
A  1  2455 A   2455 2455 2455 A   A   0 . n 
A  1  2456 A   2456 2456 2456 A   A   0 . n 
A  1  2457 U   2457 2457 2457 U   U   0 . n 
A  1  2458 U   2458 2458 2458 U   U   0 . n 
A  1  2459 G   2459 2459 2459 G   G   0 . n 
A  1  2460 A   2460 2460 2460 A   A   0 . n 
A  1  2461 U   2461 2461 2461 U   U   0 . n 
A  1  2462 G   2462 2462 2462 G   G   0 . n 
A  1  2463 A   2463 2463 2463 A   A   0 . n 
A  1  2464 C   2464 2464 2464 C   C   0 . n 
A  1  2465 A   2465 2465 2465 A   A   0 . n 
A  1  2466 G   2466 2466 2466 G   G   0 . n 
A  1  2467 A   2467 2467 2467 A   A   0 . n 
A  1  2468 A   2468 2468 2468 A   A   0 . n 
A  1  2469 A   2469 2469 2469 A   A   0 . n 
A  1  2470 A   2470 2470 2470 A   A   0 . n 
A  1  2471 G   2471 2471 2471 G   G   0 . n 
A  1  2472 C   2472 2472 2472 C   C   0 . n 
A  1  2473 U   2473 2473 2473 U   U   0 . n 
A  1  2474 A   2474 2474 2474 A   A   0 . n 
A  1  2475 C   2475 2475 2475 C   C   0 . n 
A  1  2476 C   2476 2476 2476 C   C   0 . n 
A  1  2477 C   2477 2477 2477 C   C   0 . n 
A  1  2478 U   2478 2478 2478 U   U   0 . n 
A  1  2479 A   2479 2479 2479 A   A   0 . n 
A  1  2480 G   2480 2480 2480 G   G   0 . n 
A  1  2481 G   2481 2481 2481 G   G   0 . n 
A  1  2482 G   2482 2482 2482 G   G   0 . n 
A  1  2483 A   2483 2483 2483 A   A   0 . n 
A  1  2484 U   2484 2484 2484 U   U   0 . n 
A  1  2485 A   2485 2485 2485 A   A   0 . n 
A  1  2486 A   2486 2486 2486 A   A   0 . n 
A  1  2487 C   2487 2487 2487 C   C   0 . n 
A  1  2488 A   2488 2488 2488 A   A   0 . n 
A  1  2489 G   2489 2489 2489 G   G   0 . n 
A  1  2490 A   2490 2490 2490 A   A   0 . n 
A  1  2491 G   2491 2491 2491 G   G   0 . n 
A  1  2492 U   2492 2492 2492 U   U   0 . n 
A  1  2493 C   2493 2493 2493 C   C   0 . n 
A  1  2494 G   2494 2494 2494 G   G   0 . n 
A  1  2495 U   2495 2495 2495 U   U   0 . n 
A  1  2496 C   2496 2496 2496 C   C   0 . n 
A  1  2497 A   2497 2497 2497 A   A   0 . n 
A  1  2498 C   2498 2498 2498 C   C   0 . n 
A  1  2499 U   2499 2499 2499 U   U   0 . n 
A  1  2500 C   2500 2500 2500 C   C   0 . n 
A  1  2501 G   2501 2501 2501 G   G   0 . n 
A  1  2502 C   2502 2502 2502 C   C   0 . n 
A  1  2503 A   2503 2503 2503 A   A   0 . n 
A  1  2504 A   2504 2504 2504 A   A   0 . n 
A  1  2505 G   2505 2505 2505 G   G   0 . n 
A  1  2506 A   2506 2506 2506 A   A   0 . n 
A  1  2507 G   2507 2507 2507 G   G   0 . n 
A  1  2508 C   2508 2508 2508 C   C   0 . n 
A  1  2509 A   2509 2509 2509 A   A   0 . n 
A  1  2510 C   2510 2510 2510 C   C   0 . n 
A  1  2511 A   2511 2511 2511 A   A   0 . n 
A  1  2512 U   2512 2512 2512 U   U   0 . n 
A  1  2513 A   2513 2513 2513 A   A   0 . n 
A  1  2514 U   2514 2514 2514 U   U   0 . n 
A  1  2515 C   2515 2515 2515 C   C   0 . n 
A  1  2516 G   2516 2516 2516 G   G   0 . n 
A  1  2517 A   2517 2517 2517 A   A   0 . n 
A  1  2518 C   2518 2518 2518 C   C   0 . n 
A  1  2519 C   2519 2519 2519 C   C   0 . n 
A  1  2520 G   2520 2520 2520 G   G   0 . n 
A  1  2521 A   2521 2521 2521 A   A   0 . n 
A  1  2522 G   2522 2522 2522 G   G   0 . n 
A  1  2523 U   2523 2523 2523 U   U   0 . n 
A  1  2524 G   2524 2524 2524 G   G   0 . n 
A  1  2525 G   2525 2525 2525 G   G   0 . n 
A  1  2526 C   2526 2526 2526 C   C   0 . n 
A  1  2527 U   2527 2527 2527 U   U   0 . n 
A  1  2528 U   2528 2528 2528 U   U   0 . n 
A  1  2529 G   2529 2529 2529 G   G   0 . n 
A  1  2530 C   2530 2530 2530 C   C   0 . n 
A  1  2531 U   2531 2531 2531 U   U   0 . n 
A  1  2532 A   2532 2532 2532 A   A   0 . n 
A  1  2533 C   2533 2533 2533 C   C   0 . n 
A  1  2534 C   2534 2534 2534 C   C   0 . n 
A  1  2535 U   2535 2535 2535 U   U   0 . n 
A  1  2536 C   2536 2536 2536 C   C   0 . n 
A  1  2537 G   2537 2537 2537 G   G   0 . n 
A  1  2538 A   2538 2538 2538 A   A   0 . n 
A  1  2539 U   2539 2539 2539 U   U   0 . n 
A  1  2540 G   2540 2540 2540 G   G   0 . n 
A  1  2541 U   2541 2541 2541 U   U   0 . n 
A  1  2542 C   2542 2542 2542 C   C   0 . n 
A  1  2543 G   2543 2543 2543 G   G   0 . n 
A  1  2544 G   2544 2544 2544 G   G   0 . n 
A  1  2545 U   2545 2545 2545 U   U   0 . n 
A  1  2546 U   2546 2546 2546 U   U   0 . n 
A  1  2547 C   2547 2547 2547 C   C   0 . n 
A  1  2548 C   2548 2548 2548 C   C   0 . n 
A  1  2549 C   2549 2549 2549 C   C   0 . n 
A  1  2550 U   2550 2550 2550 U   U   0 . n 
A  1  2551 C   2551 2551 2551 C   C   0 . n 
A  1  2552 C   2552 2552 2552 C   C   0 . n 
A  1  2553 A   2553 2553 2553 A   A   0 . n 
A  1  2554 U   2554 2554 2554 U   U   0 . n 
A  1  2555 C   2555 2555 2555 C   C   0 . n 
A  1  2556 C   2556 2556 2556 C   C   0 . n 
A  1  2557 U   2557 2557 2557 U   U   0 . n 
A  1  2558 G   2558 2558 2558 G   G   0 . n 
A  1  2559 C   2559 2559 2559 C   C   0 . n 
A  1  2560 C   2560 2560 2560 C   C   0 . n 
A  1  2561 C   2561 2561 2561 C   C   0 . n 
A  1  2562 G   2562 2562 2562 G   G   0 . n 
A  1  2563 U   2563 2563 2563 U   U   0 . n 
A  1  2564 G   2564 2564 2564 G   G   0 . n 
A  1  2565 C   2565 2565 2565 C   C   0 . n 
A  1  2566 A   2566 2566 2566 A   A   0 . n 
A  1  2567 G   2567 2567 2567 G   G   0 . n 
A  1  2568 A   2568 2568 2568 A   A   0 . n 
A  1  2569 A   2569 2569 2569 A   A   0 . n 
A  1  2570 G   2570 2570 2570 G   G   0 . n 
A  1  2571 C   2571 2571 2571 C   C   0 . n 
A  1  2572 G   2572 2572 2572 G   G   0 . n 
A  1  2573 G   2573 2573 2573 G   G   0 . n 
A  1  2574 G   2574 2574 2574 G   G   0 . n 
A  1  2575 C   2575 2575 2575 C   C   0 . n 
A  1  2576 A   2576 2576 2576 A   A   0 . n 
A  1  2577 A   2577 2577 2577 A   A   0 . n 
A  1  2578 G   2578 2578 2578 G   G   0 . n 
A  1  2579 G   2579 2579 2579 G   G   0 . n 
A  1  2580 G   2580 2580 2580 G   G   0 . n 
A  1  2581 U   2581 2581 2581 U   U   0 . n 
A  1  2582 G   2582 2582 2582 G   G   0 . n 
A  1  2583 A   2583 2583 2583 A   A   0 . n 
A  1  2584 G   2584 2584 2584 G   G   0 . n 
A  1  2585 G   2585 2585 2585 G   G   0 . n 
A  1  2586 U   2586 2586 2586 U   U   0 . n 
A  1  2587 OMU 2587 2587 2587 OMU OMU 0 . n 
A  1  2588 OMG 2588 2588 2588 OMG OMG 0 . n 
A  1  2589 U   2589 2589 2589 U   U   0 . n 
A  1  2590 U   2590 2590 2590 U   U   0 . n 
A  1  2591 C   2591 2591 2591 C   C   0 . n 
A  1  2592 G   2592 2592 2592 G   G   0 . n 
A  1  2593 C   2593 2593 2593 C   C   0 . n 
A  1  2594 C   2594 2594 2594 C   C   0 . n 
A  1  2595 U   2595 2595 2595 U   U   0 . n 
A  1  2596 A   2596 2596 2596 A   A   0 . n 
A  1  2597 U   2597 2597 2597 U   U   0 . n 
A  1  2598 U   2598 2598 2598 U   U   0 . n 
A  1  2599 A   2599 2599 2599 A   A   0 . n 
A  1  2600 A   2600 2600 2600 A   A   0 . n 
A  1  2601 A   2601 2601 2601 A   A   0 . n 
A  1  2602 G   2602 2602 2602 G   G   0 . n 
A  1  2603 G   2603 2603 2603 G   G   0 . n 
A  1  2604 A   2604 2604 2604 A   A   0 . n 
A  1  2605 G   2605 2605 2605 G   G   0 . n 
A  1  2606 G   2606 2606 2606 G   G   0 . n 
A  1  2607 U   2607 2607 2607 U   U   0 . n 
A  1  2608 C   2608 2608 2608 C   C   0 . n 
A  1  2609 G   2609 2609 2609 G   G   0 . n 
A  1  2610 U   2610 2610 2610 U   U   0 . n 
A  1  2611 G   2611 2611 2611 G   G   0 . n 
A  1  2612 A   2612 2612 2612 A   A   0 . n 
A  1  2613 G   2613 2613 2613 G   G   0 . n 
A  1  2614 C   2614 2614 2614 C   C   0 . n 
A  1  2615 U   2615 2615 2615 U   U   0 . n 
A  1  2616 G   2616 2616 2616 G   G   0 . n 
A  1  2617 G   2617 2617 2617 G   G   0 . n 
A  1  2618 G   2618 2618 2618 G   G   0 . n 
A  1  2619 UR3 2619 2619 2619 UR3 UR3 0 . n 
A  1  2620 U   2620 2620 2620 U   U   0 . n 
A  1  2621 PSU 2621 2621 2621 PSU PSU 0 . n 
A  1  2622 A   2622 2622 2622 A   A   0 . n 
A  1  2623 G   2623 2623 2623 G   G   0 . n 
A  1  2624 A   2624 2624 2624 A   A   0 . n 
A  1  2625 C   2625 2625 2625 C   C   0 . n 
A  1  2626 C   2626 2626 2626 C   C   0 . n 
A  1  2627 G   2627 2627 2627 G   G   0 . n 
A  1  2628 U   2628 2628 2628 U   U   0 . n 
A  1  2629 C   2629 2629 2629 C   C   0 . n 
A  1  2630 G   2630 2630 2630 G   G   0 . n 
A  1  2631 U   2631 2631 2631 U   U   0 . n 
A  1  2632 G   2632 2632 2632 G   G   0 . n 
A  1  2633 A   2633 2633 2633 A   A   0 . n 
A  1  2634 G   2634 2634 2634 G   G   0 . n 
A  1  2635 A   2635 2635 2635 A   A   0 . n 
A  1  2636 C   2636 2636 2636 C   C   0 . n 
A  1  2637 A   2637 2637 2637 A   A   0 . n 
A  1  2638 G   2638 2638 2638 G   G   0 . n 
A  1  2639 G   2639 2639 2639 G   G   0 . n 
A  1  2640 U   2640 2640 2640 U   U   0 . n 
A  1  2641 C   2641 2641 2641 C   C   0 . n 
A  1  2642 G   2642 2642 2642 G   G   0 . n 
A  1  2643 G   2643 2643 2643 G   G   0 . n 
A  1  2644 C   2644 2644 2644 C   C   0 . n 
A  1  2645 U   2645 2645 2645 U   U   0 . n 
A  1  2646 G   2646 2646 2646 G   G   0 . n 
A  1  2647 C   2647 2647 2647 C   C   0 . n 
A  1  2648 U   2648 2648 2648 U   U   0 . n 
A  1  2649 A   2649 2649 2649 A   A   0 . n 
A  1  2650 U   2650 2650 2650 U   U   0 . n 
A  1  2651 C   2651 2651 2651 C   C   0 . n 
A  1  2652 U   2652 2652 2652 U   U   0 . n 
A  1  2653 A   2653 2653 2653 A   A   0 . n 
A  1  2654 C   2654 2654 2654 C   C   0 . n 
A  1  2655 U   2655 2655 2655 U   U   0 . n 
A  1  2656 G   2656 2656 2656 G   G   0 . n 
A  1  2657 G   2657 2657 2657 G   G   0 . n 
A  1  2658 G   2658 2658 2658 G   G   0 . n 
A  1  2659 U   2659 2659 2659 U   U   0 . n 
A  1  2660 G   2660 2660 2660 G   G   0 . n 
A  1  2661 U   2661 2661 2661 U   U   0 . n 
A  1  2662 G   2662 2662 2662 G   G   0 . n 
A  1  2663 U   2663 2663 2663 U   U   0 . n 
A  1  2664 A   2664 2664 2664 A   A   0 . n 
A  1  2665 A   2665 2665 ?    ?   ?   0 . n 
A  1  2666 U   2666 2666 ?    ?   ?   0 . n 
A  1  2667 G   2667 2667 2667 G   G   0 . n 
A  1  2668 G   2668 2668 2668 G   G   0 . n 
A  1  2669 U   2669 2669 2669 U   U   0 . n 
A  1  2670 G   2670 2670 2670 G   G   0 . n 
A  1  2671 U   2671 2671 2671 U   U   0 . n 
A  1  2672 C   2672 2672 2672 C   C   0 . n 
A  1  2673 U   2673 2673 2673 U   U   0 . n 
A  1  2674 G   2674 2674 2674 G   G   0 . n 
A  1  2675 A   2675 2675 2675 A   A   0 . n 
A  1  2676 C   2676 2676 2676 C   C   0 . n 
A  1  2677 A   2677 2677 2677 A   A   0 . n 
A  1  2678 A   2678 2678 2678 A   A   0 . n 
A  1  2679 G   2679 2679 2679 G   G   0 . n 
A  1  2680 A   2680 2680 2680 A   A   0 . n 
A  1  2681 A   2681 2681 2681 A   A   0 . n 
A  1  2682 C   2682 2682 2682 C   C   0 . n 
A  1  2683 G   2683 2683 2683 G   G   0 . n 
A  1  2684 A   2684 2684 2684 A   A   0 . n 
A  1  2685 C   2685 2685 2685 C   C   0 . n 
A  1  2686 C   2686 2686 2686 C   C   0 . n 
A  1  2687 G   2687 2687 2687 G   G   0 . n 
A  1  2688 U   2688 2688 2688 U   U   0 . n 
A  1  2689 A   2689 2689 2689 A   A   0 . n 
A  1  2690 U   2690 2690 2690 U   U   0 . n 
A  1  2691 A   2691 2691 2691 A   A   0 . n 
A  1  2692 G   2692 2692 2692 G   G   0 . n 
A  1  2693 U   2693 2693 2693 U   U   0 . n 
A  1  2694 A   2694 2694 2694 A   A   0 . n 
A  1  2695 C   2695 2695 2695 C   C   0 . n 
A  1  2696 G   2696 2696 2696 G   G   0 . n 
A  1  2697 A   2697 2697 2697 A   A   0 . n 
A  1  2698 G   2698 2698 2698 G   G   0 . n 
A  1  2699 A   2699 2699 2699 A   A   0 . n 
A  1  2700 G   2700 2700 2700 G   G   0 . n 
A  1  2701 G   2701 2701 2701 G   G   0 . n 
A  1  2702 A   2702 2702 2702 A   A   0 . n 
A  1  2703 A   2703 2703 2703 A   A   0 . n 
A  1  2704 C   2704 2704 2704 C   C   0 . n 
A  1  2705 U   2705 2705 2705 U   U   0 . n 
A  1  2706 A   2706 2706 2706 A   A   0 . n 
A  1  2707 C   2707 2707 2707 C   C   0 . n 
A  1  2708 G   2708 2708 2708 G   G   0 . n 
A  1  2709 G   2709 2709 2709 G   G   0 . n 
A  1  2710 U   2710 2710 2710 U   U   0 . n 
A  1  2711 U   2711 2711 2711 U   U   0 . n 
A  1  2712 G   2712 2712 2712 G   G   0 . n 
A  1  2713 G   2713 2713 2713 G   G   0 . n 
A  1  2714 U   2714 2714 2714 U   U   0 . n 
A  1  2715 G   2715 2715 2715 G   G   0 . n 
A  1  2716 G   2716 2716 2716 G   G   0 . n 
A  1  2717 C   2717 2717 2717 C   C   0 . n 
A  1  2718 C   2718 2718 2718 C   C   0 . n 
A  1  2719 A   2719 2719 2719 A   A   0 . n 
A  1  2720 C   2720 2720 2720 C   C   0 . n 
A  1  2721 U   2721 2721 2721 U   U   0 . n 
A  1  2722 G   2722 2722 2722 G   G   0 . n 
A  1  2723 G   2723 2723 2723 G   G   0 . n 
A  1  2724 U   2724 2724 2724 U   U   0 . n 
A  1  2725 G   2725 2725 2725 G   G   0 . n 
A  1  2726 U   2726 2726 2726 U   U   0 . n 
A  1  2727 A   2727 2727 2727 A   A   0 . n 
A  1  2728 C   2728 2728 2728 C   C   0 . n 
A  1  2729 C   2729 2729 2729 C   C   0 . n 
A  1  2730 G   2730 2730 2730 G   G   0 . n 
A  1  2731 G   2731 2731 2731 G   G   0 . n 
A  1  2732 U   2732 2732 2732 U   U   0 . n 
A  1  2733 U   2733 2733 2733 U   U   0 . n 
A  1  2734 G   2734 2734 2734 G   G   0 . n 
A  1  2735 U   2735 2735 2735 U   U   0 . n 
A  1  2736 U   2736 2736 2736 U   U   0 . n 
A  1  2737 C   2737 2737 2737 C   C   0 . n 
A  1  2738 G   2738 2738 2738 G   G   0 . n 
A  1  2739 A   2739 2739 2739 A   A   0 . n 
A  1  2740 G   2740 2740 2740 G   G   0 . n 
A  1  2741 A   2741 2741 2741 A   A   0 . n 
A  1  2742 G   2742 2742 2742 G   G   0 . n 
A  1  2743 A   2743 2743 2743 A   A   0 . n 
A  1  2744 G   2744 2744 2744 G   G   0 . n 
A  1  2745 C   2745 2745 2745 C   C   0 . n 
A  1  2746 A   2746 2746 2746 A   A   0 . n 
A  1  2747 C   2747 2747 2747 C   C   0 . n 
A  1  2748 G   2748 2748 2748 G   G   0 . n 
A  1  2749 U   2749 2749 2749 U   U   0 . n 
A  1  2750 G   2750 2750 2750 G   G   0 . n 
A  1  2751 C   2751 2751 2751 C   C   0 . n 
A  1  2752 C   2752 2752 2752 C   C   0 . n 
A  1  2753 G   2753 2753 2753 G   G   0 . n 
A  1  2754 G   2754 2754 2754 G   G   0 . n 
A  1  2755 G   2755 2755 2755 G   G   0 . n 
A  1  2756 U   2756 2756 2756 U   U   0 . n 
A  1  2757 A   2757 2757 2757 A   A   0 . n 
A  1  2758 G   2758 2758 2758 G   G   0 . n 
A  1  2759 C   2759 2759 2759 C   C   0 . n 
A  1  2760 C   2760 2760 2760 C   C   0 . n 
A  1  2761 A   2761 2761 2761 A   A   0 . n 
A  1  2762 C   2762 2762 2762 C   C   0 . n 
A  1  2763 G   2763 2763 2763 G   G   0 . n 
A  1  2764 C   2764 2764 2764 C   C   0 . n 
A  1  2765 C   2765 2765 2765 C   C   0 . n 
A  1  2766 A   2766 2766 2766 A   A   0 . n 
A  1  2767 C   2767 2767 2767 C   C   0 . n 
A  1  2768 A   2768 2768 2768 A   A   0 . n 
A  1  2769 C   2769 2769 2769 C   C   0 . n 
A  1  2770 G   2770 2770 2770 G   G   0 . n 
A  1  2771 G   2771 2771 2771 G   G   0 . n 
A  1  2772 G   2772 2772 2772 G   G   0 . n 
A  1  2773 G   2773 2773 2773 G   G   0 . n 
A  1  2774 U   2774 2774 2774 U   U   0 . n 
A  1  2775 A   2775 2775 2775 A   A   0 . n 
A  1  2776 A   2776 2776 2776 A   A   0 . n 
A  1  2777 G   2777 2777 2777 G   G   0 . n 
A  1  2778 A   2778 2778 2778 A   A   0 . n 
A  1  2779 G   2779 2779 2779 G   G   0 . n 
A  1  2780 C   2780 2780 2780 C   C   0 . n 
A  1  2781 U   2781 2781 2781 U   U   0 . n 
A  1  2782 G   2782 2782 2782 G   G   0 . n 
A  1  2783 A   2783 2783 2783 A   A   0 . n 
A  1  2784 A   2784 2784 2784 A   A   0 . n 
A  1  2785 C   2785 2785 2785 C   C   0 . n 
A  1  2786 G   2786 2786 2786 G   G   0 . n 
A  1  2787 C   2787 2787 2787 C   C   0 . n 
A  1  2788 A   2788 2788 2788 A   A   0 . n 
A  1  2789 U   2789 2789 2789 U   U   0 . n 
A  1  2790 C   2790 2790 2790 C   C   0 . n 
A  1  2791 U   2791 2791 2791 U   U   0 . n 
A  1  2792 A   2792 2792 2792 A   A   0 . n 
A  1  2793 A   2793 2793 2793 A   A   0 . n 
A  1  2794 G   2794 2794 2794 G   G   0 . n 
A  1  2795 C   2795 2795 2795 C   C   0 . n 
A  1  2796 U   2796 2796 2796 U   U   0 . n 
A  1  2797 C   2797 2797 2797 C   C   0 . n 
A  1  2798 G   2798 2798 2798 G   G   0 . n 
A  1  2799 A   2799 2799 2799 A   A   0 . n 
A  1  2800 A   2800 2800 2800 A   A   0 . n 
A  1  2801 A   2801 2801 2801 A   A   0 . n 
A  1  2802 C   2802 2802 2802 C   C   0 . n 
A  1  2803 C   2803 2803 2803 C   C   0 . n 
A  1  2804 C   2804 2804 2804 C   C   0 . n 
A  1  2805 A   2805 2805 2805 A   A   0 . n 
A  1  2806 C   2806 2806 2806 C   C   0 . n 
A  1  2807 U   2807 2807 2807 U   U   0 . n 
A  1  2808 U   2808 2808 2808 U   U   0 . n 
A  1  2809 G   2809 2809 2809 G   G   0 . n 
A  1  2810 G   2810 2810 2810 G   G   0 . n 
A  1  2811 A   2811 2811 2811 A   A   0 . n 
A  1  2812 A   2812 2812 2812 A   A   0 . n 
A  1  2813 A   2813 2813 2813 A   A   0 . n 
A  1  2814 A   2814 2814 2814 A   A   0 . n 
A  1  2815 G   2815 2815 2815 G   G   0 . n 
A  1  2816 A   2816 2816 2816 A   A   0 . n 
A  1  2817 G   2817 2817 2817 G   G   0 . n 
A  1  2818 A   2818 2818 2818 A   A   0 . n 
A  1  2819 C   2819 2819 2819 C   C   0 . n 
A  1  2820 A   2820 2820 2820 A   A   0 . n 
A  1  2821 C   2821 2821 2821 C   C   0 . n 
A  1  2822 C   2822 2822 2822 C   C   0 . n 
A  1  2823 G   2823 2823 2823 G   G   0 . n 
A  1  2824 C   2824 2824 2824 C   C   0 . n 
A  1  2825 C   2825 2825 2825 C   C   0 . n 
A  1  2826 G   2826 2826 2826 G   G   0 . n 
A  1  2827 A   2827 2827 2827 A   A   0 . n 
A  1  2828 G   2828 2828 2828 G   G   0 . n 
A  1  2829 G   2829 2829 2829 G   G   0 . n 
A  1  2830 U   2830 2830 2830 U   U   0 . n 
A  1  2831 C   2831 2831 2831 C   C   0 . n 
A  1  2832 C   2832 2832 2832 C   C   0 . n 
A  1  2833 C   2833 2833 2833 C   C   0 . n 
A  1  2834 G   2834 2834 2834 G   G   0 . n 
A  1  2835 C   2835 2835 2835 C   C   0 . n 
A  1  2836 G   2836 2836 2836 G   G   0 . n 
A  1  2837 U   2837 2837 2837 U   U   0 . n 
A  1  2838 A   2838 2838 2838 A   A   0 . n 
A  1  2839 C   2839 2839 2839 C   C   0 . n 
A  1  2840 A   2840 2840 2840 A   A   0 . n 
A  1  2841 A   2841 2841 2841 A   A   0 . n 
A  1  2842 G   2842 2842 2842 G   G   0 . n 
A  1  2843 A   2843 2843 2843 A   A   0 . n 
A  1  2844 C   2844 2844 2844 C   C   0 . n 
A  1  2845 G   2845 2845 2845 G   G   0 . n 
A  1  2846 C   2846 2846 2846 C   C   0 . n 
A  1  2847 G   2847 2847 2847 G   G   0 . n 
A  1  2848 G   2848 2848 2848 G   G   0 . n 
A  1  2849 U   2849 2849 2849 U   U   0 . n 
A  1  2850 C   2850 2850 2850 C   C   0 . n 
A  1  2851 G   2851 2851 2851 G   G   0 . n 
A  1  2852 A   2852 2852 2852 A   A   0 . n 
A  1  2853 U   2853 2853 2853 U   U   0 . n 
A  1  2854 A   2854 2854 2854 A   A   0 . n 
A  1  2855 G   2855 2855 2855 G   G   0 . n 
A  1  2856 A   2856 2856 2856 A   A   0 . n 
A  1  2857 C   2857 2857 2857 C   C   0 . n 
A  1  2858 U   2858 2858 2858 U   U   0 . n 
A  1  2859 C   2859 2859 2859 C   C   0 . n 
A  1  2860 G   2860 2860 2860 G   G   0 . n 
A  1  2861 G   2861 2861 2861 G   G   0 . n 
A  1  2862 G   2862 2862 2862 G   G   0 . n 
A  1  2863 G   2863 2863 2863 G   G   0 . n 
A  1  2864 U   2864 2864 2864 U   U   0 . n 
A  1  2865 G   2865 2865 2865 G   G   0 . n 
A  1  2866 U   2866 2866 2866 U   U   0 . n 
A  1  2867 G   2867 2867 2867 G   G   0 . n 
A  1  2868 C   2868 2868 2868 C   C   0 . n 
A  1  2869 G   2869 2869 2869 G   G   0 . n 
A  1  2870 C   2870 2870 2870 C   C   0 . n 
A  1  2871 G   2871 2871 2871 G   G   0 . n 
A  1  2872 U   2872 2872 2872 U   U   0 . n 
A  1  2873 C   2873 2873 2873 C   C   0 . n 
A  1  2874 G   2874 2874 2874 G   G   0 . n 
A  1  2875 A   2875 2875 2875 A   A   0 . n 
A  1  2876 G   2876 2876 2876 G   G   0 . n 
A  1  2877 G   2877 2877 2877 G   G   0 . n 
A  1  2878 U   2878 2878 2878 U   U   0 . n 
A  1  2879 A   2879 2879 2879 A   A   0 . n 
A  1  2880 A   2880 2880 2880 A   A   0 . n 
A  1  2881 C   2881 2881 2881 C   C   0 . n 
A  1  2882 G   2882 2882 2882 G   G   0 . n 
A  1  2883 A   2883 2883 2883 A   A   0 . n 
A  1  2884 G   2884 2884 2884 G   G   0 . n 
A  1  2885 A   2885 2885 2885 A   A   0 . n 
A  1  2886 C   2886 2886 2886 C   C   0 . n 
A  1  2887 G   2887 2887 2887 G   G   0 . n 
A  1  2888 U   2888 2888 2888 U   U   0 . n 
A  1  2889 U   2889 2889 2889 U   U   0 . n 
A  1  2890 A   2890 2890 2890 A   A   0 . n 
A  1  2891 A   2891 2891 2891 A   A   0 . n 
A  1  2892 G   2892 2892 2892 G   G   0 . n 
A  1  2893 C   2893 2893 2893 C   C   0 . n 
A  1  2894 C   2894 2894 2894 C   C   0 . n 
A  1  2895 C   2895 2895 2895 C   C   0 . n 
A  1  2896 A   2896 2896 2896 A   A   0 . n 
A  1  2897 C   2897 2897 2897 C   C   0 . n 
A  1  2898 G   2898 2898 2898 G   G   0 . n 
A  1  2899 A   2899 2899 2899 A   A   0 . n 
A  1  2900 G   2900 2900 2900 G   G   0 . n 
A  1  2901 C   2901 2901 2901 C   C   0 . n 
A  1  2902 A   2902 2902 2902 A   A   0 . n 
A  1  2903 C   2903 2903 2903 C   C   0 . n 
A  1  2904 U   2904 2904 2904 U   U   0 . n 
A  1  2905 A   2905 2905 2905 A   A   0 . n 
A  1  2906 A   2906 2906 2906 A   A   0 . n 
A  1  2907 C   2907 2907 2907 C   C   0 . n 
A  1  2908 A   2908 2908 2908 A   A   0 . n 
A  1  2909 G   2909 2909 2909 G   G   0 . n 
A  1  2910 A   2910 2910 2910 A   A   0 . n 
A  1  2911 C   2911 2911 2911 C   C   0 . n 
A  1  2912 C   2912 2912 2912 C   C   0 . n 
A  1  2913 A   2913 2913 2913 A   A   0 . n 
A  1  2914 A   2914 2914 2914 A   A   0 . n 
A  1  2915 A   2915 2915 ?    ?   ?   0 . n 
A  1  2916 G   2916 2916 ?    ?   ?   0 . n 
A  1  2917 C   2917 2917 ?    ?   ?   0 . n 
A  1  2918 C   2918 2918 ?    ?   ?   0 . n 
A  1  2919 A   2919 2919 ?    ?   ?   0 . n 
A  1  2920 U   2920 2920 ?    ?   ?   0 . n 
A  1  2921 C   2921 2921 ?    ?   ?   0 . n 
A  1  2922 A   2922 2922 ?    ?   ?   0 . n 
B  2  1    U   1    1    1    U   U   9 . n 
B  2  2    U   2    2    2    U   U   9 . n 
B  2  3    A   3    3    3    A   A   9 . n 
B  2  4    G   4    4    4    G   G   9 . n 
B  2  5    G   5    5    5    G   G   9 . n 
B  2  6    C   6    6    6    C   C   9 . n 
B  2  7    G   7    7    7    G   G   9 . n 
B  2  8    G   8    8    8    G   G   9 . n 
B  2  9    C   9    9    9    C   C   9 . n 
B  2  10   C   10   10   10   C   C   9 . n 
B  2  11   A   11   11   11   A   A   9 . n 
B  2  12   C   12   12   12   C   C   9 . n 
B  2  13   A   13   13   13   A   A   9 . n 
B  2  14   G   14   14   14   G   G   9 . n 
B  2  15   C   15   15   15   C   C   9 . n 
B  2  16   G   16   16   16   G   G   9 . n 
B  2  17   G   17   17   17   G   G   9 . n 
B  2  18   U   18   18   18   U   U   9 . n 
B  2  19   G   19   19   19   G   G   9 . n 
B  2  20   G   20   20   20   G   G   9 . n 
B  2  21   G   21   21   21   G   G   9 . n 
B  2  22   G   22   22   22   G   G   9 . n 
B  2  23   U   23   23   23   U   U   9 . n 
B  2  24   U   24   24   24   U   U   9 . n 
B  2  25   G   25   25   25   G   G   9 . n 
B  2  26   C   26   26   26   C   C   9 . n 
B  2  27   C   27   27   27   C   C   9 . n 
B  2  28   U   28   28   28   U   U   9 . n 
B  2  29   C   29   29   29   C   C   9 . n 
B  2  30   C   30   30   30   C   C   9 . n 
B  2  31   C   31   31   31   C   C   9 . n 
B  2  32   G   32   32   32   G   G   9 . n 
B  2  33   U   33   33   33   U   U   9 . n 
B  2  34   A   34   34   34   A   A   9 . n 
B  2  35   C   35   35   35   C   C   9 . n 
B  2  36   C   36   36   36   C   C   9 . n 
B  2  37   C   37   37   37   C   C   9 . n 
B  2  38   A   38   38   38   A   A   9 . n 
B  2  39   U   39   39   39   U   U   9 . n 
B  2  40   C   40   40   40   C   C   9 . n 
B  2  41   C   41   41   41   C   C   9 . n 
B  2  42   C   42   42   42   C   C   9 . n 
B  2  43   G   43   43   43   G   G   9 . n 
B  2  44   A   44   44   44   A   A   9 . n 
B  2  45   A   45   45   45   A   A   9 . n 
B  2  46   C   46   46   46   C   C   9 . n 
B  2  47   A   47   47   47   A   A   9 . n 
B  2  48   C   48   48   48   C   C   9 . n 
B  2  49   G   49   49   49   G   G   9 . n 
B  2  50   G   50   50   50   G   G   9 . n 
B  2  51   A   51   51   51   A   A   9 . n 
B  2  52   A   52   52   52   A   A   9 . n 
B  2  53   G   53   53   53   G   G   9 . n 
B  2  54   A   54   54   54   A   A   9 . n 
B  2  55   U   55   55   55   U   U   9 . n 
B  2  56   A   56   56   56   A   A   9 . n 
B  2  57   A   57   57   57   A   A   9 . n 
B  2  58   G   58   58   58   G   G   9 . n 
B  2  59   C   59   59   59   C   C   9 . n 
B  2  60   C   60   60   60   C   C   9 . n 
B  2  61   C   61   61   61   C   C   9 . n 
B  2  62   A   62   62   62   A   A   9 . n 
B  2  63   C   63   63   63   C   C   9 . n 
B  2  64   C   64   64   64   C   C   9 . n 
B  2  65   A   65   65   65   A   A   9 . n 
B  2  66   G   66   66   66   G   G   9 . n 
B  2  67   C   67   67   67   C   C   9 . n 
B  2  68   G   68   68   68   G   G   9 . n 
B  2  69   U   69   69   69   U   U   9 . n 
B  2  70   U   70   70   70   U   U   9 . n 
B  2  71   C   71   71   71   C   C   9 . n 
B  2  72   C   72   72   72   C   C   9 . n 
B  2  73   A   73   73   73   A   A   9 . n 
B  2  74   G   74   74   74   G   G   9 . n 
B  2  75   G   75   75   75   G   G   9 . n 
B  2  76   G   76   76   76   G   G   9 . n 
B  2  77   A   77   77   77   A   A   9 . n 
B  2  78   G   78   78   78   G   G   9 . n 
B  2  79   U   79   79   79   U   U   9 . n 
B  2  80   A   80   80   80   A   A   9 . n 
B  2  81   C   81   81   81   C   C   9 . n 
B  2  82   U   82   82   82   U   U   9 . n 
B  2  83   G   83   83   83   G   G   9 . n 
B  2  84   G   84   84   84   G   G   9 . n 
B  2  85   A   85   85   85   A   A   9 . n 
B  2  86   G   86   86   86   G   G   9 . n 
B  2  87   U   87   87   87   U   U   9 . n 
B  2  88   G   88   88   88   G   G   9 . n 
B  2  89   C   89   89   89   C   C   9 . n 
B  2  90   G   90   90   90   G   G   9 . n 
B  2  91   C   91   91   91   C   C   9 . n 
B  2  92   G   92   92   92   G   G   9 . n 
B  2  93   A   93   93   93   A   A   9 . n 
B  2  94   G   94   94   94   G   G   9 . n 
B  2  95   C   95   95   95   C   C   9 . n 
B  2  96   C   96   96   96   C   C   9 . n 
B  2  97   U   97   97   97   U   U   9 . n 
B  2  98   C   98   98   98   C   C   9 . n 
B  2  99   U   99   99   99   U   U   9 . n 
B  2  100  G   100  100  100  G   G   9 . n 
B  2  101  G   101  101  101  G   G   9 . n 
B  2  102  G   102  102  102  G   G   9 . n 
B  2  103  A   103  103  103  A   A   9 . n 
B  2  104  A   104  104  104  A   A   9 . n 
B  2  105  A   105  105  105  A   A   9 . n 
B  2  106  U   106  106  106  U   U   9 . n 
B  2  107  C   107  107  107  C   C   9 . n 
B  2  108  C   108  108  108  C   C   9 . n 
B  2  109  G   109  109  109  G   G   9 . n 
B  2  110  G   110  110  110  G   G   9 . n 
B  2  111  U   111  111  111  U   U   9 . n 
B  2  112  U   112  112  112  U   U   9 . n 
B  2  113  C   113  113  113  C   C   9 . n 
B  2  114  G   114  114  114  G   G   9 . n 
B  2  115  C   115  115  115  C   C   9 . n 
B  2  116  C   116  116  116  C   C   9 . n 
B  2  117  G   117  117  117  G   G   9 . n 
B  2  118  C   118  118  118  C   C   9 . n 
B  2  119  C   119  119  119  C   C   9 . n 
B  2  120  A   120  120  120  A   A   9 . n 
B  2  121  C   121  121  121  C   C   9 . n 
B  2  122  C   122  122  122  C   C   9 . n 
C  3  1    MET 1    0    ?    ?   ?   A . n 
C  3  2    GLY 2    1    1    GLY GLY A . n 
C  3  3    ARG 3    2    2    ARG ARG A . n 
C  3  4    ARG 4    3    3    ARG ARG A . n 
C  3  5    ILE 5    4    4    ILE ILE A . n 
C  3  6    GLN 6    5    5    GLN GLN A . n 
C  3  7    GLY 7    6    6    GLY GLY A . n 
C  3  8    GLN 8    7    7    GLN GLN A . n 
C  3  9    ARG 9    8    8    ARG ARG A . n 
C  3  10   ARG 10   9    9    ARG ARG A . n 
C  3  11   GLY 11   10   10   GLY GLY A . n 
C  3  12   ARG 12   11   11   ARG ARG A . n 
C  3  13   GLY 13   12   12   GLY GLY A . n 
C  3  14   THR 14   13   13   THR THR A . n 
C  3  15   SER 15   14   14   SER SER A . n 
C  3  16   THR 16   15   15   THR THR A . n 
C  3  17   PHE 17   16   16   PHE PHE A . n 
C  3  18   ARG 18   17   17   ARG ARG A . n 
C  3  19   ALA 19   18   18   ALA ALA A . n 
C  3  20   PRO 20   19   19   PRO PRO A . n 
C  3  21   SER 21   20   20   SER SER A . n 
C  3  22   HIS 22   21   21   HIS HIS A . n 
C  3  23   ARG 23   22   22   ARG ARG A . n 
C  3  24   TYR 24   23   23   TYR TYR A . n 
C  3  25   LYS 25   24   24   LYS LYS A . n 
C  3  26   ALA 26   25   25   ALA ALA A . n 
C  3  27   ASP 27   26   26   ASP ASP A . n 
C  3  28   LEU 28   27   27   LEU LEU A . n 
C  3  29   GLU 29   28   28   GLU GLU A . n 
C  3  30   HIS 30   29   29   HIS HIS A . n 
C  3  31   ARG 31   30   30   ARG ARG A . n 
C  3  32   LYS 32   31   31   LYS LYS A . n 
C  3  33   VAL 33   32   32   VAL VAL A . n 
C  3  34   GLU 34   33   33   GLU GLU A . n 
C  3  35   ASP 35   34   34   ASP ASP A . n 
C  3  36   GLY 36   35   35   GLY GLY A . n 
C  3  37   ASP 37   36   36   ASP ASP A . n 
C  3  38   VAL 38   37   37   VAL VAL A . n 
C  3  39   ILE 39   38   38   ILE ILE A . n 
C  3  40   ALA 40   39   39   ALA ALA A . n 
C  3  41   GLY 41   40   40   GLY GLY A . n 
C  3  42   THR 42   41   41   THR THR A . n 
C  3  43   VAL 43   42   42   VAL VAL A . n 
C  3  44   VAL 44   43   43   VAL VAL A . n 
C  3  45   ASP 45   44   44   ASP ASP A . n 
C  3  46   ILE 46   45   45   ILE ILE A . n 
C  3  47   GLU 47   46   46   GLU GLU A . n 
C  3  48   HIS 48   47   47   HIS HIS A . n 
C  3  49   ASP 49   48   48   ASP ASP A . n 
C  3  50   PRO 50   49   49   PRO PRO A . n 
C  3  51   ALA 51   50   50   ALA ALA A . n 
C  3  52   ARG 52   51   51   ARG ARG A . n 
C  3  53   SER 53   52   52   SER SER A . n 
C  3  54   ALA 54   53   53   ALA ALA A . n 
C  3  55   PRO 55   54   54   PRO PRO A . n 
C  3  56   VAL 56   55   55   VAL VAL A . n 
C  3  57   ALA 57   56   56   ALA ALA A . n 
C  3  58   ALA 58   57   57   ALA ALA A . n 
C  3  59   VAL 59   58   58   VAL VAL A . n 
C  3  60   GLU 60   59   59   GLU GLU A . n 
C  3  61   PHE 61   60   60   PHE PHE A . n 
C  3  62   GLU 62   61   61   GLU GLU A . n 
C  3  63   ASP 63   62   62   ASP ASP A . n 
C  3  64   GLY 64   63   63   GLY GLY A . n 
C  3  65   ASP 65   64   64   ASP ASP A . n 
C  3  66   ARG 66   65   65   ARG ARG A . n 
C  3  67   ARG 67   66   66   ARG ARG A . n 
C  3  68   LEU 68   67   67   LEU LEU A . n 
C  3  69   ILE 69   68   68   ILE ILE A . n 
C  3  70   LEU 70   69   69   LEU LEU A . n 
C  3  71   ALA 71   70   70   ALA ALA A . n 
C  3  72   PRO 72   71   71   PRO PRO A . n 
C  3  73   GLU 73   72   72   GLU GLU A . n 
C  3  74   GLY 74   73   73   GLY GLY A . n 
C  3  75   VAL 75   74   74   VAL VAL A . n 
C  3  76   GLY 76   75   75   GLY GLY A . n 
C  3  77   VAL 77   76   76   VAL VAL A . n 
C  3  78   GLY 78   77   77   GLY GLY A . n 
C  3  79   ASP 79   78   78   ASP ASP A . n 
C  3  80   GLU 80   79   79   GLU GLU A . n 
C  3  81   LEU 81   80   80   LEU LEU A . n 
C  3  82   GLN 82   81   81   GLN GLN A . n 
C  3  83   VAL 83   82   82   VAL VAL A . n 
C  3  84   GLY 84   83   83   GLY GLY A . n 
C  3  85   VAL 85   84   84   VAL VAL A . n 
C  3  86   SER 86   85   85   SER SER A . n 
C  3  87   ALA 87   86   86   ALA ALA A . n 
C  3  88   GLU 88   87   87   GLU GLU A . n 
C  3  89   ILE 89   88   88   ILE ILE A . n 
C  3  90   ALA 90   89   89   ALA ALA A . n 
C  3  91   PRO 91   90   90   PRO PRO A . n 
C  3  92   GLY 92   91   91   GLY GLY A . n 
C  3  93   ASN 93   92   92   ASN ASN A . n 
C  3  94   THR 94   93   93   THR THR A . n 
C  3  95   LEU 95   94   94   LEU LEU A . n 
C  3  96   PRO 96   95   95   PRO PRO A . n 
C  3  97   LEU 97   96   96   LEU LEU A . n 
C  3  98   ALA 98   97   97   ALA ALA A . n 
C  3  99   GLU 99   98   98   GLU GLU A . n 
C  3  100  ILE 100  99   99   ILE ILE A . n 
C  3  101  PRO 101  100  100  PRO PRO A . n 
C  3  102  GLU 102  101  101  GLU GLU A . n 
C  3  103  GLY 103  102  102  GLY GLY A . n 
C  3  104  VAL 104  103  103  VAL VAL A . n 
C  3  105  PRO 105  104  104  PRO PRO A . n 
C  3  106  VAL 106  105  105  VAL VAL A . n 
C  3  107  CYS 107  106  106  CYS CYS A . n 
C  3  108  ASN 108  107  107  ASN ASN A . n 
C  3  109  VAL 109  108  108  VAL VAL A . n 
C  3  110  GLU 110  109  109  GLU GLU A . n 
C  3  111  SER 111  110  110  SER SER A . n 
C  3  112  SER 112  111  111  SER SER A . n 
C  3  113  PRO 113  112  112  PRO PRO A . n 
C  3  114  GLY 114  113  113  GLY GLY A . n 
C  3  115  ASP 115  114  114  ASP ASP A . n 
C  3  116  GLY 116  115  115  GLY GLY A . n 
C  3  117  GLY 117  116  116  GLY GLY A . n 
C  3  118  LYS 118  117  117  LYS LYS A . n 
C  3  119  PHE 119  118  118  PHE PHE A . n 
C  3  120  ALA 120  119  119  ALA ALA A . n 
C  3  121  ARG 121  120  120  ARG ARG A . n 
C  3  122  ALA 122  121  121  ALA ALA A . n 
C  3  123  SER 123  122  122  SER SER A . n 
C  3  124  GLY 124  123  123  GLY GLY A . n 
C  3  125  VAL 125  124  124  VAL VAL A . n 
C  3  126  ASN 126  125  125  ASN ASN A . n 
C  3  127  ALA 127  126  126  ALA ALA A . n 
C  3  128  GLN 128  127  127  GLN GLN A . n 
C  3  129  LEU 129  128  128  LEU LEU A . n 
C  3  130  LEU 130  129  129  LEU LEU A . n 
C  3  131  THR 131  130  130  THR THR A . n 
C  3  132  HIS 132  131  131  HIS HIS A . n 
C  3  133  ASP 133  132  132  ASP ASP A . n 
C  3  134  ARG 134  133  133  ARG ARG A . n 
C  3  135  ASN 135  134  134  ASN ASN A . n 
C  3  136  VAL 136  135  135  VAL VAL A . n 
C  3  137  ALA 137  136  136  ALA ALA A . n 
C  3  138  VAL 138  137  137  VAL VAL A . n 
C  3  139  VAL 139  138  138  VAL VAL A . n 
C  3  140  LYS 140  139  139  LYS LYS A . n 
C  3  141  LEU 141  140  140  LEU LEU A . n 
C  3  142  PRO 142  141  141  PRO PRO A . n 
C  3  143  SER 143  142  142  SER SER A . n 
C  3  144  GLY 144  143  143  GLY GLY A . n 
C  3  145  GLU 145  144  144  GLU GLU A . n 
C  3  146  MET 146  145  145  MET MET A . n 
C  3  147  LYS 147  146  146  LYS LYS A . n 
C  3  148  ARG 148  147  147  ARG ARG A . n 
C  3  149  LEU 149  148  148  LEU LEU A . n 
C  3  150  ASP 150  149  149  ASP ASP A . n 
C  3  151  PRO 151  150  150  PRO PRO A . n 
C  3  152  GLN 152  151  151  GLN GLN A . n 
C  3  153  CYS 153  152  152  CYS CYS A . n 
C  3  154  ARG 154  153  153  ARG ARG A . n 
C  3  155  ALA 155  154  154  ALA ALA A . n 
C  3  156  THR 156  155  155  THR THR A . n 
C  3  157  ILE 157  156  156  ILE ILE A . n 
C  3  158  GLY 158  157  157  GLY GLY A . n 
C  3  159  VAL 159  158  158  VAL VAL A . n 
C  3  160  VAL 160  159  159  VAL VAL A . n 
C  3  161  ALA 161  160  160  ALA ALA A . n 
C  3  162  GLY 162  161  161  GLY GLY A . n 
C  3  163  GLY 163  162  162  GLY GLY A . n 
C  3  164  GLY 164  163  163  GLY GLY A . n 
C  3  165  ARG 165  164  164  ARG ARG A . n 
C  3  166  THR 166  165  165  THR THR A . n 
C  3  167  ASP 167  166  166  ASP ASP A . n 
C  3  168  LYS 168  167  167  LYS LYS A . n 
C  3  169  PRO 169  168  168  PRO PRO A . n 
C  3  170  PHE 170  169  169  PHE PHE A . n 
C  3  171  VAL 171  170  170  VAL VAL A . n 
C  3  172  LYS 172  171  171  LYS LYS A . n 
C  3  173  ALA 173  172  172  ALA ALA A . n 
C  3  174  GLY 174  173  173  GLY GLY A . n 
C  3  175  ASN 175  174  174  ASN ASN A . n 
C  3  176  LYS 176  175  175  LYS LYS A . n 
C  3  177  HIS 177  176  176  HIS HIS A . n 
C  3  178  HIS 178  177  177  HIS HIS A . n 
C  3  179  LYS 179  178  178  LYS LYS A . n 
C  3  180  MET 180  179  179  MET MET A . n 
C  3  181  LYS 181  180  180  LYS LYS A . n 
C  3  182  ALA 182  181  181  ALA ALA A . n 
C  3  183  ARG 183  182  182  ARG ARG A . n 
C  3  184  GLY 184  183  183  GLY GLY A . n 
C  3  185  THR 185  184  184  THR THR A . n 
C  3  186  LYS 186  185  185  LYS LYS A . n 
C  3  187  TRP 187  186  186  TRP TRP A . n 
C  3  188  PRO 188  187  187  PRO PRO A . n 
C  3  189  ASN 189  188  188  ASN ASN A . n 
C  3  190  VAL 190  189  189  VAL VAL A . n 
C  3  191  ARG 191  190  190  ARG ARG A . n 
C  3  192  GLY 192  191  191  GLY GLY A . n 
C  3  193  VAL 193  192  192  VAL VAL A . n 
C  3  194  ALA 194  193  193  ALA ALA A . n 
C  3  195  MET 195  194  194  MET MET A . n 
C  3  196  ASN 196  195  195  ASN ASN A . n 
C  3  197  ALA 197  196  196  ALA ALA A . n 
C  3  198  VAL 198  197  197  VAL VAL A . n 
C  3  199  ASP 199  198  198  ASP ASP A . n 
C  3  200  HIS 200  199  199  HIS HIS A . n 
C  3  201  PRO 201  200  200  PRO PRO A . n 
C  3  202  PHE 202  201  201  PHE PHE A . n 
C  3  203  GLY 203  202  202  GLY GLY A . n 
C  3  204  GLY 204  203  203  GLY GLY A . n 
C  3  205  GLY 205  204  204  GLY GLY A . n 
C  3  206  GLY 206  205  205  GLY GLY A . n 
C  3  207  ARG 207  206  206  ARG ARG A . n 
C  3  208  GLN 208  207  207  GLN GLN A . n 
C  3  209  HIS 209  208  208  HIS HIS A . n 
C  3  210  PRO 210  209  209  PRO PRO A . n 
C  3  211  GLY 211  210  210  GLY GLY A . n 
C  3  212  LYS 212  211  211  LYS LYS A . n 
C  3  213  PRO 213  212  212  PRO PRO A . n 
C  3  214  LYS 214  213  213  LYS LYS A . n 
C  3  215  SER 215  214  214  SER SER A . n 
C  3  216  ILE 216  215  215  ILE ILE A . n 
C  3  217  SER 217  216  216  SER SER A . n 
C  3  218  ARG 218  217  217  ARG ARG A . n 
C  3  219  ASN 219  218  218  ASN ASN A . n 
C  3  220  ALA 220  219  219  ALA ALA A . n 
C  3  221  PRO 221  220  220  PRO PRO A . n 
C  3  222  PRO 222  221  221  PRO PRO A . n 
C  3  223  GLY 223  222  222  GLY GLY A . n 
C  3  224  ARG 224  223  223  ARG ARG A . n 
C  3  225  LYS 225  224  224  LYS LYS A . n 
C  3  226  VAL 226  225  225  VAL VAL A . n 
C  3  227  GLY 227  226  226  GLY GLY A . n 
C  3  228  ASP 228  227  227  ASP ASP A . n 
C  3  229  ILE 229  228  228  ILE ILE A . n 
C  3  230  ALA 230  229  229  ALA ALA A . n 
C  3  231  SER 231  230  230  SER SER A . n 
C  3  232  LYS 232  231  231  LYS LYS A . n 
C  3  233  ARG 233  232  232  ARG ARG A . n 
C  3  234  THR 234  233  233  THR THR A . n 
C  3  235  GLY 235  234  234  GLY GLY A . n 
C  3  236  ARG 236  235  235  ARG ARG A . n 
C  3  237  GLY 237  236  236  GLY GLY A . n 
C  3  238  GLY 238  237  237  GLY GLY A . n 
C  3  239  ASN 239  238  ?    ?   ?   A . n 
C  3  240  GLU 240  239  ?    ?   ?   A . n 
D  4  1    MET 1    0    ?    ?   ?   B . n 
D  4  2    PRO 2    1    1    PRO PRO B . n 
D  4  3    GLN 3    2    2    GLN GLN B . n 
D  4  4    PRO 4    3    3    PRO PRO B . n 
D  4  5    SER 5    4    4    SER SER B . n 
D  4  6    ARG 6    5    5    ARG ARG B . n 
D  4  7    PRO 7    6    6    PRO PRO B . n 
D  4  8    ARG 8    7    7    ARG ARG B . n 
D  4  9    LYS 9    8    8    LYS LYS B . n 
D  4  10   GLY 10   9    9    GLY GLY B . n 
D  4  11   SER 11   10   10   SER SER B . n 
D  4  12   LEU 12   11   11   LEU LEU B . n 
D  4  13   GLY 13   12   12   GLY GLY B . n 
D  4  14   PHE 14   13   13   PHE PHE B . n 
D  4  15   GLY 15   14   14   GLY GLY B . n 
D  4  16   PRO 16   15   15   PRO PRO B . n 
D  4  17   ARG 17   16   16   ARG ARG B . n 
D  4  18   LYS 18   17   17   LYS LYS B . n 
D  4  19   ARG 19   18   18   ARG ARG B . n 
D  4  20   SER 20   19   19   SER SER B . n 
D  4  21   THR 21   20   20   THR THR B . n 
D  4  22   SER 22   21   21   SER SER B . n 
D  4  23   GLU 23   22   22   GLU GLU B . n 
D  4  24   THR 24   23   23   THR THR B . n 
D  4  25   PRO 25   24   24   PRO PRO B . n 
D  4  26   ARG 26   25   25   ARG ARG B . n 
D  4  27   PHE 27   26   26   PHE PHE B . n 
D  4  28   ASN 28   27   27   ASN ASN B . n 
D  4  29   SER 29   28   28   SER SER B . n 
D  4  30   TRP 30   29   29   TRP TRP B . n 
D  4  31   PRO 31   30   30   PRO PRO B . n 
D  4  32   SER 32   31   31   SER SER B . n 
D  4  33   ASP 33   32   32   ASP ASP B . n 
D  4  34   ASP 34   33   33   ASP ASP B . n 
D  4  35   GLY 35   34   34   GLY GLY B . n 
D  4  36   GLN 36   35   35   GLN GLN B . n 
D  4  37   PRO 37   36   36   PRO PRO B . n 
D  4  38   GLY 38   37   37   GLY GLY B . n 
D  4  39   VAL 39   38   38   VAL VAL B . n 
D  4  40   GLN 40   39   39   GLN GLN B . n 
D  4  41   GLY 41   40   40   GLY GLY B . n 
D  4  42   PHE 42   41   41   PHE PHE B . n 
D  4  43   ALA 43   42   42   ALA ALA B . n 
D  4  44   GLY 44   43   43   GLY GLY B . n 
D  4  45   TYR 45   44   44   TYR TYR B . n 
D  4  46   LYS 46   45   45   LYS LYS B . n 
D  4  47   ALA 47   46   46   ALA ALA B . n 
D  4  48   GLY 48   47   47   GLY GLY B . n 
D  4  49   MET 49   48   48   MET MET B . n 
D  4  50   THR 50   49   49   THR THR B . n 
D  4  51   HIS 51   50   50   HIS HIS B . n 
D  4  52   VAL 52   51   51   VAL VAL B . n 
D  4  53   VAL 53   52   52   VAL VAL B . n 
D  4  54   LEU 54   53   53   LEU LEU B . n 
D  4  55   VAL 55   54   54   VAL VAL B . n 
D  4  56   ASN 56   55   55   ASN ASN B . n 
D  4  57   ASP 57   56   56   ASP ASP B . n 
D  4  58   GLU 58   57   57   GLU GLU B . n 
D  4  59   PRO 59   58   58   PRO PRO B . n 
D  4  60   ASN 60   59   59   ASN ASN B . n 
D  4  61   SER 61   60   60   SER SER B . n 
D  4  62   PRO 62   61   61   PRO PRO B . n 
D  4  63   ARG 63   62   62   ARG ARG B . n 
D  4  64   GLU 64   63   63   GLU GLU B . n 
D  4  65   GLY 65   64   64   GLY GLY B . n 
D  4  66   MET 66   65   65   MET MET B . n 
D  4  67   GLU 67   66   66   GLU GLU B . n 
D  4  68   GLU 68   67   67   GLU GLU B . n 
D  4  69   THR 69   68   68   THR THR B . n 
D  4  70   VAL 70   69   69   VAL VAL B . n 
D  4  71   PRO 71   70   70   PRO PRO B . n 
D  4  72   VAL 72   71   71   VAL VAL B . n 
D  4  73   THR 73   72   72   THR THR B . n 
D  4  74   VAL 74   73   73   VAL VAL B . n 
D  4  75   ILE 75   74   74   ILE ILE B . n 
D  4  76   GLU 76   75   75   GLU GLU B . n 
D  4  77   THR 77   76   76   THR THR B . n 
D  4  78   PRO 78   77   77   PRO PRO B . n 
D  4  79   PRO 79   78   78   PRO PRO B . n 
D  4  80   MET 80   79   79   MET MET B . n 
D  4  81   ARG 81   80   80   ARG ARG B . n 
D  4  82   ALA 82   81   81   ALA ALA B . n 
D  4  83   VAL 83   82   82   VAL VAL B . n 
D  4  84   ALA 84   83   83   ALA ALA B . n 
D  4  85   LEU 85   84   84   LEU LEU B . n 
D  4  86   ARG 86   85   85   ARG ARG B . n 
D  4  87   ALA 87   86   86   ALA ALA B . n 
D  4  88   TYR 88   87   87   TYR TYR B . n 
D  4  89   GLU 89   88   88   GLU GLU B . n 
D  4  90   ASP 90   89   89   ASP ASP B . n 
D  4  91   THR 91   90   90   THR THR B . n 
D  4  92   PRO 92   91   91   PRO PRO B . n 
D  4  93   TYR 93   92   92   TYR TYR B . n 
D  4  94   GLY 94   93   93   GLY GLY B . n 
D  4  95   GLN 95   94   94   GLN GLN B . n 
D  4  96   ARG 96   95   95   ARG ARG B . n 
D  4  97   PRO 97   96   96   PRO PRO B . n 
D  4  98   LEU 98   97   97   LEU LEU B . n 
D  4  99   THR 99   98   98   THR THR B . n 
D  4  100  GLU 100  99   99   GLU GLU B . n 
D  4  101  VAL 101  100  100  VAL VAL B . n 
D  4  102  TRP 102  101  101  TRP TRP B . n 
D  4  103  THR 103  102  102  THR THR B . n 
D  4  104  ASP 104  103  103  ASP ASP B . n 
D  4  105  GLU 105  104  104  GLU GLU B . n 
D  4  106  PHE 106  105  105  PHE PHE B . n 
D  4  107  HIS 107  106  106  HIS HIS B . n 
D  4  108  SER 108  107  107  SER SER B . n 
D  4  109  GLU 109  108  108  GLU GLU B . n 
D  4  110  LEU 110  109  109  LEU LEU B . n 
D  4  111  ASP 111  110  110  ASP ASP B . n 
D  4  112  ARG 112  111  111  ARG ARG B . n 
D  4  113  THR 113  112  112  THR THR B . n 
D  4  114  LEU 114  113  113  LEU LEU B . n 
D  4  115  ASP 115  114  114  ASP ASP B . n 
D  4  116  VAL 116  115  115  VAL VAL B . n 
D  4  117  PRO 117  116  116  PRO PRO B . n 
D  4  118  GLU 118  117  117  GLU GLU B . n 
D  4  119  ASP 119  118  118  ASP ASP B . n 
D  4  120  HIS 120  119  119  HIS HIS B . n 
D  4  121  ASP 121  120  120  ASP ASP B . n 
D  4  122  PRO 122  121  121  PRO PRO B . n 
D  4  123  ASP 123  122  122  ASP ASP B . n 
D  4  124  ALA 124  123  123  ALA ALA B . n 
D  4  125  ALA 125  124  124  ALA ALA B . n 
D  4  126  GLU 126  125  125  GLU GLU B . n 
D  4  127  GLU 127  126  126  GLU GLU B . n 
D  4  128  GLN 128  127  127  GLN GLN B . n 
D  4  129  ILE 129  128  128  ILE ILE B . n 
D  4  130  ARG 130  129  129  ARG ARG B . n 
D  4  131  ASP 131  130  130  ASP ASP B . n 
D  4  132  ALA 132  131  131  ALA ALA B . n 
D  4  133  HIS 133  132  132  HIS HIS B . n 
D  4  134  GLU 134  133  133  GLU GLU B . n 
D  4  135  ALA 135  134  134  ALA ALA B . n 
D  4  136  GLY 136  135  135  GLY GLY B . n 
D  4  137  ASP 137  136  136  ASP ASP B . n 
D  4  138  LEU 138  137  137  LEU LEU B . n 
D  4  139  GLY 139  138  138  GLY GLY B . n 
D  4  140  ASP 140  139  139  ASP ASP B . n 
D  4  141  LEU 141  140  140  LEU LEU B . n 
D  4  142  ARG 142  141  141  ARG ARG B . n 
D  4  143  LEU 143  142  142  LEU LEU B . n 
D  4  144  ILE 144  143  143  ILE ILE B . n 
D  4  145  THR 145  144  144  THR THR B . n 
D  4  146  HIS 146  145  145  HIS HIS B . n 
D  4  147  THR 147  146  146  THR THR B . n 
D  4  148  VAL 148  147  147  VAL VAL B . n 
D  4  149  PRO 149  148  148  PRO PRO B . n 
D  4  150  ASP 150  149  149  ASP ASP B . n 
D  4  151  ALA 151  150  150  ALA ALA B . n 
D  4  152  VAL 152  151  151  VAL VAL B . n 
D  4  153  PRO 153  152  152  PRO PRO B . n 
D  4  154  SER 154  153  153  SER SER B . n 
D  4  155  VAL 155  154  154  VAL VAL B . n 
D  4  156  PRO 156  155  155  PRO PRO B . n 
D  4  157  LYS 157  156  156  LYS LYS B . n 
D  4  158  LYS 158  157  157  LYS LYS B . n 
D  4  159  LYS 159  158  158  LYS LYS B . n 
D  4  160  PRO 160  159  159  PRO PRO B . n 
D  4  161  ASP 161  160  160  ASP ASP B . n 
D  4  162  VAL 162  161  161  VAL VAL B . n 
D  4  163  MET 163  162  162  MET MET B . n 
D  4  164  GLU 164  163  163  GLU GLU B . n 
D  4  165  THR 165  164  164  THR THR B . n 
D  4  166  ARG 166  165  165  ARG ARG B . n 
D  4  167  VAL 167  166  166  VAL VAL B . n 
D  4  168  GLY 168  167  167  GLY GLY B . n 
D  4  169  GLY 169  168  168  GLY GLY B . n 
D  4  170  GLY 170  169  169  GLY GLY B . n 
D  4  171  SER 171  170  170  SER SER B . n 
D  4  172  VAL 172  171  171  VAL VAL B . n 
D  4  173  SER 173  172  172  SER SER B . n 
D  4  174  ASP 174  173  173  ASP ASP B . n 
D  4  175  ARG 175  174  174  ARG ARG B . n 
D  4  176  LEU 176  175  175  LEU LEU B . n 
D  4  177  ASP 177  176  176  ASP ASP B . n 
D  4  178  HIS 178  177  177  HIS HIS B . n 
D  4  179  ALA 179  178  178  ALA ALA B . n 
D  4  180  LEU 180  179  179  LEU LEU B . n 
D  4  181  ASP 181  180  180  ASP ASP B . n 
D  4  182  ILE 182  181  181  ILE ILE B . n 
D  4  183  VAL 183  182  182  VAL VAL B . n 
D  4  184  GLU 184  183  183  GLU GLU B . n 
D  4  185  ASP 185  184  184  ASP ASP B . n 
D  4  186  GLY 186  185  185  GLY GLY B . n 
D  4  187  GLY 187  186  186  GLY GLY B . n 
D  4  188  GLU 188  187  187  GLU GLU B . n 
D  4  189  HIS 189  188  188  HIS HIS B . n 
D  4  190  ALA 190  189  189  ALA ALA B . n 
D  4  191  MET 191  190  190  MET MET B . n 
D  4  192  ASN 192  191  191  ASN ASN B . n 
D  4  193  ASP 193  192  192  ASP ASP B . n 
D  4  194  ILE 194  193  193  ILE ILE B . n 
D  4  195  PHE 195  194  194  PHE PHE B . n 
D  4  196  ARG 196  195  195  ARG ARG B . n 
D  4  197  ALA 197  196  196  ALA ALA B . n 
D  4  198  GLY 198  197  197  GLY GLY B . n 
D  4  199  GLU 199  198  198  GLU GLU B . n 
D  4  200  TYR 200  199  199  TYR TYR B . n 
D  4  201  ALA 201  200  200  ALA ALA B . n 
D  4  202  ASP 202  201  201  ASP ASP B . n 
D  4  203  VAL 203  202  202  VAL VAL B . n 
D  4  204  ALA 204  203  203  ALA ALA B . n 
D  4  205  GLY 205  204  204  GLY GLY B . n 
D  4  206  VAL 206  205  205  VAL VAL B . n 
D  4  207  THR 207  206  206  THR THR B . n 
D  4  208  LYS 208  207  207  LYS LYS B . n 
D  4  209  GLY 209  208  208  GLY GLY B . n 
D  4  210  LYS 210  209  209  LYS LYS B . n 
D  4  211  GLY 211  210  210  GLY GLY B . n 
D  4  212  THR 212  211  211  THR THR B . n 
D  4  213  GLN 213  212  212  GLN GLN B . n 
D  4  214  GLY 214  213  213  GLY GLY B . n 
D  4  215  PRO 215  214  214  PRO PRO B . n 
D  4  216  VAL 216  215  215  VAL VAL B . n 
D  4  217  LYS 217  216  216  LYS LYS B . n 
D  4  218  ARG 218  217  217  ARG ARG B . n 
D  4  219  TRP 219  218  218  TRP TRP B . n 
D  4  220  GLY 220  219  219  GLY GLY B . n 
D  4  221  VAL 221  220  220  VAL VAL B . n 
D  4  222  GLN 222  221  221  GLN GLN B . n 
D  4  223  LYS 223  222  222  LYS LYS B . n 
D  4  224  ARG 224  223  223  ARG ARG B . n 
D  4  225  LYS 225  224  224  LYS LYS B . n 
D  4  226  GLY 226  225  225  GLY GLY B . n 
D  4  227  LYS 227  226  226  LYS LYS B . n 
D  4  228  HIS 228  227  227  HIS HIS B . n 
D  4  229  ALA 229  228  228  ALA ALA B . n 
D  4  230  ARG 230  229  229  ARG ARG B . n 
D  4  231  GLN 231  230  230  GLN GLN B . n 
D  4  232  GLY 232  231  231  GLY GLY B . n 
D  4  233  TRP 233  232  232  TRP TRP B . n 
D  4  234  ARG 234  233  233  ARG ARG B . n 
D  4  235  ARG 235  234  234  ARG ARG B . n 
D  4  236  ARG 236  235  235  ARG ARG B . n 
D  4  237  ILE 237  236  236  ILE ILE B . n 
D  4  238  GLY 238  237  237  GLY GLY B . n 
D  4  239  ASN 239  238  238  ASN ASN B . n 
D  4  240  LEU 240  239  239  LEU LEU B . n 
D  4  241  GLY 241  240  240  GLY GLY B . n 
D  4  242  PRO 242  241  241  PRO PRO B . n 
D  4  243  TRP 243  242  242  TRP TRP B . n 
D  4  244  ASN 244  243  243  ASN ASN B . n 
D  4  245  PRO 245  244  244  PRO PRO B . n 
D  4  246  SER 246  245  245  SER SER B . n 
D  4  247  ARG 247  246  246  ARG ARG B . n 
D  4  248  VAL 248  247  247  VAL VAL B . n 
D  4  249  ARG 249  248  248  ARG ARG B . n 
D  4  250  SER 250  249  249  SER SER B . n 
D  4  251  THR 251  250  250  THR THR B . n 
D  4  252  VAL 252  251  251  VAL VAL B . n 
D  4  253  PRO 253  252  252  PRO PRO B . n 
D  4  254  GLN 254  253  253  GLN GLN B . n 
D  4  255  GLN 255  254  254  GLN GLN B . n 
D  4  256  GLY 256  255  255  GLY GLY B . n 
D  4  257  GLN 257  256  256  GLN GLN B . n 
D  4  258  THR 258  257  257  THR THR B . n 
D  4  259  GLY 259  258  258  GLY GLY B . n 
D  4  260  TYR 260  259  259  TYR TYR B . n 
D  4  261  HIS 261  260  260  HIS HIS B . n 
D  4  262  GLN 262  261  261  GLN GLN B . n 
D  4  263  ARG 263  262  262  ARG ARG B . n 
D  4  264  THR 264  263  263  THR THR B . n 
D  4  265  GLU 265  264  264  GLU GLU B . n 
D  4  266  LEU 266  265  265  LEU LEU B . n 
D  4  267  ASN 267  266  266  ASN ASN B . n 
D  4  268  LYS 268  267  267  LYS LYS B . n 
D  4  269  ARG 269  268  268  ARG ARG B . n 
D  4  270  LEU 270  269  269  LEU LEU B . n 
D  4  271  ILE 271  270  270  ILE ILE B . n 
D  4  272  ASP 272  271  271  ASP ASP B . n 
D  4  273  ILE 273  272  272  ILE ILE B . n 
D  4  274  GLY 274  273  273  GLY GLY B . n 
D  4  275  GLU 275  274  274  GLU GLU B . n 
D  4  276  GLY 276  275  275  GLY GLY B . n 
D  4  277  ASP 277  276  276  ASP ASP B . n 
D  4  278  GLU 278  277  277  GLU GLU B . n 
D  4  279  PRO 279  278  278  PRO PRO B . n 
D  4  280  THR 280  279  279  THR THR B . n 
D  4  281  VAL 281  280  280  VAL VAL B . n 
D  4  282  ASP 282  281  281  ASP ASP B . n 
D  4  283  GLY 283  282  282  GLY GLY B . n 
D  4  284  GLY 284  283  283  GLY GLY B . n 
D  4  285  PHE 285  284  284  PHE PHE B . n 
D  4  286  VAL 286  285  285  VAL VAL B . n 
D  4  287  ASN 287  286  286  ASN ASN B . n 
D  4  288  TYR 288  287  287  TYR TYR B . n 
D  4  289  GLY 289  288  288  GLY GLY B . n 
D  4  290  GLU 290  289  289  GLU GLU B . n 
D  4  291  VAL 291  290  290  VAL VAL B . n 
D  4  292  ASP 292  291  291  ASP ASP B . n 
D  4  293  GLY 293  292  292  GLY GLY B . n 
D  4  294  PRO 294  293  293  PRO PRO B . n 
D  4  295  TYR 295  294  294  TYR TYR B . n 
D  4  296  THR 296  295  295  THR THR B . n 
D  4  297  LEU 297  296  296  LEU LEU B . n 
D  4  298  VAL 298  297  297  VAL VAL B . n 
D  4  299  LYS 299  298  298  LYS LYS B . n 
D  4  300  GLY 300  299  299  GLY GLY B . n 
D  4  301  SER 301  300  300  SER SER B . n 
D  4  302  VAL 302  301  301  VAL VAL B . n 
D  4  303  PRO 303  302  302  PRO PRO B . n 
D  4  304  GLY 304  303  303  GLY GLY B . n 
D  4  305  PRO 305  304  304  PRO PRO B . n 
D  4  306  ASP 306  305  305  ASP ASP B . n 
D  4  307  LYS 307  306  306  LYS LYS B . n 
D  4  308  ARG 308  307  307  ARG ARG B . n 
D  4  309  LEU 309  308  308  LEU LEU B . n 
D  4  310  VAL 310  309  309  VAL VAL B . n 
D  4  311  ARG 311  310  310  ARG ARG B . n 
D  4  312  PHE 312  311  311  PHE PHE B . n 
D  4  313  ARG 313  312  312  ARG ARG B . n 
D  4  314  PRO 314  313  313  PRO PRO B . n 
D  4  315  ALA 315  314  314  ALA ALA B . n 
D  4  316  VAL 316  315  315  VAL VAL B . n 
D  4  317  ARG 317  316  316  ARG ARG B . n 
D  4  318  PRO 318  317  317  PRO PRO B . n 
D  4  319  ASN 319  318  318  ASN ASN B . n 
D  4  320  ASP 320  319  319  ASP ASP B . n 
D  4  321  GLN 321  320  320  GLN GLN B . n 
D  4  322  PRO 322  321  321  PRO PRO B . n 
D  4  323  ARG 323  322  322  ARG ARG B . n 
D  4  324  LEU 324  323  323  LEU LEU B . n 
D  4  325  ASP 325  324  324  ASP ASP B . n 
D  4  326  PRO 326  325  325  PRO PRO B . n 
D  4  327  GLU 327  326  326  GLU GLU B . n 
D  4  328  VAL 328  327  327  VAL VAL B . n 
D  4  329  ARG 329  328  328  ARG ARG B . n 
D  4  330  TYR 330  329  329  TYR TYR B . n 
D  4  331  VAL 331  330  330  VAL VAL B . n 
D  4  332  SER 332  331  331  SER SER B . n 
D  4  333  ASN 333  332  332  ASN ASN B . n 
D  4  334  GLU 334  333  333  GLU GLU B . n 
D  4  335  SER 335  334  334  SER SER B . n 
D  4  336  ASN 336  335  335  ASN ASN B . n 
D  4  337  GLN 337  336  336  GLN GLN B . n 
D  4  338  GLY 338  337  337  GLY GLY B . n 
E  5  1    MET 1    1    1    MET MET C . n 
E  5  2    GLN 2    2    2    GLN GLN C . n 
E  5  3    ALA 3    3    3    ALA ALA C . n 
E  5  4    THR 4    4    4    THR THR C . n 
E  5  5    ILE 5    5    5    ILE ILE C . n 
E  5  6    TYR 6    6    6    TYR TYR C . n 
E  5  7    ASP 7    7    7    ASP ASP C . n 
E  5  8    LEU 8    8    8    LEU LEU C . n 
E  5  9    ASP 9    9    9    ASP ASP C . n 
E  5  10   GLY 10   10   10   GLY GLY C . n 
E  5  11   ASN 11   11   11   ASN ASN C . n 
E  5  12   THR 12   12   12   THR THR C . n 
E  5  13   ASP 13   13   13   ASP ASP C . n 
E  5  14   GLY 14   14   14   GLY GLY C . n 
E  5  15   GLU 15   15   15   GLU GLU C . n 
E  5  16   VAL 16   16   16   VAL VAL C . n 
E  5  17   ASP 17   17   17   ASP ASP C . n 
E  5  18   LEU 18   18   18   LEU LEU C . n 
E  5  19   PRO 19   19   19   PRO PRO C . n 
E  5  20   ASP 20   20   20   ASP ASP C . n 
E  5  21   VAL 21   21   21   VAL VAL C . n 
E  5  22   PHE 22   22   22   PHE PHE C . n 
E  5  23   GLU 23   23   23   GLU GLU C . n 
E  5  24   THR 24   24   24   THR THR C . n 
E  5  25   PRO 25   25   25   PRO PRO C . n 
E  5  26   VAL 26   26   26   VAL VAL C . n 
E  5  27   ARG 27   27   27   ARG ARG C . n 
E  5  28   SER 28   28   28   SER SER C . n 
E  5  29   ASP 29   29   29   ASP ASP C . n 
E  5  30   LEU 30   30   30   LEU LEU C . n 
E  5  31   ILE 31   31   31   ILE ILE C . n 
E  5  32   GLY 32   32   32   GLY GLY C . n 
E  5  33   LYS 33   33   33   LYS LYS C . n 
E  5  34   ALA 34   34   34   ALA ALA C . n 
E  5  35   VAL 35   35   35   VAL VAL C . n 
E  5  36   ARG 36   36   36   ARG ARG C . n 
E  5  37   ALA 37   37   37   ALA ALA C . n 
E  5  38   ALA 38   38   38   ALA ALA C . n 
E  5  39   GLN 39   39   39   GLN GLN C . n 
E  5  40   ALA 40   40   40   ALA ALA C . n 
E  5  41   ASN 41   41   41   ASN ASN C . n 
E  5  42   ARG 42   42   42   ARG ARG C . n 
E  5  43   LYS 43   43   43   LYS LYS C . n 
E  5  44   GLN 44   44   44   GLN GLN C . n 
E  5  45   ASP 45   45   45   ASP ASP C . n 
E  5  46   TYR 46   46   46   TYR TYR C . n 
E  5  47   GLY 47   47   47   GLY GLY C . n 
E  5  48   SER 48   48   48   SER SER C . n 
E  5  49   ASP 49   49   49   ASP ASP C . n 
E  5  50   GLU 50   50   50   GLU GLU C . n 
E  5  51   TYR 51   51   51   TYR TYR C . n 
E  5  52   ALA 52   52   52   ALA ALA C . n 
E  5  53   GLY 53   53   53   GLY GLY C . n 
E  5  54   LEU 54   54   54   LEU LEU C . n 
E  5  55   ARG 55   55   55   ARG ARG C . n 
E  5  56   THR 56   56   56   THR THR C . n 
E  5  57   PRO 57   57   57   PRO PRO C . n 
E  5  58   ALA 58   58   58   ALA ALA C . n 
E  5  59   GLU 59   59   59   GLU GLU C . n 
E  5  60   SER 60   60   60   SER SER C . n 
E  5  61   PHE 61   61   61   PHE PHE C . n 
E  5  62   GLY 62   62   62   GLY GLY C . n 
E  5  63   SER 63   63   63   SER SER C . n 
E  5  64   GLY 64   64   64   GLY GLY C . n 
E  5  65   ARG 65   65   65   ARG ARG C . n 
E  5  66   GLY 66   66   66   GLY GLY C . n 
E  5  67   GLN 67   67   67   GLN GLN C . n 
E  5  68   ALA 68   68   68   ALA ALA C . n 
E  5  69   HIS 69   69   69   HIS HIS C . n 
E  5  70   VAL 70   70   70   VAL VAL C . n 
E  5  71   PRO 71   71   71   PRO PRO C . n 
E  5  72   LYS 72   72   72   LYS LYS C . n 
E  5  73   LEU 73   73   73   LEU LEU C . n 
E  5  74   ASP 74   74   74   ASP ASP C . n 
E  5  75   GLY 75   75   75   GLY GLY C . n 
E  5  76   ARG 76   76   76   ARG ARG C . n 
E  5  77   ALA 77   77   77   ALA ALA C . n 
E  5  78   ARG 78   78   78   ARG ARG C . n 
E  5  79   ARG 79   79   79   ARG ARG C . n 
E  5  80   VAL 80   80   80   VAL VAL C . n 
E  5  81   PRO 81   81   81   PRO PRO C . n 
E  5  82   GLN 82   82   82   GLN GLN C . n 
E  5  83   ALA 83   83   83   ALA ALA C . n 
E  5  84   VAL 84   84   84   VAL VAL C . n 
E  5  85   LYS 85   85   85   LYS LYS C . n 
E  5  86   GLY 86   86   86   GLY GLY C . n 
E  5  87   ARG 87   87   87   ARG ARG C . n 
E  5  88   SER 88   88   88   SER SER C . n 
E  5  89   ALA 89   89   89   ALA ALA C . n 
E  5  90   HIS 90   90   90   HIS HIS C . n 
E  5  91   PRO 91   91   91   PRO PRO C . n 
E  5  92   PRO 92   92   92   PRO PRO C . n 
E  5  93   LYS 93   93   93   LYS LYS C . n 
E  5  94   THR 94   94   94   THR THR C . n 
E  5  95   GLU 95   95   95   GLU GLU C . n 
E  5  96   LYS 96   96   96   LYS LYS C . n 
E  5  97   ASP 97   97   97   ASP ASP C . n 
E  5  98   ARG 98   98   98   ARG ARG C . n 
E  5  99   SER 99   99   99   SER SER C . n 
E  5  100  LEU 100  100  100  LEU LEU C . n 
E  5  101  ASP 101  101  101  ASP ASP C . n 
E  5  102  LEU 102  102  102  LEU LEU C . n 
E  5  103  ASN 103  103  103  ASN ASN C . n 
E  5  104  ASP 104  104  104  ASP ASP C . n 
E  5  105  LYS 105  105  105  LYS LYS C . n 
E  5  106  GLU 106  106  106  GLU GLU C . n 
E  5  107  ARG 107  107  107  ARG ARG C . n 
E  5  108  GLN 108  108  108  GLN GLN C . n 
E  5  109  LEU 109  109  109  LEU LEU C . n 
E  5  110  ALA 110  110  110  ALA ALA C . n 
E  5  111  VAL 111  111  111  VAL VAL C . n 
E  5  112  ARG 112  112  112  ARG ARG C . n 
E  5  113  SER 113  113  113  SER SER C . n 
E  5  114  ALA 114  114  114  ALA ALA C . n 
E  5  115  LEU 115  115  115  LEU LEU C . n 
E  5  116  ALA 116  116  116  ALA ALA C . n 
E  5  117  ALA 117  117  117  ALA ALA C . n 
E  5  118  THR 118  118  118  THR THR C . n 
E  5  119  ALA 119  119  119  ALA ALA C . n 
E  5  120  ASP 120  120  120  ASP ASP C . n 
E  5  121  ALA 121  121  121  ALA ALA C . n 
E  5  122  ASP 122  122  122  ASP ASP C . n 
E  5  123  LEU 123  123  123  LEU LEU C . n 
E  5  124  VAL 124  124  124  VAL VAL C . n 
E  5  125  ALA 125  125  125  ALA ALA C . n 
E  5  126  ASP 126  126  126  ASP ASP C . n 
E  5  127  ARG 127  127  127  ARG ARG C . n 
E  5  128  GLY 128  128  128  GLY GLY C . n 
E  5  129  HIS 129  129  129  HIS HIS C . n 
E  5  130  GLU 130  130  130  GLU GLU C . n 
E  5  131  PHE 131  131  131  PHE PHE C . n 
E  5  132  ASP 132  132  132  ASP ASP C . n 
E  5  133  ARG 133  133  133  ARG ARG C . n 
E  5  134  ASP 134  134  134  ASP ASP C . n 
E  5  135  GLU 135  135  135  GLU GLU C . n 
E  5  136  VAL 136  136  136  VAL VAL C . n 
E  5  137  PRO 137  137  137  PRO PRO C . n 
E  5  138  VAL 138  138  138  VAL VAL C . n 
E  5  139  VAL 139  139  139  VAL VAL C . n 
E  5  140  VAL 140  140  140  VAL VAL C . n 
E  5  141  SER 141  141  141  SER SER C . n 
E  5  142  ASP 142  142  142  ASP ASP C . n 
E  5  143  ASP 143  143  143  ASP ASP C . n 
E  5  144  PHE 144  144  144  PHE PHE C . n 
E  5  145  GLU 145  145  145  GLU GLU C . n 
E  5  146  ASP 146  146  146  ASP ASP C . n 
E  5  147  LEU 147  147  147  LEU LEU C . n 
E  5  148  VAL 148  148  148  VAL VAL C . n 
E  5  149  LYS 149  149  149  LYS LYS C . n 
E  5  150  THR 150  150  150  THR THR C . n 
E  5  151  GLN 151  151  151  GLN GLN C . n 
E  5  152  GLU 152  152  152  GLU GLU C . n 
E  5  153  VAL 153  153  153  VAL VAL C . n 
E  5  154  VAL 154  154  154  VAL VAL C . n 
E  5  155  SER 155  155  155  SER SER C . n 
E  5  156  LEU 156  156  156  LEU LEU C . n 
E  5  157  LEU 157  157  157  LEU LEU C . n 
E  5  158  GLU 158  158  158  GLU GLU C . n 
E  5  159  ALA 159  159  159  ALA ALA C . n 
E  5  160  LEU 160  160  160  LEU LEU C . n 
E  5  161  ASP 161  161  161  ASP ASP C . n 
E  5  162  VAL 162  162  162  VAL VAL C . n 
E  5  163  HIS 163  163  163  HIS HIS C . n 
E  5  164  ALA 164  164  164  ALA ALA C . n 
E  5  165  ASP 165  165  165  ASP ASP C . n 
E  5  166  ILE 166  166  166  ILE ILE C . n 
E  5  167  ASP 167  167  167  ASP ASP C . n 
E  5  168  ARG 168  168  168  ARG ARG C . n 
E  5  169  ALA 169  169  169  ALA ALA C . n 
E  5  170  ASP 170  170  170  ASP ASP C . n 
E  5  171  GLU 171  171  171  GLU GLU C . n 
E  5  172  THR 172  172  172  THR THR C . n 
E  5  173  LYS 173  173  173  LYS LYS C . n 
E  5  174  ILE 174  174  174  ILE ILE C . n 
E  5  175  LYS 175  175  175  LYS LYS C . n 
E  5  176  ALA 176  176  176  ALA ALA C . n 
E  5  177  GLY 177  177  177  GLY GLY C . n 
E  5  178  GLN 178  178  178  GLN GLN C . n 
E  5  179  GLY 179  179  179  GLY GLY C . n 
E  5  180  SER 180  180  180  SER SER C . n 
E  5  181  ALA 181  181  181  ALA ALA C . n 
E  5  182  ARG 182  182  182  ARG ARG C . n 
E  5  183  GLY 183  183  183  GLY GLY C . n 
E  5  184  ARG 184  184  184  ARG ARG C . n 
E  5  185  LYS 185  185  185  LYS LYS C . n 
E  5  186  TYR 186  186  186  TYR TYR C . n 
E  5  187  ARG 187  187  187  ARG ARG C . n 
E  5  188  ARG 188  188  188  ARG ARG C . n 
E  5  189  PRO 189  189  189  PRO PRO C . n 
E  5  190  ALA 190  190  190  ALA ALA C . n 
E  5  191  SER 191  191  191  SER SER C . n 
E  5  192  ILE 192  192  192  ILE ILE C . n 
E  5  193  LEU 193  193  193  LEU LEU C . n 
E  5  194  PHE 194  194  194  PHE PHE C . n 
E  5  195  VAL 195  195  195  VAL VAL C . n 
E  5  196  THR 196  196  196  THR THR C . n 
E  5  197  SER 197  197  197  SER SER C . n 
E  5  198  ASP 198  198  198  ASP ASP C . n 
E  5  199  GLU 199  199  199  GLU GLU C . n 
E  5  200  PRO 200  200  200  PRO PRO C . n 
E  5  201  SER 201  201  201  SER SER C . n 
E  5  202  THR 202  202  202  THR THR C . n 
E  5  203  ALA 203  203  203  ALA ALA C . n 
E  5  204  ALA 204  204  204  ALA ALA C . n 
E  5  205  ARG 205  205  205  ARG ARG C . n 
E  5  206  ASN 206  206  206  ASN ASN C . n 
E  5  207  LEU 207  207  207  LEU LEU C . n 
E  5  208  ALA 208  208  208  ALA ALA C . n 
E  5  209  GLY 209  209  209  GLY GLY C . n 
E  5  210  ALA 210  210  210  ALA ALA C . n 
E  5  211  ASP 211  211  211  ASP ASP C . n 
E  5  212  VAL 212  212  212  VAL VAL C . n 
E  5  213  ALA 213  213  213  ALA ALA C . n 
E  5  214  THR 214  214  214  THR THR C . n 
E  5  215  ALA 215  215  215  ALA ALA C . n 
E  5  216  SER 216  216  216  SER SER C . n 
E  5  217  GLU 217  217  217  GLU GLU C . n 
E  5  218  VAL 218  218  218  VAL VAL C . n 
E  5  219  ASN 219  219  219  ASN ASN C . n 
E  5  220  THR 220  220  220  THR THR C . n 
E  5  221  GLU 221  221  221  GLU GLU C . n 
E  5  222  ASP 222  222  222  ASP ASP C . n 
E  5  223  LEU 223  223  223  LEU LEU C . n 
E  5  224  ALA 224  224  224  ALA ALA C . n 
E  5  225  PRO 225  225  225  PRO PRO C . n 
E  5  226  GLY 226  226  226  GLY GLY C . n 
E  5  227  GLY 227  227  227  GLY GLY C . n 
E  5  228  ALA 228  228  228  ALA ALA C . n 
E  5  229  PRO 229  229  229  PRO PRO C . n 
E  5  230  GLY 230  230  230  GLY GLY C . n 
E  5  231  ARG 231  231  231  ARG ARG C . n 
E  5  232  LEU 232  232  232  LEU LEU C . n 
E  5  233  THR 233  233  233  THR THR C . n 
E  5  234  VAL 234  234  234  VAL VAL C . n 
E  5  235  PHE 235  235  235  PHE PHE C . n 
E  5  236  THR 236  236  236  THR THR C . n 
E  5  237  GLU 237  237  237  GLU GLU C . n 
E  5  238  SER 238  238  238  SER SER C . n 
E  5  239  ALA 239  239  239  ALA ALA C . n 
E  5  240  LEU 240  240  240  LEU LEU C . n 
E  5  241  ALA 241  241  241  ALA ALA C . n 
E  5  242  GLU 242  242  242  GLU GLU C . n 
E  5  243  VAL 243  243  243  VAL VAL C . n 
E  5  244  ALA 244  244  244  ALA ALA C . n 
E  5  245  GLU 245  245  245  GLU GLU C . n 
E  5  246  ARG 246  246  246  ARG ARG C . n 
F  6  1    MET 1    0    ?    ?   ?   D . n 
F  6  2    SER 2    1    ?    ?   ?   D . n 
F  6  3    SER 3    2    ?    ?   ?   D . n 
F  6  4    GLU 4    3    ?    ?   ?   D . n 
F  6  5    SER 5    4    ?    ?   ?   D . n 
F  6  6    GLU 6    5    ?    ?   ?   D . n 
F  6  7    SER 7    6    ?    ?   ?   D . n 
F  6  8    GLY 8    7    ?    ?   ?   D . n 
F  6  9    GLY 9    8    ?    ?   ?   D . n 
F  6  10   ASP 10   9    ?    ?   ?   D . n 
F  6  11   PHE 11   10   10   PHE PHE D . n 
F  6  12   HIS 12   11   11   HIS HIS D . n 
F  6  13   GLU 13   12   12   GLU GLU D . n 
F  6  14   MET 14   13   13   MET MET D . n 
F  6  15   ARG 15   14   14   ARG ARG D . n 
F  6  16   GLU 16   15   15   GLU GLU D . n 
F  6  17   PRO 17   16   16   PRO PRO D . n 
F  6  18   ARG 18   17   17   ARG ARG D . n 
F  6  19   ILE 19   18   18   ILE ILE D . n 
F  6  20   GLU 20   19   19   GLU GLU D . n 
F  6  21   LYS 21   20   20   LYS LYS D . n 
F  6  22   VAL 22   21   21   VAL VAL D . n 
F  6  23   VAL 23   22   22   VAL VAL D . n 
F  6  24   VAL 24   23   23   VAL VAL D . n 
F  6  25   HIS 25   24   24   HIS HIS D . n 
F  6  26   MET 26   25   25   MET MET D . n 
F  6  27   GLY 27   26   26   GLY GLY D . n 
F  6  28   ILE 28   27   27   ILE ILE D . n 
F  6  29   GLY 29   28   28   GLY GLY D . n 
F  6  30   HIS 30   29   29   HIS HIS D . n 
F  6  31   GLY 31   30   ?    ?   ?   D . n 
F  6  32   GLY 32   31   ?    ?   ?   D . n 
F  6  33   ARG 33   32   ?    ?   ?   D . n 
F  6  34   ASP 34   33   ?    ?   ?   D . n 
F  6  35   LEU 35   34   ?    ?   ?   D . n 
F  6  36   ALA 36   35   35   ALA ALA D . n 
F  6  37   ASN 37   36   36   ASN ASN D . n 
F  6  38   ALA 38   37   37   ALA ALA D . n 
F  6  39   GLU 39   38   38   GLU GLU D . n 
F  6  40   ASP 40   39   39   ASP ASP D . n 
F  6  41   ILE 41   40   40   ILE ILE D . n 
F  6  42   LEU 42   41   41   LEU LEU D . n 
F  6  43   GLY 43   42   42   GLY GLY D . n 
F  6  44   GLU 44   43   43   GLU GLU D . n 
F  6  45   ILE 45   44   44   ILE ILE D . n 
F  6  46   THR 46   45   45   THR THR D . n 
F  6  47   GLY 47   46   46   GLY GLY D . n 
F  6  48   GLN 48   47   47   GLN GLN D . n 
F  6  49   MET 49   48   48   MET MET D . n 
F  6  50   PRO 50   49   49   PRO PRO D . n 
F  6  51   VAL 51   50   50   VAL VAL D . n 
F  6  52   ARG 52   51   51   ARG ARG D . n 
F  6  53   THR 53   52   52   THR THR D . n 
F  6  54   LYS 54   53   53   LYS LYS D . n 
F  6  55   ALA 55   54   54   ALA ALA D . n 
F  6  56   LYS 56   55   55   LYS LYS D . n 
F  6  57   ARG 57   56   56   ARG ARG D . n 
F  6  58   THR 58   57   57   THR THR D . n 
F  6  59   VAL 59   58   58   VAL VAL D . n 
F  6  60   GLY 60   59   59   GLY GLY D . n 
F  6  61   GLU 61   60   60   GLU GLU D . n 
F  6  62   PHE 62   61   61   PHE PHE D . n 
F  6  63   ASP 63   62   62   ASP ASP D . n 
F  6  64   ILE 64   63   63   ILE ILE D . n 
F  6  65   ARG 65   64   64   ARG ARG D . n 
F  6  66   GLU 66   65   65   GLU GLU D . n 
F  6  67   GLY 67   66   66   GLY GLY D . n 
F  6  68   ASP 68   67   67   ASP ASP D . n 
F  6  69   PRO 69   68   68   PRO PRO D . n 
F  6  70   ILE 70   69   69   ILE ILE D . n 
F  6  71   GLY 71   70   70   GLY GLY D . n 
F  6  72   ALA 72   71   71   ALA ALA D . n 
F  6  73   LYS 73   72   72   LYS LYS D . n 
F  6  74   VAL 74   73   73   VAL VAL D . n 
F  6  75   THR 75   74   74   THR THR D . n 
F  6  76   LEU 76   75   75   LEU LEU D . n 
F  6  77   ARG 77   76   76   ARG ARG D . n 
F  6  78   ASP 78   77   77   ASP ASP D . n 
F  6  79   GLU 79   78   78   GLU GLU D . n 
F  6  80   MET 80   79   79   MET MET D . n 
F  6  81   ALA 81   80   80   ALA ALA D . n 
F  6  82   GLU 82   81   81   GLU GLU D . n 
F  6  83   GLU 83   82   82   GLU GLU D . n 
F  6  84   PHE 84   83   83   PHE PHE D . n 
F  6  85   LEU 85   84   84   LEU LEU D . n 
F  6  86   GLN 86   85   85   GLN GLN D . n 
F  6  87   THR 87   86   86   THR THR D . n 
F  6  88   ALA 88   87   87   ALA ALA D . n 
F  6  89   LEU 89   88   88   LEU LEU D . n 
F  6  90   PRO 90   89   89   PRO PRO D . n 
F  6  91   LEU 91   90   90   LEU LEU D . n 
F  6  92   ALA 92   91   91   ALA ALA D . n 
F  6  93   GLU 93   92   92   GLU GLU D . n 
F  6  94   LEU 94   93   93   LEU LEU D . n 
F  6  95   ALA 95   94   94   ALA ALA D . n 
F  6  96   THR 96   95   95   THR THR D . n 
F  6  97   SER 97   96   96   SER SER D . n 
F  6  98   GLN 98   97   97   GLN GLN D . n 
F  6  99   PHE 99   98   98   PHE PHE D . n 
F  6  100  ASP 100  99   99   ASP ASP D . n 
F  6  101  ASP 101  100  100  ASP ASP D . n 
F  6  102  THR 102  101  101  THR THR D . n 
F  6  103  GLY 103  102  102  GLY GLY D . n 
F  6  104  ASN 104  103  103  ASN ASN D . n 
F  6  105  PHE 105  104  104  PHE PHE D . n 
F  6  106  SER 106  105  105  SER SER D . n 
F  6  107  PHE 107  106  106  PHE PHE D . n 
F  6  108  GLY 108  107  107  GLY GLY D . n 
F  6  109  VAL 109  108  ?    ?   ?   D . n 
F  6  110  GLU 110  109  ?    ?   ?   D . n 
F  6  111  GLU 111  110  ?    ?   ?   D . n 
F  6  112  HIS 112  111  ?    ?   ?   D . n 
F  6  113  THR 113  112  ?    ?   ?   D . n 
F  6  114  GLU 114  113  ?    ?   ?   D . n 
F  6  115  PHE 115  114  ?    ?   ?   D . n 
F  6  116  PRO 116  115  ?    ?   ?   D . n 
F  6  117  SER 117  116  ?    ?   ?   D . n 
F  6  118  GLN 118  117  ?    ?   ?   D . n 
F  6  119  GLU 119  118  ?    ?   ?   D . n 
F  6  120  TYR 120  119  ?    ?   ?   D . n 
F  6  121  ASP 121  120  ?    ?   ?   D . n 
F  6  122  PRO 122  121  ?    ?   ?   D . n 
F  6  123  SER 123  122  ?    ?   ?   D . n 
F  6  124  ILE 124  123  ?    ?   ?   D . n 
F  6  125  GLY 125  124  ?    ?   ?   D . n 
F  6  126  ILE 126  125  ?    ?   ?   D . n 
F  6  127  TYR 127  126  ?    ?   ?   D . n 
F  6  128  GLY 128  127  ?    ?   ?   D . n 
F  6  129  LEU 129  128  128  LEU LEU D . n 
F  6  130  ASP 130  129  129  ASP ASP D . n 
F  6  131  VAL 131  130  130  VAL VAL D . n 
F  6  132  THR 132  131  131  THR THR D . n 
F  6  133  VAL 133  132  132  VAL VAL D . n 
F  6  134  ASN 134  133  133  ASN ASN D . n 
F  6  135  LEU 135  134  134  LEU LEU D . n 
F  6  136  VAL 136  135  135  VAL VAL D . n 
F  6  137  ARG 137  136  136  ARG ARG D . n 
F  6  138  PRO 138  137  137  PRO PRO D . n 
F  6  139  GLY 139  138  138  GLY GLY D . n 
F  6  140  TYR 140  139  139  TYR TYR D . n 
F  6  141  ARG 141  140  140  ARG ARG D . n 
F  6  142  VAL 142  141  141  VAL VAL D . n 
F  6  143  ALA 143  142  142  ALA ALA D . n 
F  6  144  LYS 144  143  143  LYS LYS D . n 
F  6  145  ARG 145  144  144  ARG ARG D . n 
F  6  146  ASP 146  145  145  ASP ASP D . n 
F  6  147  LYS 147  146  146  LYS LYS D . n 
F  6  148  ALA 148  147  147  ALA ALA D . n 
F  6  149  SER 149  148  148  SER SER D . n 
F  6  150  ARG 150  149  149  ARG ARG D . n 
F  6  151  SER 151  150  150  SER SER D . n 
F  6  152  ILE 152  151  151  ILE ILE D . n 
F  6  153  PRO 153  152  152  PRO PRO D . n 
F  6  154  THR 154  153  153  THR THR D . n 
F  6  155  LYS 155  154  154  LYS LYS D . n 
F  6  156  HIS 156  155  155  HIS HIS D . n 
F  6  157  ARG 157  156  156  ARG ARG D . n 
F  6  158  LEU 158  157  157  LEU LEU D . n 
F  6  159  ASN 159  158  158  ASN ASN D . n 
F  6  160  PRO 160  159  159  PRO PRO D . n 
F  6  161  ALA 161  160  160  ALA ALA D . n 
F  6  162  ASP 162  161  161  ASP ASP D . n 
F  6  163  ALA 163  162  162  ALA ALA D . n 
F  6  164  VAL 164  163  163  VAL VAL D . n 
F  6  165  ALA 165  164  164  ALA ALA D . n 
F  6  166  PHE 166  165  165  PHE PHE D . n 
F  6  167  ILE 167  166  166  ILE ILE D . n 
F  6  168  GLU 168  167  167  GLU GLU D . n 
F  6  169  SER 169  168  168  SER SER D . n 
F  6  170  THR 170  169  169  THR THR D . n 
F  6  171  TYR 171  170  170  TYR TYR D . n 
F  6  172  ASP 172  171  171  ASP ASP D . n 
F  6  173  VAL 173  172  172  VAL VAL D . n 
F  6  174  GLU 174  173  173  GLU GLU D . n 
F  6  175  VAL 175  174  174  VAL VAL D . n 
F  6  176  SER 176  175  ?    ?   ?   D . n 
F  6  177  GLU 177  176  ?    ?   ?   D . n 
G  7  1    MET 1    0    ?    ?   ?   E . n 
G  7  2    PRO 2    1    1    PRO PRO E . n 
G  7  3    ARG 3    2    2    ARG ARG E . n 
G  7  4    VAL 4    3    3    VAL VAL E . n 
G  7  5    GLU 5    4    4    GLU GLU E . n 
G  7  6    LEU 6    5    5    LEU LEU E . n 
G  7  7    GLU 7    6    6    GLU GLU E . n 
G  7  8    ILE 8    7    7    ILE ILE E . n 
G  7  9    PRO 9    8    8    PRO PRO E . n 
G  7  10   GLU 10   9    9    GLU GLU E . n 
G  7  11   ASP 11   10   10   ASP ASP E . n 
G  7  12   VAL 12   11   11   VAL VAL E . n 
G  7  13   ASP 13   12   12   ASP ASP E . n 
G  7  14   ALA 14   13   13   ALA ALA E . n 
G  7  15   GLU 15   14   14   GLU GLU E . n 
G  7  16   GLN 16   15   15   GLN GLN E . n 
G  7  17   ASP 17   16   16   ASP ASP E . n 
G  7  18   HIS 18   17   17   HIS HIS E . n 
G  7  19   LEU 19   18   18   LEU LEU E . n 
G  7  20   ASP 20   19   19   ASP ASP E . n 
G  7  21   ILE 21   20   20   ILE ILE E . n 
G  7  22   THR 22   21   21   THR THR E . n 
G  7  23   VAL 23   22   22   VAL VAL E . n 
G  7  24   GLU 24   23   23   GLU GLU E . n 
G  7  25   GLY 25   24   24   GLY GLY E . n 
G  7  26   ASP 26   25   25   ASP ASP E . n 
G  7  27   ASN 27   26   26   ASN ASN E . n 
G  7  28   GLY 28   27   27   GLY GLY E . n 
G  7  29   SER 29   28   28   SER SER E . n 
G  7  30   VAL 30   29   29   VAL VAL E . n 
G  7  31   THR 31   30   30   THR THR E . n 
G  7  32   ARG 32   31   31   ARG ARG E . n 
G  7  33   ARG 33   32   32   ARG ARG E . n 
G  7  34   LEU 34   33   33   LEU LEU E . n 
G  7  35   TRP 35   34   34   TRP TRP E . n 
G  7  36   TYR 36   35   35   TYR TYR E . n 
G  7  37   PRO 37   36   36   PRO PRO E . n 
G  7  38   ASP 38   37   37   ASP ASP E . n 
G  7  39   ILE 39   38   38   ILE ILE E . n 
G  7  40   ASP 40   39   39   ASP ASP E . n 
G  7  41   VAL 41   40   40   VAL VAL E . n 
G  7  42   SER 42   41   41   SER SER E . n 
G  7  43   VAL 43   42   42   VAL VAL E . n 
G  7  44   ASP 44   43   43   ASP ASP E . n 
G  7  45   GLY 45   44   44   GLY GLY E . n 
G  7  46   ASP 46   45   45   ASP ASP E . n 
G  7  47   THR 47   46   46   THR THR E . n 
G  7  48   VAL 48   47   47   VAL VAL E . n 
G  7  49   VAL 49   48   48   VAL VAL E . n 
G  7  50   ILE 50   49   49   ILE ILE E . n 
G  7  51   GLU 51   50   50   GLU GLU E . n 
G  7  52   SER 52   51   51   SER SER E . n 
G  7  53   ASP 53   52   52   ASP ASP E . n 
G  7  54   GLU 54   53   53   GLU GLU E . n 
G  7  55   ASP 55   54   54   ASP ASP E . n 
G  7  56   ASN 56   55   55   ASN ASN E . n 
G  7  57   ALA 57   56   56   ALA ALA E . n 
G  7  58   LYS 58   57   57   LYS LYS E . n 
G  7  59   THR 59   58   58   THR THR E . n 
G  7  60   MET 60   59   59   MET MET E . n 
G  7  61   SER 61   60   60   SER SER E . n 
G  7  62   THR 62   61   61   THR THR E . n 
G  7  63   ILE 63   62   62   ILE ILE E . n 
G  7  64   GLY 64   63   63   GLY GLY E . n 
G  7  65   THR 65   64   64   THR THR E . n 
G  7  66   PHE 66   65   65   PHE PHE E . n 
G  7  67   GLN 67   66   66   GLN GLN E . n 
G  7  68   SER 68   67   67   SER SER E . n 
G  7  69   HIS 69   68   68   HIS HIS E . n 
G  7  70   ILE 70   69   69   ILE ILE E . n 
G  7  71   GLU 71   70   70   GLU GLU E . n 
G  7  72   ASN 72   71   71   ASN ASN E . n 
G  7  73   MET 73   72   72   MET MET E . n 
G  7  74   PHE 74   73   73   PHE PHE E . n 
G  7  75   HIS 75   74   74   HIS HIS E . n 
G  7  76   GLY 76   75   75   GLY GLY E . n 
G  7  77   VAL 77   76   76   VAL VAL E . n 
G  7  78   THR 78   77   77   THR THR E . n 
G  7  79   GLU 79   78   78   GLU GLU E . n 
G  7  80   GLY 80   79   79   GLY GLY E . n 
G  7  81   TRP 81   80   80   TRP TRP E . n 
G  7  82   GLU 82   81   81   GLU GLU E . n 
G  7  83   TYR 83   82   82   TYR TYR E . n 
G  7  84   GLY 84   83   83   GLY GLY E . n 
G  7  85   MET 85   84   84   MET MET E . n 
G  7  86   GLU 86   85   85   GLU GLU E . n 
G  7  87   VAL 87   86   86   VAL VAL E . n 
G  7  88   PHE 88   87   87   PHE PHE E . n 
G  7  89   TYR 89   88   88   TYR TYR E . n 
G  7  90   SER 90   89   89   SER SER E . n 
G  7  91   HIS 91   90   90   HIS HIS E . n 
G  7  92   PHE 92   91   91   PHE PHE E . n 
G  7  93   PRO 93   92   92   PRO PRO E . n 
G  7  94   MET 94   93   93   MET MET E . n 
G  7  95   GLN 95   94   94   GLN GLN E . n 
G  7  96   VAL 96   95   95   VAL VAL E . n 
G  7  97   ASN 97   96   96   ASN ASN E . n 
G  7  98   VAL 98   97   97   VAL VAL E . n 
G  7  99   GLU 99   98   98   GLU GLU E . n 
G  7  100  GLY 100  99   99   GLY GLY E . n 
G  7  101  ASP 101  100  100  ASP ASP E . n 
G  7  102  GLU 102  101  101  GLU GLU E . n 
G  7  103  VAL 103  102  102  VAL VAL E . n 
G  7  104  VAL 104  103  103  VAL VAL E . n 
G  7  105  ILE 105  104  104  ILE ILE E . n 
G  7  106  GLU 106  105  105  GLU GLU E . n 
G  7  107  ASN 107  106  106  ASN ASN E . n 
G  7  108  PHE 108  107  107  PHE PHE E . n 
G  7  109  LEU 109  108  108  LEU LEU E . n 
G  7  110  GLY 110  109  109  GLY GLY E . n 
G  7  111  GLU 111  110  110  GLU GLU E . n 
G  7  112  LYS 112  111  111  LYS LYS E . n 
G  7  113  ALA 113  112  112  ALA ALA E . n 
G  7  114  PRO 114  113  113  PRO PRO E . n 
G  7  115  ARG 115  114  114  ARG ARG E . n 
G  7  116  ARG 116  115  115  ARG ARG E . n 
G  7  117  THR 117  116  116  THR THR E . n 
G  7  118  THR 118  117  117  THR THR E . n 
G  7  119  ILE 119  118  118  ILE ILE E . n 
G  7  120  HIS 120  119  119  HIS HIS E . n 
G  7  121  GLY 121  120  120  GLY GLY E . n 
G  7  122  ASP 122  121  121  ASP ASP E . n 
G  7  123  THR 123  122  122  THR THR E . n 
G  7  124  ASP 124  123  123  ASP ASP E . n 
G  7  125  VAL 125  124  124  VAL VAL E . n 
G  7  126  GLU 126  125  125  GLU GLU E . n 
G  7  127  ILE 127  126  126  ILE ILE E . n 
G  7  128  ASP 128  127  127  ASP ASP E . n 
G  7  129  GLY 129  128  128  GLY GLY E . n 
G  7  130  GLU 130  129  129  GLU GLU E . n 
G  7  131  GLU 131  130  130  GLU GLU E . n 
G  7  132  LEU 132  131  131  LEU LEU E . n 
G  7  133  THR 133  132  132  THR THR E . n 
G  7  134  VAL 134  133  133  VAL VAL E . n 
G  7  135  SER 135  134  134  SER SER E . n 
G  7  136  GLY 136  135  135  GLY GLY E . n 
G  7  137  PRO 137  136  136  PRO PRO E . n 
G  7  138  ASP 138  137  137  ASP ASP E . n 
G  7  139  ILE 139  138  138  ILE ILE E . n 
G  7  140  GLU 140  139  139  GLU GLU E . n 
G  7  141  ALA 141  140  140  ALA ALA E . n 
G  7  142  VAL 142  141  141  VAL VAL E . n 
G  7  143  GLY 143  142  142  GLY GLY E . n 
G  7  144  GLN 144  143  143  GLN GLN E . n 
G  7  145  THR 145  144  144  THR THR E . n 
G  7  146  ALA 146  145  145  ALA ALA E . n 
G  7  147  ALA 147  146  146  ALA ALA E . n 
G  7  148  ASP 148  147  147  ASP ASP E . n 
G  7  149  ILE 149  148  148  ILE ILE E . n 
G  7  150  GLU 150  149  149  GLU GLU E . n 
G  7  151  GLN 151  150  150  GLN GLN E . n 
G  7  152  LEU 152  151  151  LEU LEU E . n 
G  7  153  THR 153  152  152  THR THR E . n 
G  7  154  ARG 154  153  153  ARG ARG E . n 
G  7  155  ILE 155  154  154  ILE ILE E . n 
G  7  156  ASN 156  155  155  ASN ASN E . n 
G  7  157  ASP 157  156  156  ASP ASP E . n 
G  7  158  LYS 158  157  157  LYS LYS E . n 
G  7  159  ASP 159  158  158  ASP ASP E . n 
G  7  160  VAL 160  159  159  VAL VAL E . n 
G  7  161  ARG 161  160  160  ARG ARG E . n 
G  7  162  VAL 162  161  161  VAL VAL E . n 
G  7  163  PHE 163  162  162  PHE PHE E . n 
G  7  164  GLN 164  163  163  GLN GLN E . n 
G  7  165  ASP 165  164  164  ASP ASP E . n 
G  7  166  GLY 166  165  165  GLY GLY E . n 
G  7  167  VAL 167  166  166  VAL VAL E . n 
G  7  168  TYR 168  167  167  TYR TYR E . n 
G  7  169  ILE 169  168  168  ILE ILE E . n 
G  7  170  THR 170  169  169  THR THR E . n 
G  7  171  ARG 171  170  170  ARG ARG E . n 
G  7  172  LYS 172  171  171  LYS LYS E . n 
G  7  173  PRO 173  172  172  PRO PRO E . n 
G  7  174  ASN 174  173  ?    ?   ?   E . n 
G  7  175  ARG 175  174  ?    ?   ?   E . n 
G  7  176  GLY 176  175  ?    ?   ?   E . n 
G  7  177  ASP 177  176  ?    ?   ?   E . n 
G  7  178  ALA 178  177  ?    ?   ?   E . n 
H  8  1    MET 1    0    ?    ?   ?   F . n 
H  8  2    PRO 2    1    1    PRO PRO F . n 
H  8  3    VAL 3    2    2    VAL VAL F . n 
H  8  4    TYR 4    3    3    TYR TYR F . n 
H  8  5    VAL 5    4    4    VAL VAL F . n 
H  8  6    ASP 6    5    5    ASP ASP F . n 
H  8  7    PHE 7    6    6    PHE PHE F . n 
H  8  8    ASP 8    7    7    ASP ASP F . n 
H  8  9    VAL 9    8    8    VAL VAL F . n 
H  8  10   PRO 10   9    9    PRO PRO F . n 
H  8  11   ALA 11   10   10   ALA ALA F . n 
H  8  12   ASP 12   11   11   ASP ASP F . n 
H  8  13   LEU 13   12   12   LEU LEU F . n 
H  8  14   GLU 14   13   13   GLU GLU F . n 
H  8  15   ASP 15   14   14   ASP ASP F . n 
H  8  16   ASP 16   15   15   ASP ASP F . n 
H  8  17   ALA 17   16   16   ALA ALA F . n 
H  8  18   LEU 18   17   17   LEU LEU F . n 
H  8  19   GLU 19   18   18   GLU GLU F . n 
H  8  20   ALA 20   19   19   ALA ALA F . n 
H  8  21   LEU 21   20   20   LEU LEU F . n 
H  8  22   GLU 22   21   21   GLU GLU F . n 
H  8  23   VAL 23   22   22   VAL VAL F . n 
H  8  24   ALA 24   23   23   ALA ALA F . n 
H  8  25   ARG 25   24   24   ARG ARG F . n 
H  8  26   ASP 26   25   25   ASP ASP F . n 
H  8  27   THR 27   26   26   THR THR F . n 
H  8  28   GLY 28   27   27   GLY GLY F . n 
H  8  29   ALA 29   28   28   ALA ALA F . n 
H  8  30   VAL 30   29   29   VAL VAL F . n 
H  8  31   LYS 31   30   30   LYS LYS F . n 
H  8  32   LYS 32   31   31   LYS LYS F . n 
H  8  33   GLY 33   32   32   GLY GLY F . n 
H  8  34   THR 34   33   33   THR THR F . n 
H  8  35   ASN 35   34   34   ASN ASN F . n 
H  8  36   GLU 36   35   35   GLU GLU F . n 
H  8  37   THR 37   36   36   THR THR F . n 
H  8  38   THR 38   37   37   THR THR F . n 
H  8  39   LYS 39   38   38   LYS LYS F . n 
H  8  40   SER 40   39   39   SER SER F . n 
H  8  41   ILE 41   40   40   ILE ILE F . n 
H  8  42   GLU 42   41   41   GLU GLU F . n 
H  8  43   ARG 43   42   42   ARG ARG F . n 
H  8  44   GLY 44   43   43   GLY GLY F . n 
H  8  45   SER 45   44   44   SER SER F . n 
H  8  46   ALA 46   45   45   ALA ALA F . n 
H  8  47   GLU 47   46   46   GLU GLU F . n 
H  8  48   LEU 48   47   47   LEU LEU F . n 
H  8  49   VAL 49   48   48   VAL VAL F . n 
H  8  50   PHE 50   49   49   PHE PHE F . n 
H  8  51   VAL 51   50   50   VAL VAL F . n 
H  8  52   ALA 52   51   51   ALA ALA F . n 
H  8  53   GLU 53   52   52   GLU GLU F . n 
H  8  54   ASP 54   53   53   ASP ASP F . n 
H  8  55   VAL 55   54   54   VAL VAL F . n 
H  8  56   GLN 56   55   55   GLN GLN F . n 
H  8  57   PRO 57   56   56   PRO PRO F . n 
H  8  58   GLU 58   57   57   GLU GLU F . n 
H  8  59   GLU 59   58   58   GLU GLU F . n 
H  8  60   ILE 60   59   59   ILE ILE F . n 
H  8  61   VAL 61   60   60   VAL VAL F . n 
H  8  62   MET 62   61   61   MET MET F . n 
H  8  63   HIS 63   62   62   HIS HIS F . n 
H  8  64   ILE 64   63   63   ILE ILE F . n 
H  8  65   PRO 65   64   64   PRO PRO F . n 
H  8  66   GLU 66   65   65   GLU GLU F . n 
H  8  67   LEU 67   66   66   LEU LEU F . n 
H  8  68   ALA 68   67   67   ALA ALA F . n 
H  8  69   ASP 69   68   68   ASP ASP F . n 
H  8  70   GLU 70   69   69   GLU GLU F . n 
H  8  71   LYS 71   70   70   LYS LYS F . n 
H  8  72   GLY 72   71   71   GLY GLY F . n 
H  8  73   VAL 73   72   72   VAL VAL F . n 
H  8  74   PRO 74   73   73   PRO PRO F . n 
H  8  75   PHE 75   74   74   PHE PHE F . n 
H  8  76   ILE 76   75   75   ILE ILE F . n 
H  8  77   PHE 77   76   76   PHE PHE F . n 
H  8  78   VAL 78   77   77   VAL VAL F . n 
H  8  79   GLU 79   78   78   GLU GLU F . n 
H  8  80   GLN 80   79   79   GLN GLN F . n 
H  8  81   GLN 81   80   80   GLN GLN F . n 
H  8  82   ASP 82   81   81   ASP ASP F . n 
H  8  83   ASP 83   82   82   ASP ASP F . n 
H  8  84   LEU 84   83   83   LEU LEU F . n 
H  8  85   GLY 85   84   84   GLY GLY F . n 
H  8  86   HIS 86   85   85   HIS HIS F . n 
H  8  87   ALA 87   86   86   ALA ALA F . n 
H  8  88   ALA 88   87   87   ALA ALA F . n 
H  8  89   GLY 89   88   88   GLY GLY F . n 
H  8  90   LEU 90   89   89   LEU LEU F . n 
H  8  91   GLU 91   90   90   GLU GLU F . n 
H  8  92   VAL 92   91   91   VAL VAL F . n 
H  8  93   GLY 93   92   92   GLY GLY F . n 
H  8  94   SER 94   93   93   SER SER F . n 
H  8  95   ALA 95   94   94   ALA ALA F . n 
H  8  96   ALA 96   95   95   ALA ALA F . n 
H  8  97   ALA 97   96   96   ALA ALA F . n 
H  8  98   ALA 98   97   97   ALA ALA F . n 
H  8  99   VAL 99   98   98   VAL VAL F . n 
H  8  100  THR 100  99   99   THR THR F . n 
H  8  101  ASP 101  100  100  ASP ASP F . n 
H  8  102  ALA 102  101  101  ALA ALA F . n 
H  8  103  GLY 103  102  102  GLY GLY F . n 
H  8  104  GLU 104  103  103  GLU GLU F . n 
H  8  105  ALA 105  104  104  ALA ALA F . n 
H  8  106  ASP 106  105  105  ASP ASP F . n 
H  8  107  ALA 107  106  106  ALA ALA F . n 
H  8  108  ASP 108  107  107  ASP ASP F . n 
H  8  109  VAL 109  108  108  VAL VAL F . n 
H  8  110  GLU 110  109  109  GLU GLU F . n 
H  8  111  ASP 111  110  110  ASP ASP F . n 
H  8  112  ILE 112  111  111  ILE ILE F . n 
H  8  113  ALA 113  112  112  ALA ALA F . n 
H  8  114  ASP 114  113  113  ASP ASP F . n 
H  8  115  LYS 115  114  114  LYS LYS F . n 
H  8  116  VAL 116  115  115  VAL VAL F . n 
H  8  117  GLU 117  116  116  GLU GLU F . n 
H  8  118  GLU 118  117  117  GLU GLU F . n 
H  8  119  LEU 119  118  118  LEU LEU F . n 
H  8  120  ARG 120  119  119  ARG ARG F . n 
I  9  1    MET 1    1    ?    ?   ?   G . n 
I  9  2    SER 2    2    ?    ?   ?   G . n 
I  9  3    ALA 3    3    ?    ?   ?   G . n 
I  9  4    GLU 4    4    ?    ?   ?   G . n 
I  9  5    SER 5    5    ?    ?   ?   G . n 
I  9  6    GLU 6    6    ?    ?   ?   G . n 
I  9  7    ARG 7    7    ?    ?   ?   G . n 
I  9  8    LYS 8    8    ?    ?   ?   G . n 
I  9  9    THR 9    9    ?    ?   ?   G . n 
I  9  10   GLU 10   10   ?    ?   ?   G . n 
I  9  11   THR 11   11   ?    ?   ?   G . n 
I  9  12   ILE 12   12   12   ILE ILE G . n 
I  9  13   PRO 13   13   13   PRO PRO G . n 
I  9  14   GLU 14   14   14   GLU GLU G . n 
I  9  15   TRP 15   15   15   TRP TRP G . n 
I  9  16   LYS 16   16   16   LYS LYS G . n 
I  9  17   GLN 17   17   17   GLN GLN G . n 
I  9  18   GLU 18   18   18   GLU GLU G . n 
I  9  19   GLU 19   19   19   GLU GLU G . n 
I  9  20   VAL 20   20   20   VAL VAL G . n 
I  9  21   ASP 21   21   21   ASP ASP G . n 
I  9  22   ALA 22   22   22   ALA ALA G . n 
I  9  23   ILE 23   23   23   ILE ILE G . n 
I  9  24   VAL 24   24   24   VAL VAL G . n 
I  9  25   GLU 25   25   25   GLU GLU G . n 
I  9  26   MET 26   26   26   MET MET G . n 
I  9  27   ILE 27   27   27   ILE ILE G . n 
I  9  28   GLU 28   28   28   GLU GLU G . n 
I  9  29   SER 29   29   29   SER SER G . n 
I  9  30   TYR 30   30   ?    ?   ?   G . n 
I  9  31   GLU 31   31   ?    ?   ?   G . n 
I  9  32   SER 32   32   ?    ?   ?   G . n 
I  9  33   VAL 33   33   ?    ?   ?   G . n 
I  9  34   GLY 34   34   ?    ?   ?   G . n 
I  9  35   VAL 35   35   ?    ?   ?   G . n 
I  9  36   VAL 36   36   ?    ?   ?   G . n 
I  9  37   ASN 37   37   ?    ?   ?   G . n 
I  9  38   ILE 38   38   ?    ?   ?   G . n 
I  9  39   ALA 39   39   ?    ?   ?   G . n 
I  9  40   GLY 40   40   ?    ?   ?   G . n 
I  9  41   ILE 41   41   ?    ?   ?   G . n 
I  9  42   PRO 42   42   ?    ?   ?   G . n 
I  9  43   SER 43   43   ?    ?   ?   G . n 
I  9  44   ARG 44   44   ?    ?   ?   G . n 
I  9  45   GLN 45   45   ?    ?   ?   G . n 
I  9  46   LEU 46   46   ?    ?   ?   G . n 
I  9  47   GLN 47   47   ?    ?   ?   G . n 
I  9  48   ASP 48   48   ?    ?   ?   G . n 
I  9  49   MET 49   49   ?    ?   ?   G . n 
I  9  50   ARG 50   50   ?    ?   ?   G . n 
I  9  51   ARG 51   51   ?    ?   ?   G . n 
I  9  52   ASP 52   52   ?    ?   ?   G . n 
I  9  53   LEU 53   53   ?    ?   ?   G . n 
I  9  54   HIS 54   54   ?    ?   ?   G . n 
I  9  55   GLY 55   55   ?    ?   ?   G . n 
I  9  56   THR 56   56   ?    ?   ?   G . n 
I  9  57   ALA 57   57   ?    ?   ?   G . n 
I  9  58   GLU 58   58   ?    ?   ?   G . n 
I  9  59   LEU 59   59   ?    ?   ?   G . n 
I  9  60   ARG 60   60   ?    ?   ?   G . n 
I  9  61   VAL 61   61   ?    ?   ?   G . n 
I  9  62   SER 62   62   ?    ?   ?   G . n 
I  9  63   ARG 63   63   63   ARG ARG G . n 
I  9  64   ASN 64   64   64   ASN ASN G . n 
I  9  65   THR 65   65   65   THR THR G . n 
I  9  66   LEU 66   66   66   LEU LEU G . n 
I  9  67   LEU 67   67   67   LEU LEU G . n 
I  9  68   GLU 68   68   68   GLU GLU G . n 
I  9  69   ARG 69   69   69   ARG ARG G . n 
I  9  70   ALA 70   70   70   ALA ALA G . n 
I  9  71   LEU 71   71   71   LEU LEU G . n 
I  9  72   ASP 72   72   72   ASP ASP G . n 
I  9  73   ASP 73   73   73   ASP ASP G . n 
I  9  74   VAL 74   74   ?    ?   ?   G . n 
I  9  75   ASP 75   75   ?    ?   ?   G . n 
I  9  76   ASP 76   76   ?    ?   ?   G . n 
I  9  77   GLY 77   77   ?    ?   ?   G . n 
I  9  78   LEU 78   78   ?    ?   ?   G . n 
I  9  79   GLU 79   79   ?    ?   ?   G . n 
I  9  80   ASP 80   80   ?    ?   ?   G . n 
I  9  81   LEU 81   81   ?    ?   ?   G . n 
I  9  82   ASN 82   82   ?    ?   ?   G . n 
I  9  83   GLY 83   83   ?    ?   ?   G . n 
I  9  84   TYR 84   84   ?    ?   ?   G . n 
I  9  85   ILE 85   85   ?    ?   ?   G . n 
I  9  86   THR 86   86   ?    ?   ?   G . n 
I  9  87   GLY 87   87   ?    ?   ?   G . n 
I  9  88   GLN 88   88   ?    ?   ?   G . n 
I  9  89   VAL 89   89   ?    ?   ?   G . n 
I  9  90   GLY 90   90   ?    ?   ?   G . n 
I  9  91   LEU 91   91   ?    ?   ?   G . n 
I  9  92   ILE 92   92   ?    ?   ?   G . n 
I  9  93   GLY 93   93   ?    ?   ?   G . n 
I  9  94   THR 94   94   ?    ?   ?   G . n 
I  9  95   ASP 95   95   ?    ?   ?   G . n 
I  9  96   ASP 96   96   ?    ?   ?   G . n 
I  9  97   ASN 97   97   ?    ?   ?   G . n 
I  9  98   PRO 98   98   ?    ?   ?   G . n 
I  9  99   PHE 99   99   ?    ?   ?   G . n 
I  9  100  SER 100  100  ?    ?   ?   G . n 
I  9  101  LEU 101  101  ?    ?   ?   G . n 
I  9  102  PHE 102  102  ?    ?   ?   G . n 
I  9  103  GLN 103  103  ?    ?   ?   G . n 
I  9  104  GLU 104  104  ?    ?   ?   G . n 
I  9  105  LEU 105  105  ?    ?   ?   G . n 
I  9  106  GLU 106  106  ?    ?   ?   G . n 
I  9  107  ALA 107  107  ?    ?   ?   G . n 
I  9  108  SER 108  108  ?    ?   ?   G . n 
I  9  109  LYS 109  109  ?    ?   ?   G . n 
I  9  110  THR 110  110  ?    ?   ?   G . n 
I  9  111  PRO 111  111  ?    ?   ?   G . n 
I  9  112  ALA 112  112  ?    ?   ?   G . n 
I  9  113  PRO 113  113  ?    ?   ?   G . n 
I  9  114  ILE 114  114  ?    ?   ?   G . n 
I  9  115  GLY 115  115  ?    ?   ?   G . n 
I  9  116  ALA 116  116  ?    ?   ?   G . n 
I  9  117  GLY 117  117  ?    ?   ?   G . n 
I  9  118  GLU 118  118  ?    ?   ?   G . n 
I  9  119  VAL 119  119  ?    ?   ?   G . n 
I  9  120  ALA 120  120  ?    ?   ?   G . n 
I  9  121  PRO 121  121  ?    ?   ?   G . n 
I  9  122  ASN 122  122  ?    ?   ?   G . n 
I  9  123  ASP 123  123  ?    ?   ?   G . n 
I  9  124  ILE 124  124  ?    ?   ?   G . n 
I  9  125  VAL 125  125  ?    ?   ?   G . n 
I  9  126  ILE 126  126  ?    ?   ?   G . n 
I  9  127  PRO 127  127  ?    ?   ?   G . n 
I  9  128  GLU 128  128  ?    ?   ?   G . n 
I  9  129  GLY 129  129  ?    ?   ?   G . n 
I  9  130  ASP 130  130  ?    ?   ?   G . n 
I  9  131  THR 131  131  ?    ?   ?   G . n 
I  9  132  GLY 132  132  ?    ?   ?   G . n 
I  9  133  VAL 133  133  ?    ?   ?   G . n 
I  9  134  ASP 134  134  ?    ?   ?   G . n 
I  9  135  PRO 135  135  ?    ?   ?   G . n 
I  9  136  GLY 136  136  ?    ?   ?   G . n 
I  9  137  PRO 137  137  ?    ?   ?   G . n 
I  9  138  PHE 138  138  ?    ?   ?   G . n 
I  9  139  VAL 139  139  ?    ?   ?   G . n 
I  9  140  GLY 140  140  ?    ?   ?   G . n 
I  9  141  GLU 141  141  ?    ?   ?   G . n 
I  9  142  LEU 142  142  ?    ?   ?   G . n 
I  9  143  GLN 143  143  ?    ?   ?   G . n 
I  9  144  SER 144  144  ?    ?   ?   G . n 
I  9  145  VAL 145  145  ?    ?   ?   G . n 
I  9  146  GLY 146  146  ?    ?   ?   G . n 
I  9  147  ALA 147  147  ?    ?   ?   G . n 
I  9  148  ASP 148  148  ?    ?   ?   G . n 
I  9  149  ALA 149  149  ?    ?   ?   G . n 
I  9  150  ARG 150  150  ?    ?   ?   G . n 
I  9  151  ILE 151  151  ?    ?   ?   G . n 
I  9  152  GLN 152  152  ?    ?   ?   G . n 
I  9  153  GLU 153  153  ?    ?   ?   G . n 
I  9  154  GLY 154  154  ?    ?   ?   G . n 
I  9  155  SER 155  155  ?    ?   ?   G . n 
I  9  156  ILE 156  156  ?    ?   ?   G . n 
I  9  157  GLN 157  157  ?    ?   ?   G . n 
I  9  158  VAL 158  158  ?    ?   ?   G . n 
I  9  159  LEU 159  159  ?    ?   ?   G . n 
I  9  160  SER 160  160  ?    ?   ?   G . n 
I  9  161  ASP 161  161  ?    ?   ?   G . n 
I  9  162  SER 162  162  ?    ?   ?   G . n 
I  9  163  THR 163  163  ?    ?   ?   G . n 
I  9  164  VAL 164  164  ?    ?   ?   G . n 
I  9  165  LEU 165  165  ?    ?   ?   G . n 
I  9  166  ASP 166  166  ?    ?   ?   G . n 
I  9  167  THR 167  167  ?    ?   ?   G . n 
I  9  168  GLY 168  168  ?    ?   ?   G . n 
I  9  169  GLU 169  169  ?    ?   ?   G . n 
I  9  170  GLU 170  170  ?    ?   ?   G . n 
I  9  171  VAL 171  171  ?    ?   ?   G . n 
I  9  172  SER 172  172  ?    ?   ?   G . n 
I  9  173  GLN 173  173  ?    ?   ?   G . n 
I  9  174  GLU 174  174  ?    ?   ?   G . n 
I  9  175  LEU 175  175  ?    ?   ?   G . n 
I  9  176  SER 176  176  ?    ?   ?   G . n 
I  9  177  ASN 177  177  ?    ?   ?   G . n 
I  9  178  VAL 178  178  ?    ?   ?   G . n 
I  9  179  LEU 179  179  ?    ?   ?   G . n 
I  9  180  ASN 180  180  ?    ?   ?   G . n 
I  9  181  GLU 181  181  ?    ?   ?   G . n 
I  9  182  LEU 182  182  ?    ?   ?   G . n 
I  9  183  GLY 183  183  ?    ?   ?   G . n 
I  9  184  ILE 184  184  ?    ?   ?   G . n 
I  9  185  GLU 185  185  ?    ?   ?   G . n 
I  9  186  PRO 186  186  ?    ?   ?   G . n 
I  9  187  LYS 187  187  ?    ?   ?   G . n 
I  9  188  GLU 188  188  ?    ?   ?   G . n 
I  9  189  VAL 189  189  ?    ?   ?   G . n 
I  9  190  GLY 190  190  ?    ?   ?   G . n 
I  9  191  LEU 191  191  ?    ?   ?   G . n 
I  9  192  ASP 192  192  ?    ?   ?   G . n 
I  9  193  LEU 193  193  ?    ?   ?   G . n 
I  9  194  ARG 194  194  ?    ?   ?   G . n 
I  9  195  ALA 195  195  ?    ?   ?   G . n 
I  9  196  VAL 196  196  ?    ?   ?   G . n 
I  9  197  PHE 197  197  ?    ?   ?   G . n 
I  9  198  ALA 198  198  ?    ?   ?   G . n 
I  9  199  ASP 199  199  ?    ?   ?   G . n 
I  9  200  GLY 200  200  ?    ?   ?   G . n 
I  9  201  VAL 201  201  ?    ?   ?   G . n 
I  9  202  LEU 202  202  ?    ?   ?   G . n 
I  9  203  PHE 203  203  ?    ?   ?   G . n 
I  9  204  GLU 204  204  ?    ?   ?   G . n 
I  9  205  PRO 205  205  ?    ?   ?   G . n 
I  9  206  GLU 206  206  ?    ?   ?   G . n 
I  9  207  GLU 207  207  ?    ?   ?   G . n 
I  9  208  LEU 208  208  ?    ?   ?   G . n 
I  9  209  GLU 209  209  ?    ?   ?   G . n 
I  9  210  LEU 210  210  ?    ?   ?   G . n 
I  9  211  ASP 211  211  ?    ?   ?   G . n 
I  9  212  ILE 212  212  ?    ?   ?   G . n 
I  9  213  ASP 213  213  ?    ?   ?   G . n 
I  9  214  GLU 214  214  ?    ?   ?   G . n 
I  9  215  TYR 215  215  ?    ?   ?   G . n 
I  9  216  ARG 216  216  ?    ?   ?   G . n 
I  9  217  SER 217  217  ?    ?   ?   G . n 
I  9  218  ASP 218  218  ?    ?   ?   G . n 
I  9  219  ILE 219  219  ?    ?   ?   G . n 
I  9  220  GLN 220  220  ?    ?   ?   G . n 
I  9  221  ALA 221  221  ?    ?   ?   G . n 
I  9  222  ALA 222  222  ?    ?   ?   G . n 
I  9  223  ALA 223  223  ?    ?   ?   G . n 
I  9  224  GLY 224  224  ?    ?   ?   G . n 
I  9  225  ARG 225  225  ?    ?   ?   G . n 
I  9  226  ALA 226  226  ?    ?   ?   G . n 
I  9  227  PHE 227  227  ?    ?   ?   G . n 
I  9  228  ASN 228  228  ?    ?   ?   G . n 
I  9  229  LEU 229  229  ?    ?   ?   G . n 
I  9  230  SER 230  230  ?    ?   ?   G . n 
I  9  231  VAL 231  231  ?    ?   ?   G . n 
I  9  232  ASN 232  232  ?    ?   ?   G . n 
I  9  233  ALA 233  233  ?    ?   ?   G . n 
I  9  234  ASP 234  234  ?    ?   ?   G . n 
I  9  235  TYR 235  235  ?    ?   ?   G . n 
I  9  236  PRO 236  236  ?    ?   ?   G . n 
I  9  237  THR 237  237  ?    ?   ?   G . n 
I  9  238  ALA 238  238  ?    ?   ?   G . n 
I  9  239  THR 239  239  ?    ?   ?   G . n 
I  9  240  THR 240  240  ?    ?   ?   G . n 
I  9  241  ALA 241  241  ?    ?   ?   G . n 
I  9  242  PRO 242  242  ?    ?   ?   G . n 
I  9  243  THR 243  243  ?    ?   ?   G . n 
I  9  244  MET 244  244  ?    ?   ?   G . n 
I  9  245  LEU 245  245  ?    ?   ?   G . n 
I  9  246  GLN 246  246  ?    ?   ?   G . n 
I  9  247  SER 247  247  ?    ?   ?   G . n 
I  9  248  ASP 248  248  ?    ?   ?   G . n 
I  9  249  ARG 249  249  ?    ?   ?   G . n 
I  9  250  GLY 250  250  ?    ?   ?   G . n 
I  9  251  ASN 251  251  ?    ?   ?   G . n 
I  9  252  ALA 252  252  ?    ?   ?   G . n 
I  9  253  LYS 253  253  ?    ?   ?   G . n 
I  9  254  SER 254  254  ?    ?   ?   G . n 
I  9  255  LEU 255  255  ?    ?   ?   G . n 
I  9  256  ALA 256  256  ?    ?   ?   G . n 
I  9  257  LEU 257  257  ?    ?   ?   G . n 
I  9  258  GLN 258  258  ?    ?   ?   G . n 
I  9  259  ALA 259  259  ?    ?   ?   G . n 
I  9  260  ALA 260  260  ?    ?   ?   G . n 
I  9  261  ILE 261  261  ?    ?   ?   G . n 
I  9  262  GLU 262  262  ?    ?   ?   G . n 
I  9  263  ASP 263  263  ?    ?   ?   G . n 
I  9  264  PRO 264  264  ?    ?   ?   G . n 
I  9  265  GLU 265  265  ?    ?   ?   G . n 
I  9  266  VAL 266  266  ?    ?   ?   G . n 
I  9  267  VAL 267  267  ?    ?   ?   G . n 
I  9  268  PRO 268  268  ?    ?   ?   G . n 
I  9  269  ASP 269  269  ?    ?   ?   G . n 
I  9  270  LEU 270  270  ?    ?   ?   G . n 
I  9  271  VAL 271  271  ?    ?   ?   G . n 
I  9  272  SER 272  272  ?    ?   ?   G . n 
I  9  273  LYS 273  273  ?    ?   ?   G . n 
I  9  274  ALA 274  274  ?    ?   ?   G . n 
I  9  275  ASP 275  275  ?    ?   ?   G . n 
I  9  276  ALA 276  276  ?    ?   ?   G . n 
I  9  277  GLN 277  277  ?    ?   ?   G . n 
I  9  278  VAL 278  278  ?    ?   ?   G . n 
I  9  279  ARG 279  279  ?    ?   ?   G . n 
I  9  280  ALA 280  280  ?    ?   ?   G . n 
I  9  281  LEU 281  281  ?    ?   ?   G . n 
I  9  282  ALA 282  282  ?    ?   ?   G . n 
I  9  283  SER 283  283  ?    ?   ?   G . n 
I  9  284  GLN 284  284  ?    ?   ?   G . n 
I  9  285  ILE 285  285  ?    ?   ?   G . n 
I  9  286  ASP 286  286  ?    ?   ?   G . n 
I  9  287  ASP 287  287  ?    ?   ?   G . n 
I  9  288  GLU 288  288  ?    ?   ?   G . n 
I  9  289  GLU 289  289  ?    ?   ?   G . n 
I  9  290  ALA 290  290  ?    ?   ?   G . n 
I  9  291  LEU 291  291  ?    ?   ?   G . n 
I  9  292  PRO 292  292  ?    ?   ?   G . n 
I  9  293  GLU 293  293  ?    ?   ?   G . n 
I  9  294  GLU 294  294  ?    ?   ?   G . n 
I  9  295  LEU 295  295  ?    ?   ?   G . n 
I  9  296  GLN 296  296  ?    ?   ?   G . n 
I  9  297  GLY 297  297  ?    ?   ?   G . n 
I  9  298  VAL 298  298  ?    ?   ?   G . n 
I  9  299  GLU 299  299  ?    ?   ?   G . n 
I  9  300  ALA 300  300  ?    ?   ?   G . n 
I  9  301  ASP 301  301  ?    ?   ?   G . n 
I  9  302  VAL 302  302  ?    ?   ?   G . n 
I  9  303  ALA 303  303  ?    ?   ?   G . n 
I  9  304  THR 304  304  ?    ?   ?   G . n 
I  9  305  GLU 305  305  ?    ?   ?   G . n 
I  9  306  GLU 306  306  ?    ?   ?   G . n 
I  9  307  PRO 307  307  ?    ?   ?   G . n 
I  9  308  THR 308  308  ?    ?   ?   G . n 
I  9  309  ASP 309  309  ?    ?   ?   G . n 
I  9  310  ASP 310  310  ?    ?   ?   G . n 
I  9  311  GLN 311  311  ?    ?   ?   G . n 
I  9  312  ASP 312  312  ?    ?   ?   G . n 
I  9  313  ASP 313  313  ?    ?   ?   G . n 
I  9  314  ASP 314  314  ?    ?   ?   G . n 
I  9  315  THR 315  315  ?    ?   ?   G . n 
I  9  316  ALA 316  316  ?    ?   ?   G . n 
I  9  317  SER 317  317  ?    ?   ?   G . n 
I  9  318  GLU 318  318  ?    ?   ?   G . n 
I  9  319  ASP 319  319  ?    ?   ?   G . n 
I  9  320  ASP 320  320  ?    ?   ?   G . n 
I  9  321  ALA 321  321  ?    ?   ?   G . n 
I  9  322  ASP 322  322  ?    ?   ?   G . n 
I  9  323  ALA 323  323  ?    ?   ?   G . n 
I  9  324  ASP 324  324  ?    ?   ?   G . n 
I  9  325  ASP 325  325  ?    ?   ?   G . n 
I  9  326  ALA 326  326  ?    ?   ?   G . n 
I  9  327  ALA 327  327  ?    ?   ?   G . n 
I  9  328  GLU 328  328  ?    ?   ?   G . n 
I  9  329  GLU 329  329  ?    ?   ?   G . n 
I  9  330  ALA 330  330  ?    ?   ?   G . n 
I  9  331  ASP 331  331  ?    ?   ?   G . n 
I  9  332  ASP 332  332  ?    ?   ?   G . n 
I  9  333  ASP 333  333  ?    ?   ?   G . n 
I  9  334  ASP 334  334  ?    ?   ?   G . n 
I  9  335  ASP 335  335  ?    ?   ?   G . n 
I  9  336  ASP 336  336  ?    ?   ?   G . n 
I  9  337  ASP 337  337  ?    ?   ?   G . n 
I  9  338  GLU 338  338  ?    ?   ?   G . n 
I  9  339  ASP 339  339  ?    ?   ?   G . n 
I  9  340  ALA 340  340  ?    ?   ?   G . n 
I  9  341  GLY 341  341  ?    ?   ?   G . n 
I  9  342  ASP 342  342  ?    ?   ?   G . n 
I  9  343  ALA 343  343  ?    ?   ?   G . n 
I  9  344  LEU 344  344  ?    ?   ?   G . n 
I  9  345  GLY 345  345  ?    ?   ?   G . n 
I  9  346  ALA 346  346  ?    ?   ?   G . n 
I  9  347  MET 347  347  ?    ?   ?   G . n 
I  9  348  PHE 348  348  ?    ?   ?   G . n 
J  10 1    MET 1    1    ?    ?   ?   H . n 
J  10 2    SER 2    2    ?    ?   ?   H . n 
J  10 3    ASP 3    3    ?    ?   ?   H . n 
J  10 4    LYS 4    4    4    LYS LYS H . n 
J  10 5    PRO 5    5    5    PRO PRO H . n 
J  10 6    ALA 6    6    6    ALA ALA H . n 
J  10 7    SER 7    7    7    SER SER H . n 
J  10 8    MET 8    8    8    MET MET H . n 
J  10 9    TYR 9    9    9    TYR TYR H . n 
J  10 10   ARG 10   10   10   ARG ARG H . n 
J  10 11   ASP 11   11   11   ASP ASP H . n 
J  10 12   ILE 12   12   12   ILE ILE H . n 
J  10 13   ASP 13   13   13   ASP ASP H . n 
J  10 14   LYS 14   14   14   LYS LYS H . n 
J  10 15   PRO 15   15   15   PRO PRO H . n 
J  10 16   ALA 16   16   16   ALA ALA H . n 
J  10 17   TYR 17   17   17   TYR TYR H . n 
J  10 18   THR 18   18   18   THR THR H . n 
J  10 19   ARG 19   19   19   ARG ARG H . n 
J  10 20   ARG 20   20   20   ARG ARG H . n 
J  10 21   GLU 21   21   21   GLU GLU H . n 
J  10 22   TYR 22   22   22   TYR TYR H . n 
J  10 23   ILE 23   23   23   ILE ILE H . n 
J  10 24   THR 24   24   24   THR THR H . n 
J  10 25   GLY 25   25   25   GLY GLY H . n 
J  10 26   ILE 26   26   26   ILE ILE H . n 
J  10 27   PRO 27   27   27   PRO PRO H . n 
J  10 28   GLY 28   28   28   GLY GLY H . n 
J  10 29   SER 29   29   29   SER SER H . n 
J  10 30   LYS 30   30   30   LYS LYS H . n 
J  10 31   ILE 31   31   31   ILE ILE H . n 
J  10 32   ALA 32   32   32   ALA ALA H . n 
J  10 33   GLN 33   33   33   GLN GLN H . n 
J  10 34   HIS 34   34   34   HIS HIS H . n 
J  10 35   LYS 35   35   35   LYS LYS H . n 
J  10 36   MET 36   36   36   MET MET H . n 
J  10 37   GLY 37   37   37   GLY GLY H . n 
J  10 38   ARG 38   38   38   ARG ARG H . n 
J  10 39   LYS 39   39   39   LYS LYS H . n 
J  10 40   GLN 40   40   40   GLN GLN H . n 
J  10 41   LYS 41   41   41   LYS LYS H . n 
J  10 42   ASP 42   42   42   ASP ASP H . n 
J  10 43   ALA 43   43   43   ALA ALA H . n 
J  10 44   ASP 44   44   44   ASP ASP H . n 
J  10 45   ASP 45   45   45   ASP ASP H . n 
J  10 46   TYR 46   46   46   TYR TYR H . n 
J  10 47   PRO 47   47   47   PRO PRO H . n 
J  10 48   VAL 48   48   48   VAL VAL H . n 
J  10 49   GLN 49   49   49   GLN GLN H . n 
J  10 50   ILE 50   50   50   ILE ILE H . n 
J  10 51   SER 51   51   51   SER SER H . n 
J  10 52   LEU 52   52   52   LEU LEU H . n 
J  10 53   ILE 53   53   53   ILE ILE H . n 
J  10 54   VAL 54   54   54   VAL VAL H . n 
J  10 55   GLU 55   55   55   GLU GLU H . n 
J  10 56   GLU 56   56   56   GLU GLU H . n 
J  10 57   THR 57   57   57   THR THR H . n 
J  10 58   VAL 58   58   58   VAL VAL H . n 
J  10 59   GLN 59   59   59   GLN GLN H . n 
J  10 60   LEU 60   60   60   LEU LEU H . n 
J  10 61   ARG 61   61   61   ARG ARG H . n 
J  10 62   HIS 62   62   62   HIS HIS H . n 
J  10 63   GLY 63   63   63   GLY GLY H . n 
J  10 64   SER 64   64   64   SER SER H . n 
J  10 65   LEU 65   65   65   LEU LEU H . n 
J  10 66   GLU 66   66   66   GLU GLU H . n 
J  10 67   ALA 67   67   67   ALA ALA H . n 
J  10 68   SER 68   68   68   SER SER H . n 
J  10 69   ARG 69   69   69   ARG ARG H . n 
J  10 70   LEU 70   70   70   LEU LEU H . n 
J  10 71   SER 71   71   71   SER SER H . n 
J  10 72   ALA 72   72   72   ALA ALA H . n 
J  10 73   ASN 73   73   73   ASN ASN H . n 
J  10 74   ARG 74   74   74   ARG ARG H . n 
J  10 75   HIS 75   75   75   HIS HIS H . n 
J  10 76   LEU 76   76   76   LEU LEU H . n 
J  10 77   ILE 77   77   77   ILE ILE H . n 
J  10 78   LYS 78   78   78   LYS LYS H . n 
J  10 79   GLU 79   79   79   GLU GLU H . n 
J  10 80   LEU 80   80   80   LEU LEU H . n 
J  10 81   GLY 81   81   81   GLY GLY H . n 
J  10 82   GLU 82   82   82   GLU GLU H . n 
J  10 83   GLU 83   83   83   GLU GLU H . n 
J  10 84   GLY 84   84   84   GLY GLY H . n 
J  10 85   ASP 85   85   85   ASP ASP H . n 
J  10 86   TYR 86   86   86   TYR TYR H . n 
J  10 87   LYS 87   87   87   LYS LYS H . n 
J  10 88   MET 88   88   88   MET MET H . n 
J  10 89   THR 89   89   89   THR THR H . n 
J  10 90   LEU 90   90   90   LEU LEU H . n 
J  10 91   ARG 91   91   91   ARG ARG H . n 
J  10 92   LYS 92   92   92   LYS LYS H . n 
J  10 93   PHE 93   93   93   PHE PHE H . n 
J  10 94   PRO 94   94   94   PRO PRO H . n 
J  10 95   HIS 95   95   95   HIS HIS H . n 
J  10 96   GLN 96   96   96   GLN GLN H . n 
J  10 97   VAL 97   97   97   VAL VAL H . n 
J  10 98   LEU 98   98   98   LEU LEU H . n 
J  10 99   ARG 99   99   99   ARG ARG H . n 
J  10 100  GLU 100  100  100  GLU GLU H . n 
J  10 101  ASN 101  101  101  ASN ASN H . n 
J  10 102  LYS 102  102  102  LYS LYS H . n 
J  10 103  GLN 103  103  ?    ?   ?   H . n 
J  10 104  ALA 104  104  ?    ?   ?   H . n 
J  10 105  THR 105  105  ?    ?   ?   H . n 
J  10 106  GLY 106  106  ?    ?   ?   H . n 
J  10 107  ALA 107  107  ?    ?   ?   H . n 
J  10 108  GLY 108  108  ?    ?   ?   H . n 
J  10 109  ALA 109  109  ?    ?   ?   H . n 
J  10 110  ASP 110  110  ?    ?   ?   H . n 
J  10 111  ARG 111  111  ?    ?   ?   H . n 
J  10 112  VAL 112  112  ?    ?   ?   H . n 
J  10 113  SER 113  113  ?    ?   ?   H . n 
J  10 114  ASP 114  114  114  ASP ASP H . n 
J  10 115  GLY 115  115  115  GLY GLY H . n 
J  10 116  MET 116  116  116  MET MET H . n 
J  10 117  ARG 117  117  117  ARG ARG H . n 
J  10 118  ALA 118  118  118  ALA ALA H . n 
J  10 119  ALA 119  119  119  ALA ALA H . n 
J  10 120  PHE 120  120  120  PHE PHE H . n 
J  10 121  GLY 121  121  121  GLY GLY H . n 
J  10 122  LYS 122  122  122  LYS LYS H . n 
J  10 123  ILE 123  123  123  ILE ILE H . n 
J  10 124  VAL 124  124  124  VAL VAL H . n 
J  10 125  GLY 125  125  125  GLY GLY H . n 
J  10 126  THR 126  126  126  THR THR H . n 
J  10 127  ALA 127  127  127  ALA ALA H . n 
J  10 128  ALA 128  128  128  ALA ALA H . n 
J  10 129  ARG 129  129  129  ARG ARG H . n 
J  10 130  VAL 130  130  130  VAL VAL H . n 
J  10 131  GLN 131  131  131  GLN GLN H . n 
J  10 132  ALA 132  132  132  ALA ALA H . n 
J  10 133  GLY 133  133  133  GLY GLY H . n 
J  10 134  GLU 134  134  134  GLU GLU H . n 
J  10 135  GLN 135  135  135  GLN GLN H . n 
J  10 136  LEU 136  136  136  LEU LEU H . n 
J  10 137  PHE 137  137  137  PHE PHE H . n 
J  10 138  THR 138  138  138  THR THR H . n 
J  10 139  ALA 139  139  139  ALA ALA H . n 
J  10 140  TYR 140  140  140  TYR TYR H . n 
J  10 141  CYS 141  141  141  CYS CYS H . n 
J  10 142  ASN 142  142  142  ASN ASN H . n 
J  10 143  VAL 143  143  143  VAL VAL H . n 
J  10 144  GLU 144  144  144  GLU GLU H . n 
J  10 145  ASP 145  145  145  ASP ASP H . n 
J  10 146  ALA 146  146  146  ALA ALA H . n 
J  10 147  GLU 147  147  147  GLU GLU H . n 
J  10 148  HIS 148  148  148  HIS HIS H . n 
J  10 149  VAL 149  149  149  VAL VAL H . n 
J  10 150  LYS 150  150  150  LYS LYS H . n 
J  10 151  GLU 151  151  151  GLU GLU H . n 
J  10 152  ALA 152  152  152  ALA ALA H . n 
J  10 153  PHE 153  153  153  PHE PHE H . n 
J  10 154  ARG 154  154  154  ARG ARG H . n 
J  10 155  ARG 155  155  155  ARG ARG H . n 
J  10 156  ALA 156  156  156  ALA ALA H . n 
J  10 157  TYR 157  157  157  TYR TYR H . n 
J  10 158  ASN 158  158  158  ASN ASN H . n 
J  10 159  LYS 159  159  159  LYS LYS H . n 
J  10 160  ILE 160  160  160  ILE ILE H . n 
J  10 161  THR 161  161  161  THR THR H . n 
J  10 162  PRO 162  162  162  PRO PRO H . n 
J  10 163  SER 163  163  163  SER SER H . n 
J  10 164  CYS 164  164  164  CYS CYS H . n 
J  10 165  ARG 165  165  165  ARG ARG H . n 
J  10 166  ILE 166  166  166  ILE ILE H . n 
J  10 167  LYS 167  167  167  LYS LYS H . n 
J  10 168  VAL 168  168  168  VAL VAL H . n 
J  10 169  GLU 169  169  169  GLU GLU H . n 
J  10 170  ARG 170  170  170  ARG ARG H . n 
J  10 171  GLY 171  171  171  GLY GLY H . n 
J  10 172  GLU 172  172  172  GLU GLU H . n 
J  10 173  GLU 173  173  173  GLU GLU H . n 
J  10 174  LEU 174  174  174  LEU LEU H . n 
J  10 175  LEU 175  175  ?    ?   ?   H . n 
J  10 176  ILE 176  176  ?    ?   ?   H . n 
J  10 177  ALA 177  177  ?    ?   ?   H . n 
K  11 1    MET 1    0    ?    ?   ?   I . n 
K  11 2    ALA 2    1    ?    ?   ?   I . n 
K  11 3    GLY 3    2    ?    ?   ?   I . n 
K  11 4    THR 4    3    ?    ?   ?   I . n 
K  11 5    ILE 5    4    ?    ?   ?   I . n 
K  11 6    GLU 6    5    ?    ?   ?   I . n 
K  11 7    VAL 7    6    ?    ?   ?   I . n 
K  11 8    LEU 8    7    ?    ?   ?   I . n 
K  11 9    VAL 9    8    ?    ?   ?   I . n 
K  11 10   PRO 10   9    ?    ?   ?   I . n 
K  11 11   GLY 11   10   ?    ?   ?   I . n 
K  11 12   GLY 12   11   ?    ?   ?   I . n 
K  11 13   GLU 13   12   ?    ?   ?   I . n 
K  11 14   ALA 14   13   ?    ?   ?   I . n 
K  11 15   ASN 15   14   ?    ?   ?   I . n 
K  11 16   PRO 16   15   ?    ?   ?   I . n 
K  11 17   GLY 17   16   ?    ?   ?   I . n 
K  11 18   PRO 18   17   ?    ?   ?   I . n 
K  11 19   PRO 19   18   ?    ?   ?   I . n 
K  11 20   LEU 20   19   ?    ?   ?   I . n 
K  11 21   GLY 21   20   ?    ?   ?   I . n 
K  11 22   PRO 22   21   ?    ?   ?   I . n 
K  11 23   GLU 23   22   ?    ?   ?   I . n 
K  11 24   LEU 24   23   ?    ?   ?   I . n 
K  11 25   GLY 25   24   ?    ?   ?   I . n 
K  11 26   PRO 26   25   ?    ?   ?   I . n 
K  11 27   THR 27   26   ?    ?   ?   I . n 
K  11 28   PRO 28   27   ?    ?   ?   I . n 
K  11 29   VAL 29   28   ?    ?   ?   I . n 
K  11 30   ASP 30   29   ?    ?   ?   I . n 
K  11 31   VAL 31   30   ?    ?   ?   I . n 
K  11 32   GLN 32   31   ?    ?   ?   I . n 
K  11 33   ALA 33   32   ?    ?   ?   I . n 
K  11 34   VAL 34   33   ?    ?   ?   I . n 
K  11 35   VAL 35   34   ?    ?   ?   I . n 
K  11 36   GLN 36   35   ?    ?   ?   I . n 
K  11 37   GLU 37   36   ?    ?   ?   I . n 
K  11 38   ILE 38   37   ?    ?   ?   I . n 
K  11 39   ASN 39   38   ?    ?   ?   I . n 
K  11 40   ASP 40   39   ?    ?   ?   I . n 
K  11 41   GLN 41   40   ?    ?   ?   I . n 
K  11 42   THR 42   41   ?    ?   ?   I . n 
K  11 43   ALA 43   42   ?    ?   ?   I . n 
K  11 44   ALA 44   43   ?    ?   ?   I . n 
K  11 45   PHE 45   44   ?    ?   ?   I . n 
K  11 46   ASP 46   45   ?    ?   ?   I . n 
K  11 47   GLY 47   46   ?    ?   ?   I . n 
K  11 48   THR 48   47   ?    ?   ?   I . n 
K  11 49   GLU 49   48   ?    ?   ?   I . n 
K  11 50   VAL 50   49   ?    ?   ?   I . n 
K  11 51   PRO 51   50   ?    ?   ?   I . n 
K  11 52   VAL 52   51   ?    ?   ?   I . n 
K  11 53   THR 53   52   ?    ?   ?   I . n 
K  11 54   VAL 54   53   ?    ?   ?   I . n 
K  11 55   LYS 55   54   ?    ?   ?   I . n 
K  11 56   TYR 56   55   ?    ?   ?   I . n 
K  11 57   ASP 57   56   ?    ?   ?   I . n 
K  11 58   ASP 58   57   ?    ?   ?   I . n 
K  11 59   ASP 59   58   ?    ?   ?   I . n 
K  11 60   GLY 60   59   ?    ?   ?   I . n 
K  11 61   SER 61   60   ?    ?   ?   I . n 
K  11 62   PHE 62   61   ?    ?   ?   I . n 
K  11 63   GLU 63   62   ?    ?   ?   I . n 
K  11 64   ILE 64   63   ?    ?   ?   I . n 
K  11 65   GLU 65   64   ?    ?   ?   I . n 
K  11 66   VAL 66   65   ?    ?   ?   I . n 
K  11 67   GLY 67   66   66   GLY GLY I . n 
K  11 68   VAL 68   67   67   VAL VAL I . n 
K  11 69   PRO 69   68   68   PRO PRO I . n 
K  11 70   PRO 70   69   69   PRO PRO I . n 
K  11 71   THR 71   70   70   THR THR I . n 
K  11 72   ALA 72   71   71   ALA ALA I . n 
K  11 73   GLU 73   72   72   GLU GLU I . n 
K  11 74   LEU 74   73   73   LEU LEU I . n 
K  11 75   ILE 75   74   74   ILE ILE I . n 
K  11 76   LYS 76   75   75   LYS LYS I . n 
K  11 77   ASP 77   76   76   ASP ASP I . n 
K  11 78   GLU 78   77   77   GLU GLU I . n 
K  11 79   ALA 79   78   78   ALA ALA I . n 
K  11 80   GLY 80   79   79   GLY GLY I . n 
K  11 81   PHE 81   80   80   PHE PHE I . n 
K  11 82   GLU 82   81   81   GLU GLU I . n 
K  11 83   THR 83   82   82   THR THR I . n 
K  11 84   GLY 84   83   83   GLY GLY I . n 
K  11 85   SER 85   84   84   SER SER I . n 
K  11 86   GLY 86   85   85   GLY GLY I . n 
K  11 87   GLU 87   86   86   GLU GLU I . n 
K  11 88   PRO 88   87   87   PRO PRO I . n 
K  11 89   GLN 89   88   88   GLN GLN I . n 
K  11 90   GLU 90   89   89   GLU GLU I . n 
K  11 91   ASP 91   90   90   ASP ASP I . n 
K  11 92   PHE 92   91   91   PHE PHE I . n 
K  11 93   VAL 93   92   92   VAL VAL I . n 
K  11 94   ALA 94   93   93   ALA ALA I . n 
K  11 95   ASP 95   94   94   ASP ASP I . n 
K  11 96   LEU 96   95   95   LEU LEU I . n 
K  11 97   SER 97   96   96   SER SER I . n 
K  11 98   VAL 98   97   97   VAL VAL I . n 
K  11 99   ASP 99   98   98   ASP ASP I . n 
K  11 100  GLN 100  99   99   GLN GLN I . n 
K  11 101  VAL 101  100  100  VAL VAL I . n 
K  11 102  LYS 102  101  101  LYS LYS I . n 
K  11 103  GLN 103  102  102  GLN GLN I . n 
K  11 104  ILE 104  103  103  ILE ILE I . n 
K  11 105  ALA 105  104  104  ALA ALA I . n 
K  11 106  GLU 106  105  105  GLU GLU I . n 
K  11 107  GLN 107  106  106  GLN GLN I . n 
K  11 108  LYS 108  107  107  LYS LYS I . n 
K  11 109  HIS 109  108  108  HIS HIS I . n 
K  11 110  PRO 110  109  109  PRO PRO I . n 
K  11 111  ASP 111  110  110  ASP ASP I . n 
K  11 112  LEU 112  111  111  LEU LEU I . n 
K  11 113  LEU 113  112  112  LEU LEU I . n 
K  11 114  SER 114  113  113  SER SER I . n 
K  11 115  TYR 115  114  114  TYR TYR I . n 
K  11 116  ASP 116  115  115  ASP ASP I . n 
K  11 117  LEU 117  116  116  LEU LEU I . n 
K  11 118  THR 118  117  117  THR THR I . n 
K  11 119  ASN 119  118  118  ASN ASN I . n 
K  11 120  ALA 120  119  119  ALA ALA I . n 
K  11 121  ALA 121  120  120  ALA ALA I . n 
K  11 122  LYS 122  121  121  LYS LYS I . n 
K  11 123  GLU 123  122  122  GLU GLU I . n 
K  11 124  VAL 124  123  123  VAL VAL I . n 
K  11 125  VAL 125  124  124  VAL VAL I . n 
K  11 126  GLY 126  125  125  GLY GLY I . n 
K  11 127  THR 127  126  126  THR THR I . n 
K  11 128  CYS 128  127  127  CYS CYS I . n 
K  11 129  THR 129  128  128  THR THR I . n 
K  11 130  SER 130  129  129  SER SER I . n 
K  11 131  LEU 131  130  130  LEU LEU I . n 
K  11 132  GLY 132  131  131  GLY GLY I . n 
K  11 133  VAL 133  132  132  VAL VAL I . n 
K  11 134  THR 134  133  133  THR THR I . n 
K  11 135  ILE 135  134  134  ILE ILE I . n 
K  11 136  GLU 136  135  135  GLU GLU I . n 
K  11 137  GLY 137  136  ?    ?   ?   I . n 
K  11 138  GLU 138  137  ?    ?   ?   I . n 
K  11 139  ASN 139  138  ?    ?   ?   I . n 
K  11 140  PRO 140  139  ?    ?   ?   I . n 
K  11 141  ARG 141  140  ?    ?   ?   I . n 
K  11 142  GLU 142  141  ?    ?   ?   I . n 
K  11 143  PHE 143  142  ?    ?   ?   I . n 
K  11 144  LYS 144  143  ?    ?   ?   I . n 
K  11 145  GLU 145  144  ?    ?   ?   I . n 
K  11 146  ARG 146  145  ?    ?   ?   I . n 
K  11 147  ILE 147  146  ?    ?   ?   I . n 
K  11 148  ASP 148  147  ?    ?   ?   I . n 
K  11 149  ALA 149  148  ?    ?   ?   I . n 
K  11 150  GLY 150  149  ?    ?   ?   I . n 
K  11 151  GLU 151  150  ?    ?   ?   I . n 
K  11 152  TYR 152  151  ?    ?   ?   I . n 
K  11 153  ASP 153  152  ?    ?   ?   I . n 
K  11 154  ASP 154  153  ?    ?   ?   I . n 
K  11 155  VAL 155  154  ?    ?   ?   I . n 
K  11 156  PHE 156  155  ?    ?   ?   I . n 
K  11 157  ALA 157  156  ?    ?   ?   I . n 
K  11 158  ALA 158  157  ?    ?   ?   I . n 
K  11 159  GLU 159  158  ?    ?   ?   I . n 
K  11 160  ALA 160  159  ?    ?   ?   I . n 
K  11 161  GLN 161  160  ?    ?   ?   I . n 
K  11 162  ALA 162  161  ?    ?   ?   I . n 
L  12 1    MET 1    1    ?    ?   ?   J . n 
L  12 2    SER 2    2    ?    ?   ?   J . n 
L  12 3    VAL 3    3    ?    ?   ?   J . n 
L  12 4    ALA 4    4    4    ALA ALA J . n 
L  12 5    GLU 5    5    5    GLU GLU J . n 
L  12 6    PHE 6    6    6    PHE PHE J . n 
L  12 7    ASP 7    7    7    ASP ASP J . n 
L  12 8    ALA 8    8    8    ALA ALA J . n 
L  12 9    ASP 9    9    9    ASP ASP J . n 
L  12 10   VAL 10   10   10   VAL VAL J . n 
L  12 11   ILE 11   11   11   ILE ILE J . n 
L  12 12   VAL 12   12   12   VAL VAL J . n 
L  12 13   ASP 13   13   13   ASP ASP J . n 
L  12 14   ALA 14   14   14   ALA ALA J . n 
L  12 15   ARG 15   15   15   ARG ARG J . n 
L  12 16   ASP 16   16   16   ASP ASP J . n 
L  12 17   CYS 17   17   17   CYS CYS J . n 
L  12 18   ILE 18   18   18   ILE ILE J . n 
L  12 19   MET 19   19   19   MET MET J . n 
L  12 20   GLY 20   20   20   GLY GLY J . n 
L  12 21   ARG 21   21   21   ARG ARG J . n 
L  12 22   VAL 22   22   22   VAL VAL J . n 
L  12 23   ALA 23   23   23   ALA ALA J . n 
L  12 24   SER 24   24   24   SER SER J . n 
L  12 25   GLN 25   25   25   GLN GLN J . n 
L  12 26   VAL 26   26   26   VAL VAL J . n 
L  12 27   ALA 27   27   27   ALA ALA J . n 
L  12 28   GLU 28   28   28   GLU GLU J . n 
L  12 29   GLN 29   29   29   GLN GLN J . n 
L  12 30   ALA 30   30   30   ALA ALA J . n 
L  12 31   LEU 31   31   31   LEU LEU J . n 
L  12 32   ASP 32   32   32   ASP ASP J . n 
L  12 33   GLY 33   33   33   GLY GLY J . n 
L  12 34   GLU 34   34   34   GLU GLU J . n 
L  12 35   THR 35   35   35   THR THR J . n 
L  12 36   VAL 36   36   36   VAL VAL J . n 
L  12 37   ALA 37   37   37   ALA ALA J . n 
L  12 38   VAL 38   38   38   VAL VAL J . n 
L  12 39   VAL 39   39   39   VAL VAL J . n 
L  12 40   ASN 40   40   40   ASN ASN J . n 
L  12 41   ALA 41   41   41   ALA ALA J . n 
L  12 42   GLU 42   42   42   GLU GLU J . n 
L  12 43   ARG 43   43   43   ARG ARG J . n 
L  12 44   ALA 44   44   44   ALA ALA J . n 
L  12 45   VAL 45   45   45   VAL VAL J . n 
L  12 46   ILE 46   46   46   ILE ILE J . n 
L  12 47   THR 47   47   47   THR THR J . n 
L  12 48   GLY 48   48   48   GLY GLY J . n 
L  12 49   ARG 49   49   49   ARG ARG J . n 
L  12 50   GLU 50   50   50   GLU GLU J . n 
L  12 51   GLU 51   51   51   GLU GLU J . n 
L  12 52   GLN 52   52   52   GLN GLN J . n 
L  12 53   ILE 53   53   53   ILE ILE J . n 
L  12 54   VAL 54   54   54   VAL VAL J . n 
L  12 55   GLU 55   55   55   GLU GLU J . n 
L  12 56   LYS 56   56   56   LYS LYS J . n 
L  12 57   TYR 57   57   57   TYR TYR J . n 
L  12 58   GLU 58   58   58   GLU GLU J . n 
L  12 59   LYS 59   59   59   LYS LYS J . n 
L  12 60   ARG 60   60   60   ARG ARG J . n 
L  12 61   VAL 61   61   61   VAL VAL J . n 
L  12 62   ASP 62   62   62   ASP ASP J . n 
L  12 63   ILE 63   63   63   ILE ILE J . n 
L  12 64   GLY 64   64   64   GLY GLY J . n 
L  12 65   ASN 65   65   65   ASN ASN J . n 
L  12 66   ASP 66   66   66   ASP ASP J . n 
L  12 67   ASN 67   67   67   ASN ASN J . n 
L  12 68   GLY 68   68   68   GLY GLY J . n 
L  12 69   TYR 69   69   69   TYR TYR J . n 
L  12 70   PHE 70   70   70   PHE PHE J . n 
L  12 71   TYR 71   71   71   TYR TYR J . n 
L  12 72   PRO 72   72   72   PRO PRO J . n 
L  12 73   LYS 73   73   73   LYS LYS J . n 
L  12 74   ARG 74   74   74   ARG ARG J . n 
L  12 75   PRO 75   75   75   PRO PRO J . n 
L  12 76   ASP 76   76   76   ASP ASP J . n 
L  12 77   GLY 77   77   77   GLY GLY J . n 
L  12 78   ILE 78   78   78   ILE ILE J . n 
L  12 79   PHE 79   79   79   PHE PHE J . n 
L  12 80   LYS 80   80   80   LYS LYS J . n 
L  12 81   ARG 81   81   81   ARG ARG J . n 
L  12 82   THR 82   82   82   THR THR J . n 
L  12 83   ILE 83   83   83   ILE ILE J . n 
L  12 84   ARG 84   84   84   ARG ARG J . n 
L  12 85   GLY 85   85   85   GLY GLY J . n 
L  12 86   MET 86   86   86   MET MET J . n 
L  12 87   LEU 87   87   87   LEU LEU J . n 
L  12 88   PRO 88   88   88   PRO PRO J . n 
L  12 89   HIS 89   89   89   HIS HIS J . n 
L  12 90   LYS 90   90   90   LYS LYS J . n 
L  12 91   LYS 91   91   91   LYS LYS J . n 
L  12 92   GLN 92   92   92   GLN GLN J . n 
L  12 93   ARG 93   93   93   ARG ARG J . n 
L  12 94   GLY 94   94   94   GLY GLY J . n 
L  12 95   ARG 95   95   95   ARG ARG J . n 
L  12 96   GLU 96   96   96   GLU GLU J . n 
L  12 97   ALA 97   97   97   ALA ALA J . n 
L  12 98   PHE 98   98   98   PHE PHE J . n 
L  12 99   GLU 99   99   99   GLU GLU J . n 
L  12 100  SER 100  100  100  SER SER J . n 
L  12 101  VAL 101  101  101  VAL VAL J . n 
L  12 102  ARG 102  102  102  ARG ARG J . n 
L  12 103  VAL 103  103  103  VAL VAL J . n 
L  12 104  TYR 104  104  104  TYR TYR J . n 
L  12 105  LEU 105  105  105  LEU LEU J . n 
L  12 106  GLY 106  106  106  GLY GLY J . n 
L  12 107  ASN 107  107  107  ASN ASN J . n 
L  12 108  PRO 108  108  108  PRO PRO J . n 
L  12 109  TYR 109  109  109  TYR TYR J . n 
L  12 110  ASP 110  110  110  ASP ASP J . n 
L  12 111  GLU 111  111  111  GLU GLU J . n 
L  12 112  ASP 112  112  112  ASP ASP J . n 
L  12 113  GLY 113  113  113  GLY GLY J . n 
L  12 114  GLU 114  114  114  GLU GLU J . n 
L  12 115  VAL 115  115  115  VAL VAL J . n 
L  12 116  LEU 116  116  116  LEU LEU J . n 
L  12 117  ASP 117  117  117  ASP ASP J . n 
L  12 118  GLY 118  118  118  GLY GLY J . n 
L  12 119  THR 119  119  119  THR THR J . n 
L  12 120  SER 120  120  120  SER SER J . n 
L  12 121  LEU 121  121  121  LEU LEU J . n 
L  12 122  ASP 122  122  122  ASP ASP J . n 
L  12 123  ARG 123  123  123  ARG ARG J . n 
L  12 124  LEU 124  124  124  LEU LEU J . n 
L  12 125  SER 125  125  125  SER SER J . n 
L  12 126  ASN 126  126  126  ASN ASN J . n 
L  12 127  ILE 127  127  127  ILE ILE J . n 
L  12 128  LYS 128  128  128  LYS LYS J . n 
L  12 129  PHE 129  129  129  PHE PHE J . n 
L  12 130  VAL 130  130  130  VAL VAL J . n 
L  12 131  THR 131  131  131  THR THR J . n 
L  12 132  LEU 132  132  132  LEU LEU J . n 
L  12 133  GLY 133  133  133  GLY GLY J . n 
L  12 134  GLU 134  134  134  GLU GLU J . n 
L  12 135  ILE 135  135  135  ILE ILE J . n 
L  12 136  SER 136  136  136  SER SER J . n 
L  12 137  GLU 137  137  137  GLU GLU J . n 
L  12 138  THR 138  138  138  THR THR J . n 
L  12 139  LEU 139  139  139  LEU LEU J . n 
L  12 140  GLY 140  140  140  GLY GLY J . n 
L  12 141  ALA 141  141  141  ALA ALA J . n 
L  12 142  ASN 142  142  142  ASN ASN J . n 
L  12 143  LYS 143  143  143  LYS LYS J . n 
L  12 144  THR 144  144  144  THR THR J . n 
L  12 145  TRP 145  145  145  TRP TRP J . n 
M  13 1    MET 1    1    1    MET MET K . n 
M  13 2    GLU 2    2    2    GLU GLU K . n 
M  13 3    ALA 3    3    3    ALA ALA K . n 
M  13 4    LEU 4    4    4    LEU LEU K . n 
M  13 5    GLY 5    5    5    GLY GLY K . n 
M  13 6    ALA 6    6    6    ALA ALA K . n 
M  13 7    ASP 7    7    7    ASP ASP K . n 
M  13 8    VAL 8    8    8    VAL VAL K . n 
M  13 9    THR 9    9    9    THR THR K . n 
M  13 10   GLN 10   10   10   GLN GLN K . n 
M  13 11   GLY 11   11   11   GLY GLY K . n 
M  13 12   LEU 12   12   12   LEU LEU K . n 
M  13 13   GLU 13   13   13   GLU GLU K . n 
M  13 14   LYS 14   14   14   LYS LYS K . n 
M  13 15   GLY 15   15   15   GLY GLY K . n 
M  13 16   SER 16   16   16   SER SER K . n 
M  13 17   LEU 17   17   17   LEU LEU K . n 
M  13 18   ILE 18   18   18   ILE ILE K . n 
M  13 19   THR 19   19   19   THR THR K . n 
M  13 20   CYS 20   20   20   CYS CYS K . n 
M  13 21   ALA 21   21   21   ALA ALA K . n 
M  13 22   ASP 22   22   22   ASP ASP K . n 
M  13 23   ASN 23   23   23   ASN ASN K . n 
M  13 24   THR 24   24   24   THR THR K . n 
M  13 25   GLY 25   25   25   GLY GLY K . n 
M  13 26   ALA 26   26   26   ALA ALA K . n 
M  13 27   ARG 27   27   27   ARG ARG K . n 
M  13 28   GLU 28   28   28   GLU GLU K . n 
M  13 29   LEU 29   29   29   LEU LEU K . n 
M  13 30   LYS 30   30   30   LYS LYS K . n 
M  13 31   VAL 31   31   31   VAL VAL K . n 
M  13 32   ILE 32   32   32   ILE ILE K . n 
M  13 33   SER 33   33   33   SER SER K . n 
M  13 34   VAL 34   34   34   VAL VAL K . n 
M  13 35   HIS 35   35   35   HIS HIS K . n 
M  13 36   GLY 36   36   36   GLY GLY K . n 
M  13 37   TYR 37   37   37   TYR TYR K . n 
M  13 38   SER 38   38   38   SER SER K . n 
M  13 39   GLY 39   39   39   GLY GLY K . n 
M  13 40   THR 40   40   40   THR THR K . n 
M  13 41   LYS 41   41   41   LYS LYS K . n 
M  13 42   ASN 42   42   42   ASN ASN K . n 
M  13 43   ARG 43   43   43   ARG ARG K . n 
M  13 44   LEU 44   44   44   LEU LEU K . n 
M  13 45   PRO 45   45   45   PRO PRO K . n 
M  13 46   LYS 46   46   46   LYS LYS K . n 
M  13 47   ALA 47   47   47   ALA ALA K . n 
M  13 48   GLY 48   48   48   GLY GLY K . n 
M  13 49   LEU 49   49   49   LEU LEU K . n 
M  13 50   GLY 50   50   50   GLY GLY K . n 
M  13 51   ASP 51   51   51   ASP ASP K . n 
M  13 52   LYS 52   52   52   LYS LYS K . n 
M  13 53   ILE 53   53   53   ILE ILE K . n 
M  13 54   THR 54   54   54   THR THR K . n 
M  13 55   VAL 55   55   55   VAL VAL K . n 
M  13 56   SER 56   56   56   SER SER K . n 
M  13 57   VAL 57   57   57   VAL VAL K . n 
M  13 58   THR 58   58   58   THR THR K . n 
M  13 59   LYS 59   59   59   LYS LYS K . n 
M  13 60   GLY 60   60   60   GLY GLY K . n 
M  13 61   THR 61   61   61   THR THR K . n 
M  13 62   PRO 62   62   62   PRO PRO K . n 
M  13 63   GLU 63   63   63   GLU GLU K . n 
M  13 64   MET 64   64   64   MET MET K . n 
M  13 65   ARG 65   65   65   ARG ARG K . n 
M  13 66   ARG 66   66   66   ARG ARG K . n 
M  13 67   GLN 67   67   67   GLN GLN K . n 
M  13 68   VAL 68   68   68   VAL VAL K . n 
M  13 69   LEU 69   69   69   LEU LEU K . n 
M  13 70   GLU 70   70   70   GLU GLU K . n 
M  13 71   ALA 71   71   71   ALA ALA K . n 
M  13 72   VAL 72   72   72   VAL VAL K . n 
M  13 73   VAL 73   73   73   VAL VAL K . n 
M  13 74   VAL 74   74   74   VAL VAL K . n 
M  13 75   ARG 75   75   75   ARG ARG K . n 
M  13 76   GLN 76   76   76   GLN GLN K . n 
M  13 77   ARG 77   77   77   ARG ARG K . n 
M  13 78   LYS 78   78   78   LYS LYS K . n 
M  13 79   PRO 79   79   79   PRO PRO K . n 
M  13 80   ILE 80   80   80   ILE ILE K . n 
M  13 81   ARG 81   81   81   ARG ARG K . n 
M  13 82   ARG 82   82   82   ARG ARG K . n 
M  13 83   PRO 83   83   83   PRO PRO K . n 
M  13 84   ASP 84   84   84   ASP ASP K . n 
M  13 85   GLY 85   85   85   GLY GLY K . n 
M  13 86   THR 86   86   86   THR THR K . n 
M  13 87   ARG 87   87   87   ARG ARG K . n 
M  13 88   VAL 88   88   88   VAL VAL K . n 
M  13 89   LYS 89   89   89   LYS LYS K . n 
M  13 90   PHE 90   90   90   PHE PHE K . n 
M  13 91   GLU 91   91   91   GLU GLU K . n 
M  13 92   ASP 92   92   92   ASP ASP K . n 
M  13 93   ASN 93   93   93   ASN ASN K . n 
M  13 94   ALA 94   94   94   ALA ALA K . n 
M  13 95   ALA 95   95   95   ALA ALA K . n 
M  13 96   VAL 96   96   96   VAL VAL K . n 
M  13 97   ILE 97   97   97   ILE ILE K . n 
M  13 98   VAL 98   98   98   VAL VAL K . n 
M  13 99   ASP 99   99   99   ASP ASP K . n 
M  13 100  GLU 100  100  100  GLU GLU K . n 
M  13 101  ASN 101  101  101  ASN ASN K . n 
M  13 102  GLU 102  102  102  GLU GLU K . n 
M  13 103  ASP 103  103  103  ASP ASP K . n 
M  13 104  PRO 104  104  104  PRO PRO K . n 
M  13 105  ARG 105  105  105  ARG ARG K . n 
M  13 106  GLY 106  106  106  GLY GLY K . n 
M  13 107  THR 107  107  107  THR THR K . n 
M  13 108  GLU 108  108  108  GLU GLU K . n 
M  13 109  LEU 109  109  109  LEU LEU K . n 
M  13 110  LYS 110  110  110  LYS LYS K . n 
M  13 111  GLY 111  111  111  GLY GLY K . n 
M  13 112  PRO 112  112  112  PRO PRO K . n 
M  13 113  ILE 113  113  113  ILE ILE K . n 
M  13 114  ALA 114  114  114  ALA ALA K . n 
M  13 115  ARG 115  115  115  ARG ARG K . n 
M  13 116  GLU 116  116  116  GLU GLU K . n 
M  13 117  VAL 117  117  117  VAL VAL K . n 
M  13 118  ALA 118  118  118  ALA ALA K . n 
M  13 119  GLN 119  119  119  GLN GLN K . n 
M  13 120  ARG 120  120  120  ARG ARG K . n 
M  13 121  PHE 121  121  121  PHE PHE K . n 
M  13 122  GLY 122  122  122  GLY GLY K . n 
M  13 123  SER 123  123  123  SER SER K . n 
M  13 124  VAL 124  124  124  VAL VAL K . n 
M  13 125  ALA 125  125  125  ALA ALA K . n 
M  13 126  SER 126  126  126  SER SER K . n 
M  13 127  ALA 127  127  127  ALA ALA K . n 
M  13 128  ALA 128  128  128  ALA ALA K . n 
M  13 129  THR 129  129  129  THR THR K . n 
M  13 130  MET 130  130  130  MET MET K . n 
M  13 131  ILE 131  131  131  ILE ILE K . n 
M  13 132  VAL 132  132  132  VAL VAL K . n 
N  14 1    MET 1    0    ?    ?   ?   L . n 
N  14 2    THR 2    1    1    THR THR L . n 
N  14 3    SER 3    2    2    SER SER L . n 
N  14 4    LYS 4    3    3    LYS LYS L . n 
N  14 5    LYS 5    4    4    LYS LYS L . n 
N  14 6    LYS 6    5    5    LYS LYS L . n 
N  14 7    ARG 7    6    6    ARG ARG L . n 
N  14 8    GLN 8    7    7    GLN GLN L . n 
N  14 9    ARG 9    8    8    ARG ARG L . n 
N  14 10   GLY 10   9    9    GLY GLY L . n 
N  14 11   SER 11   10   10   SER SER L . n 
N  14 12   ARG 12   11   11   ARG ARG L . n 
N  14 13   THR 13   12   12   THR THR L . n 
N  14 14   HIS 14   13   13   HIS HIS L . n 
N  14 15   GLY 15   14   14   GLY GLY L . n 
N  14 16   GLY 16   15   15   GLY GLY L . n 
N  14 17   GLY 17   16   16   GLY GLY L . n 
N  14 18   SER 18   17   17   SER SER L . n 
N  14 19   HIS 19   18   18   HIS HIS L . n 
N  14 20   LYS 20   19   19   LYS LYS L . n 
N  14 21   ASN 21   20   20   ASN ASN L . n 
N  14 22   ARG 22   21   21   ARG ARG L . n 
N  14 23   ARG 23   22   22   ARG ARG L . n 
N  14 24   GLY 24   23   23   GLY GLY L . n 
N  14 25   ALA 25   24   24   ALA ALA L . n 
N  14 26   GLY 26   25   25   GLY GLY L . n 
N  14 27   HIS 27   26   26   HIS HIS L . n 
N  14 28   ARG 28   27   27   ARG ARG L . n 
N  14 29   GLY 29   28   28   GLY GLY L . n 
N  14 30   GLY 30   29   29   GLY GLY L . n 
N  14 31   ARG 31   30   30   ARG ARG L . n 
N  14 32   GLY 32   31   31   GLY GLY L . n 
N  14 33   ASP 33   32   32   ASP ASP L . n 
N  14 34   ALA 34   33   33   ALA ALA L . n 
N  14 35   GLY 35   34   34   GLY GLY L . n 
N  14 36   ARG 36   35   35   ARG ARG L . n 
N  14 37   ASP 37   36   36   ASP ASP L . n 
N  14 38   LYS 38   37   37   LYS LYS L . n 
N  14 39   HIS 39   38   38   HIS HIS L . n 
N  14 40   GLU 40   39   39   GLU GLU L . n 
N  14 41   PHE 41   40   40   PHE PHE L . n 
N  14 42   HIS 42   41   41   HIS HIS L . n 
N  14 43   ASN 43   42   42   ASN ASN L . n 
N  14 44   HIS 44   43   43   HIS HIS L . n 
N  14 45   GLU 45   44   44   GLU GLU L . n 
N  14 46   PRO 46   45   45   PRO PRO L . n 
N  14 47   LEU 47   46   46   LEU LEU L . n 
N  14 48   GLY 48   47   47   GLY GLY L . n 
N  14 49   LYS 49   48   48   LYS LYS L . n 
N  14 50   SER 50   49   49   SER SER L . n 
N  14 51   GLY 51   50   50   GLY GLY L . n 
N  14 52   PHE 52   51   51   PHE PHE L . n 
N  14 53   LYS 53   52   52   LYS LYS L . n 
N  14 54   ARG 54   53   53   ARG ARG L . n 
N  14 55   PRO 55   54   54   PRO PRO L . n 
N  14 56   GLN 56   55   55   GLN GLN L . n 
N  14 57   LYS 57   56   56   LYS LYS L . n 
N  14 58   VAL 58   57   57   VAL VAL L . n 
N  14 59   GLN 59   58   58   GLN GLN L . n 
N  14 60   GLU 60   59   59   GLU GLU L . n 
N  14 61   GLU 61   60   60   GLU GLU L . n 
N  14 62   ALA 62   61   61   ALA ALA L . n 
N  14 63   ALA 63   62   62   ALA ALA L . n 
N  14 64   THR 64   63   63   THR THR L . n 
N  14 65   ILE 65   64   64   ILE ILE L . n 
N  14 66   ASP 66   65   65   ASP ASP L . n 
N  14 67   VAL 67   66   66   VAL VAL L . n 
N  14 68   ARG 68   67   67   ARG ARG L . n 
N  14 69   GLU 69   68   68   GLU GLU L . n 
N  14 70   ILE 70   69   69   ILE ILE L . n 
N  14 71   ASP 71   70   70   ASP ASP L . n 
N  14 72   GLU 72   71   71   GLU GLU L . n 
N  14 73   ASN 73   72   72   ASN ASN L . n 
N  14 74   VAL 74   73   73   VAL VAL L . n 
N  14 75   THR 75   74   74   THR THR L . n 
N  14 76   LEU 76   75   75   LEU LEU L . n 
N  14 77   LEU 77   76   76   LEU LEU L . n 
N  14 78   ALA 78   77   77   ALA ALA L . n 
N  14 79   ALA 79   78   78   ALA ALA L . n 
N  14 80   ASP 80   79   79   ASP ASP L . n 
N  14 81   ASP 81   80   80   ASP ASP L . n 
N  14 82   VAL 82   81   81   VAL VAL L . n 
N  14 83   ALA 83   82   82   ALA ALA L . n 
N  14 84   GLU 84   83   83   GLU GLU L . n 
N  14 85   VAL 85   84   ?    ?   ?   L . n 
N  14 86   GLU 86   85   ?    ?   ?   L . n 
N  14 87   ASP 87   86   ?    ?   ?   L . n 
N  14 88   GLY 88   87   ?    ?   ?   L . n 
N  14 89   GLY 89   88   ?    ?   ?   L . n 
N  14 90   PHE 90   89   89   PHE PHE L . n 
N  14 91   ARG 91   90   90   ARG ARG L . n 
N  14 92   VAL 92   91   91   VAL VAL L . n 
N  14 93   ASP 93   92   92   ASP ASP L . n 
N  14 94   VAL 94   93   93   VAL VAL L . n 
N  14 95   ARG 95   94   94   ARG ARG L . n 
N  14 96   ASP 96   95   95   ASP ASP L . n 
N  14 97   VAL 97   96   96   VAL VAL L . n 
N  14 98   VAL 98   97   97   VAL VAL L . n 
N  14 99   GLU 99   98   98   GLU GLU L . n 
N  14 100  GLU 100  99   99   GLU GLU L . n 
N  14 101  ALA 101  100  100  ALA ALA L . n 
N  14 102  ASP 102  101  101  ASP ASP L . n 
N  14 103  ASP 103  102  102  ASP ASP L . n 
N  14 104  ALA 104  103  103  ALA ALA L . n 
N  14 105  ASP 105  104  104  ASP ASP L . n 
N  14 106  TYR 106  105  105  TYR TYR L . n 
N  14 107  VAL 107  106  106  VAL VAL L . n 
N  14 108  LYS 108  107  107  LYS LYS L . n 
N  14 109  VAL 109  108  108  VAL VAL L . n 
N  14 110  LEU 110  109  109  LEU LEU L . n 
N  14 111  GLY 111  110  110  GLY GLY L . n 
N  14 112  ALA 112  111  111  ALA ALA L . n 
N  14 113  GLY 113  112  112  GLY GLY L . n 
N  14 114  GLN 114  113  113  GLN GLN L . n 
N  14 115  VAL 115  114  114  VAL VAL L . n 
N  14 116  ARG 116  115  115  ARG ARG L . n 
N  14 117  HIS 117  116  116  HIS HIS L . n 
N  14 118  GLU 118  117  117  GLU GLU L . n 
N  14 119  LEU 119  118  118  LEU LEU L . n 
N  14 120  THR 120  119  119  THR THR L . n 
N  14 121  LEU 121  120  120  LEU LEU L . n 
N  14 122  ILE 122  121  121  ILE ILE L . n 
N  14 123  ALA 123  122  122  ALA ALA L . n 
N  14 124  ASP 124  123  123  ASP ASP L . n 
N  14 125  ASP 125  124  124  ASP ASP L . n 
N  14 126  PHE 126  125  125  PHE PHE L . n 
N  14 127  SER 127  126  126  SER SER L . n 
N  14 128  GLU 128  127  127  GLU GLU L . n 
N  14 129  GLY 129  128  128  GLY GLY L . n 
N  14 130  ALA 130  129  129  ALA ALA L . n 
N  14 131  ARG 131  130  130  ARG ARG L . n 
N  14 132  GLU 132  131  131  GLU GLU L . n 
N  14 133  LYS 133  132  132  LYS LYS L . n 
N  14 134  VAL 134  133  133  VAL VAL L . n 
N  14 135  GLU 135  134  134  GLU GLU L . n 
N  14 136  GLY 136  135  135  GLY GLY L . n 
N  14 137  ALA 137  136  136  ALA ALA L . n 
N  14 138  GLY 138  137  137  GLY GLY L . n 
N  14 139  GLY 139  138  138  GLY GLY L . n 
N  14 140  SER 140  139  139  SER SER L . n 
N  14 141  VAL 141  140  140  VAL VAL L . n 
N  14 142  GLU 142  141  141  GLU GLU L . n 
N  14 143  LEU 143  142  142  LEU LEU L . n 
N  14 144  THR 144  143  143  THR THR L . n 
N  14 145  ASP 145  144  144  ASP ASP L . n 
N  14 146  LEU 146  145  145  LEU LEU L . n 
N  14 147  GLY 147  146  146  GLY GLY L . n 
N  14 148  GLU 148  147  147  GLU GLU L . n 
N  14 149  GLU 149  148  148  GLU GLU L . n 
N  14 150  ARG 150  149  149  ARG ARG L . n 
N  14 151  GLN 151  150  150  GLN GLN L . n 
N  14 152  ALA 152  151  ?    ?   ?   L . n 
N  14 153  GLU 153  152  ?    ?   ?   L . n 
N  14 154  ALA 154  153  ?    ?   ?   L . n 
N  14 155  GLU 155  154  ?    ?   ?   L . n 
N  14 156  GLU 156  155  ?    ?   ?   L . n 
N  14 157  THR 157  156  ?    ?   ?   L . n 
N  14 158  GLU 158  157  ?    ?   ?   L . n 
N  14 159  ASP 159  158  ?    ?   ?   L . n 
N  14 160  ALA 160  159  ?    ?   ?   L . n 
N  14 161  ASP 161  160  ?    ?   ?   L . n 
N  14 162  ALA 162  161  ?    ?   ?   L . n 
N  14 163  ASP 163  162  ?    ?   ?   L . n 
N  14 164  GLU 164  163  ?    ?   ?   L . n 
N  14 165  GLU 165  164  ?    ?   ?   L . n 
O  15 1    ALA 1    1    1    ALA ALA M . n 
O  15 2    ARG 2    2    2    ARG ARG M . n 
O  15 3    SER 3    3    3    SER SER M . n 
O  15 4    ALA 4    4    4    ALA ALA M . n 
O  15 5    TYR 5    5    5    TYR TYR M . n 
O  15 6    SER 6    6    6    SER SER M . n 
O  15 7    TYR 7    7    7    TYR TYR M . n 
O  15 8    ILE 8    8    8    ILE ILE M . n 
O  15 9    ARG 9    9    9    ARG ARG M . n 
O  15 10   ASP 10   10   10   ASP ASP M . n 
O  15 11   ALA 11   11   11   ALA ALA M . n 
O  15 12   TRP 12   12   12   TRP TRP M . n 
O  15 13   GLU 13   13   13   GLU GLU M . n 
O  15 14   ASN 14   14   14   ASN ASN M . n 
O  15 15   PRO 15   15   15   PRO PRO M . n 
O  15 16   GLY 16   16   16   GLY GLY M . n 
O  15 17   ASP 17   17   17   ASP ASP M . n 
O  15 18   GLY 18   18   18   GLY GLY M . n 
O  15 19   GLN 19   19   19   GLN GLN M . n 
O  15 20   LEU 20   20   20   LEU LEU M . n 
O  15 21   ALA 21   21   21   ALA ALA M . n 
O  15 22   GLU 22   22   22   GLU GLU M . n 
O  15 23   LEU 23   23   23   LEU LEU M . n 
O  15 24   GLN 24   24   24   GLN GLN M . n 
O  15 25   TRP 25   25   25   TRP TRP M . n 
O  15 26   GLN 26   26   26   GLN GLN M . n 
O  15 27   ARG 27   27   27   ARG ARG M . n 
O  15 28   GLN 28   28   28   GLN GLN M . n 
O  15 29   GLN 29   29   29   GLN GLN M . n 
O  15 30   GLU 30   30   30   GLU GLU M . n 
O  15 31   TRP 31   31   31   TRP TRP M . n 
O  15 32   ARG 32   32   32   ARG ARG M . n 
O  15 33   ASN 33   33   33   ASN ASN M . n 
O  15 34   GLU 34   34   34   GLU GLU M . n 
O  15 35   GLY 35   35   35   GLY GLY M . n 
O  15 36   ALA 36   36   36   ALA ALA M . n 
O  15 37   VAL 37   37   37   VAL VAL M . n 
O  15 38   GLU 38   38   38   GLU GLU M . n 
O  15 39   ARG 39   39   39   ARG ARG M . n 
O  15 40   ILE 40   40   40   ILE ILE M . n 
O  15 41   GLU 41   41   41   GLU GLU M . n 
O  15 42   ARG 42   42   42   ARG ARG M . n 
O  15 43   PRO 43   43   43   PRO PRO M . n 
O  15 44   THR 44   44   44   THR THR M . n 
O  15 45   ARG 45   45   45   ARG ARG M . n 
O  15 46   LEU 46   46   46   LEU LEU M . n 
O  15 47   ASP 47   47   47   ASP ASP M . n 
O  15 48   LYS 48   48   48   LYS LYS M . n 
O  15 49   ALA 49   49   49   ALA ALA M . n 
O  15 50   ARG 50   50   50   ARG ARG M . n 
O  15 51   SER 51   51   51   SER SER M . n 
O  15 52   GLN 52   52   52   GLN GLN M . n 
O  15 53   GLY 53   53   53   GLY GLY M . n 
O  15 54   TYR 54   54   54   TYR TYR M . n 
O  15 55   LYS 55   55   55   LYS LYS M . n 
O  15 56   ALA 56   56   56   ALA ALA M . n 
O  15 57   LYS 57   57   57   LYS LYS M . n 
O  15 58   GLN 58   58   58   GLN GLN M . n 
O  15 59   GLY 59   59   59   GLY GLY M . n 
O  15 60   VAL 60   60   60   VAL VAL M . n 
O  15 61   ILE 61   61   61   ILE ILE M . n 
O  15 62   VAL 62   62   62   VAL VAL M . n 
O  15 63   ALA 63   63   63   ALA ALA M . n 
O  15 64   ARG 64   64   64   ARG ARG M . n 
O  15 65   VAL 65   65   65   VAL VAL M . n 
O  15 66   SER 66   66   66   SER SER M . n 
O  15 67   VAL 67   67   67   VAL VAL M . n 
O  15 68   ARG 68   68   68   ARG ARG M . n 
O  15 69   LYS 69   69   69   LYS LYS M . n 
O  15 70   GLY 70   70   70   GLY GLY M . n 
O  15 71   SER 71   71   71   SER SER M . n 
O  15 72   ALA 72   72   72   ALA ALA M . n 
O  15 73   ARG 73   73   73   ARG ARG M . n 
O  15 74   LYS 74   74   74   LYS LYS M . n 
O  15 75   ARG 75   75   75   ARG ARG M . n 
O  15 76   ARG 76   76   76   ARG ARG M . n 
O  15 77   HIS 77   77   77   HIS HIS M . n 
O  15 78   LYS 78   78   78   LYS LYS M . n 
O  15 79   ALA 79   79   79   ALA ALA M . n 
O  15 80   GLY 80   80   80   GLY GLY M . n 
O  15 81   ARG 81   81   81   ARG ARG M . n 
O  15 82   ARG 82   82   82   ARG ARG M . n 
O  15 83   SER 83   83   83   SER SER M . n 
O  15 84   LYS 84   84   84   LYS LYS M . n 
O  15 85   ARG 85   85   85   ARG ARG M . n 
O  15 86   GLN 86   86   86   GLN GLN M . n 
O  15 87   GLY 87   87   87   GLY GLY M . n 
O  15 88   VAL 88   88   88   VAL VAL M . n 
O  15 89   THR 89   89   89   THR THR M . n 
O  15 90   ARG 90   90   90   ARG ARG M . n 
O  15 91   ILE 91   91   91   ILE ILE M . n 
O  15 92   THR 92   92   92   THR THR M . n 
O  15 93   ARG 93   93   93   ARG ARG M . n 
O  15 94   ARG 94   94   94   ARG ARG M . n 
O  15 95   LYS 95   95   95   LYS LYS M . n 
O  15 96   ASP 96   96   96   ASP ASP M . n 
O  15 97   ILE 97   97   97   ILE ILE M . n 
O  15 98   GLN 98   98   98   GLN GLN M . n 
O  15 99   ARG 99   99   99   ARG ARG M . n 
O  15 100  VAL 100  100  100  VAL VAL M . n 
O  15 101  ALA 101  101  101  ALA ALA M . n 
O  15 102  GLU 102  102  102  GLU GLU M . n 
O  15 103  GLU 103  103  103  GLU GLU M . n 
O  15 104  ARG 104  104  104  ARG ARG M . n 
O  15 105  ALA 105  105  105  ALA ALA M . n 
O  15 106  SER 106  106  106  SER SER M . n 
O  15 107  ARG 107  107  107  ARG ARG M . n 
O  15 108  THR 108  108  108  THR THR M . n 
O  15 109  PHE 109  109  109  PHE PHE M . n 
O  15 110  PRO 110  110  110  PRO PRO M . n 
O  15 111  ASN 111  111  111  ASN ASN M . n 
O  15 112  LEU 112  112  112  LEU LEU M . n 
O  15 113  ARG 113  113  113  ARG ARG M . n 
O  15 114  VAL 114  114  114  VAL VAL M . n 
O  15 115  LEU 115  115  115  LEU LEU M . n 
O  15 116  ASN 116  116  116  ASN ASN M . n 
O  15 117  SER 117  117  117  SER SER M . n 
O  15 118  TYR 118  118  118  TYR TYR M . n 
O  15 119  SER 119  119  119  SER SER M . n 
O  15 120  VAL 120  120  120  VAL VAL M . n 
O  15 121  GLY 121  121  121  GLY GLY M . n 
O  15 122  GLN 122  122  122  GLN GLN M . n 
O  15 123  ASP 123  123  123  ASP ASP M . n 
O  15 124  GLY 124  124  124  GLY GLY M . n 
O  15 125  ARG 125  125  125  ARG ARG M . n 
O  15 126  GLN 126  126  126  GLN GLN M . n 
O  15 127  LYS 127  127  127  LYS LYS M . n 
O  15 128  TRP 128  128  128  TRP TRP M . n 
O  15 129  HIS 129  129  129  HIS HIS M . n 
O  15 130  GLU 130  130  130  GLU GLU M . n 
O  15 131  VAL 131  131  131  VAL VAL M . n 
O  15 132  ILE 132  132  132  ILE ILE M . n 
O  15 133  LEU 133  133  133  LEU LEU M . n 
O  15 134  ILE 134  134  134  ILE ILE M . n 
O  15 135  ASP 135  135  135  ASP ASP M . n 
O  15 136  PRO 136  136  136  PRO PRO M . n 
O  15 137  ASN 137  137  137  ASN ASN M . n 
O  15 138  HIS 138  138  138  HIS HIS M . n 
O  15 139  PRO 139  139  139  PRO PRO M . n 
O  15 140  ALA 140  140  140  ALA ALA M . n 
O  15 141  ILE 141  141  141  ILE ILE M . n 
O  15 142  GLN 142  142  142  GLN GLN M . n 
O  15 143  ASN 143  143  143  ASN ASN M . n 
O  15 144  ASP 144  144  144  ASP ASP M . n 
O  15 145  ASP 145  145  145  ASP ASP M . n 
O  15 146  ASP 146  146  146  ASP ASP M . n 
O  15 147  LEU 147  147  147  LEU LEU M . n 
O  15 148  SER 148  148  148  SER SER M . n 
O  15 149  TRP 149  149  149  TRP TRP M . n 
O  15 150  ILE 150  150  150  ILE ILE M . n 
O  15 151  CYS 151  151  151  CYS CYS M . n 
O  15 152  ALA 152  152  152  ALA ALA M . n 
O  15 153  ASP 153  153  153  ASP ASP M . n 
O  15 154  ASP 154  154  154  ASP ASP M . n 
O  15 155  GLN 155  155  155  GLN GLN M . n 
O  15 156  ALA 156  156  156  ALA ALA M . n 
O  15 157  ASP 157  157  157  ASP ASP M . n 
O  15 158  ARG 158  158  158  ARG ARG M . n 
O  15 159  VAL 159  159  159  VAL VAL M . n 
O  15 160  PHE 160  160  160  PHE PHE M . n 
O  15 161  ARG 161  161  161  ARG ARG M . n 
O  15 162  GLY 162  162  162  GLY GLY M . n 
O  15 163  LEU 163  163  163  LEU LEU M . n 
O  15 164  THR 164  164  164  THR THR M . n 
O  15 165  GLY 165  165  165  GLY GLY M . n 
O  15 166  ALA 166  166  166  ALA ALA M . n 
O  15 167  GLY 167  167  167  GLY GLY M . n 
O  15 168  ARG 168  168  168  ARG ARG M . n 
O  15 169  ARG 169  169  169  ARG ARG M . n 
O  15 170  ASN 170  170  170  ASN ASN M . n 
O  15 171  ARG 171  171  171  ARG ARG M . n 
O  15 172  GLY 172  172  172  GLY GLY M . n 
O  15 173  LEU 173  173  173  LEU LEU M . n 
O  15 174  SER 174  174  174  SER SER M . n 
O  15 175  GLY 175  175  175  GLY GLY M . n 
O  15 176  LYS 176  176  176  LYS LYS M . n 
O  15 177  GLY 177  177  177  GLY GLY M . n 
O  15 178  LYS 178  178  178  LYS LYS M . n 
O  15 179  GLY 179  179  179  GLY GLY M . n 
O  15 180  SER 180  180  180  SER SER M . n 
O  15 181  GLU 181  181  181  GLU GLU M . n 
O  15 182  LYS 182  182  182  LYS LYS M . n 
O  15 183  THR 183  183  183  THR THR M . n 
O  15 184  ARG 184  184  184  ARG ARG M . n 
O  15 185  PRO 185  185  185  PRO PRO M . n 
O  15 186  SER 186  186  186  SER SER M . n 
O  15 187  LEU 187  187  187  LEU LEU M . n 
O  15 188  ARG 188  188  188  ARG ARG M . n 
O  15 189  SER 189  189  189  SER SER M . n 
O  15 190  ASN 190  190  190  ASN ASN M . n 
O  15 191  GLY 191  191  191  GLY GLY M . n 
O  15 192  GLY 192  192  192  GLY GLY M . n 
O  15 193  LYS 193  193  193  LYS LYS M . n 
O  15 194  GLY 194  194  194  GLY GLY M . n 
P  16 1    MET 1    0    ?    ?   ?   N . n 
P  16 2    ALA 2    1    1    ALA ALA N . n 
P  16 3    THR 3    2    2    THR THR N . n 
P  16 4    GLY 4    3    3    GLY GLY N . n 
P  16 5    PRO 5    4    4    PRO PRO N . n 
P  16 6    ARG 6    5    5    ARG ARG N . n 
P  16 7    TYR 7    6    6    TYR TYR N . n 
P  16 8    LYS 8    7    7    LYS LYS N . n 
P  16 9    VAL 9    8    8    VAL VAL N . n 
P  16 10   PRO 10   9    9    PRO PRO N . n 
P  16 11   MET 11   10   10   MET MET N . n 
P  16 12   ARG 12   11   11   ARG ARG N . n 
P  16 13   ARG 13   12   12   ARG ARG N . n 
P  16 14   ARG 14   13   13   ARG ARG N . n 
P  16 15   ARG 15   14   14   ARG ARG N . n 
P  16 16   GLU 16   15   15   GLU GLU N . n 
P  16 17   ALA 17   16   16   ALA ALA N . n 
P  16 18   ARG 18   17   17   ARG ARG N . n 
P  16 19   THR 19   18   18   THR THR N . n 
P  16 20   ASP 20   19   19   ASP ASP N . n 
P  16 21   TYR 21   20   20   TYR TYR N . n 
P  16 22   HIS 22   21   21   HIS HIS N . n 
P  16 23   GLN 23   22   22   GLN GLN N . n 
P  16 24   ARG 24   23   23   ARG ARG N . n 
P  16 25   LEU 25   24   24   LEU LEU N . n 
P  16 26   ARG 26   25   25   ARG ARG N . n 
P  16 27   LEU 27   26   26   LEU LEU N . n 
P  16 28   LEU 28   27   27   LEU LEU N . n 
P  16 29   LYS 29   28   28   LYS LYS N . n 
P  16 30   SER 30   29   29   SER SER N . n 
P  16 31   GLY 31   30   30   GLY GLY N . n 
P  16 32   LYS 32   31   31   LYS LYS N . n 
P  16 33   PRO 33   32   32   PRO PRO N . n 
P  16 34   ARG 34   33   33   ARG ARG N . n 
P  16 35   LEU 35   34   34   LEU LEU N . n 
P  16 36   VAL 36   35   35   VAL VAL N . n 
P  16 37   ALA 37   36   36   ALA ALA N . n 
P  16 38   ARG 38   37   37   ARG ARG N . n 
P  16 39   LYS 39   38   38   LYS LYS N . n 
P  16 40   SER 40   39   39   SER SER N . n 
P  16 41   ASN 41   40   40   ASN ASN N . n 
P  16 42   LYS 42   41   41   LYS LYS N . n 
P  16 43   HIS 43   42   42   HIS HIS N . n 
P  16 44   VAL 44   43   43   VAL VAL N . n 
P  16 45   ARG 45   44   44   ARG ARG N . n 
P  16 46   ALA 46   45   45   ALA ALA N . n 
P  16 47   GLN 47   46   46   GLN GLN N . n 
P  16 48   LEU 48   47   47   LEU LEU N . n 
P  16 49   VAL 49   48   48   VAL VAL N . n 
P  16 50   THR 50   49   49   THR THR N . n 
P  16 51   LEU 51   50   50   LEU LEU N . n 
P  16 52   GLY 52   51   51   GLY GLY N . n 
P  16 53   PRO 53   52   52   PRO PRO N . n 
P  16 54   ASN 54   53   53   ASN ASN N . n 
P  16 55   GLY 55   54   54   GLY GLY N . n 
P  16 56   ASP 56   55   55   ASP ASP N . n 
P  16 57   ASP 57   56   56   ASP ASP N . n 
P  16 58   THR 58   57   57   THR THR N . n 
P  16 59   LEU 59   58   58   LEU LEU N . n 
P  16 60   ALA 60   59   59   ALA ALA N . n 
P  16 61   SER 61   60   60   SER SER N . n 
P  16 62   ALA 62   61   61   ALA ALA N . n 
P  16 63   HIS 63   62   62   HIS HIS N . n 
P  16 64   SER 64   63   63   SER SER N . n 
P  16 65   SER 65   64   64   SER SER N . n 
P  16 66   ASP 66   65   65   ASP ASP N . n 
P  16 67   LEU 67   66   66   LEU LEU N . n 
P  16 68   ALA 68   67   67   ALA ALA N . n 
P  16 69   GLU 69   68   68   GLU GLU N . n 
P  16 70   TYR 70   69   69   TYR TYR N . n 
P  16 71   GLY 71   70   70   GLY GLY N . n 
P  16 72   TRP 72   71   71   TRP TRP N . n 
P  16 73   GLU 73   72   72   GLU GLU N . n 
P  16 74   ALA 74   73   73   ALA ALA N . n 
P  16 75   PRO 75   74   74   PRO PRO N . n 
P  16 76   THR 76   75   75   THR THR N . n 
P  16 77   GLY 77   76   76   GLY GLY N . n 
P  16 78   ASN 78   77   77   ASN ASN N . n 
P  16 79   MET 79   78   78   MET MET N . n 
P  16 80   PRO 80   79   79   PRO PRO N . n 
P  16 81   SER 81   80   80   SER SER N . n 
P  16 82   ALA 82   81   81   ALA ALA N . n 
P  16 83   TYR 83   82   82   TYR TYR N . n 
P  16 84   LEU 84   83   83   LEU LEU N . n 
P  16 85   THR 85   84   84   THR THR N . n 
P  16 86   GLY 86   85   85   GLY GLY N . n 
P  16 87   LEU 87   86   86   LEU LEU N . n 
P  16 88   LEU 88   87   87   LEU LEU N . n 
P  16 89   ALA 89   88   88   ALA ALA N . n 
P  16 90   GLY 90   89   89   GLY GLY N . n 
P  16 91   LEU 91   90   90   LEU LEU N . n 
P  16 92   ARG 92   91   91   ARG ARG N . n 
P  16 93   ALA 93   92   92   ALA ALA N . n 
P  16 94   GLN 94   93   93   GLN GLN N . n 
P  16 95   GLU 95   94   94   GLU GLU N . n 
P  16 96   ALA 96   95   95   ALA ALA N . n 
P  16 97   GLY 97   96   96   GLY GLY N . n 
P  16 98   VAL 98   97   97   VAL VAL N . n 
P  16 99   GLU 99   98   98   GLU GLU N . n 
P  16 100  GLU 100  99   99   GLU GLU N . n 
P  16 101  ALA 101  100  100  ALA ALA N . n 
P  16 102  VAL 102  101  101  VAL VAL N . n 
P  16 103  LEU 103  102  102  LEU LEU N . n 
P  16 104  ASP 104  103  103  ASP ASP N . n 
P  16 105  ILE 105  104  104  ILE ILE N . n 
P  16 106  GLY 106  105  105  GLY GLY N . n 
P  16 107  LEU 107  106  106  LEU LEU N . n 
P  16 108  ASN 108  107  107  ASN ASN N . n 
P  16 109  SER 109  108  108  SER SER N . n 
P  16 110  PRO 110  109  109  PRO PRO N . n 
P  16 111  THR 111  110  110  THR THR N . n 
P  16 112  PRO 112  111  111  PRO PRO N . n 
P  16 113  GLY 113  112  112  GLY GLY N . n 
P  16 114  SER 114  113  113  SER SER N . n 
P  16 115  LYS 115  114  114  LYS LYS N . n 
P  16 116  VAL 116  115  115  VAL VAL N . n 
P  16 117  PHE 117  116  116  PHE PHE N . n 
P  16 118  ALA 118  117  117  ALA ALA N . n 
P  16 119  ILE 119  118  118  ILE ILE N . n 
P  16 120  GLN 120  119  119  GLN GLN N . n 
P  16 121  GLU 121  120  120  GLU GLU N . n 
P  16 122  GLY 122  121  121  GLY GLY N . n 
P  16 123  ALA 123  122  122  ALA ALA N . n 
P  16 124  ILE 124  123  123  ILE ILE N . n 
P  16 125  ASP 125  124  124  ASP ASP N . n 
P  16 126  ALA 126  125  125  ALA ALA N . n 
P  16 127  GLY 127  126  126  GLY GLY N . n 
P  16 128  LEU 128  127  127  LEU LEU N . n 
P  16 129  ASP 129  128  128  ASP ASP N . n 
P  16 130  ILE 130  129  129  ILE ILE N . n 
P  16 131  PRO 131  130  130  PRO PRO N . n 
P  16 132  HIS 132  131  131  HIS HIS N . n 
P  16 133  ASN 133  132  132  ASN ASN N . n 
P  16 134  ASP 134  133  133  ASP ASP N . n 
P  16 135  ASP 135  134  134  ASP ASP N . n 
P  16 136  VAL 136  135  135  VAL VAL N . n 
P  16 137  LEU 137  136  136  LEU LEU N . n 
P  16 138  ALA 138  137  137  ALA ALA N . n 
P  16 139  ASP 139  138  138  ASP ASP N . n 
P  16 140  TRP 140  139  139  TRP TRP N . n 
P  16 141  GLN 141  140  140  GLN GLN N . n 
P  16 142  ARG 142  141  141  ARG ARG N . n 
P  16 143  THR 143  142  142  THR THR N . n 
P  16 144  ARG 144  143  143  ARG ARG N . n 
P  16 145  GLY 145  144  144  GLY GLY N . n 
P  16 146  ALA 146  145  145  ALA ALA N . n 
P  16 147  HIS 147  146  146  HIS HIS N . n 
P  16 148  ILE 148  147  147  ILE ILE N . n 
P  16 149  ALA 149  148  148  ALA ALA N . n 
P  16 150  GLU 150  149  149  GLU GLU N . n 
P  16 151  TYR 151  150  150  TYR TYR N . n 
P  16 152  ASP 152  151  151  ASP ASP N . n 
P  16 153  GLU 153  152  152  GLU GLU N . n 
P  16 154  GLN 154  153  153  GLN GLN N . n 
P  16 155  LEU 155  154  154  LEU LEU N . n 
P  16 156  GLU 156  155  155  GLU GLU N . n 
P  16 157  GLU 157  156  156  GLU GLU N . n 
P  16 158  PRO 158  157  157  PRO PRO N . n 
P  16 159  LEU 159  158  158  LEU LEU N . n 
P  16 160  TYR 160  159  159  TYR TYR N . n 
P  16 161  SER 161  160  160  SER SER N . n 
P  16 162  GLY 162  161  161  GLY GLY N . n 
P  16 163  ASP 163  162  162  ASP ASP N . n 
P  16 164  PHE 164  163  163  PHE PHE N . n 
P  16 165  ASP 165  164  164  ASP ASP N . n 
P  16 166  ALA 166  165  165  ALA ALA N . n 
P  16 167  ALA 167  166  166  ALA ALA N . n 
P  16 168  ASP 168  167  167  ASP ASP N . n 
P  16 169  LEU 169  168  168  LEU LEU N . n 
P  16 170  PRO 170  169  169  PRO PRO N . n 
P  16 171  GLU 171  170  170  GLU GLU N . n 
P  16 172  HIS 172  171  171  HIS HIS N . n 
P  16 173  PHE 173  172  172  PHE PHE N . n 
P  16 174  ASP 174  173  173  ASP ASP N . n 
P  16 175  GLU 175  174  174  GLU GLU N . n 
P  16 176  LEU 176  175  175  LEU LEU N . n 
P  16 177  ARG 177  176  176  ARG ARG N . n 
P  16 178  GLU 178  177  177  GLU GLU N . n 
P  16 179  THR 179  178  178  THR THR N . n 
P  16 180  LEU 180  179  179  LEU LEU N . n 
P  16 181  LEU 181  180  180  LEU LEU N . n 
P  16 182  ASP 182  181  181  ASP ASP N . n 
P  16 183  GLY 183  182  182  GLY GLY N . n 
P  16 184  ASP 184  183  183  ASP ASP N . n 
P  16 185  ILE 185  184  184  ILE ILE N . n 
P  16 186  GLU 186  185  185  GLU GLU N . n 
P  16 187  LEU 187  186  186  LEU LEU N . n 
Q  17 1    MET 1    0    ?    ?   ?   O . n 
Q  17 2    SER 2    1    1    SER SER O . n 
Q  17 3    LYS 3    2    2    LYS LYS O . n 
Q  17 4    THR 4    3    3    THR THR O . n 
Q  17 5    ASN 5    4    4    ASN ASN O . n 
Q  17 6    PRO 6    5    5    PRO PRO O . n 
Q  17 7    ARG 7    6    6    ARG ARG O . n 
Q  17 8    LEU 8    7    7    LEU LEU O . n 
Q  17 9    SER 9    8    8    SER SER O . n 
Q  17 10   SER 10   9    9    SER SER O . n 
Q  17 11   LEU 11   10   10   LEU LEU O . n 
Q  17 12   ILE 12   11   11   ILE ILE O . n 
Q  17 13   ALA 13   12   12   ALA ALA O . n 
Q  17 14   ASP 14   13   13   ASP ASP O . n 
Q  17 15   LEU 15   14   14   LEU LEU O . n 
Q  17 16   LYS 16   15   15   LYS LYS O . n 
Q  17 17   SER 17   16   16   SER SER O . n 
Q  17 18   ALA 18   17   17   ALA ALA O . n 
Q  17 19   ALA 19   18   18   ALA ALA O . n 
Q  17 20   ARG 20   19   19   ARG ARG O . n 
Q  17 21   SER 21   20   20   SER SER O . n 
Q  17 22   SER 22   21   21   SER SER O . n 
Q  17 23   GLY 23   22   22   GLY GLY O . n 
Q  17 24   GLY 24   23   23   GLY GLY O . n 
Q  17 25   ALA 25   24   24   ALA ALA O . n 
Q  17 26   VAL 26   25   25   VAL VAL O . n 
Q  17 27   TRP 27   26   26   TRP TRP O . n 
Q  17 28   GLY 28   27   27   GLY GLY O . n 
Q  17 29   ASP 29   28   28   ASP ASP O . n 
Q  17 30   VAL 30   29   29   VAL VAL O . n 
Q  17 31   ALA 31   30   30   ALA ALA O . n 
Q  17 32   GLU 32   31   31   GLU GLU O . n 
Q  17 33   ARG 33   32   32   ARG ARG O . n 
Q  17 34   LEU 34   33   33   LEU LEU O . n 
Q  17 35   GLU 35   34   34   GLU GLU O . n 
Q  17 36   LYS 36   35   35   LYS LYS O . n 
Q  17 37   PRO 37   36   36   PRO PRO O . n 
Q  17 38   ARG 38   37   37   ARG ARG O . n 
Q  17 39   ARG 39   38   38   ARG ARG O . n 
Q  17 40   THR 40   39   39   THR THR O . n 
Q  17 41   HIS 41   40   40   HIS HIS O . n 
Q  17 42   ALA 42   41   41   ALA ALA O . n 
Q  17 43   GLU 43   42   42   GLU GLU O . n 
Q  17 44   VAL 44   43   43   VAL VAL O . n 
Q  17 45   ASN 45   44   44   ASN ASN O . n 
Q  17 46   LEU 46   45   45   LEU LEU O . n 
Q  17 47   GLY 47   46   46   GLY GLY O . n 
Q  17 48   ARG 48   47   47   ARG ARG O . n 
Q  17 49   ILE 49   48   48   ILE ILE O . n 
Q  17 50   GLU 50   49   49   GLU GLU O . n 
Q  17 51   ARG 51   50   50   ARG ARG O . n 
Q  17 52   TYR 52   51   51   TYR TYR O . n 
Q  17 53   ALA 53   52   52   ALA ALA O . n 
Q  17 54   GLN 54   53   53   GLN GLN O . n 
Q  17 55   GLU 55   54   54   GLU GLU O . n 
Q  17 56   ASP 56   55   55   ASP ASP O . n 
Q  17 57   GLU 57   56   56   GLU GLU O . n 
Q  17 58   THR 58   57   57   THR THR O . n 
Q  17 59   VAL 59   58   58   VAL VAL O . n 
Q  17 60   VAL 60   59   59   VAL VAL O . n 
Q  17 61   VAL 61   60   60   VAL VAL O . n 
Q  17 62   PRO 62   61   61   PRO PRO O . n 
Q  17 63   GLY 63   62   62   GLY GLY O . n 
Q  17 64   LYS 64   63   63   LYS LYS O . n 
Q  17 65   VAL 65   64   64   VAL VAL O . n 
Q  17 66   LEU 66   65   65   LEU LEU O . n 
Q  17 67   GLY 67   66   66   GLY GLY O . n 
Q  17 68   SER 68   67   67   SER SER O . n 
Q  17 69   GLY 69   68   68   GLY GLY O . n 
Q  17 70   VAL 70   69   69   VAL VAL O . n 
Q  17 71   LEU 71   70   70   LEU LEU O . n 
Q  17 72   GLN 72   71   71   GLN GLN O . n 
Q  17 73   LYS 73   72   72   LYS LYS O . n 
Q  17 74   ASP 74   73   73   ASP ASP O . n 
Q  17 75   VAL 75   74   74   VAL VAL O . n 
Q  17 76   THR 76   75   75   THR THR O . n 
Q  17 77   VAL 77   76   76   VAL VAL O . n 
Q  17 78   ALA 78   77   77   ALA ALA O . n 
Q  17 79   ALA 79   78   78   ALA ALA O . n 
Q  17 80   VAL 80   79   79   VAL VAL O . n 
Q  17 81   ASP 81   80   80   ASP ASP O . n 
Q  17 82   PHE 82   81   81   PHE PHE O . n 
Q  17 83   SER 83   82   82   SER SER O . n 
Q  17 84   GLY 84   83   83   GLY GLY O . n 
Q  17 85   THR 85   84   84   THR THR O . n 
Q  17 86   ALA 86   85   85   ALA ALA O . n 
Q  17 87   GLU 87   86   86   GLU GLU O . n 
Q  17 88   THR 88   87   87   THR THR O . n 
Q  17 89   LYS 89   88   88   LYS LYS O . n 
Q  17 90   ILE 90   89   89   ILE ILE O . n 
Q  17 91   ASP 91   90   90   ASP ASP O . n 
Q  17 92   GLN 92   91   91   GLN GLN O . n 
Q  17 93   VAL 93   92   92   VAL VAL O . n 
Q  17 94   GLY 94   93   93   GLY GLY O . n 
Q  17 95   GLU 95   94   94   GLU GLU O . n 
Q  17 96   ALA 96   95   95   ALA ALA O . n 
Q  17 97   VAL 97   96   96   VAL VAL O . n 
Q  17 98   SER 98   97   97   SER SER O . n 
Q  17 99   LEU 99   98   98   LEU LEU O . n 
Q  17 100  GLU 100  99   99   GLU GLU O . n 
Q  17 101  GLN 101  100  100  GLN GLN O . n 
Q  17 102  ALA 102  101  101  ALA ALA O . n 
Q  17 103  ILE 103  102  102  ILE ILE O . n 
Q  17 104  GLU 104  103  103  GLU GLU O . n 
Q  17 105  ASN 105  104  104  ASN ASN O . n 
Q  17 106  ASN 106  105  105  ASN ASN O . n 
Q  17 107  PRO 107  106  106  PRO PRO O . n 
Q  17 108  GLU 108  107  107  GLU GLU O . n 
Q  17 109  GLY 109  108  108  GLY GLY O . n 
Q  17 110  SER 110  109  109  SER SER O . n 
Q  17 111  HIS 111  110  110  HIS HIS O . n 
Q  17 112  VAL 112  111  111  VAL VAL O . n 
Q  17 113  ARG 113  112  112  ARG ARG O . n 
Q  17 114  VAL 114  113  113  VAL VAL O . n 
Q  17 115  ILE 115  114  114  ILE ILE O . n 
Q  17 116  ARG 116  115  115  ARG ARG O . n 
R  18 1    MET 1    0    ?    ?   ?   P . n 
R  18 2    THR 2    1    1    THR THR P . n 
R  18 3    ASP 3    2    2    ASP ASP P . n 
R  18 4    LEU 4    3    3    LEU LEU P . n 
R  18 5    SER 5    4    4    SER SER P . n 
R  18 6    ALA 6    5    5    ALA ALA P . n 
R  18 7    GLN 7    6    6    GLN GLN P . n 
R  18 8    LYS 8    7    7    LYS LYS P . n 
R  18 9    ARG 9    8    8    ARG ARG P . n 
R  18 10   LEU 10   9    9    LEU LEU P . n 
R  18 11   ALA 11   10   10   ALA ALA P . n 
R  18 12   ALA 12   11   11   ALA ALA P . n 
R  18 13   ASP 13   12   12   ASP ASP P . n 
R  18 14   VAL 14   13   13   VAL VAL P . n 
R  18 15   LEU 15   14   14   LEU LEU P . n 
R  18 16   ASP 16   15   15   ASP ASP P . n 
R  18 17   VAL 17   16   16   VAL VAL P . n 
R  18 18   GLY 18   17   17   GLY GLY P . n 
R  18 19   LYS 19   18   18   LYS LYS P . n 
R  18 20   ASN 20   19   19   ASN ASN P . n 
R  18 21   ARG 21   20   20   ARG ARG P . n 
R  18 22   VAL 22   21   21   VAL VAL P . n 
R  18 23   TRP 23   22   22   TRP TRP P . n 
R  18 24   PHE 24   23   23   PHE PHE P . n 
R  18 25   ASN 25   24   24   ASN ASN P . n 
R  18 26   PRO 26   25   25   PRO PRO P . n 
R  18 27   GLU 27   26   26   GLU GLU P . n 
R  18 28   ARG 28   27   27   ARG ARG P . n 
R  18 29   GLN 29   28   28   GLN GLN P . n 
R  18 30   GLY 30   29   29   GLY GLY P . n 
R  18 31   ASP 31   30   30   ASP ASP P . n 
R  18 32   ILE 32   31   31   ILE ILE P . n 
R  18 33   ALA 33   32   32   ALA ALA P . n 
R  18 34   ASP 34   33   33   ASP ASP P . n 
R  18 35   ALA 35   34   34   ALA ALA P . n 
R  18 36   ILE 36   35   35   ILE ILE P . n 
R  18 37   THR 37   36   36   THR THR P . n 
R  18 38   ARG 38   37   37   ARG ARG P . n 
R  18 39   GLU 39   38   38   GLU GLU P . n 
R  18 40   ASP 40   39   39   ASP ASP P . n 
R  18 41   VAL 41   40   40   VAL VAL P . n 
R  18 42   ARG 42   41   41   ARG ARG P . n 
R  18 43   GLU 43   42   42   GLU GLU P . n 
R  18 44   LEU 44   43   43   LEU LEU P . n 
R  18 45   VAL 45   44   44   VAL VAL P . n 
R  18 46   ASP 46   45   45   ASP ASP P . n 
R  18 47   GLU 47   46   46   GLU GLU P . n 
R  18 48   GLY 48   47   47   GLY GLY P . n 
R  18 49   ALA 49   48   48   ALA ALA P . n 
R  18 50   ILE 50   49   49   ILE ILE P . n 
R  18 51   GLN 51   50   50   GLN GLN P . n 
R  18 52   ALA 52   51   51   ALA ALA P . n 
R  18 53   LYS 53   52   52   LYS LYS P . n 
R  18 54   ASP 54   53   53   ASP ASP P . n 
R  18 55   LYS 55   54   54   LYS LYS P . n 
R  18 56   LYS 56   55   55   LYS LYS P . n 
R  18 57   GLY 57   56   56   GLY GLY P . n 
R  18 58   ASN 58   57   57   ASN ASN P . n 
R  18 59   SER 59   58   58   SER SER P . n 
R  18 60   ARG 60   59   59   ARG ARG P . n 
R  18 61   GLY 61   60   60   GLY GLY P . n 
R  18 62   ARG 62   61   61   ARG ARG P . n 
R  18 63   ALA 63   62   62   ALA ALA P . n 
R  18 64   ARG 64   63   63   ARG ARG P . n 
R  18 65   GLU 65   64   64   GLU GLU P . n 
R  18 66   ARG 66   65   65   ARG ARG P . n 
R  18 67   GLN 67   66   66   GLN GLN P . n 
R  18 68   LYS 68   67   67   LYS LYS P . n 
R  18 69   LYS 69   68   68   LYS LYS P . n 
R  18 70   ARG 70   69   69   ARG ARG P . n 
R  18 71   ALA 71   70   70   ALA ALA P . n 
R  18 72   TYR 72   71   71   TYR TYR P . n 
R  18 73   GLY 73   72   72   GLY GLY P . n 
R  18 74   HIS 74   73   73   HIS HIS P . n 
R  18 75   GLN 75   74   74   GLN GLN P . n 
R  18 76   LYS 76   75   75   LYS LYS P . n 
R  18 77   GLY 77   76   76   GLY GLY P . n 
R  18 78   ALA 78   77   77   ALA ALA P . n 
R  18 79   GLY 79   78   78   GLY GLY P . n 
R  18 80   SER 80   79   79   SER SER P . n 
R  18 81   ARG 81   80   80   ARG ARG P . n 
R  18 82   LYS 82   81   81   LYS LYS P . n 
R  18 83   GLY 83   82   82   GLY GLY P . n 
R  18 84   LYS 84   83   83   LYS LYS P . n 
R  18 85   ALA 85   84   84   ALA ALA P . n 
R  18 86   GLY 86   85   85   GLY GLY P . n 
R  18 87   ALA 87   86   86   ALA ALA P . n 
R  18 88   ARG 88   87   87   ARG ARG P . n 
R  18 89   GLN 89   88   88   GLN GLN P . n 
R  18 90   ASN 90   89   89   ASN ASN P . n 
R  18 91   SER 91   90   90   SER SER P . n 
R  18 92   LYS 92   91   91   LYS LYS P . n 
R  18 93   GLU 93   92   92   GLU GLU P . n 
R  18 94   ASP 94   93   93   ASP ASP P . n 
R  18 95   TRP 95   94   94   TRP TRP P . n 
R  18 96   GLU 96   95   95   GLU GLU P . n 
R  18 97   SER 97   96   96   SER SER P . n 
R  18 98   ARG 98   97   97   ARG ARG P . n 
R  18 99   ILE 99   98   98   ILE ILE P . n 
R  18 100  ARG 100  99   99   ARG ARG P . n 
R  18 101  ALA 101  100  100  ALA ALA P . n 
R  18 102  GLN 102  101  101  GLN GLN P . n 
R  18 103  ARG 103  102  102  ARG ARG P . n 
R  18 104  THR 104  103  103  THR THR P . n 
R  18 105  LYS 105  104  104  LYS LYS P . n 
R  18 106  LEU 106  105  105  LEU LEU P . n 
R  18 107  ARG 107  106  106  ARG ARG P . n 
R  18 108  GLU 108  107  107  GLU GLU P . n 
R  18 109  LEU 109  108  108  LEU LEU P . n 
R  18 110  ARG 110  109  109  ARG ARG P . n 
R  18 111  ASP 111  110  110  ASP ASP P . n 
R  18 112  GLU 112  111  111  GLU GLU P . n 
R  18 113  GLY 113  112  112  GLY GLY P . n 
R  18 114  THR 114  113  113  THR THR P . n 
R  18 115  LEU 115  114  114  LEU LEU P . n 
R  18 116  SER 116  115  115  SER SER P . n 
R  18 117  SER 117  116  116  SER SER P . n 
R  18 118  SER 118  117  117  SER SER P . n 
R  18 119  GLN 119  118  118  GLN GLN P . n 
R  18 120  TYR 120  119  119  TYR TYR P . n 
R  18 121  ARG 121  120  120  ARG ARG P . n 
R  18 122  ASP 122  121  121  ASP ASP P . n 
R  18 123  LEU 123  122  122  LEU LEU P . n 
R  18 124  TYR 124  123  123  TYR TYR P . n 
R  18 125  ASP 125  124  124  ASP ASP P . n 
R  18 126  LYS 126  125  125  LYS LYS P . n 
R  18 127  ALA 127  126  126  ALA ALA P . n 
R  18 128  GLY 128  127  127  GLY GLY P . n 
R  18 129  GLY 129  128  128  GLY GLY P . n 
R  18 130  GLY 130  129  129  GLY GLY P . n 
R  18 131  GLU 131  130  130  GLU GLU P . n 
R  18 132  PHE 132  131  131  PHE PHE P . n 
R  18 133  ASP 133  132  132  ASP ASP P . n 
R  18 134  SER 134  133  133  SER SER P . n 
R  18 135  VAL 135  134  134  VAL VAL P . n 
R  18 136  ALA 136  135  135  ALA ALA P . n 
R  18 137  ASP 137  136  136  ASP ASP P . n 
R  18 138  LEU 138  137  137  LEU LEU P . n 
R  18 139  GLU 139  138  138  GLU GLU P . n 
R  18 140  ARG 140  139  139  ARG ARG P . n 
R  18 141  TYR 141  140  140  TYR TYR P . n 
R  18 142  ILE 142  141  141  ILE ILE P . n 
R  18 143  ASP 143  142  142  ASP ASP P . n 
R  18 144  ALA 144  143  143  ALA ALA P . n 
R  18 145  ASN 145  144  ?    ?   ?   P . n 
R  18 146  HIS 146  145  ?    ?   ?   P . n 
R  18 147  GLY 147  146  ?    ?   ?   P . n 
R  18 148  ASP 148  147  ?    ?   ?   P . n 
R  18 149  ALA 149  148  ?    ?   ?   P . n 
S  19 1    MET 1    0    ?    ?   ?   Q . n 
S  19 2    PRO 2    1    1    PRO PRO Q . n 
S  19 3    SER 3    2    2    SER SER Q . n 
S  19 4    SER 4    3    3    SER SER Q . n 
S  19 5    ASN 5    4    4    ASN ASN Q . n 
S  19 6    GLY 6    5    5    GLY GLY Q . n 
S  19 7    PRO 7    6    6    PRO PRO Q . n 
S  19 8    LEU 8    7    7    LEU LEU Q . n 
S  19 9    GLU 9    8    8    GLU GLU Q . n 
S  19 10   GLY 10   9    9    GLY GLY Q . n 
S  19 11   THR 11   10   10   THR THR Q . n 
S  19 12   ARG 12   11   11   ARG ARG Q . n 
S  19 13   GLY 13   12   12   GLY GLY Q . n 
S  19 14   LYS 14   13   13   LYS LYS Q . n 
S  19 15   LEU 15   14   14   LEU LEU Q . n 
S  19 16   LYS 16   15   15   LYS LYS Q . n 
S  19 17   ASN 17   16   16   ASN ASN Q . n 
S  19 18   LYS 18   17   17   LYS LYS Q . n 
S  19 19   PRO 19   18   18   PRO PRO Q . n 
S  19 20   ARG 20   19   19   ARG ARG Q . n 
S  19 21   ASP 21   20   20   ASP ASP Q . n 
S  19 22   ARG 22   21   21   ARG ARG Q . n 
S  19 23   GLY 23   22   22   GLY GLY Q . n 
S  19 24   THR 24   23   23   THR THR Q . n 
S  19 25   SER 25   24   24   SER SER Q . n 
S  19 26   PRO 26   25   25   PRO PRO Q . n 
S  19 27   PRO 27   26   26   PRO PRO Q . n 
S  19 28   GLN 28   27   27   GLN GLN Q . n 
S  19 29   ARG 29   28   28   ARG ARG Q . n 
S  19 30   ALA 30   29   29   ALA ALA Q . n 
S  19 31   VAL 31   30   30   VAL VAL Q . n 
S  19 32   GLU 32   31   31   GLU GLU Q . n 
S  19 33   GLU 33   32   32   GLU GLU Q . n 
S  19 34   PHE 34   33   33   PHE PHE Q . n 
S  19 35   ASP 35   34   34   ASP ASP Q . n 
S  19 36   ASP 36   35   35   ASP ASP Q . n 
S  19 37   GLY 37   36   36   GLY GLY Q . n 
S  19 38   GLU 38   37   37   GLU GLU Q . n 
S  19 39   LYS 39   38   38   LYS LYS Q . n 
S  19 40   VAL 40   39   39   VAL VAL Q . n 
S  19 41   HIS 41   40   40   HIS HIS Q . n 
S  19 42   LEU 42   41   41   LEU LEU Q . n 
S  19 43   LYS 43   42   42   LYS LYS Q . n 
S  19 44   ILE 44   43   43   ILE ILE Q . n 
S  19 45   ASP 45   44   44   ASP ASP Q . n 
S  19 46   PRO 46   45   45   PRO PRO Q . n 
S  19 47   SER 47   46   46   SER SER Q . n 
S  19 48   VAL 48   47   47   VAL VAL Q . n 
S  19 49   PRO 49   48   48   PRO PRO Q . n 
S  19 50   ASN 50   49   49   ASN ASN Q . n 
S  19 51   GLY 51   50   50   GLY GLY Q . n 
S  19 52   ARG 52   51   51   ARG ARG Q . n 
S  19 53   PHE 53   52   52   PHE PHE Q . n 
S  19 54   HIS 54   53   53   HIS HIS Q . n 
S  19 55   PRO 55   54   54   PRO PRO Q . n 
S  19 56   ARG 56   55   55   ARG ARG Q . n 
S  19 57   PHE 57   56   56   PHE PHE Q . n 
S  19 58   ASP 58   57   57   ASP ASP Q . n 
S  19 59   GLY 59   58   58   GLY GLY Q . n 
S  19 60   GLN 60   59   59   GLN GLN Q . n 
S  19 61   THR 61   60   60   THR THR Q . n 
S  19 62   GLY 62   61   61   GLY GLY Q . n 
S  19 63   THR 63   62   62   THR THR Q . n 
S  19 64   VAL 64   63   63   VAL VAL Q . n 
S  19 65   GLU 65   64   64   GLU GLU Q . n 
S  19 66   GLY 66   65   65   GLY GLY Q . n 
S  19 67   LYS 67   66   66   LYS LYS Q . n 
S  19 68   GLN 68   67   67   GLN GLN Q . n 
S  19 69   GLY 69   68   68   GLY GLY Q . n 
S  19 70   ASP 70   69   69   ASP ASP Q . n 
S  19 71   ALA 71   70   70   ALA ALA Q . n 
S  19 72   TYR 72   71   71   TYR TYR Q . n 
S  19 73   LYS 73   72   72   LYS LYS Q . n 
S  19 74   VAL 74   73   73   VAL VAL Q . n 
S  19 75   ASP 75   74   74   ASP ASP Q . n 
S  19 76   ILE 76   75   75   ILE ILE Q . n 
S  19 77   VAL 77   76   76   VAL VAL Q . n 
S  19 78   ASP 78   77   77   ASP ASP Q . n 
S  19 79   GLY 79   78   78   GLY GLY Q . n 
S  19 80   GLY 80   79   79   GLY GLY Q . n 
S  19 81   LYS 81   80   80   LYS LYS Q . n 
S  19 82   GLU 82   81   81   GLU GLU Q . n 
S  19 83   LYS 83   82   82   LYS LYS Q . n 
S  19 84   THR 84   83   83   THR THR Q . n 
S  19 85   ILE 85   84   84   ILE ILE Q . n 
S  19 86   ILE 86   85   85   ILE ILE Q . n 
S  19 87   VAL 87   86   86   VAL VAL Q . n 
S  19 88   THR 88   87   87   THR THR Q . n 
S  19 89   ALA 89   88   88   ALA ALA Q . n 
S  19 90   ALA 90   89   89   ALA ALA Q . n 
S  19 91   HIS 91   90   90   HIS HIS Q . n 
S  19 92   LEU 92   91   91   LEU LEU Q . n 
S  19 93   ARG 93   92   92   ARG ARG Q . n 
S  19 94   ARG 94   93   93   ARG ARG Q . n 
S  19 95   GLN 95   94   94   GLN GLN Q . n 
S  19 96   GLU 96   95   95   GLU GLU Q . n 
T  20 1    MET 1    0    ?    ?   ?   R . n 
T  20 2    GLY 2    1    1    GLY GLY R . n 
T  20 3    ILE 3    2    2    ILE ILE R . n 
T  20 4    SER 4    3    3    SER SER R . n 
T  20 5    TYR 5    4    4    TYR TYR R . n 
T  20 6    SER 6    5    5    SER SER R . n 
T  20 7    VAL 7    6    6    VAL VAL R . n 
T  20 8    GLU 8    7    7    GLU GLU R . n 
T  20 9    ALA 9    8    8    ALA ALA R . n 
T  20 10   ASP 10   9    9    ASP ASP R . n 
T  20 11   PRO 11   10   10   PRO PRO R . n 
T  20 12   ASP 12   11   11   ASP ASP R . n 
T  20 13   THR 13   12   12   THR THR R . n 
T  20 14   THR 14   13   13   THR THR R . n 
T  20 15   ALA 15   14   14   ALA ALA R . n 
T  20 16   LYS 16   15   15   LYS LYS R . n 
T  20 17   ALA 17   16   16   ALA ALA R . n 
T  20 18   MET 18   17   17   MET MET R . n 
T  20 19   LEU 19   18   18   LEU LEU R . n 
T  20 20   ARG 20   19   19   ARG ARG R . n 
T  20 21   GLU 21   20   20   GLU GLU R . n 
T  20 22   ARG 22   21   21   ARG ARG R . n 
T  20 23   GLN 23   22   22   GLN GLN R . n 
T  20 24   MET 24   23   23   MET MET R . n 
T  20 25   SER 25   24   24   SER SER R . n 
T  20 26   PHE 26   25   25   PHE PHE R . n 
T  20 27   LYS 27   26   26   LYS LYS R . n 
T  20 28   HIS 28   27   27   HIS HIS R . n 
T  20 29   SER 29   28   28   SER SER R . n 
T  20 30   LYS 30   29   29   LYS LYS R . n 
T  20 31   ALA 31   30   30   ALA ALA R . n 
T  20 32   ILE 32   31   31   ILE ILE R . n 
T  20 33   ALA 33   32   32   ALA ALA R . n 
T  20 34   ARG 34   33   33   ARG ARG R . n 
T  20 35   GLU 35   34   34   GLU GLU R . n 
T  20 36   ILE 36   35   35   ILE ILE R . n 
T  20 37   LYS 37   36   36   LYS LYS R . n 
T  20 38   GLY 38   37   37   GLY GLY R . n 
T  20 39   LYS 39   38   38   LYS LYS R . n 
T  20 40   THR 40   39   39   THR THR R . n 
T  20 41   ALA 41   40   40   ALA ALA R . n 
T  20 42   GLY 42   41   41   GLY GLY R . n 
T  20 43   GLU 43   42   42   GLU GLU R . n 
T  20 44   ALA 44   43   43   ALA ALA R . n 
T  20 45   VAL 45   44   44   VAL VAL R . n 
T  20 46   ASP 46   45   45   ASP ASP R . n 
T  20 47   TYR 47   46   46   TYR TYR R . n 
T  20 48   LEU 48   47   47   LEU LEU R . n 
T  20 49   GLU 49   48   48   GLU GLU R . n 
T  20 50   ALA 50   49   49   ALA ALA R . n 
T  20 51   VAL 51   50   50   VAL VAL R . n 
T  20 52   ILE 52   51   51   ILE ILE R . n 
T  20 53   GLU 53   52   52   GLU GLU R . n 
T  20 54   GLY 54   53   53   GLY GLY R . n 
T  20 55   ASP 55   54   54   ASP ASP R . n 
T  20 56   GLN 56   55   55   GLN GLN R . n 
T  20 57   PRO 57   56   56   PRO PRO R . n 
T  20 58   VAL 58   57   57   VAL VAL R . n 
T  20 59   PRO 59   58   58   PRO PRO R . n 
T  20 60   PHE 60   59   59   PHE PHE R . n 
T  20 61   LYS 61   60   60   LYS LYS R . n 
T  20 62   GLN 62   61   61   GLN GLN R . n 
T  20 63   HIS 63   62   62   HIS HIS R . n 
T  20 64   ASN 64   63   63   ASN ASN R . n 
T  20 65   SER 65   64   64   SER SER R . n 
T  20 66   GLY 66   65   65   GLY GLY R . n 
T  20 67   VAL 67   66   66   VAL VAL R . n 
T  20 68   GLY 68   67   67   GLY GLY R . n 
T  20 69   HIS 69   68   68   HIS HIS R . n 
T  20 70   LYS 70   69   69   LYS LYS R . n 
T  20 71   SER 71   70   70   SER SER R . n 
T  20 72   LYS 72   71   71   LYS LYS R . n 
T  20 73   VAL 73   72   72   VAL VAL R . n 
T  20 74   ASP 74   73   73   ASP ASP R . n 
T  20 75   GLY 75   74   74   GLY GLY R . n 
T  20 76   TRP 76   75   75   TRP TRP R . n 
T  20 77   ASP 77   76   76   ASP ASP R . n 
T  20 78   ALA 78   77   77   ALA ALA R . n 
T  20 79   GLY 79   78   78   GLY GLY R . n 
T  20 80   ARG 80   79   79   ARG ARG R . n 
T  20 81   TYR 81   80   80   TYR TYR R . n 
T  20 82   PRO 82   81   81   PRO PRO R . n 
T  20 83   GLU 83   82   82   GLU GLU R . n 
T  20 84   LYS 84   83   83   LYS LYS R . n 
T  20 85   ALA 85   84   84   ALA ALA R . n 
T  20 86   SER 86   85   85   SER SER R . n 
T  20 87   LYS 87   86   86   LYS LYS R . n 
T  20 88   ALA 88   87   87   ALA ALA R . n 
T  20 89   PHE 89   88   88   PHE PHE R . n 
T  20 90   LEU 90   89   89   LEU LEU R . n 
T  20 91   ASP 91   90   90   ASP ASP R . n 
T  20 92   LEU 92   91   91   LEU LEU R . n 
T  20 93   LEU 93   92   92   LEU LEU R . n 
T  20 94   GLU 94   93   93   GLU GLU R . n 
T  20 95   ASN 95   94   94   ASN ASN R . n 
T  20 96   ALA 96   95   95   ALA ALA R . n 
T  20 97   VAL 97   96   96   VAL VAL R . n 
T  20 98   GLY 98   97   97   GLY GLY R . n 
T  20 99   ASN 99   98   98   ASN ASN R . n 
T  20 100  ALA 100  99   99   ALA ALA R . n 
T  20 101  ASP 101  100  100  ASP ASP R . n 
T  20 102  HIS 102  101  101  HIS HIS R . n 
T  20 103  GLN 103  102  102  GLN GLN R . n 
T  20 104  GLY 104  103  103  GLY GLY R . n 
T  20 105  PHE 105  104  104  PHE PHE R . n 
T  20 106  ASP 106  105  105  ASP ASP R . n 
T  20 107  GLY 107  106  106  GLY GLY R . n 
T  20 108  GLU 108  107  107  GLU GLU R . n 
T  20 109  ALA 109  108  108  ALA ALA R . n 
T  20 110  MET 110  109  109  MET MET R . n 
T  20 111  THR 111  110  110  THR THR R . n 
T  20 112  ILE 112  111  111  ILE ILE R . n 
T  20 113  LYS 113  112  112  LYS LYS R . n 
T  20 114  HIS 114  113  113  HIS HIS R . n 
T  20 115  VAL 115  114  114  VAL VAL R . n 
T  20 116  ALA 116  115  115  ALA ALA R . n 
T  20 117  ALA 117  116  116  ALA ALA R . n 
T  20 118  HIS 118  117  117  HIS HIS R . n 
T  20 119  LYS 119  118  118  LYS LYS R . n 
T  20 120  VAL 120  119  119  VAL VAL R . n 
T  20 121  GLY 121  120  120  GLY GLY R . n 
T  20 122  GLU 122  121  121  GLU GLU R . n 
T  20 123  GLN 123  122  122  GLN GLN R . n 
T  20 124  GLN 124  123  123  GLN GLN R . n 
T  20 125  GLY 125  124  124  GLY GLY R . n 
T  20 126  ARG 126  125  125  ARG ARG R . n 
T  20 127  LYS 127  126  126  LYS LYS R . n 
T  20 128  PRO 128  127  127  PRO PRO R . n 
T  20 129  ARG 129  128  128  ARG ARG R . n 
T  20 130  ALA 130  129  129  ALA ALA R . n 
T  20 131  MET 131  130  130  MET MET R . n 
T  20 132  GLY 132  131  131  GLY GLY R . n 
T  20 133  ARG 133  132  132  ARG ARG R . n 
T  20 134  ALA 134  133  133  ALA ALA R . n 
T  20 135  SER 135  134  134  SER SER R . n 
T  20 136  ALA 136  135  135  ALA ALA R . n 
T  20 137  TRP 137  136  136  TRP TRP R . n 
T  20 138  ASN 138  137  137  ASN ASN R . n 
T  20 139  SER 139  138  138  SER SER R . n 
T  20 140  PRO 140  139  139  PRO PRO R . n 
T  20 141  GLN 141  140  140  GLN GLN R . n 
T  20 142  VAL 142  141  141  VAL VAL R . n 
T  20 143  ASP 143  142  142  ASP ASP R . n 
T  20 144  VAL 144  143  143  VAL VAL R . n 
T  20 145  GLU 145  144  144  GLU GLU R . n 
T  20 146  LEU 146  145  145  LEU LEU R . n 
T  20 147  ILE 147  146  146  ILE ILE R . n 
T  20 148  LEU 148  147  147  LEU LEU R . n 
T  20 149  GLU 149  148  148  GLU GLU R . n 
T  20 150  GLU 150  149  149  GLU GLU R . n 
T  20 151  PRO 151  150  150  PRO PRO R . n 
T  20 152  GLU 152  151  ?    ?   ?   R . n 
T  20 153  VAL 153  152  ?    ?   ?   R . n 
T  20 154  GLU 154  153  ?    ?   ?   R . n 
T  20 155  ASP 155  154  ?    ?   ?   R . n 
U  21 1    MET 1    0    ?    ?   ?   S . n 
U  21 2    SER 2    1    1    SER SER S . n 
U  21 3    TRP 3    2    2    TRP TRP S . n 
U  21 4    ASP 4    3    3    ASP ASP S . n 
U  21 5    VAL 5    4    4    VAL VAL S . n 
U  21 6    ILE 6    5    5    ILE ILE S . n 
U  21 7    LYS 7    6    6    LYS LYS S . n 
U  21 8    HIS 8    7    7    HIS HIS S . n 
U  21 9    PRO 9    8    8    PRO PRO S . n 
U  21 10   HIS 10   9    9    HIS HIS S . n 
U  21 11   VAL 11   10   10   VAL VAL S . n 
U  21 12   THR 12   11   11   THR THR S . n 
U  21 13   GLU 13   12   12   GLU GLU S . n 
U  21 14   LYS 14   13   13   LYS LYS S . n 
U  21 15   ALA 15   14   14   ALA ALA S . n 
U  21 16   MET 16   15   15   MET MET S . n 
U  21 17   ASN 17   16   16   ASN ASN S . n 
U  21 18   ASP 18   17   17   ASP ASP S . n 
U  21 19   MET 19   18   18   MET MET S . n 
U  21 20   ASP 20   19   19   ASP ASP S . n 
U  21 21   PHE 21   20   20   PHE PHE S . n 
U  21 22   GLN 22   21   21   GLN GLN S . n 
U  21 23   ASN 23   22   22   ASN ASN S . n 
U  21 24   LYS 24   23   23   LYS LYS S . n 
U  21 25   LEU 25   24   24   LEU LEU S . n 
U  21 26   GLN 26   25   25   GLN GLN S . n 
U  21 27   PHE 27   26   26   PHE PHE S . n 
U  21 28   ALA 28   27   27   ALA ALA S . n 
U  21 29   VAL 29   28   28   VAL VAL S . n 
U  21 30   ASP 30   29   29   ASP ASP S . n 
U  21 31   ASP 31   30   30   ASP ASP S . n 
U  21 32   ARG 32   31   31   ARG ARG S . n 
U  21 33   ALA 33   32   32   ALA ALA S . n 
U  21 34   SER 34   33   33   SER SER S . n 
U  21 35   LYS 35   34   34   LYS LYS S . n 
U  21 36   GLY 36   35   35   GLY GLY S . n 
U  21 37   GLU 37   36   36   GLU GLU S . n 
U  21 38   VAL 38   37   37   VAL VAL S . n 
U  21 39   ALA 39   38   38   ALA ALA S . n 
U  21 40   ASP 40   39   39   ASP ASP S . n 
U  21 41   ALA 41   40   40   ALA ALA S . n 
U  21 42   VAL 42   41   41   VAL VAL S . n 
U  21 43   GLU 43   42   42   GLU GLU S . n 
U  21 44   GLU 44   43   43   GLU GLU S . n 
U  21 45   GLN 45   44   44   GLN GLN S . n 
U  21 46   TYR 46   45   45   TYR TYR S . n 
U  21 47   ASP 47   46   46   ASP ASP S . n 
U  21 48   VAL 48   47   47   VAL VAL S . n 
U  21 49   THR 49   48   48   THR THR S . n 
U  21 50   VAL 50   49   49   VAL VAL S . n 
U  21 51   GLU 51   50   50   GLU GLU S . n 
U  21 52   GLN 52   51   51   GLN GLN S . n 
U  21 53   VAL 53   52   52   VAL VAL S . n 
U  21 54   ASN 54   53   53   ASN ASN S . n 
U  21 55   THR 55   54   54   THR THR S . n 
U  21 56   GLN 56   55   55   GLN GLN S . n 
U  21 57   ASN 57   56   56   ASN ASN S . n 
U  21 58   THR 58   57   57   THR THR S . n 
U  21 59   MET 59   58   58   MET MET S . n 
U  21 60   ASP 60   59   59   ASP ASP S . n 
U  21 61   GLY 61   60   60   GLY GLY S . n 
U  21 62   GLU 62   61   61   GLU GLU S . n 
U  21 63   LYS 63   62   62   LYS LYS S . n 
U  21 64   LYS 64   63   63   LYS LYS S . n 
U  21 65   ALA 65   64   64   ALA ALA S . n 
U  21 66   VAL 66   65   65   VAL VAL S . n 
U  21 67   VAL 67   66   66   VAL VAL S . n 
U  21 68   ARG 68   67   67   ARG ARG S . n 
U  21 69   LEU 69   68   68   LEU LEU S . n 
U  21 70   SER 70   69   69   SER SER S . n 
U  21 71   GLU 71   70   70   GLU GLU S . n 
U  21 72   ASP 72   71   71   ASP ASP S . n 
U  21 73   ASP 73   72   72   ASP ASP S . n 
U  21 74   ASP 74   73   73   ASP ASP S . n 
U  21 75   ALA 75   74   74   ALA ALA S . n 
U  21 76   GLN 76   75   75   GLN GLN S . n 
U  21 77   GLU 77   76   76   GLU GLU S . n 
U  21 78   VAL 78   77   77   VAL VAL S . n 
U  21 79   ALA 79   78   78   ALA ALA S . n 
U  21 80   SER 80   79   79   SER SER S . n 
U  21 81   ARG 81   80   80   ARG ARG S . n 
U  21 82   ILE 82   81   81   ILE ILE S . n 
U  21 83   GLY 83   82   ?    ?   ?   S . n 
U  21 84   VAL 84   83   ?    ?   ?   S . n 
U  21 85   PHE 85   84   ?    ?   ?   S . n 
V  22 1    MET 1    0    ?    ?   ?   T . n 
V  22 2    SER 2    1    1    SER SER T . n 
V  22 3    LYS 3    2    2    LYS LYS T . n 
V  22 4    GLN 4    3    3    GLN GLN T . n 
V  22 5    PRO 5    4    4    PRO PRO T . n 
V  22 6    ASP 6    5    5    ASP ASP T . n 
V  22 7    LYS 7    6    6    LYS LYS T . n 
V  22 8    GLN 8    7    7    GLN GLN T . n 
V  22 9    ARG 9    8    8    ARG ARG T . n 
V  22 10   LYS 10   9    9    LYS LYS T . n 
V  22 11   SER 11   10   10   SER SER T . n 
V  22 12   GLN 12   11   11   GLN GLN T . n 
V  22 13   ARG 13   12   12   ARG ARG T . n 
V  22 14   ARG 14   13   13   ARG ARG T . n 
V  22 15   ALA 15   14   14   ALA ALA T . n 
V  22 16   PRO 16   15   15   PRO PRO T . n 
V  22 17   LEU 17   16   16   LEU LEU T . n 
V  22 18   HIS 18   17   17   HIS HIS T . n 
V  22 19   GLU 19   18   18   GLU GLU T . n 
V  22 20   ARG 20   19   19   ARG ARG T . n 
V  22 21   HIS 21   20   20   HIS HIS T . n 
V  22 22   LYS 22   21   21   LYS LYS T . n 
V  22 23   GLN 23   22   22   GLN GLN T . n 
V  22 24   VAL 24   23   23   VAL VAL T . n 
V  22 25   ARG 25   24   24   ARG ARG T . n 
V  22 26   ALA 26   25   25   ALA ALA T . n 
V  22 27   THR 27   26   26   THR THR T . n 
V  22 28   LEU 28   27   27   LEU LEU T . n 
V  22 29   SER 29   28   28   SER SER T . n 
V  22 30   ALA 30   29   29   ALA ALA T . n 
V  22 31   ASP 31   30   30   ASP ASP T . n 
V  22 32   LEU 32   31   31   LEU LEU T . n 
V  22 33   ARG 33   32   32   ARG ARG T . n 
V  22 34   GLU 34   33   33   GLU GLU T . n 
V  22 35   GLU 35   34   34   GLU GLU T . n 
V  22 36   TYR 36   35   35   TYR TYR T . n 
V  22 37   GLY 37   36   36   GLY GLY T . n 
V  22 38   GLN 38   37   37   GLN GLN T . n 
V  22 39   ARG 39   38   38   ARG ARG T . n 
V  22 40   ASN 40   39   39   ASN ASN T . n 
V  22 41   VAL 41   40   40   VAL VAL T . n 
V  22 42   ARG 42   41   41   ARG ARG T . n 
V  22 43   VAL 43   42   42   VAL VAL T . n 
V  22 44   ASN 44   43   43   ASN ASN T . n 
V  22 45   ALA 45   44   44   ALA ALA T . n 
V  22 46   GLY 46   45   45   GLY GLY T . n 
V  22 47   ASP 47   46   46   ASP ASP T . n 
V  22 48   THR 48   47   47   THR THR T . n 
V  22 49   VAL 49   48   48   VAL VAL T . n 
V  22 50   GLU 50   49   49   GLU GLU T . n 
V  22 51   VAL 51   50   50   VAL VAL T . n 
V  22 52   LEU 52   51   51   LEU LEU T . n 
V  22 53   ARG 53   52   52   ARG ARG T . n 
V  22 54   GLY 54   53   53   GLY GLY T . n 
V  22 55   ASP 55   54   54   ASP ASP T . n 
V  22 56   PHE 56   55   55   PHE PHE T . n 
V  22 57   ALA 57   56   56   ALA ALA T . n 
V  22 58   GLY 58   57   57   GLY GLY T . n 
V  22 59   GLU 59   58   58   GLU GLU T . n 
V  22 60   GLU 60   59   59   GLU GLU T . n 
V  22 61   GLY 61   60   60   GLY GLY T . n 
V  22 62   GLU 62   61   61   GLU GLU T . n 
V  22 63   VAL 63   62   62   VAL VAL T . n 
V  22 64   ILE 64   63   63   ILE ILE T . n 
V  22 65   ASN 65   64   64   ASN ASN T . n 
V  22 66   VAL 66   65   65   VAL VAL T . n 
V  22 67   ASP 67   66   66   ASP ASP T . n 
V  22 68   LEU 68   67   67   LEU LEU T . n 
V  22 69   ASP 69   68   68   ASP ASP T . n 
V  22 70   LYS 70   69   69   LYS LYS T . n 
V  22 71   ALA 71   70   70   ALA ALA T . n 
V  22 72   VAL 72   71   71   VAL VAL T . n 
V  22 73   ILE 73   72   72   ILE ILE T . n 
V  22 74   HIS 74   73   73   HIS HIS T . n 
V  22 75   VAL 75   74   74   VAL VAL T . n 
V  22 76   GLU 76   75   75   GLU GLU T . n 
V  22 77   ASP 77   76   76   ASP ASP T . n 
V  22 78   VAL 78   77   77   VAL VAL T . n 
V  22 79   THR 79   78   78   THR THR T . n 
V  22 80   LEU 80   79   79   LEU LEU T . n 
V  22 81   GLU 81   80   80   GLU GLU T . n 
V  22 82   LYS 82   81   81   LYS LYS T . n 
V  22 83   THR 83   82   82   THR THR T . n 
V  22 84   ASP 84   83   83   ASP ASP T . n 
V  22 85   GLY 85   84   84   GLY GLY T . n 
V  22 86   GLU 86   85   85   GLU GLU T . n 
V  22 87   GLU 87   86   86   GLU GLU T . n 
V  22 88   VAL 88   87   87   VAL VAL T . n 
V  22 89   PRO 89   88   88   PRO PRO T . n 
V  22 90   ARG 90   89   89   ARG ARG T . n 
V  22 91   PRO 91   90   90   PRO PRO T . n 
V  22 92   LEU 92   91   91   LEU LEU T . n 
V  22 93   ASP 93   92   92   ASP ASP T . n 
V  22 94   THR 94   93   93   THR THR T . n 
V  22 95   SER 95   94   94   SER SER T . n 
V  22 96   ASN 96   95   95   ASN ASN T . n 
V  22 97   VAL 97   96   96   VAL VAL T . n 
V  22 98   ARG 98   97   97   ARG ARG T . n 
V  22 99   VAL 99   98   98   VAL VAL T . n 
V  22 100  THR 100  99   99   THR THR T . n 
V  22 101  ASP 101  100  100  ASP ASP T . n 
V  22 102  LEU 102  101  101  LEU LEU T . n 
V  22 103  ASP 103  102  102  ASP ASP T . n 
V  22 104  LEU 104  103  103  LEU LEU T . n 
V  22 105  GLU 105  104  104  GLU GLU T . n 
V  22 106  ASP 106  105  105  ASP ASP T . n 
V  22 107  GLU 107  106  106  GLU GLU T . n 
V  22 108  LYS 108  107  107  LYS LYS T . n 
V  22 109  ARG 109  108  108  ARG ARG T . n 
V  22 110  GLU 110  109  109  GLU GLU T . n 
V  22 111  ALA 111  110  110  ALA ALA T . n 
V  22 112  ARG 112  111  111  ARG ARG T . n 
V  22 113  LEU 113  112  112  LEU LEU T . n 
V  22 114  GLU 114  113  113  GLU GLU T . n 
V  22 115  SER 115  114  114  SER SER T . n 
V  22 116  GLU 116  115  115  GLU GLU T . n 
V  22 117  ASP 117  116  116  ASP ASP T . n 
V  22 118  ASP 118  117  117  ASP ASP T . n 
V  22 119  SER 119  118  118  SER SER T . n 
V  22 120  ALA 120  119  119  ALA ALA T . n 
W  23 1    PRO 1    1    ?    ?   ?   U . n 
W  23 2    ARG 2    2    ?    ?   ?   U . n 
W  23 3    THR 3    3    ?    ?   ?   U . n 
W  23 4    ARG 4    4    4    ARG ARG U . n 
W  23 5    GLU 5    5    5    GLU GLU U . n 
W  23 6    CYS 6    6    6    CYS CYS U . n 
W  23 7    ASP 7    7    7    ASP ASP U . n 
W  23 8    TYR 8    8    8    TYR TYR U . n 
W  23 9    CYS 9    9    9    CYS CYS U . n 
W  23 10   GLY 10   10   10   GLY GLY U . n 
W  23 11   THR 11   11   11   THR THR U . n 
W  23 12   ASP 12   12   12   ASP ASP U . n 
W  23 13   ILE 13   13   13   ILE ILE U . n 
W  23 14   GLU 14   14   14   GLU GLU U . n 
W  23 15   PRO 15   15   15   PRO PRO U . n 
W  23 16   GLY 16   16   16   GLY GLY U . n 
W  23 17   THR 17   17   17   THR THR U . n 
W  23 18   GLY 18   18   18   GLY GLY U . n 
W  23 19   THR 19   19   19   THR THR U . n 
W  23 20   MET 20   20   20   MET MET U . n 
W  23 21   PHE 21   21   21   PHE PHE U . n 
W  23 22   VAL 22   22   22   VAL VAL U . n 
W  23 23   HIS 23   23   23   HIS HIS U . n 
W  23 24   LYS 24   24   24   LYS LYS U . n 
W  23 25   ASP 25   25   25   ASP ASP U . n 
W  23 26   GLY 26   26   26   GLY GLY U . n 
W  23 27   ALA 27   27   27   ALA ALA U . n 
W  23 28   THR 28   28   28   THR THR U . n 
W  23 29   THR 29   29   29   THR THR U . n 
W  23 30   HIS 30   30   30   HIS HIS U . n 
W  23 31   PHE 31   31   31   PHE PHE U . n 
W  23 32   CYS 32   32   32   CYS CYS U . n 
W  23 33   SER 33   33   33   SER SER U . n 
W  23 34   SER 34   34   34   SER SER U . n 
W  23 35   LYS 35   35   35   LYS LYS U . n 
W  23 36   CYS 36   36   36   CYS CYS U . n 
W  23 37   GLU 37   37   37   GLU GLU U . n 
W  23 38   ASN 38   38   38   ASN ASN U . n 
W  23 39   ASN 39   39   39   ASN ASN U . n 
W  23 40   ALA 40   40   40   ALA ALA U . n 
W  23 41   ASP 41   41   41   ASP ASP U . n 
W  23 42   LEU 42   42   42   LEU LEU U . n 
W  23 43   GLY 43   43   43   GLY GLY U . n 
W  23 44   ARG 44   44   44   ARG ARG U . n 
W  23 45   GLU 45   45   45   GLU GLU U . n 
W  23 46   ALA 46   46   46   ALA ALA U . n 
W  23 47   ARG 47   47   47   ARG ARG U . n 
W  23 48   ASN 48   48   48   ASN ASN U . n 
W  23 49   LEU 49   49   49   LEU LEU U . n 
W  23 50   GLU 50   50   50   GLU GLU U . n 
W  23 51   TRP 51   51   51   TRP TRP U . n 
W  23 52   THR 52   52   52   THR THR U . n 
W  23 53   ASP 53   53   53   ASP ASP U . n 
W  23 54   THR 54   54   54   THR THR U . n 
W  23 55   ALA 55   55   55   ALA ALA U . n 
W  23 56   ARG 56   56   56   ARG ARG U . n 
W  23 57   GLY 57   57   ?    ?   ?   U . n 
W  23 58   GLU 58   58   ?    ?   ?   U . n 
W  23 59   ALA 59   59   ?    ?   ?   U . n 
W  23 60   GLY 60   60   ?    ?   ?   U . n 
W  23 61   GLU 61   61   ?    ?   ?   U . n 
W  23 62   ALA 62   62   ?    ?   ?   U . n 
W  23 63   GLU 63   63   ?    ?   ?   U . n 
W  23 64   ASP 64   64   ?    ?   ?   U . n 
W  23 65   GLU 65   65   ?    ?   ?   U . n 
W  23 66   ALA 66   66   ?    ?   ?   U . n 
X  24 1    MET 1    0    ?    ?   ?   V . n 
X  24 2    THR 2    1    1    THR THR V . n 
X  24 3    VAL 3    2    2    VAL VAL V . n 
X  24 4    LEU 4    3    3    LEU LEU V . n 
X  24 5    HIS 5    4    4    HIS HIS V . n 
X  24 6    VAL 6    5    5    VAL VAL V . n 
X  24 7    GLN 7    6    6    GLN GLN V . n 
X  24 8    GLU 8    7    7    GLU GLU V . n 
X  24 9    ILE 9    8    8    ILE ILE V . n 
X  24 10   ARG 10   9    9    ARG ARG V . n 
X  24 11   ASP 11   10   10   ASP ASP V . n 
X  24 12   MET 12   11   11   MET MET V . n 
X  24 13   THR 13   12   12   THR THR V . n 
X  24 14   PRO 14   13   13   PRO PRO V . n 
X  24 15   ALA 15   14   14   ALA ALA V . n 
X  24 16   GLU 16   15   15   GLU GLU V . n 
X  24 17   ARG 17   16   16   ARG ARG V . n 
X  24 18   GLU 18   17   17   GLU GLU V . n 
X  24 19   ALA 19   18   18   ALA ALA V . n 
X  24 20   GLU 20   19   19   GLU GLU V . n 
X  24 21   LEU 21   20   20   LEU LEU V . n 
X  24 22   ASP 22   21   21   ASP ASP V . n 
X  24 23   ASP 23   22   22   ASP ASP V . n 
X  24 24   LEU 24   23   23   LEU LEU V . n 
X  24 25   LYS 25   24   24   LYS LYS V . n 
X  24 26   THR 26   25   25   THR THR V . n 
X  24 27   GLU 27   26   26   GLU GLU V . n 
X  24 28   LEU 28   27   27   LEU LEU V . n 
X  24 29   LEU 29   28   28   LEU LEU V . n 
X  24 30   ASN 30   29   29   ASN ASN V . n 
X  24 31   ALA 31   30   30   ALA ALA V . n 
X  24 32   ARG 32   31   31   ARG ARG V . n 
X  24 33   ALA 33   32   32   ALA ALA V . n 
X  24 34   VAL 34   33   33   VAL VAL V . n 
X  24 35   GLN 35   34   34   GLN GLN V . n 
X  24 36   ALA 36   35   35   ALA ALA V . n 
X  24 37   ALA 37   36   36   ALA ALA V . n 
X  24 38   GLY 38   37   37   GLY GLY V . n 
X  24 39   GLY 39   38   38   GLY GLY V . n 
X  24 40   ALA 40   39   39   ALA ALA V . n 
X  24 41   PRO 41   40   40   PRO PRO V . n 
X  24 42   GLU 42   41   41   GLU GLU V . n 
X  24 43   ASN 43   42   42   ASN ASN V . n 
X  24 44   PRO 44   43   43   PRO PRO V . n 
X  24 45   GLY 45   44   44   GLY GLY V . n 
X  24 46   ARG 46   45   45   ARG ARG V . n 
X  24 47   ILE 47   46   46   ILE ILE V . n 
X  24 48   LYS 48   47   47   LYS LYS V . n 
X  24 49   GLU 49   48   48   GLU GLU V . n 
X  24 50   LEU 50   49   49   LEU LEU V . n 
X  24 51   ARG 51   50   50   ARG ARG V . n 
X  24 52   LYS 52   51   51   LYS LYS V . n 
X  24 53   ALA 53   52   52   ALA ALA V . n 
X  24 54   ILE 54   53   53   ILE ILE V . n 
X  24 55   ALA 55   54   54   ALA ALA V . n 
X  24 56   ARG 56   55   55   ARG ARG V . n 
X  24 57   ILE 57   56   56   ILE ILE V . n 
X  24 58   LYS 58   57   57   LYS LYS V . n 
X  24 59   THR 59   58   58   THR THR V . n 
X  24 60   ILE 60   59   59   ILE ILE V . n 
X  24 61   GLN 61   60   60   GLN GLN V . n 
X  24 62   GLY 62   61   61   GLY GLY V . n 
X  24 63   GLU 63   62   62   GLU GLU V . n 
X  24 64   GLU 64   63   63   GLU GLU V . n 
X  24 65   GLY 65   64   64   GLY GLY V . n 
X  24 66   ASP 66   65   65   ASP ASP V . n 
X  24 67   LEU 67   66   ?    ?   ?   V . n 
X  24 68   GLN 68   67   ?    ?   ?   V . n 
X  24 69   GLU 69   68   ?    ?   ?   V . n 
X  24 70   ASN 70   69   ?    ?   ?   V . n 
X  24 71   GLU 71   70   ?    ?   ?   V . n 
Y  25 1    MET 1    1    1    MET MET W . n 
Y  25 2    HIS 2    2    2    HIS HIS W . n 
Y  25 3    ALA 3    3    3    ALA ALA W . n 
Y  25 4    LEU 4    4    4    LEU LEU W . n 
Y  25 5    VAL 5    5    5    VAL VAL W . n 
Y  25 6    GLN 6    6    6    GLN GLN W . n 
Y  25 7    LEU 7    7    7    LEU LEU W . n 
Y  25 8    ARG 8    8    8    ARG ARG W . n 
Y  25 9    GLY 9    9    9    GLY GLY W . n 
Y  25 10   GLU 10   10   10   GLU GLU W . n 
Y  25 11   VAL 11   11   11   VAL VAL W . n 
Y  25 12   ASN 12   12   12   ASN ASN W . n 
Y  25 13   MET 13   13   13   MET MET W . n 
Y  25 14   HIS 14   14   14   HIS HIS W . n 
Y  25 15   THR 15   15   15   THR THR W . n 
Y  25 16   ASP 16   16   16   ASP ASP W . n 
Y  25 17   ILE 17   17   17   ILE ILE W . n 
Y  25 18   GLN 18   18   18   GLN GLN W . n 
Y  25 19   ASP 19   19   19   ASP ASP W . n 
Y  25 20   THR 20   20   20   THR THR W . n 
Y  25 21   LEU 21   21   21   LEU LEU W . n 
Y  25 22   GLU 22   22   22   GLU GLU W . n 
Y  25 23   MET 23   23   23   MET MET W . n 
Y  25 24   LEU 24   24   24   LEU LEU W . n 
Y  25 25   ASN 25   25   25   ASN ASN W . n 
Y  25 26   ILE 26   26   26   ILE ILE W . n 
Y  25 27   HIS 27   27   27   HIS HIS W . n 
Y  25 28   HIS 28   28   28   HIS HIS W . n 
Y  25 29   VAL 29   29   29   VAL VAL W . n 
Y  25 30   ASN 30   30   30   ASN ASN W . n 
Y  25 31   HIS 31   31   31   HIS HIS W . n 
Y  25 32   CYS 32   32   32   CYS CYS W . n 
Y  25 33   THR 33   33   33   THR THR W . n 
Y  25 34   LEU 34   34   34   LEU LEU W . n 
Y  25 35   VAL 35   35   35   VAL VAL W . n 
Y  25 36   PRO 36   36   36   PRO PRO W . n 
Y  25 37   GLU 37   37   37   GLU GLU W . n 
Y  25 38   THR 38   38   38   THR THR W . n 
Y  25 39   ASP 39   39   39   ASP ASP W . n 
Y  25 40   ALA 40   40   40   ALA ALA W . n 
Y  25 41   TYR 41   41   41   TYR TYR W . n 
Y  25 42   ARG 42   42   42   ARG ARG W . n 
Y  25 43   GLY 43   43   43   GLY GLY W . n 
Y  25 44   MET 44   44   44   MET MET W . n 
Y  25 45   VAL 45   45   45   VAL VAL W . n 
Y  25 46   ALA 46   46   46   ALA ALA W . n 
Y  25 47   LYS 47   47   47   LYS LYS W . n 
Y  25 48   VAL 48   48   48   VAL VAL W . n 
Y  25 49   ASN 49   49   49   ASN ASN W . n 
Y  25 50   ASP 50   50   50   ASP ASP W . n 
Y  25 51   PHE 51   51   51   PHE PHE W . n 
Y  25 52   VAL 52   52   52   VAL VAL W . n 
Y  25 53   ALA 53   53   53   ALA ALA W . n 
Y  25 54   PHE 54   54   54   PHE PHE W . n 
Y  25 55   GLY 55   55   55   GLY GLY W . n 
Y  25 56   GLU 56   56   56   GLU GLU W . n 
Y  25 57   PRO 57   57   57   PRO PRO W . n 
Y  25 58   SER 58   58   58   SER SER W . n 
Y  25 59   GLN 59   59   59   GLN GLN W . n 
Y  25 60   GLU 60   60   60   GLU GLU W . n 
Y  25 61   THR 61   61   61   THR THR W . n 
Y  25 62   LEU 62   62   62   LEU LEU W . n 
Y  25 63   GLU 63   63   63   GLU GLU W . n 
Y  25 64   THR 64   64   64   THR THR W . n 
Y  25 65   VAL 65   65   65   VAL VAL W . n 
Y  25 66   LEU 66   66   66   LEU LEU W . n 
Y  25 67   ALA 67   67   67   ALA ALA W . n 
Y  25 68   THR 68   68   68   THR THR W . n 
Y  25 69   ARG 69   69   69   ARG ARG W . n 
Y  25 70   ALA 70   70   70   ALA ALA W . n 
Y  25 71   GLU 71   71   71   GLU GLU W . n 
Y  25 72   PRO 72   72   72   PRO PRO W . n 
Y  25 73   LEU 73   73   73   LEU LEU W . n 
Y  25 74   GLU 74   74   74   GLU GLU W . n 
Y  25 75   GLY 75   75   75   GLY GLY W . n 
Y  25 76   ASP 76   76   76   ASP ASP W . n 
Y  25 77   ALA 77   77   77   ALA ALA W . n 
Y  25 78   ASP 78   78   78   ASP ASP W . n 
Y  25 79   VAL 79   79   79   VAL VAL W . n 
Y  25 80   ASP 80   80   80   ASP ASP W . n 
Y  25 81   ASP 81   81   81   ASP ASP W . n 
Y  25 82   GLU 82   82   82   GLU GLU W . n 
Y  25 83   TRP 83   83   83   TRP TRP W . n 
Y  25 84   VAL 84   84   84   VAL VAL W . n 
Y  25 85   ALA 85   85   85   ALA ALA W . n 
Y  25 86   GLU 86   86   86   GLU GLU W . n 
Y  25 87   HIS 87   87   87   HIS HIS W . n 
Y  25 88   THR 88   88   88   THR THR W . n 
Y  25 89   ASP 89   89   89   ASP ASP W . n 
Y  25 90   TYR 90   90   90   TYR TYR W . n 
Y  25 91   ASP 91   91   91   ASP ASP W . n 
Y  25 92   ASP 92   92   92   ASP ASP W . n 
Y  25 93   ILE 93   93   93   ILE ILE W . n 
Y  25 94   SER 94   94   94   SER SER W . n 
Y  25 95   GLY 95   95   95   GLY GLY W . n 
Y  25 96   LEU 96   96   96   LEU LEU W . n 
Y  25 97   ALA 97   97   97   ALA ALA W . n 
Y  25 98   PHE 98   98   98   PHE PHE W . n 
Y  25 99   ALA 99   99   99   ALA ALA W . n 
Y  25 100  LEU 100  100  100  LEU LEU W . n 
Y  25 101  LEU 101  101  101  LEU LEU W . n 
Y  25 102  SER 102  102  102  SER SER W . n 
Y  25 103  GLU 103  103  103  GLU GLU W . n 
Y  25 104  GLU 104  104  104  GLU GLU W . n 
Y  25 105  THR 105  105  105  THR THR W . n 
Y  25 106  THR 106  106  106  THR THR W . n 
Y  25 107  LEU 107  107  107  LEU LEU W . n 
Y  25 108  ARG 108  108  108  ARG ARG W . n 
Y  25 109  GLU 109  109  109  GLU GLU W . n 
Y  25 110  GLN 110  110  110  GLN GLN W . n 
Y  25 111  GLY 111  111  111  GLY GLY W . n 
Y  25 112  LEU 112  112  112  LEU LEU W . n 
Y  25 113  SER 113  113  113  SER SER W . n 
Y  25 114  PRO 114  114  114  PRO PRO W . n 
Y  25 115  THR 115  115  115  THR THR W . n 
Y  25 116  LEU 116  116  116  LEU LEU W . n 
Y  25 117  ARG 117  117  117  ARG ARG W . n 
Y  25 118  LEU 118  118  118  LEU LEU W . n 
Y  25 119  HIS 119  119  119  HIS HIS W . n 
Y  25 120  PRO 120  120  120  PRO PRO W . n 
Y  25 121  PRO 121  121  121  PRO PRO W . n 
Y  25 122  ARG 122  122  122  ARG ARG W . n 
Y  25 123  GLY 123  123  123  GLY GLY W . n 
Y  25 124  GLY 124  124  124  GLY GLY W . n 
Y  25 125  HIS 125  125  125  HIS HIS W . n 
Y  25 126  ASP 126  126  126  ASP ASP W . n 
Y  25 127  GLY 127  127  127  GLY GLY W . n 
Y  25 128  VAL 128  128  128  VAL VAL W . n 
Y  25 129  LYS 129  129  129  LYS LYS W . n 
Y  25 130  HIS 130  130  130  HIS HIS W . n 
Y  25 131  PRO 131  131  131  PRO PRO W . n 
Y  25 132  VAL 132  132  132  VAL VAL W . n 
Y  25 133  LYS 133  133  133  LYS LYS W . n 
Y  25 134  GLU 134  134  134  GLU GLU W . n 
Y  25 135  GLY 135  135  135  GLY GLY W . n 
Y  25 136  GLY 136  136  136  GLY GLY W . n 
Y  25 137  GLN 137  137  137  GLN GLN W . n 
Y  25 138  LEU 138  138  138  LEU LEU W . n 
Y  25 139  GLY 139  139  139  GLY GLY W . n 
Y  25 140  LYS 140  140  140  LYS LYS W . n 
Y  25 141  HIS 141  141  141  HIS HIS W . n 
Y  25 142  ASP 142  142  142  ASP ASP W . n 
Y  25 143  THR 143  143  143  THR THR W . n 
Y  25 144  GLU 144  144  144  GLU GLU W . n 
Y  25 145  GLY 145  145  145  GLY GLY W . n 
Y  25 146  ILE 146  146  146  ILE ILE W . n 
Y  25 147  ASP 147  147  147  ASP ASP W . n 
Y  25 148  ASP 148  148  148  ASP ASP W . n 
Y  25 149  LEU 149  149  149  LEU LEU W . n 
Y  25 150  LEU 150  150  150  LEU LEU W . n 
Y  25 151  GLU 151  151  151  GLU GLU W . n 
Y  25 152  ALA 152  152  152  ALA ALA W . n 
Y  25 153  MET 153  153  153  MET MET W . n 
Y  25 154  ARG 154  154  154  ARG ARG W . n 
Z  26 1    MET 1    0    ?    ?   ?   X . n 
Z  26 2    SER 2    1    ?    ?   ?   X . n 
Z  26 3    ALA 3    2    ?    ?   ?   X . n 
Z  26 4    SER 4    3    ?    ?   ?   X . n 
Z  26 5    ASP 5    4    ?    ?   ?   X . n 
Z  26 6    PHE 6    5    ?    ?   ?   X . n 
Z  26 7    GLU 7    6    ?    ?   ?   X . n 
Z  26 8    GLU 8    7    7    GLU GLU X . n 
Z  26 9    ARG 9    8    8    ARG ARG X . n 
Z  26 10   VAL 10   9    9    VAL VAL X . n 
Z  26 11   VAL 11   10   10   VAL VAL X . n 
Z  26 12   THR 12   11   11   THR THR X . n 
Z  26 13   ILE 13   12   12   ILE ILE X . n 
Z  26 14   PRO 14   13   13   PRO PRO X . n 
Z  26 15   LEU 15   14   14   LEU LEU X . n 
Z  26 16   ARG 16   15   15   ARG ARG X . n 
Z  26 17   ASP 17   16   16   ASP ASP X . n 
Z  26 18   ALA 18   17   17   ALA ALA X . n 
Z  26 19   ARG 19   18   18   ARG ARG X . n 
Z  26 20   ALA 20   19   19   ALA ALA X . n 
Z  26 21   GLU 21   20   20   GLU GLU X . n 
Z  26 22   PRO 22   21   21   PRO PRO X . n 
Z  26 23   ASN 23   22   22   ASN ASN X . n 
Z  26 24   HIS 24   23   23   HIS HIS X . n 
Z  26 25   LYS 25   24   24   LYS LYS X . n 
Z  26 26   ARG 26   25   25   ARG ARG X . n 
Z  26 27   ALA 27   26   26   ALA ALA X . n 
Z  26 28   ASP 28   27   27   ASP ASP X . n 
Z  26 29   LYS 29   28   28   LYS LYS X . n 
Z  26 30   ALA 30   29   29   ALA ALA X . n 
Z  26 31   MET 31   30   30   MET MET X . n 
Z  26 32   ILE 32   31   31   ILE ILE X . n 
Z  26 33   LEU 33   32   32   LEU LEU X . n 
Z  26 34   ILE 34   33   33   ILE ILE X . n 
Z  26 35   ARG 35   34   34   ARG ARG X . n 
Z  26 36   GLU 36   35   35   GLU GLU X . n 
Z  26 37   HIS 37   36   36   HIS HIS X . n 
Z  26 38   LEU 38   37   37   LEU LEU X . n 
Z  26 39   ALA 39   38   38   ALA ALA X . n 
Z  26 40   LYS 40   39   39   LYS LYS X . n 
Z  26 41   HIS 41   40   40   HIS HIS X . n 
Z  26 42   PHE 42   41   41   PHE PHE X . n 
Z  26 43   SER 43   42   42   SER SER X . n 
Z  26 44   VAL 44   43   43   VAL VAL X . n 
Z  26 45   ASP 45   44   44   ASP ASP X . n 
Z  26 46   GLU 46   45   45   GLU GLU X . n 
Z  26 47   ASP 47   46   46   ASP ASP X . n 
Z  26 48   ALA 48   47   47   ALA ALA X . n 
Z  26 49   VAL 49   48   48   VAL VAL X . n 
Z  26 50   ARG 50   49   49   ARG ARG X . n 
Z  26 51   LEU 51   50   50   LEU LEU X . n 
Z  26 52   ASP 52   51   51   ASP ASP X . n 
Z  26 53   PRO 53   52   52   PRO PRO X . n 
Z  26 54   SER 54   53   53   SER SER X . n 
Z  26 55   ILE 55   54   54   ILE ILE X . n 
Z  26 56   ASN 56   55   55   ASN ASN X . n 
Z  26 57   GLU 57   56   56   GLU GLU X . n 
Z  26 58   ALA 58   57   57   ALA ALA X . n 
Z  26 59   ALA 59   58   58   ALA ALA X . n 
Z  26 60   TRP 60   59   59   TRP TRP X . n 
Z  26 61   ALA 61   60   60   ALA ALA X . n 
Z  26 62   ARG 62   61   61   ARG ARG X . n 
Z  26 63   GLY 63   62   62   GLY GLY X . n 
Z  26 64   ARG 64   63   63   ARG ARG X . n 
Z  26 65   ALA 65   64   64   ALA ALA X . n 
Z  26 66   ASN 66   65   65   ASN ASN X . n 
Z  26 67   THR 67   66   66   THR THR X . n 
Z  26 68   PRO 68   67   67   PRO PRO X . n 
Z  26 69   SER 69   68   68   SER SER X . n 
Z  26 70   LYS 70   69   69   LYS LYS X . n 
Z  26 71   ILE 71   70   70   ILE ILE X . n 
Z  26 72   ARG 72   71   71   ARG ARG X . n 
Z  26 73   VAL 73   72   72   VAL VAL X . n 
Z  26 74   ARG 74   73   73   ARG ARG X . n 
Z  26 75   ALA 75   74   74   ALA ALA X . n 
Z  26 76   ALA 76   75   75   ALA ALA X . n 
Z  26 77   ARG 77   76   76   ARG ARG X . n 
Z  26 78   PHE 78   77   77   PHE PHE X . n 
Z  26 79   GLU 79   78   78   GLU GLU X . n 
Z  26 80   GLU 80   79   79   GLU GLU X . n 
Z  26 81   GLU 81   80   80   GLU GLU X . n 
Z  26 82   GLY 82   81   81   GLY GLY X . n 
Z  26 83   GLU 83   82   82   GLU GLU X . n 
Z  26 84   ALA 84   83   83   ALA ALA X . n 
Z  26 85   ILE 85   84   84   ILE ILE X . n 
Z  26 86   VAL 86   85   85   VAL VAL X . n 
Z  26 87   GLU 87   86   86   GLU GLU X . n 
Z  26 88   ALA 88   87   87   ALA ALA X . n 
Z  26 89   GLU 89   88   88   GLU GLU X . n 
Z  26 90   THR 90   89   ?    ?   ?   X . n 
Z  26 91   ALA 91   90   ?    ?   ?   X . n 
Z  26 92   GLU 92   91   ?    ?   ?   X . n 
AA 27 1    MET 1    0    ?    ?   ?   Y . n 
AA 27 2    ALA 2    1    ?    ?   ?   Y . n 
AA 27 3    ASP 3    2    ?    ?   ?   Y . n 
AA 27 4    ASN 4    3    ?    ?   ?   Y . n 
AA 27 5    GLU 5    4    ?    ?   ?   Y . n 
AA 27 6    GLU 6    5    ?    ?   ?   Y . n 
AA 27 7    ASP 7    6    ?    ?   ?   Y . n 
AA 27 8    VAL 8    7    ?    ?   ?   Y . n 
AA 27 9    GLU 9    8    ?    ?   ?   Y . n 
AA 27 10   ALA 10   9    ?    ?   ?   Y . n 
AA 27 11   GLU 11   10   ?    ?   ?   Y . n 
AA 27 12   GLU 12   11   ?    ?   ?   Y . n 
AA 27 13   GLU 13   12   ?    ?   ?   Y . n 
AA 27 14   TYR 14   13   ?    ?   ?   Y . n 
AA 27 15   THR 15   14   ?    ?   ?   Y . n 
AA 27 16   GLU 16   15   ?    ?   ?   Y . n 
AA 27 17   LEU 17   16   ?    ?   ?   Y . n 
AA 27 18   THR 18   17   ?    ?   ?   Y . n 
AA 27 19   ASP 19   18   ?    ?   ?   Y . n 
AA 27 20   ILE 20   19   ?    ?   ?   Y . n 
AA 27 21   SER 21   20   ?    ?   ?   Y . n 
AA 27 22   GLY 22   21   ?    ?   ?   Y . n 
AA 27 23   VAL 23   22   ?    ?   ?   Y . n 
AA 27 24   GLY 24   23   ?    ?   ?   Y . n 
AA 27 25   PRO 25   24   ?    ?   ?   Y . n 
AA 27 26   SER 26   25   ?    ?   ?   Y . n 
AA 27 27   LYS 27   26   ?    ?   ?   Y . n 
AA 27 28   ALA 28   27   ?    ?   ?   Y . n 
AA 27 29   GLU 29   28   ?    ?   ?   Y . n 
AA 27 30   SER 30   29   ?    ?   ?   Y . n 
AA 27 31   LEU 31   30   ?    ?   ?   Y . n 
AA 27 32   ARG 32   31   ?    ?   ?   Y . n 
AA 27 33   GLU 33   32   ?    ?   ?   Y . n 
AA 27 34   ALA 34   33   ?    ?   ?   Y . n 
AA 27 35   GLY 35   34   ?    ?   ?   Y . n 
AA 27 36   PHE 36   35   ?    ?   ?   Y . n 
AA 27 37   GLU 37   36   ?    ?   ?   Y . n 
AA 27 38   SER 38   37   ?    ?   ?   Y . n 
AA 27 39   VAL 39   38   ?    ?   ?   Y . n 
AA 27 40   GLU 40   39   ?    ?   ?   Y . n 
AA 27 41   ASP 41   40   ?    ?   ?   Y . n 
AA 27 42   VAL 42   41   ?    ?   ?   Y . n 
AA 27 43   ARG 43   42   ?    ?   ?   Y . n 
AA 27 44   GLY 44   43   ?    ?   ?   Y . n 
AA 27 45   ALA 45   44   ?    ?   ?   Y . n 
AA 27 46   ASP 46   45   ?    ?   ?   Y . n 
AA 27 47   GLN 47   46   ?    ?   ?   Y . n 
AA 27 48   SER 48   47   ?    ?   ?   Y . n 
AA 27 49   ALA 49   48   ?    ?   ?   Y . n 
AA 27 50   LEU 50   49   ?    ?   ?   Y . n 
AA 27 51   ALA 51   50   ?    ?   ?   Y . n 
AA 27 52   ASP 52   51   ?    ?   ?   Y . n 
AA 27 53   VAL 53   52   ?    ?   ?   Y . n 
AA 27 54   SER 54   53   ?    ?   ?   Y . n 
AA 27 55   GLY 55   54   ?    ?   ?   Y . n 
AA 27 56   ILE 56   55   ?    ?   ?   Y . n 
AA 27 57   GLY 57   56   ?    ?   ?   Y . n 
AA 27 58   ASN 58   57   ?    ?   ?   Y . n 
AA 27 59   ALA 59   58   ?    ?   ?   Y . n 
AA 27 60   LEU 60   59   ?    ?   ?   Y . n 
AA 27 61   ALA 61   60   ?    ?   ?   Y . n 
AA 27 62   ALA 62   61   ?    ?   ?   Y . n 
AA 27 63   ARG 63   62   ?    ?   ?   Y . n 
AA 27 64   ILE 64   63   ?    ?   ?   Y . n 
AA 27 65   LYS 65   64   ?    ?   ?   Y . n 
AA 27 66   ALA 66   65   ?    ?   ?   Y . n 
AA 27 67   ASP 67   66   ?    ?   ?   Y . n 
AA 27 68   VAL 68   67   ?    ?   ?   Y . n 
AA 27 69   GLY 69   68   ?    ?   ?   Y . n 
AA 27 70   GLY 70   69   ?    ?   ?   Y . n 
AA 27 71   LEU 71   70   ?    ?   ?   Y . n 
AA 27 72   GLU 72   71   ?    ?   ?   Y . n 
AA 27 73   VAL 73   72   ?    ?   ?   Y . n 
AA 27 74   GLU 74   73   ?    ?   ?   Y . n 
AA 27 75   SER 75   74   ?    ?   ?   Y . n 
AA 27 76   GLU 76   75   ?    ?   ?   Y . n 
AA 27 77   THR 77   76   ?    ?   ?   Y . n 
AA 27 78   GLU 78   77   ?    ?   ?   Y . n 
AA 27 79   ALA 79   78   ?    ?   ?   Y . n 
AA 27 80   GLU 80   79   ?    ?   ?   Y . n 
AA 27 81   VAL 81   80   ?    ?   ?   Y . n 
AA 27 82   GLU 82   81   ?    ?   ?   Y . n 
AA 27 83   GLU 83   82   ?    ?   ?   Y . n 
AA 27 84   GLU 84   83   ?    ?   ?   Y . n 
AA 27 85   GLY 85   84   ?    ?   ?   Y . n 
AA 27 86   GLY 86   85   ?    ?   ?   Y . n 
AA 27 87   GLU 87   86   ?    ?   ?   Y . n 
AA 27 88   GLU 88   87   ?    ?   ?   Y . n 
AA 27 89   ALA 89   88   ?    ?   ?   Y . n 
AA 27 90   PRO 90   89   ?    ?   ?   Y . n 
AA 27 91   ASP 91   90   ?    ?   ?   Y . n 
AA 27 92   GLU 92   91   ?    ?   ?   Y . n 
AA 27 93   ASP 93   92   ?    ?   ?   Y . n 
AA 27 94   VAL 94   93   ?    ?   ?   Y . n 
AA 27 95   GLU 95   94   ?    ?   ?   Y . n 
AA 27 96   THR 96   95   95   THR THR Y . n 
AA 27 97   GLU 97   96   96   GLU GLU Y . n 
AA 27 98   LEU 98   97   97   LEU LEU Y . n 
AA 27 99   GLN 99   98   98   GLN GLN Y . n 
AA 27 100  ALA 100  99   99   ALA ALA Y . n 
AA 27 101  ARG 101  100  100  ARG ARG Y . n 
AA 27 102  GLY 102  101  101  GLY GLY Y . n 
AA 27 103  LEU 103  102  102  LEU LEU Y . n 
AA 27 104  THR 104  103  103  THR THR Y . n 
AA 27 105  GLU 105  104  104  GLU GLU Y . n 
AA 27 106  LYS 106  105  105  LYS LYS Y . n 
AA 27 107  THR 107  106  106  THR THR Y . n 
AA 27 108  PRO 108  107  107  PRO PRO Y . n 
AA 27 109  ASP 109  108  108  ASP ASP Y . n 
AA 27 110  LEU 110  109  109  LEU LEU Y . n 
AA 27 111  SER 111  110  110  SER SER Y . n 
AA 27 112  ASP 112  111  111  ASP ASP Y . n 
AA 27 113  GLU 113  112  112  GLU GLU Y . n 
AA 27 114  ASP 114  113  113  ASP ASP Y . n 
AA 27 115  ALA 115  114  114  ALA ALA Y . n 
AA 27 116  ARG 116  115  115  ARG ARG Y . n 
AA 27 117  LEU 117  116  116  LEU LEU Y . n 
AA 27 118  LEU 118  117  117  LEU LEU Y . n 
AA 27 119  THR 119  118  118  THR THR Y . n 
AA 27 120  GLN 120  119  119  GLN GLN Y . n 
AA 27 121  ARG 121  120  120  ARG ARG Y . n 
AA 27 122  HIS 122  121  121  HIS HIS Y . n 
AA 27 123  ARG 123  122  122  ARG ARG Y . n 
AA 27 124  VAL 124  123  123  VAL VAL Y . n 
AA 27 125  GLY 125  124  124  GLY GLY Y . n 
AA 27 126  LYS 126  125  125  LYS LYS Y . n 
AA 27 127  PRO 127  126  126  PRO PRO Y . n 
AA 27 128  GLN 128  127  127  GLN GLN Y . n 
AA 27 129  PHE 129  128  128  PHE PHE Y . n 
AA 27 130  ASN 130  129  129  ASN ASN Y . n 
AA 27 131  ARG 131  130  130  ARG ARG Y . n 
AA 27 132  GLN 132  131  131  GLN GLN Y . n 
AA 27 133  ASP 133  132  132  ASP ASP Y . n 
AA 27 134  HIS 134  133  133  HIS HIS Y . n 
AA 27 135  HIS 135  134  134  HIS HIS Y . n 
AA 27 136  LYS 136  135  135  LYS LYS Y . n 
AA 27 137  LYS 137  136  136  LYS LYS Y . n 
AA 27 138  LYS 138  137  137  LYS LYS Y . n 
AA 27 139  ARG 139  138  138  ARG ARG Y . n 
AA 27 140  VAL 140  139  139  VAL VAL Y . n 
AA 27 141  SER 141  140  140  SER SER Y . n 
AA 27 142  THR 142  141  141  THR THR Y . n 
AA 27 143  SER 143  142  142  SER SER Y . n 
AA 27 144  TRP 144  143  143  TRP TRP Y . n 
AA 27 145  ARG 145  144  144  ARG ARG Y . n 
AA 27 146  LYS 146  145  145  LYS LYS Y . n 
AA 27 147  PRO 147  146  146  PRO PRO Y . n 
AA 27 148  ARG 148  147  147  ARG ARG Y . n 
AA 27 149  GLY 149  148  148  GLY GLY Y . n 
AA 27 150  GLN 150  149  149  GLN GLN Y . n 
AA 27 151  LEU 151  150  150  LEU LEU Y . n 
AA 27 152  SER 152  151  151  SER SER Y . n 
AA 27 153  LYS 153  152  152  LYS LYS Y . n 
AA 27 154  GLN 154  153  153  GLN GLN Y . n 
AA 27 155  ARG 155  154  154  ARG ARG Y . n 
AA 27 156  ARG 156  155  155  ARG ARG Y . n 
AA 27 157  GLY 157  156  156  GLY GLY Y . n 
AA 27 158  ILE 158  157  157  ILE ILE Y . n 
AA 27 159  LYS 159  158  158  LYS LYS Y . n 
AA 27 160  GLY 160  159  159  GLY GLY Y . n 
AA 27 161  LYS 161  160  160  LYS LYS Y . n 
AA 27 162  GLY 162  161  161  GLY GLY Y . n 
AA 27 163  ASP 163  162  162  ASP ASP Y . n 
AA 27 164  THR 164  163  163  THR THR Y . n 
AA 27 165  VAL 165  164  164  VAL VAL Y . n 
AA 27 166  GLU 166  165  165  GLU GLU Y . n 
AA 27 167  ALA 167  166  166  ALA ALA Y . n 
AA 27 168  GLY 168  167  167  GLY GLY Y . n 
AA 27 169  PHE 169  168  168  PHE PHE Y . n 
AA 27 170  ARG 170  169  169  ARG ARG Y . n 
AA 27 171  SER 171  170  170  SER SER Y . n 
AA 27 172  PRO 172  171  171  PRO PRO Y . n 
AA 27 173  THR 173  172  172  THR THR Y . n 
AA 27 174  ALA 174  173  173  ALA ALA Y . n 
AA 27 175  VAL 175  174  174  VAL VAL Y . n 
AA 27 176  ARG 176  175  175  ARG ARG Y . n 
AA 27 177  GLY 177  176  176  GLY GLY Y . n 
AA 27 178  LYS 178  177  177  LYS LYS Y . n 
AA 27 179  HIS 179  178  178  HIS HIS Y . n 
AA 27 180  PRO 180  179  179  PRO PRO Y . n 
AA 27 181  SER 181  180  180  SER SER Y . n 
AA 27 182  GLY 182  181  181  GLY GLY Y . n 
AA 27 183  PHE 183  182  182  PHE PHE Y . n 
AA 27 184  GLU 184  183  183  GLU GLU Y . n 
AA 27 185  GLU 185  184  184  GLU GLU Y . n 
AA 27 186  VAL 186  185  185  VAL VAL Y . n 
AA 27 187  ARG 187  186  186  ARG ARG Y . n 
AA 27 188  VAL 188  187  187  VAL VAL Y . n 
AA 27 189  HIS 189  188  188  HIS HIS Y . n 
AA 27 190  ASN 190  189  189  ASN ASN Y . n 
AA 27 191  VAL 191  190  190  VAL VAL Y . n 
AA 27 192  ASP 192  191  191  ASP ASP Y . n 
AA 27 193  ASP 193  192  192  ASP ASP Y . n 
AA 27 194  LEU 194  193  193  LEU LEU Y . n 
AA 27 195  GLU 195  194  194  GLU GLU Y . n 
AA 27 196  GLY 196  195  195  GLY GLY Y . n 
AA 27 197  VAL 197  196  196  VAL VAL Y . n 
AA 27 198  ASP 198  197  197  ASP ASP Y . n 
AA 27 199  GLY 199  198  198  GLY GLY Y . n 
AA 27 200  ASP 200  199  199  ASP ASP Y . n 
AA 27 201  THR 201  200  200  THR THR Y . n 
AA 27 202  GLU 202  201  201  GLU GLU Y . n 
AA 27 203  ALA 203  202  202  ALA ALA Y . n 
AA 27 204  VAL 204  203  203  VAL VAL Y . n 
AA 27 205  ARG 205  204  204  ARG ARG Y . n 
AA 27 206  ILE 206  205  205  ILE ILE Y . n 
AA 27 207  ALA 207  206  206  ALA ALA Y . n 
AA 27 208  SER 208  207  207  SER SER Y . n 
AA 27 209  LYS 209  208  208  LYS LYS Y . n 
AA 27 210  VAL 210  209  209  VAL VAL Y . n 
AA 27 211  GLY 211  210  210  GLY GLY Y . n 
AA 27 212  ALA 212  211  211  ALA ALA Y . n 
AA 27 213  ARG 213  212  212  ARG ARG Y . n 
AA 27 214  LYS 214  213  213  LYS LYS Y . n 
AA 27 215  ARG 215  214  214  ARG ARG Y . n 
AA 27 216  GLU 216  215  215  GLU GLU Y . n 
AA 27 217  ARG 217  216  216  ARG ARG Y . n 
AA 27 218  ILE 218  217  217  ILE ILE Y . n 
AA 27 219  GLU 219  218  218  GLU GLU Y . n 
AA 27 220  GLU 220  219  219  GLU GLU Y . n 
AA 27 221  GLU 221  220  220  GLU GLU Y . n 
AA 27 222  ALA 222  221  221  ALA ALA Y . n 
AA 27 223  GLU 223  222  222  GLU GLU Y . n 
AA 27 224  ASP 224  223  223  ASP ASP Y . n 
AA 27 225  ALA 225  224  224  ALA ALA Y . n 
AA 27 226  GLY 226  225  225  GLY GLY Y . n 
AA 27 227  ILE 227  226  226  ILE ILE Y . n 
AA 27 228  ARG 228  227  227  ARG ARG Y . n 
AA 27 229  VAL 229  228  228  VAL VAL Y . n 
AA 27 230  LEU 230  229  229  LEU LEU Y . n 
AA 27 231  ASN 231  230  230  ASN ASN Y . n 
AA 27 232  PRO 232  231  231  PRO PRO Y . n 
AA 27 233  THR 233  232  232  THR THR Y . n 
AA 27 234  TYR 234  233  233  TYR TYR Y . n 
AA 27 235  VAL 235  234  234  VAL VAL Y . n 
AA 27 236  GLU 236  235  235  GLU GLU Y . n 
AA 27 237  VAL 237  236  236  VAL VAL Y . n 
AA 27 238  GLU 238  237  ?    ?   ?   Y . n 
AA 27 239  VAL 239  238  ?    ?   ?   Y . n 
AA 27 240  SER 240  239  ?    ?   ?   Y . n 
AA 27 241  GLU 241  240  ?    ?   ?   Y . n 
BA 28 1    ARG 1    10   10   ARG ARG Z . n 
BA 28 2    SER 2    11   11   SER SER Z . n 
BA 28 3    GLY 3    12   12   GLY GLY Z . n 
BA 28 4    ARG 4    13   13   ARG ARG Z . n 
BA 28 5    PHE 5    14   14   PHE PHE Z . n 
BA 28 6    GLY 6    15   15   GLY GLY Z . n 
BA 28 7    ALA 7    16   16   ALA ALA Z . n 
BA 28 8    ARG 8    17   17   ARG ARG Z . n 
BA 28 9    TYR 9    18   18   TYR TYR Z . n 
BA 28 10   GLY 10   19   19   GLY GLY Z . n 
BA 28 11   ARG 11   20   20   ARG ARG Z . n 
BA 28 12   VAL 12   21   21   VAL VAL Z . n 
BA 28 13   SER 13   22   22   SER SER Z . n 
BA 28 14   ARG 14   23   23   ARG ARG Z . n 
BA 28 15   ARG 15   24   24   ARG ARG Z . n 
BA 28 16   ARG 16   25   25   ARG ARG Z . n 
BA 28 17   VAL 17   26   26   VAL VAL Z . n 
BA 28 18   ALA 18   27   27   ALA ALA Z . n 
BA 28 19   GLU 19   28   28   GLU GLU Z . n 
BA 28 20   ILE 20   29   29   ILE ILE Z . n 
BA 28 21   GLU 21   30   30   GLU GLU Z . n 
BA 28 22   SER 22   31   31   SER SER Z . n 
BA 28 23   GLU 23   32   32   GLU GLU Z . n 
BA 28 24   MET 24   33   33   MET MET Z . n 
BA 28 25   ASN 25   34   34   ASN ASN Z . n 
BA 28 26   GLU 26   35   35   GLU GLU Z . n 
BA 28 27   ASP 27   36   36   ASP ASP Z . n 
BA 28 28   HIS 28   37   37   HIS HIS Z . n 
BA 28 29   ALA 29   38   38   ALA ALA Z . n 
BA 28 30   CYS 30   39   39   CYS CYS Z . n 
BA 28 31   PRO 31   40   40   PRO PRO Z . n 
BA 28 32   ASN 32   41   41   ASN ASN Z . n 
BA 28 33   CYS 33   42   42   CYS CYS Z . n 
BA 28 34   GLY 34   43   43   GLY GLY Z . n 
BA 28 35   GLU 35   44   44   GLU GLU Z . n 
BA 28 36   ASP 36   45   45   ASP ASP Z . n 
BA 28 37   ARG 37   46   46   ARG ARG Z . n 
BA 28 38   VAL 38   47   47   VAL VAL Z . n 
BA 28 39   ASP 39   48   48   ASP ASP Z . n 
BA 28 40   ARG 40   49   49   ARG ARG Z . n 
BA 28 41   GLN 41   50   50   GLN GLN Z . n 
BA 28 42   GLY 42   51   51   GLY GLY Z . n 
BA 28 43   THR 43   52   52   THR THR Z . n 
BA 28 44   GLY 44   53   53   GLY GLY Z . n 
BA 28 45   ILE 45   54   54   ILE ILE Z . n 
BA 28 46   TRP 46   55   55   TRP TRP Z . n 
BA 28 47   GLN 47   56   56   GLN GLN Z . n 
BA 28 48   CYS 48   57   57   CYS CYS Z . n 
BA 28 49   SER 49   58   58   SER SER Z . n 
BA 28 50   TYR 50   59   59   TYR TYR Z . n 
BA 28 51   CYS 51   60   60   CYS CYS Z . n 
BA 28 52   ASP 52   61   61   ASP ASP Z . n 
BA 28 53   TYR 53   62   62   TYR TYR Z . n 
BA 28 54   LYS 54   63   63   LYS LYS Z . n 
BA 28 55   PHE 55   64   64   PHE PHE Z . n 
BA 28 56   THR 56   65   65   THR THR Z . n 
BA 28 57   GLY 57   66   66   GLY GLY Z . n 
BA 28 58   GLY 58   67   67   GLY GLY Z . n 
BA 28 59   SER 59   68   68   SER SER Z . n 
BA 28 60   TYR 60   69   69   TYR TYR Z . n 
BA 28 61   LYS 61   70   70   LYS LYS Z . n 
BA 28 62   PRO 62   71   71   PRO PRO Z . n 
BA 28 63   GLU 63   72   72   GLU GLU Z . n 
BA 28 64   THR 64   73   73   THR THR Z . n 
BA 28 65   PRO 65   74   74   PRO PRO Z . n 
BA 28 66   GLY 66   75   75   GLY GLY Z . n 
BA 28 67   GLY 67   76   76   GLY GLY Z . n 
BA 28 68   LYS 68   77   77   LYS LYS Z . n 
BA 28 69   THR 69   78   78   THR THR Z . n 
BA 28 70   VAL 70   79   79   VAL VAL Z . n 
BA 28 71   ARG 71   80   80   ARG ARG Z . n 
BA 28 72   ARG 72   81   81   ARG ARG Z . n 
BA 28 73   SER 73   82   82   SER SER Z . n 
BA 28 74   ILE 74   83   ?    ?   ?   Z . n 
BA 28 75   ARG 75   84   ?    ?   ?   Z . n 
BA 28 76   ALA 76   85   ?    ?   ?   Z . n 
BA 28 77   ALA 77   86   ?    ?   ?   Z . n 
BA 28 78   LEU 78   87   ?    ?   ?   Z . n 
BA 28 79   SER 79   88   ?    ?   ?   Z . n 
BA 28 80   GLU 80   89   ?    ?   ?   Z . n 
BA 28 81   ASP 81   90   ?    ?   ?   Z . n 
BA 28 82   GLU 82   91   ?    ?   ?   Z . n 
BA 28 83   GLU 83   92   ?    ?   ?   Z . n 
CA 29 1    MET 1    0    ?    ?   ?   1 . n 
CA 29 2    THR 2    1    1    THR THR 1 . n 
CA 29 3    GLY 3    2    2    GLY GLY 1 . n 
CA 29 4    ALA 4    3    3    ALA ALA 1 . n 
CA 29 5    GLY 5    4    4    GLY GLY 1 . n 
CA 29 6    THR 6    5    5    THR THR 1 . n 
CA 29 7    PRO 7    6    6    PRO PRO 1 . n 
CA 29 8    SER 8    7    7    SER SER 1 . n 
CA 29 9    GLN 9    8    8    GLN GLN 1 . n 
CA 29 10   GLY 10   9    9    GLY GLY 1 . n 
CA 29 11   LYS 11   10   10   LYS LYS 1 . n 
CA 29 12   LYS 12   11   11   LYS LYS 1 . n 
CA 29 13   ASN 13   12   12   ASN ASN 1 . n 
CA 29 14   THR 14   13   13   THR THR 1 . n 
CA 29 15   THR 15   14   14   THR THR 1 . n 
CA 29 16   THR 16   15   15   THR THR 1 . n 
CA 29 17   HIS 17   16   16   HIS HIS 1 . n 
CA 29 18   THR 18   17   17   THR THR 1 . n 
CA 29 19   LYS 19   18   18   LYS LYS 1 . n 
CA 29 20   CYS 20   19   19   CYS CYS 1 . n 
CA 29 21   ARG 21   20   20   ARG ARG 1 . n 
CA 29 22   ARG 22   21   21   ARG ARG 1 . n 
CA 29 23   CYS 23   22   22   CYS CYS 1 . n 
CA 29 24   GLY 24   23   23   GLY GLY 1 . n 
CA 29 25   GLU 25   24   24   GLU GLU 1 . n 
CA 29 26   LYS 26   25   25   LYS LYS 1 . n 
CA 29 27   SER 27   26   26   SER SER 1 . n 
CA 29 28   TYR 28   27   27   TYR TYR 1 . n 
CA 29 29   HIS 29   28   28   HIS HIS 1 . n 
CA 29 30   THR 30   29   29   THR THR 1 . n 
CA 29 31   LYS 31   30   30   LYS LYS 1 . n 
CA 29 32   LYS 32   31   31   LYS LYS 1 . n 
CA 29 33   LYS 33   32   32   LYS LYS 1 . n 
CA 29 34   VAL 34   33   33   VAL VAL 1 . n 
CA 29 35   CYS 35   34   34   CYS CYS 1 . n 
CA 29 36   SER 36   35   35   SER SER 1 . n 
CA 29 37   SER 37   36   36   SER SER 1 . n 
CA 29 38   CYS 38   37   37   CYS CYS 1 . n 
CA 29 39   GLY 39   38   38   GLY GLY 1 . n 
CA 29 40   PHE 40   39   39   PHE PHE 1 . n 
CA 29 41   GLY 41   40   40   GLY GLY 1 . n 
CA 29 42   LYS 42   41   41   LYS LYS 1 . n 
CA 29 43   SER 43   42   42   SER SER 1 . n 
CA 29 44   ALA 44   43   43   ALA ALA 1 . n 
CA 29 45   LYS 45   44   44   LYS LYS 1 . n 
CA 29 46   ARG 46   45   45   ARG ARG 1 . n 
CA 29 47   ARG 47   46   46   ARG ARG 1 . n 
CA 29 48   ASP 48   47   47   ASP ASP 1 . n 
CA 29 49   TYR 49   48   48   TYR TYR 1 . n 
CA 29 50   GLU 50   49   49   GLU GLU 1 . n 
CA 29 51   TRP 51   50   50   TRP TRP 1 . n 
CA 29 52   GLN 52   51   51   GLN GLN 1 . n 
CA 29 53   SER 53   52   52   SER SER 1 . n 
CA 29 54   LYS 54   53   53   LYS LYS 1 . n 
CA 29 55   ALA 55   54   54   ALA ALA 1 . n 
CA 29 56   GLY 56   55   55   GLY GLY 1 . n 
CA 29 57   GLU 57   56   56   GLU GLU 1 . n 
DA 30 1    MET 1    0    ?    ?   ?   2 . n 
DA 30 2    GLY 2    1    1    GLY GLY 2 . n 
DA 30 3    LYS 3    2    2    LYS LYS 2 . n 
DA 30 4    LYS 4    3    3    LYS LYS 2 . n 
DA 30 5    SER 5    4    4    SER SER 2 . n 
DA 30 6    LYS 6    5    5    LYS LYS 2 . n 
DA 30 7    ALA 7    6    6    ALA ALA 2 . n 
DA 30 8    THR 8    7    7    THR THR 2 . n 
DA 30 9    LYS 9    8    8    LYS LYS 2 . n 
DA 30 10   LYS 10   9    9    LYS LYS 2 . n 
DA 30 11   ARG 11   10   10   ARG ARG 2 . n 
DA 30 12   LEU 12   11   11   LEU LEU 2 . n 
DA 30 13   ALA 13   12   12   ALA ALA 2 . n 
DA 30 14   LYS 14   13   13   LYS LYS 2 . n 
DA 30 15   LEU 15   14   14   LEU LEU 2 . n 
DA 30 16   ASP 16   15   15   ASP ASP 2 . n 
DA 30 17   ASN 17   16   16   ASN ASN 2 . n 
DA 30 18   GLN 18   17   17   GLN GLN 2 . n 
DA 30 19   ASN 19   18   18   ASN ASN 2 . n 
DA 30 20   SER 20   19   19   SER SER 2 . n 
DA 30 21   ARG 21   20   20   ARG ARG 2 . n 
DA 30 22   VAL 22   21   21   VAL VAL 2 . n 
DA 30 23   PRO 23   22   22   PRO PRO 2 . n 
DA 30 24   ALA 24   23   23   ALA ALA 2 . n 
DA 30 25   TRP 25   24   24   TRP TRP 2 . n 
DA 30 26   VAL 26   25   25   VAL VAL 2 . n 
DA 30 27   MET 27   26   26   MET MET 2 . n 
DA 30 28   LEU 28   27   27   LEU LEU 2 . n 
DA 30 29   LYS 29   28   28   LYS LYS 2 . n 
DA 30 30   THR 30   29   29   THR THR 2 . n 
DA 30 31   ASP 31   30   30   ASP ASP 2 . n 
DA 30 32   ARG 32   31   31   ARG ARG 2 . n 
DA 30 33   GLU 33   32   ?    ?   ?   2 . n 
DA 30 34   VAL 34   33   ?    ?   ?   2 . n 
DA 30 35   GLN 35   34   ?    ?   ?   2 . n 
DA 30 36   ARG 36   35   35   ARG ARG 2 . n 
DA 30 37   ASN 37   36   36   ASN ASN 2 . n 
DA 30 38   HIS 38   37   37   HIS HIS 2 . n 
DA 30 39   LYS 39   38   38   LYS LYS 2 . n 
DA 30 40   ARG 40   39   39   ARG ARG 2 . n 
DA 30 41   ARG 41   40   40   ARG ARG 2 . n 
DA 30 42   HIS 42   41   41   HIS HIS 2 . n 
DA 30 43   TRP 43   42   42   TRP TRP 2 . n 
DA 30 44   ARG 44   43   43   ARG ARG 2 . n 
DA 30 45   ARG 45   44   44   ARG ARG 2 . n 
DA 30 46   ASN 46   45   45   ASN ASN 2 . n 
DA 30 47   ASP 47   46   46   ASP ASP 2 . n 
DA 30 48   THR 48   47   47   THR THR 2 . n 
DA 30 49   ASP 49   48   48   ASP ASP 2 . n 
DA 30 50   GLU 50   49   49   GLU GLU 2 . n 
EA 31 1    MET 1    1    1    MET MET 3 . n 
EA 31 2    GLN 2    2    2    GLN GLN 3 . n 
EA 31 3    MET 3    3    3    MET MET 3 . n 
EA 31 4    PRO 4    4    4    PRO PRO 3 . n 
EA 31 5    ARG 5    5    5    ARG ARG 3 . n 
EA 31 6    ARG 6    6    6    ARG ARG 3 . n 
EA 31 7    PHE 7    7    7    PHE PHE 3 . n 
EA 31 8    ASN 8    8    8    ASN ASN 3 . n 
EA 31 9    THR 9    9    9    THR THR 3 . n 
EA 31 10   TYR 10   10   10   TYR TYR 3 . n 
EA 31 11   CYS 11   11   11   CYS CYS 3 . n 
EA 31 12   PRO 12   12   12   PRO PRO 3 . n 
EA 31 13   HIS 13   13   13   HIS HIS 3 . n 
EA 31 14   CYS 14   14   14   CYS CYS 3 . n 
EA 31 15   ASN 15   15   15   ASN ASN 3 . n 
EA 31 16   GLU 16   16   16   GLU GLU 3 . n 
EA 31 17   HIS 17   17   17   HIS HIS 3 . n 
EA 31 18   GLN 18   18   18   GLN GLN 3 . n 
EA 31 19   GLU 19   19   19   GLU GLU 3 . n 
EA 31 20   HIS 20   20   20   HIS HIS 3 . n 
EA 31 21   GLU 21   21   21   GLU GLU 3 . n 
EA 31 22   VAL 22   22   22   VAL VAL 3 . n 
EA 31 23   GLU 23   23   23   GLU GLU 3 . n 
EA 31 24   LYS 24   24   24   LYS LYS 3 . n 
EA 31 25   VAL 25   25   25   VAL VAL 3 . n 
EA 31 26   ARG 26   26   26   ARG ARG 3 . n 
EA 31 27   SER 27   27   27   SER SER 3 . n 
EA 31 28   GLY 28   28   28   GLY GLY 3 . n 
EA 31 29   ARG 29   29   29   ARG ARG 3 . n 
EA 31 30   GLN 30   30   30   GLN GLN 3 . n 
EA 31 31   THR 31   31   31   THR THR 3 . n 
EA 31 32   GLY 32   32   32   GLY GLY 3 . n 
EA 31 33   MET 33   33   33   MET MET 3 . n 
EA 31 34   LYS 34   34   34   LYS LYS 3 . n 
EA 31 35   TRP 35   35   35   TRP TRP 3 . n 
EA 31 36   ILE 36   36   36   ILE ILE 3 . n 
EA 31 37   ASP 37   37   37   ASP ASP 3 . n 
EA 31 38   ARG 38   38   38   ARG ARG 3 . n 
EA 31 39   GLN 39   39   39   GLN GLN 3 . n 
EA 31 40   ARG 40   40   40   ARG ARG 3 . n 
EA 31 41   GLU 41   41   41   GLU GLU 3 . n 
EA 31 42   ARG 42   42   42   ARG ARG 3 . n 
EA 31 43   ASN 43   43   43   ASN ASN 3 . n 
EA 31 44   SER 44   44   44   SER SER 3 . n 
EA 31 45   GLY 45   45   45   GLY GLY 3 . n 
EA 31 46   ILE 46   46   46   ILE ILE 3 . n 
EA 31 47   GLY 47   47   47   GLY GLY 3 . n 
EA 31 48   ASN 48   48   48   ASN ASN 3 . n 
EA 31 49   ASP 49   49   49   ASP ASP 3 . n 
EA 31 50   GLY 50   50   50   GLY GLY 3 . n 
EA 31 51   LYS 51   51   51   LYS LYS 3 . n 
EA 31 52   PHE 52   52   52   PHE PHE 3 . n 
EA 31 53   SER 53   53   53   SER SER 3 . n 
EA 31 54   LYS 54   54   54   LYS LYS 3 . n 
EA 31 55   VAL 55   55   55   VAL VAL 3 . n 
EA 31 56   PRO 56   56   56   PRO PRO 3 . n 
EA 31 57   GLY 57   57   57   GLY GLY 3 . n 
EA 31 58   GLY 58   58   58   GLY GLY 3 . n 
EA 31 59   ASP 59   59   59   ASP ASP 3 . n 
EA 31 60   LYS 60   60   60   LYS LYS 3 . n 
EA 31 61   PRO 61   61   61   PRO PRO 3 . n 
EA 31 62   THR 62   62   62   THR THR 3 . n 
EA 31 63   LYS 63   63   63   LYS LYS 3 . n 
EA 31 64   LYS 64   64   64   LYS LYS 3 . n 
EA 31 65   THR 65   65   65   THR THR 3 . n 
EA 31 66   ASP 66   66   66   ASP ASP 3 . n 
EA 31 67   LEU 67   67   67   LEU LEU 3 . n 
EA 31 68   LYS 68   68   68   LYS LYS 3 . n 
EA 31 69   TYR 69   69   69   TYR TYR 3 . n 
EA 31 70   ARG 70   70   70   ARG ARG 3 . n 
EA 31 71   CYS 71   71   71   CYS CYS 3 . n 
EA 31 72   GLY 72   72   72   GLY GLY 3 . n 
EA 31 73   GLU 73   73   73   GLU GLU 3 . n 
EA 31 74   CYS 74   74   74   CYS CYS 3 . n 
EA 31 75   GLY 75   75   75   GLY GLY 3 . n 
EA 31 76   LYS 76   76   76   LYS LYS 3 . n 
EA 31 77   ALA 77   77   77   ALA ALA 3 . n 
EA 31 78   HIS 78   78   78   HIS HIS 3 . n 
EA 31 79   LEU 79   79   79   LEU LEU 3 . n 
EA 31 80   ARG 80   80   80   ARG ARG 3 . n 
EA 31 81   GLU 81   81   81   GLU GLU 3 . n 
EA 31 82   GLY 82   82   82   GLY GLY 3 . n 
EA 31 83   TRP 83   83   83   TRP TRP 3 . n 
EA 31 84   ARG 84   84   84   ARG ARG 3 . n 
EA 31 85   ALA 85   85   85   ALA ALA 3 . n 
EA 31 86   GLY 86   86   86   GLY GLY 3 . n 
EA 31 87   ARG 87   87   87   ARG ARG 3 . n 
EA 31 88   LEU 88   88   88   LEU LEU 3 . n 
EA 31 89   GLU 89   89   89   GLU GLU 3 . n 
EA 31 90   PHE 90   90   90   PHE PHE 3 . n 
EA 31 91   GLN 91   91   91   GLN GLN 3 . n 
EA 31 92   GLU 92   92   92   GLU GLU 3 . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
FA 32 ZIT 1    9500 9500 ZIT ZIT 0 . 
GA 33 MG  1    8001 8001 MG  MG  0 . 
HA 33 MG  1    8002 8002 MG  MG  0 . 
IA 33 MG  1    8003 8003 MG  MG  0 . 
JA 33 MG  1    8004 8004 MG  MG  0 . 
KA 33 MG  1    8005 8005 MG  MG  0 . 
LA 33 MG  1    8006 8006 MG  MG  0 . 
MA 33 MG  1    8007 8007 MG  MG  0 . 
NA 33 MG  1    8008 8008 MG  MG  0 . 
OA 33 MG  1    8009 8009 MG  MG  0 . 
PA 33 MG  1    8010 8010 MG  MG  0 . 
QA 33 MG  1    8011 8011 MG  MG  0 . 
RA 33 MG  1    8012 8012 MG  MG  0 . 
SA 33 MG  1    8013 8013 MG  MG  0 . 
TA 33 MG  1    8014 8014 MG  MG  0 . 
UA 33 MG  1    8015 8015 MG  MG  0 . 
VA 33 MG  1    8016 8016 MG  MG  0 . 
WA 33 MG  1    8017 8017 MG  MG  0 . 
XA 33 MG  1    8018 8018 MG  MG  0 . 
YA 33 MG  1    8019 8019 MG  MG  0 . 
ZA 33 MG  1    8020 8020 MG  MG  0 . 
AB 33 MG  1    8021 8021 MG  MG  0 . 
BB 33 MG  1    8022 8022 MG  MG  0 . 
CB 33 MG  1    8023 8023 MG  MG  0 . 
DB 33 MG  1    8024 8024 MG  MG  0 . 
EB 33 MG  1    8025 8025 MG  MG  0 . 
FB 33 MG  1    8026 8026 MG  MG  0 . 
GB 33 MG  1    8027 8027 MG  MG  0 . 
HB 33 MG  1    8028 8028 MG  MG  0 . 
IB 33 MG  1    8029 8029 MG  MG  0 . 
JB 33 MG  1    8030 8030 MG  MG  0 . 
KB 33 MG  1    8031 8031 MG  MG  0 . 
LB 33 MG  1    8032 8032 MG  MG  0 . 
MB 33 MG  1    8033 8033 MG  MG  0 . 
NB 33 MG  1    8034 8034 MG  MG  0 . 
OB 33 MG  1    8035 8035 MG  MG  0 . 
PB 33 MG  1    8036 8036 MG  MG  0 . 
QB 33 MG  1    8037 8037 MG  MG  0 . 
RB 33 MG  1    8038 8038 MG  MG  0 . 
SB 33 MG  1    8039 8039 MG  MG  0 . 
TB 33 MG  1    8040 8040 MG  MG  0 . 
UB 33 MG  1    8041 8041 MG  MG  0 . 
VB 33 MG  1    8043 8043 MG  MG  0 . 
WB 33 MG  1    8044 8044 MG  MG  0 . 
XB 33 MG  1    8045 8045 MG  MG  0 . 
YB 33 MG  1    8046 8046 MG  MG  0 . 
ZB 33 MG  1    8047 8047 MG  MG  0 . 
AC 33 MG  1    8048 8048 MG  MG  0 . 
BC 33 MG  1    8049 8049 MG  MG  0 . 
CC 33 MG  1    8052 8052 MG  MG  0 . 
DC 33 MG  1    8053 8053 MG  MG  0 . 
EC 33 MG  1    8055 8055 MG  MG  0 . 
FC 33 MG  1    8056 8056 MG  MG  0 . 
GC 33 MG  1    8058 8058 MG  MG  0 . 
HC 33 MG  1    8059 8059 MG  MG  0 . 
IC 33 MG  1    8060 8060 MG  MG  0 . 
JC 33 MG  1    8061 8061 MG  MG  0 . 
KC 33 MG  1    8062 8062 MG  MG  0 . 
LC 33 MG  1    8063 8063 MG  MG  0 . 
MC 33 MG  1    8064 8064 MG  MG  0 . 
NC 33 MG  1    8065 8065 MG  MG  0 . 
OC 33 MG  1    8066 8066 MG  MG  0 . 
PC 33 MG  1    8067 8067 MG  MG  0 . 
QC 33 MG  1    8068 8068 MG  MG  0 . 
RC 33 MG  1    8069 8069 MG  MG  0 . 
SC 33 MG  1    8070 8070 MG  MG  0 . 
TC 33 MG  1    8071 8071 MG  MG  0 . 
UC 33 MG  1    8072 8072 MG  MG  0 . 
VC 33 MG  1    8073 8073 MG  MG  0 . 
WC 33 MG  1    8075 8075 MG  MG  0 . 
XC 33 MG  1    8076 8076 MG  MG  0 . 
YC 33 MG  1    8077 8077 MG  MG  0 . 
ZC 33 MG  1    8078 8078 MG  MG  0 . 
AD 33 MG  1    8079 8079 MG  MG  0 . 
BD 33 MG  1    8080 8080 MG  MG  0 . 
CD 33 MG  1    8081 8081 MG  MG  0 . 
DD 33 MG  1    8082 8082 MG  MG  0 . 
ED 33 MG  1    8083 8083 MG  MG  0 . 
FD 33 MG  1    8084 8084 MG  MG  0 . 
GD 33 MG  1    8085 8085 MG  MG  0 . 
HD 33 MG  1    8087 8087 MG  MG  0 . 
ID 33 MG  1    8088 8088 MG  MG  0 . 
JD 33 MG  1    8089 8089 MG  MG  0 . 
KD 33 MG  1    8090 8090 MG  MG  0 . 
LD 33 MG  1    8091 8091 MG  MG  0 . 
MD 33 MG  1    8092 8092 MG  MG  0 . 
ND 33 MG  1    8093 8093 MG  MG  0 . 
OD 34 K   1    8401 8401 K   K   0 . 
PD 34 K   1    8402 8402 K   K   0 . 
QD 35 NA  1    8501 8501 NA  NA  0 . 
RD 35 NA  1    8502 8502 NA  NA  0 . 
SD 35 NA  1    8504 8504 NA  NA  0 . 
TD 35 NA  1    8505 8505 NA  NA  0 . 
UD 35 NA  1    8506 8506 NA  NA  0 . 
VD 35 NA  1    8507 8507 NA  NA  0 . 
WD 35 NA  1    8508 8508 NA  NA  0 . 
XD 35 NA  1    8509 8509 NA  NA  0 . 
YD 35 NA  1    8511 8511 NA  NA  0 . 
ZD 35 NA  1    8512 8512 NA  NA  0 . 
AE 35 NA  1    8513 8513 NA  NA  0 . 
BE 35 NA  1    8514 8514 NA  NA  0 . 
CE 35 NA  1    8515 8515 NA  NA  0 . 
DE 35 NA  1    8516 8516 NA  NA  0 . 
EE 35 NA  1    8517 8517 NA  NA  0 . 
FE 35 NA  1    8519 8519 NA  NA  0 . 
GE 35 NA  1    8520 8520 NA  NA  0 . 
HE 35 NA  1    8521 8521 NA  NA  0 . 
IE 35 NA  1    8522 8522 NA  NA  0 . 
JE 35 NA  1    8523 8523 NA  NA  0 . 
KE 35 NA  1    8524 8524 NA  NA  0 . 
LE 35 NA  1    8525 8525 NA  NA  0 . 
ME 35 NA  1    8526 8526 NA  NA  0 . 
NE 35 NA  1    8527 8527 NA  NA  0 . 
OE 35 NA  1    8528 8528 NA  NA  0 . 
PE 35 NA  1    8529 8529 NA  NA  0 . 
QE 35 NA  1    8530 8530 NA  NA  0 . 
RE 35 NA  1    8531 8531 NA  NA  0 . 
SE 35 NA  1    8533 8533 NA  NA  0 . 
TE 35 NA  1    8534 8534 NA  NA  0 . 
UE 35 NA  1    8535 8535 NA  NA  0 . 
VE 35 NA  1    8536 8536 NA  NA  0 . 
WE 35 NA  1    8537 8537 NA  NA  0 . 
XE 35 NA  1    8541 8541 NA  NA  0 . 
YE 35 NA  1    8542 8542 NA  NA  0 . 
ZE 35 NA  1    8544 8544 NA  NA  0 . 
AF 35 NA  1    8545 8545 NA  NA  0 . 
BF 35 NA  1    8546 8546 NA  NA  0 . 
CF 35 NA  1    8547 8547 NA  NA  0 . 
DF 35 NA  1    8548 8548 NA  NA  0 . 
EF 35 NA  1    8549 8549 NA  NA  0 . 
FF 35 NA  1    8550 8550 NA  NA  0 . 
GF 35 NA  1    8551 8551 NA  NA  0 . 
HF 35 NA  1    8552 8552 NA  NA  0 . 
IF 35 NA  1    8553 8553 NA  NA  0 . 
JF 35 NA  1    8554 8554 NA  NA  0 . 
KF 35 NA  1    8555 8555 NA  NA  0 . 
LF 35 NA  1    8556 8556 NA  NA  0 . 
MF 35 NA  1    8557 8557 NA  NA  0 . 
NF 35 NA  1    8558 8558 NA  NA  0 . 
OF 35 NA  1    8559 8559 NA  NA  0 . 
PF 35 NA  1    8560 8560 NA  NA  0 . 
QF 35 NA  1    8561 8561 NA  NA  0 . 
RF 35 NA  1    8562 8562 NA  NA  0 . 
SF 35 NA  1    8563 8563 NA  NA  0 . 
TF 35 NA  1    8564 8564 NA  NA  0 . 
UF 35 NA  1    8565 8565 NA  NA  0 . 
VF 35 NA  1    8566 8566 NA  NA  0 . 
WF 35 NA  1    8567 8567 NA  NA  0 . 
XF 35 NA  1    8568 8568 NA  NA  0 . 
YF 35 NA  1    8569 8569 NA  NA  0 . 
ZF 35 NA  1    8570 8570 NA  NA  0 . 
AG 35 NA  1    8571 8571 NA  NA  0 . 
BG 35 NA  1    8573 8573 NA  NA  0 . 
CG 35 NA  1    8574 8574 NA  NA  0 . 
DG 36 CL  1    8803 8803 CL  CL  0 . 
EG 36 CL  1    8805 8805 CL  CL  0 . 
FG 36 CL  1    8811 8811 CL  CL  0 . 
GG 36 CL  1    8812 8812 CL  CL  0 . 
HG 36 CL  1    8813 8813 CL  CL  0 . 
IG 36 CL  1    8814 8814 CL  CL  0 . 
JG 36 CL  1    8815 8815 CL  CL  0 . 
KG 36 CL  1    8816 8816 CL  CL  0 . 
LG 36 CL  1    8817 8817 CL  CL  0 . 
MG 36 CL  1    8822 8822 CL  CL  0 . 
NG 37 SR  1    8901 8901 SR  SR  0 . 
OG 37 SR  1    8902 8902 SR  SR  0 . 
PG 37 SR  1    8903 8903 SR  SR  0 . 
QG 37 SR  1    8904 8904 SR  SR  0 . 
RG 37 SR  1    8905 8905 SR  SR  0 . 
SG 37 SR  1    8906 8906 SR  SR  0 . 
TG 37 SR  1    8907 8907 SR  SR  0 . 
UG 37 SR  1    8908 8908 SR  SR  0 . 
VG 37 SR  1    8909 8909 SR  SR  0 . 
WG 37 SR  1    8910 8910 SR  SR  0 . 
XG 37 SR  1    8911 8911 SR  SR  0 . 
YG 37 SR  1    8914 8914 SR  SR  0 . 
ZG 37 SR  1    8915 8915 SR  SR  0 . 
AH 37 SR  1    8916 8916 SR  SR  0 . 
BH 37 SR  1    8917 8917 SR  SR  0 . 
CH 37 SR  1    8918 8918 SR  SR  0 . 
DH 37 SR  1    8919 8919 SR  SR  0 . 
EH 37 SR  1    8920 8920 SR  SR  0 . 
FH 37 SR  1    8921 8921 SR  SR  0 . 
GH 37 SR  1    8922 8922 SR  SR  0 . 
HH 37 SR  1    8923 8923 SR  SR  0 . 
IH 37 SR  1    8924 8924 SR  SR  0 . 
JH 37 SR  1    8925 8925 SR  SR  0 . 
KH 37 SR  1    8926 8926 SR  SR  0 . 
LH 37 SR  1    8927 8927 SR  SR  0 . 
MH 37 SR  1    8928 8928 SR  SR  0 . 
NH 37 SR  1    8931 8931 SR  SR  0 . 
OH 37 SR  1    8933 8933 SR  SR  0 . 
PH 37 SR  1    8934 8934 SR  SR  0 . 
QH 37 SR  1    8935 8935 SR  SR  0 . 
RH 37 SR  1    8936 8936 SR  SR  0 . 
SH 37 SR  1    8937 8937 SR  SR  0 . 
TH 37 SR  1    8938 8938 SR  SR  0 . 
UH 37 SR  1    8939 8939 SR  SR  0 . 
VH 37 SR  1    8940 8940 SR  SR  0 . 
WH 37 SR  1    8941 8941 SR  SR  0 . 
XH 37 SR  1    8942 8942 SR  SR  0 . 
YH 37 SR  1    8943 8943 SR  SR  0 . 
ZH 37 SR  1    8944 8944 SR  SR  0 . 
AI 37 SR  1    8945 8945 SR  SR  0 . 
BI 37 SR  1    8946 8946 SR  SR  0 . 
CI 37 SR  1    8947 8947 SR  SR  0 . 
DI 37 SR  1    8948 8948 SR  SR  0 . 
EI 37 SR  1    8949 8949 SR  SR  0 . 
FI 37 SR  1    8951 8951 SR  SR  0 . 
GI 37 SR  1    8953 8953 SR  SR  0 . 
HI 37 SR  1    8954 8954 SR  SR  0 . 
II 37 SR  1    8955 8955 SR  SR  0 . 
JI 37 SR  1    8956 8956 SR  SR  0 . 
KI 37 SR  1    8957 8957 SR  SR  0 . 
LI 37 SR  1    8958 8958 SR  SR  0 . 
MI 37 SR  1    8959 8959 SR  SR  0 . 
NI 37 SR  1    8960 8960 SR  SR  0 . 
OI 37 SR  1    8962 8962 SR  SR  0 . 
PI 37 SR  1    8963 8963 SR  SR  0 . 
QI 37 SR  1    8964 8964 SR  SR  0 . 
RI 37 SR  1    8965 8965 SR  SR  0 . 
SI 37 SR  1    8966 8966 SR  SR  0 . 
TI 37 SR  1    8967 8967 SR  SR  0 . 
UI 37 SR  1    8968 8968 SR  SR  0 . 
VI 37 SR  1    8969 8969 SR  SR  0 . 
WI 37 SR  1    8970 8970 SR  SR  0 . 
XI 37 SR  1    8971 8971 SR  SR  0 . 
YI 37 SR  1    8973 8973 SR  SR  0 . 
ZI 37 SR  1    8974 8974 SR  SR  0 . 
AJ 37 SR  1    8975 8975 SR  SR  0 . 
BJ 37 SR  1    8976 8976 SR  SR  0 . 
CJ 37 SR  1    8978 8978 SR  SR  0 . 
DJ 37 SR  1    8979 8979 SR  SR  0 . 
EJ 37 SR  1    8981 8981 SR  SR  0 . 
FJ 37 SR  1    8982 8982 SR  SR  0 . 
GJ 37 SR  1    8983 8983 SR  SR  0 . 
HJ 37 SR  1    8984 8984 SR  SR  0 . 
IJ 37 SR  1    8985 8985 SR  SR  0 . 
JJ 37 SR  1    8986 8986 SR  SR  0 . 
KJ 37 SR  1    8988 8988 SR  SR  0 . 
LJ 37 SR  1    8989 8989 SR  SR  0 . 
MJ 37 SR  1    8990 8990 SR  SR  0 . 
NJ 37 SR  1    8991 8991 SR  SR  0 . 
OJ 37 SR  1    8992 8992 SR  SR  0 . 
PJ 37 SR  1    8993 8993 SR  SR  0 . 
QJ 37 SR  1    8994 8994 SR  SR  0 . 
RJ 37 SR  1    8995 8995 SR  SR  0 . 
SJ 37 SR  1    8996 8996 SR  SR  0 . 
TJ 37 SR  1    8997 8997 SR  SR  0 . 
UJ 37 SR  1    8998 8998 SR  SR  0 . 
VJ 37 SR  1    8999 8999 SR  SR  0 . 
WJ 37 SR  1    9000 9000 SR  SR  0 . 
XJ 37 SR  1    9001 9001 SR  SR  0 . 
YJ 37 SR  1    9002 9002 SR  SR  0 . 
ZJ 37 SR  1    9004 9004 SR  SR  0 . 
AK 37 SR  1    9006 9006 SR  SR  0 . 
BK 37 SR  1    9007 9007 SR  SR  0 . 
CK 37 SR  1    9008 9008 SR  SR  0 . 
DK 33 MG  1    8074 8074 MG  MG  9 . 
EK 35 NA  1    8543 8543 NA  NA  9 . 
FK 35 NA  1    8572 8572 NA  NA  9 . 
GK 37 SR  1    8980 8980 SR  SR  9 . 
HK 37 SR  1    9003 9003 SR  SR  9 . 
IK 33 MG  1    8050 8050 MG  MG  A . 
JK 33 MG  1    8051 8051 MG  MG  A . 
KK 36 CL  1    8809 8809 CL  CL  A . 
LK 37 SR  1    8929 8929 SR  SR  A . 
MK 37 SR  1    8930 8930 SR  SR  A . 
NK 37 SR  1    8977 8977 SR  SR  A . 
OK 33 MG  1    8042 8042 MG  MG  B . 
PK 36 CL  1    8819 8819 CL  CL  B . 
QK 37 SR  1    8950 8950 SR  SR  B . 
RK 37 SR  1    8987 8987 SR  SR  B . 
SK 35 NA  1    8503 8503 NA  NA  C . 
TK 37 SR  1    9005 9005 SR  SR  F . 
UK 35 NA  1    8518 8518 NA  NA  H . 
VK 37 SR  1    8972 8972 SR  SR  H . 
WK 35 NA  1    8538 8538 NA  NA  J . 
XK 36 CL  1    8801 8801 CL  CL  J . 
YK 36 CL  1    8802 8802 CL  CL  J . 
ZK 36 CL  1    8821 8821 CL  CL  J . 
AL 33 MG  1    8054 8054 MG  MG  K . 
BL 36 CL  1    8810 8810 CL  CL  L . 
CL 35 NA  1    8539 8539 NA  NA  M . 
DL 36 CL  1    8818 8818 CL  CL  M . 
EL 36 CL  1    8807 8807 CL  CL  N . 
FL 38 CD  1    8705 8705 CD  CD  O . 
GL 36 CL  1    8808 8808 CL  CL  O . 
HL 35 NA  1    8540 8540 NA  NA  Q . 
IL 35 NA  1    8532 8532 NA  NA  R . 
JL 35 NA  1    8575 8575 NA  NA  R . 
KL 36 CL  1    8806 8806 CL  CL  R . 
LL 37 SR  1    8912 8912 SR  SR  R . 
ML 35 NA  1    8510 8510 NA  NA  S . 
NL 37 SR  1    8961 8961 SR  SR  S . 
OL 33 MG  1    8057 8057 MG  MG  T . 
PL 38 CD  1    8701 8701 CD  CD  U . 
QL 33 MG  1    8086 8086 MG  MG  Y . 
RL 36 CL  1    8820 8820 CL  CL  Y . 
SL 38 CD  1    8703 8703 CD  CD  Z . 
TL 38 CD  1    8702 8702 CD  CD  1 . 
UL 37 SR  1    8913 8913 SR  SR  1 . 
VL 37 SR  1    8952 8952 SR  SR  1 . 
WL 38 CD  1    8704 8704 CD  CD  3 . 
XL 36 CL  1    8804 8804 CL  CL  3 . 
YL 37 SR  1    8932 8932 SR  SR  3 . 
ZL 39 HOH 1    3001 620  HOH HOH 0 . 
ZL 39 HOH 2    3002 621  HOH HOH 0 . 
ZL 39 HOH 3    3003 623  HOH HOH 0 . 
ZL 39 HOH 4    3004 624  HOH HOH 0 . 
ZL 39 HOH 5    3005 625  HOH HOH 0 . 
ZL 39 HOH 6    3006 627  HOH HOH 0 . 
ZL 39 HOH 7    3007 628  HOH HOH 0 . 
ZL 39 HOH 8    3008 630  HOH HOH 0 . 
ZL 39 HOH 9    3009 631  HOH HOH 0 . 
ZL 39 HOH 10   3010 632  HOH HOH 0 . 
ZL 39 HOH 11   3011 633  HOH HOH 0 . 
ZL 39 HOH 12   3012 634  HOH HOH 0 . 
ZL 39 HOH 13   3013 638  HOH HOH 0 . 
ZL 39 HOH 14   3014 640  HOH HOH 0 . 
ZL 39 HOH 15   3015 642  HOH HOH 0 . 
ZL 39 HOH 16   3016 643  HOH HOH 0 . 
ZL 39 HOH 17   3017 644  HOH HOH 0 . 
ZL 39 HOH 18   3018 645  HOH HOH 0 . 
ZL 39 HOH 19   3019 646  HOH HOH 0 . 
ZL 39 HOH 20   3020 647  HOH HOH 0 . 
ZL 39 HOH 21   3021 648  HOH HOH 0 . 
ZL 39 HOH 22   3022 649  HOH HOH 0 . 
ZL 39 HOH 23   3023 650  HOH HOH 0 . 
ZL 39 HOH 24   3024 653  HOH HOH 0 . 
ZL 39 HOH 25   3025 654  HOH HOH 0 . 
ZL 39 HOH 26   3026 655  HOH HOH 0 . 
ZL 39 HOH 27   3027 656  HOH HOH 0 . 
ZL 39 HOH 28   3028 657  HOH HOH 0 . 
ZL 39 HOH 29   3029 658  HOH HOH 0 . 
ZL 39 HOH 30   3030 659  HOH HOH 0 . 
ZL 39 HOH 31   3031 660  HOH HOH 0 . 
ZL 39 HOH 32   3032 661  HOH HOH 0 . 
ZL 39 HOH 33   3033 662  HOH HOH 0 . 
ZL 39 HOH 34   3034 663  HOH HOH 0 . 
ZL 39 HOH 35   3035 664  HOH HOH 0 . 
ZL 39 HOH 36   3036 665  HOH HOH 0 . 
ZL 39 HOH 37   3037 667  HOH HOH 0 . 
ZL 39 HOH 38   3038 669  HOH HOH 0 . 
ZL 39 HOH 39   3039 671  HOH HOH 0 . 
ZL 39 HOH 40   3040 672  HOH HOH 0 . 
ZL 39 HOH 41   3041 675  HOH HOH 0 . 
ZL 39 HOH 42   3042 676  HOH HOH 0 . 
ZL 39 HOH 43   3043 677  HOH HOH 0 . 
ZL 39 HOH 44   3044 678  HOH HOH 0 . 
ZL 39 HOH 45   3045 679  HOH HOH 0 . 
ZL 39 HOH 46   3046 680  HOH HOH 0 . 
ZL 39 HOH 47   3047 681  HOH HOH 0 . 
ZL 39 HOH 48   3048 682  HOH HOH 0 . 
ZL 39 HOH 49   3049 683  HOH HOH 0 . 
ZL 39 HOH 50   3050 684  HOH HOH 0 . 
ZL 39 HOH 51   3051 685  HOH HOH 0 . 
ZL 39 HOH 52   3052 686  HOH HOH 0 . 
ZL 39 HOH 53   3053 688  HOH HOH 0 . 
ZL 39 HOH 54   3054 690  HOH HOH 0 . 
ZL 39 HOH 55   3055 691  HOH HOH 0 . 
ZL 39 HOH 56   3056 693  HOH HOH 0 . 
ZL 39 HOH 57   3057 694  HOH HOH 0 . 
ZL 39 HOH 58   3058 695  HOH HOH 0 . 
ZL 39 HOH 59   3059 696  HOH HOH 0 . 
ZL 39 HOH 60   3060 697  HOH HOH 0 . 
ZL 39 HOH 61   3061 698  HOH HOH 0 . 
ZL 39 HOH 62   3062 699  HOH HOH 0 . 
ZL 39 HOH 63   3063 700  HOH HOH 0 . 
ZL 39 HOH 64   3064 701  HOH HOH 0 . 
ZL 39 HOH 65   3065 702  HOH HOH 0 . 
ZL 39 HOH 66   3066 703  HOH HOH 0 . 
ZL 39 HOH 67   3067 704  HOH HOH 0 . 
ZL 39 HOH 68   3068 706  HOH HOH 0 . 
ZL 39 HOH 69   3069 707  HOH HOH 0 . 
ZL 39 HOH 70   3070 708  HOH HOH 0 . 
ZL 39 HOH 71   3071 709  HOH HOH 0 . 
ZL 39 HOH 72   3072 711  HOH HOH 0 . 
ZL 39 HOH 73   3073 712  HOH HOH 0 . 
ZL 39 HOH 74   3074 713  HOH HOH 0 . 
ZL 39 HOH 75   3075 715  HOH HOH 0 . 
ZL 39 HOH 76   3076 716  HOH HOH 0 . 
ZL 39 HOH 77   3077 717  HOH HOH 0 . 
ZL 39 HOH 78   3078 720  HOH HOH 0 . 
ZL 39 HOH 79   3079 722  HOH HOH 0 . 
ZL 39 HOH 80   3080 723  HOH HOH 0 . 
ZL 39 HOH 81   3081 724  HOH HOH 0 . 
ZL 39 HOH 82   3082 725  HOH HOH 0 . 
ZL 39 HOH 83   3083 727  HOH HOH 0 . 
ZL 39 HOH 84   3084 728  HOH HOH 0 . 
ZL 39 HOH 85   3085 729  HOH HOH 0 . 
ZL 39 HOH 86   3086 730  HOH HOH 0 . 
ZL 39 HOH 87   3087 731  HOH HOH 0 . 
ZL 39 HOH 88   3088 732  HOH HOH 0 . 
ZL 39 HOH 89   3089 733  HOH HOH 0 . 
ZL 39 HOH 90   3090 734  HOH HOH 0 . 
ZL 39 HOH 91   3091 735  HOH HOH 0 . 
ZL 39 HOH 92   3092 736  HOH HOH 0 . 
ZL 39 HOH 93   3093 739  HOH HOH 0 . 
ZL 39 HOH 94   3094 740  HOH HOH 0 . 
ZL 39 HOH 95   3095 741  HOH HOH 0 . 
ZL 39 HOH 96   3096 742  HOH HOH 0 . 
ZL 39 HOH 97   3097 743  HOH HOH 0 . 
ZL 39 HOH 98   3098 744  HOH HOH 0 . 
ZL 39 HOH 99   3099 745  HOH HOH 0 . 
ZL 39 HOH 100  3100 746  HOH HOH 0 . 
ZL 39 HOH 101  3101 747  HOH HOH 0 . 
ZL 39 HOH 102  3102 748  HOH HOH 0 . 
ZL 39 HOH 103  3103 749  HOH HOH 0 . 
ZL 39 HOH 104  3104 751  HOH HOH 0 . 
ZL 39 HOH 105  3105 752  HOH HOH 0 . 
ZL 39 HOH 106  3106 753  HOH HOH 0 . 
ZL 39 HOH 107  3107 754  HOH HOH 0 . 
ZL 39 HOH 108  3108 755  HOH HOH 0 . 
ZL 39 HOH 109  3109 756  HOH HOH 0 . 
ZL 39 HOH 110  3110 757  HOH HOH 0 . 
ZL 39 HOH 111  3111 758  HOH HOH 0 . 
ZL 39 HOH 112  3112 759  HOH HOH 0 . 
ZL 39 HOH 113  3113 761  HOH HOH 0 . 
ZL 39 HOH 114  3114 762  HOH HOH 0 . 
ZL 39 HOH 115  3115 763  HOH HOH 0 . 
ZL 39 HOH 116  3116 764  HOH HOH 0 . 
ZL 39 HOH 117  3117 765  HOH HOH 0 . 
ZL 39 HOH 118  3118 767  HOH HOH 0 . 
ZL 39 HOH 119  3119 769  HOH HOH 0 . 
ZL 39 HOH 120  3120 770  HOH HOH 0 . 
ZL 39 HOH 121  3121 771  HOH HOH 0 . 
ZL 39 HOH 122  3122 775  HOH HOH 0 . 
ZL 39 HOH 123  3123 776  HOH HOH 0 . 
ZL 39 HOH 124  3124 777  HOH HOH 0 . 
ZL 39 HOH 125  3125 778  HOH HOH 0 . 
ZL 39 HOH 126  3126 780  HOH HOH 0 . 
ZL 39 HOH 127  3127 781  HOH HOH 0 . 
ZL 39 HOH 128  3128 783  HOH HOH 0 . 
ZL 39 HOH 129  3129 784  HOH HOH 0 . 
ZL 39 HOH 130  3130 785  HOH HOH 0 . 
ZL 39 HOH 131  3131 786  HOH HOH 0 . 
ZL 39 HOH 132  3132 787  HOH HOH 0 . 
ZL 39 HOH 133  3133 788  HOH HOH 0 . 
ZL 39 HOH 134  3134 789  HOH HOH 0 . 
ZL 39 HOH 135  3135 790  HOH HOH 0 . 
ZL 39 HOH 136  3136 791  HOH HOH 0 . 
ZL 39 HOH 137  3137 792  HOH HOH 0 . 
ZL 39 HOH 138  3138 793  HOH HOH 0 . 
ZL 39 HOH 139  3139 794  HOH HOH 0 . 
ZL 39 HOH 140  3140 796  HOH HOH 0 . 
ZL 39 HOH 141  3141 797  HOH HOH 0 . 
ZL 39 HOH 142  3142 798  HOH HOH 0 . 
ZL 39 HOH 143  3143 800  HOH HOH 0 . 
ZL 39 HOH 144  3144 801  HOH HOH 0 . 
ZL 39 HOH 145  3145 802  HOH HOH 0 . 
ZL 39 HOH 146  3146 803  HOH HOH 0 . 
ZL 39 HOH 147  3147 806  HOH HOH 0 . 
ZL 39 HOH 148  3148 807  HOH HOH 0 . 
ZL 39 HOH 149  3149 809  HOH HOH 0 . 
ZL 39 HOH 150  3150 810  HOH HOH 0 . 
ZL 39 HOH 151  3151 811  HOH HOH 0 . 
ZL 39 HOH 152  3152 812  HOH HOH 0 . 
ZL 39 HOH 153  3153 813  HOH HOH 0 . 
ZL 39 HOH 154  3154 814  HOH HOH 0 . 
ZL 39 HOH 155  3155 815  HOH HOH 0 . 
ZL 39 HOH 156  3156 816  HOH HOH 0 . 
ZL 39 HOH 157  3157 817  HOH HOH 0 . 
ZL 39 HOH 158  3158 818  HOH HOH 0 . 
ZL 39 HOH 159  3159 819  HOH HOH 0 . 
ZL 39 HOH 160  3160 820  HOH HOH 0 . 
ZL 39 HOH 161  3161 821  HOH HOH 0 . 
ZL 39 HOH 162  3162 822  HOH HOH 0 . 
ZL 39 HOH 163  3163 825  HOH HOH 0 . 
ZL 39 HOH 164  3164 826  HOH HOH 0 . 
ZL 39 HOH 165  3165 827  HOH HOH 0 . 
ZL 39 HOH 166  3166 831  HOH HOH 0 . 
ZL 39 HOH 167  3167 832  HOH HOH 0 . 
ZL 39 HOH 168  3168 833  HOH HOH 0 . 
ZL 39 HOH 169  3169 834  HOH HOH 0 . 
ZL 39 HOH 170  3170 835  HOH HOH 0 . 
ZL 39 HOH 171  3171 836  HOH HOH 0 . 
ZL 39 HOH 172  3172 837  HOH HOH 0 . 
ZL 39 HOH 173  3173 838  HOH HOH 0 . 
ZL 39 HOH 174  3174 839  HOH HOH 0 . 
ZL 39 HOH 175  3175 841  HOH HOH 0 . 
ZL 39 HOH 176  3176 842  HOH HOH 0 . 
ZL 39 HOH 177  3177 843  HOH HOH 0 . 
ZL 39 HOH 178  3178 844  HOH HOH 0 . 
ZL 39 HOH 179  3179 846  HOH HOH 0 . 
ZL 39 HOH 180  3180 848  HOH HOH 0 . 
ZL 39 HOH 181  3181 849  HOH HOH 0 . 
ZL 39 HOH 182  3182 850  HOH HOH 0 . 
ZL 39 HOH 183  3183 851  HOH HOH 0 . 
ZL 39 HOH 184  3184 852  HOH HOH 0 . 
ZL 39 HOH 185  3185 855  HOH HOH 0 . 
ZL 39 HOH 186  3186 856  HOH HOH 0 . 
ZL 39 HOH 187  3187 857  HOH HOH 0 . 
ZL 39 HOH 188  3188 858  HOH HOH 0 . 
ZL 39 HOH 189  3189 859  HOH HOH 0 . 
ZL 39 HOH 190  3190 861  HOH HOH 0 . 
ZL 39 HOH 191  3191 862  HOH HOH 0 . 
ZL 39 HOH 192  3192 866  HOH HOH 0 . 
ZL 39 HOH 193  3193 867  HOH HOH 0 . 
ZL 39 HOH 194  3194 868  HOH HOH 0 . 
ZL 39 HOH 195  3195 869  HOH HOH 0 . 
ZL 39 HOH 196  3196 870  HOH HOH 0 . 
ZL 39 HOH 197  3197 872  HOH HOH 0 . 
ZL 39 HOH 198  3198 873  HOH HOH 0 . 
ZL 39 HOH 199  3199 875  HOH HOH 0 . 
ZL 39 HOH 200  3200 876  HOH HOH 0 . 
ZL 39 HOH 201  3201 877  HOH HOH 0 . 
ZL 39 HOH 202  3202 878  HOH HOH 0 . 
ZL 39 HOH 203  3203 879  HOH HOH 0 . 
ZL 39 HOH 204  3204 880  HOH HOH 0 . 
ZL 39 HOH 205  3205 881  HOH HOH 0 . 
ZL 39 HOH 206  3206 883  HOH HOH 0 . 
ZL 39 HOH 207  3207 884  HOH HOH 0 . 
ZL 39 HOH 208  3208 885  HOH HOH 0 . 
ZL 39 HOH 209  3209 886  HOH HOH 0 . 
ZL 39 HOH 210  3210 888  HOH HOH 0 . 
ZL 39 HOH 211  3211 889  HOH HOH 0 . 
ZL 39 HOH 212  3212 890  HOH HOH 0 . 
ZL 39 HOH 213  3213 891  HOH HOH 0 . 
ZL 39 HOH 214  3214 893  HOH HOH 0 . 
ZL 39 HOH 215  3215 894  HOH HOH 0 . 
ZL 39 HOH 216  3216 896  HOH HOH 0 . 
ZL 39 HOH 217  3217 897  HOH HOH 0 . 
ZL 39 HOH 218  3218 899  HOH HOH 0 . 
ZL 39 HOH 219  3219 900  HOH HOH 0 . 
ZL 39 HOH 220  3220 901  HOH HOH 0 . 
ZL 39 HOH 221  3221 903  HOH HOH 0 . 
ZL 39 HOH 222  3222 904  HOH HOH 0 . 
ZL 39 HOH 223  3223 905  HOH HOH 0 . 
ZL 39 HOH 224  3224 906  HOH HOH 0 . 
ZL 39 HOH 225  3225 908  HOH HOH 0 . 
ZL 39 HOH 226  3226 909  HOH HOH 0 . 
ZL 39 HOH 227  3227 911  HOH HOH 0 . 
ZL 39 HOH 228  3228 912  HOH HOH 0 . 
ZL 39 HOH 229  3229 913  HOH HOH 0 . 
ZL 39 HOH 230  3230 915  HOH HOH 0 . 
ZL 39 HOH 231  3231 916  HOH HOH 0 . 
ZL 39 HOH 232  3232 917  HOH HOH 0 . 
ZL 39 HOH 233  3233 918  HOH HOH 0 . 
ZL 39 HOH 234  3234 919  HOH HOH 0 . 
ZL 39 HOH 235  3235 920  HOH HOH 0 . 
ZL 39 HOH 236  3236 921  HOH HOH 0 . 
ZL 39 HOH 237  3237 923  HOH HOH 0 . 
ZL 39 HOH 238  3238 925  HOH HOH 0 . 
ZL 39 HOH 239  3239 926  HOH HOH 0 . 
ZL 39 HOH 240  3240 928  HOH HOH 0 . 
ZL 39 HOH 241  3241 929  HOH HOH 0 . 
ZL 39 HOH 242  3242 931  HOH HOH 0 . 
ZL 39 HOH 243  3243 932  HOH HOH 0 . 
ZL 39 HOH 244  3244 934  HOH HOH 0 . 
ZL 39 HOH 245  3245 939  HOH HOH 0 . 
ZL 39 HOH 246  3246 940  HOH HOH 0 . 
ZL 39 HOH 247  3247 942  HOH HOH 0 . 
ZL 39 HOH 248  3248 944  HOH HOH 0 . 
ZL 39 HOH 249  3249 945  HOH HOH 0 . 
ZL 39 HOH 250  3250 946  HOH HOH 0 . 
ZL 39 HOH 251  3251 947  HOH HOH 0 . 
ZL 39 HOH 252  3252 949  HOH HOH 0 . 
ZL 39 HOH 253  3253 950  HOH HOH 0 . 
ZL 39 HOH 254  3254 951  HOH HOH 0 . 
ZL 39 HOH 255  3255 952  HOH HOH 0 . 
ZL 39 HOH 256  3256 953  HOH HOH 0 . 
ZL 39 HOH 257  3257 954  HOH HOH 0 . 
ZL 39 HOH 258  3258 956  HOH HOH 0 . 
ZL 39 HOH 259  3259 957  HOH HOH 0 . 
ZL 39 HOH 260  3260 958  HOH HOH 0 . 
ZL 39 HOH 261  3261 959  HOH HOH 0 . 
ZL 39 HOH 262  3262 961  HOH HOH 0 . 
ZL 39 HOH 263  3263 962  HOH HOH 0 . 
ZL 39 HOH 264  3264 963  HOH HOH 0 . 
ZL 39 HOH 265  3265 964  HOH HOH 0 . 
ZL 39 HOH 266  3266 965  HOH HOH 0 . 
ZL 39 HOH 267  3267 966  HOH HOH 0 . 
ZL 39 HOH 268  3268 967  HOH HOH 0 . 
ZL 39 HOH 269  3269 968  HOH HOH 0 . 
ZL 39 HOH 270  3270 969  HOH HOH 0 . 
ZL 39 HOH 271  3271 970  HOH HOH 0 . 
ZL 39 HOH 272  3272 971  HOH HOH 0 . 
ZL 39 HOH 273  3273 974  HOH HOH 0 . 
ZL 39 HOH 274  3274 975  HOH HOH 0 . 
ZL 39 HOH 275  3275 976  HOH HOH 0 . 
ZL 39 HOH 276  3276 977  HOH HOH 0 . 
ZL 39 HOH 277  3277 979  HOH HOH 0 . 
ZL 39 HOH 278  3278 980  HOH HOH 0 . 
ZL 39 HOH 279  3279 983  HOH HOH 0 . 
ZL 39 HOH 280  3280 984  HOH HOH 0 . 
ZL 39 HOH 281  3281 987  HOH HOH 0 . 
ZL 39 HOH 282  3282 989  HOH HOH 0 . 
ZL 39 HOH 283  3283 990  HOH HOH 0 . 
ZL 39 HOH 284  3284 992  HOH HOH 0 . 
ZL 39 HOH 285  3285 993  HOH HOH 0 . 
ZL 39 HOH 286  3286 994  HOH HOH 0 . 
ZL 39 HOH 287  3287 996  HOH HOH 0 . 
ZL 39 HOH 288  3288 999  HOH HOH 0 . 
ZL 39 HOH 289  3289 1000 HOH HOH 0 . 
ZL 39 HOH 290  3290 1001 HOH HOH 0 . 
ZL 39 HOH 291  3291 1002 HOH HOH 0 . 
ZL 39 HOH 292  3292 1003 HOH HOH 0 . 
ZL 39 HOH 293  3293 1005 HOH HOH 0 . 
ZL 39 HOH 294  3294 1008 HOH HOH 0 . 
ZL 39 HOH 295  3295 1009 HOH HOH 0 . 
ZL 39 HOH 296  3296 1010 HOH HOH 0 . 
ZL 39 HOH 297  3297 1011 HOH HOH 0 . 
ZL 39 HOH 298  3298 1012 HOH HOH 0 . 
ZL 39 HOH 299  3299 1013 HOH HOH 0 . 
ZL 39 HOH 300  3300 1014 HOH HOH 0 . 
ZL 39 HOH 301  3301 1015 HOH HOH 0 . 
ZL 39 HOH 302  3302 1016 HOH HOH 0 . 
ZL 39 HOH 303  3303 1021 HOH HOH 0 . 
ZL 39 HOH 304  3304 1022 HOH HOH 0 . 
ZL 39 HOH 305  3305 1023 HOH HOH 0 . 
ZL 39 HOH 306  3306 1024 HOH HOH 0 . 
ZL 39 HOH 307  3307 1025 HOH HOH 0 . 
ZL 39 HOH 308  3308 1027 HOH HOH 0 . 
ZL 39 HOH 309  3309 1028 HOH HOH 0 . 
ZL 39 HOH 310  3310 1029 HOH HOH 0 . 
ZL 39 HOH 311  3311 1030 HOH HOH 0 . 
ZL 39 HOH 312  3312 1032 HOH HOH 0 . 
ZL 39 HOH 313  3313 1033 HOH HOH 0 . 
ZL 39 HOH 314  3314 1034 HOH HOH 0 . 
ZL 39 HOH 315  3315 1035 HOH HOH 0 . 
ZL 39 HOH 316  3316 1036 HOH HOH 0 . 
ZL 39 HOH 317  3317 1037 HOH HOH 0 . 
ZL 39 HOH 318  3318 1038 HOH HOH 0 . 
ZL 39 HOH 319  3319 1039 HOH HOH 0 . 
ZL 39 HOH 320  3320 1040 HOH HOH 0 . 
ZL 39 HOH 321  3321 1041 HOH HOH 0 . 
ZL 39 HOH 322  3322 1042 HOH HOH 0 . 
ZL 39 HOH 323  3323 1043 HOH HOH 0 . 
ZL 39 HOH 324  3324 1044 HOH HOH 0 . 
ZL 39 HOH 325  3325 1045 HOH HOH 0 . 
ZL 39 HOH 326  3326 1046 HOH HOH 0 . 
ZL 39 HOH 327  3327 1049 HOH HOH 0 . 
ZL 39 HOH 328  3328 1050 HOH HOH 0 . 
ZL 39 HOH 329  3329 1052 HOH HOH 0 . 
ZL 39 HOH 330  3330 1055 HOH HOH 0 . 
ZL 39 HOH 331  3331 1057 HOH HOH 0 . 
ZL 39 HOH 332  3332 1058 HOH HOH 0 . 
ZL 39 HOH 333  3333 1059 HOH HOH 0 . 
ZL 39 HOH 334  3334 1060 HOH HOH 0 . 
ZL 39 HOH 335  3335 1061 HOH HOH 0 . 
ZL 39 HOH 336  3336 1062 HOH HOH 0 . 
ZL 39 HOH 337  3337 1063 HOH HOH 0 . 
ZL 39 HOH 338  3338 1064 HOH HOH 0 . 
ZL 39 HOH 339  3339 1065 HOH HOH 0 . 
ZL 39 HOH 340  3340 1067 HOH HOH 0 . 
ZL 39 HOH 341  3341 1070 HOH HOH 0 . 
ZL 39 HOH 342  3342 1071 HOH HOH 0 . 
ZL 39 HOH 343  3343 1072 HOH HOH 0 . 
ZL 39 HOH 344  3344 1073 HOH HOH 0 . 
ZL 39 HOH 345  3345 1075 HOH HOH 0 . 
ZL 39 HOH 346  3346 1077 HOH HOH 0 . 
ZL 39 HOH 347  3347 1078 HOH HOH 0 . 
ZL 39 HOH 348  3348 1079 HOH HOH 0 . 
ZL 39 HOH 349  3349 1080 HOH HOH 0 . 
ZL 39 HOH 350  3350 1081 HOH HOH 0 . 
ZL 39 HOH 351  3351 1082 HOH HOH 0 . 
ZL 39 HOH 352  3352 1083 HOH HOH 0 . 
ZL 39 HOH 353  3353 1084 HOH HOH 0 . 
ZL 39 HOH 354  3354 1085 HOH HOH 0 . 
ZL 39 HOH 355  3355 1086 HOH HOH 0 . 
ZL 39 HOH 356  3356 1087 HOH HOH 0 . 
ZL 39 HOH 357  3357 1088 HOH HOH 0 . 
ZL 39 HOH 358  3358 1089 HOH HOH 0 . 
ZL 39 HOH 359  3359 1090 HOH HOH 0 . 
ZL 39 HOH 360  3360 1091 HOH HOH 0 . 
ZL 39 HOH 361  3361 1092 HOH HOH 0 . 
ZL 39 HOH 362  3362 1093 HOH HOH 0 . 
ZL 39 HOH 363  3363 1095 HOH HOH 0 . 
ZL 39 HOH 364  3364 1096 HOH HOH 0 . 
ZL 39 HOH 365  3365 1097 HOH HOH 0 . 
ZL 39 HOH 366  3366 1098 HOH HOH 0 . 
ZL 39 HOH 367  3367 1101 HOH HOH 0 . 
ZL 39 HOH 368  3368 1102 HOH HOH 0 . 
ZL 39 HOH 369  3369 1103 HOH HOH 0 . 
ZL 39 HOH 370  3370 1104 HOH HOH 0 . 
ZL 39 HOH 371  3371 1105 HOH HOH 0 . 
ZL 39 HOH 372  3372 1106 HOH HOH 0 . 
ZL 39 HOH 373  3373 1107 HOH HOH 0 . 
ZL 39 HOH 374  3374 1108 HOH HOH 0 . 
ZL 39 HOH 375  3375 1109 HOH HOH 0 . 
ZL 39 HOH 376  3376 1110 HOH HOH 0 . 
ZL 39 HOH 377  3377 1111 HOH HOH 0 . 
ZL 39 HOH 378  3378 1112 HOH HOH 0 . 
ZL 39 HOH 379  3379 1113 HOH HOH 0 . 
ZL 39 HOH 380  3380 1114 HOH HOH 0 . 
ZL 39 HOH 381  3381 1115 HOH HOH 0 . 
ZL 39 HOH 382  3382 1116 HOH HOH 0 . 
ZL 39 HOH 383  3383 1117 HOH HOH 0 . 
ZL 39 HOH 384  3384 1119 HOH HOH 0 . 
ZL 39 HOH 385  3385 1121 HOH HOH 0 . 
ZL 39 HOH 386  3386 1122 HOH HOH 0 . 
ZL 39 HOH 387  3387 1125 HOH HOH 0 . 
ZL 39 HOH 388  3388 1126 HOH HOH 0 . 
ZL 39 HOH 389  3389 1127 HOH HOH 0 . 
ZL 39 HOH 390  3390 1128 HOH HOH 0 . 
ZL 39 HOH 391  3391 1129 HOH HOH 0 . 
ZL 39 HOH 392  3392 1130 HOH HOH 0 . 
ZL 39 HOH 393  3393 1131 HOH HOH 0 . 
ZL 39 HOH 394  3394 1134 HOH HOH 0 . 
ZL 39 HOH 395  3395 1135 HOH HOH 0 . 
ZL 39 HOH 396  3396 1138 HOH HOH 0 . 
ZL 39 HOH 397  3397 1142 HOH HOH 0 . 
ZL 39 HOH 398  3398 1143 HOH HOH 0 . 
ZL 39 HOH 399  3399 1144 HOH HOH 0 . 
ZL 39 HOH 400  3400 1145 HOH HOH 0 . 
ZL 39 HOH 401  3401 1146 HOH HOH 0 . 
ZL 39 HOH 402  3402 1147 HOH HOH 0 . 
ZL 39 HOH 403  3403 1148 HOH HOH 0 . 
ZL 39 HOH 404  3404 1149 HOH HOH 0 . 
ZL 39 HOH 405  3405 1150 HOH HOH 0 . 
ZL 39 HOH 406  3406 1151 HOH HOH 0 . 
ZL 39 HOH 407  3407 1152 HOH HOH 0 . 
ZL 39 HOH 408  3408 1153 HOH HOH 0 . 
ZL 39 HOH 409  3409 1156 HOH HOH 0 . 
ZL 39 HOH 410  3410 1157 HOH HOH 0 . 
ZL 39 HOH 411  3411 1158 HOH HOH 0 . 
ZL 39 HOH 412  3412 1159 HOH HOH 0 . 
ZL 39 HOH 413  3413 1160 HOH HOH 0 . 
ZL 39 HOH 414  3414 1161 HOH HOH 0 . 
ZL 39 HOH 415  3415 1162 HOH HOH 0 . 
ZL 39 HOH 416  3416 1164 HOH HOH 0 . 
ZL 39 HOH 417  3417 1166 HOH HOH 0 . 
ZL 39 HOH 418  3418 1167 HOH HOH 0 . 
ZL 39 HOH 419  3419 1169 HOH HOH 0 . 
ZL 39 HOH 420  3420 1170 HOH HOH 0 . 
ZL 39 HOH 421  3421 1171 HOH HOH 0 . 
ZL 39 HOH 422  3422 1172 HOH HOH 0 . 
ZL 39 HOH 423  3423 1173 HOH HOH 0 . 
ZL 39 HOH 424  3424 1174 HOH HOH 0 . 
ZL 39 HOH 425  3425 1175 HOH HOH 0 . 
ZL 39 HOH 426  3426 1176 HOH HOH 0 . 
ZL 39 HOH 427  3427 1177 HOH HOH 0 . 
ZL 39 HOH 428  3428 1180 HOH HOH 0 . 
ZL 39 HOH 429  3429 1181 HOH HOH 0 . 
ZL 39 HOH 430  3430 1182 HOH HOH 0 . 
ZL 39 HOH 431  3431 1183 HOH HOH 0 . 
ZL 39 HOH 432  3432 1184 HOH HOH 0 . 
ZL 39 HOH 433  3433 1186 HOH HOH 0 . 
ZL 39 HOH 434  3434 1187 HOH HOH 0 . 
ZL 39 HOH 435  3435 1189 HOH HOH 0 . 
ZL 39 HOH 436  3436 1190 HOH HOH 0 . 
ZL 39 HOH 437  3437 1191 HOH HOH 0 . 
ZL 39 HOH 438  3438 1192 HOH HOH 0 . 
ZL 39 HOH 439  3439 1194 HOH HOH 0 . 
ZL 39 HOH 440  3440 1195 HOH HOH 0 . 
ZL 39 HOH 441  3441 1196 HOH HOH 0 . 
ZL 39 HOH 442  3442 1199 HOH HOH 0 . 
ZL 39 HOH 443  3443 1201 HOH HOH 0 . 
ZL 39 HOH 444  3444 1202 HOH HOH 0 . 
ZL 39 HOH 445  3445 1203 HOH HOH 0 . 
ZL 39 HOH 446  3446 1204 HOH HOH 0 . 
ZL 39 HOH 447  3447 1205 HOH HOH 0 . 
ZL 39 HOH 448  3448 1206 HOH HOH 0 . 
ZL 39 HOH 449  3449 1207 HOH HOH 0 . 
ZL 39 HOH 450  3450 1208 HOH HOH 0 . 
ZL 39 HOH 451  3451 1209 HOH HOH 0 . 
ZL 39 HOH 452  3452 1210 HOH HOH 0 . 
ZL 39 HOH 453  3453 1211 HOH HOH 0 . 
ZL 39 HOH 454  3454 1212 HOH HOH 0 . 
ZL 39 HOH 455  3455 1213 HOH HOH 0 . 
ZL 39 HOH 456  3456 1214 HOH HOH 0 . 
ZL 39 HOH 457  3457 1216 HOH HOH 0 . 
ZL 39 HOH 458  3458 1217 HOH HOH 0 . 
ZL 39 HOH 459  3459 1218 HOH HOH 0 . 
ZL 39 HOH 460  3460 1219 HOH HOH 0 . 
ZL 39 HOH 461  3461 1221 HOH HOH 0 . 
ZL 39 HOH 462  3462 1222 HOH HOH 0 . 
ZL 39 HOH 463  3463 1223 HOH HOH 0 . 
ZL 39 HOH 464  3464 1224 HOH HOH 0 . 
ZL 39 HOH 465  3465 1225 HOH HOH 0 . 
ZL 39 HOH 466  3466 1227 HOH HOH 0 . 
ZL 39 HOH 467  3467 1229 HOH HOH 0 . 
ZL 39 HOH 468  3468 1230 HOH HOH 0 . 
ZL 39 HOH 469  3469 1231 HOH HOH 0 . 
ZL 39 HOH 470  3470 1232 HOH HOH 0 . 
ZL 39 HOH 471  3471 1233 HOH HOH 0 . 
ZL 39 HOH 472  3472 1235 HOH HOH 0 . 
ZL 39 HOH 473  3473 1237 HOH HOH 0 . 
ZL 39 HOH 474  3474 1239 HOH HOH 0 . 
ZL 39 HOH 475  3475 1241 HOH HOH 0 . 
ZL 39 HOH 476  3476 1244 HOH HOH 0 . 
ZL 39 HOH 477  3477 1245 HOH HOH 0 . 
ZL 39 HOH 478  3478 1246 HOH HOH 0 . 
ZL 39 HOH 479  3479 1247 HOH HOH 0 . 
ZL 39 HOH 480  3480 1248 HOH HOH 0 . 
ZL 39 HOH 481  3481 1249 HOH HOH 0 . 
ZL 39 HOH 482  3482 1250 HOH HOH 0 . 
ZL 39 HOH 483  3483 1251 HOH HOH 0 . 
ZL 39 HOH 484  3484 1252 HOH HOH 0 . 
ZL 39 HOH 485  3485 1253 HOH HOH 0 . 
ZL 39 HOH 486  3486 1255 HOH HOH 0 . 
ZL 39 HOH 487  3487 1256 HOH HOH 0 . 
ZL 39 HOH 488  3488 1258 HOH HOH 0 . 
ZL 39 HOH 489  3489 1260 HOH HOH 0 . 
ZL 39 HOH 490  3490 1262 HOH HOH 0 . 
ZL 39 HOH 491  3491 1263 HOH HOH 0 . 
ZL 39 HOH 492  3492 1264 HOH HOH 0 . 
ZL 39 HOH 493  3493 1265 HOH HOH 0 . 
ZL 39 HOH 494  3494 1267 HOH HOH 0 . 
ZL 39 HOH 495  3495 1268 HOH HOH 0 . 
ZL 39 HOH 496  3496 1270 HOH HOH 0 . 
ZL 39 HOH 497  3497 1271 HOH HOH 0 . 
ZL 39 HOH 498  3498 1272 HOH HOH 0 . 
ZL 39 HOH 499  3499 1273 HOH HOH 0 . 
ZL 39 HOH 500  3500 1274 HOH HOH 0 . 
ZL 39 HOH 501  3501 1275 HOH HOH 0 . 
ZL 39 HOH 502  3502 1277 HOH HOH 0 . 
ZL 39 HOH 503  3503 1278 HOH HOH 0 . 
ZL 39 HOH 504  3504 1279 HOH HOH 0 . 
ZL 39 HOH 505  3505 1282 HOH HOH 0 . 
ZL 39 HOH 506  3506 1283 HOH HOH 0 . 
ZL 39 HOH 507  3507 1284 HOH HOH 0 . 
ZL 39 HOH 508  3508 1285 HOH HOH 0 . 
ZL 39 HOH 509  3509 1286 HOH HOH 0 . 
ZL 39 HOH 510  3510 1287 HOH HOH 0 . 
ZL 39 HOH 511  3511 1288 HOH HOH 0 . 
ZL 39 HOH 512  3512 1289 HOH HOH 0 . 
ZL 39 HOH 513  3513 1290 HOH HOH 0 . 
ZL 39 HOH 514  3514 1291 HOH HOH 0 . 
ZL 39 HOH 515  3515 1292 HOH HOH 0 . 
ZL 39 HOH 516  3516 1294 HOH HOH 0 . 
ZL 39 HOH 517  3517 1296 HOH HOH 0 . 
ZL 39 HOH 518  3518 1297 HOH HOH 0 . 
ZL 39 HOH 519  3519 1298 HOH HOH 0 . 
ZL 39 HOH 520  3520 1299 HOH HOH 0 . 
ZL 39 HOH 521  3521 1300 HOH HOH 0 . 
ZL 39 HOH 522  3522 1301 HOH HOH 0 . 
ZL 39 HOH 523  3523 1302 HOH HOH 0 . 
ZL 39 HOH 524  3524 1303 HOH HOH 0 . 
ZL 39 HOH 525  3525 1304 HOH HOH 0 . 
ZL 39 HOH 526  3526 1305 HOH HOH 0 . 
ZL 39 HOH 527  3527 1306 HOH HOH 0 . 
ZL 39 HOH 528  3528 1308 HOH HOH 0 . 
ZL 39 HOH 529  3529 1311 HOH HOH 0 . 
ZL 39 HOH 530  3530 1312 HOH HOH 0 . 
ZL 39 HOH 531  3531 1313 HOH HOH 0 . 
ZL 39 HOH 532  3532 1315 HOH HOH 0 . 
ZL 39 HOH 533  3533 1318 HOH HOH 0 . 
ZL 39 HOH 534  3534 1319 HOH HOH 0 . 
ZL 39 HOH 535  3535 1320 HOH HOH 0 . 
ZL 39 HOH 536  3536 1321 HOH HOH 0 . 
ZL 39 HOH 537  3537 1322 HOH HOH 0 . 
ZL 39 HOH 538  3538 1323 HOH HOH 0 . 
ZL 39 HOH 539  3539 1325 HOH HOH 0 . 
ZL 39 HOH 540  3540 1326 HOH HOH 0 . 
ZL 39 HOH 541  3541 1327 HOH HOH 0 . 
ZL 39 HOH 542  3542 1328 HOH HOH 0 . 
ZL 39 HOH 543  3543 1330 HOH HOH 0 . 
ZL 39 HOH 544  3544 1331 HOH HOH 0 . 
ZL 39 HOH 545  3545 1332 HOH HOH 0 . 
ZL 39 HOH 546  3546 1333 HOH HOH 0 . 
ZL 39 HOH 547  3547 1335 HOH HOH 0 . 
ZL 39 HOH 548  3548 1337 HOH HOH 0 . 
ZL 39 HOH 549  3549 1338 HOH HOH 0 . 
ZL 39 HOH 550  3550 1339 HOH HOH 0 . 
ZL 39 HOH 551  3551 1340 HOH HOH 0 . 
ZL 39 HOH 552  3552 1341 HOH HOH 0 . 
ZL 39 HOH 553  3553 1342 HOH HOH 0 . 
ZL 39 HOH 554  3554 1343 HOH HOH 0 . 
ZL 39 HOH 555  3555 1344 HOH HOH 0 . 
ZL 39 HOH 556  3556 1345 HOH HOH 0 . 
ZL 39 HOH 557  3557 1346 HOH HOH 0 . 
ZL 39 HOH 558  3558 1347 HOH HOH 0 . 
ZL 39 HOH 559  3559 1348 HOH HOH 0 . 
ZL 39 HOH 560  3560 1349 HOH HOH 0 . 
ZL 39 HOH 561  3561 1350 HOH HOH 0 . 
ZL 39 HOH 562  3562 1351 HOH HOH 0 . 
ZL 39 HOH 563  3563 1352 HOH HOH 0 . 
ZL 39 HOH 564  3564 1353 HOH HOH 0 . 
ZL 39 HOH 565  3565 1354 HOH HOH 0 . 
ZL 39 HOH 566  3566 1355 HOH HOH 0 . 
ZL 39 HOH 567  3567 1357 HOH HOH 0 . 
ZL 39 HOH 568  3568 1358 HOH HOH 0 . 
ZL 39 HOH 569  3569 1359 HOH HOH 0 . 
ZL 39 HOH 570  3570 1362 HOH HOH 0 . 
ZL 39 HOH 571  3571 1363 HOH HOH 0 . 
ZL 39 HOH 572  3572 1364 HOH HOH 0 . 
ZL 39 HOH 573  3573 1365 HOH HOH 0 . 
ZL 39 HOH 574  3574 1366 HOH HOH 0 . 
ZL 39 HOH 575  3575 1367 HOH HOH 0 . 
ZL 39 HOH 576  3576 1368 HOH HOH 0 . 
ZL 39 HOH 577  3577 1369 HOH HOH 0 . 
ZL 39 HOH 578  3578 1371 HOH HOH 0 . 
ZL 39 HOH 579  3579 1374 HOH HOH 0 . 
ZL 39 HOH 580  3580 1375 HOH HOH 0 . 
ZL 39 HOH 581  3581 1377 HOH HOH 0 . 
ZL 39 HOH 582  3582 1378 HOH HOH 0 . 
ZL 39 HOH 583  3583 1379 HOH HOH 0 . 
ZL 39 HOH 584  3584 1380 HOH HOH 0 . 
ZL 39 HOH 585  3585 1381 HOH HOH 0 . 
ZL 39 HOH 586  3586 1382 HOH HOH 0 . 
ZL 39 HOH 587  3587 1383 HOH HOH 0 . 
ZL 39 HOH 588  3588 1384 HOH HOH 0 . 
ZL 39 HOH 589  3589 1385 HOH HOH 0 . 
ZL 39 HOH 590  3590 1386 HOH HOH 0 . 
ZL 39 HOH 591  3591 1388 HOH HOH 0 . 
ZL 39 HOH 592  3592 1389 HOH HOH 0 . 
ZL 39 HOH 593  3593 1390 HOH HOH 0 . 
ZL 39 HOH 594  3594 1392 HOH HOH 0 . 
ZL 39 HOH 595  3595 1393 HOH HOH 0 . 
ZL 39 HOH 596  3596 1394 HOH HOH 0 . 
ZL 39 HOH 597  3597 1395 HOH HOH 0 . 
ZL 39 HOH 598  3598 1396 HOH HOH 0 . 
ZL 39 HOH 599  3599 1397 HOH HOH 0 . 
ZL 39 HOH 600  3600 1398 HOH HOH 0 . 
ZL 39 HOH 601  3601 1399 HOH HOH 0 . 
ZL 39 HOH 602  3602 1400 HOH HOH 0 . 
ZL 39 HOH 603  3603 1401 HOH HOH 0 . 
ZL 39 HOH 604  3604 1402 HOH HOH 0 . 
ZL 39 HOH 605  3605 1403 HOH HOH 0 . 
ZL 39 HOH 606  3606 1404 HOH HOH 0 . 
ZL 39 HOH 607  3607 1407 HOH HOH 0 . 
ZL 39 HOH 608  3608 1408 HOH HOH 0 . 
ZL 39 HOH 609  3609 1409 HOH HOH 0 . 
ZL 39 HOH 610  3610 1410 HOH HOH 0 . 
ZL 39 HOH 611  3611 1411 HOH HOH 0 . 
ZL 39 HOH 612  3612 1412 HOH HOH 0 . 
ZL 39 HOH 613  3613 1414 HOH HOH 0 . 
ZL 39 HOH 614  3614 1415 HOH HOH 0 . 
ZL 39 HOH 615  3615 1418 HOH HOH 0 . 
ZL 39 HOH 616  3616 1419 HOH HOH 0 . 
ZL 39 HOH 617  3617 1420 HOH HOH 0 . 
ZL 39 HOH 618  3618 1421 HOH HOH 0 . 
ZL 39 HOH 619  3619 1423 HOH HOH 0 . 
ZL 39 HOH 620  3620 1424 HOH HOH 0 . 
ZL 39 HOH 621  3621 1425 HOH HOH 0 . 
ZL 39 HOH 622  3622 1426 HOH HOH 0 . 
ZL 39 HOH 623  3623 1427 HOH HOH 0 . 
ZL 39 HOH 624  3624 1429 HOH HOH 0 . 
ZL 39 HOH 625  3625 1430 HOH HOH 0 . 
ZL 39 HOH 626  3626 1431 HOH HOH 0 . 
ZL 39 HOH 627  3627 1432 HOH HOH 0 . 
ZL 39 HOH 628  3628 1434 HOH HOH 0 . 
ZL 39 HOH 629  3629 1435 HOH HOH 0 . 
ZL 39 HOH 630  3630 1438 HOH HOH 0 . 
ZL 39 HOH 631  3631 1439 HOH HOH 0 . 
ZL 39 HOH 632  3632 1440 HOH HOH 0 . 
ZL 39 HOH 633  3633 1442 HOH HOH 0 . 
ZL 39 HOH 634  3634 1443 HOH HOH 0 . 
ZL 39 HOH 635  3635 1444 HOH HOH 0 . 
ZL 39 HOH 636  3636 1445 HOH HOH 0 . 
ZL 39 HOH 637  3637 1446 HOH HOH 0 . 
ZL 39 HOH 638  3638 1447 HOH HOH 0 . 
ZL 39 HOH 639  3639 1448 HOH HOH 0 . 
ZL 39 HOH 640  3640 1451 HOH HOH 0 . 
ZL 39 HOH 641  3641 1452 HOH HOH 0 . 
ZL 39 HOH 642  3642 1453 HOH HOH 0 . 
ZL 39 HOH 643  3643 1455 HOH HOH 0 . 
ZL 39 HOH 644  3644 1456 HOH HOH 0 . 
ZL 39 HOH 645  3645 1457 HOH HOH 0 . 
ZL 39 HOH 646  3646 1459 HOH HOH 0 . 
ZL 39 HOH 647  3647 1460 HOH HOH 0 . 
ZL 39 HOH 648  3648 1461 HOH HOH 0 . 
ZL 39 HOH 649  3649 1462 HOH HOH 0 . 
ZL 39 HOH 650  3650 1463 HOH HOH 0 . 
ZL 39 HOH 651  3651 1464 HOH HOH 0 . 
ZL 39 HOH 652  3652 1465 HOH HOH 0 . 
ZL 39 HOH 653  3653 1467 HOH HOH 0 . 
ZL 39 HOH 654  3654 1468 HOH HOH 0 . 
ZL 39 HOH 655  3655 1469 HOH HOH 0 . 
ZL 39 HOH 656  3656 1470 HOH HOH 0 . 
ZL 39 HOH 657  3657 1471 HOH HOH 0 . 
ZL 39 HOH 658  3658 1472 HOH HOH 0 . 
ZL 39 HOH 659  3659 1473 HOH HOH 0 . 
ZL 39 HOH 660  3660 1474 HOH HOH 0 . 
ZL 39 HOH 661  3661 1475 HOH HOH 0 . 
ZL 39 HOH 662  3662 1476 HOH HOH 0 . 
ZL 39 HOH 663  3663 1477 HOH HOH 0 . 
ZL 39 HOH 664  3664 1478 HOH HOH 0 . 
ZL 39 HOH 665  3665 1479 HOH HOH 0 . 
ZL 39 HOH 666  3666 1480 HOH HOH 0 . 
ZL 39 HOH 667  3667 1481 HOH HOH 0 . 
ZL 39 HOH 668  3668 1482 HOH HOH 0 . 
ZL 39 HOH 669  3669 1483 HOH HOH 0 . 
ZL 39 HOH 670  3670 1485 HOH HOH 0 . 
ZL 39 HOH 671  3671 1486 HOH HOH 0 . 
ZL 39 HOH 672  3672 1487 HOH HOH 0 . 
ZL 39 HOH 673  3673 1490 HOH HOH 0 . 
ZL 39 HOH 674  3674 1491 HOH HOH 0 . 
ZL 39 HOH 675  3675 1493 HOH HOH 0 . 
ZL 39 HOH 676  3676 1494 HOH HOH 0 . 
ZL 39 HOH 677  3677 1495 HOH HOH 0 . 
ZL 39 HOH 678  3678 1496 HOH HOH 0 . 
ZL 39 HOH 679  3679 1497 HOH HOH 0 . 
ZL 39 HOH 680  3680 1498 HOH HOH 0 . 
ZL 39 HOH 681  3681 1499 HOH HOH 0 . 
ZL 39 HOH 682  3682 1500 HOH HOH 0 . 
ZL 39 HOH 683  3683 1501 HOH HOH 0 . 
ZL 39 HOH 684  3684 1502 HOH HOH 0 . 
ZL 39 HOH 685  3685 1503 HOH HOH 0 . 
ZL 39 HOH 686  3686 1505 HOH HOH 0 . 
ZL 39 HOH 687  3687 1506 HOH HOH 0 . 
ZL 39 HOH 688  3688 1507 HOH HOH 0 . 
ZL 39 HOH 689  3689 1508 HOH HOH 0 . 
ZL 39 HOH 690  3690 1510 HOH HOH 0 . 
ZL 39 HOH 691  3691 1512 HOH HOH 0 . 
ZL 39 HOH 692  3692 1513 HOH HOH 0 . 
ZL 39 HOH 693  3693 1514 HOH HOH 0 . 
ZL 39 HOH 694  3694 1515 HOH HOH 0 . 
ZL 39 HOH 695  3695 1516 HOH HOH 0 . 
ZL 39 HOH 696  3696 1518 HOH HOH 0 . 
ZL 39 HOH 697  3697 1519 HOH HOH 0 . 
ZL 39 HOH 698  3698 1520 HOH HOH 0 . 
ZL 39 HOH 699  3699 1521 HOH HOH 0 . 
ZL 39 HOH 700  3700 1522 HOH HOH 0 . 
ZL 39 HOH 701  3701 1523 HOH HOH 0 . 
ZL 39 HOH 702  3702 1525 HOH HOH 0 . 
ZL 39 HOH 703  3703 1526 HOH HOH 0 . 
ZL 39 HOH 704  3704 1527 HOH HOH 0 . 
ZL 39 HOH 705  3705 1528 HOH HOH 0 . 
ZL 39 HOH 706  3706 1529 HOH HOH 0 . 
ZL 39 HOH 707  3707 1530 HOH HOH 0 . 
ZL 39 HOH 708  3708 1531 HOH HOH 0 . 
ZL 39 HOH 709  3709 1532 HOH HOH 0 . 
ZL 39 HOH 710  3710 1533 HOH HOH 0 . 
ZL 39 HOH 711  3711 1534 HOH HOH 0 . 
ZL 39 HOH 712  3712 1535 HOH HOH 0 . 
ZL 39 HOH 713  3713 1537 HOH HOH 0 . 
ZL 39 HOH 714  3714 1539 HOH HOH 0 . 
ZL 39 HOH 715  3715 1540 HOH HOH 0 . 
ZL 39 HOH 716  3716 1541 HOH HOH 0 . 
ZL 39 HOH 717  3717 1542 HOH HOH 0 . 
ZL 39 HOH 718  3718 1543 HOH HOH 0 . 
ZL 39 HOH 719  3719 1544 HOH HOH 0 . 
ZL 39 HOH 720  3720 1545 HOH HOH 0 . 
ZL 39 HOH 721  3721 1546 HOH HOH 0 . 
ZL 39 HOH 722  3722 1547 HOH HOH 0 . 
ZL 39 HOH 723  3723 1548 HOH HOH 0 . 
ZL 39 HOH 724  3724 1549 HOH HOH 0 . 
ZL 39 HOH 725  3725 1551 HOH HOH 0 . 
ZL 39 HOH 726  3726 1552 HOH HOH 0 . 
ZL 39 HOH 727  3727 1553 HOH HOH 0 . 
ZL 39 HOH 728  3728 1554 HOH HOH 0 . 
ZL 39 HOH 729  3729 1555 HOH HOH 0 . 
ZL 39 HOH 730  3730 1556 HOH HOH 0 . 
ZL 39 HOH 731  3731 1557 HOH HOH 0 . 
ZL 39 HOH 732  3732 1558 HOH HOH 0 . 
ZL 39 HOH 733  3733 1560 HOH HOH 0 . 
ZL 39 HOH 734  3734 1561 HOH HOH 0 . 
ZL 39 HOH 735  3735 1562 HOH HOH 0 . 
ZL 39 HOH 736  3736 1564 HOH HOH 0 . 
ZL 39 HOH 737  3737 1565 HOH HOH 0 . 
ZL 39 HOH 738  3738 1566 HOH HOH 0 . 
ZL 39 HOH 739  3739 1567 HOH HOH 0 . 
ZL 39 HOH 740  3740 1568 HOH HOH 0 . 
ZL 39 HOH 741  3741 1570 HOH HOH 0 . 
ZL 39 HOH 742  3742 1572 HOH HOH 0 . 
ZL 39 HOH 743  3743 1573 HOH HOH 0 . 
ZL 39 HOH 744  3744 1574 HOH HOH 0 . 
ZL 39 HOH 745  3745 1575 HOH HOH 0 . 
ZL 39 HOH 746  3746 1576 HOH HOH 0 . 
ZL 39 HOH 747  3747 1577 HOH HOH 0 . 
ZL 39 HOH 748  3748 1578 HOH HOH 0 . 
ZL 39 HOH 749  3749 1579 HOH HOH 0 . 
ZL 39 HOH 750  3750 1580 HOH HOH 0 . 
ZL 39 HOH 751  3751 1582 HOH HOH 0 . 
ZL 39 HOH 752  3752 1583 HOH HOH 0 . 
ZL 39 HOH 753  3753 1584 HOH HOH 0 . 
ZL 39 HOH 754  3754 1586 HOH HOH 0 . 
ZL 39 HOH 755  3755 1587 HOH HOH 0 . 
ZL 39 HOH 756  3756 1588 HOH HOH 0 . 
ZL 39 HOH 757  3757 1590 HOH HOH 0 . 
ZL 39 HOH 758  3758 1591 HOH HOH 0 . 
ZL 39 HOH 759  3759 1592 HOH HOH 0 . 
ZL 39 HOH 760  3760 1593 HOH HOH 0 . 
ZL 39 HOH 761  3761 1595 HOH HOH 0 . 
ZL 39 HOH 762  3762 1598 HOH HOH 0 . 
ZL 39 HOH 763  3763 1599 HOH HOH 0 . 
ZL 39 HOH 764  3764 1600 HOH HOH 0 . 
ZL 39 HOH 765  3765 1601 HOH HOH 0 . 
ZL 39 HOH 766  3766 1602 HOH HOH 0 . 
ZL 39 HOH 767  3767 1603 HOH HOH 0 . 
ZL 39 HOH 768  3768 1604 HOH HOH 0 . 
ZL 39 HOH 769  3769 1605 HOH HOH 0 . 
ZL 39 HOH 770  3770 1606 HOH HOH 0 . 
ZL 39 HOH 771  3771 1608 HOH HOH 0 . 
ZL 39 HOH 772  3772 1609 HOH HOH 0 . 
ZL 39 HOH 773  3773 1610 HOH HOH 0 . 
ZL 39 HOH 774  3774 1611 HOH HOH 0 . 
ZL 39 HOH 775  3775 1612 HOH HOH 0 . 
ZL 39 HOH 776  3776 1613 HOH HOH 0 . 
ZL 39 HOH 777  3777 1614 HOH HOH 0 . 
ZL 39 HOH 778  3778 1615 HOH HOH 0 . 
ZL 39 HOH 779  3779 1616 HOH HOH 0 . 
ZL 39 HOH 780  3780 1618 HOH HOH 0 . 
ZL 39 HOH 781  3781 1619 HOH HOH 0 . 
ZL 39 HOH 782  3782 1620 HOH HOH 0 . 
ZL 39 HOH 783  3783 1621 HOH HOH 0 . 
ZL 39 HOH 784  3784 1622 HOH HOH 0 . 
ZL 39 HOH 785  3785 1624 HOH HOH 0 . 
ZL 39 HOH 786  3786 1625 HOH HOH 0 . 
ZL 39 HOH 787  3787 1626 HOH HOH 0 . 
ZL 39 HOH 788  3788 1627 HOH HOH 0 . 
ZL 39 HOH 789  3789 1628 HOH HOH 0 . 
ZL 39 HOH 790  3790 1630 HOH HOH 0 . 
ZL 39 HOH 791  3791 1631 HOH HOH 0 . 
ZL 39 HOH 792  3792 1632 HOH HOH 0 . 
ZL 39 HOH 793  3793 1633 HOH HOH 0 . 
ZL 39 HOH 794  3794 1634 HOH HOH 0 . 
ZL 39 HOH 795  3795 1635 HOH HOH 0 . 
ZL 39 HOH 796  3796 1636 HOH HOH 0 . 
ZL 39 HOH 797  3797 1637 HOH HOH 0 . 
ZL 39 HOH 798  3798 1638 HOH HOH 0 . 
ZL 39 HOH 799  3799 1640 HOH HOH 0 . 
ZL 39 HOH 800  3800 1641 HOH HOH 0 . 
ZL 39 HOH 801  3801 1642 HOH HOH 0 . 
ZL 39 HOH 802  3802 1643 HOH HOH 0 . 
ZL 39 HOH 803  3803 1645 HOH HOH 0 . 
ZL 39 HOH 804  3804 1646 HOH HOH 0 . 
ZL 39 HOH 805  3805 1647 HOH HOH 0 . 
ZL 39 HOH 806  3806 1649 HOH HOH 0 . 
ZL 39 HOH 807  3807 1650 HOH HOH 0 . 
ZL 39 HOH 808  3808 1651 HOH HOH 0 . 
ZL 39 HOH 809  3809 1653 HOH HOH 0 . 
ZL 39 HOH 810  3810 1654 HOH HOH 0 . 
ZL 39 HOH 811  3811 1657 HOH HOH 0 . 
ZL 39 HOH 812  3812 1658 HOH HOH 0 . 
ZL 39 HOH 813  3813 1659 HOH HOH 0 . 
ZL 39 HOH 814  3814 1660 HOH HOH 0 . 
ZL 39 HOH 815  3815 1661 HOH HOH 0 . 
ZL 39 HOH 816  3816 1662 HOH HOH 0 . 
ZL 39 HOH 817  3817 1663 HOH HOH 0 . 
ZL 39 HOH 818  3818 1665 HOH HOH 0 . 
ZL 39 HOH 819  3819 1666 HOH HOH 0 . 
ZL 39 HOH 820  3820 1667 HOH HOH 0 . 
ZL 39 HOH 821  3821 1668 HOH HOH 0 . 
ZL 39 HOH 822  3822 1670 HOH HOH 0 . 
ZL 39 HOH 823  3823 1671 HOH HOH 0 . 
ZL 39 HOH 824  3824 1672 HOH HOH 0 . 
ZL 39 HOH 825  3825 1673 HOH HOH 0 . 
ZL 39 HOH 826  3826 1674 HOH HOH 0 . 
ZL 39 HOH 827  3827 1676 HOH HOH 0 . 
ZL 39 HOH 828  3828 1677 HOH HOH 0 . 
ZL 39 HOH 829  3829 1678 HOH HOH 0 . 
ZL 39 HOH 830  3830 1679 HOH HOH 0 . 
ZL 39 HOH 831  3831 1682 HOH HOH 0 . 
ZL 39 HOH 832  3832 1683 HOH HOH 0 . 
ZL 39 HOH 833  3833 1684 HOH HOH 0 . 
ZL 39 HOH 834  3834 1686 HOH HOH 0 . 
ZL 39 HOH 835  3835 1688 HOH HOH 0 . 
ZL 39 HOH 836  3836 1689 HOH HOH 0 . 
ZL 39 HOH 837  3837 1691 HOH HOH 0 . 
ZL 39 HOH 838  3838 1693 HOH HOH 0 . 
ZL 39 HOH 839  3839 1694 HOH HOH 0 . 
ZL 39 HOH 840  3840 1695 HOH HOH 0 . 
ZL 39 HOH 841  3841 1696 HOH HOH 0 . 
ZL 39 HOH 842  3842 1697 HOH HOH 0 . 
ZL 39 HOH 843  3843 1698 HOH HOH 0 . 
ZL 39 HOH 844  3844 1700 HOH HOH 0 . 
ZL 39 HOH 845  3845 1702 HOH HOH 0 . 
ZL 39 HOH 846  3846 1704 HOH HOH 0 . 
ZL 39 HOH 847  3847 1706 HOH HOH 0 . 
ZL 39 HOH 848  3848 1707 HOH HOH 0 . 
ZL 39 HOH 849  3849 1708 HOH HOH 0 . 
ZL 39 HOH 850  3850 1709 HOH HOH 0 . 
ZL 39 HOH 851  3851 1710 HOH HOH 0 . 
ZL 39 HOH 852  3852 1712 HOH HOH 0 . 
ZL 39 HOH 853  3853 1713 HOH HOH 0 . 
ZL 39 HOH 854  3854 1717 HOH HOH 0 . 
ZL 39 HOH 855  3855 1718 HOH HOH 0 . 
ZL 39 HOH 856  3856 1719 HOH HOH 0 . 
ZL 39 HOH 857  3857 1720 HOH HOH 0 . 
ZL 39 HOH 858  3858 1721 HOH HOH 0 . 
ZL 39 HOH 859  3859 1722 HOH HOH 0 . 
ZL 39 HOH 860  3860 1723 HOH HOH 0 . 
ZL 39 HOH 861  3861 1724 HOH HOH 0 . 
ZL 39 HOH 862  3862 1725 HOH HOH 0 . 
ZL 39 HOH 863  3863 1728 HOH HOH 0 . 
ZL 39 HOH 864  3864 1729 HOH HOH 0 . 
ZL 39 HOH 865  3865 1730 HOH HOH 0 . 
ZL 39 HOH 866  3866 1731 HOH HOH 0 . 
ZL 39 HOH 867  3867 1732 HOH HOH 0 . 
ZL 39 HOH 868  3868 1733 HOH HOH 0 . 
ZL 39 HOH 869  3869 1734 HOH HOH 0 . 
ZL 39 HOH 870  3870 1735 HOH HOH 0 . 
ZL 39 HOH 871  3871 1736 HOH HOH 0 . 
ZL 39 HOH 872  3872 1737 HOH HOH 0 . 
ZL 39 HOH 873  3873 1738 HOH HOH 0 . 
ZL 39 HOH 874  3874 1739 HOH HOH 0 . 
ZL 39 HOH 875  3875 1740 HOH HOH 0 . 
ZL 39 HOH 876  3876 1741 HOH HOH 0 . 
ZL 39 HOH 877  3877 1742 HOH HOH 0 . 
ZL 39 HOH 878  3878 1743 HOH HOH 0 . 
ZL 39 HOH 879  3879 1744 HOH HOH 0 . 
ZL 39 HOH 880  3880 1746 HOH HOH 0 . 
ZL 39 HOH 881  3881 1747 HOH HOH 0 . 
ZL 39 HOH 882  3882 1748 HOH HOH 0 . 
ZL 39 HOH 883  3883 1749 HOH HOH 0 . 
ZL 39 HOH 884  3884 1751 HOH HOH 0 . 
ZL 39 HOH 885  3885 1752 HOH HOH 0 . 
ZL 39 HOH 886  3886 1755 HOH HOH 0 . 
ZL 39 HOH 887  3887 1756 HOH HOH 0 . 
ZL 39 HOH 888  3888 1757 HOH HOH 0 . 
ZL 39 HOH 889  3889 1759 HOH HOH 0 . 
ZL 39 HOH 890  3890 1761 HOH HOH 0 . 
ZL 39 HOH 891  3891 1763 HOH HOH 0 . 
ZL 39 HOH 892  3892 1766 HOH HOH 0 . 
ZL 39 HOH 893  3893 1767 HOH HOH 0 . 
ZL 39 HOH 894  3894 1768 HOH HOH 0 . 
ZL 39 HOH 895  3895 1769 HOH HOH 0 . 
ZL 39 HOH 896  3896 1770 HOH HOH 0 . 
ZL 39 HOH 897  3897 1771 HOH HOH 0 . 
ZL 39 HOH 898  3898 1772 HOH HOH 0 . 
ZL 39 HOH 899  3899 1773 HOH HOH 0 . 
ZL 39 HOH 900  3900 1774 HOH HOH 0 . 
ZL 39 HOH 901  3901 1775 HOH HOH 0 . 
ZL 39 HOH 902  3902 1776 HOH HOH 0 . 
ZL 39 HOH 903  3903 1777 HOH HOH 0 . 
ZL 39 HOH 904  3904 1780 HOH HOH 0 . 
ZL 39 HOH 905  3905 1781 HOH HOH 0 . 
ZL 39 HOH 906  3906 1782 HOH HOH 0 . 
ZL 39 HOH 907  3907 1783 HOH HOH 0 . 
ZL 39 HOH 908  3908 1784 HOH HOH 0 . 
ZL 39 HOH 909  3909 1785 HOH HOH 0 . 
ZL 39 HOH 910  3910 1786 HOH HOH 0 . 
ZL 39 HOH 911  3911 1787 HOH HOH 0 . 
ZL 39 HOH 912  3912 1788 HOH HOH 0 . 
ZL 39 HOH 913  3913 1789 HOH HOH 0 . 
ZL 39 HOH 914  3914 1790 HOH HOH 0 . 
ZL 39 HOH 915  3915 1791 HOH HOH 0 . 
ZL 39 HOH 916  3916 1792 HOH HOH 0 . 
ZL 39 HOH 917  3917 1793 HOH HOH 0 . 
ZL 39 HOH 918  3918 1794 HOH HOH 0 . 
ZL 39 HOH 919  3919 1797 HOH HOH 0 . 
ZL 39 HOH 920  3920 1798 HOH HOH 0 . 
ZL 39 HOH 921  3921 1800 HOH HOH 0 . 
ZL 39 HOH 922  3922 1801 HOH HOH 0 . 
ZL 39 HOH 923  3923 1802 HOH HOH 0 . 
ZL 39 HOH 924  3924 1804 HOH HOH 0 . 
ZL 39 HOH 925  3925 1805 HOH HOH 0 . 
ZL 39 HOH 926  3926 1806 HOH HOH 0 . 
ZL 39 HOH 927  3927 1807 HOH HOH 0 . 
ZL 39 HOH 928  3928 1808 HOH HOH 0 . 
ZL 39 HOH 929  3929 1809 HOH HOH 0 . 
ZL 39 HOH 930  3930 1810 HOH HOH 0 . 
ZL 39 HOH 931  3931 1811 HOH HOH 0 . 
ZL 39 HOH 932  3932 1813 HOH HOH 0 . 
ZL 39 HOH 933  3933 1814 HOH HOH 0 . 
ZL 39 HOH 934  3934 1816 HOH HOH 0 . 
ZL 39 HOH 935  3935 1817 HOH HOH 0 . 
ZL 39 HOH 936  3936 1818 HOH HOH 0 . 
ZL 39 HOH 937  3937 1819 HOH HOH 0 . 
ZL 39 HOH 938  3938 1820 HOH HOH 0 . 
ZL 39 HOH 939  3939 1821 HOH HOH 0 . 
ZL 39 HOH 940  3940 1823 HOH HOH 0 . 
ZL 39 HOH 941  3941 1824 HOH HOH 0 . 
ZL 39 HOH 942  3942 1826 HOH HOH 0 . 
ZL 39 HOH 943  3943 1827 HOH HOH 0 . 
ZL 39 HOH 944  3944 1828 HOH HOH 0 . 
ZL 39 HOH 945  3945 1829 HOH HOH 0 . 
ZL 39 HOH 946  3946 1831 HOH HOH 0 . 
ZL 39 HOH 947  3947 1833 HOH HOH 0 . 
ZL 39 HOH 948  3948 1834 HOH HOH 0 . 
ZL 39 HOH 949  3949 1836 HOH HOH 0 . 
ZL 39 HOH 950  3950 1837 HOH HOH 0 . 
ZL 39 HOH 951  3951 1839 HOH HOH 0 . 
ZL 39 HOH 952  3952 1840 HOH HOH 0 . 
ZL 39 HOH 953  3953 1842 HOH HOH 0 . 
ZL 39 HOH 954  3954 1843 HOH HOH 0 . 
ZL 39 HOH 955  3955 1844 HOH HOH 0 . 
ZL 39 HOH 956  3956 1845 HOH HOH 0 . 
ZL 39 HOH 957  3957 1846 HOH HOH 0 . 
ZL 39 HOH 958  3958 1847 HOH HOH 0 . 
ZL 39 HOH 959  3959 1848 HOH HOH 0 . 
ZL 39 HOH 960  3960 1849 HOH HOH 0 . 
ZL 39 HOH 961  3961 1850 HOH HOH 0 . 
ZL 39 HOH 962  3962 1851 HOH HOH 0 . 
ZL 39 HOH 963  3963 1853 HOH HOH 0 . 
ZL 39 HOH 964  3964 1854 HOH HOH 0 . 
ZL 39 HOH 965  3965 1855 HOH HOH 0 . 
ZL 39 HOH 966  3966 1856 HOH HOH 0 . 
ZL 39 HOH 967  3967 1857 HOH HOH 0 . 
ZL 39 HOH 968  3968 1858 HOH HOH 0 . 
ZL 39 HOH 969  3969 1859 HOH HOH 0 . 
ZL 39 HOH 970  3970 1860 HOH HOH 0 . 
ZL 39 HOH 971  3971 1862 HOH HOH 0 . 
ZL 39 HOH 972  3972 1863 HOH HOH 0 . 
ZL 39 HOH 973  3973 1864 HOH HOH 0 . 
ZL 39 HOH 974  3974 1866 HOH HOH 0 . 
ZL 39 HOH 975  3975 1868 HOH HOH 0 . 
ZL 39 HOH 976  3976 1869 HOH HOH 0 . 
ZL 39 HOH 977  3977 1870 HOH HOH 0 . 
ZL 39 HOH 978  3978 1871 HOH HOH 0 . 
ZL 39 HOH 979  3979 1872 HOH HOH 0 . 
ZL 39 HOH 980  3980 1873 HOH HOH 0 . 
ZL 39 HOH 981  3981 1874 HOH HOH 0 . 
ZL 39 HOH 982  3982 1875 HOH HOH 0 . 
ZL 39 HOH 983  3983 1876 HOH HOH 0 . 
ZL 39 HOH 984  3984 1877 HOH HOH 0 . 
ZL 39 HOH 985  3985 1878 HOH HOH 0 . 
ZL 39 HOH 986  3986 1879 HOH HOH 0 . 
ZL 39 HOH 987  3987 1880 HOH HOH 0 . 
ZL 39 HOH 988  3988 1881 HOH HOH 0 . 
ZL 39 HOH 989  3989 1882 HOH HOH 0 . 
ZL 39 HOH 990  3990 1884 HOH HOH 0 . 
ZL 39 HOH 991  3991 1885 HOH HOH 0 . 
ZL 39 HOH 992  3992 1887 HOH HOH 0 . 
ZL 39 HOH 993  3993 1888 HOH HOH 0 . 
ZL 39 HOH 994  3994 1889 HOH HOH 0 . 
ZL 39 HOH 995  3995 1891 HOH HOH 0 . 
ZL 39 HOH 996  3996 1892 HOH HOH 0 . 
ZL 39 HOH 997  3997 1893 HOH HOH 0 . 
ZL 39 HOH 998  3998 1895 HOH HOH 0 . 
ZL 39 HOH 999  3999 1896 HOH HOH 0 . 
ZL 39 HOH 1000 4000 1899 HOH HOH 0 . 
ZL 39 HOH 1001 4001 1900 HOH HOH 0 . 
ZL 39 HOH 1002 4002 1901 HOH HOH 0 . 
ZL 39 HOH 1003 4003 1903 HOH HOH 0 . 
ZL 39 HOH 1004 4004 1904 HOH HOH 0 . 
ZL 39 HOH 1005 4005 1905 HOH HOH 0 . 
ZL 39 HOH 1006 4006 1906 HOH HOH 0 . 
ZL 39 HOH 1007 4007 1908 HOH HOH 0 . 
ZL 39 HOH 1008 4008 1909 HOH HOH 0 . 
ZL 39 HOH 1009 4009 1911 HOH HOH 0 . 
ZL 39 HOH 1010 4010 1912 HOH HOH 0 . 
ZL 39 HOH 1011 4011 1913 HOH HOH 0 . 
ZL 39 HOH 1012 4012 1914 HOH HOH 0 . 
ZL 39 HOH 1013 4013 1915 HOH HOH 0 . 
ZL 39 HOH 1014 4014 1917 HOH HOH 0 . 
ZL 39 HOH 1015 4015 1918 HOH HOH 0 . 
ZL 39 HOH 1016 4016 1920 HOH HOH 0 . 
ZL 39 HOH 1017 4017 1921 HOH HOH 0 . 
ZL 39 HOH 1018 4018 1922 HOH HOH 0 . 
ZL 39 HOH 1019 4019 1924 HOH HOH 0 . 
ZL 39 HOH 1020 4020 1925 HOH HOH 0 . 
ZL 39 HOH 1021 4021 1927 HOH HOH 0 . 
ZL 39 HOH 1022 4022 1928 HOH HOH 0 . 
ZL 39 HOH 1023 4023 1929 HOH HOH 0 . 
ZL 39 HOH 1024 4024 1930 HOH HOH 0 . 
ZL 39 HOH 1025 4025 1931 HOH HOH 0 . 
ZL 39 HOH 1026 4026 1935 HOH HOH 0 . 
ZL 39 HOH 1027 4027 1936 HOH HOH 0 . 
ZL 39 HOH 1028 4028 1938 HOH HOH 0 . 
ZL 39 HOH 1029 4029 1939 HOH HOH 0 . 
ZL 39 HOH 1030 4030 1941 HOH HOH 0 . 
ZL 39 HOH 1031 4031 1942 HOH HOH 0 . 
ZL 39 HOH 1032 4032 1944 HOH HOH 0 . 
ZL 39 HOH 1033 4033 1945 HOH HOH 0 . 
ZL 39 HOH 1034 4034 1946 HOH HOH 0 . 
ZL 39 HOH 1035 4035 1947 HOH HOH 0 . 
ZL 39 HOH 1036 4036 1948 HOH HOH 0 . 
ZL 39 HOH 1037 4037 1949 HOH HOH 0 . 
ZL 39 HOH 1038 4038 1950 HOH HOH 0 . 
ZL 39 HOH 1039 4039 1952 HOH HOH 0 . 
ZL 39 HOH 1040 4040 1953 HOH HOH 0 . 
ZL 39 HOH 1041 4041 1954 HOH HOH 0 . 
ZL 39 HOH 1042 4042 1956 HOH HOH 0 . 
ZL 39 HOH 1043 4043 1957 HOH HOH 0 . 
ZL 39 HOH 1044 4044 1958 HOH HOH 0 . 
ZL 39 HOH 1045 4045 1959 HOH HOH 0 . 
ZL 39 HOH 1046 4046 1960 HOH HOH 0 . 
ZL 39 HOH 1047 4047 1961 HOH HOH 0 . 
ZL 39 HOH 1048 4048 1962 HOH HOH 0 . 
ZL 39 HOH 1049 4049 1963 HOH HOH 0 . 
ZL 39 HOH 1050 4050 1964 HOH HOH 0 . 
ZL 39 HOH 1051 4051 1965 HOH HOH 0 . 
ZL 39 HOH 1052 4052 1966 HOH HOH 0 . 
ZL 39 HOH 1053 4053 1967 HOH HOH 0 . 
ZL 39 HOH 1054 4054 1970 HOH HOH 0 . 
ZL 39 HOH 1055 4055 1971 HOH HOH 0 . 
ZL 39 HOH 1056 4056 1973 HOH HOH 0 . 
ZL 39 HOH 1057 4057 1974 HOH HOH 0 . 
ZL 39 HOH 1058 4058 1975 HOH HOH 0 . 
ZL 39 HOH 1059 4059 1976 HOH HOH 0 . 
ZL 39 HOH 1060 4060 1977 HOH HOH 0 . 
ZL 39 HOH 1061 4061 1978 HOH HOH 0 . 
ZL 39 HOH 1062 4062 1980 HOH HOH 0 . 
ZL 39 HOH 1063 4063 1983 HOH HOH 0 . 
ZL 39 HOH 1064 4064 1984 HOH HOH 0 . 
ZL 39 HOH 1065 4065 1985 HOH HOH 0 . 
ZL 39 HOH 1066 4066 1988 HOH HOH 0 . 
ZL 39 HOH 1067 4067 1989 HOH HOH 0 . 
ZL 39 HOH 1068 4068 1992 HOH HOH 0 . 
ZL 39 HOH 1069 4069 1994 HOH HOH 0 . 
ZL 39 HOH 1070 4070 1995 HOH HOH 0 . 
ZL 39 HOH 1071 4071 1997 HOH HOH 0 . 
ZL 39 HOH 1072 4072 1998 HOH HOH 0 . 
ZL 39 HOH 1073 4073 1999 HOH HOH 0 . 
ZL 39 HOH 1074 4074 2000 HOH HOH 0 . 
ZL 39 HOH 1075 4075 2001 HOH HOH 0 . 
ZL 39 HOH 1076 4076 2002 HOH HOH 0 . 
ZL 39 HOH 1077 4077 2003 HOH HOH 0 . 
ZL 39 HOH 1078 4078 2004 HOH HOH 0 . 
ZL 39 HOH 1079 4079 2005 HOH HOH 0 . 
ZL 39 HOH 1080 4080 2006 HOH HOH 0 . 
ZL 39 HOH 1081 4081 2007 HOH HOH 0 . 
ZL 39 HOH 1082 4082 2008 HOH HOH 0 . 
ZL 39 HOH 1083 4083 2010 HOH HOH 0 . 
ZL 39 HOH 1084 4084 2011 HOH HOH 0 . 
ZL 39 HOH 1085 4085 2012 HOH HOH 0 . 
ZL 39 HOH 1086 4086 2013 HOH HOH 0 . 
ZL 39 HOH 1087 4087 2014 HOH HOH 0 . 
ZL 39 HOH 1088 4088 2016 HOH HOH 0 . 
ZL 39 HOH 1089 4089 2017 HOH HOH 0 . 
ZL 39 HOH 1090 4090 2019 HOH HOH 0 . 
ZL 39 HOH 1091 4091 2020 HOH HOH 0 . 
ZL 39 HOH 1092 4092 2021 HOH HOH 0 . 
ZL 39 HOH 1093 4093 2022 HOH HOH 0 . 
ZL 39 HOH 1094 4094 2023 HOH HOH 0 . 
ZL 39 HOH 1095 4095 2024 HOH HOH 0 . 
ZL 39 HOH 1096 4096 2025 HOH HOH 0 . 
ZL 39 HOH 1097 4097 2026 HOH HOH 0 . 
ZL 39 HOH 1098 4098 2027 HOH HOH 0 . 
ZL 39 HOH 1099 4099 2030 HOH HOH 0 . 
ZL 39 HOH 1100 4100 2031 HOH HOH 0 . 
ZL 39 HOH 1101 4101 2032 HOH HOH 0 . 
ZL 39 HOH 1102 4102 2033 HOH HOH 0 . 
ZL 39 HOH 1103 4103 2034 HOH HOH 0 . 
ZL 39 HOH 1104 4104 2035 HOH HOH 0 . 
ZL 39 HOH 1105 4105 2036 HOH HOH 0 . 
ZL 39 HOH 1106 4106 2037 HOH HOH 0 . 
ZL 39 HOH 1107 4107 2038 HOH HOH 0 . 
ZL 39 HOH 1108 4108 2039 HOH HOH 0 . 
ZL 39 HOH 1109 4109 2042 HOH HOH 0 . 
ZL 39 HOH 1110 4110 2043 HOH HOH 0 . 
ZL 39 HOH 1111 4111 2044 HOH HOH 0 . 
ZL 39 HOH 1112 4112 2045 HOH HOH 0 . 
ZL 39 HOH 1113 4113 2046 HOH HOH 0 . 
ZL 39 HOH 1114 4114 2047 HOH HOH 0 . 
ZL 39 HOH 1115 4115 2048 HOH HOH 0 . 
ZL 39 HOH 1116 4116 2049 HOH HOH 0 . 
ZL 39 HOH 1117 4117 2050 HOH HOH 0 . 
ZL 39 HOH 1118 4118 2053 HOH HOH 0 . 
ZL 39 HOH 1119 4119 2054 HOH HOH 0 . 
ZL 39 HOH 1120 4120 2055 HOH HOH 0 . 
ZL 39 HOH 1121 4121 2056 HOH HOH 0 . 
ZL 39 HOH 1122 4122 2057 HOH HOH 0 . 
ZL 39 HOH 1123 4123 2058 HOH HOH 0 . 
ZL 39 HOH 1124 4124 2059 HOH HOH 0 . 
ZL 39 HOH 1125 4125 2060 HOH HOH 0 . 
ZL 39 HOH 1126 4126 2061 HOH HOH 0 . 
ZL 39 HOH 1127 4127 2062 HOH HOH 0 . 
ZL 39 HOH 1128 4128 2063 HOH HOH 0 . 
ZL 39 HOH 1129 4129 2065 HOH HOH 0 . 
ZL 39 HOH 1130 4130 2066 HOH HOH 0 . 
ZL 39 HOH 1131 4131 2067 HOH HOH 0 . 
ZL 39 HOH 1132 4132 2068 HOH HOH 0 . 
ZL 39 HOH 1133 4133 2069 HOH HOH 0 . 
ZL 39 HOH 1134 4134 2070 HOH HOH 0 . 
ZL 39 HOH 1135 4135 2071 HOH HOH 0 . 
ZL 39 HOH 1136 4136 2072 HOH HOH 0 . 
ZL 39 HOH 1137 4137 2073 HOH HOH 0 . 
ZL 39 HOH 1138 4138 2074 HOH HOH 0 . 
ZL 39 HOH 1139 4139 2075 HOH HOH 0 . 
ZL 39 HOH 1140 4140 2076 HOH HOH 0 . 
ZL 39 HOH 1141 4141 2077 HOH HOH 0 . 
ZL 39 HOH 1142 4142 2078 HOH HOH 0 . 
ZL 39 HOH 1143 4143 2080 HOH HOH 0 . 
ZL 39 HOH 1144 4144 2082 HOH HOH 0 . 
ZL 39 HOH 1145 4145 2083 HOH HOH 0 . 
ZL 39 HOH 1146 4146 2084 HOH HOH 0 . 
ZL 39 HOH 1147 4147 2085 HOH HOH 0 . 
ZL 39 HOH 1148 4148 2087 HOH HOH 0 . 
ZL 39 HOH 1149 4149 2088 HOH HOH 0 . 
ZL 39 HOH 1150 4150 2089 HOH HOH 0 . 
ZL 39 HOH 1151 4151 2090 HOH HOH 0 . 
ZL 39 HOH 1152 4152 2091 HOH HOH 0 . 
ZL 39 HOH 1153 4153 2092 HOH HOH 0 . 
ZL 39 HOH 1154 4154 2093 HOH HOH 0 . 
ZL 39 HOH 1155 4155 2094 HOH HOH 0 . 
ZL 39 HOH 1156 4156 2095 HOH HOH 0 . 
ZL 39 HOH 1157 4157 2096 HOH HOH 0 . 
ZL 39 HOH 1158 4158 2097 HOH HOH 0 . 
ZL 39 HOH 1159 4159 2098 HOH HOH 0 . 
ZL 39 HOH 1160 4160 2099 HOH HOH 0 . 
ZL 39 HOH 1161 4161 2100 HOH HOH 0 . 
ZL 39 HOH 1162 4162 2101 HOH HOH 0 . 
ZL 39 HOH 1163 4163 2102 HOH HOH 0 . 
ZL 39 HOH 1164 4164 2103 HOH HOH 0 . 
ZL 39 HOH 1165 4165 2105 HOH HOH 0 . 
ZL 39 HOH 1166 4166 2107 HOH HOH 0 . 
ZL 39 HOH 1167 4167 2108 HOH HOH 0 . 
ZL 39 HOH 1168 4168 2109 HOH HOH 0 . 
ZL 39 HOH 1169 4169 2110 HOH HOH 0 . 
ZL 39 HOH 1170 4170 2111 HOH HOH 0 . 
ZL 39 HOH 1171 4171 2112 HOH HOH 0 . 
ZL 39 HOH 1172 4172 2113 HOH HOH 0 . 
ZL 39 HOH 1173 4173 2114 HOH HOH 0 . 
ZL 39 HOH 1174 4174 2115 HOH HOH 0 . 
ZL 39 HOH 1175 4175 2116 HOH HOH 0 . 
ZL 39 HOH 1176 4176 2117 HOH HOH 0 . 
ZL 39 HOH 1177 4177 2119 HOH HOH 0 . 
ZL 39 HOH 1178 4178 2120 HOH HOH 0 . 
ZL 39 HOH 1179 4179 2122 HOH HOH 0 . 
ZL 39 HOH 1180 4180 2123 HOH HOH 0 . 
ZL 39 HOH 1181 4181 2124 HOH HOH 0 . 
ZL 39 HOH 1182 4182 2126 HOH HOH 0 . 
ZL 39 HOH 1183 4183 2127 HOH HOH 0 . 
ZL 39 HOH 1184 4184 2128 HOH HOH 0 . 
ZL 39 HOH 1185 4185 2129 HOH HOH 0 . 
ZL 39 HOH 1186 4186 2130 HOH HOH 0 . 
ZL 39 HOH 1187 4187 2131 HOH HOH 0 . 
ZL 39 HOH 1188 4188 2132 HOH HOH 0 . 
ZL 39 HOH 1189 4189 2134 HOH HOH 0 . 
ZL 39 HOH 1190 4190 2135 HOH HOH 0 . 
ZL 39 HOH 1191 4191 2136 HOH HOH 0 . 
ZL 39 HOH 1192 4192 2137 HOH HOH 0 . 
ZL 39 HOH 1193 4193 2138 HOH HOH 0 . 
ZL 39 HOH 1194 4194 2139 HOH HOH 0 . 
ZL 39 HOH 1195 4195 2140 HOH HOH 0 . 
ZL 39 HOH 1196 4196 2141 HOH HOH 0 . 
ZL 39 HOH 1197 4197 2142 HOH HOH 0 . 
ZL 39 HOH 1198 4198 2143 HOH HOH 0 . 
ZL 39 HOH 1199 4199 2144 HOH HOH 0 . 
ZL 39 HOH 1200 4200 2145 HOH HOH 0 . 
ZL 39 HOH 1201 4201 2146 HOH HOH 0 . 
ZL 39 HOH 1202 4202 2147 HOH HOH 0 . 
ZL 39 HOH 1203 4203 2148 HOH HOH 0 . 
ZL 39 HOH 1204 4204 2149 HOH HOH 0 . 
ZL 39 HOH 1205 4205 2151 HOH HOH 0 . 
ZL 39 HOH 1206 4206 2152 HOH HOH 0 . 
ZL 39 HOH 1207 4207 2153 HOH HOH 0 . 
ZL 39 HOH 1208 4208 2154 HOH HOH 0 . 
ZL 39 HOH 1209 4209 2155 HOH HOH 0 . 
ZL 39 HOH 1210 4210 2156 HOH HOH 0 . 
ZL 39 HOH 1211 4211 2157 HOH HOH 0 . 
ZL 39 HOH 1212 4212 2158 HOH HOH 0 . 
ZL 39 HOH 1213 4213 2159 HOH HOH 0 . 
ZL 39 HOH 1214 4214 2160 HOH HOH 0 . 
ZL 39 HOH 1215 4215 2162 HOH HOH 0 . 
ZL 39 HOH 1216 4216 2163 HOH HOH 0 . 
ZL 39 HOH 1217 4217 2164 HOH HOH 0 . 
ZL 39 HOH 1218 4218 2165 HOH HOH 0 . 
ZL 39 HOH 1219 4219 2168 HOH HOH 0 . 
ZL 39 HOH 1220 4220 2169 HOH HOH 0 . 
ZL 39 HOH 1221 4221 2170 HOH HOH 0 . 
ZL 39 HOH 1222 4222 2175 HOH HOH 0 . 
ZL 39 HOH 1223 4223 2177 HOH HOH 0 . 
ZL 39 HOH 1224 4224 2179 HOH HOH 0 . 
ZL 39 HOH 1225 4225 2181 HOH HOH 0 . 
ZL 39 HOH 1226 4226 2182 HOH HOH 0 . 
ZL 39 HOH 1227 4227 2183 HOH HOH 0 . 
ZL 39 HOH 1228 4228 2184 HOH HOH 0 . 
ZL 39 HOH 1229 4229 2185 HOH HOH 0 . 
ZL 39 HOH 1230 4230 2186 HOH HOH 0 . 
ZL 39 HOH 1231 4231 2187 HOH HOH 0 . 
ZL 39 HOH 1232 4232 2189 HOH HOH 0 . 
ZL 39 HOH 1233 4233 2192 HOH HOH 0 . 
ZL 39 HOH 1234 4234 2193 HOH HOH 0 . 
ZL 39 HOH 1235 4235 2196 HOH HOH 0 . 
ZL 39 HOH 1236 4236 2197 HOH HOH 0 . 
ZL 39 HOH 1237 4237 2198 HOH HOH 0 . 
ZL 39 HOH 1238 4238 2199 HOH HOH 0 . 
ZL 39 HOH 1239 4239 2200 HOH HOH 0 . 
ZL 39 HOH 1240 4240 2201 HOH HOH 0 . 
ZL 39 HOH 1241 4241 2202 HOH HOH 0 . 
ZL 39 HOH 1242 4242 2204 HOH HOH 0 . 
ZL 39 HOH 1243 4243 2206 HOH HOH 0 . 
ZL 39 HOH 1244 4244 2208 HOH HOH 0 . 
ZL 39 HOH 1245 4245 2210 HOH HOH 0 . 
ZL 39 HOH 1246 4246 2211 HOH HOH 0 . 
ZL 39 HOH 1247 4247 2212 HOH HOH 0 . 
ZL 39 HOH 1248 4248 2213 HOH HOH 0 . 
ZL 39 HOH 1249 4249 2215 HOH HOH 0 . 
ZL 39 HOH 1250 4250 2216 HOH HOH 0 . 
ZL 39 HOH 1251 4251 2217 HOH HOH 0 . 
ZL 39 HOH 1252 4252 2220 HOH HOH 0 . 
ZL 39 HOH 1253 4253 2221 HOH HOH 0 . 
ZL 39 HOH 1254 4254 2223 HOH HOH 0 . 
ZL 39 HOH 1255 4255 2225 HOH HOH 0 . 
ZL 39 HOH 1256 4256 2226 HOH HOH 0 . 
ZL 39 HOH 1257 4257 2228 HOH HOH 0 . 
ZL 39 HOH 1258 4258 2230 HOH HOH 0 . 
ZL 39 HOH 1259 4259 2231 HOH HOH 0 . 
ZL 39 HOH 1260 4260 2232 HOH HOH 0 . 
ZL 39 HOH 1261 4261 2233 HOH HOH 0 . 
ZL 39 HOH 1262 4262 2234 HOH HOH 0 . 
ZL 39 HOH 1263 4263 2235 HOH HOH 0 . 
ZL 39 HOH 1264 4264 2236 HOH HOH 0 . 
ZL 39 HOH 1265 4265 2237 HOH HOH 0 . 
ZL 39 HOH 1266 4266 2239 HOH HOH 0 . 
ZL 39 HOH 1267 4267 2240 HOH HOH 0 . 
ZL 39 HOH 1268 4268 2241 HOH HOH 0 . 
ZL 39 HOH 1269 4269 2242 HOH HOH 0 . 
ZL 39 HOH 1270 4270 2243 HOH HOH 0 . 
ZL 39 HOH 1271 4271 2244 HOH HOH 0 . 
ZL 39 HOH 1272 4272 2245 HOH HOH 0 . 
ZL 39 HOH 1273 4273 2246 HOH HOH 0 . 
ZL 39 HOH 1274 4274 2248 HOH HOH 0 . 
ZL 39 HOH 1275 4275 2249 HOH HOH 0 . 
ZL 39 HOH 1276 4276 2250 HOH HOH 0 . 
ZL 39 HOH 1277 4277 2251 HOH HOH 0 . 
ZL 39 HOH 1278 4278 2252 HOH HOH 0 . 
ZL 39 HOH 1279 4279 2253 HOH HOH 0 . 
ZL 39 HOH 1280 4280 2254 HOH HOH 0 . 
ZL 39 HOH 1281 4281 2255 HOH HOH 0 . 
ZL 39 HOH 1282 4282 2256 HOH HOH 0 . 
ZL 39 HOH 1283 4283 2258 HOH HOH 0 . 
ZL 39 HOH 1284 4284 2260 HOH HOH 0 . 
ZL 39 HOH 1285 4285 2261 HOH HOH 0 . 
ZL 39 HOH 1286 4286 2262 HOH HOH 0 . 
ZL 39 HOH 1287 4287 2265 HOH HOH 0 . 
ZL 39 HOH 1288 4288 2269 HOH HOH 0 . 
ZL 39 HOH 1289 4289 2270 HOH HOH 0 . 
ZL 39 HOH 1290 4290 2273 HOH HOH 0 . 
ZL 39 HOH 1291 4291 2275 HOH HOH 0 . 
ZL 39 HOH 1292 4292 2276 HOH HOH 0 . 
ZL 39 HOH 1293 4293 2277 HOH HOH 0 . 
ZL 39 HOH 1294 4294 2280 HOH HOH 0 . 
ZL 39 HOH 1295 4295 2281 HOH HOH 0 . 
ZL 39 HOH 1296 4296 2282 HOH HOH 0 . 
ZL 39 HOH 1297 4297 2283 HOH HOH 0 . 
ZL 39 HOH 1298 4298 2284 HOH HOH 0 . 
ZL 39 HOH 1299 4299 2287 HOH HOH 0 . 
ZL 39 HOH 1300 4300 2288 HOH HOH 0 . 
ZL 39 HOH 1301 4301 2290 HOH HOH 0 . 
ZL 39 HOH 1302 4302 2291 HOH HOH 0 . 
ZL 39 HOH 1303 4303 2292 HOH HOH 0 . 
ZL 39 HOH 1304 4304 2294 HOH HOH 0 . 
ZL 39 HOH 1305 4305 2296 HOH HOH 0 . 
ZL 39 HOH 1306 4306 2297 HOH HOH 0 . 
ZL 39 HOH 1307 4307 2298 HOH HOH 0 . 
ZL 39 HOH 1308 4308 2299 HOH HOH 0 . 
ZL 39 HOH 1309 4309 2300 HOH HOH 0 . 
ZL 39 HOH 1310 4310 2301 HOH HOH 0 . 
ZL 39 HOH 1311 4311 2302 HOH HOH 0 . 
ZL 39 HOH 1312 4312 2303 HOH HOH 0 . 
ZL 39 HOH 1313 4313 2304 HOH HOH 0 . 
ZL 39 HOH 1314 4314 2307 HOH HOH 0 . 
ZL 39 HOH 1315 4315 2308 HOH HOH 0 . 
ZL 39 HOH 1316 4316 2310 HOH HOH 0 . 
ZL 39 HOH 1317 4317 2311 HOH HOH 0 . 
ZL 39 HOH 1318 4318 2312 HOH HOH 0 . 
ZL 39 HOH 1319 4319 2313 HOH HOH 0 . 
ZL 39 HOH 1320 4320 2314 HOH HOH 0 . 
ZL 39 HOH 1321 4321 2315 HOH HOH 0 . 
ZL 39 HOH 1322 4322 2318 HOH HOH 0 . 
ZL 39 HOH 1323 4323 2319 HOH HOH 0 . 
ZL 39 HOH 1324 4324 2321 HOH HOH 0 . 
ZL 39 HOH 1325 4325 2322 HOH HOH 0 . 
ZL 39 HOH 1326 4326 2324 HOH HOH 0 . 
ZL 39 HOH 1327 4327 2325 HOH HOH 0 . 
ZL 39 HOH 1328 4328 2326 HOH HOH 0 . 
ZL 39 HOH 1329 4329 2327 HOH HOH 0 . 
ZL 39 HOH 1330 4330 2328 HOH HOH 0 . 
ZL 39 HOH 1331 4331 2330 HOH HOH 0 . 
ZL 39 HOH 1332 4332 2332 HOH HOH 0 . 
ZL 39 HOH 1333 4333 2335 HOH HOH 0 . 
ZL 39 HOH 1334 4334 2337 HOH HOH 0 . 
ZL 39 HOH 1335 4335 2338 HOH HOH 0 . 
ZL 39 HOH 1336 4336 2339 HOH HOH 0 . 
ZL 39 HOH 1337 4337 2340 HOH HOH 0 . 
ZL 39 HOH 1338 4338 2341 HOH HOH 0 . 
ZL 39 HOH 1339 4339 2342 HOH HOH 0 . 
ZL 39 HOH 1340 4340 2344 HOH HOH 0 . 
ZL 39 HOH 1341 4341 2346 HOH HOH 0 . 
ZL 39 HOH 1342 4342 2347 HOH HOH 0 . 
ZL 39 HOH 1343 4343 2348 HOH HOH 0 . 
ZL 39 HOH 1344 4344 2349 HOH HOH 0 . 
ZL 39 HOH 1345 4345 2350 HOH HOH 0 . 
ZL 39 HOH 1346 4346 2351 HOH HOH 0 . 
ZL 39 HOH 1347 4347 2352 HOH HOH 0 . 
ZL 39 HOH 1348 4348 2354 HOH HOH 0 . 
ZL 39 HOH 1349 4349 2355 HOH HOH 0 . 
ZL 39 HOH 1350 4350 2356 HOH HOH 0 . 
ZL 39 HOH 1351 4351 2360 HOH HOH 0 . 
ZL 39 HOH 1352 4352 2362 HOH HOH 0 . 
ZL 39 HOH 1353 4353 2363 HOH HOH 0 . 
ZL 39 HOH 1354 4354 2364 HOH HOH 0 . 
ZL 39 HOH 1355 4355 2365 HOH HOH 0 . 
ZL 39 HOH 1356 4356 2366 HOH HOH 0 . 
ZL 39 HOH 1357 4357 2367 HOH HOH 0 . 
ZL 39 HOH 1358 4358 2368 HOH HOH 0 . 
ZL 39 HOH 1359 4359 2369 HOH HOH 0 . 
ZL 39 HOH 1360 4360 2370 HOH HOH 0 . 
ZL 39 HOH 1361 4361 2372 HOH HOH 0 . 
ZL 39 HOH 1362 4362 2373 HOH HOH 0 . 
ZL 39 HOH 1363 4363 2376 HOH HOH 0 . 
ZL 39 HOH 1364 4364 2377 HOH HOH 0 . 
ZL 39 HOH 1365 4365 2378 HOH HOH 0 . 
ZL 39 HOH 1366 4366 2379 HOH HOH 0 . 
ZL 39 HOH 1367 4367 2380 HOH HOH 0 . 
ZL 39 HOH 1368 4368 2381 HOH HOH 0 . 
ZL 39 HOH 1369 4369 2382 HOH HOH 0 . 
ZL 39 HOH 1370 4370 2383 HOH HOH 0 . 
ZL 39 HOH 1371 4371 2384 HOH HOH 0 . 
ZL 39 HOH 1372 4372 2386 HOH HOH 0 . 
ZL 39 HOH 1373 4373 2387 HOH HOH 0 . 
ZL 39 HOH 1374 4374 2388 HOH HOH 0 . 
ZL 39 HOH 1375 4375 2389 HOH HOH 0 . 
ZL 39 HOH 1376 4376 2391 HOH HOH 0 . 
ZL 39 HOH 1377 4377 2392 HOH HOH 0 . 
ZL 39 HOH 1378 4378 2393 HOH HOH 0 . 
ZL 39 HOH 1379 4379 2394 HOH HOH 0 . 
ZL 39 HOH 1380 4380 2397 HOH HOH 0 . 
ZL 39 HOH 1381 4381 2398 HOH HOH 0 . 
ZL 39 HOH 1382 4382 2399 HOH HOH 0 . 
ZL 39 HOH 1383 4383 2400 HOH HOH 0 . 
ZL 39 HOH 1384 4384 2402 HOH HOH 0 . 
ZL 39 HOH 1385 4385 2403 HOH HOH 0 . 
ZL 39 HOH 1386 4386 2404 HOH HOH 0 . 
ZL 39 HOH 1387 4387 2405 HOH HOH 0 . 
ZL 39 HOH 1388 4388 2406 HOH HOH 0 . 
ZL 39 HOH 1389 4389 2407 HOH HOH 0 . 
ZL 39 HOH 1390 4390 2409 HOH HOH 0 . 
ZL 39 HOH 1391 4391 2410 HOH HOH 0 . 
ZL 39 HOH 1392 4392 2412 HOH HOH 0 . 
ZL 39 HOH 1393 4393 2413 HOH HOH 0 . 
ZL 39 HOH 1394 4394 2414 HOH HOH 0 . 
ZL 39 HOH 1395 4395 2415 HOH HOH 0 . 
ZL 39 HOH 1396 4396 2418 HOH HOH 0 . 
ZL 39 HOH 1397 4397 2419 HOH HOH 0 . 
ZL 39 HOH 1398 4398 2420 HOH HOH 0 . 
ZL 39 HOH 1399 4399 2421 HOH HOH 0 . 
ZL 39 HOH 1400 4400 2422 HOH HOH 0 . 
ZL 39 HOH 1401 4401 2424 HOH HOH 0 . 
ZL 39 HOH 1402 4402 2425 HOH HOH 0 . 
ZL 39 HOH 1403 4403 2426 HOH HOH 0 . 
ZL 39 HOH 1404 4404 2427 HOH HOH 0 . 
ZL 39 HOH 1405 4405 2428 HOH HOH 0 . 
ZL 39 HOH 1406 4406 2429 HOH HOH 0 . 
ZL 39 HOH 1407 4407 2432 HOH HOH 0 . 
ZL 39 HOH 1408 4408 2433 HOH HOH 0 . 
ZL 39 HOH 1409 4409 2435 HOH HOH 0 . 
ZL 39 HOH 1410 4410 2436 HOH HOH 0 . 
ZL 39 HOH 1411 4411 2437 HOH HOH 0 . 
ZL 39 HOH 1412 4412 2438 HOH HOH 0 . 
ZL 39 HOH 1413 4413 2439 HOH HOH 0 . 
ZL 39 HOH 1414 4414 2440 HOH HOH 0 . 
ZL 39 HOH 1415 4415 2441 HOH HOH 0 . 
ZL 39 HOH 1416 4416 2442 HOH HOH 0 . 
ZL 39 HOH 1417 4417 2443 HOH HOH 0 . 
ZL 39 HOH 1418 4418 2444 HOH HOH 0 . 
ZL 39 HOH 1419 4419 2445 HOH HOH 0 . 
ZL 39 HOH 1420 4420 2446 HOH HOH 0 . 
ZL 39 HOH 1421 4421 2447 HOH HOH 0 . 
ZL 39 HOH 1422 4422 2449 HOH HOH 0 . 
ZL 39 HOH 1423 4423 2450 HOH HOH 0 . 
ZL 39 HOH 1424 4424 2451 HOH HOH 0 . 
ZL 39 HOH 1425 4425 2452 HOH HOH 0 . 
ZL 39 HOH 1426 4426 2454 HOH HOH 0 . 
ZL 39 HOH 1427 4427 2455 HOH HOH 0 . 
ZL 39 HOH 1428 4428 2457 HOH HOH 0 . 
ZL 39 HOH 1429 4429 2458 HOH HOH 0 . 
ZL 39 HOH 1430 4430 2459 HOH HOH 0 . 
ZL 39 HOH 1431 4431 2460 HOH HOH 0 . 
ZL 39 HOH 1432 4432 2461 HOH HOH 0 . 
ZL 39 HOH 1433 4433 2463 HOH HOH 0 . 
ZL 39 HOH 1434 4434 2464 HOH HOH 0 . 
ZL 39 HOH 1435 4435 2465 HOH HOH 0 . 
ZL 39 HOH 1436 4436 2467 HOH HOH 0 . 
ZL 39 HOH 1437 4437 2468 HOH HOH 0 . 
ZL 39 HOH 1438 4438 2469 HOH HOH 0 . 
ZL 39 HOH 1439 4439 2470 HOH HOH 0 . 
ZL 39 HOH 1440 4440 2472 HOH HOH 0 . 
ZL 39 HOH 1441 4441 2473 HOH HOH 0 . 
ZL 39 HOH 1442 4442 2474 HOH HOH 0 . 
ZL 39 HOH 1443 4443 2475 HOH HOH 0 . 
ZL 39 HOH 1444 4444 2476 HOH HOH 0 . 
ZL 39 HOH 1445 4445 2477 HOH HOH 0 . 
ZL 39 HOH 1446 4446 2478 HOH HOH 0 . 
ZL 39 HOH 1447 4447 2481 HOH HOH 0 . 
ZL 39 HOH 1448 4448 2482 HOH HOH 0 . 
ZL 39 HOH 1449 4449 2483 HOH HOH 0 . 
ZL 39 HOH 1450 4450 2484 HOH HOH 0 . 
ZL 39 HOH 1451 4451 2488 HOH HOH 0 . 
ZL 39 HOH 1452 4452 2489 HOH HOH 0 . 
ZL 39 HOH 1453 4453 2490 HOH HOH 0 . 
ZL 39 HOH 1454 4454 2492 HOH HOH 0 . 
ZL 39 HOH 1455 4455 2493 HOH HOH 0 . 
ZL 39 HOH 1456 4456 2494 HOH HOH 0 . 
ZL 39 HOH 1457 4457 2496 HOH HOH 0 . 
ZL 39 HOH 1458 4458 2498 HOH HOH 0 . 
ZL 39 HOH 1459 4459 2500 HOH HOH 0 . 
ZL 39 HOH 1460 4460 2501 HOH HOH 0 . 
ZL 39 HOH 1461 4461 2502 HOH HOH 0 . 
ZL 39 HOH 1462 4462 2503 HOH HOH 0 . 
ZL 39 HOH 1463 4463 2504 HOH HOH 0 . 
ZL 39 HOH 1464 4464 2505 HOH HOH 0 . 
ZL 39 HOH 1465 4465 2506 HOH HOH 0 . 
ZL 39 HOH 1466 4466 2507 HOH HOH 0 . 
ZL 39 HOH 1467 4467 2508 HOH HOH 0 . 
ZL 39 HOH 1468 4468 2509 HOH HOH 0 . 
ZL 39 HOH 1469 4469 2511 HOH HOH 0 . 
ZL 39 HOH 1470 4470 2512 HOH HOH 0 . 
ZL 39 HOH 1471 4471 2513 HOH HOH 0 . 
ZL 39 HOH 1472 4472 2515 HOH HOH 0 . 
ZL 39 HOH 1473 4473 2516 HOH HOH 0 . 
ZL 39 HOH 1474 4474 2517 HOH HOH 0 . 
ZL 39 HOH 1475 4475 2521 HOH HOH 0 . 
ZL 39 HOH 1476 4476 2523 HOH HOH 0 . 
ZL 39 HOH 1477 4477 2524 HOH HOH 0 . 
ZL 39 HOH 1478 4478 2525 HOH HOH 0 . 
ZL 39 HOH 1479 4479 2526 HOH HOH 0 . 
ZL 39 HOH 1480 4480 2527 HOH HOH 0 . 
ZL 39 HOH 1481 4481 2528 HOH HOH 0 . 
ZL 39 HOH 1482 4482 2529 HOH HOH 0 . 
ZL 39 HOH 1483 4483 2530 HOH HOH 0 . 
ZL 39 HOH 1484 4484 2531 HOH HOH 0 . 
ZL 39 HOH 1485 4485 2532 HOH HOH 0 . 
ZL 39 HOH 1486 4486 2533 HOH HOH 0 . 
ZL 39 HOH 1487 4487 2534 HOH HOH 0 . 
ZL 39 HOH 1488 4488 2535 HOH HOH 0 . 
ZL 39 HOH 1489 4489 2538 HOH HOH 0 . 
ZL 39 HOH 1490 4490 2539 HOH HOH 0 . 
ZL 39 HOH 1491 4491 2540 HOH HOH 0 . 
ZL 39 HOH 1492 4492 2542 HOH HOH 0 . 
ZL 39 HOH 1493 4493 2543 HOH HOH 0 . 
ZL 39 HOH 1494 4494 2544 HOH HOH 0 . 
ZL 39 HOH 1495 4495 2546 HOH HOH 0 . 
ZL 39 HOH 1496 4496 2547 HOH HOH 0 . 
ZL 39 HOH 1497 4497 2550 HOH HOH 0 . 
ZL 39 HOH 1498 4498 2552 HOH HOH 0 . 
ZL 39 HOH 1499 4499 2553 HOH HOH 0 . 
ZL 39 HOH 1500 4500 2554 HOH HOH 0 . 
ZL 39 HOH 1501 4501 2556 HOH HOH 0 . 
ZL 39 HOH 1502 4502 2558 HOH HOH 0 . 
ZL 39 HOH 1503 4503 2559 HOH HOH 0 . 
ZL 39 HOH 1504 4504 2560 HOH HOH 0 . 
ZL 39 HOH 1505 4505 2561 HOH HOH 0 . 
ZL 39 HOH 1506 4506 2562 HOH HOH 0 . 
ZL 39 HOH 1507 4507 2564 HOH HOH 0 . 
ZL 39 HOH 1508 4508 2565 HOH HOH 0 . 
ZL 39 HOH 1509 4509 2566 HOH HOH 0 . 
ZL 39 HOH 1510 4510 2567 HOH HOH 0 . 
ZL 39 HOH 1511 4511 2568 HOH HOH 0 . 
ZL 39 HOH 1512 4512 2570 HOH HOH 0 . 
ZL 39 HOH 1513 4513 2571 HOH HOH 0 . 
ZL 39 HOH 1514 4514 2572 HOH HOH 0 . 
ZL 39 HOH 1515 4515 2573 HOH HOH 0 . 
ZL 39 HOH 1516 4516 2574 HOH HOH 0 . 
ZL 39 HOH 1517 4517 2575 HOH HOH 0 . 
ZL 39 HOH 1518 4518 2576 HOH HOH 0 . 
ZL 39 HOH 1519 4519 2578 HOH HOH 0 . 
ZL 39 HOH 1520 4520 2579 HOH HOH 0 . 
ZL 39 HOH 1521 4521 2581 HOH HOH 0 . 
ZL 39 HOH 1522 4522 2582 HOH HOH 0 . 
ZL 39 HOH 1523 4523 2583 HOH HOH 0 . 
ZL 39 HOH 1524 4524 2584 HOH HOH 0 . 
ZL 39 HOH 1525 4525 2585 HOH HOH 0 . 
ZL 39 HOH 1526 4526 2586 HOH HOH 0 . 
ZL 39 HOH 1527 4527 2587 HOH HOH 0 . 
ZL 39 HOH 1528 4528 2588 HOH HOH 0 . 
ZL 39 HOH 1529 4529 2589 HOH HOH 0 . 
ZL 39 HOH 1530 4530 2590 HOH HOH 0 . 
ZL 39 HOH 1531 4531 2592 HOH HOH 0 . 
ZL 39 HOH 1532 4532 2593 HOH HOH 0 . 
ZL 39 HOH 1533 4533 2594 HOH HOH 0 . 
ZL 39 HOH 1534 4534 2595 HOH HOH 0 . 
ZL 39 HOH 1535 4535 2596 HOH HOH 0 . 
ZL 39 HOH 1536 4536 2597 HOH HOH 0 . 
ZL 39 HOH 1537 4537 2598 HOH HOH 0 . 
ZL 39 HOH 1538 4538 2599 HOH HOH 0 . 
ZL 39 HOH 1539 4539 2600 HOH HOH 0 . 
ZL 39 HOH 1540 4540 2601 HOH HOH 0 . 
ZL 39 HOH 1541 4541 2602 HOH HOH 0 . 
ZL 39 HOH 1542 4542 2603 HOH HOH 0 . 
ZL 39 HOH 1543 4543 2604 HOH HOH 0 . 
ZL 39 HOH 1544 4544 2605 HOH HOH 0 . 
ZL 39 HOH 1545 4545 2607 HOH HOH 0 . 
ZL 39 HOH 1546 4546 2608 HOH HOH 0 . 
ZL 39 HOH 1547 4547 2610 HOH HOH 0 . 
ZL 39 HOH 1548 4548 2611 HOH HOH 0 . 
ZL 39 HOH 1549 4549 2612 HOH HOH 0 . 
ZL 39 HOH 1550 4550 2615 HOH HOH 0 . 
ZL 39 HOH 1551 4551 2616 HOH HOH 0 . 
ZL 39 HOH 1552 4552 2617 HOH HOH 0 . 
ZL 39 HOH 1553 4553 2619 HOH HOH 0 . 
ZL 39 HOH 1554 4554 2620 HOH HOH 0 . 
ZL 39 HOH 1555 4555 2622 HOH HOH 0 . 
ZL 39 HOH 1556 4556 2624 HOH HOH 0 . 
ZL 39 HOH 1557 4557 2626 HOH HOH 0 . 
ZL 39 HOH 1558 4558 2627 HOH HOH 0 . 
ZL 39 HOH 1559 4559 2628 HOH HOH 0 . 
ZL 39 HOH 1560 4560 2629 HOH HOH 0 . 
ZL 39 HOH 1561 4561 2631 HOH HOH 0 . 
ZL 39 HOH 1562 4562 2634 HOH HOH 0 . 
ZL 39 HOH 1563 4563 2635 HOH HOH 0 . 
ZL 39 HOH 1564 4564 2636 HOH HOH 0 . 
ZL 39 HOH 1565 4565 2637 HOH HOH 0 . 
ZL 39 HOH 1566 4566 2638 HOH HOH 0 . 
ZL 39 HOH 1567 4567 2639 HOH HOH 0 . 
ZL 39 HOH 1568 4568 2640 HOH HOH 0 . 
ZL 39 HOH 1569 4569 2642 HOH HOH 0 . 
ZL 39 HOH 1570 4570 2646 HOH HOH 0 . 
ZL 39 HOH 1571 4571 2647 HOH HOH 0 . 
ZL 39 HOH 1572 4572 2648 HOH HOH 0 . 
ZL 39 HOH 1573 4573 2650 HOH HOH 0 . 
ZL 39 HOH 1574 4574 2652 HOH HOH 0 . 
ZL 39 HOH 1575 4575 2653 HOH HOH 0 . 
ZL 39 HOH 1576 4576 2654 HOH HOH 0 . 
ZL 39 HOH 1577 4577 2655 HOH HOH 0 . 
ZL 39 HOH 1578 4578 2656 HOH HOH 0 . 
ZL 39 HOH 1579 4579 2657 HOH HOH 0 . 
ZL 39 HOH 1580 4580 2658 HOH HOH 0 . 
ZL 39 HOH 1581 4581 2661 HOH HOH 0 . 
ZL 39 HOH 1582 4582 2662 HOH HOH 0 . 
ZL 39 HOH 1583 4583 2666 HOH HOH 0 . 
ZL 39 HOH 1584 4584 2667 HOH HOH 0 . 
ZL 39 HOH 1585 4585 2668 HOH HOH 0 . 
ZL 39 HOH 1586 4586 2671 HOH HOH 0 . 
ZL 39 HOH 1587 4587 2673 HOH HOH 0 . 
ZL 39 HOH 1588 4588 2674 HOH HOH 0 . 
ZL 39 HOH 1589 4589 2676 HOH HOH 0 . 
ZL 39 HOH 1590 4590 2677 HOH HOH 0 . 
ZL 39 HOH 1591 4591 2678 HOH HOH 0 . 
ZL 39 HOH 1592 4592 2680 HOH HOH 0 . 
ZL 39 HOH 1593 4593 2681 HOH HOH 0 . 
ZL 39 HOH 1594 4594 2683 HOH HOH 0 . 
ZL 39 HOH 1595 4595 2684 HOH HOH 0 . 
ZL 39 HOH 1596 4596 2685 HOH HOH 0 . 
ZL 39 HOH 1597 4597 2688 HOH HOH 0 . 
ZL 39 HOH 1598 4598 2689 HOH HOH 0 . 
ZL 39 HOH 1599 4599 2690 HOH HOH 0 . 
ZL 39 HOH 1600 4600 2692 HOH HOH 0 . 
ZL 39 HOH 1601 4601 2693 HOH HOH 0 . 
ZL 39 HOH 1602 4602 2696 HOH HOH 0 . 
ZL 39 HOH 1603 4603 2698 HOH HOH 0 . 
ZL 39 HOH 1604 4604 2699 HOH HOH 0 . 
ZL 39 HOH 1605 4605 2700 HOH HOH 0 . 
ZL 39 HOH 1606 4606 2701 HOH HOH 0 . 
ZL 39 HOH 1607 4607 2702 HOH HOH 0 . 
ZL 39 HOH 1608 4608 2703 HOH HOH 0 . 
ZL 39 HOH 1609 4609 2704 HOH HOH 0 . 
ZL 39 HOH 1610 4610 2705 HOH HOH 0 . 
ZL 39 HOH 1611 4611 2706 HOH HOH 0 . 
ZL 39 HOH 1612 4612 2707 HOH HOH 0 . 
ZL 39 HOH 1613 4613 2708 HOH HOH 0 . 
ZL 39 HOH 1614 4614 2709 HOH HOH 0 . 
ZL 39 HOH 1615 4615 2712 HOH HOH 0 . 
ZL 39 HOH 1616 4616 2713 HOH HOH 0 . 
ZL 39 HOH 1617 4617 2715 HOH HOH 0 . 
ZL 39 HOH 1618 4618 2716 HOH HOH 0 . 
ZL 39 HOH 1619 4619 2717 HOH HOH 0 . 
ZL 39 HOH 1620 4620 2718 HOH HOH 0 . 
ZL 39 HOH 1621 4621 2719 HOH HOH 0 . 
ZL 39 HOH 1622 4622 2720 HOH HOH 0 . 
ZL 39 HOH 1623 4623 2721 HOH HOH 0 . 
ZL 39 HOH 1624 4624 2722 HOH HOH 0 . 
ZL 39 HOH 1625 4625 2723 HOH HOH 0 . 
ZL 39 HOH 1626 4626 2724 HOH HOH 0 . 
ZL 39 HOH 1627 4627 2725 HOH HOH 0 . 
ZL 39 HOH 1628 4628 2726 HOH HOH 0 . 
ZL 39 HOH 1629 4629 2727 HOH HOH 0 . 
ZL 39 HOH 1630 4630 2728 HOH HOH 0 . 
ZL 39 HOH 1631 4631 2731 HOH HOH 0 . 
ZL 39 HOH 1632 4632 2732 HOH HOH 0 . 
ZL 39 HOH 1633 4633 2733 HOH HOH 0 . 
ZL 39 HOH 1634 4634 2734 HOH HOH 0 . 
ZL 39 HOH 1635 4635 2735 HOH HOH 0 . 
ZL 39 HOH 1636 4636 2736 HOH HOH 0 . 
ZL 39 HOH 1637 4637 2737 HOH HOH 0 . 
ZL 39 HOH 1638 4638 2739 HOH HOH 0 . 
ZL 39 HOH 1639 4639 2740 HOH HOH 0 . 
ZL 39 HOH 1640 4640 2741 HOH HOH 0 . 
ZL 39 HOH 1641 4641 2742 HOH HOH 0 . 
ZL 39 HOH 1642 4642 2743 HOH HOH 0 . 
ZL 39 HOH 1643 4643 2744 HOH HOH 0 . 
ZL 39 HOH 1644 4644 2745 HOH HOH 0 . 
ZL 39 HOH 1645 4645 2746 HOH HOH 0 . 
ZL 39 HOH 1646 4646 2747 HOH HOH 0 . 
ZL 39 HOH 1647 4647 2748 HOH HOH 0 . 
ZL 39 HOH 1648 4648 2751 HOH HOH 0 . 
ZL 39 HOH 1649 4649 2752 HOH HOH 0 . 
ZL 39 HOH 1650 4650 2753 HOH HOH 0 . 
ZL 39 HOH 1651 4651 2754 HOH HOH 0 . 
ZL 39 HOH 1652 4652 2755 HOH HOH 0 . 
ZL 39 HOH 1653 4653 2757 HOH HOH 0 . 
ZL 39 HOH 1654 4654 2760 HOH HOH 0 . 
ZL 39 HOH 1655 4655 2762 HOH HOH 0 . 
ZL 39 HOH 1656 4656 2763 HOH HOH 0 . 
ZL 39 HOH 1657 4657 2764 HOH HOH 0 . 
ZL 39 HOH 1658 4658 2765 HOH HOH 0 . 
ZL 39 HOH 1659 4659 2766 HOH HOH 0 . 
ZL 39 HOH 1660 4660 2767 HOH HOH 0 . 
ZL 39 HOH 1661 4661 2771 HOH HOH 0 . 
ZL 39 HOH 1662 4662 2773 HOH HOH 0 . 
ZL 39 HOH 1663 4663 2774 HOH HOH 0 . 
ZL 39 HOH 1664 4664 2776 HOH HOH 0 . 
ZL 39 HOH 1665 4665 2778 HOH HOH 0 . 
ZL 39 HOH 1666 4666 2779 HOH HOH 0 . 
ZL 39 HOH 1667 4667 2780 HOH HOH 0 . 
ZL 39 HOH 1668 4668 2783 HOH HOH 0 . 
ZL 39 HOH 1669 4669 2784 HOH HOH 0 . 
ZL 39 HOH 1670 4670 2785 HOH HOH 0 . 
ZL 39 HOH 1671 4671 2787 HOH HOH 0 . 
ZL 39 HOH 1672 4672 2790 HOH HOH 0 . 
ZL 39 HOH 1673 4673 2791 HOH HOH 0 . 
ZL 39 HOH 1674 4674 2792 HOH HOH 0 . 
ZL 39 HOH 1675 4675 2793 HOH HOH 0 . 
ZL 39 HOH 1676 4676 2794 HOH HOH 0 . 
ZL 39 HOH 1677 4677 2795 HOH HOH 0 . 
ZL 39 HOH 1678 4678 2797 HOH HOH 0 . 
ZL 39 HOH 1679 4679 2799 HOH HOH 0 . 
ZL 39 HOH 1680 4680 2800 HOH HOH 0 . 
ZL 39 HOH 1681 4681 2801 HOH HOH 0 . 
ZL 39 HOH 1682 4682 2802 HOH HOH 0 . 
ZL 39 HOH 1683 4683 2803 HOH HOH 0 . 
ZL 39 HOH 1684 4684 2804 HOH HOH 0 . 
ZL 39 HOH 1685 4685 2805 HOH HOH 0 . 
ZL 39 HOH 1686 4686 2806 HOH HOH 0 . 
ZL 39 HOH 1687 4687 2807 HOH HOH 0 . 
ZL 39 HOH 1688 4688 2808 HOH HOH 0 . 
ZL 39 HOH 1689 4689 2809 HOH HOH 0 . 
ZL 39 HOH 1690 4690 2810 HOH HOH 0 . 
ZL 39 HOH 1691 4691 2811 HOH HOH 0 . 
ZL 39 HOH 1692 4692 2812 HOH HOH 0 . 
ZL 39 HOH 1693 4693 2813 HOH HOH 0 . 
ZL 39 HOH 1694 4694 2814 HOH HOH 0 . 
ZL 39 HOH 1695 4695 2816 HOH HOH 0 . 
ZL 39 HOH 1696 4696 2817 HOH HOH 0 . 
ZL 39 HOH 1697 4697 2818 HOH HOH 0 . 
ZL 39 HOH 1698 4698 2819 HOH HOH 0 . 
ZL 39 HOH 1699 4699 2820 HOH HOH 0 . 
ZL 39 HOH 1700 4700 2821 HOH HOH 0 . 
ZL 39 HOH 1701 4701 2827 HOH HOH 0 . 
ZL 39 HOH 1702 4702 2829 HOH HOH 0 . 
ZL 39 HOH 1703 4703 2830 HOH HOH 0 . 
ZL 39 HOH 1704 4704 2832 HOH HOH 0 . 
ZL 39 HOH 1705 4705 2833 HOH HOH 0 . 
ZL 39 HOH 1706 4706 2834 HOH HOH 0 . 
ZL 39 HOH 1707 4707 2835 HOH HOH 0 . 
ZL 39 HOH 1708 4708 2836 HOH HOH 0 . 
ZL 39 HOH 1709 4709 2837 HOH HOH 0 . 
ZL 39 HOH 1710 4710 2838 HOH HOH 0 . 
ZL 39 HOH 1711 4711 2839 HOH HOH 0 . 
ZL 39 HOH 1712 4712 2840 HOH HOH 0 . 
ZL 39 HOH 1713 4713 2841 HOH HOH 0 . 
ZL 39 HOH 1714 4714 2842 HOH HOH 0 . 
ZL 39 HOH 1715 4715 2843 HOH HOH 0 . 
ZL 39 HOH 1716 4716 2844 HOH HOH 0 . 
ZL 39 HOH 1717 4717 2845 HOH HOH 0 . 
ZL 39 HOH 1718 4718 2848 HOH HOH 0 . 
ZL 39 HOH 1719 4719 2849 HOH HOH 0 . 
ZL 39 HOH 1720 4720 2851 HOH HOH 0 . 
ZL 39 HOH 1721 4721 2854 HOH HOH 0 . 
ZL 39 HOH 1722 4722 2855 HOH HOH 0 . 
ZL 39 HOH 1723 4723 2856 HOH HOH 0 . 
ZL 39 HOH 1724 4724 2859 HOH HOH 0 . 
ZL 39 HOH 1725 4725 2860 HOH HOH 0 . 
ZL 39 HOH 1726 4726 2861 HOH HOH 0 . 
ZL 39 HOH 1727 4727 2862 HOH HOH 0 . 
ZL 39 HOH 1728 4728 2863 HOH HOH 0 . 
ZL 39 HOH 1729 4729 2864 HOH HOH 0 . 
ZL 39 HOH 1730 4730 2865 HOH HOH 0 . 
ZL 39 HOH 1731 4731 2867 HOH HOH 0 . 
ZL 39 HOH 1732 4732 2869 HOH HOH 0 . 
ZL 39 HOH 1733 4733 2870 HOH HOH 0 . 
ZL 39 HOH 1734 4734 2871 HOH HOH 0 . 
ZL 39 HOH 1735 4735 2872 HOH HOH 0 . 
ZL 39 HOH 1736 4736 2873 HOH HOH 0 . 
ZL 39 HOH 1737 4737 2877 HOH HOH 0 . 
ZL 39 HOH 1738 4738 2878 HOH HOH 0 . 
ZL 39 HOH 1739 4739 2880 HOH HOH 0 . 
ZL 39 HOH 1740 4740 2882 HOH HOH 0 . 
ZL 39 HOH 1741 4741 2883 HOH HOH 0 . 
ZL 39 HOH 1742 4742 2884 HOH HOH 0 . 
ZL 39 HOH 1743 4743 2887 HOH HOH 0 . 
ZL 39 HOH 1744 4744 2888 HOH HOH 0 . 
ZL 39 HOH 1745 4745 2891 HOH HOH 0 . 
ZL 39 HOH 1746 4746 2892 HOH HOH 0 . 
ZL 39 HOH 1747 4747 2893 HOH HOH 0 . 
ZL 39 HOH 1748 4748 2894 HOH HOH 0 . 
ZL 39 HOH 1749 4749 2895 HOH HOH 0 . 
ZL 39 HOH 1750 4750 2896 HOH HOH 0 . 
ZL 39 HOH 1751 4751 2897 HOH HOH 0 . 
ZL 39 HOH 1752 4752 2898 HOH HOH 0 . 
ZL 39 HOH 1753 4753 2899 HOH HOH 0 . 
ZL 39 HOH 1754 4754 2900 HOH HOH 0 . 
ZL 39 HOH 1755 4755 2902 HOH HOH 0 . 
ZL 39 HOH 1756 4756 2905 HOH HOH 0 . 
ZL 39 HOH 1757 4757 2906 HOH HOH 0 . 
ZL 39 HOH 1758 4758 2909 HOH HOH 0 . 
ZL 39 HOH 1759 4759 2910 HOH HOH 0 . 
ZL 39 HOH 1760 4760 2911 HOH HOH 0 . 
ZL 39 HOH 1761 4761 2912 HOH HOH 0 . 
ZL 39 HOH 1762 4762 2913 HOH HOH 0 . 
ZL 39 HOH 1763 4763 2915 HOH HOH 0 . 
ZL 39 HOH 1764 4764 2917 HOH HOH 0 . 
ZL 39 HOH 1765 4765 2918 HOH HOH 0 . 
ZL 39 HOH 1766 4766 2919 HOH HOH 0 . 
ZL 39 HOH 1767 4767 2920 HOH HOH 0 . 
ZL 39 HOH 1768 4768 2921 HOH HOH 0 . 
ZL 39 HOH 1769 4769 2923 HOH HOH 0 . 
ZL 39 HOH 1770 4770 2924 HOH HOH 0 . 
ZL 39 HOH 1771 4771 2925 HOH HOH 0 . 
ZL 39 HOH 1772 4772 2926 HOH HOH 0 . 
ZL 39 HOH 1773 4773 2927 HOH HOH 0 . 
ZL 39 HOH 1774 4774 2928 HOH HOH 0 . 
ZL 39 HOH 1775 4775 2930 HOH HOH 0 . 
ZL 39 HOH 1776 4776 2931 HOH HOH 0 . 
ZL 39 HOH 1777 4777 2932 HOH HOH 0 . 
ZL 39 HOH 1778 4778 2933 HOH HOH 0 . 
ZL 39 HOH 1779 4779 2936 HOH HOH 0 . 
ZL 39 HOH 1780 4780 2937 HOH HOH 0 . 
ZL 39 HOH 1781 4781 2939 HOH HOH 0 . 
ZL 39 HOH 1782 4782 2940 HOH HOH 0 . 
ZL 39 HOH 1783 4783 2942 HOH HOH 0 . 
ZL 39 HOH 1784 4784 2944 HOH HOH 0 . 
ZL 39 HOH 1785 4785 2945 HOH HOH 0 . 
ZL 39 HOH 1786 4786 2946 HOH HOH 0 . 
ZL 39 HOH 1787 4787 2947 HOH HOH 0 . 
ZL 39 HOH 1788 4788 2948 HOH HOH 0 . 
ZL 39 HOH 1789 4789 2949 HOH HOH 0 . 
ZL 39 HOH 1790 4790 2950 HOH HOH 0 . 
ZL 39 HOH 1791 4791 2951 HOH HOH 0 . 
ZL 39 HOH 1792 4792 2952 HOH HOH 0 . 
ZL 39 HOH 1793 4793 2953 HOH HOH 0 . 
ZL 39 HOH 1794 4794 2954 HOH HOH 0 . 
ZL 39 HOH 1795 4795 2955 HOH HOH 0 . 
ZL 39 HOH 1796 4796 2956 HOH HOH 0 . 
ZL 39 HOH 1797 4797 2958 HOH HOH 0 . 
ZL 39 HOH 1798 4798 2959 HOH HOH 0 . 
ZL 39 HOH 1799 4799 2960 HOH HOH 0 . 
ZL 39 HOH 1800 4800 2962 HOH HOH 0 . 
ZL 39 HOH 1801 4801 2964 HOH HOH 0 . 
ZL 39 HOH 1802 4802 2965 HOH HOH 0 . 
ZL 39 HOH 1803 4803 2966 HOH HOH 0 . 
ZL 39 HOH 1804 4804 2967 HOH HOH 0 . 
ZL 39 HOH 1805 4805 2968 HOH HOH 0 . 
ZL 39 HOH 1806 4806 2969 HOH HOH 0 . 
ZL 39 HOH 1807 4807 2970 HOH HOH 0 . 
ZL 39 HOH 1808 4808 2971 HOH HOH 0 . 
ZL 39 HOH 1809 4809 2973 HOH HOH 0 . 
ZL 39 HOH 1810 4810 2974 HOH HOH 0 . 
ZL 39 HOH 1811 4811 2975 HOH HOH 0 . 
ZL 39 HOH 1812 4812 2976 HOH HOH 0 . 
ZL 39 HOH 1813 4813 2977 HOH HOH 0 . 
ZL 39 HOH 1814 4814 2978 HOH HOH 0 . 
ZL 39 HOH 1815 4815 2980 HOH HOH 0 . 
ZL 39 HOH 1816 4816 2981 HOH HOH 0 . 
ZL 39 HOH 1817 4817 2983 HOH HOH 0 . 
ZL 39 HOH 1818 4818 2985 HOH HOH 0 . 
ZL 39 HOH 1819 4819 2987 HOH HOH 0 . 
ZL 39 HOH 1820 4820 2988 HOH HOH 0 . 
ZL 39 HOH 1821 4821 2989 HOH HOH 0 . 
ZL 39 HOH 1822 4822 2992 HOH HOH 0 . 
ZL 39 HOH 1823 4823 2995 HOH HOH 0 . 
ZL 39 HOH 1824 4824 2996 HOH HOH 0 . 
ZL 39 HOH 1825 4825 2998 HOH HOH 0 . 
ZL 39 HOH 1826 4826 3000 HOH HOH 0 . 
ZL 39 HOH 1827 4827 3001 HOH HOH 0 . 
ZL 39 HOH 1828 4828 3002 HOH HOH 0 . 
ZL 39 HOH 1829 4829 3003 HOH HOH 0 . 
ZL 39 HOH 1830 4830 3004 HOH HOH 0 . 
ZL 39 HOH 1831 4831 3006 HOH HOH 0 . 
ZL 39 HOH 1832 4832 3007 HOH HOH 0 . 
ZL 39 HOH 1833 4833 3008 HOH HOH 0 . 
ZL 39 HOH 1834 4834 3010 HOH HOH 0 . 
ZL 39 HOH 1835 4835 3011 HOH HOH 0 . 
ZL 39 HOH 1836 4836 3014 HOH HOH 0 . 
ZL 39 HOH 1837 4837 3016 HOH HOH 0 . 
ZL 39 HOH 1838 4838 3017 HOH HOH 0 . 
ZL 39 HOH 1839 4839 3018 HOH HOH 0 . 
ZL 39 HOH 1840 4840 3019 HOH HOH 0 . 
ZL 39 HOH 1841 4841 3020 HOH HOH 0 . 
ZL 39 HOH 1842 4842 3021 HOH HOH 0 . 
ZL 39 HOH 1843 4843 3022 HOH HOH 0 . 
ZL 39 HOH 1844 4844 3023 HOH HOH 0 . 
ZL 39 HOH 1845 4845 3024 HOH HOH 0 . 
ZL 39 HOH 1846 4846 3025 HOH HOH 0 . 
ZL 39 HOH 1847 4847 3027 HOH HOH 0 . 
ZL 39 HOH 1848 4848 3028 HOH HOH 0 . 
ZL 39 HOH 1849 4849 3029 HOH HOH 0 . 
ZL 39 HOH 1850 4850 3030 HOH HOH 0 . 
ZL 39 HOH 1851 4851 3031 HOH HOH 0 . 
ZL 39 HOH 1852 4852 3036 HOH HOH 0 . 
ZL 39 HOH 1853 4853 3037 HOH HOH 0 . 
ZL 39 HOH 1854 4854 3038 HOH HOH 0 . 
ZL 39 HOH 1855 4855 3039 HOH HOH 0 . 
ZL 39 HOH 1856 4856 3040 HOH HOH 0 . 
ZL 39 HOH 1857 4857 3041 HOH HOH 0 . 
ZL 39 HOH 1858 4858 3042 HOH HOH 0 . 
ZL 39 HOH 1859 4859 3044 HOH HOH 0 . 
ZL 39 HOH 1860 4860 3046 HOH HOH 0 . 
ZL 39 HOH 1861 4861 3047 HOH HOH 0 . 
ZL 39 HOH 1862 4862 3048 HOH HOH 0 . 
ZL 39 HOH 1863 4863 3049 HOH HOH 0 . 
ZL 39 HOH 1864 4864 3050 HOH HOH 0 . 
ZL 39 HOH 1865 4865 3052 HOH HOH 0 . 
ZL 39 HOH 1866 4866 3053 HOH HOH 0 . 
ZL 39 HOH 1867 4867 3054 HOH HOH 0 . 
ZL 39 HOH 1868 4868 3055 HOH HOH 0 . 
ZL 39 HOH 1869 4869 3057 HOH HOH 0 . 
ZL 39 HOH 1870 4870 3058 HOH HOH 0 . 
ZL 39 HOH 1871 4871 3059 HOH HOH 0 . 
ZL 39 HOH 1872 4872 3060 HOH HOH 0 . 
ZL 39 HOH 1873 4873 3061 HOH HOH 0 . 
ZL 39 HOH 1874 4874 3064 HOH HOH 0 . 
ZL 39 HOH 1875 4875 3067 HOH HOH 0 . 
ZL 39 HOH 1876 4876 3068 HOH HOH 0 . 
ZL 39 HOH 1877 4877 3070 HOH HOH 0 . 
ZL 39 HOH 1878 4878 3072 HOH HOH 0 . 
ZL 39 HOH 1879 4879 3074 HOH HOH 0 . 
ZL 39 HOH 1880 4880 3075 HOH HOH 0 . 
ZL 39 HOH 1881 4881 3076 HOH HOH 0 . 
ZL 39 HOH 1882 4882 3077 HOH HOH 0 . 
ZL 39 HOH 1883 4883 3078 HOH HOH 0 . 
ZL 39 HOH 1884 4884 3079 HOH HOH 0 . 
ZL 39 HOH 1885 4885 3081 HOH HOH 0 . 
ZL 39 HOH 1886 4886 3083 HOH HOH 0 . 
ZL 39 HOH 1887 4887 3085 HOH HOH 0 . 
ZL 39 HOH 1888 4888 3086 HOH HOH 0 . 
ZL 39 HOH 1889 4889 3087 HOH HOH 0 . 
ZL 39 HOH 1890 4890 3089 HOH HOH 0 . 
ZL 39 HOH 1891 4891 3090 HOH HOH 0 . 
ZL 39 HOH 1892 4892 3091 HOH HOH 0 . 
ZL 39 HOH 1893 4893 3092 HOH HOH 0 . 
ZL 39 HOH 1894 4894 3093 HOH HOH 0 . 
ZL 39 HOH 1895 4895 3094 HOH HOH 0 . 
ZL 39 HOH 1896 4896 3095 HOH HOH 0 . 
ZL 39 HOH 1897 4897 3096 HOH HOH 0 . 
ZL 39 HOH 1898 4898 3097 HOH HOH 0 . 
ZL 39 HOH 1899 4899 3098 HOH HOH 0 . 
ZL 39 HOH 1900 4900 3099 HOH HOH 0 . 
ZL 39 HOH 1901 4901 3101 HOH HOH 0 . 
ZL 39 HOH 1902 4902 3105 HOH HOH 0 . 
ZL 39 HOH 1903 4903 3109 HOH HOH 0 . 
ZL 39 HOH 1904 4904 3110 HOH HOH 0 . 
ZL 39 HOH 1905 4905 3112 HOH HOH 0 . 
ZL 39 HOH 1906 4906 3113 HOH HOH 0 . 
ZL 39 HOH 1907 4907 3114 HOH HOH 0 . 
ZL 39 HOH 1908 4908 3115 HOH HOH 0 . 
ZL 39 HOH 1909 4909 3116 HOH HOH 0 . 
ZL 39 HOH 1910 4910 3118 HOH HOH 0 . 
ZL 39 HOH 1911 4911 3119 HOH HOH 0 . 
ZL 39 HOH 1912 4912 3120 HOH HOH 0 . 
ZL 39 HOH 1913 4913 3123 HOH HOH 0 . 
ZL 39 HOH 1914 4914 3124 HOH HOH 0 . 
ZL 39 HOH 1915 4915 3125 HOH HOH 0 . 
ZL 39 HOH 1916 4916 3127 HOH HOH 0 . 
ZL 39 HOH 1917 4917 3128 HOH HOH 0 . 
ZL 39 HOH 1918 4918 3130 HOH HOH 0 . 
ZL 39 HOH 1919 4919 3131 HOH HOH 0 . 
ZL 39 HOH 1920 4920 3136 HOH HOH 0 . 
ZL 39 HOH 1921 4921 3137 HOH HOH 0 . 
ZL 39 HOH 1922 4922 3139 HOH HOH 0 . 
ZL 39 HOH 1923 4923 3140 HOH HOH 0 . 
ZL 39 HOH 1924 4924 3141 HOH HOH 0 . 
ZL 39 HOH 1925 4925 3144 HOH HOH 0 . 
ZL 39 HOH 1926 4926 3145 HOH HOH 0 . 
ZL 39 HOH 1927 4927 3147 HOH HOH 0 . 
ZL 39 HOH 1928 4928 3148 HOH HOH 0 . 
ZL 39 HOH 1929 4929 3149 HOH HOH 0 . 
ZL 39 HOH 1930 4930 3150 HOH HOH 0 . 
ZL 39 HOH 1931 4931 3151 HOH HOH 0 . 
ZL 39 HOH 1932 4932 3153 HOH HOH 0 . 
ZL 39 HOH 1933 4933 3154 HOH HOH 0 . 
ZL 39 HOH 1934 4934 3158 HOH HOH 0 . 
ZL 39 HOH 1935 4935 3161 HOH HOH 0 . 
ZL 39 HOH 1936 4936 3162 HOH HOH 0 . 
ZL 39 HOH 1937 4937 3163 HOH HOH 0 . 
ZL 39 HOH 1938 4938 3165 HOH HOH 0 . 
ZL 39 HOH 1939 4939 3166 HOH HOH 0 . 
ZL 39 HOH 1940 4940 3168 HOH HOH 0 . 
ZL 39 HOH 1941 4941 3169 HOH HOH 0 . 
ZL 39 HOH 1942 4942 3170 HOH HOH 0 . 
ZL 39 HOH 1943 4943 3171 HOH HOH 0 . 
ZL 39 HOH 1944 4944 3172 HOH HOH 0 . 
ZL 39 HOH 1945 4945 3173 HOH HOH 0 . 
ZL 39 HOH 1946 4946 3174 HOH HOH 0 . 
ZL 39 HOH 1947 4947 3175 HOH HOH 0 . 
ZL 39 HOH 1948 4948 3177 HOH HOH 0 . 
ZL 39 HOH 1949 4949 3178 HOH HOH 0 . 
ZL 39 HOH 1950 4950 3181 HOH HOH 0 . 
ZL 39 HOH 1951 4951 3182 HOH HOH 0 . 
ZL 39 HOH 1952 4952 3183 HOH HOH 0 . 
ZL 39 HOH 1953 4953 3184 HOH HOH 0 . 
ZL 39 HOH 1954 4954 3185 HOH HOH 0 . 
ZL 39 HOH 1955 4955 3186 HOH HOH 0 . 
ZL 39 HOH 1956 4956 3187 HOH HOH 0 . 
ZL 39 HOH 1957 4957 3189 HOH HOH 0 . 
ZL 39 HOH 1958 4958 3190 HOH HOH 0 . 
ZL 39 HOH 1959 4959 3191 HOH HOH 0 . 
ZL 39 HOH 1960 4960 3192 HOH HOH 0 . 
ZL 39 HOH 1961 4961 3195 HOH HOH 0 . 
ZL 39 HOH 1962 4962 3197 HOH HOH 0 . 
ZL 39 HOH 1963 4963 3199 HOH HOH 0 . 
ZL 39 HOH 1964 4964 3200 HOH HOH 0 . 
ZL 39 HOH 1965 4965 3201 HOH HOH 0 . 
ZL 39 HOH 1966 4966 3202 HOH HOH 0 . 
ZL 39 HOH 1967 4967 3206 HOH HOH 0 . 
ZL 39 HOH 1968 4968 3208 HOH HOH 0 . 
ZL 39 HOH 1969 4969 3209 HOH HOH 0 . 
ZL 39 HOH 1970 4970 3210 HOH HOH 0 . 
ZL 39 HOH 1971 4971 3211 HOH HOH 0 . 
ZL 39 HOH 1972 4972 3212 HOH HOH 0 . 
ZL 39 HOH 1973 4973 3213 HOH HOH 0 . 
ZL 39 HOH 1974 4974 3214 HOH HOH 0 . 
ZL 39 HOH 1975 4975 3215 HOH HOH 0 . 
ZL 39 HOH 1976 4976 3216 HOH HOH 0 . 
ZL 39 HOH 1977 4977 3217 HOH HOH 0 . 
ZL 39 HOH 1978 4978 3218 HOH HOH 0 . 
ZL 39 HOH 1979 4979 3220 HOH HOH 0 . 
ZL 39 HOH 1980 4980 3222 HOH HOH 0 . 
ZL 39 HOH 1981 4981 3225 HOH HOH 0 . 
ZL 39 HOH 1982 4982 3226 HOH HOH 0 . 
ZL 39 HOH 1983 4983 3227 HOH HOH 0 . 
ZL 39 HOH 1984 4984 3229 HOH HOH 0 . 
ZL 39 HOH 1985 4985 3230 HOH HOH 0 . 
ZL 39 HOH 1986 4986 3231 HOH HOH 0 . 
ZL 39 HOH 1987 4987 3232 HOH HOH 0 . 
ZL 39 HOH 1988 4988 3233 HOH HOH 0 . 
ZL 39 HOH 1989 4989 3235 HOH HOH 0 . 
ZL 39 HOH 1990 4990 3237 HOH HOH 0 . 
ZL 39 HOH 1991 4991 3238 HOH HOH 0 . 
ZL 39 HOH 1992 4992 3239 HOH HOH 0 . 
ZL 39 HOH 1993 4993 3242 HOH HOH 0 . 
ZL 39 HOH 1994 4994 3246 HOH HOH 0 . 
ZL 39 HOH 1995 4995 3247 HOH HOH 0 . 
ZL 39 HOH 1996 4996 3248 HOH HOH 0 . 
ZL 39 HOH 1997 4997 3252 HOH HOH 0 . 
ZL 39 HOH 1998 4998 3253 HOH HOH 0 . 
ZL 39 HOH 1999 4999 3255 HOH HOH 0 . 
ZL 39 HOH 2000 5000 3256 HOH HOH 0 . 
ZL 39 HOH 2001 5001 3257 HOH HOH 0 . 
ZL 39 HOH 2002 5002 3258 HOH HOH 0 . 
ZL 39 HOH 2003 5003 3259 HOH HOH 0 . 
ZL 39 HOH 2004 5004 3260 HOH HOH 0 . 
ZL 39 HOH 2005 5005 3261 HOH HOH 0 . 
ZL 39 HOH 2006 5006 3262 HOH HOH 0 . 
ZL 39 HOH 2007 5007 3263 HOH HOH 0 . 
ZL 39 HOH 2008 5008 3264 HOH HOH 0 . 
ZL 39 HOH 2009 5009 3265 HOH HOH 0 . 
ZL 39 HOH 2010 5010 3266 HOH HOH 0 . 
ZL 39 HOH 2011 5011 3267 HOH HOH 0 . 
ZL 39 HOH 2012 5012 3268 HOH HOH 0 . 
ZL 39 HOH 2013 5013 3269 HOH HOH 0 . 
ZL 39 HOH 2014 5014 3270 HOH HOH 0 . 
ZL 39 HOH 2015 5015 3271 HOH HOH 0 . 
ZL 39 HOH 2016 5016 3272 HOH HOH 0 . 
ZL 39 HOH 2017 5017 3275 HOH HOH 0 . 
ZL 39 HOH 2018 5018 3276 HOH HOH 0 . 
ZL 39 HOH 2019 5019 3277 HOH HOH 0 . 
ZL 39 HOH 2020 5020 3280 HOH HOH 0 . 
ZL 39 HOH 2021 5021 3281 HOH HOH 0 . 
ZL 39 HOH 2022 5022 3282 HOH HOH 0 . 
ZL 39 HOH 2023 5023 3283 HOH HOH 0 . 
ZL 39 HOH 2024 5024 3284 HOH HOH 0 . 
ZL 39 HOH 2025 5025 3285 HOH HOH 0 . 
ZL 39 HOH 2026 5026 3286 HOH HOH 0 . 
ZL 39 HOH 2027 5027 3287 HOH HOH 0 . 
ZL 39 HOH 2028 5028 3288 HOH HOH 0 . 
ZL 39 HOH 2029 5029 3289 HOH HOH 0 . 
ZL 39 HOH 2030 5030 3290 HOH HOH 0 . 
ZL 39 HOH 2031 5031 3291 HOH HOH 0 . 
ZL 39 HOH 2032 5032 3292 HOH HOH 0 . 
ZL 39 HOH 2033 5033 3293 HOH HOH 0 . 
ZL 39 HOH 2034 5034 3295 HOH HOH 0 . 
ZL 39 HOH 2035 5035 3296 HOH HOH 0 . 
ZL 39 HOH 2036 5036 3297 HOH HOH 0 . 
ZL 39 HOH 2037 5037 3298 HOH HOH 0 . 
ZL 39 HOH 2038 5038 3300 HOH HOH 0 . 
ZL 39 HOH 2039 5039 3301 HOH HOH 0 . 
ZL 39 HOH 2040 5040 3302 HOH HOH 0 . 
ZL 39 HOH 2041 5041 3304 HOH HOH 0 . 
ZL 39 HOH 2042 5042 3305 HOH HOH 0 . 
ZL 39 HOH 2043 5043 3307 HOH HOH 0 . 
ZL 39 HOH 2044 5044 3308 HOH HOH 0 . 
ZL 39 HOH 2045 5045 3309 HOH HOH 0 . 
ZL 39 HOH 2046 5046 3310 HOH HOH 0 . 
ZL 39 HOH 2047 5047 3311 HOH HOH 0 . 
ZL 39 HOH 2048 5048 3313 HOH HOH 0 . 
ZL 39 HOH 2049 5049 3315 HOH HOH 0 . 
ZL 39 HOH 2050 5050 3316 HOH HOH 0 . 
ZL 39 HOH 2051 5051 3317 HOH HOH 0 . 
ZL 39 HOH 2052 5052 3318 HOH HOH 0 . 
ZL 39 HOH 2053 5053 3320 HOH HOH 0 . 
ZL 39 HOH 2054 5054 3321 HOH HOH 0 . 
ZL 39 HOH 2055 5055 3322 HOH HOH 0 . 
ZL 39 HOH 2056 5056 3323 HOH HOH 0 . 
ZL 39 HOH 2057 5057 3324 HOH HOH 0 . 
ZL 39 HOH 2058 5058 3325 HOH HOH 0 . 
ZL 39 HOH 2059 5059 3327 HOH HOH 0 . 
ZL 39 HOH 2060 5060 3329 HOH HOH 0 . 
ZL 39 HOH 2061 5061 3330 HOH HOH 0 . 
ZL 39 HOH 2062 5062 3331 HOH HOH 0 . 
ZL 39 HOH 2063 5063 3334 HOH HOH 0 . 
ZL 39 HOH 2064 5064 3335 HOH HOH 0 . 
ZL 39 HOH 2065 5065 3336 HOH HOH 0 . 
ZL 39 HOH 2066 5066 3337 HOH HOH 0 . 
ZL 39 HOH 2067 5067 3339 HOH HOH 0 . 
ZL 39 HOH 2068 5068 3341 HOH HOH 0 . 
ZL 39 HOH 2069 5069 3342 HOH HOH 0 . 
ZL 39 HOH 2070 5070 3343 HOH HOH 0 . 
ZL 39 HOH 2071 5071 3344 HOH HOH 0 . 
ZL 39 HOH 2072 5072 3345 HOH HOH 0 . 
ZL 39 HOH 2073 5073 3346 HOH HOH 0 . 
ZL 39 HOH 2074 5074 3350 HOH HOH 0 . 
ZL 39 HOH 2075 5075 3351 HOH HOH 0 . 
ZL 39 HOH 2076 5076 3353 HOH HOH 0 . 
ZL 39 HOH 2077 5077 3354 HOH HOH 0 . 
ZL 39 HOH 2078 5078 3355 HOH HOH 0 . 
ZL 39 HOH 2079 5079 3356 HOH HOH 0 . 
ZL 39 HOH 2080 5080 3357 HOH HOH 0 . 
ZL 39 HOH 2081 5081 3358 HOH HOH 0 . 
ZL 39 HOH 2082 5082 3361 HOH HOH 0 . 
ZL 39 HOH 2083 5083 3362 HOH HOH 0 . 
ZL 39 HOH 2084 5084 3365 HOH HOH 0 . 
ZL 39 HOH 2085 5085 3366 HOH HOH 0 . 
ZL 39 HOH 2086 5086 3367 HOH HOH 0 . 
ZL 39 HOH 2087 5087 3368 HOH HOH 0 . 
ZL 39 HOH 2088 5088 3372 HOH HOH 0 . 
ZL 39 HOH 2089 5089 3373 HOH HOH 0 . 
ZL 39 HOH 2090 5090 3374 HOH HOH 0 . 
ZL 39 HOH 2091 5091 3375 HOH HOH 0 . 
ZL 39 HOH 2092 5092 3376 HOH HOH 0 . 
ZL 39 HOH 2093 5093 3378 HOH HOH 0 . 
ZL 39 HOH 2094 5094 3379 HOH HOH 0 . 
ZL 39 HOH 2095 5095 3380 HOH HOH 0 . 
ZL 39 HOH 2096 5096 3381 HOH HOH 0 . 
ZL 39 HOH 2097 5097 3382 HOH HOH 0 . 
ZL 39 HOH 2098 5098 3383 HOH HOH 0 . 
ZL 39 HOH 2099 5099 3384 HOH HOH 0 . 
ZL 39 HOH 2100 5100 3387 HOH HOH 0 . 
ZL 39 HOH 2101 5101 3389 HOH HOH 0 . 
ZL 39 HOH 2102 5102 3390 HOH HOH 0 . 
ZL 39 HOH 2103 5103 3393 HOH HOH 0 . 
ZL 39 HOH 2104 5104 3394 HOH HOH 0 . 
ZL 39 HOH 2105 5105 3395 HOH HOH 0 . 
ZL 39 HOH 2106 5106 3396 HOH HOH 0 . 
ZL 39 HOH 2107 5107 3397 HOH HOH 0 . 
ZL 39 HOH 2108 5108 3398 HOH HOH 0 . 
ZL 39 HOH 2109 5109 3399 HOH HOH 0 . 
ZL 39 HOH 2110 5110 3400 HOH HOH 0 . 
ZL 39 HOH 2111 5111 3402 HOH HOH 0 . 
ZL 39 HOH 2112 5112 3403 HOH HOH 0 . 
ZL 39 HOH 2113 5113 3404 HOH HOH 0 . 
ZL 39 HOH 2114 5114 3405 HOH HOH 0 . 
ZL 39 HOH 2115 5115 3406 HOH HOH 0 . 
ZL 39 HOH 2116 5116 3407 HOH HOH 0 . 
ZL 39 HOH 2117 5117 3408 HOH HOH 0 . 
ZL 39 HOH 2118 5118 3409 HOH HOH 0 . 
ZL 39 HOH 2119 5119 3410 HOH HOH 0 . 
ZL 39 HOH 2120 5120 3411 HOH HOH 0 . 
ZL 39 HOH 2121 5121 3412 HOH HOH 0 . 
ZL 39 HOH 2122 5122 3413 HOH HOH 0 . 
ZL 39 HOH 2123 5123 3414 HOH HOH 0 . 
ZL 39 HOH 2124 5124 3415 HOH HOH 0 . 
ZL 39 HOH 2125 5125 3417 HOH HOH 0 . 
ZL 39 HOH 2126 5126 3418 HOH HOH 0 . 
ZL 39 HOH 2127 5127 3420 HOH HOH 0 . 
ZL 39 HOH 2128 5128 3423 HOH HOH 0 . 
ZL 39 HOH 2129 5129 3424 HOH HOH 0 . 
ZL 39 HOH 2130 5130 3425 HOH HOH 0 . 
ZL 39 HOH 2131 5131 3426 HOH HOH 0 . 
ZL 39 HOH 2132 5132 3427 HOH HOH 0 . 
ZL 39 HOH 2133 5133 3429 HOH HOH 0 . 
ZL 39 HOH 2134 5134 3430 HOH HOH 0 . 
ZL 39 HOH 2135 5135 3431 HOH HOH 0 . 
ZL 39 HOH 2136 5136 3432 HOH HOH 0 . 
ZL 39 HOH 2137 5137 3433 HOH HOH 0 . 
ZL 39 HOH 2138 5138 3434 HOH HOH 0 . 
ZL 39 HOH 2139 5139 3435 HOH HOH 0 . 
ZL 39 HOH 2140 5140 3436 HOH HOH 0 . 
ZL 39 HOH 2141 5141 3437 HOH HOH 0 . 
ZL 39 HOH 2142 5142 3438 HOH HOH 0 . 
ZL 39 HOH 2143 5143 3439 HOH HOH 0 . 
ZL 39 HOH 2144 5144 3440 HOH HOH 0 . 
ZL 39 HOH 2145 5145 3441 HOH HOH 0 . 
ZL 39 HOH 2146 5146 3444 HOH HOH 0 . 
ZL 39 HOH 2147 5147 3446 HOH HOH 0 . 
ZL 39 HOH 2148 5148 3447 HOH HOH 0 . 
ZL 39 HOH 2149 5149 3448 HOH HOH 0 . 
ZL 39 HOH 2150 5150 3449 HOH HOH 0 . 
ZL 39 HOH 2151 5151 3450 HOH HOH 0 . 
ZL 39 HOH 2152 5152 3451 HOH HOH 0 . 
ZL 39 HOH 2153 5153 3452 HOH HOH 0 . 
ZL 39 HOH 2154 5154 3453 HOH HOH 0 . 
ZL 39 HOH 2155 5155 3454 HOH HOH 0 . 
ZL 39 HOH 2156 5156 3455 HOH HOH 0 . 
ZL 39 HOH 2157 5157 3457 HOH HOH 0 . 
ZL 39 HOH 2158 5158 3460 HOH HOH 0 . 
ZL 39 HOH 2159 5159 3462 HOH HOH 0 . 
ZL 39 HOH 2160 5160 3464 HOH HOH 0 . 
ZL 39 HOH 2161 5161 3467 HOH HOH 0 . 
ZL 39 HOH 2162 5162 3468 HOH HOH 0 . 
ZL 39 HOH 2163 5163 3469 HOH HOH 0 . 
ZL 39 HOH 2164 5164 3470 HOH HOH 0 . 
ZL 39 HOH 2165 5165 3473 HOH HOH 0 . 
ZL 39 HOH 2166 5166 3474 HOH HOH 0 . 
ZL 39 HOH 2167 5167 3475 HOH HOH 0 . 
ZL 39 HOH 2168 5168 3476 HOH HOH 0 . 
ZL 39 HOH 2169 5169 3479 HOH HOH 0 . 
ZL 39 HOH 2170 5170 3481 HOH HOH 0 . 
ZL 39 HOH 2171 5171 3485 HOH HOH 0 . 
ZL 39 HOH 2172 5172 3486 HOH HOH 0 . 
ZL 39 HOH 2173 5173 3487 HOH HOH 0 . 
ZL 39 HOH 2174 5174 3488 HOH HOH 0 . 
ZL 39 HOH 2175 5175 3489 HOH HOH 0 . 
ZL 39 HOH 2176 5176 3491 HOH HOH 0 . 
ZL 39 HOH 2177 5177 3493 HOH HOH 0 . 
ZL 39 HOH 2178 5178 3494 HOH HOH 0 . 
ZL 39 HOH 2179 5179 3495 HOH HOH 0 . 
ZL 39 HOH 2180 5180 3497 HOH HOH 0 . 
ZL 39 HOH 2181 5181 3498 HOH HOH 0 . 
ZL 39 HOH 2182 5182 3499 HOH HOH 0 . 
ZL 39 HOH 2183 5183 3500 HOH HOH 0 . 
ZL 39 HOH 2184 5184 3501 HOH HOH 0 . 
ZL 39 HOH 2185 5185 3503 HOH HOH 0 . 
ZL 39 HOH 2186 5186 3506 HOH HOH 0 . 
ZL 39 HOH 2187 5187 3509 HOH HOH 0 . 
ZL 39 HOH 2188 5188 3510 HOH HOH 0 . 
ZL 39 HOH 2189 5189 3512 HOH HOH 0 . 
ZL 39 HOH 2190 5190 3514 HOH HOH 0 . 
ZL 39 HOH 2191 5191 3515 HOH HOH 0 . 
ZL 39 HOH 2192 5192 3516 HOH HOH 0 . 
ZL 39 HOH 2193 5193 3518 HOH HOH 0 . 
ZL 39 HOH 2194 5194 3519 HOH HOH 0 . 
ZL 39 HOH 2195 5195 3521 HOH HOH 0 . 
ZL 39 HOH 2196 5196 3522 HOH HOH 0 . 
ZL 39 HOH 2197 5197 3524 HOH HOH 0 . 
ZL 39 HOH 2198 5198 3525 HOH HOH 0 . 
ZL 39 HOH 2199 5199 3526 HOH HOH 0 . 
ZL 39 HOH 2200 5200 3527 HOH HOH 0 . 
ZL 39 HOH 2201 5201 3528 HOH HOH 0 . 
ZL 39 HOH 2202 5202 3530 HOH HOH 0 . 
ZL 39 HOH 2203 5203 3531 HOH HOH 0 . 
ZL 39 HOH 2204 5204 3536 HOH HOH 0 . 
ZL 39 HOH 2205 5205 3537 HOH HOH 0 . 
ZL 39 HOH 2206 5206 3540 HOH HOH 0 . 
ZL 39 HOH 2207 5207 3541 HOH HOH 0 . 
ZL 39 HOH 2208 5208 3542 HOH HOH 0 . 
ZL 39 HOH 2209 5209 3543 HOH HOH 0 . 
ZL 39 HOH 2210 5210 3544 HOH HOH 0 . 
ZL 39 HOH 2211 5211 3545 HOH HOH 0 . 
ZL 39 HOH 2212 5212 3546 HOH HOH 0 . 
ZL 39 HOH 2213 5213 3551 HOH HOH 0 . 
ZL 39 HOH 2214 5214 3552 HOH HOH 0 . 
ZL 39 HOH 2215 5215 3553 HOH HOH 0 . 
ZL 39 HOH 2216 5216 3555 HOH HOH 0 . 
ZL 39 HOH 2217 5217 3556 HOH HOH 0 . 
ZL 39 HOH 2218 5218 3557 HOH HOH 0 . 
ZL 39 HOH 2219 5219 3558 HOH HOH 0 . 
ZL 39 HOH 2220 5220 3559 HOH HOH 0 . 
ZL 39 HOH 2221 5221 3560 HOH HOH 0 . 
ZL 39 HOH 2222 5222 3561 HOH HOH 0 . 
ZL 39 HOH 2223 5223 3565 HOH HOH 0 . 
ZL 39 HOH 2224 5224 3567 HOH HOH 0 . 
ZL 39 HOH 2225 5225 3568 HOH HOH 0 . 
ZL 39 HOH 2226 5226 3569 HOH HOH 0 . 
ZL 39 HOH 2227 5227 3570 HOH HOH 0 . 
ZL 39 HOH 2228 5228 3571 HOH HOH 0 . 
ZL 39 HOH 2229 5229 3574 HOH HOH 0 . 
ZL 39 HOH 2230 5230 3576 HOH HOH 0 . 
ZL 39 HOH 2231 5231 3577 HOH HOH 0 . 
ZL 39 HOH 2232 5232 3578 HOH HOH 0 . 
ZL 39 HOH 2233 5233 3579 HOH HOH 0 . 
ZL 39 HOH 2234 5234 3581 HOH HOH 0 . 
ZL 39 HOH 2235 5235 3582 HOH HOH 0 . 
ZL 39 HOH 2236 5236 3584 HOH HOH 0 . 
ZL 39 HOH 2237 5237 3585 HOH HOH 0 . 
ZL 39 HOH 2238 5238 3586 HOH HOH 0 . 
ZL 39 HOH 2239 5239 3590 HOH HOH 0 . 
ZL 39 HOH 2240 5240 3591 HOH HOH 0 . 
ZL 39 HOH 2241 5241 3592 HOH HOH 0 . 
ZL 39 HOH 2242 5242 3593 HOH HOH 0 . 
ZL 39 HOH 2243 5243 3594 HOH HOH 0 . 
ZL 39 HOH 2244 5244 3596 HOH HOH 0 . 
ZL 39 HOH 2245 5245 3598 HOH HOH 0 . 
ZL 39 HOH 2246 5246 3599 HOH HOH 0 . 
ZL 39 HOH 2247 5247 3605 HOH HOH 0 . 
ZL 39 HOH 2248 5248 3606 HOH HOH 0 . 
ZL 39 HOH 2249 5249 3607 HOH HOH 0 . 
ZL 39 HOH 2250 5250 3608 HOH HOH 0 . 
ZL 39 HOH 2251 5251 3609 HOH HOH 0 . 
ZL 39 HOH 2252 5252 3610 HOH HOH 0 . 
ZL 39 HOH 2253 5253 3611 HOH HOH 0 . 
ZL 39 HOH 2254 5254 3612 HOH HOH 0 . 
ZL 39 HOH 2255 5255 3613 HOH HOH 0 . 
ZL 39 HOH 2256 5256 3616 HOH HOH 0 . 
ZL 39 HOH 2257 5257 3617 HOH HOH 0 . 
ZL 39 HOH 2258 5258 3618 HOH HOH 0 . 
ZL 39 HOH 2259 5259 3619 HOH HOH 0 . 
ZL 39 HOH 2260 5260 3620 HOH HOH 0 . 
ZL 39 HOH 2261 5261 3621 HOH HOH 0 . 
ZL 39 HOH 2262 5262 3622 HOH HOH 0 . 
ZL 39 HOH 2263 5263 3623 HOH HOH 0 . 
ZL 39 HOH 2264 5264 3624 HOH HOH 0 . 
ZL 39 HOH 2265 5265 3625 HOH HOH 0 . 
ZL 39 HOH 2266 5266 3626 HOH HOH 0 . 
ZL 39 HOH 2267 5267 3628 HOH HOH 0 . 
ZL 39 HOH 2268 5268 3629 HOH HOH 0 . 
ZL 39 HOH 2269 5269 3630 HOH HOH 0 . 
ZL 39 HOH 2270 5270 3631 HOH HOH 0 . 
ZL 39 HOH 2271 5271 3632 HOH HOH 0 . 
ZL 39 HOH 2272 5272 3633 HOH HOH 0 . 
ZL 39 HOH 2273 5273 3634 HOH HOH 0 . 
ZL 39 HOH 2274 5274 3635 HOH HOH 0 . 
ZL 39 HOH 2275 5275 3636 HOH HOH 0 . 
ZL 39 HOH 2276 5276 3637 HOH HOH 0 . 
ZL 39 HOH 2277 5277 3638 HOH HOH 0 . 
ZL 39 HOH 2278 5278 3639 HOH HOH 0 . 
ZL 39 HOH 2279 5279 3640 HOH HOH 0 . 
ZL 39 HOH 2280 5280 3641 HOH HOH 0 . 
ZL 39 HOH 2281 5281 3642 HOH HOH 0 . 
ZL 39 HOH 2282 5282 3643 HOH HOH 0 . 
ZL 39 HOH 2283 5283 3644 HOH HOH 0 . 
ZL 39 HOH 2284 5284 3645 HOH HOH 0 . 
ZL 39 HOH 2285 5285 3646 HOH HOH 0 . 
ZL 39 HOH 2286 5286 3647 HOH HOH 0 . 
ZL 39 HOH 2287 5287 3648 HOH HOH 0 . 
ZL 39 HOH 2288 5288 3650 HOH HOH 0 . 
ZL 39 HOH 2289 5289 3651 HOH HOH 0 . 
ZL 39 HOH 2290 5290 3652 HOH HOH 0 . 
ZL 39 HOH 2291 5291 3653 HOH HOH 0 . 
ZL 39 HOH 2292 5292 3654 HOH HOH 0 . 
ZL 39 HOH 2293 5293 3656 HOH HOH 0 . 
ZL 39 HOH 2294 5294 3657 HOH HOH 0 . 
ZL 39 HOH 2295 5295 3658 HOH HOH 0 . 
ZL 39 HOH 2296 5296 3659 HOH HOH 0 . 
ZL 39 HOH 2297 5297 3660 HOH HOH 0 . 
ZL 39 HOH 2298 5298 3661 HOH HOH 0 . 
ZL 39 HOH 2299 5299 3663 HOH HOH 0 . 
ZL 39 HOH 2300 5300 3664 HOH HOH 0 . 
ZL 39 HOH 2301 5301 3667 HOH HOH 0 . 
ZL 39 HOH 2302 5302 3668 HOH HOH 0 . 
ZL 39 HOH 2303 5303 3669 HOH HOH 0 . 
ZL 39 HOH 2304 5304 3670 HOH HOH 0 . 
ZL 39 HOH 2305 5305 3672 HOH HOH 0 . 
ZL 39 HOH 2306 5306 3673 HOH HOH 0 . 
ZL 39 HOH 2307 5307 3674 HOH HOH 0 . 
ZL 39 HOH 2308 5308 3675 HOH HOH 0 . 
ZL 39 HOH 2309 5309 3676 HOH HOH 0 . 
ZL 39 HOH 2310 5310 3677 HOH HOH 0 . 
ZL 39 HOH 2311 5311 3678 HOH HOH 0 . 
ZL 39 HOH 2312 5312 3679 HOH HOH 0 . 
ZL 39 HOH 2313 5313 3680 HOH HOH 0 . 
ZL 39 HOH 2314 5314 3681 HOH HOH 0 . 
ZL 39 HOH 2315 5315 3682 HOH HOH 0 . 
ZL 39 HOH 2316 5316 3683 HOH HOH 0 . 
ZL 39 HOH 2317 5317 3684 HOH HOH 0 . 
ZL 39 HOH 2318 5318 3685 HOH HOH 0 . 
ZL 39 HOH 2319 5319 3687 HOH HOH 0 . 
ZL 39 HOH 2320 5320 3688 HOH HOH 0 . 
ZL 39 HOH 2321 5321 3689 HOH HOH 0 . 
ZL 39 HOH 2322 5322 3691 HOH HOH 0 . 
ZL 39 HOH 2323 5323 3692 HOH HOH 0 . 
ZL 39 HOH 2324 5324 3695 HOH HOH 0 . 
ZL 39 HOH 2325 5325 3697 HOH HOH 0 . 
ZL 39 HOH 2326 5326 3699 HOH HOH 0 . 
ZL 39 HOH 2327 5327 3701 HOH HOH 0 . 
ZL 39 HOH 2328 5328 3702 HOH HOH 0 . 
ZL 39 HOH 2329 5329 3703 HOH HOH 0 . 
ZL 39 HOH 2330 5330 3704 HOH HOH 0 . 
ZL 39 HOH 2331 5331 3706 HOH HOH 0 . 
ZL 39 HOH 2332 5332 3708 HOH HOH 0 . 
ZL 39 HOH 2333 5333 3710 HOH HOH 0 . 
ZL 39 HOH 2334 5334 3712 HOH HOH 0 . 
ZL 39 HOH 2335 5335 3715 HOH HOH 0 . 
ZL 39 HOH 2336 5336 3717 HOH HOH 0 . 
ZL 39 HOH 2337 5337 3718 HOH HOH 0 . 
ZL 39 HOH 2338 5338 3721 HOH HOH 0 . 
ZL 39 HOH 2339 5339 3724 HOH HOH 0 . 
ZL 39 HOH 2340 5340 3725 HOH HOH 0 . 
ZL 39 HOH 2341 5341 3727 HOH HOH 0 . 
ZL 39 HOH 2342 5342 3728 HOH HOH 0 . 
ZL 39 HOH 2343 5343 3729 HOH HOH 0 . 
ZL 39 HOH 2344 5344 3730 HOH HOH 0 . 
ZL 39 HOH 2345 5345 3731 HOH HOH 0 . 
ZL 39 HOH 2346 5346 3732 HOH HOH 0 . 
ZL 39 HOH 2347 5347 3733 HOH HOH 0 . 
ZL 39 HOH 2348 5348 3735 HOH HOH 0 . 
ZL 39 HOH 2349 5349 3736 HOH HOH 0 . 
ZL 39 HOH 2350 5350 3738 HOH HOH 0 . 
ZL 39 HOH 2351 5351 3740 HOH HOH 0 . 
ZL 39 HOH 2352 5352 3742 HOH HOH 0 . 
ZL 39 HOH 2353 5353 3743 HOH HOH 0 . 
ZL 39 HOH 2354 5354 3744 HOH HOH 0 . 
ZL 39 HOH 2355 5355 3745 HOH HOH 0 . 
ZL 39 HOH 2356 5356 3746 HOH HOH 0 . 
ZL 39 HOH 2357 5357 3747 HOH HOH 0 . 
ZL 39 HOH 2358 5358 3749 HOH HOH 0 . 
ZL 39 HOH 2359 5359 3751 HOH HOH 0 . 
ZL 39 HOH 2360 5360 3752 HOH HOH 0 . 
ZL 39 HOH 2361 5361 3753 HOH HOH 0 . 
ZL 39 HOH 2362 5362 3754 HOH HOH 0 . 
ZL 39 HOH 2363 5363 3755 HOH HOH 0 . 
ZL 39 HOH 2364 5364 3756 HOH HOH 0 . 
ZL 39 HOH 2365 5365 3757 HOH HOH 0 . 
ZL 39 HOH 2366 5366 3758 HOH HOH 0 . 
ZL 39 HOH 2367 5367 3759 HOH HOH 0 . 
ZL 39 HOH 2368 5368 3761 HOH HOH 0 . 
ZL 39 HOH 2369 5369 3763 HOH HOH 0 . 
ZL 39 HOH 2370 5370 3764 HOH HOH 0 . 
ZL 39 HOH 2371 5371 3767 HOH HOH 0 . 
ZL 39 HOH 2372 5372 3768 HOH HOH 0 . 
ZL 39 HOH 2373 5373 3769 HOH HOH 0 . 
ZL 39 HOH 2374 5374 3770 HOH HOH 0 . 
ZL 39 HOH 2375 5375 3771 HOH HOH 0 . 
ZL 39 HOH 2376 5376 3773 HOH HOH 0 . 
ZL 39 HOH 2377 5377 3774 HOH HOH 0 . 
ZL 39 HOH 2378 5378 3775 HOH HOH 0 . 
ZL 39 HOH 2379 5379 3776 HOH HOH 0 . 
ZL 39 HOH 2380 5380 3777 HOH HOH 0 . 
ZL 39 HOH 2381 5381 3778 HOH HOH 0 . 
ZL 39 HOH 2382 5382 3780 HOH HOH 0 . 
ZL 39 HOH 2383 5383 3781 HOH HOH 0 . 
ZL 39 HOH 2384 5384 3783 HOH HOH 0 . 
ZL 39 HOH 2385 5385 3786 HOH HOH 0 . 
ZL 39 HOH 2386 5386 3787 HOH HOH 0 . 
ZL 39 HOH 2387 5387 3788 HOH HOH 0 . 
ZL 39 HOH 2388 5388 3791 HOH HOH 0 . 
ZL 39 HOH 2389 5389 3792 HOH HOH 0 . 
ZL 39 HOH 2390 5390 3794 HOH HOH 0 . 
ZL 39 HOH 2391 5391 3796 HOH HOH 0 . 
ZL 39 HOH 2392 5392 3798 HOH HOH 0 . 
ZL 39 HOH 2393 5393 3799 HOH HOH 0 . 
ZL 39 HOH 2394 5394 3800 HOH HOH 0 . 
ZL 39 HOH 2395 5395 3801 HOH HOH 0 . 
ZL 39 HOH 2396 5396 3802 HOH HOH 0 . 
ZL 39 HOH 2397 5397 3803 HOH HOH 0 . 
ZL 39 HOH 2398 5398 3804 HOH HOH 0 . 
ZL 39 HOH 2399 5399 3808 HOH HOH 0 . 
ZL 39 HOH 2400 5400 3809 HOH HOH 0 . 
ZL 39 HOH 2401 5401 3811 HOH HOH 0 . 
ZL 39 HOH 2402 5402 3812 HOH HOH 0 . 
ZL 39 HOH 2403 5403 3813 HOH HOH 0 . 
ZL 39 HOH 2404 5404 3814 HOH HOH 0 . 
ZL 39 HOH 2405 5405 3815 HOH HOH 0 . 
ZL 39 HOH 2406 5406 3816 HOH HOH 0 . 
ZL 39 HOH 2407 5407 3817 HOH HOH 0 . 
ZL 39 HOH 2408 5408 3819 HOH HOH 0 . 
ZL 39 HOH 2409 5409 3821 HOH HOH 0 . 
ZL 39 HOH 2410 5410 3822 HOH HOH 0 . 
ZL 39 HOH 2411 5411 3823 HOH HOH 0 . 
ZL 39 HOH 2412 5412 3825 HOH HOH 0 . 
ZL 39 HOH 2413 5413 3826 HOH HOH 0 . 
ZL 39 HOH 2414 5414 3828 HOH HOH 0 . 
ZL 39 HOH 2415 5415 3829 HOH HOH 0 . 
ZL 39 HOH 2416 5416 3830 HOH HOH 0 . 
ZL 39 HOH 2417 5417 3831 HOH HOH 0 . 
ZL 39 HOH 2418 5418 3832 HOH HOH 0 . 
ZL 39 HOH 2419 5419 3834 HOH HOH 0 . 
ZL 39 HOH 2420 5420 3835 HOH HOH 0 . 
ZL 39 HOH 2421 5421 3836 HOH HOH 0 . 
ZL 39 HOH 2422 5422 3837 HOH HOH 0 . 
ZL 39 HOH 2423 5423 3838 HOH HOH 0 . 
ZL 39 HOH 2424 5424 3840 HOH HOH 0 . 
ZL 39 HOH 2425 5425 3841 HOH HOH 0 . 
ZL 39 HOH 2426 5426 3842 HOH HOH 0 . 
ZL 39 HOH 2427 5427 3844 HOH HOH 0 . 
ZL 39 HOH 2428 5428 3845 HOH HOH 0 . 
ZL 39 HOH 2429 5429 3846 HOH HOH 0 . 
ZL 39 HOH 2430 5430 3847 HOH HOH 0 . 
ZL 39 HOH 2431 5431 3848 HOH HOH 0 . 
ZL 39 HOH 2432 5432 3849 HOH HOH 0 . 
ZL 39 HOH 2433 5433 3850 HOH HOH 0 . 
ZL 39 HOH 2434 5434 3852 HOH HOH 0 . 
ZL 39 HOH 2435 5435 3853 HOH HOH 0 . 
ZL 39 HOH 2436 5436 3854 HOH HOH 0 . 
ZL 39 HOH 2437 5437 3856 HOH HOH 0 . 
ZL 39 HOH 2438 5438 3857 HOH HOH 0 . 
ZL 39 HOH 2439 5439 3858 HOH HOH 0 . 
ZL 39 HOH 2440 5440 3860 HOH HOH 0 . 
ZL 39 HOH 2441 5441 3864 HOH HOH 0 . 
ZL 39 HOH 2442 5442 3865 HOH HOH 0 . 
ZL 39 HOH 2443 5443 3867 HOH HOH 0 . 
ZL 39 HOH 2444 5444 3868 HOH HOH 0 . 
ZL 39 HOH 2445 5445 3869 HOH HOH 0 . 
ZL 39 HOH 2446 5446 3871 HOH HOH 0 . 
ZL 39 HOH 2447 5447 3872 HOH HOH 0 . 
ZL 39 HOH 2448 5448 3873 HOH HOH 0 . 
ZL 39 HOH 2449 5449 3874 HOH HOH 0 . 
ZL 39 HOH 2450 5450 3875 HOH HOH 0 . 
ZL 39 HOH 2451 5451 3876 HOH HOH 0 . 
ZL 39 HOH 2452 5452 3877 HOH HOH 0 . 
ZL 39 HOH 2453 5453 3879 HOH HOH 0 . 
ZL 39 HOH 2454 5454 3880 HOH HOH 0 . 
ZL 39 HOH 2455 5455 3882 HOH HOH 0 . 
ZL 39 HOH 2456 5456 3883 HOH HOH 0 . 
ZL 39 HOH 2457 5457 3884 HOH HOH 0 . 
ZL 39 HOH 2458 5458 3885 HOH HOH 0 . 
ZL 39 HOH 2459 5459 3886 HOH HOH 0 . 
ZL 39 HOH 2460 5460 3888 HOH HOH 0 . 
ZL 39 HOH 2461 5461 3889 HOH HOH 0 . 
ZL 39 HOH 2462 5462 3893 HOH HOH 0 . 
ZL 39 HOH 2463 5463 3895 HOH HOH 0 . 
ZL 39 HOH 2464 5464 3897 HOH HOH 0 . 
ZL 39 HOH 2465 5465 3898 HOH HOH 0 . 
ZL 39 HOH 2466 5466 3901 HOH HOH 0 . 
ZL 39 HOH 2467 5467 3902 HOH HOH 0 . 
ZL 39 HOH 2468 5468 3904 HOH HOH 0 . 
ZL 39 HOH 2469 5469 3906 HOH HOH 0 . 
ZL 39 HOH 2470 5470 3907 HOH HOH 0 . 
ZL 39 HOH 2471 5471 3908 HOH HOH 0 . 
ZL 39 HOH 2472 5472 3910 HOH HOH 0 . 
ZL 39 HOH 2473 5473 3912 HOH HOH 0 . 
ZL 39 HOH 2474 5474 3913 HOH HOH 0 . 
ZL 39 HOH 2475 5475 3914 HOH HOH 0 . 
ZL 39 HOH 2476 5476 3915 HOH HOH 0 . 
ZL 39 HOH 2477 5477 3916 HOH HOH 0 . 
ZL 39 HOH 2478 5478 3918 HOH HOH 0 . 
ZL 39 HOH 2479 5479 3921 HOH HOH 0 . 
ZL 39 HOH 2480 5480 3922 HOH HOH 0 . 
ZL 39 HOH 2481 5481 3926 HOH HOH 0 . 
ZL 39 HOH 2482 5482 3927 HOH HOH 0 . 
ZL 39 HOH 2483 5483 3930 HOH HOH 0 . 
ZL 39 HOH 2484 5484 3931 HOH HOH 0 . 
ZL 39 HOH 2485 5485 3932 HOH HOH 0 . 
ZL 39 HOH 2486 5486 3933 HOH HOH 0 . 
ZL 39 HOH 2487 5487 3934 HOH HOH 0 . 
ZL 39 HOH 2488 5488 3935 HOH HOH 0 . 
ZL 39 HOH 2489 5489 3936 HOH HOH 0 . 
ZL 39 HOH 2490 5490 3937 HOH HOH 0 . 
ZL 39 HOH 2491 5491 3938 HOH HOH 0 . 
ZL 39 HOH 2492 5492 3941 HOH HOH 0 . 
ZL 39 HOH 2493 5493 3942 HOH HOH 0 . 
ZL 39 HOH 2494 5494 3943 HOH HOH 0 . 
ZL 39 HOH 2495 5495 3945 HOH HOH 0 . 
ZL 39 HOH 2496 5496 3946 HOH HOH 0 . 
ZL 39 HOH 2497 5497 3950 HOH HOH 0 . 
ZL 39 HOH 2498 5498 3951 HOH HOH 0 . 
ZL 39 HOH 2499 5499 3952 HOH HOH 0 . 
ZL 39 HOH 2500 5500 3953 HOH HOH 0 . 
ZL 39 HOH 2501 5501 3954 HOH HOH 0 . 
ZL 39 HOH 2502 5502 3956 HOH HOH 0 . 
ZL 39 HOH 2503 5503 3957 HOH HOH 0 . 
ZL 39 HOH 2504 5504 3958 HOH HOH 0 . 
ZL 39 HOH 2505 5505 3959 HOH HOH 0 . 
ZL 39 HOH 2506 5506 3960 HOH HOH 0 . 
ZL 39 HOH 2507 5507 3961 HOH HOH 0 . 
ZL 39 HOH 2508 5508 3962 HOH HOH 0 . 
ZL 39 HOH 2509 5509 3963 HOH HOH 0 . 
ZL 39 HOH 2510 5510 3964 HOH HOH 0 . 
ZL 39 HOH 2511 5511 3965 HOH HOH 0 . 
ZL 39 HOH 2512 5512 3966 HOH HOH 0 . 
ZL 39 HOH 2513 5513 3967 HOH HOH 0 . 
ZL 39 HOH 2514 5514 3968 HOH HOH 0 . 
ZL 39 HOH 2515 5515 3972 HOH HOH 0 . 
ZL 39 HOH 2516 5516 3974 HOH HOH 0 . 
ZL 39 HOH 2517 5517 3975 HOH HOH 0 . 
ZL 39 HOH 2518 5518 3976 HOH HOH 0 . 
ZL 39 HOH 2519 5519 3977 HOH HOH 0 . 
ZL 39 HOH 2520 5520 3979 HOH HOH 0 . 
ZL 39 HOH 2521 5521 3980 HOH HOH 0 . 
ZL 39 HOH 2522 5522 3981 HOH HOH 0 . 
ZL 39 HOH 2523 5523 3982 HOH HOH 0 . 
ZL 39 HOH 2524 5524 3983 HOH HOH 0 . 
ZL 39 HOH 2525 5525 3984 HOH HOH 0 . 
ZL 39 HOH 2526 5526 3985 HOH HOH 0 . 
ZL 39 HOH 2527 5527 3986 HOH HOH 0 . 
ZL 39 HOH 2528 5528 3987 HOH HOH 0 . 
ZL 39 HOH 2529 5529 3988 HOH HOH 0 . 
ZL 39 HOH 2530 5530 3989 HOH HOH 0 . 
ZL 39 HOH 2531 5531 3990 HOH HOH 0 . 
ZL 39 HOH 2532 5532 3992 HOH HOH 0 . 
ZL 39 HOH 2533 5533 3993 HOH HOH 0 . 
ZL 39 HOH 2534 5534 3994 HOH HOH 0 . 
ZL 39 HOH 2535 5535 3995 HOH HOH 0 . 
ZL 39 HOH 2536 5536 3997 HOH HOH 0 . 
ZL 39 HOH 2537 5537 3998 HOH HOH 0 . 
ZL 39 HOH 2538 5538 4000 HOH HOH 0 . 
ZL 39 HOH 2539 5539 4001 HOH HOH 0 . 
ZL 39 HOH 2540 5540 4002 HOH HOH 0 . 
ZL 39 HOH 2541 5541 4004 HOH HOH 0 . 
ZL 39 HOH 2542 5542 4005 HOH HOH 0 . 
ZL 39 HOH 2543 5543 4007 HOH HOH 0 . 
ZL 39 HOH 2544 5544 4008 HOH HOH 0 . 
ZL 39 HOH 2545 5545 4010 HOH HOH 0 . 
ZL 39 HOH 2546 5546 4012 HOH HOH 0 . 
ZL 39 HOH 2547 5547 4013 HOH HOH 0 . 
ZL 39 HOH 2548 5548 4014 HOH HOH 0 . 
ZL 39 HOH 2549 5549 4015 HOH HOH 0 . 
ZL 39 HOH 2550 5550 4017 HOH HOH 0 . 
ZL 39 HOH 2551 5551 4018 HOH HOH 0 . 
ZL 39 HOH 2552 5552 4019 HOH HOH 0 . 
ZL 39 HOH 2553 5553 4020 HOH HOH 0 . 
ZL 39 HOH 2554 5554 4021 HOH HOH 0 . 
ZL 39 HOH 2555 5555 4022 HOH HOH 0 . 
ZL 39 HOH 2556 5556 4024 HOH HOH 0 . 
ZL 39 HOH 2557 5557 4025 HOH HOH 0 . 
ZL 39 HOH 2558 5558 4027 HOH HOH 0 . 
ZL 39 HOH 2559 5559 4029 HOH HOH 0 . 
ZL 39 HOH 2560 5560 4030 HOH HOH 0 . 
ZL 39 HOH 2561 5561 4032 HOH HOH 0 . 
ZL 39 HOH 2562 5562 4035 HOH HOH 0 . 
ZL 39 HOH 2563 5563 4036 HOH HOH 0 . 
ZL 39 HOH 2564 5564 4037 HOH HOH 0 . 
ZL 39 HOH 2565 5565 4040 HOH HOH 0 . 
ZL 39 HOH 2566 5566 4042 HOH HOH 0 . 
ZL 39 HOH 2567 5567 4044 HOH HOH 0 . 
ZL 39 HOH 2568 5568 4045 HOH HOH 0 . 
ZL 39 HOH 2569 5569 4046 HOH HOH 0 . 
ZL 39 HOH 2570 5570 4047 HOH HOH 0 . 
ZL 39 HOH 2571 5571 4048 HOH HOH 0 . 
ZL 39 HOH 2572 5572 4050 HOH HOH 0 . 
ZL 39 HOH 2573 5573 4051 HOH HOH 0 . 
ZL 39 HOH 2574 5574 4054 HOH HOH 0 . 
ZL 39 HOH 2575 5575 4055 HOH HOH 0 . 
ZL 39 HOH 2576 5576 4058 HOH HOH 0 . 
ZL 39 HOH 2577 5577 4059 HOH HOH 0 . 
ZL 39 HOH 2578 5578 4060 HOH HOH 0 . 
ZL 39 HOH 2579 5579 4061 HOH HOH 0 . 
ZL 39 HOH 2580 5580 4062 HOH HOH 0 . 
ZL 39 HOH 2581 5581 4063 HOH HOH 0 . 
ZL 39 HOH 2582 5582 4065 HOH HOH 0 . 
ZL 39 HOH 2583 5583 4068 HOH HOH 0 . 
ZL 39 HOH 2584 5584 4070 HOH HOH 0 . 
ZL 39 HOH 2585 5585 4071 HOH HOH 0 . 
ZL 39 HOH 2586 5586 4072 HOH HOH 0 . 
ZL 39 HOH 2587 5587 4073 HOH HOH 0 . 
ZL 39 HOH 2588 5588 4075 HOH HOH 0 . 
ZL 39 HOH 2589 5589 4076 HOH HOH 0 . 
ZL 39 HOH 2590 5590 4079 HOH HOH 0 . 
ZL 39 HOH 2591 5591 4081 HOH HOH 0 . 
ZL 39 HOH 2592 5592 4082 HOH HOH 0 . 
ZL 39 HOH 2593 5593 4083 HOH HOH 0 . 
ZL 39 HOH 2594 5594 4084 HOH HOH 0 . 
ZL 39 HOH 2595 5595 4085 HOH HOH 0 . 
ZL 39 HOH 2596 5596 4086 HOH HOH 0 . 
ZL 39 HOH 2597 5597 4087 HOH HOH 0 . 
ZL 39 HOH 2598 5598 4088 HOH HOH 0 . 
ZL 39 HOH 2599 5599 4089 HOH HOH 0 . 
ZL 39 HOH 2600 5600 4090 HOH HOH 0 . 
ZL 39 HOH 2601 5601 4091 HOH HOH 0 . 
ZL 39 HOH 2602 5602 4092 HOH HOH 0 . 
ZL 39 HOH 2603 5603 4093 HOH HOH 0 . 
ZL 39 HOH 2604 5604 4094 HOH HOH 0 . 
ZL 39 HOH 2605 5605 4095 HOH HOH 0 . 
ZL 39 HOH 2606 5606 4096 HOH HOH 0 . 
ZL 39 HOH 2607 5607 4099 HOH HOH 0 . 
ZL 39 HOH 2608 5608 4100 HOH HOH 0 . 
ZL 39 HOH 2609 5609 4101 HOH HOH 0 . 
ZL 39 HOH 2610 5610 4102 HOH HOH 0 . 
ZL 39 HOH 2611 5611 4103 HOH HOH 0 . 
ZL 39 HOH 2612 5612 4104 HOH HOH 0 . 
ZL 39 HOH 2613 5613 4105 HOH HOH 0 . 
ZL 39 HOH 2614 5614 4106 HOH HOH 0 . 
ZL 39 HOH 2615 5615 4107 HOH HOH 0 . 
ZL 39 HOH 2616 5616 4110 HOH HOH 0 . 
ZL 39 HOH 2617 5617 4111 HOH HOH 0 . 
ZL 39 HOH 2618 5618 4112 HOH HOH 0 . 
ZL 39 HOH 2619 5619 4113 HOH HOH 0 . 
ZL 39 HOH 2620 5620 4114 HOH HOH 0 . 
ZL 39 HOH 2621 5621 4115 HOH HOH 0 . 
ZL 39 HOH 2622 5622 4116 HOH HOH 0 . 
ZL 39 HOH 2623 5623 4118 HOH HOH 0 . 
ZL 39 HOH 2624 5624 4119 HOH HOH 0 . 
ZL 39 HOH 2625 5625 4120 HOH HOH 0 . 
ZL 39 HOH 2626 5626 4122 HOH HOH 0 . 
ZL 39 HOH 2627 5627 4123 HOH HOH 0 . 
ZL 39 HOH 2628 5628 4124 HOH HOH 0 . 
ZL 39 HOH 2629 5629 4125 HOH HOH 0 . 
ZL 39 HOH 2630 5630 4126 HOH HOH 0 . 
ZL 39 HOH 2631 5631 4127 HOH HOH 0 . 
ZL 39 HOH 2632 5632 4129 HOH HOH 0 . 
ZL 39 HOH 2633 5633 4130 HOH HOH 0 . 
ZL 39 HOH 2634 5634 4131 HOH HOH 0 . 
ZL 39 HOH 2635 5635 4133 HOH HOH 0 . 
ZL 39 HOH 2636 5636 4134 HOH HOH 0 . 
ZL 39 HOH 2637 5637 4137 HOH HOH 0 . 
ZL 39 HOH 2638 5638 4138 HOH HOH 0 . 
ZL 39 HOH 2639 5639 4139 HOH HOH 0 . 
ZL 39 HOH 2640 5640 4141 HOH HOH 0 . 
ZL 39 HOH 2641 5641 4142 HOH HOH 0 . 
ZL 39 HOH 2642 5642 4143 HOH HOH 0 . 
ZL 39 HOH 2643 5643 4146 HOH HOH 0 . 
ZL 39 HOH 2644 5644 4147 HOH HOH 0 . 
ZL 39 HOH 2645 5645 4148 HOH HOH 0 . 
ZL 39 HOH 2646 5646 4149 HOH HOH 0 . 
ZL 39 HOH 2647 5647 4150 HOH HOH 0 . 
ZL 39 HOH 2648 5648 4151 HOH HOH 0 . 
ZL 39 HOH 2649 5649 4153 HOH HOH 0 . 
ZL 39 HOH 2650 5650 4155 HOH HOH 0 . 
ZL 39 HOH 2651 5651 4156 HOH HOH 0 . 
ZL 39 HOH 2652 5652 4157 HOH HOH 0 . 
ZL 39 HOH 2653 5653 4158 HOH HOH 0 . 
ZL 39 HOH 2654 5654 4159 HOH HOH 0 . 
ZL 39 HOH 2655 5655 4160 HOH HOH 0 . 
ZL 39 HOH 2656 5656 4161 HOH HOH 0 . 
ZL 39 HOH 2657 5657 4162 HOH HOH 0 . 
ZL 39 HOH 2658 5658 4164 HOH HOH 0 . 
ZL 39 HOH 2659 5659 4165 HOH HOH 0 . 
ZL 39 HOH 2660 5660 4166 HOH HOH 0 . 
ZL 39 HOH 2661 5661 4167 HOH HOH 0 . 
ZL 39 HOH 2662 5662 4168 HOH HOH 0 . 
ZL 39 HOH 2663 5663 4169 HOH HOH 0 . 
ZL 39 HOH 2664 5664 4170 HOH HOH 0 . 
ZL 39 HOH 2665 5665 4174 HOH HOH 0 . 
ZL 39 HOH 2666 5666 4175 HOH HOH 0 . 
ZL 39 HOH 2667 5667 4176 HOH HOH 0 . 
ZL 39 HOH 2668 5668 4177 HOH HOH 0 . 
ZL 39 HOH 2669 5669 4178 HOH HOH 0 . 
ZL 39 HOH 2670 5670 4179 HOH HOH 0 . 
ZL 39 HOH 2671 5671 4180 HOH HOH 0 . 
ZL 39 HOH 2672 5672 4181 HOH HOH 0 . 
ZL 39 HOH 2673 5673 4182 HOH HOH 0 . 
ZL 39 HOH 2674 5674 4184 HOH HOH 0 . 
ZL 39 HOH 2675 5675 4185 HOH HOH 0 . 
ZL 39 HOH 2676 5676 4186 HOH HOH 0 . 
ZL 39 HOH 2677 5677 4187 HOH HOH 0 . 
ZL 39 HOH 2678 5678 4188 HOH HOH 0 . 
ZL 39 HOH 2679 5679 4190 HOH HOH 0 . 
ZL 39 HOH 2680 5680 4192 HOH HOH 0 . 
ZL 39 HOH 2681 5681 4194 HOH HOH 0 . 
ZL 39 HOH 2682 5682 4197 HOH HOH 0 . 
ZL 39 HOH 2683 5683 4198 HOH HOH 0 . 
ZL 39 HOH 2684 5684 4201 HOH HOH 0 . 
ZL 39 HOH 2685 5685 4205 HOH HOH 0 . 
ZL 39 HOH 2686 5686 4206 HOH HOH 0 . 
ZL 39 HOH 2687 5687 4207 HOH HOH 0 . 
ZL 39 HOH 2688 5688 4209 HOH HOH 0 . 
ZL 39 HOH 2689 5689 4210 HOH HOH 0 . 
ZL 39 HOH 2690 5690 4212 HOH HOH 0 . 
ZL 39 HOH 2691 5691 4213 HOH HOH 0 . 
ZL 39 HOH 2692 5692 4214 HOH HOH 0 . 
ZL 39 HOH 2693 5693 4215 HOH HOH 0 . 
ZL 39 HOH 2694 5694 4216 HOH HOH 0 . 
ZL 39 HOH 2695 5695 4217 HOH HOH 0 . 
ZL 39 HOH 2696 5696 4218 HOH HOH 0 . 
ZL 39 HOH 2697 5697 4220 HOH HOH 0 . 
ZL 39 HOH 2698 5698 4221 HOH HOH 0 . 
ZL 39 HOH 2699 5699 4222 HOH HOH 0 . 
ZL 39 HOH 2700 5700 4224 HOH HOH 0 . 
ZL 39 HOH 2701 5701 4225 HOH HOH 0 . 
ZL 39 HOH 2702 5702 4226 HOH HOH 0 . 
ZL 39 HOH 2703 5703 4227 HOH HOH 0 . 
ZL 39 HOH 2704 5704 4228 HOH HOH 0 . 
ZL 39 HOH 2705 5705 4229 HOH HOH 0 . 
ZL 39 HOH 2706 5706 4230 HOH HOH 0 . 
ZL 39 HOH 2707 5707 4231 HOH HOH 0 . 
ZL 39 HOH 2708 5708 4232 HOH HOH 0 . 
ZL 39 HOH 2709 5709 4234 HOH HOH 0 . 
ZL 39 HOH 2710 5710 4235 HOH HOH 0 . 
ZL 39 HOH 2711 5711 4236 HOH HOH 0 . 
ZL 39 HOH 2712 5712 4238 HOH HOH 0 . 
ZL 39 HOH 2713 5713 4239 HOH HOH 0 . 
ZL 39 HOH 2714 5714 4240 HOH HOH 0 . 
ZL 39 HOH 2715 5715 4241 HOH HOH 0 . 
ZL 39 HOH 2716 5716 4244 HOH HOH 0 . 
ZL 39 HOH 2717 5717 4246 HOH HOH 0 . 
ZL 39 HOH 2718 5718 4247 HOH HOH 0 . 
ZL 39 HOH 2719 5719 4248 HOH HOH 0 . 
ZL 39 HOH 2720 5720 4251 HOH HOH 0 . 
ZL 39 HOH 2721 5721 4252 HOH HOH 0 . 
ZL 39 HOH 2722 5722 4253 HOH HOH 0 . 
ZL 39 HOH 2723 5723 4254 HOH HOH 0 . 
ZL 39 HOH 2724 5724 4255 HOH HOH 0 . 
ZL 39 HOH 2725 5725 4256 HOH HOH 0 . 
ZL 39 HOH 2726 5726 4259 HOH HOH 0 . 
ZL 39 HOH 2727 5727 4260 HOH HOH 0 . 
ZL 39 HOH 2728 5728 4262 HOH HOH 0 . 
ZL 39 HOH 2729 5729 4263 HOH HOH 0 . 
ZL 39 HOH 2730 5730 4264 HOH HOH 0 . 
ZL 39 HOH 2731 5731 4266 HOH HOH 0 . 
ZL 39 HOH 2732 5732 4267 HOH HOH 0 . 
ZL 39 HOH 2733 5733 4268 HOH HOH 0 . 
ZL 39 HOH 2734 5734 4269 HOH HOH 0 . 
ZL 39 HOH 2735 5735 4270 HOH HOH 0 . 
ZL 39 HOH 2736 5736 4271 HOH HOH 0 . 
ZL 39 HOH 2737 5737 4272 HOH HOH 0 . 
ZL 39 HOH 2738 5738 4274 HOH HOH 0 . 
ZL 39 HOH 2739 5739 4275 HOH HOH 0 . 
ZL 39 HOH 2740 5740 4276 HOH HOH 0 . 
ZL 39 HOH 2741 5741 4277 HOH HOH 0 . 
ZL 39 HOH 2742 5742 4278 HOH HOH 0 . 
ZL 39 HOH 2743 5743 4279 HOH HOH 0 . 
ZL 39 HOH 2744 5744 4281 HOH HOH 0 . 
ZL 39 HOH 2745 5745 4282 HOH HOH 0 . 
ZL 39 HOH 2746 5746 4283 HOH HOH 0 . 
ZL 39 HOH 2747 5747 4284 HOH HOH 0 . 
ZL 39 HOH 2748 5748 4285 HOH HOH 0 . 
ZL 39 HOH 2749 5749 4287 HOH HOH 0 . 
ZL 39 HOH 2750 5750 4289 HOH HOH 0 . 
ZL 39 HOH 2751 5751 4290 HOH HOH 0 . 
ZL 39 HOH 2752 5752 4291 HOH HOH 0 . 
ZL 39 HOH 2753 5753 4292 HOH HOH 0 . 
ZL 39 HOH 2754 5754 4293 HOH HOH 0 . 
ZL 39 HOH 2755 5755 4295 HOH HOH 0 . 
ZL 39 HOH 2756 5756 4296 HOH HOH 0 . 
ZL 39 HOH 2757 5757 4298 HOH HOH 0 . 
ZL 39 HOH 2758 5758 4300 HOH HOH 0 . 
ZL 39 HOH 2759 5759 4302 HOH HOH 0 . 
ZL 39 HOH 2760 5760 4303 HOH HOH 0 . 
ZL 39 HOH 2761 5761 4305 HOH HOH 0 . 
ZL 39 HOH 2762 5762 4306 HOH HOH 0 . 
ZL 39 HOH 2763 5763 4307 HOH HOH 0 . 
ZL 39 HOH 2764 5764 4308 HOH HOH 0 . 
ZL 39 HOH 2765 5765 4309 HOH HOH 0 . 
ZL 39 HOH 2766 5766 4310 HOH HOH 0 . 
ZL 39 HOH 2767 5767 4313 HOH HOH 0 . 
ZL 39 HOH 2768 5768 4314 HOH HOH 0 . 
ZL 39 HOH 2769 5769 4315 HOH HOH 0 . 
ZL 39 HOH 2770 5770 4316 HOH HOH 0 . 
ZL 39 HOH 2771 5771 4319 HOH HOH 0 . 
ZL 39 HOH 2772 5772 4321 HOH HOH 0 . 
ZL 39 HOH 2773 5773 4322 HOH HOH 0 . 
ZL 39 HOH 2774 5774 4323 HOH HOH 0 . 
ZL 39 HOH 2775 5775 4324 HOH HOH 0 . 
ZL 39 HOH 2776 5776 4325 HOH HOH 0 . 
ZL 39 HOH 2777 5777 4326 HOH HOH 0 . 
ZL 39 HOH 2778 5778 4328 HOH HOH 0 . 
ZL 39 HOH 2779 5779 4329 HOH HOH 0 . 
ZL 39 HOH 2780 5780 4330 HOH HOH 0 . 
ZL 39 HOH 2781 5781 4331 HOH HOH 0 . 
ZL 39 HOH 2782 5782 4332 HOH HOH 0 . 
ZL 39 HOH 2783 5783 4335 HOH HOH 0 . 
ZL 39 HOH 2784 5784 4336 HOH HOH 0 . 
ZL 39 HOH 2785 5785 4337 HOH HOH 0 . 
ZL 39 HOH 2786 5786 4338 HOH HOH 0 . 
ZL 39 HOH 2787 5787 4339 HOH HOH 0 . 
ZL 39 HOH 2788 5788 4340 HOH HOH 0 . 
ZL 39 HOH 2789 5789 4342 HOH HOH 0 . 
ZL 39 HOH 2790 5790 4343 HOH HOH 0 . 
ZL 39 HOH 2791 5791 4344 HOH HOH 0 . 
ZL 39 HOH 2792 5792 4345 HOH HOH 0 . 
ZL 39 HOH 2793 5793 4346 HOH HOH 0 . 
ZL 39 HOH 2794 5794 4347 HOH HOH 0 . 
ZL 39 HOH 2795 5795 4348 HOH HOH 0 . 
ZL 39 HOH 2796 5796 4349 HOH HOH 0 . 
ZL 39 HOH 2797 5797 4352 HOH HOH 0 . 
ZL 39 HOH 2798 5798 4353 HOH HOH 0 . 
ZL 39 HOH 2799 5799 4354 HOH HOH 0 . 
ZL 39 HOH 2800 5800 4355 HOH HOH 0 . 
ZL 39 HOH 2801 5801 4356 HOH HOH 0 . 
ZL 39 HOH 2802 5802 4358 HOH HOH 0 . 
ZL 39 HOH 2803 5803 4359 HOH HOH 0 . 
ZL 39 HOH 2804 5804 4361 HOH HOH 0 . 
ZL 39 HOH 2805 5805 4362 HOH HOH 0 . 
ZL 39 HOH 2806 5806 4364 HOH HOH 0 . 
ZL 39 HOH 2807 5807 4365 HOH HOH 0 . 
ZL 39 HOH 2808 5808 4366 HOH HOH 0 . 
ZL 39 HOH 2809 5809 4369 HOH HOH 0 . 
ZL 39 HOH 2810 5810 4371 HOH HOH 0 . 
ZL 39 HOH 2811 5811 4373 HOH HOH 0 . 
ZL 39 HOH 2812 5812 4374 HOH HOH 0 . 
ZL 39 HOH 2813 5813 4375 HOH HOH 0 . 
ZL 39 HOH 2814 5814 4376 HOH HOH 0 . 
ZL 39 HOH 2815 5815 4377 HOH HOH 0 . 
ZL 39 HOH 2816 5816 4379 HOH HOH 0 . 
ZL 39 HOH 2817 5817 4380 HOH HOH 0 . 
ZL 39 HOH 2818 5818 4383 HOH HOH 0 . 
ZL 39 HOH 2819 5819 4384 HOH HOH 0 . 
ZL 39 HOH 2820 5820 4385 HOH HOH 0 . 
ZL 39 HOH 2821 5821 4386 HOH HOH 0 . 
ZL 39 HOH 2822 5822 4387 HOH HOH 0 . 
ZL 39 HOH 2823 5823 4388 HOH HOH 0 . 
ZL 39 HOH 2824 5824 4389 HOH HOH 0 . 
ZL 39 HOH 2825 5825 4390 HOH HOH 0 . 
ZL 39 HOH 2826 5826 4392 HOH HOH 0 . 
ZL 39 HOH 2827 5827 4393 HOH HOH 0 . 
ZL 39 HOH 2828 5828 4395 HOH HOH 0 . 
ZL 39 HOH 2829 5829 4396 HOH HOH 0 . 
ZL 39 HOH 2830 5830 4397 HOH HOH 0 . 
ZL 39 HOH 2831 5831 4399 HOH HOH 0 . 
ZL 39 HOH 2832 5832 4401 HOH HOH 0 . 
ZL 39 HOH 2833 5833 4404 HOH HOH 0 . 
ZL 39 HOH 2834 5834 4406 HOH HOH 0 . 
ZL 39 HOH 2835 5835 4407 HOH HOH 0 . 
ZL 39 HOH 2836 5836 4409 HOH HOH 0 . 
ZL 39 HOH 2837 5837 4410 HOH HOH 0 . 
ZL 39 HOH 2838 5838 4411 HOH HOH 0 . 
ZL 39 HOH 2839 5839 4412 HOH HOH 0 . 
ZL 39 HOH 2840 5840 4413 HOH HOH 0 . 
ZL 39 HOH 2841 5841 4414 HOH HOH 0 . 
ZL 39 HOH 2842 5842 4415 HOH HOH 0 . 
ZL 39 HOH 2843 5843 4416 HOH HOH 0 . 
ZL 39 HOH 2844 5844 4417 HOH HOH 0 . 
ZL 39 HOH 2845 5845 4418 HOH HOH 0 . 
ZL 39 HOH 2846 5846 4419 HOH HOH 0 . 
ZL 39 HOH 2847 5847 4421 HOH HOH 0 . 
ZL 39 HOH 2848 5848 4422 HOH HOH 0 . 
ZL 39 HOH 2849 5849 4423 HOH HOH 0 . 
ZL 39 HOH 2850 5850 4424 HOH HOH 0 . 
ZL 39 HOH 2851 5851 4425 HOH HOH 0 . 
ZL 39 HOH 2852 5852 4426 HOH HOH 0 . 
ZL 39 HOH 2853 5853 4428 HOH HOH 0 . 
ZL 39 HOH 2854 5854 4429 HOH HOH 0 . 
ZL 39 HOH 2855 5855 4430 HOH HOH 0 . 
ZL 39 HOH 2856 5856 4431 HOH HOH 0 . 
ZL 39 HOH 2857 5857 4432 HOH HOH 0 . 
ZL 39 HOH 2858 5858 4433 HOH HOH 0 . 
ZL 39 HOH 2859 5859 4434 HOH HOH 0 . 
ZL 39 HOH 2860 5860 4435 HOH HOH 0 . 
ZL 39 HOH 2861 5861 4436 HOH HOH 0 . 
ZL 39 HOH 2862 5862 4438 HOH HOH 0 . 
ZL 39 HOH 2863 5863 4439 HOH HOH 0 . 
ZL 39 HOH 2864 5864 4440 HOH HOH 0 . 
ZL 39 HOH 2865 5865 4441 HOH HOH 0 . 
ZL 39 HOH 2866 5866 4442 HOH HOH 0 . 
ZL 39 HOH 2867 5867 4443 HOH HOH 0 . 
ZL 39 HOH 2868 5868 4444 HOH HOH 0 . 
ZL 39 HOH 2869 5869 4445 HOH HOH 0 . 
ZL 39 HOH 2870 5870 4446 HOH HOH 0 . 
ZL 39 HOH 2871 5871 4447 HOH HOH 0 . 
ZL 39 HOH 2872 5872 4448 HOH HOH 0 . 
ZL 39 HOH 2873 5873 4449 HOH HOH 0 . 
ZL 39 HOH 2874 5874 4451 HOH HOH 0 . 
ZL 39 HOH 2875 5875 4452 HOH HOH 0 . 
ZL 39 HOH 2876 5876 4453 HOH HOH 0 . 
ZL 39 HOH 2877 5877 4455 HOH HOH 0 . 
ZL 39 HOH 2878 5878 4456 HOH HOH 0 . 
ZL 39 HOH 2879 5879 4457 HOH HOH 0 . 
ZL 39 HOH 2880 5880 4458 HOH HOH 0 . 
ZL 39 HOH 2881 5881 4459 HOH HOH 0 . 
ZL 39 HOH 2882 5882 4460 HOH HOH 0 . 
ZL 39 HOH 2883 5883 4461 HOH HOH 0 . 
ZL 39 HOH 2884 5884 4462 HOH HOH 0 . 
ZL 39 HOH 2885 5885 4464 HOH HOH 0 . 
ZL 39 HOH 2886 5886 4465 HOH HOH 0 . 
ZL 39 HOH 2887 5887 4466 HOH HOH 0 . 
ZL 39 HOH 2888 5888 4467 HOH HOH 0 . 
ZL 39 HOH 2889 5889 4468 HOH HOH 0 . 
ZL 39 HOH 2890 5890 4469 HOH HOH 0 . 
ZL 39 HOH 2891 5891 4470 HOH HOH 0 . 
ZL 39 HOH 2892 5892 4473 HOH HOH 0 . 
ZL 39 HOH 2893 5893 4474 HOH HOH 0 . 
ZL 39 HOH 2894 5894 4475 HOH HOH 0 . 
ZL 39 HOH 2895 5895 4476 HOH HOH 0 . 
ZL 39 HOH 2896 5896 4477 HOH HOH 0 . 
ZL 39 HOH 2897 5897 4478 HOH HOH 0 . 
ZL 39 HOH 2898 5898 4480 HOH HOH 0 . 
ZL 39 HOH 2899 5899 4481 HOH HOH 0 . 
ZL 39 HOH 2900 5900 4482 HOH HOH 0 . 
ZL 39 HOH 2901 5901 4484 HOH HOH 0 . 
ZL 39 HOH 2902 5902 4486 HOH HOH 0 . 
ZL 39 HOH 2903 5903 4487 HOH HOH 0 . 
ZL 39 HOH 2904 5904 4488 HOH HOH 0 . 
ZL 39 HOH 2905 5905 4489 HOH HOH 0 . 
ZL 39 HOH 2906 5906 4491 HOH HOH 0 . 
ZL 39 HOH 2907 5907 4492 HOH HOH 0 . 
ZL 39 HOH 2908 5908 4493 HOH HOH 0 . 
ZL 39 HOH 2909 5909 4495 HOH HOH 0 . 
ZL 39 HOH 2910 5910 4496 HOH HOH 0 . 
ZL 39 HOH 2911 5911 4497 HOH HOH 0 . 
ZL 39 HOH 2912 5912 4499 HOH HOH 0 . 
ZL 39 HOH 2913 5913 4500 HOH HOH 0 . 
ZL 39 HOH 2914 5914 4501 HOH HOH 0 . 
ZL 39 HOH 2915 5915 4503 HOH HOH 0 . 
ZL 39 HOH 2916 5916 4504 HOH HOH 0 . 
ZL 39 HOH 2917 5917 4505 HOH HOH 0 . 
ZL 39 HOH 2918 5918 4506 HOH HOH 0 . 
ZL 39 HOH 2919 5919 4507 HOH HOH 0 . 
ZL 39 HOH 2920 5920 4508 HOH HOH 0 . 
ZL 39 HOH 2921 5921 4509 HOH HOH 0 . 
ZL 39 HOH 2922 5922 4510 HOH HOH 0 . 
ZL 39 HOH 2923 5923 4511 HOH HOH 0 . 
ZL 39 HOH 2924 5924 4512 HOH HOH 0 . 
ZL 39 HOH 2925 5925 4513 HOH HOH 0 . 
ZL 39 HOH 2926 5926 4515 HOH HOH 0 . 
ZL 39 HOH 2927 5927 4516 HOH HOH 0 . 
ZL 39 HOH 2928 5928 4517 HOH HOH 0 . 
ZL 39 HOH 2929 5929 4518 HOH HOH 0 . 
ZL 39 HOH 2930 5930 4519 HOH HOH 0 . 
ZL 39 HOH 2931 5931 4520 HOH HOH 0 . 
ZL 39 HOH 2932 5932 4521 HOH HOH 0 . 
ZL 39 HOH 2933 5933 4523 HOH HOH 0 . 
ZL 39 HOH 2934 5934 4525 HOH HOH 0 . 
ZL 39 HOH 2935 5935 4526 HOH HOH 0 . 
ZL 39 HOH 2936 5936 4528 HOH HOH 0 . 
ZL 39 HOH 2937 5937 4529 HOH HOH 0 . 
ZL 39 HOH 2938 5938 4530 HOH HOH 0 . 
ZL 39 HOH 2939 5939 4532 HOH HOH 0 . 
ZL 39 HOH 2940 5940 4533 HOH HOH 0 . 
ZL 39 HOH 2941 5941 4534 HOH HOH 0 . 
ZL 39 HOH 2942 5942 4536 HOH HOH 0 . 
ZL 39 HOH 2943 5943 4537 HOH HOH 0 . 
ZL 39 HOH 2944 5944 4542 HOH HOH 0 . 
ZL 39 HOH 2945 5945 4543 HOH HOH 0 . 
ZL 39 HOH 2946 5946 4545 HOH HOH 0 . 
ZL 39 HOH 2947 5947 4546 HOH HOH 0 . 
ZL 39 HOH 2948 5948 4548 HOH HOH 0 . 
ZL 39 HOH 2949 5949 4550 HOH HOH 0 . 
ZL 39 HOH 2950 5950 4551 HOH HOH 0 . 
ZL 39 HOH 2951 5951 4552 HOH HOH 0 . 
ZL 39 HOH 2952 5952 4553 HOH HOH 0 . 
ZL 39 HOH 2953 5953 4554 HOH HOH 0 . 
ZL 39 HOH 2954 5954 4555 HOH HOH 0 . 
ZL 39 HOH 2955 5955 4556 HOH HOH 0 . 
ZL 39 HOH 2956 5956 4557 HOH HOH 0 . 
ZL 39 HOH 2957 5957 4559 HOH HOH 0 . 
ZL 39 HOH 2958 5958 4560 HOH HOH 0 . 
ZL 39 HOH 2959 5959 4562 HOH HOH 0 . 
ZL 39 HOH 2960 5960 4564 HOH HOH 0 . 
ZL 39 HOH 2961 5961 4565 HOH HOH 0 . 
ZL 39 HOH 2962 5962 4566 HOH HOH 0 . 
ZL 39 HOH 2963 5963 4568 HOH HOH 0 . 
ZL 39 HOH 2964 5964 4570 HOH HOH 0 . 
ZL 39 HOH 2965 5965 4571 HOH HOH 0 . 
ZL 39 HOH 2966 5966 4573 HOH HOH 0 . 
ZL 39 HOH 2967 5967 4574 HOH HOH 0 . 
ZL 39 HOH 2968 5968 4576 HOH HOH 0 . 
ZL 39 HOH 2969 5969 4579 HOH HOH 0 . 
ZL 39 HOH 2970 5970 4580 HOH HOH 0 . 
ZL 39 HOH 2971 5971 4581 HOH HOH 0 . 
ZL 39 HOH 2972 5972 4582 HOH HOH 0 . 
ZL 39 HOH 2973 5973 4583 HOH HOH 0 . 
ZL 39 HOH 2974 5974 4585 HOH HOH 0 . 
ZL 39 HOH 2975 5975 4587 HOH HOH 0 . 
ZL 39 HOH 2976 5976 4588 HOH HOH 0 . 
ZL 39 HOH 2977 5977 4591 HOH HOH 0 . 
ZL 39 HOH 2978 5978 4592 HOH HOH 0 . 
ZL 39 HOH 2979 5979 4593 HOH HOH 0 . 
ZL 39 HOH 2980 5980 4594 HOH HOH 0 . 
ZL 39 HOH 2981 5981 4597 HOH HOH 0 . 
ZL 39 HOH 2982 5982 4598 HOH HOH 0 . 
ZL 39 HOH 2983 5983 4599 HOH HOH 0 . 
ZL 39 HOH 2984 5984 4601 HOH HOH 0 . 
ZL 39 HOH 2985 5985 4602 HOH HOH 0 . 
ZL 39 HOH 2986 5986 4603 HOH HOH 0 . 
ZL 39 HOH 2987 5987 4605 HOH HOH 0 . 
ZL 39 HOH 2988 5988 4607 HOH HOH 0 . 
ZL 39 HOH 2989 5989 4609 HOH HOH 0 . 
ZL 39 HOH 2990 5990 4611 HOH HOH 0 . 
ZL 39 HOH 2991 5991 4613 HOH HOH 0 . 
ZL 39 HOH 2992 5992 4614 HOH HOH 0 . 
ZL 39 HOH 2993 5993 4615 HOH HOH 0 . 
ZL 39 HOH 2994 5994 4616 HOH HOH 0 . 
ZL 39 HOH 2995 5995 4617 HOH HOH 0 . 
ZL 39 HOH 2996 5996 4618 HOH HOH 0 . 
ZL 39 HOH 2997 5997 4620 HOH HOH 0 . 
ZL 39 HOH 2998 5998 4621 HOH HOH 0 . 
ZL 39 HOH 2999 5999 4622 HOH HOH 0 . 
ZL 39 HOH 3000 6000 4623 HOH HOH 0 . 
ZL 39 HOH 3001 6001 4625 HOH HOH 0 . 
ZL 39 HOH 3002 6002 4628 HOH HOH 0 . 
ZL 39 HOH 3003 6003 4629 HOH HOH 0 . 
ZL 39 HOH 3004 6004 4630 HOH HOH 0 . 
ZL 39 HOH 3005 6005 4631 HOH HOH 0 . 
ZL 39 HOH 3006 6006 4633 HOH HOH 0 . 
ZL 39 HOH 3007 6007 4634 HOH HOH 0 . 
ZL 39 HOH 3008 6008 4635 HOH HOH 0 . 
ZL 39 HOH 3009 6009 4636 HOH HOH 0 . 
ZL 39 HOH 3010 6010 4638 HOH HOH 0 . 
ZL 39 HOH 3011 6011 4639 HOH HOH 0 . 
ZL 39 HOH 3012 6012 4640 HOH HOH 0 . 
ZL 39 HOH 3013 6013 4643 HOH HOH 0 . 
ZL 39 HOH 3014 6014 4644 HOH HOH 0 . 
ZL 39 HOH 3015 6015 4645 HOH HOH 0 . 
ZL 39 HOH 3016 6016 4647 HOH HOH 0 . 
ZL 39 HOH 3017 6017 4648 HOH HOH 0 . 
ZL 39 HOH 3018 6018 4649 HOH HOH 0 . 
ZL 39 HOH 3019 6019 4651 HOH HOH 0 . 
ZL 39 HOH 3020 6020 4652 HOH HOH 0 . 
ZL 39 HOH 3021 6021 4653 HOH HOH 0 . 
ZL 39 HOH 3022 6022 4654 HOH HOH 0 . 
ZL 39 HOH 3023 6023 4655 HOH HOH 0 . 
ZL 39 HOH 3024 6024 4657 HOH HOH 0 . 
ZL 39 HOH 3025 6025 4658 HOH HOH 0 . 
ZL 39 HOH 3026 6026 4659 HOH HOH 0 . 
ZL 39 HOH 3027 6027 4660 HOH HOH 0 . 
ZL 39 HOH 3028 6028 4662 HOH HOH 0 . 
ZL 39 HOH 3029 6029 4663 HOH HOH 0 . 
ZL 39 HOH 3030 6030 4665 HOH HOH 0 . 
ZL 39 HOH 3031 6031 4666 HOH HOH 0 . 
ZL 39 HOH 3032 6032 4668 HOH HOH 0 . 
ZL 39 HOH 3033 6033 4669 HOH HOH 0 . 
ZL 39 HOH 3034 6034 4670 HOH HOH 0 . 
ZL 39 HOH 3035 6035 4671 HOH HOH 0 . 
ZL 39 HOH 3036 6036 4672 HOH HOH 0 . 
ZL 39 HOH 3037 6037 4674 HOH HOH 0 . 
ZL 39 HOH 3038 6038 4675 HOH HOH 0 . 
ZL 39 HOH 3039 6039 4676 HOH HOH 0 . 
ZL 39 HOH 3040 6040 4677 HOH HOH 0 . 
ZL 39 HOH 3041 6041 4679 HOH HOH 0 . 
ZL 39 HOH 3042 6042 4683 HOH HOH 0 . 
ZL 39 HOH 3043 6043 4684 HOH HOH 0 . 
ZL 39 HOH 3044 6044 4685 HOH HOH 0 . 
ZL 39 HOH 3045 6045 4686 HOH HOH 0 . 
ZL 39 HOH 3046 6046 4689 HOH HOH 0 . 
ZL 39 HOH 3047 6047 4691 HOH HOH 0 . 
ZL 39 HOH 3048 6048 4692 HOH HOH 0 . 
ZL 39 HOH 3049 6049 4693 HOH HOH 0 . 
ZL 39 HOH 3050 6050 4694 HOH HOH 0 . 
ZL 39 HOH 3051 6051 4697 HOH HOH 0 . 
ZL 39 HOH 3052 6052 4699 HOH HOH 0 . 
ZL 39 HOH 3053 6053 4702 HOH HOH 0 . 
ZL 39 HOH 3054 6054 4703 HOH HOH 0 . 
ZL 39 HOH 3055 6055 4704 HOH HOH 0 . 
ZL 39 HOH 3056 6056 4705 HOH HOH 0 . 
ZL 39 HOH 3057 6057 4706 HOH HOH 0 . 
ZL 39 HOH 3058 6058 4708 HOH HOH 0 . 
ZL 39 HOH 3059 6059 4710 HOH HOH 0 . 
ZL 39 HOH 3060 6060 4711 HOH HOH 0 . 
ZL 39 HOH 3061 6061 4715 HOH HOH 0 . 
ZL 39 HOH 3062 6062 4716 HOH HOH 0 . 
ZL 39 HOH 3063 6063 4717 HOH HOH 0 . 
ZL 39 HOH 3064 6064 4720 HOH HOH 0 . 
ZL 39 HOH 3065 6065 4721 HOH HOH 0 . 
ZL 39 HOH 3066 6066 4722 HOH HOH 0 . 
ZL 39 HOH 3067 6067 4723 HOH HOH 0 . 
ZL 39 HOH 3068 6068 4724 HOH HOH 0 . 
ZL 39 HOH 3069 6069 4725 HOH HOH 0 . 
ZL 39 HOH 3070 6070 4726 HOH HOH 0 . 
ZL 39 HOH 3071 6071 4727 HOH HOH 0 . 
ZL 39 HOH 3072 6072 4728 HOH HOH 0 . 
ZL 39 HOH 3073 6073 4729 HOH HOH 0 . 
ZL 39 HOH 3074 6074 4731 HOH HOH 0 . 
ZL 39 HOH 3075 6075 4732 HOH HOH 0 . 
ZL 39 HOH 3076 6076 4733 HOH HOH 0 . 
ZL 39 HOH 3077 6077 4734 HOH HOH 0 . 
ZL 39 HOH 3078 6078 4735 HOH HOH 0 . 
ZL 39 HOH 3079 6079 4736 HOH HOH 0 . 
ZL 39 HOH 3080 6080 4737 HOH HOH 0 . 
ZL 39 HOH 3081 6081 4738 HOH HOH 0 . 
ZL 39 HOH 3082 6082 4739 HOH HOH 0 . 
ZL 39 HOH 3083 6083 4740 HOH HOH 0 . 
ZL 39 HOH 3084 6084 4741 HOH HOH 0 . 
ZL 39 HOH 3085 6085 4743 HOH HOH 0 . 
ZL 39 HOH 3086 6086 4745 HOH HOH 0 . 
ZL 39 HOH 3087 6087 4748 HOH HOH 0 . 
ZL 39 HOH 3088 6088 4749 HOH HOH 0 . 
ZL 39 HOH 3089 6089 4750 HOH HOH 0 . 
ZL 39 HOH 3090 6090 4751 HOH HOH 0 . 
ZL 39 HOH 3091 6091 4752 HOH HOH 0 . 
ZL 39 HOH 3092 6092 4753 HOH HOH 0 . 
ZL 39 HOH 3093 6093 4754 HOH HOH 0 . 
ZL 39 HOH 3094 6094 4755 HOH HOH 0 . 
ZL 39 HOH 3095 6095 4756 HOH HOH 0 . 
ZL 39 HOH 3096 6096 4757 HOH HOH 0 . 
ZL 39 HOH 3097 6097 4758 HOH HOH 0 . 
ZL 39 HOH 3098 6098 4759 HOH HOH 0 . 
ZL 39 HOH 3099 6099 4762 HOH HOH 0 . 
ZL 39 HOH 3100 6100 4764 HOH HOH 0 . 
ZL 39 HOH 3101 6101 4765 HOH HOH 0 . 
ZL 39 HOH 3102 6102 4766 HOH HOH 0 . 
ZL 39 HOH 3103 6103 4767 HOH HOH 0 . 
ZL 39 HOH 3104 6104 4769 HOH HOH 0 . 
ZL 39 HOH 3105 6105 4773 HOH HOH 0 . 
ZL 39 HOH 3106 6106 4774 HOH HOH 0 . 
ZL 39 HOH 3107 6107 4776 HOH HOH 0 . 
ZL 39 HOH 3108 6108 4777 HOH HOH 0 . 
ZL 39 HOH 3109 6109 4778 HOH HOH 0 . 
ZL 39 HOH 3110 6110 4779 HOH HOH 0 . 
ZL 39 HOH 3111 6111 4781 HOH HOH 0 . 
ZL 39 HOH 3112 6112 4783 HOH HOH 0 . 
ZL 39 HOH 3113 6113 4784 HOH HOH 0 . 
ZL 39 HOH 3114 6114 4786 HOH HOH 0 . 
ZL 39 HOH 3115 6115 4787 HOH HOH 0 . 
ZL 39 HOH 3116 6116 4788 HOH HOH 0 . 
ZL 39 HOH 3117 6117 4789 HOH HOH 0 . 
ZL 39 HOH 3118 6118 4790 HOH HOH 0 . 
ZL 39 HOH 3119 6119 4793 HOH HOH 0 . 
ZL 39 HOH 3120 6120 4794 HOH HOH 0 . 
ZL 39 HOH 3121 6121 4795 HOH HOH 0 . 
ZL 39 HOH 3122 6122 4796 HOH HOH 0 . 
ZL 39 HOH 3123 6123 4798 HOH HOH 0 . 
ZL 39 HOH 3124 6124 4799 HOH HOH 0 . 
ZL 39 HOH 3125 6125 4800 HOH HOH 0 . 
ZL 39 HOH 3126 6126 4801 HOH HOH 0 . 
ZL 39 HOH 3127 6127 4802 HOH HOH 0 . 
ZL 39 HOH 3128 6128 4803 HOH HOH 0 . 
ZL 39 HOH 3129 6129 4805 HOH HOH 0 . 
ZL 39 HOH 3130 6130 4809 HOH HOH 0 . 
ZL 39 HOH 3131 6131 4811 HOH HOH 0 . 
ZL 39 HOH 3132 6132 4813 HOH HOH 0 . 
ZL 39 HOH 3133 6133 4814 HOH HOH 0 . 
ZL 39 HOH 3134 6134 4815 HOH HOH 0 . 
ZL 39 HOH 3135 6135 4816 HOH HOH 0 . 
ZL 39 HOH 3136 6136 4817 HOH HOH 0 . 
ZL 39 HOH 3137 6137 4820 HOH HOH 0 . 
ZL 39 HOH 3138 6138 4821 HOH HOH 0 . 
ZL 39 HOH 3139 6139 4822 HOH HOH 0 . 
ZL 39 HOH 3140 6140 4823 HOH HOH 0 . 
ZL 39 HOH 3141 6141 4824 HOH HOH 0 . 
ZL 39 HOH 3142 6142 4825 HOH HOH 0 . 
ZL 39 HOH 3143 6143 4827 HOH HOH 0 . 
ZL 39 HOH 3144 6144 4828 HOH HOH 0 . 
ZL 39 HOH 3145 6145 4829 HOH HOH 0 . 
ZL 39 HOH 3146 6146 4830 HOH HOH 0 . 
ZL 39 HOH 3147 6147 4831 HOH HOH 0 . 
ZL 39 HOH 3148 6148 4832 HOH HOH 0 . 
ZL 39 HOH 3149 6149 4833 HOH HOH 0 . 
ZL 39 HOH 3150 6150 4834 HOH HOH 0 . 
ZL 39 HOH 3151 6151 4835 HOH HOH 0 . 
ZL 39 HOH 3152 6152 4836 HOH HOH 0 . 
ZL 39 HOH 3153 6153 4837 HOH HOH 0 . 
ZL 39 HOH 3154 6154 4838 HOH HOH 0 . 
ZL 39 HOH 3155 6155 4839 HOH HOH 0 . 
ZL 39 HOH 3156 6156 4840 HOH HOH 0 . 
ZL 39 HOH 3157 6157 4841 HOH HOH 0 . 
ZL 39 HOH 3158 6158 4842 HOH HOH 0 . 
ZL 39 HOH 3159 6159 4843 HOH HOH 0 . 
ZL 39 HOH 3160 6160 4844 HOH HOH 0 . 
ZL 39 HOH 3161 6161 4845 HOH HOH 0 . 
ZL 39 HOH 3162 6162 4848 HOH HOH 0 . 
ZL 39 HOH 3163 6163 4849 HOH HOH 0 . 
ZL 39 HOH 3164 6164 4850 HOH HOH 0 . 
ZL 39 HOH 3165 6165 4851 HOH HOH 0 . 
ZL 39 HOH 3166 6166 4852 HOH HOH 0 . 
ZL 39 HOH 3167 6167 4853 HOH HOH 0 . 
ZL 39 HOH 3168 6168 4854 HOH HOH 0 . 
ZL 39 HOH 3169 6169 4855 HOH HOH 0 . 
ZL 39 HOH 3170 6170 4856 HOH HOH 0 . 
ZL 39 HOH 3171 6171 4857 HOH HOH 0 . 
ZL 39 HOH 3172 6172 4858 HOH HOH 0 . 
ZL 39 HOH 3173 6173 4860 HOH HOH 0 . 
ZL 39 HOH 3174 6174 4861 HOH HOH 0 . 
ZL 39 HOH 3175 6175 4864 HOH HOH 0 . 
ZL 39 HOH 3176 6176 4866 HOH HOH 0 . 
ZL 39 HOH 3177 6177 4867 HOH HOH 0 . 
ZL 39 HOH 3178 6178 4868 HOH HOH 0 . 
ZL 39 HOH 3179 6179 4871 HOH HOH 0 . 
ZL 39 HOH 3180 6180 4872 HOH HOH 0 . 
ZL 39 HOH 3181 6181 4873 HOH HOH 0 . 
ZL 39 HOH 3182 6182 4874 HOH HOH 0 . 
ZL 39 HOH 3183 6183 4875 HOH HOH 0 . 
ZL 39 HOH 3184 6184 4876 HOH HOH 0 . 
ZL 39 HOH 3185 6185 4878 HOH HOH 0 . 
ZL 39 HOH 3186 6186 4880 HOH HOH 0 . 
ZL 39 HOH 3187 6187 4881 HOH HOH 0 . 
ZL 39 HOH 3188 6188 4882 HOH HOH 0 . 
ZL 39 HOH 3189 6189 4883 HOH HOH 0 . 
ZL 39 HOH 3190 6190 4885 HOH HOH 0 . 
ZL 39 HOH 3191 6191 4888 HOH HOH 0 . 
ZL 39 HOH 3192 6192 4889 HOH HOH 0 . 
ZL 39 HOH 3193 6193 4890 HOH HOH 0 . 
ZL 39 HOH 3194 6194 4891 HOH HOH 0 . 
ZL 39 HOH 3195 6195 4894 HOH HOH 0 . 
ZL 39 HOH 3196 6196 4896 HOH HOH 0 . 
ZL 39 HOH 3197 6197 4897 HOH HOH 0 . 
ZL 39 HOH 3198 6198 4898 HOH HOH 0 . 
ZL 39 HOH 3199 6199 4900 HOH HOH 0 . 
ZL 39 HOH 3200 6200 4901 HOH HOH 0 . 
ZL 39 HOH 3201 6201 4903 HOH HOH 0 . 
ZL 39 HOH 3202 6202 4904 HOH HOH 0 . 
ZL 39 HOH 3203 6203 4905 HOH HOH 0 . 
ZL 39 HOH 3204 6204 4906 HOH HOH 0 . 
ZL 39 HOH 3205 6205 4907 HOH HOH 0 . 
ZL 39 HOH 3206 6206 4910 HOH HOH 0 . 
ZL 39 HOH 3207 6207 4911 HOH HOH 0 . 
ZL 39 HOH 3208 6208 4912 HOH HOH 0 . 
ZL 39 HOH 3209 6209 4914 HOH HOH 0 . 
ZL 39 HOH 3210 6210 4915 HOH HOH 0 . 
ZL 39 HOH 3211 6211 4916 HOH HOH 0 . 
ZL 39 HOH 3212 6212 4919 HOH HOH 0 . 
ZL 39 HOH 3213 6213 4922 HOH HOH 0 . 
ZL 39 HOH 3214 6214 4923 HOH HOH 0 . 
ZL 39 HOH 3215 6215 4924 HOH HOH 0 . 
ZL 39 HOH 3216 6216 4925 HOH HOH 0 . 
ZL 39 HOH 3217 6217 4926 HOH HOH 0 . 
ZL 39 HOH 3218 6218 4927 HOH HOH 0 . 
ZL 39 HOH 3219 6219 4928 HOH HOH 0 . 
ZL 39 HOH 3220 6220 4929 HOH HOH 0 . 
ZL 39 HOH 3221 6221 4930 HOH HOH 0 . 
ZL 39 HOH 3222 6222 4931 HOH HOH 0 . 
ZL 39 HOH 3223 6223 4934 HOH HOH 0 . 
ZL 39 HOH 3224 6224 4935 HOH HOH 0 . 
ZL 39 HOH 3225 6225 4936 HOH HOH 0 . 
ZL 39 HOH 3226 6226 4937 HOH HOH 0 . 
ZL 39 HOH 3227 6227 4938 HOH HOH 0 . 
ZL 39 HOH 3228 6228 4939 HOH HOH 0 . 
ZL 39 HOH 3229 6229 4940 HOH HOH 0 . 
ZL 39 HOH 3230 6230 4941 HOH HOH 0 . 
ZL 39 HOH 3231 6231 4942 HOH HOH 0 . 
ZL 39 HOH 3232 6232 4943 HOH HOH 0 . 
ZL 39 HOH 3233 6233 4945 HOH HOH 0 . 
ZL 39 HOH 3234 6234 4946 HOH HOH 0 . 
ZL 39 HOH 3235 6235 4947 HOH HOH 0 . 
ZL 39 HOH 3236 6236 4948 HOH HOH 0 . 
ZL 39 HOH 3237 6237 4949 HOH HOH 0 . 
ZL 39 HOH 3238 6238 4950 HOH HOH 0 . 
ZL 39 HOH 3239 6239 4951 HOH HOH 0 . 
ZL 39 HOH 3240 6240 4952 HOH HOH 0 . 
ZL 39 HOH 3241 6241 4953 HOH HOH 0 . 
ZL 39 HOH 3242 6242 4954 HOH HOH 0 . 
ZL 39 HOH 3243 6243 4955 HOH HOH 0 . 
ZL 39 HOH 3244 6244 4957 HOH HOH 0 . 
ZL 39 HOH 3245 6245 4958 HOH HOH 0 . 
ZL 39 HOH 3246 6246 4959 HOH HOH 0 . 
ZL 39 HOH 3247 6247 4960 HOH HOH 0 . 
ZL 39 HOH 3248 6248 4962 HOH HOH 0 . 
ZL 39 HOH 3249 6249 4964 HOH HOH 0 . 
ZL 39 HOH 3250 6250 4965 HOH HOH 0 . 
ZL 39 HOH 3251 6251 4966 HOH HOH 0 . 
ZL 39 HOH 3252 6252 4968 HOH HOH 0 . 
ZL 39 HOH 3253 6253 4969 HOH HOH 0 . 
ZL 39 HOH 3254 6254 4972 HOH HOH 0 . 
ZL 39 HOH 3255 6255 4973 HOH HOH 0 . 
ZL 39 HOH 3256 6256 4976 HOH HOH 0 . 
ZL 39 HOH 3257 6257 4977 HOH HOH 0 . 
ZL 39 HOH 3258 6258 4978 HOH HOH 0 . 
ZL 39 HOH 3259 6259 4979 HOH HOH 0 . 
ZL 39 HOH 3260 6260 4980 HOH HOH 0 . 
ZL 39 HOH 3261 6261 4981 HOH HOH 0 . 
ZL 39 HOH 3262 6262 4982 HOH HOH 0 . 
ZL 39 HOH 3263 6263 4983 HOH HOH 0 . 
ZL 39 HOH 3264 6264 4984 HOH HOH 0 . 
ZL 39 HOH 3265 6265 4986 HOH HOH 0 . 
ZL 39 HOH 3266 6266 4987 HOH HOH 0 . 
ZL 39 HOH 3267 6267 4991 HOH HOH 0 . 
ZL 39 HOH 3268 6268 4992 HOH HOH 0 . 
ZL 39 HOH 3269 6269 4993 HOH HOH 0 . 
ZL 39 HOH 3270 6270 4994 HOH HOH 0 . 
ZL 39 HOH 3271 6271 4996 HOH HOH 0 . 
ZL 39 HOH 3272 6272 4998 HOH HOH 0 . 
ZL 39 HOH 3273 6273 5000 HOH HOH 0 . 
ZL 39 HOH 3274 6274 5001 HOH HOH 0 . 
ZL 39 HOH 3275 6275 5002 HOH HOH 0 . 
ZL 39 HOH 3276 6276 5003 HOH HOH 0 . 
ZL 39 HOH 3277 6277 5005 HOH HOH 0 . 
ZL 39 HOH 3278 6278 5006 HOH HOH 0 . 
ZL 39 HOH 3279 6279 5007 HOH HOH 0 . 
ZL 39 HOH 3280 6280 5009 HOH HOH 0 . 
ZL 39 HOH 3281 6281 5010 HOH HOH 0 . 
ZL 39 HOH 3282 6282 5011 HOH HOH 0 . 
ZL 39 HOH 3283 6283 5012 HOH HOH 0 . 
ZL 39 HOH 3284 6284 5013 HOH HOH 0 . 
ZL 39 HOH 3285 6285 5015 HOH HOH 0 . 
ZL 39 HOH 3286 6286 5016 HOH HOH 0 . 
ZL 39 HOH 3287 6287 5017 HOH HOH 0 . 
ZL 39 HOH 3288 6288 5018 HOH HOH 0 . 
ZL 39 HOH 3289 6289 5022 HOH HOH 0 . 
ZL 39 HOH 3290 6290 5023 HOH HOH 0 . 
ZL 39 HOH 3291 6291 5024 HOH HOH 0 . 
ZL 39 HOH 3292 6292 5027 HOH HOH 0 . 
ZL 39 HOH 3293 6293 5028 HOH HOH 0 . 
ZL 39 HOH 3294 6294 5032 HOH HOH 0 . 
ZL 39 HOH 3295 6295 5033 HOH HOH 0 . 
ZL 39 HOH 3296 6296 5034 HOH HOH 0 . 
ZL 39 HOH 3297 6297 5038 HOH HOH 0 . 
ZL 39 HOH 3298 6298 5039 HOH HOH 0 . 
ZL 39 HOH 3299 6299 5040 HOH HOH 0 . 
ZL 39 HOH 3300 6300 5041 HOH HOH 0 . 
ZL 39 HOH 3301 6301 5042 HOH HOH 0 . 
ZL 39 HOH 3302 6302 5043 HOH HOH 0 . 
ZL 39 HOH 3303 6303 5044 HOH HOH 0 . 
ZL 39 HOH 3304 6304 5045 HOH HOH 0 . 
ZL 39 HOH 3305 6305 5047 HOH HOH 0 . 
ZL 39 HOH 3306 6306 5048 HOH HOH 0 . 
ZL 39 HOH 3307 6307 5049 HOH HOH 0 . 
ZL 39 HOH 3308 6308 5050 HOH HOH 0 . 
ZL 39 HOH 3309 6309 5051 HOH HOH 0 . 
ZL 39 HOH 3310 6310 5053 HOH HOH 0 . 
ZL 39 HOH 3311 6311 5054 HOH HOH 0 . 
ZL 39 HOH 3312 6312 5057 HOH HOH 0 . 
ZL 39 HOH 3313 6313 5059 HOH HOH 0 . 
ZL 39 HOH 3314 6314 5060 HOH HOH 0 . 
ZL 39 HOH 3315 6315 5063 HOH HOH 0 . 
ZL 39 HOH 3316 6316 5066 HOH HOH 0 . 
ZL 39 HOH 3317 6317 5067 HOH HOH 0 . 
ZL 39 HOH 3318 6318 5068 HOH HOH 0 . 
ZL 39 HOH 3319 6319 5070 HOH HOH 0 . 
ZL 39 HOH 3320 6320 5072 HOH HOH 0 . 
ZL 39 HOH 3321 6321 5073 HOH HOH 0 . 
ZL 39 HOH 3322 6322 5074 HOH HOH 0 . 
ZL 39 HOH 3323 6323 5076 HOH HOH 0 . 
ZL 39 HOH 3324 6324 5077 HOH HOH 0 . 
ZL 39 HOH 3325 6325 5078 HOH HOH 0 . 
ZL 39 HOH 3326 6326 5081 HOH HOH 0 . 
ZL 39 HOH 3327 6327 5082 HOH HOH 0 . 
ZL 39 HOH 3328 6328 5085 HOH HOH 0 . 
ZL 39 HOH 3329 6329 5087 HOH HOH 0 . 
ZL 39 HOH 3330 6330 5088 HOH HOH 0 . 
ZL 39 HOH 3331 6331 5089 HOH HOH 0 . 
ZL 39 HOH 3332 6332 5090 HOH HOH 0 . 
ZL 39 HOH 3333 6333 5091 HOH HOH 0 . 
ZL 39 HOH 3334 6334 5092 HOH HOH 0 . 
ZL 39 HOH 3335 6335 5094 HOH HOH 0 . 
ZL 39 HOH 3336 6336 5095 HOH HOH 0 . 
ZL 39 HOH 3337 6337 5097 HOH HOH 0 . 
ZL 39 HOH 3338 6338 5098 HOH HOH 0 . 
ZL 39 HOH 3339 6339 5099 HOH HOH 0 . 
ZL 39 HOH 3340 6340 5100 HOH HOH 0 . 
ZL 39 HOH 3341 6341 5101 HOH HOH 0 . 
ZL 39 HOH 3342 6342 5103 HOH HOH 0 . 
ZL 39 HOH 3343 6343 5105 HOH HOH 0 . 
ZL 39 HOH 3344 6344 5107 HOH HOH 0 . 
ZL 39 HOH 3345 6345 5109 HOH HOH 0 . 
ZL 39 HOH 3346 6346 5110 HOH HOH 0 . 
ZL 39 HOH 3347 6347 5112 HOH HOH 0 . 
ZL 39 HOH 3348 6348 5113 HOH HOH 0 . 
ZL 39 HOH 3349 6349 5114 HOH HOH 0 . 
ZL 39 HOH 3350 6350 5115 HOH HOH 0 . 
ZL 39 HOH 3351 6351 5116 HOH HOH 0 . 
ZL 39 HOH 3352 6352 5117 HOH HOH 0 . 
ZL 39 HOH 3353 6353 5118 HOH HOH 0 . 
ZL 39 HOH 3354 6354 5119 HOH HOH 0 . 
ZL 39 HOH 3355 6355 5120 HOH HOH 0 . 
ZL 39 HOH 3356 6356 5121 HOH HOH 0 . 
ZL 39 HOH 3357 6357 5122 HOH HOH 0 . 
ZL 39 HOH 3358 6358 5123 HOH HOH 0 . 
ZL 39 HOH 3359 6359 5124 HOH HOH 0 . 
ZL 39 HOH 3360 6360 5125 HOH HOH 0 . 
ZL 39 HOH 3361 6361 5126 HOH HOH 0 . 
ZL 39 HOH 3362 6362 5129 HOH HOH 0 . 
ZL 39 HOH 3363 6363 5130 HOH HOH 0 . 
ZL 39 HOH 3364 6364 5131 HOH HOH 0 . 
ZL 39 HOH 3365 6365 5134 HOH HOH 0 . 
ZL 39 HOH 3366 6366 5135 HOH HOH 0 . 
ZL 39 HOH 3367 6367 5138 HOH HOH 0 . 
ZL 39 HOH 3368 6368 5139 HOH HOH 0 . 
ZL 39 HOH 3369 6369 5140 HOH HOH 0 . 
ZL 39 HOH 3370 6370 5141 HOH HOH 0 . 
ZL 39 HOH 3371 6371 5143 HOH HOH 0 . 
ZL 39 HOH 3372 6372 5144 HOH HOH 0 . 
ZL 39 HOH 3373 6373 5145 HOH HOH 0 . 
ZL 39 HOH 3374 6374 5148 HOH HOH 0 . 
ZL 39 HOH 3375 6375 5149 HOH HOH 0 . 
ZL 39 HOH 3376 6376 5150 HOH HOH 0 . 
ZL 39 HOH 3377 6377 5152 HOH HOH 0 . 
ZL 39 HOH 3378 6378 5153 HOH HOH 0 . 
ZL 39 HOH 3379 6379 5154 HOH HOH 0 . 
ZL 39 HOH 3380 6380 5155 HOH HOH 0 . 
ZL 39 HOH 3381 6381 5156 HOH HOH 0 . 
ZL 39 HOH 3382 6382 5157 HOH HOH 0 . 
ZL 39 HOH 3383 6383 5161 HOH HOH 0 . 
ZL 39 HOH 3384 6384 5162 HOH HOH 0 . 
ZL 39 HOH 3385 6385 5166 HOH HOH 0 . 
ZL 39 HOH 3386 6386 5167 HOH HOH 0 . 
ZL 39 HOH 3387 6387 5168 HOH HOH 0 . 
ZL 39 HOH 3388 6388 5169 HOH HOH 0 . 
ZL 39 HOH 3389 6389 5171 HOH HOH 0 . 
ZL 39 HOH 3390 6390 5172 HOH HOH 0 . 
ZL 39 HOH 3391 6391 5173 HOH HOH 0 . 
ZL 39 HOH 3392 6392 5176 HOH HOH 0 . 
ZL 39 HOH 3393 6393 5178 HOH HOH 0 . 
ZL 39 HOH 3394 6394 5179 HOH HOH 0 . 
ZL 39 HOH 3395 6395 5180 HOH HOH 0 . 
ZL 39 HOH 3396 6396 5182 HOH HOH 0 . 
ZL 39 HOH 3397 6397 5183 HOH HOH 0 . 
ZL 39 HOH 3398 6398 5184 HOH HOH 0 . 
ZL 39 HOH 3399 6399 5185 HOH HOH 0 . 
ZL 39 HOH 3400 6400 5186 HOH HOH 0 . 
ZL 39 HOH 3401 6401 5187 HOH HOH 0 . 
ZL 39 HOH 3402 6402 5188 HOH HOH 0 . 
ZL 39 HOH 3403 6403 5189 HOH HOH 0 . 
ZL 39 HOH 3404 6404 5190 HOH HOH 0 . 
ZL 39 HOH 3405 6405 5193 HOH HOH 0 . 
ZL 39 HOH 3406 6406 5194 HOH HOH 0 . 
ZL 39 HOH 3407 6407 5195 HOH HOH 0 . 
ZL 39 HOH 3408 6408 5196 HOH HOH 0 . 
ZL 39 HOH 3409 6409 5197 HOH HOH 0 . 
ZL 39 HOH 3410 6410 5199 HOH HOH 0 . 
ZL 39 HOH 3411 6411 5200 HOH HOH 0 . 
ZL 39 HOH 3412 6412 5202 HOH HOH 0 . 
ZL 39 HOH 3413 6413 5205 HOH HOH 0 . 
ZL 39 HOH 3414 6414 5206 HOH HOH 0 . 
ZL 39 HOH 3415 6415 5207 HOH HOH 0 . 
ZL 39 HOH 3416 6416 5209 HOH HOH 0 . 
ZL 39 HOH 3417 6417 5211 HOH HOH 0 . 
ZL 39 HOH 3418 6418 5213 HOH HOH 0 . 
ZL 39 HOH 3419 6419 5214 HOH HOH 0 . 
ZL 39 HOH 3420 6420 5215 HOH HOH 0 . 
ZL 39 HOH 3421 6421 5216 HOH HOH 0 . 
ZL 39 HOH 3422 6422 5217 HOH HOH 0 . 
ZL 39 HOH 3423 6423 5219 HOH HOH 0 . 
ZL 39 HOH 3424 6424 5220 HOH HOH 0 . 
ZL 39 HOH 3425 6425 5221 HOH HOH 0 . 
ZL 39 HOH 3426 6426 5223 HOH HOH 0 . 
ZL 39 HOH 3427 6427 5224 HOH HOH 0 . 
ZL 39 HOH 3428 6428 5225 HOH HOH 0 . 
ZL 39 HOH 3429 6429 5226 HOH HOH 0 . 
ZL 39 HOH 3430 6430 5228 HOH HOH 0 . 
ZL 39 HOH 3431 6431 5229 HOH HOH 0 . 
ZL 39 HOH 3432 6432 5230 HOH HOH 0 . 
ZL 39 HOH 3433 6433 5232 HOH HOH 0 . 
ZL 39 HOH 3434 6434 5235 HOH HOH 0 . 
ZL 39 HOH 3435 6435 5236 HOH HOH 0 . 
ZL 39 HOH 3436 6436 5238 HOH HOH 0 . 
ZL 39 HOH 3437 6437 5239 HOH HOH 0 . 
ZL 39 HOH 3438 6438 5243 HOH HOH 0 . 
ZL 39 HOH 3439 6439 5244 HOH HOH 0 . 
ZL 39 HOH 3440 6440 5245 HOH HOH 0 . 
ZL 39 HOH 3441 6441 5246 HOH HOH 0 . 
ZL 39 HOH 3442 6442 5248 HOH HOH 0 . 
ZL 39 HOH 3443 6443 5250 HOH HOH 0 . 
ZL 39 HOH 3444 6444 5251 HOH HOH 0 . 
ZL 39 HOH 3445 6445 5252 HOH HOH 0 . 
ZL 39 HOH 3446 6446 5253 HOH HOH 0 . 
ZL 39 HOH 3447 6447 5254 HOH HOH 0 . 
ZL 39 HOH 3448 6448 5257 HOH HOH 0 . 
ZL 39 HOH 3449 6449 5258 HOH HOH 0 . 
ZL 39 HOH 3450 6450 5259 HOH HOH 0 . 
ZL 39 HOH 3451 6451 5260 HOH HOH 0 . 
ZL 39 HOH 3452 6452 5261 HOH HOH 0 . 
ZL 39 HOH 3453 6453 5263 HOH HOH 0 . 
ZL 39 HOH 3454 6454 5265 HOH HOH 0 . 
ZL 39 HOH 3455 6455 5266 HOH HOH 0 . 
ZL 39 HOH 3456 6456 5267 HOH HOH 0 . 
ZL 39 HOH 3457 6457 5268 HOH HOH 0 . 
ZL 39 HOH 3458 6458 5269 HOH HOH 0 . 
ZL 39 HOH 3459 6459 5270 HOH HOH 0 . 
ZL 39 HOH 3460 6460 5272 HOH HOH 0 . 
ZL 39 HOH 3461 6461 5273 HOH HOH 0 . 
ZL 39 HOH 3462 6462 5275 HOH HOH 0 . 
ZL 39 HOH 3463 6463 5276 HOH HOH 0 . 
ZL 39 HOH 3464 6464 5277 HOH HOH 0 . 
ZL 39 HOH 3465 6465 5278 HOH HOH 0 . 
ZL 39 HOH 3466 6466 5280 HOH HOH 0 . 
ZL 39 HOH 3467 6467 5282 HOH HOH 0 . 
ZL 39 HOH 3468 6468 5284 HOH HOH 0 . 
ZL 39 HOH 3469 6469 5285 HOH HOH 0 . 
ZL 39 HOH 3470 6470 5286 HOH HOH 0 . 
ZL 39 HOH 3471 6471 5287 HOH HOH 0 . 
ZL 39 HOH 3472 6472 5288 HOH HOH 0 . 
ZL 39 HOH 3473 6473 5289 HOH HOH 0 . 
ZL 39 HOH 3474 6474 5291 HOH HOH 0 . 
ZL 39 HOH 3475 6475 5292 HOH HOH 0 . 
ZL 39 HOH 3476 6476 5295 HOH HOH 0 . 
ZL 39 HOH 3477 6477 5296 HOH HOH 0 . 
ZL 39 HOH 3478 6478 5297 HOH HOH 0 . 
ZL 39 HOH 3479 6479 5299 HOH HOH 0 . 
ZL 39 HOH 3480 6480 5300 HOH HOH 0 . 
ZL 39 HOH 3481 6481 5301 HOH HOH 0 . 
ZL 39 HOH 3482 6482 5302 HOH HOH 0 . 
ZL 39 HOH 3483 6483 5303 HOH HOH 0 . 
ZL 39 HOH 3484 6484 5304 HOH HOH 0 . 
ZL 39 HOH 3485 6485 5307 HOH HOH 0 . 
ZL 39 HOH 3486 6486 5309 HOH HOH 0 . 
ZL 39 HOH 3487 6487 5310 HOH HOH 0 . 
ZL 39 HOH 3488 6488 5313 HOH HOH 0 . 
ZL 39 HOH 3489 6489 5314 HOH HOH 0 . 
ZL 39 HOH 3490 6490 5315 HOH HOH 0 . 
ZL 39 HOH 3491 6491 5320 HOH HOH 0 . 
ZL 39 HOH 3492 6492 5322 HOH HOH 0 . 
ZL 39 HOH 3493 6493 5323 HOH HOH 0 . 
ZL 39 HOH 3494 6494 5324 HOH HOH 0 . 
ZL 39 HOH 3495 6495 5325 HOH HOH 0 . 
ZL 39 HOH 3496 6496 5326 HOH HOH 0 . 
ZL 39 HOH 3497 6497 5327 HOH HOH 0 . 
ZL 39 HOH 3498 6498 5328 HOH HOH 0 . 
ZL 39 HOH 3499 6499 5329 HOH HOH 0 . 
ZL 39 HOH 3500 6500 5330 HOH HOH 0 . 
ZL 39 HOH 3501 6501 5332 HOH HOH 0 . 
ZL 39 HOH 3502 6502 5335 HOH HOH 0 . 
ZL 39 HOH 3503 6503 5336 HOH HOH 0 . 
ZL 39 HOH 3504 6504 5339 HOH HOH 0 . 
ZL 39 HOH 3505 6505 5341 HOH HOH 0 . 
ZL 39 HOH 3506 6506 5342 HOH HOH 0 . 
ZL 39 HOH 3507 6507 5343 HOH HOH 0 . 
ZL 39 HOH 3508 6508 5344 HOH HOH 0 . 
ZL 39 HOH 3509 6509 5345 HOH HOH 0 . 
ZL 39 HOH 3510 6510 5346 HOH HOH 0 . 
ZL 39 HOH 3511 6511 5347 HOH HOH 0 . 
ZL 39 HOH 3512 6512 5348 HOH HOH 0 . 
ZL 39 HOH 3513 6513 5349 HOH HOH 0 . 
ZL 39 HOH 3514 6514 5351 HOH HOH 0 . 
ZL 39 HOH 3515 6515 5352 HOH HOH 0 . 
ZL 39 HOH 3516 6516 5354 HOH HOH 0 . 
ZL 39 HOH 3517 6517 5355 HOH HOH 0 . 
ZL 39 HOH 3518 6518 5359 HOH HOH 0 . 
ZL 39 HOH 3519 6519 5362 HOH HOH 0 . 
ZL 39 HOH 3520 6520 5363 HOH HOH 0 . 
ZL 39 HOH 3521 6521 5365 HOH HOH 0 . 
ZL 39 HOH 3522 6522 5368 HOH HOH 0 . 
ZL 39 HOH 3523 6523 5369 HOH HOH 0 . 
ZL 39 HOH 3524 6524 5370 HOH HOH 0 . 
ZL 39 HOH 3525 6525 5372 HOH HOH 0 . 
ZL 39 HOH 3526 6526 5373 HOH HOH 0 . 
ZL 39 HOH 3527 6527 5374 HOH HOH 0 . 
ZL 39 HOH 3528 6528 5375 HOH HOH 0 . 
ZL 39 HOH 3529 6529 5376 HOH HOH 0 . 
ZL 39 HOH 3530 6530 5377 HOH HOH 0 . 
ZL 39 HOH 3531 6531 5378 HOH HOH 0 . 
ZL 39 HOH 3532 6532 5380 HOH HOH 0 . 
ZL 39 HOH 3533 6533 5381 HOH HOH 0 . 
ZL 39 HOH 3534 6534 5382 HOH HOH 0 . 
ZL 39 HOH 3535 6535 5383 HOH HOH 0 . 
ZL 39 HOH 3536 6536 5384 HOH HOH 0 . 
ZL 39 HOH 3537 6537 5387 HOH HOH 0 . 
ZL 39 HOH 3538 6538 5388 HOH HOH 0 . 
ZL 39 HOH 3539 6539 5391 HOH HOH 0 . 
ZL 39 HOH 3540 6540 5392 HOH HOH 0 . 
ZL 39 HOH 3541 6541 5393 HOH HOH 0 . 
ZL 39 HOH 3542 6542 5394 HOH HOH 0 . 
ZL 39 HOH 3543 6543 5395 HOH HOH 0 . 
ZL 39 HOH 3544 6544 5396 HOH HOH 0 . 
ZL 39 HOH 3545 6545 5397 HOH HOH 0 . 
ZL 39 HOH 3546 6546 5399 HOH HOH 0 . 
ZL 39 HOH 3547 6547 5401 HOH HOH 0 . 
ZL 39 HOH 3548 6548 5402 HOH HOH 0 . 
ZL 39 HOH 3549 6549 5403 HOH HOH 0 . 
ZL 39 HOH 3550 6550 5405 HOH HOH 0 . 
ZL 39 HOH 3551 6551 5406 HOH HOH 0 . 
ZL 39 HOH 3552 6552 5407 HOH HOH 0 . 
ZL 39 HOH 3553 6553 5409 HOH HOH 0 . 
ZL 39 HOH 3554 6554 5410 HOH HOH 0 . 
ZL 39 HOH 3555 6555 5411 HOH HOH 0 . 
ZL 39 HOH 3556 6556 5412 HOH HOH 0 . 
ZL 39 HOH 3557 6557 5415 HOH HOH 0 . 
ZL 39 HOH 3558 6558 5417 HOH HOH 0 . 
ZL 39 HOH 3559 6559 5418 HOH HOH 0 . 
ZL 39 HOH 3560 6560 5419 HOH HOH 0 . 
ZL 39 HOH 3561 6561 5421 HOH HOH 0 . 
ZL 39 HOH 3562 6562 5422 HOH HOH 0 . 
ZL 39 HOH 3563 6563 5423 HOH HOH 0 . 
ZL 39 HOH 3564 6564 5424 HOH HOH 0 . 
ZL 39 HOH 3565 6565 5426 HOH HOH 0 . 
ZL 39 HOH 3566 6566 5428 HOH HOH 0 . 
ZL 39 HOH 3567 6567 5429 HOH HOH 0 . 
ZL 39 HOH 3568 6568 5431 HOH HOH 0 . 
ZL 39 HOH 3569 6569 5432 HOH HOH 0 . 
ZL 39 HOH 3570 6570 5433 HOH HOH 0 . 
ZL 39 HOH 3571 6571 5434 HOH HOH 0 . 
ZL 39 HOH 3572 6572 5436 HOH HOH 0 . 
ZL 39 HOH 3573 6573 5437 HOH HOH 0 . 
ZL 39 HOH 3574 6574 5438 HOH HOH 0 . 
ZL 39 HOH 3575 6575 5439 HOH HOH 0 . 
ZL 39 HOH 3576 6576 5441 HOH HOH 0 . 
ZL 39 HOH 3577 6577 5443 HOH HOH 0 . 
ZL 39 HOH 3578 6578 5445 HOH HOH 0 . 
ZL 39 HOH 3579 6579 5446 HOH HOH 0 . 
ZL 39 HOH 3580 6580 5447 HOH HOH 0 . 
ZL 39 HOH 3581 6581 5449 HOH HOH 0 . 
ZL 39 HOH 3582 6582 5450 HOH HOH 0 . 
ZL 39 HOH 3583 6583 5451 HOH HOH 0 . 
ZL 39 HOH 3584 6584 5452 HOH HOH 0 . 
ZL 39 HOH 3585 6585 5453 HOH HOH 0 . 
ZL 39 HOH 3586 6586 5454 HOH HOH 0 . 
ZL 39 HOH 3587 6587 5455 HOH HOH 0 . 
ZL 39 HOH 3588 6588 5456 HOH HOH 0 . 
ZL 39 HOH 3589 6589 5457 HOH HOH 0 . 
ZL 39 HOH 3590 6590 5459 HOH HOH 0 . 
ZL 39 HOH 3591 6591 5461 HOH HOH 0 . 
ZL 39 HOH 3592 6592 5462 HOH HOH 0 . 
ZL 39 HOH 3593 6593 5463 HOH HOH 0 . 
ZL 39 HOH 3594 6594 5464 HOH HOH 0 . 
ZL 39 HOH 3595 6595 5465 HOH HOH 0 . 
ZL 39 HOH 3596 6596 5467 HOH HOH 0 . 
ZL 39 HOH 3597 6597 5468 HOH HOH 0 . 
ZL 39 HOH 3598 6598 5469 HOH HOH 0 . 
ZL 39 HOH 3599 6599 5470 HOH HOH 0 . 
ZL 39 HOH 3600 6600 5472 HOH HOH 0 . 
ZL 39 HOH 3601 6601 5473 HOH HOH 0 . 
ZL 39 HOH 3602 6602 5474 HOH HOH 0 . 
ZL 39 HOH 3603 6603 5475 HOH HOH 0 . 
ZL 39 HOH 3604 6604 5476 HOH HOH 0 . 
ZL 39 HOH 3605 6605 5477 HOH HOH 0 . 
ZL 39 HOH 3606 6606 5479 HOH HOH 0 . 
ZL 39 HOH 3607 6607 5480 HOH HOH 0 . 
ZL 39 HOH 3608 6608 5481 HOH HOH 0 . 
ZL 39 HOH 3609 6609 5485 HOH HOH 0 . 
ZL 39 HOH 3610 6610 5486 HOH HOH 0 . 
ZL 39 HOH 3611 6611 5488 HOH HOH 0 . 
ZL 39 HOH 3612 6612 5489 HOH HOH 0 . 
ZL 39 HOH 3613 6613 5490 HOH HOH 0 . 
ZL 39 HOH 3614 6614 5492 HOH HOH 0 . 
ZL 39 HOH 3615 6615 5493 HOH HOH 0 . 
ZL 39 HOH 3616 6616 5494 HOH HOH 0 . 
ZL 39 HOH 3617 6617 5496 HOH HOH 0 . 
ZL 39 HOH 3618 6618 5497 HOH HOH 0 . 
ZL 39 HOH 3619 6619 5500 HOH HOH 0 . 
ZL 39 HOH 3620 6620 5501 HOH HOH 0 . 
ZL 39 HOH 3621 6621 5502 HOH HOH 0 . 
ZL 39 HOH 3622 6622 5503 HOH HOH 0 . 
ZL 39 HOH 3623 6623 5506 HOH HOH 0 . 
ZL 39 HOH 3624 6624 5507 HOH HOH 0 . 
ZL 39 HOH 3625 6625 5508 HOH HOH 0 . 
ZL 39 HOH 3626 6626 5509 HOH HOH 0 . 
ZL 39 HOH 3627 6627 5510 HOH HOH 0 . 
ZL 39 HOH 3628 6628 5512 HOH HOH 0 . 
ZL 39 HOH 3629 6629 5513 HOH HOH 0 . 
ZL 39 HOH 3630 6630 5514 HOH HOH 0 . 
ZL 39 HOH 3631 6631 5515 HOH HOH 0 . 
ZL 39 HOH 3632 6632 5516 HOH HOH 0 . 
ZL 39 HOH 3633 6633 5517 HOH HOH 0 . 
ZL 39 HOH 3634 6634 5520 HOH HOH 0 . 
ZL 39 HOH 3635 6635 5524 HOH HOH 0 . 
ZL 39 HOH 3636 6636 5525 HOH HOH 0 . 
ZL 39 HOH 3637 6637 5526 HOH HOH 0 . 
ZL 39 HOH 3638 6638 5527 HOH HOH 0 . 
ZL 39 HOH 3639 6639 5531 HOH HOH 0 . 
ZL 39 HOH 3640 6640 5532 HOH HOH 0 . 
ZL 39 HOH 3641 6641 5533 HOH HOH 0 . 
ZL 39 HOH 3642 6642 5536 HOH HOH 0 . 
ZL 39 HOH 3643 6643 5538 HOH HOH 0 . 
ZL 39 HOH 3644 6644 5539 HOH HOH 0 . 
ZL 39 HOH 3645 6645 5540 HOH HOH 0 . 
ZL 39 HOH 3646 6646 5541 HOH HOH 0 . 
ZL 39 HOH 3647 6647 5542 HOH HOH 0 . 
ZL 39 HOH 3648 6648 5543 HOH HOH 0 . 
ZL 39 HOH 3649 6649 5544 HOH HOH 0 . 
ZL 39 HOH 3650 6650 5546 HOH HOH 0 . 
ZL 39 HOH 3651 6651 5547 HOH HOH 0 . 
ZL 39 HOH 3652 6652 5548 HOH HOH 0 . 
ZL 39 HOH 3653 6653 5549 HOH HOH 0 . 
ZL 39 HOH 3654 6654 5550 HOH HOH 0 . 
ZL 39 HOH 3655 6655 5552 HOH HOH 0 . 
ZL 39 HOH 3656 6656 5554 HOH HOH 0 . 
ZL 39 HOH 3657 6657 5555 HOH HOH 0 . 
ZL 39 HOH 3658 6658 5556 HOH HOH 0 . 
ZL 39 HOH 3659 6659 5557 HOH HOH 0 . 
ZL 39 HOH 3660 6660 5559 HOH HOH 0 . 
ZL 39 HOH 3661 6661 5560 HOH HOH 0 . 
ZL 39 HOH 3662 6662 5562 HOH HOH 0 . 
ZL 39 HOH 3663 6663 5563 HOH HOH 0 . 
ZL 39 HOH 3664 6664 5565 HOH HOH 0 . 
ZL 39 HOH 3665 6665 5566 HOH HOH 0 . 
ZL 39 HOH 3666 6666 5567 HOH HOH 0 . 
ZL 39 HOH 3667 6667 5568 HOH HOH 0 . 
ZL 39 HOH 3668 6668 5569 HOH HOH 0 . 
ZL 39 HOH 3669 6669 5570 HOH HOH 0 . 
ZL 39 HOH 3670 6670 5571 HOH HOH 0 . 
ZL 39 HOH 3671 6671 5573 HOH HOH 0 . 
ZL 39 HOH 3672 6672 5574 HOH HOH 0 . 
ZL 39 HOH 3673 6673 5575 HOH HOH 0 . 
ZL 39 HOH 3674 6674 5577 HOH HOH 0 . 
ZL 39 HOH 3675 6675 5579 HOH HOH 0 . 
ZL 39 HOH 3676 6676 5580 HOH HOH 0 . 
ZL 39 HOH 3677 6677 5581 HOH HOH 0 . 
ZL 39 HOH 3678 6678 5582 HOH HOH 0 . 
ZL 39 HOH 3679 6679 5584 HOH HOH 0 . 
ZL 39 HOH 3680 6680 5585 HOH HOH 0 . 
ZL 39 HOH 3681 6681 5586 HOH HOH 0 . 
ZL 39 HOH 3682 6682 5587 HOH HOH 0 . 
ZL 39 HOH 3683 6683 5588 HOH HOH 0 . 
ZL 39 HOH 3684 6684 5589 HOH HOH 0 . 
ZL 39 HOH 3685 6685 5593 HOH HOH 0 . 
ZL 39 HOH 3686 6686 5595 HOH HOH 0 . 
ZL 39 HOH 3687 6687 5596 HOH HOH 0 . 
ZL 39 HOH 3688 6688 5601 HOH HOH 0 . 
ZL 39 HOH 3689 6689 5602 HOH HOH 0 . 
ZL 39 HOH 3690 6690 5603 HOH HOH 0 . 
ZL 39 HOH 3691 6691 5604 HOH HOH 0 . 
ZL 39 HOH 3692 6692 5605 HOH HOH 0 . 
ZL 39 HOH 3693 6693 5606 HOH HOH 0 . 
ZL 39 HOH 3694 6694 5607 HOH HOH 0 . 
ZL 39 HOH 3695 6695 5608 HOH HOH 0 . 
ZL 39 HOH 3696 6696 5609 HOH HOH 0 . 
ZL 39 HOH 3697 6697 5610 HOH HOH 0 . 
ZL 39 HOH 3698 6698 5611 HOH HOH 0 . 
ZL 39 HOH 3699 6699 5612 HOH HOH 0 . 
ZL 39 HOH 3700 6700 5613 HOH HOH 0 . 
ZL 39 HOH 3701 6701 5615 HOH HOH 0 . 
ZL 39 HOH 3702 6702 5617 HOH HOH 0 . 
ZL 39 HOH 3703 6703 5619 HOH HOH 0 . 
ZL 39 HOH 3704 6704 5623 HOH HOH 0 . 
ZL 39 HOH 3705 6705 5624 HOH HOH 0 . 
ZL 39 HOH 3706 6706 5625 HOH HOH 0 . 
ZL 39 HOH 3707 6707 5626 HOH HOH 0 . 
ZL 39 HOH 3708 6708 5629 HOH HOH 0 . 
ZL 39 HOH 3709 6709 5630 HOH HOH 0 . 
ZL 39 HOH 3710 6710 5631 HOH HOH 0 . 
ZL 39 HOH 3711 6711 5633 HOH HOH 0 . 
ZL 39 HOH 3712 6712 5634 HOH HOH 0 . 
ZL 39 HOH 3713 6713 5635 HOH HOH 0 . 
ZL 39 HOH 3714 6714 5636 HOH HOH 0 . 
ZL 39 HOH 3715 6715 5637 HOH HOH 0 . 
ZL 39 HOH 3716 6716 5643 HOH HOH 0 . 
ZL 39 HOH 3717 6717 5644 HOH HOH 0 . 
ZL 39 HOH 3718 6718 5645 HOH HOH 0 . 
ZL 39 HOH 3719 6719 5647 HOH HOH 0 . 
ZL 39 HOH 3720 6720 5649 HOH HOH 0 . 
ZL 39 HOH 3721 6721 5650 HOH HOH 0 . 
ZL 39 HOH 3722 6722 5651 HOH HOH 0 . 
ZL 39 HOH 3723 6723 5652 HOH HOH 0 . 
ZL 39 HOH 3724 6724 5653 HOH HOH 0 . 
ZL 39 HOH 3725 6725 5654 HOH HOH 0 . 
ZL 39 HOH 3726 6726 5655 HOH HOH 0 . 
ZL 39 HOH 3727 6727 5656 HOH HOH 0 . 
ZL 39 HOH 3728 6728 5657 HOH HOH 0 . 
ZL 39 HOH 3729 6729 5658 HOH HOH 0 . 
ZL 39 HOH 3730 6730 5659 HOH HOH 0 . 
ZL 39 HOH 3731 6731 5660 HOH HOH 0 . 
ZL 39 HOH 3732 6732 5662 HOH HOH 0 . 
ZL 39 HOH 3733 6733 5664 HOH HOH 0 . 
ZL 39 HOH 3734 6734 5666 HOH HOH 0 . 
ZL 39 HOH 3735 6735 5667 HOH HOH 0 . 
ZL 39 HOH 3736 6736 5668 HOH HOH 0 . 
ZL 39 HOH 3737 6737 5669 HOH HOH 0 . 
ZL 39 HOH 3738 6738 5670 HOH HOH 0 . 
ZL 39 HOH 3739 6739 5672 HOH HOH 0 . 
ZL 39 HOH 3740 6740 5673 HOH HOH 0 . 
ZL 39 HOH 3741 6741 5674 HOH HOH 0 . 
ZL 39 HOH 3742 6742 5676 HOH HOH 0 . 
ZL 39 HOH 3743 6743 5677 HOH HOH 0 . 
ZL 39 HOH 3744 6744 5678 HOH HOH 0 . 
ZL 39 HOH 3745 6745 5679 HOH HOH 0 . 
ZL 39 HOH 3746 6746 5680 HOH HOH 0 . 
ZL 39 HOH 3747 6747 5681 HOH HOH 0 . 
ZL 39 HOH 3748 6748 5682 HOH HOH 0 . 
ZL 39 HOH 3749 6749 5683 HOH HOH 0 . 
ZL 39 HOH 3750 6750 5685 HOH HOH 0 . 
ZL 39 HOH 3751 6751 5687 HOH HOH 0 . 
ZL 39 HOH 3752 6752 5688 HOH HOH 0 . 
ZL 39 HOH 3753 6753 5689 HOH HOH 0 . 
ZL 39 HOH 3754 6754 5692 HOH HOH 0 . 
ZL 39 HOH 3755 6755 5693 HOH HOH 0 . 
ZL 39 HOH 3756 6756 5694 HOH HOH 0 . 
ZL 39 HOH 3757 6757 5695 HOH HOH 0 . 
ZL 39 HOH 3758 6758 5697 HOH HOH 0 . 
ZL 39 HOH 3759 6759 5698 HOH HOH 0 . 
ZL 39 HOH 3760 6760 5699 HOH HOH 0 . 
ZL 39 HOH 3761 6761 5700 HOH HOH 0 . 
ZL 39 HOH 3762 6762 5701 HOH HOH 0 . 
ZL 39 HOH 3763 6763 5703 HOH HOH 0 . 
ZL 39 HOH 3764 6764 5704 HOH HOH 0 . 
ZL 39 HOH 3765 6765 5705 HOH HOH 0 . 
ZL 39 HOH 3766 6766 5709 HOH HOH 0 . 
ZL 39 HOH 3767 6767 5710 HOH HOH 0 . 
ZL 39 HOH 3768 6768 5711 HOH HOH 0 . 
ZL 39 HOH 3769 6769 5712 HOH HOH 0 . 
ZL 39 HOH 3770 6770 5713 HOH HOH 0 . 
ZL 39 HOH 3771 6771 5714 HOH HOH 0 . 
ZL 39 HOH 3772 6772 5715 HOH HOH 0 . 
ZL 39 HOH 3773 6773 5716 HOH HOH 0 . 
ZL 39 HOH 3774 6774 5717 HOH HOH 0 . 
ZL 39 HOH 3775 6775 5718 HOH HOH 0 . 
ZL 39 HOH 3776 6776 5720 HOH HOH 0 . 
ZL 39 HOH 3777 6777 5721 HOH HOH 0 . 
ZL 39 HOH 3778 6778 5722 HOH HOH 0 . 
ZL 39 HOH 3779 6779 5723 HOH HOH 0 . 
ZL 39 HOH 3780 6780 5724 HOH HOH 0 . 
ZL 39 HOH 3781 6781 5726 HOH HOH 0 . 
ZL 39 HOH 3782 6782 5731 HOH HOH 0 . 
ZL 39 HOH 3783 6783 5732 HOH HOH 0 . 
ZL 39 HOH 3784 6784 5734 HOH HOH 0 . 
ZL 39 HOH 3785 6785 5735 HOH HOH 0 . 
ZL 39 HOH 3786 6786 5736 HOH HOH 0 . 
ZL 39 HOH 3787 6787 5738 HOH HOH 0 . 
ZL 39 HOH 3788 6788 5739 HOH HOH 0 . 
ZL 39 HOH 3789 6789 5740 HOH HOH 0 . 
ZL 39 HOH 3790 6790 5741 HOH HOH 0 . 
ZL 39 HOH 3791 6791 5742 HOH HOH 0 . 
ZL 39 HOH 3792 6792 5743 HOH HOH 0 . 
ZL 39 HOH 3793 6793 5744 HOH HOH 0 . 
ZL 39 HOH 3794 6794 5745 HOH HOH 0 . 
ZL 39 HOH 3795 6795 5746 HOH HOH 0 . 
ZL 39 HOH 3796 6796 5748 HOH HOH 0 . 
ZL 39 HOH 3797 6797 5749 HOH HOH 0 . 
ZL 39 HOH 3798 6798 5753 HOH HOH 0 . 
ZL 39 HOH 3799 6799 5755 HOH HOH 0 . 
ZL 39 HOH 3800 6800 5756 HOH HOH 0 . 
ZL 39 HOH 3801 6801 5757 HOH HOH 0 . 
ZL 39 HOH 3802 6802 5760 HOH HOH 0 . 
ZL 39 HOH 3803 6803 5761 HOH HOH 0 . 
ZL 39 HOH 3804 6804 5762 HOH HOH 0 . 
ZL 39 HOH 3805 6805 5764 HOH HOH 0 . 
ZL 39 HOH 3806 6806 5765 HOH HOH 0 . 
ZL 39 HOH 3807 6807 5768 HOH HOH 0 . 
ZL 39 HOH 3808 6808 5770 HOH HOH 0 . 
ZL 39 HOH 3809 6809 5771 HOH HOH 0 . 
ZL 39 HOH 3810 6810 5772 HOH HOH 0 . 
ZL 39 HOH 3811 6811 5773 HOH HOH 0 . 
ZL 39 HOH 3812 6812 5774 HOH HOH 0 . 
ZL 39 HOH 3813 6813 5775 HOH HOH 0 . 
ZL 39 HOH 3814 6814 5776 HOH HOH 0 . 
ZL 39 HOH 3815 6815 5777 HOH HOH 0 . 
ZL 39 HOH 3816 6816 5779 HOH HOH 0 . 
ZL 39 HOH 3817 6817 5781 HOH HOH 0 . 
ZL 39 HOH 3818 6818 5782 HOH HOH 0 . 
ZL 39 HOH 3819 6819 5783 HOH HOH 0 . 
ZL 39 HOH 3820 6820 5784 HOH HOH 0 . 
ZL 39 HOH 3821 6821 5785 HOH HOH 0 . 
ZL 39 HOH 3822 6822 5786 HOH HOH 0 . 
ZL 39 HOH 3823 6823 5787 HOH HOH 0 . 
ZL 39 HOH 3824 6824 5788 HOH HOH 0 . 
ZL 39 HOH 3825 6825 5789 HOH HOH 0 . 
ZL 39 HOH 3826 6826 5790 HOH HOH 0 . 
ZL 39 HOH 3827 6827 5791 HOH HOH 0 . 
ZL 39 HOH 3828 6828 5792 HOH HOH 0 . 
ZL 39 HOH 3829 6829 5793 HOH HOH 0 . 
ZL 39 HOH 3830 6830 5794 HOH HOH 0 . 
ZL 39 HOH 3831 6831 5796 HOH HOH 0 . 
ZL 39 HOH 3832 6832 5797 HOH HOH 0 . 
ZL 39 HOH 3833 6833 5798 HOH HOH 0 . 
ZL 39 HOH 3834 6834 5799 HOH HOH 0 . 
ZL 39 HOH 3835 6835 5800 HOH HOH 0 . 
ZL 39 HOH 3836 6836 5801 HOH HOH 0 . 
ZL 39 HOH 3837 6837 5802 HOH HOH 0 . 
ZL 39 HOH 3838 6838 5803 HOH HOH 0 . 
ZL 39 HOH 3839 6839 5804 HOH HOH 0 . 
ZL 39 HOH 3840 6840 5805 HOH HOH 0 . 
ZL 39 HOH 3841 6841 5806 HOH HOH 0 . 
ZL 39 HOH 3842 6842 5807 HOH HOH 0 . 
ZL 39 HOH 3843 6843 5808 HOH HOH 0 . 
ZL 39 HOH 3844 6844 5809 HOH HOH 0 . 
ZL 39 HOH 3845 6845 5812 HOH HOH 0 . 
ZL 39 HOH 3846 6846 5815 HOH HOH 0 . 
ZL 39 HOH 3847 6847 5818 HOH HOH 0 . 
ZL 39 HOH 3848 6848 5819 HOH HOH 0 . 
ZL 39 HOH 3849 6849 5820 HOH HOH 0 . 
ZL 39 HOH 3850 6850 5821 HOH HOH 0 . 
ZL 39 HOH 3851 6851 5823 HOH HOH 0 . 
ZL 39 HOH 3852 6852 5824 HOH HOH 0 . 
ZL 39 HOH 3853 6853 5825 HOH HOH 0 . 
ZL 39 HOH 3854 6854 5826 HOH HOH 0 . 
ZL 39 HOH 3855 6855 5827 HOH HOH 0 . 
ZL 39 HOH 3856 6856 5829 HOH HOH 0 . 
ZL 39 HOH 3857 6857 5830 HOH HOH 0 . 
ZL 39 HOH 3858 6858 5831 HOH HOH 0 . 
ZL 39 HOH 3859 6859 5833 HOH HOH 0 . 
ZL 39 HOH 3860 6860 5835 HOH HOH 0 . 
ZL 39 HOH 3861 6861 5838 HOH HOH 0 . 
ZL 39 HOH 3862 6862 5839 HOH HOH 0 . 
ZL 39 HOH 3863 6863 5843 HOH HOH 0 . 
ZL 39 HOH 3864 6864 5844 HOH HOH 0 . 
ZL 39 HOH 3865 6865 5845 HOH HOH 0 . 
ZL 39 HOH 3866 6866 5846 HOH HOH 0 . 
ZL 39 HOH 3867 6867 5847 HOH HOH 0 . 
ZL 39 HOH 3868 6868 5848 HOH HOH 0 . 
ZL 39 HOH 3869 6869 5850 HOH HOH 0 . 
ZL 39 HOH 3870 6870 5852 HOH HOH 0 . 
ZL 39 HOH 3871 6871 5854 HOH HOH 0 . 
ZL 39 HOH 3872 6872 5856 HOH HOH 0 . 
ZL 39 HOH 3873 6873 5857 HOH HOH 0 . 
ZL 39 HOH 3874 6874 5859 HOH HOH 0 . 
ZL 39 HOH 3875 6875 5860 HOH HOH 0 . 
ZL 39 HOH 3876 6876 5863 HOH HOH 0 . 
ZL 39 HOH 3877 6877 5867 HOH HOH 0 . 
ZL 39 HOH 3878 6878 5868 HOH HOH 0 . 
ZL 39 HOH 3879 6879 5869 HOH HOH 0 . 
ZL 39 HOH 3880 6880 5872 HOH HOH 0 . 
ZL 39 HOH 3881 6881 5874 HOH HOH 0 . 
ZL 39 HOH 3882 6882 5875 HOH HOH 0 . 
ZL 39 HOH 3883 6883 5876 HOH HOH 0 . 
ZL 39 HOH 3884 6884 5877 HOH HOH 0 . 
ZL 39 HOH 3885 6885 5878 HOH HOH 0 . 
ZL 39 HOH 3886 6886 5879 HOH HOH 0 . 
ZL 39 HOH 3887 6887 5880 HOH HOH 0 . 
ZL 39 HOH 3888 6888 5882 HOH HOH 0 . 
ZL 39 HOH 3889 6889 5883 HOH HOH 0 . 
ZL 39 HOH 3890 6890 5884 HOH HOH 0 . 
ZL 39 HOH 3891 6891 5886 HOH HOH 0 . 
ZL 39 HOH 3892 6892 5887 HOH HOH 0 . 
ZL 39 HOH 3893 6893 5889 HOH HOH 0 . 
ZL 39 HOH 3894 6894 5890 HOH HOH 0 . 
ZL 39 HOH 3895 6895 5893 HOH HOH 0 . 
ZL 39 HOH 3896 6896 5894 HOH HOH 0 . 
ZL 39 HOH 3897 6897 5895 HOH HOH 0 . 
ZL 39 HOH 3898 6898 5896 HOH HOH 0 . 
ZL 39 HOH 3899 6899 5898 HOH HOH 0 . 
ZL 39 HOH 3900 6900 5900 HOH HOH 0 . 
ZL 39 HOH 3901 6901 5901 HOH HOH 0 . 
ZL 39 HOH 3902 6902 5902 HOH HOH 0 . 
ZL 39 HOH 3903 6903 5905 HOH HOH 0 . 
ZL 39 HOH 3904 6904 5906 HOH HOH 0 . 
ZL 39 HOH 3905 6905 5909 HOH HOH 0 . 
ZL 39 HOH 3906 6906 5910 HOH HOH 0 . 
ZL 39 HOH 3907 6907 5911 HOH HOH 0 . 
ZL 39 HOH 3908 6908 5912 HOH HOH 0 . 
ZL 39 HOH 3909 6909 5914 HOH HOH 0 . 
ZL 39 HOH 3910 6910 5916 HOH HOH 0 . 
ZL 39 HOH 3911 6911 5917 HOH HOH 0 . 
ZL 39 HOH 3912 6912 5918 HOH HOH 0 . 
ZL 39 HOH 3913 6913 5920 HOH HOH 0 . 
ZL 39 HOH 3914 6914 5921 HOH HOH 0 . 
ZL 39 HOH 3915 6915 5922 HOH HOH 0 . 
ZL 39 HOH 3916 6916 5924 HOH HOH 0 . 
ZL 39 HOH 3917 6917 5925 HOH HOH 0 . 
ZL 39 HOH 3918 6918 5926 HOH HOH 0 . 
ZL 39 HOH 3919 6919 5927 HOH HOH 0 . 
ZL 39 HOH 3920 6920 5928 HOH HOH 0 . 
ZL 39 HOH 3921 6921 5930 HOH HOH 0 . 
ZL 39 HOH 3922 6922 5931 HOH HOH 0 . 
ZL 39 HOH 3923 6923 5932 HOH HOH 0 . 
ZL 39 HOH 3924 6924 5933 HOH HOH 0 . 
ZL 39 HOH 3925 6925 5935 HOH HOH 0 . 
ZL 39 HOH 3926 6926 5937 HOH HOH 0 . 
ZL 39 HOH 3927 6927 5938 HOH HOH 0 . 
ZL 39 HOH 3928 6928 5939 HOH HOH 0 . 
ZL 39 HOH 3929 6929 5941 HOH HOH 0 . 
ZL 39 HOH 3930 6930 5944 HOH HOH 0 . 
ZL 39 HOH 3931 6931 5945 HOH HOH 0 . 
ZL 39 HOH 3932 6932 5946 HOH HOH 0 . 
ZL 39 HOH 3933 6933 5947 HOH HOH 0 . 
ZL 39 HOH 3934 6934 5948 HOH HOH 0 . 
ZL 39 HOH 3935 6935 5951 HOH HOH 0 . 
ZL 39 HOH 3936 6936 5952 HOH HOH 0 . 
ZL 39 HOH 3937 6937 5953 HOH HOH 0 . 
ZL 39 HOH 3938 6938 5954 HOH HOH 0 . 
ZL 39 HOH 3939 6939 5955 HOH HOH 0 . 
ZL 39 HOH 3940 6940 5956 HOH HOH 0 . 
ZL 39 HOH 3941 6941 5957 HOH HOH 0 . 
ZL 39 HOH 3942 6942 5958 HOH HOH 0 . 
ZL 39 HOH 3943 6943 5959 HOH HOH 0 . 
ZL 39 HOH 3944 6944 5960 HOH HOH 0 . 
ZL 39 HOH 3945 6945 5962 HOH HOH 0 . 
ZL 39 HOH 3946 6946 5963 HOH HOH 0 . 
ZL 39 HOH 3947 6947 5964 HOH HOH 0 . 
ZL 39 HOH 3948 6948 5965 HOH HOH 0 . 
ZL 39 HOH 3949 6949 5967 HOH HOH 0 . 
ZL 39 HOH 3950 6950 5968 HOH HOH 0 . 
ZL 39 HOH 3951 6951 5969 HOH HOH 0 . 
ZL 39 HOH 3952 6952 5970 HOH HOH 0 . 
ZL 39 HOH 3953 6953 5972 HOH HOH 0 . 
ZL 39 HOH 3954 6954 5973 HOH HOH 0 . 
ZL 39 HOH 3955 6955 5974 HOH HOH 0 . 
ZL 39 HOH 3956 6956 5975 HOH HOH 0 . 
ZL 39 HOH 3957 6957 5976 HOH HOH 0 . 
ZL 39 HOH 3958 6958 5977 HOH HOH 0 . 
ZL 39 HOH 3959 6959 5978 HOH HOH 0 . 
ZL 39 HOH 3960 6960 5980 HOH HOH 0 . 
ZL 39 HOH 3961 6961 5982 HOH HOH 0 . 
ZL 39 HOH 3962 6962 5984 HOH HOH 0 . 
ZL 39 HOH 3963 6963 5985 HOH HOH 0 . 
ZL 39 HOH 3964 6964 5987 HOH HOH 0 . 
ZL 39 HOH 3965 6965 5988 HOH HOH 0 . 
ZL 39 HOH 3966 6966 5989 HOH HOH 0 . 
ZL 39 HOH 3967 6967 5991 HOH HOH 0 . 
ZL 39 HOH 3968 6968 5992 HOH HOH 0 . 
ZL 39 HOH 3969 6969 5993 HOH HOH 0 . 
ZL 39 HOH 3970 6970 5994 HOH HOH 0 . 
ZL 39 HOH 3971 6971 5995 HOH HOH 0 . 
ZL 39 HOH 3972 6972 5997 HOH HOH 0 . 
ZL 39 HOH 3973 6973 5999 HOH HOH 0 . 
ZL 39 HOH 3974 6974 6000 HOH HOH 0 . 
ZL 39 HOH 3975 6975 6002 HOH HOH 0 . 
ZL 39 HOH 3976 6976 6003 HOH HOH 0 . 
ZL 39 HOH 3977 6977 6004 HOH HOH 0 . 
ZL 39 HOH 3978 6978 6005 HOH HOH 0 . 
ZL 39 HOH 3979 6979 6009 HOH HOH 0 . 
ZL 39 HOH 3980 6980 6010 HOH HOH 0 . 
ZL 39 HOH 3981 6981 6011 HOH HOH 0 . 
ZL 39 HOH 3982 6982 6012 HOH HOH 0 . 
ZL 39 HOH 3983 6983 6013 HOH HOH 0 . 
ZL 39 HOH 3984 6984 6014 HOH HOH 0 . 
ZL 39 HOH 3985 6985 6018 HOH HOH 0 . 
ZL 39 HOH 3986 6986 6019 HOH HOH 0 . 
ZL 39 HOH 3987 6987 6021 HOH HOH 0 . 
ZL 39 HOH 3988 6988 6022 HOH HOH 0 . 
ZL 39 HOH 3989 6989 6024 HOH HOH 0 . 
ZL 39 HOH 3990 6990 6025 HOH HOH 0 . 
ZL 39 HOH 3991 6991 6026 HOH HOH 0 . 
ZL 39 HOH 3992 6992 6028 HOH HOH 0 . 
ZL 39 HOH 3993 6993 6029 HOH HOH 0 . 
ZL 39 HOH 3994 6994 6031 HOH HOH 0 . 
ZL 39 HOH 3995 6995 6032 HOH HOH 0 . 
ZL 39 HOH 3996 6996 6033 HOH HOH 0 . 
ZL 39 HOH 3997 6997 6034 HOH HOH 0 . 
ZL 39 HOH 3998 6998 6035 HOH HOH 0 . 
ZL 39 HOH 3999 6999 6036 HOH HOH 0 . 
ZL 39 HOH 4000 7000 6037 HOH HOH 0 . 
ZL 39 HOH 4001 7001 6040 HOH HOH 0 . 
ZL 39 HOH 4002 7002 6042 HOH HOH 0 . 
ZL 39 HOH 4003 7003 6043 HOH HOH 0 . 
ZL 39 HOH 4004 7004 6045 HOH HOH 0 . 
ZL 39 HOH 4005 7005 6047 HOH HOH 0 . 
ZL 39 HOH 4006 7006 6048 HOH HOH 0 . 
ZL 39 HOH 4007 7007 6049 HOH HOH 0 . 
ZL 39 HOH 4008 7008 6050 HOH HOH 0 . 
ZL 39 HOH 4009 7009 6054 HOH HOH 0 . 
ZL 39 HOH 4010 7010 6055 HOH HOH 0 . 
ZL 39 HOH 4011 7011 6057 HOH HOH 0 . 
ZL 39 HOH 4012 7012 6058 HOH HOH 0 . 
ZL 39 HOH 4013 7013 6059 HOH HOH 0 . 
ZL 39 HOH 4014 7014 6060 HOH HOH 0 . 
ZL 39 HOH 4015 7015 6061 HOH HOH 0 . 
ZL 39 HOH 4016 7016 6062 HOH HOH 0 . 
ZL 39 HOH 4017 7017 6063 HOH HOH 0 . 
ZL 39 HOH 4018 7018 6065 HOH HOH 0 . 
ZL 39 HOH 4019 7019 6066 HOH HOH 0 . 
ZL 39 HOH 4020 7020 6068 HOH HOH 0 . 
ZL 39 HOH 4021 7021 6070 HOH HOH 0 . 
ZL 39 HOH 4022 7022 6071 HOH HOH 0 . 
ZL 39 HOH 4023 7023 6073 HOH HOH 0 . 
ZL 39 HOH 4024 7024 6074 HOH HOH 0 . 
ZL 39 HOH 4025 7025 6075 HOH HOH 0 . 
ZL 39 HOH 4026 7026 6076 HOH HOH 0 . 
ZL 39 HOH 4027 7027 6077 HOH HOH 0 . 
ZL 39 HOH 4028 7028 6078 HOH HOH 0 . 
ZL 39 HOH 4029 7029 6079 HOH HOH 0 . 
ZL 39 HOH 4030 7030 6080 HOH HOH 0 . 
ZL 39 HOH 4031 7031 6081 HOH HOH 0 . 
ZL 39 HOH 4032 7032 6082 HOH HOH 0 . 
ZL 39 HOH 4033 7033 6083 HOH HOH 0 . 
ZL 39 HOH 4034 7034 6084 HOH HOH 0 . 
ZL 39 HOH 4035 7035 6085 HOH HOH 0 . 
ZL 39 HOH 4036 7036 6087 HOH HOH 0 . 
ZL 39 HOH 4037 7037 6088 HOH HOH 0 . 
ZL 39 HOH 4038 7038 6090 HOH HOH 0 . 
ZL 39 HOH 4039 7039 6091 HOH HOH 0 . 
ZL 39 HOH 4040 7040 6093 HOH HOH 0 . 
ZL 39 HOH 4041 7041 6094 HOH HOH 0 . 
ZL 39 HOH 4042 7042 6095 HOH HOH 0 . 
ZL 39 HOH 4043 7043 6096 HOH HOH 0 . 
ZL 39 HOH 4044 7044 6098 HOH HOH 0 . 
ZL 39 HOH 4045 7045 6102 HOH HOH 0 . 
ZL 39 HOH 4046 7046 6103 HOH HOH 0 . 
ZL 39 HOH 4047 7047 6104 HOH HOH 0 . 
ZL 39 HOH 4048 7048 6105 HOH HOH 0 . 
ZL 39 HOH 4049 7049 6106 HOH HOH 0 . 
ZL 39 HOH 4050 7050 6107 HOH HOH 0 . 
ZL 39 HOH 4051 7051 6108 HOH HOH 0 . 
ZL 39 HOH 4052 7052 6112 HOH HOH 0 . 
ZL 39 HOH 4053 7053 6113 HOH HOH 0 . 
ZL 39 HOH 4054 7054 6114 HOH HOH 0 . 
ZL 39 HOH 4055 7055 6117 HOH HOH 0 . 
ZL 39 HOH 4056 7056 6118 HOH HOH 0 . 
ZL 39 HOH 4057 7057 6119 HOH HOH 0 . 
ZL 39 HOH 4058 7058 6120 HOH HOH 0 . 
ZL 39 HOH 4059 7059 6121 HOH HOH 0 . 
ZL 39 HOH 4060 7060 6122 HOH HOH 0 . 
ZL 39 HOH 4061 7061 6123 HOH HOH 0 . 
ZL 39 HOH 4062 7062 6124 HOH HOH 0 . 
ZL 39 HOH 4063 7063 6125 HOH HOH 0 . 
ZL 39 HOH 4064 7064 6126 HOH HOH 0 . 
ZL 39 HOH 4065 7065 6128 HOH HOH 0 . 
ZL 39 HOH 4066 7066 6129 HOH HOH 0 . 
ZL 39 HOH 4067 7067 6131 HOH HOH 0 . 
ZL 39 HOH 4068 7068 6132 HOH HOH 0 . 
ZL 39 HOH 4069 7069 6133 HOH HOH 0 . 
ZL 39 HOH 4070 7070 6134 HOH HOH 0 . 
ZL 39 HOH 4071 7071 6135 HOH HOH 0 . 
ZL 39 HOH 4072 7072 6137 HOH HOH 0 . 
ZL 39 HOH 4073 7073 6138 HOH HOH 0 . 
ZL 39 HOH 4074 7074 6140 HOH HOH 0 . 
ZL 39 HOH 4075 7075 6141 HOH HOH 0 . 
ZL 39 HOH 4076 7076 6143 HOH HOH 0 . 
ZL 39 HOH 4077 7077 6145 HOH HOH 0 . 
ZL 39 HOH 4078 7078 6148 HOH HOH 0 . 
ZL 39 HOH 4079 7079 6149 HOH HOH 0 . 
ZL 39 HOH 4080 7080 6151 HOH HOH 0 . 
ZL 39 HOH 4081 7081 6152 HOH HOH 0 . 
ZL 39 HOH 4082 7082 6154 HOH HOH 0 . 
ZL 39 HOH 4083 7083 6155 HOH HOH 0 . 
ZL 39 HOH 4084 7084 6157 HOH HOH 0 . 
ZL 39 HOH 4085 7085 6158 HOH HOH 0 . 
ZL 39 HOH 4086 7086 6159 HOH HOH 0 . 
ZL 39 HOH 4087 7087 6160 HOH HOH 0 . 
ZL 39 HOH 4088 7088 6162 HOH HOH 0 . 
ZL 39 HOH 4089 7089 6164 HOH HOH 0 . 
ZL 39 HOH 4090 7090 6167 HOH HOH 0 . 
ZL 39 HOH 4091 7091 6169 HOH HOH 0 . 
ZL 39 HOH 4092 7092 6170 HOH HOH 0 . 
ZL 39 HOH 4093 7093 6171 HOH HOH 0 . 
ZL 39 HOH 4094 7094 6172 HOH HOH 0 . 
ZL 39 HOH 4095 7095 6173 HOH HOH 0 . 
ZL 39 HOH 4096 7096 6174 HOH HOH 0 . 
ZL 39 HOH 4097 7097 6175 HOH HOH 0 . 
ZL 39 HOH 4098 7098 6176 HOH HOH 0 . 
ZL 39 HOH 4099 7099 6180 HOH HOH 0 . 
ZL 39 HOH 4100 7100 6181 HOH HOH 0 . 
ZL 39 HOH 4101 7101 6183 HOH HOH 0 . 
ZL 39 HOH 4102 7102 6184 HOH HOH 0 . 
ZL 39 HOH 4103 7103 6185 HOH HOH 0 . 
ZL 39 HOH 4104 7104 6186 HOH HOH 0 . 
ZL 39 HOH 4105 7105 6188 HOH HOH 0 . 
ZL 39 HOH 4106 7106 6191 HOH HOH 0 . 
ZL 39 HOH 4107 7107 6193 HOH HOH 0 . 
ZL 39 HOH 4108 7108 6195 HOH HOH 0 . 
ZL 39 HOH 4109 7109 6196 HOH HOH 0 . 
ZL 39 HOH 4110 7110 6197 HOH HOH 0 . 
ZL 39 HOH 4111 7111 6199 HOH HOH 0 . 
ZL 39 HOH 4112 7112 6200 HOH HOH 0 . 
ZL 39 HOH 4113 7113 6202 HOH HOH 0 . 
ZL 39 HOH 4114 7114 6203 HOH HOH 0 . 
ZL 39 HOH 4115 7115 6204 HOH HOH 0 . 
ZL 39 HOH 4116 7116 6205 HOH HOH 0 . 
ZL 39 HOH 4117 7117 6208 HOH HOH 0 . 
ZL 39 HOH 4118 7118 6211 HOH HOH 0 . 
ZL 39 HOH 4119 7119 6212 HOH HOH 0 . 
ZL 39 HOH 4120 7120 6214 HOH HOH 0 . 
ZL 39 HOH 4121 7121 6217 HOH HOH 0 . 
ZL 39 HOH 4122 7122 6218 HOH HOH 0 . 
ZL 39 HOH 4123 7123 6219 HOH HOH 0 . 
ZL 39 HOH 4124 7124 6222 HOH HOH 0 . 
ZL 39 HOH 4125 7125 6223 HOH HOH 0 . 
ZL 39 HOH 4126 7126 6224 HOH HOH 0 . 
ZL 39 HOH 4127 7127 6225 HOH HOH 0 . 
ZL 39 HOH 4128 7128 6227 HOH HOH 0 . 
ZL 39 HOH 4129 7129 6228 HOH HOH 0 . 
ZL 39 HOH 4130 7130 6231 HOH HOH 0 . 
ZL 39 HOH 4131 7131 6232 HOH HOH 0 . 
ZL 39 HOH 4132 7132 6233 HOH HOH 0 . 
ZL 39 HOH 4133 7133 6235 HOH HOH 0 . 
ZL 39 HOH 4134 7134 6236 HOH HOH 0 . 
ZL 39 HOH 4135 7135 6237 HOH HOH 0 . 
ZL 39 HOH 4136 7136 6240 HOH HOH 0 . 
ZL 39 HOH 4137 7137 6241 HOH HOH 0 . 
ZL 39 HOH 4138 7138 6243 HOH HOH 0 . 
ZL 39 HOH 4139 7139 6244 HOH HOH 0 . 
ZL 39 HOH 4140 7140 6245 HOH HOH 0 . 
ZL 39 HOH 4141 7141 6246 HOH HOH 0 . 
ZL 39 HOH 4142 7142 6248 HOH HOH 0 . 
ZL 39 HOH 4143 7143 6249 HOH HOH 0 . 
ZL 39 HOH 4144 7144 6253 HOH HOH 0 . 
ZL 39 HOH 4145 7145 6254 HOH HOH 0 . 
ZL 39 HOH 4146 7146 6255 HOH HOH 0 . 
ZL 39 HOH 4147 7147 6257 HOH HOH 0 . 
ZL 39 HOH 4148 7148 6258 HOH HOH 0 . 
ZL 39 HOH 4149 7149 6259 HOH HOH 0 . 
ZL 39 HOH 4150 7150 6261 HOH HOH 0 . 
ZL 39 HOH 4151 7151 6264 HOH HOH 0 . 
ZL 39 HOH 4152 7152 6265 HOH HOH 0 . 
ZL 39 HOH 4153 7153 6266 HOH HOH 0 . 
ZL 39 HOH 4154 7154 6267 HOH HOH 0 . 
ZL 39 HOH 4155 7155 6269 HOH HOH 0 . 
ZL 39 HOH 4156 7156 6270 HOH HOH 0 . 
ZL 39 HOH 4157 7157 6271 HOH HOH 0 . 
ZL 39 HOH 4158 7158 6272 HOH HOH 0 . 
ZL 39 HOH 4159 7159 6274 HOH HOH 0 . 
ZL 39 HOH 4160 7160 6275 HOH HOH 0 . 
ZL 39 HOH 4161 7161 6277 HOH HOH 0 . 
ZL 39 HOH 4162 7162 6278 HOH HOH 0 . 
ZL 39 HOH 4163 7163 6279 HOH HOH 0 . 
ZL 39 HOH 4164 7164 6280 HOH HOH 0 . 
ZL 39 HOH 4165 7165 6281 HOH HOH 0 . 
ZL 39 HOH 4166 7166 6282 HOH HOH 0 . 
ZL 39 HOH 4167 7167 6283 HOH HOH 0 . 
ZL 39 HOH 4168 7168 6284 HOH HOH 0 . 
ZL 39 HOH 4169 7169 6285 HOH HOH 0 . 
ZL 39 HOH 4170 7170 6287 HOH HOH 0 . 
ZL 39 HOH 4171 7171 6288 HOH HOH 0 . 
ZL 39 HOH 4172 7172 6290 HOH HOH 0 . 
ZL 39 HOH 4173 7173 6291 HOH HOH 0 . 
ZL 39 HOH 4174 7174 6293 HOH HOH 0 . 
ZL 39 HOH 4175 7175 6294 HOH HOH 0 . 
ZL 39 HOH 4176 7176 6295 HOH HOH 0 . 
ZL 39 HOH 4177 7177 6297 HOH HOH 0 . 
ZL 39 HOH 4178 7178 6300 HOH HOH 0 . 
ZL 39 HOH 4179 7179 6301 HOH HOH 0 . 
ZL 39 HOH 4180 7180 6303 HOH HOH 0 . 
ZL 39 HOH 4181 7181 6304 HOH HOH 0 . 
ZL 39 HOH 4182 7182 6305 HOH HOH 0 . 
ZL 39 HOH 4183 7183 6306 HOH HOH 0 . 
ZL 39 HOH 4184 7184 6307 HOH HOH 0 . 
ZL 39 HOH 4185 7185 6309 HOH HOH 0 . 
ZL 39 HOH 4186 7186 6310 HOH HOH 0 . 
ZL 39 HOH 4187 7187 6311 HOH HOH 0 . 
ZL 39 HOH 4188 7188 6316 HOH HOH 0 . 
ZL 39 HOH 4189 7189 6318 HOH HOH 0 . 
ZL 39 HOH 4190 7190 6319 HOH HOH 0 . 
ZL 39 HOH 4191 7191 6321 HOH HOH 0 . 
ZL 39 HOH 4192 7192 6322 HOH HOH 0 . 
ZL 39 HOH 4193 7193 6323 HOH HOH 0 . 
ZL 39 HOH 4194 7194 6324 HOH HOH 0 . 
ZL 39 HOH 4195 7195 6327 HOH HOH 0 . 
ZL 39 HOH 4196 7196 6328 HOH HOH 0 . 
ZL 39 HOH 4197 7197 6329 HOH HOH 0 . 
ZL 39 HOH 4198 7198 6330 HOH HOH 0 . 
ZL 39 HOH 4199 7199 6331 HOH HOH 0 . 
ZL 39 HOH 4200 7200 6332 HOH HOH 0 . 
ZL 39 HOH 4201 7201 6333 HOH HOH 0 . 
ZL 39 HOH 4202 7202 6334 HOH HOH 0 . 
ZL 39 HOH 4203 7203 6335 HOH HOH 0 . 
ZL 39 HOH 4204 7204 6336 HOH HOH 0 . 
ZL 39 HOH 4205 7205 6337 HOH HOH 0 . 
ZL 39 HOH 4206 7206 6338 HOH HOH 0 . 
ZL 39 HOH 4207 7207 6340 HOH HOH 0 . 
ZL 39 HOH 4208 7208 6342 HOH HOH 0 . 
ZL 39 HOH 4209 7209 6343 HOH HOH 0 . 
ZL 39 HOH 4210 7210 6345 HOH HOH 0 . 
ZL 39 HOH 4211 7211 6347 HOH HOH 0 . 
ZL 39 HOH 4212 7212 6348 HOH HOH 0 . 
ZL 39 HOH 4213 7213 6349 HOH HOH 0 . 
ZL 39 HOH 4214 7214 6350 HOH HOH 0 . 
ZL 39 HOH 4215 7215 6353 HOH HOH 0 . 
ZL 39 HOH 4216 7216 6354 HOH HOH 0 . 
ZL 39 HOH 4217 7217 6355 HOH HOH 0 . 
ZL 39 HOH 4218 7218 6356 HOH HOH 0 . 
ZL 39 HOH 4219 7219 6358 HOH HOH 0 . 
ZL 39 HOH 4220 7220 6360 HOH HOH 0 . 
ZL 39 HOH 4221 7221 6361 HOH HOH 0 . 
ZL 39 HOH 4222 7222 6362 HOH HOH 0 . 
ZL 39 HOH 4223 7223 6363 HOH HOH 0 . 
ZL 39 HOH 4224 7224 6364 HOH HOH 0 . 
ZL 39 HOH 4225 7225 6365 HOH HOH 0 . 
ZL 39 HOH 4226 7226 6366 HOH HOH 0 . 
ZL 39 HOH 4227 7227 6367 HOH HOH 0 . 
ZL 39 HOH 4228 7228 6369 HOH HOH 0 . 
ZL 39 HOH 4229 7229 6370 HOH HOH 0 . 
ZL 39 HOH 4230 7230 6371 HOH HOH 0 . 
ZL 39 HOH 4231 7231 6375 HOH HOH 0 . 
ZL 39 HOH 4232 7232 6376 HOH HOH 0 . 
ZL 39 HOH 4233 7233 6377 HOH HOH 0 . 
ZL 39 HOH 4234 7234 6379 HOH HOH 0 . 
ZL 39 HOH 4235 7235 6381 HOH HOH 0 . 
ZL 39 HOH 4236 7236 6382 HOH HOH 0 . 
ZL 39 HOH 4237 7237 6383 HOH HOH 0 . 
ZL 39 HOH 4238 7238 6386 HOH HOH 0 . 
ZL 39 HOH 4239 7239 6387 HOH HOH 0 . 
ZL 39 HOH 4240 7240 6388 HOH HOH 0 . 
ZL 39 HOH 4241 7241 6389 HOH HOH 0 . 
ZL 39 HOH 4242 7242 6390 HOH HOH 0 . 
ZL 39 HOH 4243 7243 6393 HOH HOH 0 . 
ZL 39 HOH 4244 7244 6394 HOH HOH 0 . 
ZL 39 HOH 4245 7245 6395 HOH HOH 0 . 
ZL 39 HOH 4246 7246 6396 HOH HOH 0 . 
ZL 39 HOH 4247 7247 6397 HOH HOH 0 . 
ZL 39 HOH 4248 7248 6398 HOH HOH 0 . 
ZL 39 HOH 4249 7249 6400 HOH HOH 0 . 
ZL 39 HOH 4250 7250 6401 HOH HOH 0 . 
ZL 39 HOH 4251 7251 6404 HOH HOH 0 . 
ZL 39 HOH 4252 7252 6405 HOH HOH 0 . 
ZL 39 HOH 4253 7253 6406 HOH HOH 0 . 
ZL 39 HOH 4254 7254 6407 HOH HOH 0 . 
ZL 39 HOH 4255 7255 6408 HOH HOH 0 . 
ZL 39 HOH 4256 7256 6409 HOH HOH 0 . 
ZL 39 HOH 4257 7257 6410 HOH HOH 0 . 
ZL 39 HOH 4258 7258 6411 HOH HOH 0 . 
ZL 39 HOH 4259 7259 6414 HOH HOH 0 . 
ZL 39 HOH 4260 7260 6415 HOH HOH 0 . 
ZL 39 HOH 4261 7261 6416 HOH HOH 0 . 
ZL 39 HOH 4262 7262 6417 HOH HOH 0 . 
ZL 39 HOH 4263 7263 6419 HOH HOH 0 . 
ZL 39 HOH 4264 7264 6420 HOH HOH 0 . 
ZL 39 HOH 4265 7265 6421 HOH HOH 0 . 
ZL 39 HOH 4266 7266 6422 HOH HOH 0 . 
ZL 39 HOH 4267 7267 6423 HOH HOH 0 . 
ZL 39 HOH 4268 7268 6424 HOH HOH 0 . 
ZL 39 HOH 4269 7269 6425 HOH HOH 0 . 
ZL 39 HOH 4270 7270 6426 HOH HOH 0 . 
ZL 39 HOH 4271 7271 6427 HOH HOH 0 . 
ZL 39 HOH 4272 7272 6428 HOH HOH 0 . 
ZL 39 HOH 4273 7273 6430 HOH HOH 0 . 
ZL 39 HOH 4274 7274 6431 HOH HOH 0 . 
ZL 39 HOH 4275 7275 6433 HOH HOH 0 . 
ZL 39 HOH 4276 7276 6434 HOH HOH 0 . 
ZL 39 HOH 4277 7277 6435 HOH HOH 0 . 
ZL 39 HOH 4278 7278 6436 HOH HOH 0 . 
ZL 39 HOH 4279 7279 6438 HOH HOH 0 . 
ZL 39 HOH 4280 7280 6442 HOH HOH 0 . 
ZL 39 HOH 4281 7281 6443 HOH HOH 0 . 
ZL 39 HOH 4282 7282 6444 HOH HOH 0 . 
ZL 39 HOH 4283 7283 6445 HOH HOH 0 . 
ZL 39 HOH 4284 7284 6446 HOH HOH 0 . 
ZL 39 HOH 4285 7285 6447 HOH HOH 0 . 
ZL 39 HOH 4286 7286 6449 HOH HOH 0 . 
ZL 39 HOH 4287 7287 6450 HOH HOH 0 . 
ZL 39 HOH 4288 7288 6451 HOH HOH 0 . 
ZL 39 HOH 4289 7289 6453 HOH HOH 0 . 
ZL 39 HOH 4290 7290 6454 HOH HOH 0 . 
ZL 39 HOH 4291 7291 6455 HOH HOH 0 . 
ZL 39 HOH 4292 7292 6458 HOH HOH 0 . 
ZL 39 HOH 4293 7293 6460 HOH HOH 0 . 
ZL 39 HOH 4294 7294 6461 HOH HOH 0 . 
ZL 39 HOH 4295 7295 6462 HOH HOH 0 . 
ZL 39 HOH 4296 7296 6463 HOH HOH 0 . 
ZL 39 HOH 4297 7297 6465 HOH HOH 0 . 
ZL 39 HOH 4298 7298 6466 HOH HOH 0 . 
ZL 39 HOH 4299 7299 6467 HOH HOH 0 . 
ZL 39 HOH 4300 7300 6468 HOH HOH 0 . 
ZL 39 HOH 4301 7301 6469 HOH HOH 0 . 
ZL 39 HOH 4302 7302 6471 HOH HOH 0 . 
ZL 39 HOH 4303 7303 6472 HOH HOH 0 . 
ZL 39 HOH 4304 7304 6473 HOH HOH 0 . 
ZL 39 HOH 4305 7305 6475 HOH HOH 0 . 
ZL 39 HOH 4306 7306 6477 HOH HOH 0 . 
ZL 39 HOH 4307 7307 6480 HOH HOH 0 . 
ZL 39 HOH 4308 7308 6481 HOH HOH 0 . 
ZL 39 HOH 4309 7309 6483 HOH HOH 0 . 
ZL 39 HOH 4310 7310 6485 HOH HOH 0 . 
ZL 39 HOH 4311 7311 6487 HOH HOH 0 . 
ZL 39 HOH 4312 7312 6488 HOH HOH 0 . 
ZL 39 HOH 4313 7313 6489 HOH HOH 0 . 
ZL 39 HOH 4314 7314 6490 HOH HOH 0 . 
ZL 39 HOH 4315 7315 6491 HOH HOH 0 . 
ZL 39 HOH 4316 7316 6492 HOH HOH 0 . 
ZL 39 HOH 4317 7317 6494 HOH HOH 0 . 
ZL 39 HOH 4318 7318 6495 HOH HOH 0 . 
ZL 39 HOH 4319 7319 6496 HOH HOH 0 . 
ZL 39 HOH 4320 7320 6499 HOH HOH 0 . 
ZL 39 HOH 4321 7321 6501 HOH HOH 0 . 
ZL 39 HOH 4322 7322 6503 HOH HOH 0 . 
ZL 39 HOH 4323 7323 6504 HOH HOH 0 . 
ZL 39 HOH 4324 7324 6505 HOH HOH 0 . 
ZL 39 HOH 4325 7325 6506 HOH HOH 0 . 
ZL 39 HOH 4326 7326 6507 HOH HOH 0 . 
ZL 39 HOH 4327 7327 6508 HOH HOH 0 . 
ZL 39 HOH 4328 7328 6509 HOH HOH 0 . 
ZL 39 HOH 4329 7329 6510 HOH HOH 0 . 
ZL 39 HOH 4330 7330 6512 HOH HOH 0 . 
ZL 39 HOH 4331 7331 6515 HOH HOH 0 . 
ZL 39 HOH 4332 7332 6516 HOH HOH 0 . 
ZL 39 HOH 4333 7333 6517 HOH HOH 0 . 
ZL 39 HOH 4334 7334 6518 HOH HOH 0 . 
ZL 39 HOH 4335 7335 6520 HOH HOH 0 . 
ZL 39 HOH 4336 7336 6521 HOH HOH 0 . 
ZL 39 HOH 4337 7337 6522 HOH HOH 0 . 
ZL 39 HOH 4338 7338 6523 HOH HOH 0 . 
ZL 39 HOH 4339 7339 6524 HOH HOH 0 . 
ZL 39 HOH 4340 7340 6526 HOH HOH 0 . 
ZL 39 HOH 4341 7341 6527 HOH HOH 0 . 
ZL 39 HOH 4342 7342 6528 HOH HOH 0 . 
ZL 39 HOH 4343 7343 6529 HOH HOH 0 . 
ZL 39 HOH 4344 7344 6530 HOH HOH 0 . 
ZL 39 HOH 4345 7345 6533 HOH HOH 0 . 
ZL 39 HOH 4346 7346 6534 HOH HOH 0 . 
ZL 39 HOH 4347 7347 6535 HOH HOH 0 . 
ZL 39 HOH 4348 7348 6537 HOH HOH 0 . 
ZL 39 HOH 4349 7349 6538 HOH HOH 0 . 
ZL 39 HOH 4350 7350 6539 HOH HOH 0 . 
ZL 39 HOH 4351 7351 6540 HOH HOH 0 . 
ZL 39 HOH 4352 7352 6541 HOH HOH 0 . 
ZL 39 HOH 4353 7353 6543 HOH HOH 0 . 
ZL 39 HOH 4354 7354 6544 HOH HOH 0 . 
ZL 39 HOH 4355 7355 6547 HOH HOH 0 . 
ZL 39 HOH 4356 7356 6548 HOH HOH 0 . 
ZL 39 HOH 4357 7357 6549 HOH HOH 0 . 
ZL 39 HOH 4358 7358 6550 HOH HOH 0 . 
ZL 39 HOH 4359 7359 6551 HOH HOH 0 . 
ZL 39 HOH 4360 7360 6552 HOH HOH 0 . 
ZL 39 HOH 4361 7361 6556 HOH HOH 0 . 
ZL 39 HOH 4362 7362 6557 HOH HOH 0 . 
ZL 39 HOH 4363 7363 6560 HOH HOH 0 . 
ZL 39 HOH 4364 7364 6561 HOH HOH 0 . 
ZL 39 HOH 4365 7365 6562 HOH HOH 0 . 
ZL 39 HOH 4366 7366 6563 HOH HOH 0 . 
ZL 39 HOH 4367 7367 6565 HOH HOH 0 . 
ZL 39 HOH 4368 7368 6566 HOH HOH 0 . 
ZL 39 HOH 4369 7369 6567 HOH HOH 0 . 
ZL 39 HOH 4370 7370 6568 HOH HOH 0 . 
ZL 39 HOH 4371 7371 6569 HOH HOH 0 . 
ZL 39 HOH 4372 7372 6570 HOH HOH 0 . 
ZL 39 HOH 4373 7373 6572 HOH HOH 0 . 
ZL 39 HOH 4374 7374 6573 HOH HOH 0 . 
ZL 39 HOH 4375 7375 6574 HOH HOH 0 . 
ZL 39 HOH 4376 7376 6575 HOH HOH 0 . 
ZL 39 HOH 4377 7377 6576 HOH HOH 0 . 
ZL 39 HOH 4378 7378 6577 HOH HOH 0 . 
ZL 39 HOH 4379 7379 6579 HOH HOH 0 . 
ZL 39 HOH 4380 7380 6580 HOH HOH 0 . 
ZL 39 HOH 4381 7381 6581 HOH HOH 0 . 
ZL 39 HOH 4382 7382 6582 HOH HOH 0 . 
ZL 39 HOH 4383 7383 6583 HOH HOH 0 . 
ZL 39 HOH 4384 7384 6584 HOH HOH 0 . 
ZL 39 HOH 4385 7385 6586 HOH HOH 0 . 
ZL 39 HOH 4386 7386 6587 HOH HOH 0 . 
ZL 39 HOH 4387 7387 6591 HOH HOH 0 . 
ZL 39 HOH 4388 7388 6592 HOH HOH 0 . 
ZL 39 HOH 4389 7389 6595 HOH HOH 0 . 
ZL 39 HOH 4390 7390 6596 HOH HOH 0 . 
ZL 39 HOH 4391 7391 6598 HOH HOH 0 . 
ZL 39 HOH 4392 7392 6600 HOH HOH 0 . 
ZL 39 HOH 4393 7393 6601 HOH HOH 0 . 
ZL 39 HOH 4394 7394 6602 HOH HOH 0 . 
ZL 39 HOH 4395 7395 6604 HOH HOH 0 . 
ZL 39 HOH 4396 7396 6606 HOH HOH 0 . 
ZL 39 HOH 4397 7397 6607 HOH HOH 0 . 
ZL 39 HOH 4398 7398 6608 HOH HOH 0 . 
ZL 39 HOH 4399 7399 6609 HOH HOH 0 . 
ZL 39 HOH 4400 7400 6610 HOH HOH 0 . 
ZL 39 HOH 4401 7401 6611 HOH HOH 0 . 
ZL 39 HOH 4402 7402 6612 HOH HOH 0 . 
ZL 39 HOH 4403 7403 6614 HOH HOH 0 . 
ZL 39 HOH 4404 7404 6615 HOH HOH 0 . 
ZL 39 HOH 4405 7405 6619 HOH HOH 0 . 
ZL 39 HOH 4406 7406 6620 HOH HOH 0 . 
ZL 39 HOH 4407 7407 6623 HOH HOH 0 . 
ZL 39 HOH 4408 7408 6624 HOH HOH 0 . 
ZL 39 HOH 4409 7409 6625 HOH HOH 0 . 
ZL 39 HOH 4410 7410 6626 HOH HOH 0 . 
ZL 39 HOH 4411 7411 6627 HOH HOH 0 . 
ZL 39 HOH 4412 7412 6629 HOH HOH 0 . 
ZL 39 HOH 4413 7413 6631 HOH HOH 0 . 
ZL 39 HOH 4414 7414 6632 HOH HOH 0 . 
ZL 39 HOH 4415 7415 6633 HOH HOH 0 . 
ZL 39 HOH 4416 7416 6634 HOH HOH 0 . 
ZL 39 HOH 4417 7417 6635 HOH HOH 0 . 
ZL 39 HOH 4418 7418 6636 HOH HOH 0 . 
ZL 39 HOH 4419 7419 6637 HOH HOH 0 . 
ZL 39 HOH 4420 7420 6639 HOH HOH 0 . 
ZL 39 HOH 4421 7421 6640 HOH HOH 0 . 
ZL 39 HOH 4422 7422 6641 HOH HOH 0 . 
ZL 39 HOH 4423 7423 6642 HOH HOH 0 . 
ZL 39 HOH 4424 7424 6643 HOH HOH 0 . 
ZL 39 HOH 4425 7425 6644 HOH HOH 0 . 
ZL 39 HOH 4426 7426 6648 HOH HOH 0 . 
ZL 39 HOH 4427 7427 6649 HOH HOH 0 . 
ZL 39 HOH 4428 7428 6650 HOH HOH 0 . 
ZL 39 HOH 4429 7429 6651 HOH HOH 0 . 
ZL 39 HOH 4430 7430 6652 HOH HOH 0 . 
ZL 39 HOH 4431 7431 6654 HOH HOH 0 . 
ZL 39 HOH 4432 7432 6655 HOH HOH 0 . 
ZL 39 HOH 4433 7433 6656 HOH HOH 0 . 
ZL 39 HOH 4434 7434 6657 HOH HOH 0 . 
ZL 39 HOH 4435 7435 6660 HOH HOH 0 . 
ZL 39 HOH 4436 7436 6662 HOH HOH 0 . 
ZL 39 HOH 4437 7437 6663 HOH HOH 0 . 
ZL 39 HOH 4438 7438 6664 HOH HOH 0 . 
ZL 39 HOH 4439 7439 6666 HOH HOH 0 . 
ZL 39 HOH 4440 7440 6667 HOH HOH 0 . 
ZL 39 HOH 4441 7441 6668 HOH HOH 0 . 
ZL 39 HOH 4442 7442 6671 HOH HOH 0 . 
ZL 39 HOH 4443 7443 6672 HOH HOH 0 . 
ZL 39 HOH 4444 7444 6673 HOH HOH 0 . 
ZL 39 HOH 4445 7445 6674 HOH HOH 0 . 
ZL 39 HOH 4446 7446 6675 HOH HOH 0 . 
ZL 39 HOH 4447 7447 6676 HOH HOH 0 . 
ZL 39 HOH 4448 7448 6677 HOH HOH 0 . 
ZL 39 HOH 4449 7449 6680 HOH HOH 0 . 
ZL 39 HOH 4450 7450 6681 HOH HOH 0 . 
ZL 39 HOH 4451 7451 6684 HOH HOH 0 . 
ZL 39 HOH 4452 7452 6685 HOH HOH 0 . 
ZL 39 HOH 4453 7453 6686 HOH HOH 0 . 
ZL 39 HOH 4454 7454 6688 HOH HOH 0 . 
ZL 39 HOH 4455 7455 6689 HOH HOH 0 . 
ZL 39 HOH 4456 7456 6691 HOH HOH 0 . 
ZL 39 HOH 4457 7457 6692 HOH HOH 0 . 
ZL 39 HOH 4458 7458 6693 HOH HOH 0 . 
ZL 39 HOH 4459 7459 6695 HOH HOH 0 . 
ZL 39 HOH 4460 7460 6696 HOH HOH 0 . 
ZL 39 HOH 4461 7461 6697 HOH HOH 0 . 
ZL 39 HOH 4462 7462 6698 HOH HOH 0 . 
ZL 39 HOH 4463 7463 6699 HOH HOH 0 . 
ZL 39 HOH 4464 7464 6701 HOH HOH 0 . 
ZL 39 HOH 4465 7465 6705 HOH HOH 0 . 
ZL 39 HOH 4466 7466 6708 HOH HOH 0 . 
ZL 39 HOH 4467 7467 6709 HOH HOH 0 . 
ZL 39 HOH 4468 7468 6712 HOH HOH 0 . 
ZL 39 HOH 4469 7469 6713 HOH HOH 0 . 
ZL 39 HOH 4470 7470 6714 HOH HOH 0 . 
ZL 39 HOH 4471 7471 6715 HOH HOH 0 . 
ZL 39 HOH 4472 7472 6718 HOH HOH 0 . 
ZL 39 HOH 4473 7473 6720 HOH HOH 0 . 
ZL 39 HOH 4474 7474 6721 HOH HOH 0 . 
ZL 39 HOH 4475 7475 6722 HOH HOH 0 . 
ZL 39 HOH 4476 7476 6723 HOH HOH 0 . 
ZL 39 HOH 4477 7477 6724 HOH HOH 0 . 
ZL 39 HOH 4478 7478 6725 HOH HOH 0 . 
ZL 39 HOH 4479 7479 6726 HOH HOH 0 . 
ZL 39 HOH 4480 7480 6727 HOH HOH 0 . 
ZL 39 HOH 4481 7481 6728 HOH HOH 0 . 
ZL 39 HOH 4482 7482 6729 HOH HOH 0 . 
ZL 39 HOH 4483 7483 6730 HOH HOH 0 . 
ZL 39 HOH 4484 7484 6731 HOH HOH 0 . 
ZL 39 HOH 4485 7485 6732 HOH HOH 0 . 
ZL 39 HOH 4486 7486 6733 HOH HOH 0 . 
ZL 39 HOH 4487 7487 6734 HOH HOH 0 . 
ZL 39 HOH 4488 7488 6735 HOH HOH 0 . 
ZL 39 HOH 4489 7489 6736 HOH HOH 0 . 
ZL 39 HOH 4490 7490 6737 HOH HOH 0 . 
ZL 39 HOH 4491 7491 6738 HOH HOH 0 . 
ZL 39 HOH 4492 7492 6739 HOH HOH 0 . 
ZL 39 HOH 4493 7493 6740 HOH HOH 0 . 
ZL 39 HOH 4494 7494 6742 HOH HOH 0 . 
ZL 39 HOH 4495 7495 6743 HOH HOH 0 . 
ZL 39 HOH 4496 7496 6745 HOH HOH 0 . 
ZL 39 HOH 4497 7497 6747 HOH HOH 0 . 
ZL 39 HOH 4498 7498 6748 HOH HOH 0 . 
ZL 39 HOH 4499 7499 6750 HOH HOH 0 . 
ZL 39 HOH 4500 7500 6751 HOH HOH 0 . 
ZL 39 HOH 4501 7501 6753 HOH HOH 0 . 
ZL 39 HOH 4502 7502 6757 HOH HOH 0 . 
ZL 39 HOH 4503 7503 6758 HOH HOH 0 . 
ZL 39 HOH 4504 7504 6759 HOH HOH 0 . 
ZL 39 HOH 4505 7505 6760 HOH HOH 0 . 
ZL 39 HOH 4506 7506 6761 HOH HOH 0 . 
ZL 39 HOH 4507 7507 6763 HOH HOH 0 . 
ZL 39 HOH 4508 7508 6764 HOH HOH 0 . 
ZL 39 HOH 4509 7509 6765 HOH HOH 0 . 
ZL 39 HOH 4510 7510 6766 HOH HOH 0 . 
ZL 39 HOH 4511 7511 6767 HOH HOH 0 . 
ZL 39 HOH 4512 7512 6768 HOH HOH 0 . 
ZL 39 HOH 4513 7513 6769 HOH HOH 0 . 
ZL 39 HOH 4514 7514 6770 HOH HOH 0 . 
ZL 39 HOH 4515 7515 6774 HOH HOH 0 . 
ZL 39 HOH 4516 7516 6775 HOH HOH 0 . 
ZL 39 HOH 4517 7517 6776 HOH HOH 0 . 
ZL 39 HOH 4518 7518 6777 HOH HOH 0 . 
ZL 39 HOH 4519 7519 6778 HOH HOH 0 . 
ZL 39 HOH 4520 7520 6781 HOH HOH 0 . 
ZL 39 HOH 4521 7521 6782 HOH HOH 0 . 
ZL 39 HOH 4522 7522 6785 HOH HOH 0 . 
ZL 39 HOH 4523 7523 6786 HOH HOH 0 . 
ZL 39 HOH 4524 7524 6787 HOH HOH 0 . 
ZL 39 HOH 4525 7525 6788 HOH HOH 0 . 
ZL 39 HOH 4526 7526 6789 HOH HOH 0 . 
ZL 39 HOH 4527 7527 6790 HOH HOH 0 . 
ZL 39 HOH 4528 7528 6791 HOH HOH 0 . 
ZL 39 HOH 4529 7529 6792 HOH HOH 0 . 
ZL 39 HOH 4530 7530 6793 HOH HOH 0 . 
ZL 39 HOH 4531 7531 6794 HOH HOH 0 . 
ZL 39 HOH 4532 7532 6797 HOH HOH 0 . 
ZL 39 HOH 4533 7533 6799 HOH HOH 0 . 
ZL 39 HOH 4534 7534 6801 HOH HOH 0 . 
ZL 39 HOH 4535 7535 6802 HOH HOH 0 . 
ZL 39 HOH 4536 7536 6803 HOH HOH 0 . 
ZL 39 HOH 4537 7537 6805 HOH HOH 0 . 
ZL 39 HOH 4538 7538 6808 HOH HOH 0 . 
ZL 39 HOH 4539 7539 6809 HOH HOH 0 . 
ZL 39 HOH 4540 7540 6811 HOH HOH 0 . 
ZL 39 HOH 4541 7541 6812 HOH HOH 0 . 
ZL 39 HOH 4542 7542 6813 HOH HOH 0 . 
ZL 39 HOH 4543 7543 6814 HOH HOH 0 . 
ZL 39 HOH 4544 7544 6815 HOH HOH 0 . 
ZL 39 HOH 4545 7545 6816 HOH HOH 0 . 
ZL 39 HOH 4546 7546 6817 HOH HOH 0 . 
ZL 39 HOH 4547 7547 6818 HOH HOH 0 . 
ZL 39 HOH 4548 7548 6819 HOH HOH 0 . 
ZL 39 HOH 4549 7549 6820 HOH HOH 0 . 
ZL 39 HOH 4550 7550 6821 HOH HOH 0 . 
ZL 39 HOH 4551 7551 6823 HOH HOH 0 . 
ZL 39 HOH 4552 7552 6824 HOH HOH 0 . 
ZL 39 HOH 4553 7553 6826 HOH HOH 0 . 
ZL 39 HOH 4554 7554 6828 HOH HOH 0 . 
ZL 39 HOH 4555 7555 6829 HOH HOH 0 . 
ZL 39 HOH 4556 7556 6830 HOH HOH 0 . 
ZL 39 HOH 4557 7557 6831 HOH HOH 0 . 
ZL 39 HOH 4558 7558 6832 HOH HOH 0 . 
ZL 39 HOH 4559 7559 6834 HOH HOH 0 . 
ZL 39 HOH 4560 7560 6837 HOH HOH 0 . 
ZL 39 HOH 4561 7561 6838 HOH HOH 0 . 
ZL 39 HOH 4562 7562 6840 HOH HOH 0 . 
ZL 39 HOH 4563 7563 6841 HOH HOH 0 . 
ZL 39 HOH 4564 7564 6842 HOH HOH 0 . 
ZL 39 HOH 4565 7565 6843 HOH HOH 0 . 
ZL 39 HOH 4566 7566 6844 HOH HOH 0 . 
ZL 39 HOH 4567 7567 6845 HOH HOH 0 . 
ZL 39 HOH 4568 7568 6846 HOH HOH 0 . 
ZL 39 HOH 4569 7569 6847 HOH HOH 0 . 
ZL 39 HOH 4570 7570 6850 HOH HOH 0 . 
ZL 39 HOH 4571 7571 6851 HOH HOH 0 . 
ZL 39 HOH 4572 7572 6852 HOH HOH 0 . 
ZL 39 HOH 4573 7573 6853 HOH HOH 0 . 
ZL 39 HOH 4574 7574 6855 HOH HOH 0 . 
ZL 39 HOH 4575 7575 6856 HOH HOH 0 . 
ZL 39 HOH 4576 7576 6857 HOH HOH 0 . 
ZL 39 HOH 4577 7577 6858 HOH HOH 0 . 
ZL 39 HOH 4578 7578 6859 HOH HOH 0 . 
ZL 39 HOH 4579 7579 6860 HOH HOH 0 . 
ZL 39 HOH 4580 7580 6861 HOH HOH 0 . 
ZL 39 HOH 4581 7581 6862 HOH HOH 0 . 
ZL 39 HOH 4582 7582 6864 HOH HOH 0 . 
ZL 39 HOH 4583 7583 6865 HOH HOH 0 . 
ZL 39 HOH 4584 7584 6868 HOH HOH 0 . 
ZL 39 HOH 4585 7585 6870 HOH HOH 0 . 
ZL 39 HOH 4586 7586 6872 HOH HOH 0 . 
ZL 39 HOH 4587 7587 6873 HOH HOH 0 . 
ZL 39 HOH 4588 7588 6874 HOH HOH 0 . 
ZL 39 HOH 4589 7589 6875 HOH HOH 0 . 
ZL 39 HOH 4590 7590 6876 HOH HOH 0 . 
ZL 39 HOH 4591 7591 6878 HOH HOH 0 . 
ZL 39 HOH 4592 7592 6880 HOH HOH 0 . 
ZL 39 HOH 4593 7593 6882 HOH HOH 0 . 
ZL 39 HOH 4594 7594 6883 HOH HOH 0 . 
ZL 39 HOH 4595 7595 6884 HOH HOH 0 . 
ZL 39 HOH 4596 7596 6885 HOH HOH 0 . 
ZL 39 HOH 4597 7597 6888 HOH HOH 0 . 
ZL 39 HOH 4598 7598 6890 HOH HOH 0 . 
ZL 39 HOH 4599 7599 6891 HOH HOH 0 . 
ZL 39 HOH 4600 7600 6892 HOH HOH 0 . 
ZL 39 HOH 4601 7601 6894 HOH HOH 0 . 
ZL 39 HOH 4602 7602 6896 HOH HOH 0 . 
ZL 39 HOH 4603 7603 6897 HOH HOH 0 . 
ZL 39 HOH 4604 7604 6898 HOH HOH 0 . 
ZL 39 HOH 4605 7605 6900 HOH HOH 0 . 
ZL 39 HOH 4606 7606 6902 HOH HOH 0 . 
ZL 39 HOH 4607 7607 6903 HOH HOH 0 . 
ZL 39 HOH 4608 7608 6907 HOH HOH 0 . 
ZL 39 HOH 4609 7609 6908 HOH HOH 0 . 
ZL 39 HOH 4610 7610 6910 HOH HOH 0 . 
ZL 39 HOH 4611 7611 6911 HOH HOH 0 . 
ZL 39 HOH 4612 7612 6912 HOH HOH 0 . 
ZL 39 HOH 4613 7613 6914 HOH HOH 0 . 
ZL 39 HOH 4614 7614 6915 HOH HOH 0 . 
ZL 39 HOH 4615 7615 6916 HOH HOH 0 . 
ZL 39 HOH 4616 7616 6917 HOH HOH 0 . 
ZL 39 HOH 4617 7617 6918 HOH HOH 0 . 
ZL 39 HOH 4618 7618 6919 HOH HOH 0 . 
ZL 39 HOH 4619 7619 6920 HOH HOH 0 . 
ZL 39 HOH 4620 7620 6921 HOH HOH 0 . 
ZL 39 HOH 4621 7621 6922 HOH HOH 0 . 
ZL 39 HOH 4622 7622 6923 HOH HOH 0 . 
ZL 39 HOH 4623 7623 6924 HOH HOH 0 . 
ZL 39 HOH 4624 7624 6925 HOH HOH 0 . 
ZL 39 HOH 4625 7625 6927 HOH HOH 0 . 
ZL 39 HOH 4626 7626 6928 HOH HOH 0 . 
ZL 39 HOH 4627 7627 6929 HOH HOH 0 . 
ZL 39 HOH 4628 7628 6930 HOH HOH 0 . 
ZL 39 HOH 4629 7629 6933 HOH HOH 0 . 
ZL 39 HOH 4630 7630 6934 HOH HOH 0 . 
ZL 39 HOH 4631 7631 6935 HOH HOH 0 . 
ZL 39 HOH 4632 7632 6938 HOH HOH 0 . 
ZL 39 HOH 4633 7633 6941 HOH HOH 0 . 
ZL 39 HOH 4634 7634 6942 HOH HOH 0 . 
ZL 39 HOH 4635 7635 6943 HOH HOH 0 . 
ZL 39 HOH 4636 7636 6944 HOH HOH 0 . 
ZL 39 HOH 4637 7637 6945 HOH HOH 0 . 
ZL 39 HOH 4638 7638 6947 HOH HOH 0 . 
ZL 39 HOH 4639 7639 6948 HOH HOH 0 . 
ZL 39 HOH 4640 7640 6949 HOH HOH 0 . 
ZL 39 HOH 4641 7641 6950 HOH HOH 0 . 
ZL 39 HOH 4642 7642 6951 HOH HOH 0 . 
ZL 39 HOH 4643 7643 6952 HOH HOH 0 . 
ZL 39 HOH 4644 7644 6953 HOH HOH 0 . 
ZL 39 HOH 4645 7645 6954 HOH HOH 0 . 
ZL 39 HOH 4646 7646 6955 HOH HOH 0 . 
ZL 39 HOH 4647 7647 6957 HOH HOH 0 . 
ZL 39 HOH 4648 7648 6959 HOH HOH 0 . 
ZL 39 HOH 4649 7649 6961 HOH HOH 0 . 
ZL 39 HOH 4650 7650 6962 HOH HOH 0 . 
ZL 39 HOH 4651 7651 6963 HOH HOH 0 . 
ZL 39 HOH 4652 7652 6964 HOH HOH 0 . 
ZL 39 HOH 4653 7653 6965 HOH HOH 0 . 
ZL 39 HOH 4654 7654 6966 HOH HOH 0 . 
ZL 39 HOH 4655 7655 6967 HOH HOH 0 . 
ZL 39 HOH 4656 7656 6968 HOH HOH 0 . 
ZL 39 HOH 4657 7657 6970 HOH HOH 0 . 
ZL 39 HOH 4658 7658 6971 HOH HOH 0 . 
ZL 39 HOH 4659 7659 6973 HOH HOH 0 . 
ZL 39 HOH 4660 7660 6974 HOH HOH 0 . 
ZL 39 HOH 4661 7661 6975 HOH HOH 0 . 
ZL 39 HOH 4662 7662 6977 HOH HOH 0 . 
ZL 39 HOH 4663 7663 6980 HOH HOH 0 . 
ZL 39 HOH 4664 7664 6981 HOH HOH 0 . 
ZL 39 HOH 4665 7665 6983 HOH HOH 0 . 
ZL 39 HOH 4666 7666 6984 HOH HOH 0 . 
ZL 39 HOH 4667 7667 6985 HOH HOH 0 . 
ZL 39 HOH 4668 7668 6986 HOH HOH 0 . 
ZL 39 HOH 4669 7669 6987 HOH HOH 0 . 
ZL 39 HOH 4670 7670 6989 HOH HOH 0 . 
ZL 39 HOH 4671 7671 6990 HOH HOH 0 . 
ZL 39 HOH 4672 7672 6991 HOH HOH 0 . 
ZL 39 HOH 4673 7673 6992 HOH HOH 0 . 
ZL 39 HOH 4674 7674 6993 HOH HOH 0 . 
ZL 39 HOH 4675 7675 6995 HOH HOH 0 . 
ZL 39 HOH 4676 7676 6996 HOH HOH 0 . 
ZL 39 HOH 4677 7677 6997 HOH HOH 0 . 
ZL 39 HOH 4678 7678 6998 HOH HOH 0 . 
ZL 39 HOH 4679 7679 6999 HOH HOH 0 . 
ZL 39 HOH 4680 7680 7000 HOH HOH 0 . 
ZL 39 HOH 4681 7681 7001 HOH HOH 0 . 
ZL 39 HOH 4682 7682 7002 HOH HOH 0 . 
ZL 39 HOH 4683 7683 7005 HOH HOH 0 . 
ZL 39 HOH 4684 7684 7006 HOH HOH 0 . 
ZL 39 HOH 4685 7685 7007 HOH HOH 0 . 
ZL 39 HOH 4686 7686 7008 HOH HOH 0 . 
ZL 39 HOH 4687 7687 7009 HOH HOH 0 . 
ZL 39 HOH 4688 7688 7010 HOH HOH 0 . 
ZL 39 HOH 4689 7689 7012 HOH HOH 0 . 
ZL 39 HOH 4690 7690 7013 HOH HOH 0 . 
ZL 39 HOH 4691 7691 7014 HOH HOH 0 . 
ZL 39 HOH 4692 7692 7015 HOH HOH 0 . 
ZL 39 HOH 4693 7693 7021 HOH HOH 0 . 
ZL 39 HOH 4694 7694 7022 HOH HOH 0 . 
ZL 39 HOH 4695 7695 7023 HOH HOH 0 . 
ZL 39 HOH 4696 7696 7024 HOH HOH 0 . 
ZL 39 HOH 4697 7697 7025 HOH HOH 0 . 
ZL 39 HOH 4698 7698 7026 HOH HOH 0 . 
ZL 39 HOH 4699 7699 7027 HOH HOH 0 . 
ZL 39 HOH 4700 7700 7028 HOH HOH 0 . 
ZL 39 HOH 4701 7701 7030 HOH HOH 0 . 
ZL 39 HOH 4702 7702 7032 HOH HOH 0 . 
ZL 39 HOH 4703 7703 7033 HOH HOH 0 . 
ZL 39 HOH 4704 7704 7034 HOH HOH 0 . 
ZL 39 HOH 4705 7705 7035 HOH HOH 0 . 
ZL 39 HOH 4706 7706 7036 HOH HOH 0 . 
ZL 39 HOH 4707 7707 7037 HOH HOH 0 . 
ZL 39 HOH 4708 7708 7038 HOH HOH 0 . 
ZL 39 HOH 4709 7709 7039 HOH HOH 0 . 
ZL 39 HOH 4710 7710 7040 HOH HOH 0 . 
ZL 39 HOH 4711 7711 7041 HOH HOH 0 . 
ZL 39 HOH 4712 7712 7043 HOH HOH 0 . 
ZL 39 HOH 4713 7713 7044 HOH HOH 0 . 
ZL 39 HOH 4714 7714 7045 HOH HOH 0 . 
ZL 39 HOH 4715 7715 7047 HOH HOH 0 . 
ZL 39 HOH 4716 7716 7048 HOH HOH 0 . 
ZL 39 HOH 4717 7717 7049 HOH HOH 0 . 
ZL 39 HOH 4718 7718 7050 HOH HOH 0 . 
ZL 39 HOH 4719 7719 7051 HOH HOH 0 . 
ZL 39 HOH 4720 7720 7052 HOH HOH 0 . 
ZL 39 HOH 4721 7721 7053 HOH HOH 0 . 
ZL 39 HOH 4722 7722 7054 HOH HOH 0 . 
ZL 39 HOH 4723 7723 7055 HOH HOH 0 . 
ZL 39 HOH 4724 7724 7056 HOH HOH 0 . 
ZL 39 HOH 4725 7725 7059 HOH HOH 0 . 
ZL 39 HOH 4726 7726 7060 HOH HOH 0 . 
ZL 39 HOH 4727 7727 7062 HOH HOH 0 . 
ZL 39 HOH 4728 7728 7063 HOH HOH 0 . 
ZL 39 HOH 4729 7729 7065 HOH HOH 0 . 
ZL 39 HOH 4730 7730 7066 HOH HOH 0 . 
ZL 39 HOH 4731 7731 7067 HOH HOH 0 . 
ZL 39 HOH 4732 7732 7068 HOH HOH 0 . 
ZL 39 HOH 4733 7733 7069 HOH HOH 0 . 
ZL 39 HOH 4734 7734 7071 HOH HOH 0 . 
ZL 39 HOH 4735 7735 7074 HOH HOH 0 . 
ZL 39 HOH 4736 7736 7076 HOH HOH 0 . 
ZL 39 HOH 4737 7737 7078 HOH HOH 0 . 
ZL 39 HOH 4738 7738 7079 HOH HOH 0 . 
ZL 39 HOH 4739 7739 7080 HOH HOH 0 . 
ZL 39 HOH 4740 7740 7081 HOH HOH 0 . 
ZL 39 HOH 4741 7741 7082 HOH HOH 0 . 
ZL 39 HOH 4742 7742 7085 HOH HOH 0 . 
ZL 39 HOH 4743 7743 7086 HOH HOH 0 . 
ZL 39 HOH 4744 7744 7087 HOH HOH 0 . 
ZL 39 HOH 4745 7745 7090 HOH HOH 0 . 
ZL 39 HOH 4746 7746 7092 HOH HOH 0 . 
ZL 39 HOH 4747 7747 7094 HOH HOH 0 . 
ZL 39 HOH 4748 7748 7095 HOH HOH 0 . 
ZL 39 HOH 4749 7749 7096 HOH HOH 0 . 
ZL 39 HOH 4750 7750 7097 HOH HOH 0 . 
ZL 39 HOH 4751 7751 7098 HOH HOH 0 . 
ZL 39 HOH 4752 7752 7099 HOH HOH 0 . 
ZL 39 HOH 4753 7753 7100 HOH HOH 0 . 
ZL 39 HOH 4754 7754 7101 HOH HOH 0 . 
ZL 39 HOH 4755 7755 7102 HOH HOH 0 . 
ZL 39 HOH 4756 7756 7104 HOH HOH 0 . 
ZL 39 HOH 4757 7757 7105 HOH HOH 0 . 
ZL 39 HOH 4758 7758 7107 HOH HOH 0 . 
ZL 39 HOH 4759 7759 7108 HOH HOH 0 . 
ZL 39 HOH 4760 7760 7109 HOH HOH 0 . 
ZL 39 HOH 4761 7761 7112 HOH HOH 0 . 
ZL 39 HOH 4762 7762 7113 HOH HOH 0 . 
ZL 39 HOH 4763 7763 7114 HOH HOH 0 . 
ZL 39 HOH 4764 7764 7115 HOH HOH 0 . 
ZL 39 HOH 4765 7765 7116 HOH HOH 0 . 
ZL 39 HOH 4766 7766 7117 HOH HOH 0 . 
ZL 39 HOH 4767 7767 7118 HOH HOH 0 . 
ZL 39 HOH 4768 7768 7119 HOH HOH 0 . 
ZL 39 HOH 4769 7769 7120 HOH HOH 0 . 
ZL 39 HOH 4770 7770 7122 HOH HOH 0 . 
ZL 39 HOH 4771 7771 7124 HOH HOH 0 . 
ZL 39 HOH 4772 7772 7125 HOH HOH 0 . 
ZL 39 HOH 4773 7773 7126 HOH HOH 0 . 
ZL 39 HOH 4774 7774 7127 HOH HOH 0 . 
ZL 39 HOH 4775 7775 7128 HOH HOH 0 . 
ZL 39 HOH 4776 7776 7129 HOH HOH 0 . 
ZL 39 HOH 4777 7777 7130 HOH HOH 0 . 
ZL 39 HOH 4778 7778 7132 HOH HOH 0 . 
ZL 39 HOH 4779 7779 7133 HOH HOH 0 . 
ZL 39 HOH 4780 7780 7134 HOH HOH 0 . 
ZL 39 HOH 4781 7781 7135 HOH HOH 0 . 
ZL 39 HOH 4782 7782 7136 HOH HOH 0 . 
ZL 39 HOH 4783 7783 7137 HOH HOH 0 . 
ZL 39 HOH 4784 7784 7138 HOH HOH 0 . 
ZL 39 HOH 4785 7785 7140 HOH HOH 0 . 
ZL 39 HOH 4786 7786 7142 HOH HOH 0 . 
ZL 39 HOH 4787 7787 7144 HOH HOH 0 . 
ZL 39 HOH 4788 7788 7147 HOH HOH 0 . 
ZL 39 HOH 4789 7789 7150 HOH HOH 0 . 
ZL 39 HOH 4790 7790 7152 HOH HOH 0 . 
ZL 39 HOH 4791 7791 7153 HOH HOH 0 . 
ZL 39 HOH 4792 7792 7154 HOH HOH 0 . 
ZL 39 HOH 4793 7793 7155 HOH HOH 0 . 
ZL 39 HOH 4794 7794 7158 HOH HOH 0 . 
ZL 39 HOH 4795 7795 7159 HOH HOH 0 . 
ZL 39 HOH 4796 7796 7160 HOH HOH 0 . 
ZL 39 HOH 4797 7797 7162 HOH HOH 0 . 
ZL 39 HOH 4798 7798 7165 HOH HOH 0 . 
ZL 39 HOH 4799 7799 7166 HOH HOH 0 . 
ZL 39 HOH 4800 7800 7168 HOH HOH 0 . 
ZL 39 HOH 4801 7801 7170 HOH HOH 0 . 
ZL 39 HOH 4802 7802 7171 HOH HOH 0 . 
ZL 39 HOH 4803 7803 7172 HOH HOH 0 . 
ZL 39 HOH 4804 7804 7173 HOH HOH 0 . 
ZL 39 HOH 4805 7805 7174 HOH HOH 0 . 
ZL 39 HOH 4806 7806 7175 HOH HOH 0 . 
ZL 39 HOH 4807 7807 7178 HOH HOH 0 . 
ZL 39 HOH 4808 7808 7179 HOH HOH 0 . 
ZL 39 HOH 4809 7809 7180 HOH HOH 0 . 
ZL 39 HOH 4810 7810 7182 HOH HOH 0 . 
ZL 39 HOH 4811 7811 7184 HOH HOH 0 . 
ZL 39 HOH 4812 7812 7185 HOH HOH 0 . 
ZL 39 HOH 4813 7813 7187 HOH HOH 0 . 
ZL 39 HOH 4814 7814 7188 HOH HOH 0 . 
ZL 39 HOH 4815 7815 7189 HOH HOH 0 . 
ZL 39 HOH 4816 7816 7190 HOH HOH 0 . 
ZL 39 HOH 4817 7817 7191 HOH HOH 0 . 
ZL 39 HOH 4818 7818 7192 HOH HOH 0 . 
ZL 39 HOH 4819 7819 7193 HOH HOH 0 . 
ZL 39 HOH 4820 7820 7194 HOH HOH 0 . 
ZL 39 HOH 4821 7821 7196 HOH HOH 0 . 
ZL 39 HOH 4822 7822 7197 HOH HOH 0 . 
ZL 39 HOH 4823 7823 7198 HOH HOH 0 . 
ZL 39 HOH 4824 7824 7199 HOH HOH 0 . 
ZL 39 HOH 4825 7825 7200 HOH HOH 0 . 
ZL 39 HOH 4826 7826 7201 HOH HOH 0 . 
ZL 39 HOH 4827 7827 7202 HOH HOH 0 . 
ZL 39 HOH 4828 7828 7203 HOH HOH 0 . 
ZL 39 HOH 4829 7829 7204 HOH HOH 0 . 
ZL 39 HOH 4830 7830 7205 HOH HOH 0 . 
ZL 39 HOH 4831 7831 7206 HOH HOH 0 . 
ZL 39 HOH 4832 7832 7207 HOH HOH 0 . 
ZL 39 HOH 4833 7833 7209 HOH HOH 0 . 
ZL 39 HOH 4834 7834 7211 HOH HOH 0 . 
ZL 39 HOH 4835 7835 7212 HOH HOH 0 . 
ZL 39 HOH 4836 7836 7214 HOH HOH 0 . 
ZL 39 HOH 4837 7837 7216 HOH HOH 0 . 
ZL 39 HOH 4838 7838 7217 HOH HOH 0 . 
ZL 39 HOH 4839 7839 7219 HOH HOH 0 . 
ZL 39 HOH 4840 7840 7220 HOH HOH 0 . 
ZL 39 HOH 4841 7841 7221 HOH HOH 0 . 
ZL 39 HOH 4842 7842 7222 HOH HOH 0 . 
ZL 39 HOH 4843 7843 7226 HOH HOH 0 . 
ZL 39 HOH 4844 7844 7227 HOH HOH 0 . 
ZL 39 HOH 4845 7845 7228 HOH HOH 0 . 
ZL 39 HOH 4846 7846 7230 HOH HOH 0 . 
ZL 39 HOH 4847 7847 7231 HOH HOH 0 . 
ZL 39 HOH 4848 7848 7232 HOH HOH 0 . 
ZL 39 HOH 4849 7849 7233 HOH HOH 0 . 
ZL 39 HOH 4850 7850 7235 HOH HOH 0 . 
ZL 39 HOH 4851 7851 7237 HOH HOH 0 . 
ZL 39 HOH 4852 7852 7238 HOH HOH 0 . 
ZL 39 HOH 4853 7853 7241 HOH HOH 0 . 
ZL 39 HOH 4854 7854 7242 HOH HOH 0 . 
ZL 39 HOH 4855 7855 7243 HOH HOH 0 . 
ZL 39 HOH 4856 7856 7250 HOH HOH 0 . 
ZL 39 HOH 4857 7857 7251 HOH HOH 0 . 
ZL 39 HOH 4858 7858 7252 HOH HOH 0 . 
ZL 39 HOH 4859 7859 7253 HOH HOH 0 . 
ZL 39 HOH 4860 7860 7255 HOH HOH 0 . 
ZL 39 HOH 4861 7861 7256 HOH HOH 0 . 
ZL 39 HOH 4862 7862 7257 HOH HOH 0 . 
ZL 39 HOH 4863 7863 7258 HOH HOH 0 . 
ZL 39 HOH 4864 7864 7259 HOH HOH 0 . 
ZL 39 HOH 4865 7865 7260 HOH HOH 0 . 
ZL 39 HOH 4866 7866 7261 HOH HOH 0 . 
ZL 39 HOH 4867 7867 7262 HOH HOH 0 . 
ZL 39 HOH 4868 7868 7264 HOH HOH 0 . 
ZL 39 HOH 4869 7869 7265 HOH HOH 0 . 
ZL 39 HOH 4870 7870 7266 HOH HOH 0 . 
ZL 39 HOH 4871 7871 7269 HOH HOH 0 . 
ZL 39 HOH 4872 7872 7271 HOH HOH 0 . 
ZL 39 HOH 4873 7873 7272 HOH HOH 0 . 
ZL 39 HOH 4874 7874 7275 HOH HOH 0 . 
ZL 39 HOH 4875 7875 7278 HOH HOH 0 . 
ZL 39 HOH 4876 7876 7280 HOH HOH 0 . 
ZL 39 HOH 4877 7877 7283 HOH HOH 0 . 
ZL 39 HOH 4878 7878 7286 HOH HOH 0 . 
ZL 39 HOH 4879 7879 7288 HOH HOH 0 . 
ZL 39 HOH 4880 7880 7290 HOH HOH 0 . 
ZL 39 HOH 4881 7881 7291 HOH HOH 0 . 
ZL 39 HOH 4882 7882 7293 HOH HOH 0 . 
ZL 39 HOH 4883 7883 7295 HOH HOH 0 . 
ZL 39 HOH 4884 7884 7296 HOH HOH 0 . 
ZL 39 HOH 4885 7885 7297 HOH HOH 0 . 
ZL 39 HOH 4886 7886 7299 HOH HOH 0 . 
ZL 39 HOH 4887 7887 7300 HOH HOH 0 . 
ZL 39 HOH 4888 7888 7302 HOH HOH 0 . 
ZL 39 HOH 4889 7889 7304 HOH HOH 0 . 
ZL 39 HOH 4890 7890 7305 HOH HOH 0 . 
ZL 39 HOH 4891 7891 7308 HOH HOH 0 . 
ZL 39 HOH 4892 7892 7309 HOH HOH 0 . 
ZL 39 HOH 4893 7893 7310 HOH HOH 0 . 
ZL 39 HOH 4894 7894 7311 HOH HOH 0 . 
ZL 39 HOH 4895 7895 7312 HOH HOH 0 . 
ZL 39 HOH 4896 7896 7313 HOH HOH 0 . 
ZL 39 HOH 4897 7897 7314 HOH HOH 0 . 
ZL 39 HOH 4898 7898 7316 HOH HOH 0 . 
ZL 39 HOH 4899 7899 7317 HOH HOH 0 . 
ZL 39 HOH 4900 7900 7318 HOH HOH 0 . 
ZL 39 HOH 4901 7901 7319 HOH HOH 0 . 
ZL 39 HOH 4902 7902 7320 HOH HOH 0 . 
ZL 39 HOH 4903 7903 7321 HOH HOH 0 . 
ZL 39 HOH 4904 7904 7323 HOH HOH 0 . 
ZL 39 HOH 4905 7905 7326 HOH HOH 0 . 
ZL 39 HOH 4906 7906 7327 HOH HOH 0 . 
ZL 39 HOH 4907 7907 7329 HOH HOH 0 . 
ZL 39 HOH 4908 7908 7331 HOH HOH 0 . 
ZL 39 HOH 4909 7909 7332 HOH HOH 0 . 
ZL 39 HOH 4910 7910 7333 HOH HOH 0 . 
ZL 39 HOH 4911 7911 7334 HOH HOH 0 . 
ZL 39 HOH 4912 7912 7335 HOH HOH 0 . 
ZL 39 HOH 4913 7913 7336 HOH HOH 0 . 
ZL 39 HOH 4914 7914 7337 HOH HOH 0 . 
ZL 39 HOH 4915 7915 7338 HOH HOH 0 . 
ZL 39 HOH 4916 7916 7339 HOH HOH 0 . 
ZL 39 HOH 4917 7917 7340 HOH HOH 0 . 
ZL 39 HOH 4918 7918 7341 HOH HOH 0 . 
ZL 39 HOH 4919 7919 7342 HOH HOH 0 . 
ZL 39 HOH 4920 7920 7344 HOH HOH 0 . 
ZL 39 HOH 4921 7921 7346 HOH HOH 0 . 
ZL 39 HOH 4922 7922 7348 HOH HOH 0 . 
ZL 39 HOH 4923 7923 7350 HOH HOH 0 . 
ZL 39 HOH 4924 7924 7351 HOH HOH 0 . 
ZL 39 HOH 4925 7925 7352 HOH HOH 0 . 
ZL 39 HOH 4926 7926 7353 HOH HOH 0 . 
ZL 39 HOH 4927 7927 7355 HOH HOH 0 . 
ZL 39 HOH 4928 7928 7356 HOH HOH 0 . 
ZL 39 HOH 4929 7929 7357 HOH HOH 0 . 
ZL 39 HOH 4930 7930 7359 HOH HOH 0 . 
ZL 39 HOH 4931 7931 7360 HOH HOH 0 . 
ZL 39 HOH 4932 7932 7362 HOH HOH 0 . 
ZL 39 HOH 4933 7933 7363 HOH HOH 0 . 
ZL 39 HOH 4934 7934 7364 HOH HOH 0 . 
ZL 39 HOH 4935 7935 7365 HOH HOH 0 . 
ZL 39 HOH 4936 7936 7366 HOH HOH 0 . 
ZL 39 HOH 4937 7937 7367 HOH HOH 0 . 
ZL 39 HOH 4938 7938 7368 HOH HOH 0 . 
ZL 39 HOH 4939 7939 7369 HOH HOH 0 . 
ZL 39 HOH 4940 7940 7371 HOH HOH 0 . 
ZL 39 HOH 4941 7941 7372 HOH HOH 0 . 
ZL 39 HOH 4942 7942 7373 HOH HOH 0 . 
ZL 39 HOH 4943 7943 7382 HOH HOH 0 . 
ZL 39 HOH 4944 7944 7383 HOH HOH 0 . 
ZL 39 HOH 4945 7945 7385 HOH HOH 0 . 
ZL 39 HOH 4946 7946 7386 HOH HOH 0 . 
ZL 39 HOH 4947 7947 7388 HOH HOH 0 . 
ZL 39 HOH 4948 7948 7389 HOH HOH 0 . 
ZL 39 HOH 4949 7949 7391 HOH HOH 0 . 
ZL 39 HOH 4950 7950 7392 HOH HOH 0 . 
ZL 39 HOH 4951 7951 7393 HOH HOH 0 . 
ZL 39 HOH 4952 7952 7394 HOH HOH 0 . 
ZL 39 HOH 4953 7953 7395 HOH HOH 0 . 
ZL 39 HOH 4954 7954 7397 HOH HOH 0 . 
ZL 39 HOH 4955 7955 7398 HOH HOH 0 . 
ZL 39 HOH 4956 7956 7399 HOH HOH 0 . 
ZL 39 HOH 4957 7957 7402 HOH HOH 0 . 
ZL 39 HOH 4958 7958 7403 HOH HOH 0 . 
ZL 39 HOH 4959 7959 7405 HOH HOH 0 . 
ZL 39 HOH 4960 7960 7406 HOH HOH 0 . 
ZL 39 HOH 4961 7961 7407 HOH HOH 0 . 
ZL 39 HOH 4962 7962 7409 HOH HOH 0 . 
ZL 39 HOH 4963 7963 7410 HOH HOH 0 . 
ZL 39 HOH 4964 7964 7412 HOH HOH 0 . 
ZL 39 HOH 4965 7965 7414 HOH HOH 0 . 
ZL 39 HOH 4966 7966 7415 HOH HOH 0 . 
ZL 39 HOH 4967 7967 7416 HOH HOH 0 . 
ZL 39 HOH 4968 7968 7417 HOH HOH 0 . 
ZL 39 HOH 4969 7969 7418 HOH HOH 0 . 
ZL 39 HOH 4970 7970 7420 HOH HOH 0 . 
ZL 39 HOH 4971 7971 7421 HOH HOH 0 . 
ZL 39 HOH 4972 7972 7422 HOH HOH 0 . 
ZL 39 HOH 4973 7973 7423 HOH HOH 0 . 
ZL 39 HOH 4974 7974 7429 HOH HOH 0 . 
ZL 39 HOH 4975 7975 7430 HOH HOH 0 . 
ZL 39 HOH 4976 7976 7431 HOH HOH 0 . 
ZL 39 HOH 4977 7977 7432 HOH HOH 0 . 
ZL 39 HOH 4978 7978 7433 HOH HOH 0 . 
ZL 39 HOH 4979 7979 7434 HOH HOH 0 . 
ZL 39 HOH 4980 7980 7435 HOH HOH 0 . 
ZL 39 HOH 4981 7981 7437 HOH HOH 0 . 
ZL 39 HOH 4982 7982 7440 HOH HOH 0 . 
ZL 39 HOH 4983 7983 7441 HOH HOH 0 . 
ZL 39 HOH 4984 7984 7442 HOH HOH 0 . 
ZL 39 HOH 4985 7985 7443 HOH HOH 0 . 
ZL 39 HOH 4986 7986 7445 HOH HOH 0 . 
ZL 39 HOH 4987 7987 7446 HOH HOH 0 . 
ZL 39 HOH 4988 7988 7447 HOH HOH 0 . 
ZL 39 HOH 4989 7989 7448 HOH HOH 0 . 
ZL 39 HOH 4990 7990 7449 HOH HOH 0 . 
ZL 39 HOH 4991 7991 7450 HOH HOH 0 . 
ZL 39 HOH 4992 7992 7451 HOH HOH 0 . 
ZL 39 HOH 4993 7993 7452 HOH HOH 0 . 
ZL 39 HOH 4994 7994 7453 HOH HOH 0 . 
ZL 39 HOH 4995 7995 7455 HOH HOH 0 . 
ZL 39 HOH 4996 7996 7456 HOH HOH 0 . 
ZL 39 HOH 4997 7997 7457 HOH HOH 0 . 
ZL 39 HOH 4998 7998 7458 HOH HOH 0 . 
ZL 39 HOH 4999 7999 7459 HOH HOH 0 . 
ZL 39 HOH 5000 8000 7460 HOH HOH 0 . 
ZL 39 HOH 5001 8042 7461 HOH HOH 0 . 
ZL 39 HOH 5002 8050 7464 HOH HOH 0 . 
ZL 39 HOH 5003 8051 7466 HOH HOH 0 . 
ZL 39 HOH 5004 8054 7467 HOH HOH 0 . 
ZL 39 HOH 5005 8057 7468 HOH HOH 0 . 
ZL 39 HOH 5006 8074 7469 HOH HOH 0 . 
ZL 39 HOH 5007 8086 7472 HOH HOH 0 . 
ZL 39 HOH 5008 8094 7473 HOH HOH 0 . 
ZL 39 HOH 5009 8095 7476 HOH HOH 0 . 
ZL 39 HOH 5010 8096 7478 HOH HOH 0 . 
ZL 39 HOH 5011 8097 7479 HOH HOH 0 . 
ZL 39 HOH 5012 8098 7480 HOH HOH 0 . 
ZL 39 HOH 5013 8099 7483 HOH HOH 0 . 
ZL 39 HOH 5014 8100 7484 HOH HOH 0 . 
ZL 39 HOH 5015 8101 7485 HOH HOH 0 . 
ZL 39 HOH 5016 8102 7486 HOH HOH 0 . 
ZL 39 HOH 5017 8103 7487 HOH HOH 0 . 
ZL 39 HOH 5018 8104 7489 HOH HOH 0 . 
ZL 39 HOH 5019 8105 7490 HOH HOH 0 . 
ZL 39 HOH 5020 8106 7491 HOH HOH 0 . 
ZL 39 HOH 5021 8107 7493 HOH HOH 0 . 
ZL 39 HOH 5022 8108 7495 HOH HOH 0 . 
ZL 39 HOH 5023 8109 7496 HOH HOH 0 . 
ZL 39 HOH 5024 8110 7497 HOH HOH 0 . 
ZL 39 HOH 5025 8111 7498 HOH HOH 0 . 
ZL 39 HOH 5026 8112 7499 HOH HOH 0 . 
ZL 39 HOH 5027 8113 7504 HOH HOH 0 . 
ZL 39 HOH 5028 8114 7506 HOH HOH 0 . 
ZL 39 HOH 5029 8115 7507 HOH HOH 0 . 
ZL 39 HOH 5030 8116 7508 HOH HOH 0 . 
ZL 39 HOH 5031 8117 7509 HOH HOH 0 . 
ZL 39 HOH 5032 8118 7510 HOH HOH 0 . 
ZL 39 HOH 5033 8119 7511 HOH HOH 0 . 
ZL 39 HOH 5034 8120 7512 HOH HOH 0 . 
ZL 39 HOH 5035 8121 7513 HOH HOH 0 . 
ZL 39 HOH 5036 8122 7514 HOH HOH 0 . 
ZL 39 HOH 5037 8123 7515 HOH HOH 0 . 
ZL 39 HOH 5038 8124 7516 HOH HOH 0 . 
ZL 39 HOH 5039 8125 7517 HOH HOH 0 . 
ZL 39 HOH 5040 8126 7518 HOH HOH 0 . 
ZL 39 HOH 5041 8127 7520 HOH HOH 0 . 
ZL 39 HOH 5042 8128 7522 HOH HOH 0 . 
ZL 39 HOH 5043 8129 7523 HOH HOH 0 . 
ZL 39 HOH 5044 8130 7524 HOH HOH 0 . 
ZL 39 HOH 5045 8131 7526 HOH HOH 0 . 
ZL 39 HOH 5046 8132 7527 HOH HOH 0 . 
ZL 39 HOH 5047 8133 7528 HOH HOH 0 . 
ZL 39 HOH 5048 8134 7529 HOH HOH 0 . 
ZL 39 HOH 5049 8135 7530 HOH HOH 0 . 
ZL 39 HOH 5050 8136 7532 HOH HOH 0 . 
ZL 39 HOH 5051 8137 7533 HOH HOH 0 . 
ZL 39 HOH 5052 8138 7534 HOH HOH 0 . 
ZL 39 HOH 5053 8139 7536 HOH HOH 0 . 
ZL 39 HOH 5054 8140 7537 HOH HOH 0 . 
ZL 39 HOH 5055 8141 7538 HOH HOH 0 . 
ZL 39 HOH 5056 8142 7540 HOH HOH 0 . 
ZL 39 HOH 5057 8143 7541 HOH HOH 0 . 
ZL 39 HOH 5058 8144 7547 HOH HOH 0 . 
ZL 39 HOH 5059 8145 7548 HOH HOH 0 . 
ZL 39 HOH 5060 8146 7550 HOH HOH 0 . 
ZL 39 HOH 5061 8147 7553 HOH HOH 0 . 
ZL 39 HOH 5062 8148 7554 HOH HOH 0 . 
ZL 39 HOH 5063 8149 7557 HOH HOH 0 . 
ZL 39 HOH 5064 8150 7558 HOH HOH 0 . 
ZL 39 HOH 5065 8151 7559 HOH HOH 0 . 
ZL 39 HOH 5066 8152 7560 HOH HOH 0 . 
ZL 39 HOH 5067 8153 7562 HOH HOH 0 . 
ZL 39 HOH 5068 8154 7563 HOH HOH 0 . 
ZL 39 HOH 5069 8155 7564 HOH HOH 0 . 
ZL 39 HOH 5070 8156 7566 HOH HOH 0 . 
ZL 39 HOH 5071 8157 7567 HOH HOH 0 . 
ZL 39 HOH 5072 8158 7570 HOH HOH 0 . 
ZL 39 HOH 5073 8159 7571 HOH HOH 0 . 
ZL 39 HOH 5074 8160 7573 HOH HOH 0 . 
ZL 39 HOH 5075 8161 7574 HOH HOH 0 . 
ZL 39 HOH 5076 8162 7578 HOH HOH 0 . 
ZL 39 HOH 5077 8163 7581 HOH HOH 0 . 
ZL 39 HOH 5078 8164 7582 HOH HOH 0 . 
ZL 39 HOH 5079 8165 7583 HOH HOH 0 . 
ZL 39 HOH 5080 8166 7584 HOH HOH 0 . 
ZL 39 HOH 5081 8167 7585 HOH HOH 0 . 
ZL 39 HOH 5082 8168 7586 HOH HOH 0 . 
ZL 39 HOH 5083 8169 7587 HOH HOH 0 . 
ZL 39 HOH 5084 8170 7588 HOH HOH 0 . 
ZL 39 HOH 5085 8171 7589 HOH HOH 0 . 
ZL 39 HOH 5086 8172 7591 HOH HOH 0 . 
ZL 39 HOH 5087 8173 7592 HOH HOH 0 . 
ZL 39 HOH 5088 8174 7593 HOH HOH 0 . 
ZL 39 HOH 5089 8175 7594 HOH HOH 0 . 
ZL 39 HOH 5090 8176 7595 HOH HOH 0 . 
ZL 39 HOH 5091 8177 7596 HOH HOH 0 . 
ZL 39 HOH 5092 8178 7598 HOH HOH 0 . 
ZL 39 HOH 5093 8179 7599 HOH HOH 0 . 
ZL 39 HOH 5094 8180 7600 HOH HOH 0 . 
ZL 39 HOH 5095 8181 7601 HOH HOH 0 . 
ZL 39 HOH 5096 8182 7602 HOH HOH 0 . 
ZL 39 HOH 5097 8183 7604 HOH HOH 0 . 
ZL 39 HOH 5098 8184 7605 HOH HOH 0 . 
ZL 39 HOH 5099 8185 7609 HOH HOH 0 . 
ZL 39 HOH 5100 8186 7610 HOH HOH 0 . 
ZL 39 HOH 5101 8187 7612 HOH HOH 0 . 
ZL 39 HOH 5102 8188 7614 HOH HOH 0 . 
ZL 39 HOH 5103 8189 7615 HOH HOH 0 . 
ZL 39 HOH 5104 8190 7616 HOH HOH 0 . 
ZL 39 HOH 5105 8191 7618 HOH HOH 0 . 
ZL 39 HOH 5106 8192 7619 HOH HOH 0 . 
ZL 39 HOH 5107 8193 7620 HOH HOH 0 . 
ZL 39 HOH 5108 8194 7621 HOH HOH 0 . 
ZL 39 HOH 5109 8195 7622 HOH HOH 0 . 
ZL 39 HOH 5110 8196 7623 HOH HOH 0 . 
ZL 39 HOH 5111 8197 7624 HOH HOH 0 . 
ZL 39 HOH 5112 8198 7626 HOH HOH 0 . 
ZL 39 HOH 5113 8199 7627 HOH HOH 0 . 
ZL 39 HOH 5114 8200 7628 HOH HOH 0 . 
ZL 39 HOH 5115 8201 7629 HOH HOH 0 . 
ZL 39 HOH 5116 8202 7632 HOH HOH 0 . 
ZL 39 HOH 5117 8203 7633 HOH HOH 0 . 
ZL 39 HOH 5118 8204 7634 HOH HOH 0 . 
ZL 39 HOH 5119 8205 7635 HOH HOH 0 . 
ZL 39 HOH 5120 8206 7638 HOH HOH 0 . 
ZL 39 HOH 5121 8207 7639 HOH HOH 0 . 
ZL 39 HOH 5122 8208 7640 HOH HOH 0 . 
ZL 39 HOH 5123 8209 7642 HOH HOH 0 . 
ZL 39 HOH 5124 8210 7643 HOH HOH 0 . 
ZL 39 HOH 5125 8211 7644 HOH HOH 0 . 
ZL 39 HOH 5126 8212 7645 HOH HOH 0 . 
ZL 39 HOH 5127 8213 7646 HOH HOH 0 . 
ZL 39 HOH 5128 8214 7647 HOH HOH 0 . 
ZL 39 HOH 5129 8215 7648 HOH HOH 0 . 
ZL 39 HOH 5130 8216 7649 HOH HOH 0 . 
ZL 39 HOH 5131 8217 7651 HOH HOH 0 . 
ZL 39 HOH 5132 8218 7652 HOH HOH 0 . 
ZL 39 HOH 5133 8219 7654 HOH HOH 0 . 
ZL 39 HOH 5134 8220 7655 HOH HOH 0 . 
ZL 39 HOH 5135 8221 7656 HOH HOH 0 . 
ZL 39 HOH 5136 8222 7657 HOH HOH 0 . 
ZL 39 HOH 5137 8223 7659 HOH HOH 0 . 
ZL 39 HOH 5138 8224 7660 HOH HOH 0 . 
ZL 39 HOH 5139 8225 7662 HOH HOH 0 . 
ZL 39 HOH 5140 8226 7663 HOH HOH 0 . 
ZL 39 HOH 5141 8227 7664 HOH HOH 0 . 
ZL 39 HOH 5142 8228 7665 HOH HOH 0 . 
ZL 39 HOH 5143 8229 7666 HOH HOH 0 . 
ZL 39 HOH 5144 8230 7667 HOH HOH 0 . 
ZL 39 HOH 5145 8231 7668 HOH HOH 0 . 
ZL 39 HOH 5146 8232 7669 HOH HOH 0 . 
ZL 39 HOH 5147 8233 7670 HOH HOH 0 . 
ZL 39 HOH 5148 8234 7671 HOH HOH 0 . 
ZL 39 HOH 5149 8235 7672 HOH HOH 0 . 
ZL 39 HOH 5150 8236 7675 HOH HOH 0 . 
ZL 39 HOH 5151 8237 7676 HOH HOH 0 . 
ZL 39 HOH 5152 8238 7677 HOH HOH 0 . 
ZL 39 HOH 5153 8239 7679 HOH HOH 0 . 
ZL 39 HOH 5154 8240 7680 HOH HOH 0 . 
ZL 39 HOH 5155 8241 7683 HOH HOH 0 . 
ZL 39 HOH 5156 8242 7686 HOH HOH 0 . 
ZL 39 HOH 5157 8243 7687 HOH HOH 0 . 
ZL 39 HOH 5158 8244 7688 HOH HOH 0 . 
ZL 39 HOH 5159 8245 7689 HOH HOH 0 . 
ZL 39 HOH 5160 8246 7690 HOH HOH 0 . 
ZL 39 HOH 5161 8247 7691 HOH HOH 0 . 
ZL 39 HOH 5162 8248 7693 HOH HOH 0 . 
ZL 39 HOH 5163 8249 7694 HOH HOH 0 . 
ZL 39 HOH 5164 8250 7695 HOH HOH 0 . 
ZL 39 HOH 5165 8251 7696 HOH HOH 0 . 
ZL 39 HOH 5166 8252 7698 HOH HOH 0 . 
ZL 39 HOH 5167 8253 7700 HOH HOH 0 . 
ZL 39 HOH 5168 8254 7701 HOH HOH 0 . 
ZL 39 HOH 5169 8255 7702 HOH HOH 0 . 
ZL 39 HOH 5170 8256 7703 HOH HOH 0 . 
ZL 39 HOH 5171 8257 7704 HOH HOH 0 . 
ZL 39 HOH 5172 8258 7705 HOH HOH 0 . 
ZL 39 HOH 5173 8259 7706 HOH HOH 0 . 
ZL 39 HOH 5174 8260 7707 HOH HOH 0 . 
ZL 39 HOH 5175 8261 7708 HOH HOH 0 . 
ZL 39 HOH 5176 8262 7709 HOH HOH 0 . 
ZL 39 HOH 5177 8263 7710 HOH HOH 0 . 
ZL 39 HOH 5178 8264 7711 HOH HOH 0 . 
ZL 39 HOH 5179 8265 7712 HOH HOH 0 . 
ZL 39 HOH 5180 8266 7715 HOH HOH 0 . 
ZL 39 HOH 5181 8267 7717 HOH HOH 0 . 
ZL 39 HOH 5182 8268 7718 HOH HOH 0 . 
ZL 39 HOH 5183 8269 7719 HOH HOH 0 . 
ZL 39 HOH 5184 8270 7720 HOH HOH 0 . 
ZL 39 HOH 5185 8271 7721 HOH HOH 0 . 
ZL 39 HOH 5186 8272 7722 HOH HOH 0 . 
ZL 39 HOH 5187 8273 7723 HOH HOH 0 . 
ZL 39 HOH 5188 8274 7724 HOH HOH 0 . 
ZL 39 HOH 5189 8275 7725 HOH HOH 0 . 
ZL 39 HOH 5190 8276 7726 HOH HOH 0 . 
ZL 39 HOH 5191 8277 7727 HOH HOH 0 . 
ZL 39 HOH 5192 8278 7728 HOH HOH 0 . 
ZL 39 HOH 5193 8279 7729 HOH HOH 0 . 
ZL 39 HOH 5194 8280 7730 HOH HOH 0 . 
ZL 39 HOH 5195 8281 7731 HOH HOH 0 . 
ZL 39 HOH 5196 8282 7732 HOH HOH 0 . 
ZL 39 HOH 5197 8283 7733 HOH HOH 0 . 
ZL 39 HOH 5198 8284 7734 HOH HOH 0 . 
ZL 39 HOH 5199 8285 7735 HOH HOH 0 . 
ZL 39 HOH 5200 8286 7736 HOH HOH 0 . 
ZL 39 HOH 5201 8287 7737 HOH HOH 0 . 
ZL 39 HOH 5202 8288 7738 HOH HOH 0 . 
ZL 39 HOH 5203 8289 7739 HOH HOH 0 . 
ZL 39 HOH 5204 8290 7740 HOH HOH 0 . 
ZL 39 HOH 5205 8291 7741 HOH HOH 0 . 
ZL 39 HOH 5206 8292 7742 HOH HOH 0 . 
ZL 39 HOH 5207 8293 7743 HOH HOH 0 . 
ZL 39 HOH 5208 8294 7744 HOH HOH 0 . 
ZL 39 HOH 5209 8295 7745 HOH HOH 0 . 
ZL 39 HOH 5210 8296 7746 HOH HOH 0 . 
ZL 39 HOH 5211 8297 7747 HOH HOH 0 . 
ZL 39 HOH 5212 8298 7748 HOH HOH 0 . 
ZL 39 HOH 5213 8299 7749 HOH HOH 0 . 
ZL 39 HOH 5214 8300 7750 HOH HOH 0 . 
ZL 39 HOH 5215 8301 7751 HOH HOH 0 . 
ZL 39 HOH 5216 8302 7753 HOH HOH 0 . 
ZL 39 HOH 5217 8303 7754 HOH HOH 0 . 
ZL 39 HOH 5218 8304 7755 HOH HOH 0 . 
ZL 39 HOH 5219 8305 7756 HOH HOH 0 . 
ZL 39 HOH 5220 8306 7758 HOH HOH 0 . 
ZL 39 HOH 5221 8307 7759 HOH HOH 0 . 
ZL 39 HOH 5222 8308 7760 HOH HOH 0 . 
ZL 39 HOH 5223 8309 7761 HOH HOH 0 . 
ZL 39 HOH 5224 8310 7762 HOH HOH 0 . 
ZL 39 HOH 5225 8311 7763 HOH HOH 0 . 
ZL 39 HOH 5226 8312 7765 HOH HOH 0 . 
ZL 39 HOH 5227 8313 7766 HOH HOH 0 . 
ZL 39 HOH 5228 8314 7767 HOH HOH 0 . 
ZL 39 HOH 5229 8315 7768 HOH HOH 0 . 
ZL 39 HOH 5230 8316 7769 HOH HOH 0 . 
ZL 39 HOH 5231 8317 7771 HOH HOH 0 . 
ZL 39 HOH 5232 8318 7774 HOH HOH 0 . 
ZL 39 HOH 5233 8319 7775 HOH HOH 0 . 
ZL 39 HOH 5234 8320 7776 HOH HOH 0 . 
ZL 39 HOH 5235 8321 7777 HOH HOH 0 . 
ZL 39 HOH 5236 8322 7778 HOH HOH 0 . 
ZL 39 HOH 5237 8323 7779 HOH HOH 0 . 
ZL 39 HOH 5238 8324 7780 HOH HOH 0 . 
ZL 39 HOH 5239 8325 7781 HOH HOH 0 . 
ZL 39 HOH 5240 8326 7782 HOH HOH 0 . 
ZL 39 HOH 5241 8327 7783 HOH HOH 0 . 
ZL 39 HOH 5242 8328 7784 HOH HOH 0 . 
ZL 39 HOH 5243 8329 7786 HOH HOH 0 . 
ZL 39 HOH 5244 8330 7787 HOH HOH 0 . 
ZL 39 HOH 5245 8331 7788 HOH HOH 0 . 
ZL 39 HOH 5246 8332 7789 HOH HOH 0 . 
ZL 39 HOH 5247 8333 7790 HOH HOH 0 . 
ZL 39 HOH 5248 8334 7793 HOH HOH 0 . 
ZL 39 HOH 5249 8335 7794 HOH HOH 0 . 
ZL 39 HOH 5250 8336 7795 HOH HOH 0 . 
ZL 39 HOH 5251 8337 7796 HOH HOH 0 . 
ZL 39 HOH 5252 8338 7797 HOH HOH 0 . 
ZL 39 HOH 5253 8339 7798 HOH HOH 0 . 
ZL 39 HOH 5254 8340 7799 HOH HOH 0 . 
ZL 39 HOH 5255 8341 7800 HOH HOH 0 . 
ZL 39 HOH 5256 8342 7801 HOH HOH 0 . 
ZL 39 HOH 5257 8343 7802 HOH HOH 0 . 
ZL 39 HOH 5258 8344 7803 HOH HOH 0 . 
ZL 39 HOH 5259 8345 7804 HOH HOH 0 . 
ZL 39 HOH 5260 8346 7805 HOH HOH 0 . 
ZL 39 HOH 5261 8347 7806 HOH HOH 0 . 
ZL 39 HOH 5262 8348 7807 HOH HOH 0 . 
ZL 39 HOH 5263 8349 7808 HOH HOH 0 . 
ZL 39 HOH 5264 8350 7809 HOH HOH 0 . 
ZL 39 HOH 5265 8351 7811 HOH HOH 0 . 
ZL 39 HOH 5266 8352 7812 HOH HOH 0 . 
ZL 39 HOH 5267 8353 7813 HOH HOH 0 . 
ZL 39 HOH 5268 8354 7814 HOH HOH 0 . 
ZL 39 HOH 5269 8355 7815 HOH HOH 0 . 
ZL 39 HOH 5270 8356 7816 HOH HOH 0 . 
ZL 39 HOH 5271 8357 7817 HOH HOH 0 . 
ZL 39 HOH 5272 8358 7818 HOH HOH 0 . 
ZL 39 HOH 5273 8359 7819 HOH HOH 0 . 
ZL 39 HOH 5274 8360 7820 HOH HOH 0 . 
ZL 39 HOH 5275 8361 7821 HOH HOH 0 . 
ZL 39 HOH 5276 8362 7822 HOH HOH 0 . 
ZL 39 HOH 5277 8363 7823 HOH HOH 0 . 
ZL 39 HOH 5278 8364 7824 HOH HOH 0 . 
ZL 39 HOH 5279 8365 7825 HOH HOH 0 . 
ZL 39 HOH 5280 8366 7826 HOH HOH 0 . 
ZL 39 HOH 5281 8367 7827 HOH HOH 0 . 
ZL 39 HOH 5282 8368 7828 HOH HOH 0 . 
ZL 39 HOH 5283 8369 7829 HOH HOH 0 . 
ZL 39 HOH 5284 8370 7830 HOH HOH 0 . 
ZL 39 HOH 5285 8371 7831 HOH HOH 0 . 
ZL 39 HOH 5286 8372 7832 HOH HOH 0 . 
ZL 39 HOH 5287 8373 7833 HOH HOH 0 . 
ZL 39 HOH 5288 8374 7834 HOH HOH 0 . 
ZL 39 HOH 5289 8375 7835 HOH HOH 0 . 
ZL 39 HOH 5290 8376 7836 HOH HOH 0 . 
ZL 39 HOH 5291 8377 7837 HOH HOH 0 . 
ZL 39 HOH 5292 8378 7838 HOH HOH 0 . 
ZL 39 HOH 5293 8379 7839 HOH HOH 0 . 
ZL 39 HOH 5294 8380 7840 HOH HOH 0 . 
ZL 39 HOH 5295 8381 7841 HOH HOH 0 . 
ZL 39 HOH 5296 8382 7842 HOH HOH 0 . 
ZL 39 HOH 5297 8383 7843 HOH HOH 0 . 
ZL 39 HOH 5298 8384 7844 HOH HOH 0 . 
ZL 39 HOH 5299 8385 7845 HOH HOH 0 . 
ZL 39 HOH 5300 8386 7846 HOH HOH 0 . 
ZL 39 HOH 5301 8387 7847 HOH HOH 0 . 
ZL 39 HOH 5302 8388 7848 HOH HOH 0 . 
ZL 39 HOH 5303 8389 7849 HOH HOH 0 . 
ZL 39 HOH 5304 8390 7850 HOH HOH 0 . 
ZL 39 HOH 5305 8391 7851 HOH HOH 0 . 
ZL 39 HOH 5306 8392 7852 HOH HOH 0 . 
ZL 39 HOH 5307 8393 7853 HOH HOH 0 . 
ZL 39 HOH 5308 8394 7856 HOH HOH 0 . 
ZL 39 HOH 5309 8395 7858 HOH HOH 0 . 
ZL 39 HOH 5310 8396 7859 HOH HOH 0 . 
ZL 39 HOH 5311 8397 7860 HOH HOH 0 . 
ZL 39 HOH 5312 8398 7861 HOH HOH 0 . 
ZL 39 HOH 5313 8399 7862 HOH HOH 0 . 
ZL 39 HOH 5314 8400 7864 HOH HOH 0 . 
ZL 39 HOH 5315 8403 7865 HOH HOH 0 . 
ZL 39 HOH 5316 8404 7866 HOH HOH 0 . 
ZL 39 HOH 5317 8405 7869 HOH HOH 0 . 
ZL 39 HOH 5318 8406 7870 HOH HOH 0 . 
ZL 39 HOH 5319 8407 7872 HOH HOH 0 . 
ZL 39 HOH 5320 8408 7873 HOH HOH 0 . 
ZL 39 HOH 5321 8409 7876 HOH HOH 0 . 
ZL 39 HOH 5322 8410 7877 HOH HOH 0 . 
ZL 39 HOH 5323 8411 7878 HOH HOH 0 . 
ZL 39 HOH 5324 8412 7879 HOH HOH 0 . 
ZL 39 HOH 5325 8413 7880 HOH HOH 0 . 
ZL 39 HOH 5326 8414 7881 HOH HOH 0 . 
ZL 39 HOH 5327 8415 7882 HOH HOH 0 . 
ZL 39 HOH 5328 8416 7883 HOH HOH 0 . 
ZL 39 HOH 5329 8417 7884 HOH HOH 0 . 
ZL 39 HOH 5330 8418 7885 HOH HOH 0 . 
ZL 39 HOH 5331 8419 7886 HOH HOH 0 . 
ZL 39 HOH 5332 8420 7888 HOH HOH 0 . 
ZL 39 HOH 5333 8421 7889 HOH HOH 0 . 
ZL 39 HOH 5334 8422 7891 HOH HOH 0 . 
ZL 39 HOH 5335 8423 7893 HOH HOH 0 . 
ZL 39 HOH 5336 8424 7894 HOH HOH 0 . 
ZL 39 HOH 5337 8425 7896 HOH HOH 0 . 
ZL 39 HOH 5338 8426 7897 HOH HOH 0 . 
ZL 39 HOH 5339 8427 7898 HOH HOH 0 . 
ZL 39 HOH 5340 8428 7900 HOH HOH 0 . 
ZL 39 HOH 5341 8429 7903 HOH HOH 0 . 
ZL 39 HOH 5342 8430 7904 HOH HOH 0 . 
ZL 39 HOH 5343 8431 7905 HOH HOH 0 . 
ZL 39 HOH 5344 8432 7906 HOH HOH 0 . 
ZL 39 HOH 5345 8433 7909 HOH HOH 0 . 
ZL 39 HOH 5346 8434 7910 HOH HOH 0 . 
ZL 39 HOH 5347 9501 1    HOH HOH 0 . 
ZL 39 HOH 5348 9502 2    HOH HOH 0 . 
ZL 39 HOH 5349 9503 3    HOH HOH 0 . 
ZL 39 HOH 5350 9504 5    HOH HOH 0 . 
ZL 39 HOH 5351 9505 6    HOH HOH 0 . 
ZL 39 HOH 5352 9506 7    HOH HOH 0 . 
ZL 39 HOH 5353 9507 8    HOH HOH 0 . 
ZL 39 HOH 5354 9508 9    HOH HOH 0 . 
ZL 39 HOH 5355 9509 10   HOH HOH 0 . 
ZL 39 HOH 5356 9510 11   HOH HOH 0 . 
ZL 39 HOH 5357 9511 12   HOH HOH 0 . 
ZL 39 HOH 5358 9512 14   HOH HOH 0 . 
ZL 39 HOH 5359 9513 15   HOH HOH 0 . 
ZL 39 HOH 5360 9514 16   HOH HOH 0 . 
ZL 39 HOH 5361 9515 17   HOH HOH 0 . 
ZL 39 HOH 5362 9516 19   HOH HOH 0 . 
ZL 39 HOH 5363 9517 20   HOH HOH 0 . 
ZL 39 HOH 5364 9518 21   HOH HOH 0 . 
ZL 39 HOH 5365 9519 22   HOH HOH 0 . 
ZL 39 HOH 5366 9520 25   HOH HOH 0 . 
ZL 39 HOH 5367 9521 26   HOH HOH 0 . 
ZL 39 HOH 5368 9522 27   HOH HOH 0 . 
ZL 39 HOH 5369 9523 29   HOH HOH 0 . 
ZL 39 HOH 5370 9524 30   HOH HOH 0 . 
ZL 39 HOH 5371 9525 31   HOH HOH 0 . 
ZL 39 HOH 5372 9526 32   HOH HOH 0 . 
ZL 39 HOH 5373 9527 33   HOH HOH 0 . 
ZL 39 HOH 5374 9528 34   HOH HOH 0 . 
ZL 39 HOH 5375 9529 35   HOH HOH 0 . 
ZL 39 HOH 5376 9530 36   HOH HOH 0 . 
ZL 39 HOH 5377 9531 37   HOH HOH 0 . 
ZL 39 HOH 5378 9532 38   HOH HOH 0 . 
ZL 39 HOH 5379 9533 39   HOH HOH 0 . 
ZL 39 HOH 5380 9534 40   HOH HOH 0 . 
ZL 39 HOH 5381 9535 41   HOH HOH 0 . 
ZL 39 HOH 5382 9536 44   HOH HOH 0 . 
ZL 39 HOH 5383 9537 45   HOH HOH 0 . 
ZL 39 HOH 5384 9538 46   HOH HOH 0 . 
ZL 39 HOH 5385 9539 47   HOH HOH 0 . 
ZL 39 HOH 5386 9540 48   HOH HOH 0 . 
ZL 39 HOH 5387 9541 49   HOH HOH 0 . 
ZL 39 HOH 5388 9542 50   HOH HOH 0 . 
ZL 39 HOH 5389 9543 51   HOH HOH 0 . 
ZL 39 HOH 5390 9544 52   HOH HOH 0 . 
ZL 39 HOH 5391 9545 54   HOH HOH 0 . 
ZL 39 HOH 5392 9546 58   HOH HOH 0 . 
ZL 39 HOH 5393 9547 60   HOH HOH 0 . 
ZL 39 HOH 5394 9548 61   HOH HOH 0 . 
ZL 39 HOH 5395 9549 62   HOH HOH 0 . 
ZL 39 HOH 5396 9550 63   HOH HOH 0 . 
ZL 39 HOH 5397 9551 64   HOH HOH 0 . 
ZL 39 HOH 5398 9552 65   HOH HOH 0 . 
ZL 39 HOH 5399 9553 67   HOH HOH 0 . 
ZL 39 HOH 5400 9554 68   HOH HOH 0 . 
ZL 39 HOH 5401 9555 69   HOH HOH 0 . 
ZL 39 HOH 5402 9556 70   HOH HOH 0 . 
ZL 39 HOH 5403 9557 71   HOH HOH 0 . 
ZL 39 HOH 5404 9558 73   HOH HOH 0 . 
ZL 39 HOH 5405 9559 74   HOH HOH 0 . 
ZL 39 HOH 5406 9560 76   HOH HOH 0 . 
ZL 39 HOH 5407 9561 78   HOH HOH 0 . 
ZL 39 HOH 5408 9562 79   HOH HOH 0 . 
ZL 39 HOH 5409 9563 80   HOH HOH 0 . 
ZL 39 HOH 5410 9564 81   HOH HOH 0 . 
ZL 39 HOH 5411 9565 83   HOH HOH 0 . 
ZL 39 HOH 5412 9566 84   HOH HOH 0 . 
ZL 39 HOH 5413 9567 85   HOH HOH 0 . 
ZL 39 HOH 5414 9568 87   HOH HOH 0 . 
ZL 39 HOH 5415 9569 91   HOH HOH 0 . 
ZL 39 HOH 5416 9570 92   HOH HOH 0 . 
ZL 39 HOH 5417 9571 93   HOH HOH 0 . 
ZL 39 HOH 5418 9572 94   HOH HOH 0 . 
ZL 39 HOH 5419 9573 95   HOH HOH 0 . 
ZL 39 HOH 5420 9574 96   HOH HOH 0 . 
ZL 39 HOH 5421 9575 97   HOH HOH 0 . 
ZL 39 HOH 5422 9576 99   HOH HOH 0 . 
ZL 39 HOH 5423 9577 101  HOH HOH 0 . 
ZL 39 HOH 5424 9578 102  HOH HOH 0 . 
ZL 39 HOH 5425 9579 103  HOH HOH 0 . 
ZL 39 HOH 5426 9580 104  HOH HOH 0 . 
ZL 39 HOH 5427 9581 105  HOH HOH 0 . 
ZL 39 HOH 5428 9582 106  HOH HOH 0 . 
ZL 39 HOH 5429 9583 107  HOH HOH 0 . 
ZL 39 HOH 5430 9584 108  HOH HOH 0 . 
ZL 39 HOH 5431 9585 109  HOH HOH 0 . 
ZL 39 HOH 5432 9586 110  HOH HOH 0 . 
ZL 39 HOH 5433 9587 111  HOH HOH 0 . 
ZL 39 HOH 5434 9588 112  HOH HOH 0 . 
ZL 39 HOH 5435 9589 113  HOH HOH 0 . 
ZL 39 HOH 5436 9590 114  HOH HOH 0 . 
ZL 39 HOH 5437 9591 116  HOH HOH 0 . 
ZL 39 HOH 5438 9592 117  HOH HOH 0 . 
ZL 39 HOH 5439 9593 118  HOH HOH 0 . 
ZL 39 HOH 5440 9594 121  HOH HOH 0 . 
ZL 39 HOH 5441 9595 123  HOH HOH 0 . 
ZL 39 HOH 5442 9596 126  HOH HOH 0 . 
ZL 39 HOH 5443 9597 127  HOH HOH 0 . 
ZL 39 HOH 5444 9598 129  HOH HOH 0 . 
ZL 39 HOH 5445 9599 130  HOH HOH 0 . 
ZL 39 HOH 5446 9600 132  HOH HOH 0 . 
ZL 39 HOH 5447 9601 135  HOH HOH 0 . 
ZL 39 HOH 5448 9602 136  HOH HOH 0 . 
ZL 39 HOH 5449 9603 137  HOH HOH 0 . 
ZL 39 HOH 5450 9604 138  HOH HOH 0 . 
ZL 39 HOH 5451 9605 139  HOH HOH 0 . 
ZL 39 HOH 5452 9606 141  HOH HOH 0 . 
ZL 39 HOH 5453 9607 142  HOH HOH 0 . 
ZL 39 HOH 5454 9608 144  HOH HOH 0 . 
ZL 39 HOH 5455 9609 145  HOH HOH 0 . 
ZL 39 HOH 5456 9610 146  HOH HOH 0 . 
ZL 39 HOH 5457 9611 147  HOH HOH 0 . 
ZL 39 HOH 5458 9612 149  HOH HOH 0 . 
ZL 39 HOH 5459 9613 150  HOH HOH 0 . 
ZL 39 HOH 5460 9614 152  HOH HOH 0 . 
ZL 39 HOH 5461 9615 153  HOH HOH 0 . 
ZL 39 HOH 5462 9616 154  HOH HOH 0 . 
ZL 39 HOH 5463 9617 155  HOH HOH 0 . 
ZL 39 HOH 5464 9618 156  HOH HOH 0 . 
ZL 39 HOH 5465 9619 158  HOH HOH 0 . 
ZL 39 HOH 5466 9620 159  HOH HOH 0 . 
ZL 39 HOH 5467 9621 160  HOH HOH 0 . 
ZL 39 HOH 5468 9622 161  HOH HOH 0 . 
ZL 39 HOH 5469 9623 162  HOH HOH 0 . 
ZL 39 HOH 5470 9624 164  HOH HOH 0 . 
ZL 39 HOH 5471 9625 165  HOH HOH 0 . 
ZL 39 HOH 5472 9626 166  HOH HOH 0 . 
ZL 39 HOH 5473 9627 167  HOH HOH 0 . 
ZL 39 HOH 5474 9628 168  HOH HOH 0 . 
ZL 39 HOH 5475 9629 170  HOH HOH 0 . 
ZL 39 HOH 5476 9630 171  HOH HOH 0 . 
ZL 39 HOH 5477 9631 172  HOH HOH 0 . 
ZL 39 HOH 5478 9632 173  HOH HOH 0 . 
ZL 39 HOH 5479 9633 174  HOH HOH 0 . 
ZL 39 HOH 5480 9634 175  HOH HOH 0 . 
ZL 39 HOH 5481 9635 176  HOH HOH 0 . 
ZL 39 HOH 5482 9636 178  HOH HOH 0 . 
ZL 39 HOH 5483 9637 179  HOH HOH 0 . 
ZL 39 HOH 5484 9638 180  HOH HOH 0 . 
ZL 39 HOH 5485 9639 181  HOH HOH 0 . 
ZL 39 HOH 5486 9640 182  HOH HOH 0 . 
ZL 39 HOH 5487 9641 183  HOH HOH 0 . 
ZL 39 HOH 5488 9642 184  HOH HOH 0 . 
ZL 39 HOH 5489 9643 185  HOH HOH 0 . 
ZL 39 HOH 5490 9644 186  HOH HOH 0 . 
ZL 39 HOH 5491 9645 187  HOH HOH 0 . 
ZL 39 HOH 5492 9646 188  HOH HOH 0 . 
ZL 39 HOH 5493 9647 189  HOH HOH 0 . 
ZL 39 HOH 5494 9648 190  HOH HOH 0 . 
ZL 39 HOH 5495 9649 192  HOH HOH 0 . 
ZL 39 HOH 5496 9650 193  HOH HOH 0 . 
ZL 39 HOH 5497 9651 195  HOH HOH 0 . 
ZL 39 HOH 5498 9652 196  HOH HOH 0 . 
ZL 39 HOH 5499 9653 197  HOH HOH 0 . 
ZL 39 HOH 5500 9654 198  HOH HOH 0 . 
ZL 39 HOH 5501 9655 199  HOH HOH 0 . 
ZL 39 HOH 5502 9656 201  HOH HOH 0 . 
ZL 39 HOH 5503 9657 202  HOH HOH 0 . 
ZL 39 HOH 5504 9658 203  HOH HOH 0 . 
ZL 39 HOH 5505 9659 204  HOH HOH 0 . 
ZL 39 HOH 5506 9660 205  HOH HOH 0 . 
ZL 39 HOH 5507 9661 206  HOH HOH 0 . 
ZL 39 HOH 5508 9662 207  HOH HOH 0 . 
ZL 39 HOH 5509 9663 208  HOH HOH 0 . 
ZL 39 HOH 5510 9664 209  HOH HOH 0 . 
ZL 39 HOH 5511 9665 210  HOH HOH 0 . 
ZL 39 HOH 5512 9666 211  HOH HOH 0 . 
ZL 39 HOH 5513 9667 212  HOH HOH 0 . 
ZL 39 HOH 5514 9668 213  HOH HOH 0 . 
ZL 39 HOH 5515 9669 214  HOH HOH 0 . 
ZL 39 HOH 5516 9670 216  HOH HOH 0 . 
ZL 39 HOH 5517 9671 217  HOH HOH 0 . 
ZL 39 HOH 5518 9672 218  HOH HOH 0 . 
ZL 39 HOH 5519 9673 219  HOH HOH 0 . 
ZL 39 HOH 5520 9674 220  HOH HOH 0 . 
ZL 39 HOH 5521 9675 221  HOH HOH 0 . 
ZL 39 HOH 5522 9676 222  HOH HOH 0 . 
ZL 39 HOH 5523 9677 224  HOH HOH 0 . 
ZL 39 HOH 5524 9678 225  HOH HOH 0 . 
ZL 39 HOH 5525 9679 226  HOH HOH 0 . 
ZL 39 HOH 5526 9680 227  HOH HOH 0 . 
ZL 39 HOH 5527 9681 228  HOH HOH 0 . 
ZL 39 HOH 5528 9682 229  HOH HOH 0 . 
ZL 39 HOH 5529 9683 230  HOH HOH 0 . 
ZL 39 HOH 5530 9684 231  HOH HOH 0 . 
ZL 39 HOH 5531 9685 232  HOH HOH 0 . 
ZL 39 HOH 5532 9686 233  HOH HOH 0 . 
ZL 39 HOH 5533 9687 234  HOH HOH 0 . 
ZL 39 HOH 5534 9688 235  HOH HOH 0 . 
ZL 39 HOH 5535 9689 236  HOH HOH 0 . 
ZL 39 HOH 5536 9690 237  HOH HOH 0 . 
ZL 39 HOH 5537 9691 238  HOH HOH 0 . 
ZL 39 HOH 5538 9692 240  HOH HOH 0 . 
ZL 39 HOH 5539 9693 241  HOH HOH 0 . 
ZL 39 HOH 5540 9694 242  HOH HOH 0 . 
ZL 39 HOH 5541 9695 243  HOH HOH 0 . 
ZL 39 HOH 5542 9696 244  HOH HOH 0 . 
ZL 39 HOH 5543 9697 248  HOH HOH 0 . 
ZL 39 HOH 5544 9698 251  HOH HOH 0 . 
ZL 39 HOH 5545 9699 252  HOH HOH 0 . 
ZL 39 HOH 5546 9700 253  HOH HOH 0 . 
ZL 39 HOH 5547 9701 254  HOH HOH 0 . 
ZL 39 HOH 5548 9702 256  HOH HOH 0 . 
ZL 39 HOH 5549 9703 257  HOH HOH 0 . 
ZL 39 HOH 5550 9704 258  HOH HOH 0 . 
ZL 39 HOH 5551 9705 259  HOH HOH 0 . 
ZL 39 HOH 5552 9706 260  HOH HOH 0 . 
ZL 39 HOH 5553 9707 261  HOH HOH 0 . 
ZL 39 HOH 5554 9708 262  HOH HOH 0 . 
ZL 39 HOH 5555 9709 263  HOH HOH 0 . 
ZL 39 HOH 5556 9710 264  HOH HOH 0 . 
ZL 39 HOH 5557 9711 266  HOH HOH 0 . 
ZL 39 HOH 5558 9712 268  HOH HOH 0 . 
ZL 39 HOH 5559 9713 269  HOH HOH 0 . 
ZL 39 HOH 5560 9714 270  HOH HOH 0 . 
ZL 39 HOH 5561 9715 271  HOH HOH 0 . 
ZL 39 HOH 5562 9716 272  HOH HOH 0 . 
ZL 39 HOH 5563 9717 273  HOH HOH 0 . 
ZL 39 HOH 5564 9718 274  HOH HOH 0 . 
ZL 39 HOH 5565 9719 276  HOH HOH 0 . 
ZL 39 HOH 5566 9720 277  HOH HOH 0 . 
ZL 39 HOH 5567 9721 278  HOH HOH 0 . 
ZL 39 HOH 5568 9722 279  HOH HOH 0 . 
ZL 39 HOH 5569 9723 280  HOH HOH 0 . 
ZL 39 HOH 5570 9724 281  HOH HOH 0 . 
ZL 39 HOH 5571 9725 282  HOH HOH 0 . 
ZL 39 HOH 5572 9726 283  HOH HOH 0 . 
ZL 39 HOH 5573 9727 284  HOH HOH 0 . 
ZL 39 HOH 5574 9728 285  HOH HOH 0 . 
ZL 39 HOH 5575 9729 287  HOH HOH 0 . 
ZL 39 HOH 5576 9730 288  HOH HOH 0 . 
ZL 39 HOH 5577 9731 289  HOH HOH 0 . 
ZL 39 HOH 5578 9732 290  HOH HOH 0 . 
ZL 39 HOH 5579 9733 291  HOH HOH 0 . 
ZL 39 HOH 5580 9734 294  HOH HOH 0 . 
ZL 39 HOH 5581 9735 295  HOH HOH 0 . 
ZL 39 HOH 5582 9736 296  HOH HOH 0 . 
ZL 39 HOH 5583 9737 297  HOH HOH 0 . 
ZL 39 HOH 5584 9738 298  HOH HOH 0 . 
ZL 39 HOH 5585 9739 299  HOH HOH 0 . 
ZL 39 HOH 5586 9740 300  HOH HOH 0 . 
ZL 39 HOH 5587 9741 302  HOH HOH 0 . 
ZL 39 HOH 5588 9742 303  HOH HOH 0 . 
ZL 39 HOH 5589 9743 305  HOH HOH 0 . 
ZL 39 HOH 5590 9744 307  HOH HOH 0 . 
ZL 39 HOH 5591 9745 308  HOH HOH 0 . 
ZL 39 HOH 5592 9746 312  HOH HOH 0 . 
ZL 39 HOH 5593 9747 313  HOH HOH 0 . 
ZL 39 HOH 5594 9748 314  HOH HOH 0 . 
ZL 39 HOH 5595 9749 315  HOH HOH 0 . 
ZL 39 HOH 5596 9750 316  HOH HOH 0 . 
ZL 39 HOH 5597 9751 317  HOH HOH 0 . 
ZL 39 HOH 5598 9752 318  HOH HOH 0 . 
ZL 39 HOH 5599 9753 319  HOH HOH 0 . 
ZL 39 HOH 5600 9754 320  HOH HOH 0 . 
ZL 39 HOH 5601 9755 322  HOH HOH 0 . 
ZL 39 HOH 5602 9756 323  HOH HOH 0 . 
ZL 39 HOH 5603 9757 324  HOH HOH 0 . 
ZL 39 HOH 5604 9758 325  HOH HOH 0 . 
ZL 39 HOH 5605 9759 326  HOH HOH 0 . 
ZL 39 HOH 5606 9760 329  HOH HOH 0 . 
ZL 39 HOH 5607 9761 330  HOH HOH 0 . 
ZL 39 HOH 5608 9762 331  HOH HOH 0 . 
ZL 39 HOH 5609 9763 332  HOH HOH 0 . 
ZL 39 HOH 5610 9764 333  HOH HOH 0 . 
ZL 39 HOH 5611 9765 335  HOH HOH 0 . 
ZL 39 HOH 5612 9766 337  HOH HOH 0 . 
ZL 39 HOH 5613 9767 338  HOH HOH 0 . 
ZL 39 HOH 5614 9768 339  HOH HOH 0 . 
ZL 39 HOH 5615 9769 342  HOH HOH 0 . 
ZL 39 HOH 5616 9770 344  HOH HOH 0 . 
ZL 39 HOH 5617 9771 345  HOH HOH 0 . 
ZL 39 HOH 5618 9772 346  HOH HOH 0 . 
ZL 39 HOH 5619 9773 347  HOH HOH 0 . 
ZL 39 HOH 5620 9774 348  HOH HOH 0 . 
ZL 39 HOH 5621 9775 349  HOH HOH 0 . 
ZL 39 HOH 5622 9776 350  HOH HOH 0 . 
ZL 39 HOH 5623 9777 351  HOH HOH 0 . 
ZL 39 HOH 5624 9778 355  HOH HOH 0 . 
ZL 39 HOH 5625 9779 356  HOH HOH 0 . 
ZL 39 HOH 5626 9780 357  HOH HOH 0 . 
ZL 39 HOH 5627 9781 358  HOH HOH 0 . 
ZL 39 HOH 5628 9782 359  HOH HOH 0 . 
ZL 39 HOH 5629 9783 360  HOH HOH 0 . 
ZL 39 HOH 5630 9784 361  HOH HOH 0 . 
ZL 39 HOH 5631 9785 362  HOH HOH 0 . 
ZL 39 HOH 5632 9786 363  HOH HOH 0 . 
ZL 39 HOH 5633 9787 364  HOH HOH 0 . 
ZL 39 HOH 5634 9788 365  HOH HOH 0 . 
ZL 39 HOH 5635 9789 366  HOH HOH 0 . 
ZL 39 HOH 5636 9790 367  HOH HOH 0 . 
ZL 39 HOH 5637 9791 368  HOH HOH 0 . 
ZL 39 HOH 5638 9792 369  HOH HOH 0 . 
ZL 39 HOH 5639 9793 371  HOH HOH 0 . 
ZL 39 HOH 5640 9794 374  HOH HOH 0 . 
ZL 39 HOH 5641 9795 375  HOH HOH 0 . 
ZL 39 HOH 5642 9796 376  HOH HOH 0 . 
ZL 39 HOH 5643 9797 377  HOH HOH 0 . 
ZL 39 HOH 5644 9798 378  HOH HOH 0 . 
ZL 39 HOH 5645 9799 379  HOH HOH 0 . 
ZL 39 HOH 5646 9800 380  HOH HOH 0 . 
ZL 39 HOH 5647 9801 381  HOH HOH 0 . 
ZL 39 HOH 5648 9802 384  HOH HOH 0 . 
ZL 39 HOH 5649 9803 385  HOH HOH 0 . 
ZL 39 HOH 5650 9804 386  HOH HOH 0 . 
ZL 39 HOH 5651 9805 387  HOH HOH 0 . 
ZL 39 HOH 5652 9806 388  HOH HOH 0 . 
ZL 39 HOH 5653 9807 390  HOH HOH 0 . 
ZL 39 HOH 5654 9808 391  HOH HOH 0 . 
ZL 39 HOH 5655 9809 392  HOH HOH 0 . 
ZL 39 HOH 5656 9810 393  HOH HOH 0 . 
ZL 39 HOH 5657 9811 394  HOH HOH 0 . 
ZL 39 HOH 5658 9812 397  HOH HOH 0 . 
ZL 39 HOH 5659 9813 399  HOH HOH 0 . 
ZL 39 HOH 5660 9814 400  HOH HOH 0 . 
ZL 39 HOH 5661 9815 402  HOH HOH 0 . 
ZL 39 HOH 5662 9816 403  HOH HOH 0 . 
ZL 39 HOH 5663 9817 404  HOH HOH 0 . 
ZL 39 HOH 5664 9818 405  HOH HOH 0 . 
ZL 39 HOH 5665 9819 406  HOH HOH 0 . 
ZL 39 HOH 5666 9820 407  HOH HOH 0 . 
ZL 39 HOH 5667 9821 409  HOH HOH 0 . 
ZL 39 HOH 5668 9822 410  HOH HOH 0 . 
ZL 39 HOH 5669 9823 411  HOH HOH 0 . 
ZL 39 HOH 5670 9824 412  HOH HOH 0 . 
ZL 39 HOH 5671 9825 413  HOH HOH 0 . 
ZL 39 HOH 5672 9826 414  HOH HOH 0 . 
ZL 39 HOH 5673 9827 415  HOH HOH 0 . 
ZL 39 HOH 5674 9828 416  HOH HOH 0 . 
ZL 39 HOH 5675 9829 417  HOH HOH 0 . 
ZL 39 HOH 5676 9830 418  HOH HOH 0 . 
ZL 39 HOH 5677 9831 419  HOH HOH 0 . 
ZL 39 HOH 5678 9832 420  HOH HOH 0 . 
ZL 39 HOH 5679 9833 422  HOH HOH 0 . 
ZL 39 HOH 5680 9834 423  HOH HOH 0 . 
ZL 39 HOH 5681 9835 424  HOH HOH 0 . 
ZL 39 HOH 5682 9836 425  HOH HOH 0 . 
ZL 39 HOH 5683 9837 426  HOH HOH 0 . 
ZL 39 HOH 5684 9838 427  HOH HOH 0 . 
ZL 39 HOH 5685 9839 428  HOH HOH 0 . 
ZL 39 HOH 5686 9840 429  HOH HOH 0 . 
ZL 39 HOH 5687 9841 430  HOH HOH 0 . 
ZL 39 HOH 5688 9842 431  HOH HOH 0 . 
ZL 39 HOH 5689 9843 432  HOH HOH 0 . 
ZL 39 HOH 5690 9844 433  HOH HOH 0 . 
ZL 39 HOH 5691 9845 434  HOH HOH 0 . 
ZL 39 HOH 5692 9846 435  HOH HOH 0 . 
ZL 39 HOH 5693 9847 437  HOH HOH 0 . 
ZL 39 HOH 5694 9848 438  HOH HOH 0 . 
ZL 39 HOH 5695 9849 439  HOH HOH 0 . 
ZL 39 HOH 5696 9850 441  HOH HOH 0 . 
ZL 39 HOH 5697 9851 442  HOH HOH 0 . 
ZL 39 HOH 5698 9852 443  HOH HOH 0 . 
ZL 39 HOH 5699 9853 445  HOH HOH 0 . 
ZL 39 HOH 5700 9854 446  HOH HOH 0 . 
ZL 39 HOH 5701 9855 447  HOH HOH 0 . 
ZL 39 HOH 5702 9856 448  HOH HOH 0 . 
ZL 39 HOH 5703 9857 449  HOH HOH 0 . 
ZL 39 HOH 5704 9858 451  HOH HOH 0 . 
ZL 39 HOH 5705 9859 452  HOH HOH 0 . 
ZL 39 HOH 5706 9860 453  HOH HOH 0 . 
ZL 39 HOH 5707 9861 454  HOH HOH 0 . 
ZL 39 HOH 5708 9862 455  HOH HOH 0 . 
ZL 39 HOH 5709 9863 456  HOH HOH 0 . 
ZL 39 HOH 5710 9864 457  HOH HOH 0 . 
ZL 39 HOH 5711 9865 459  HOH HOH 0 . 
ZL 39 HOH 5712 9866 461  HOH HOH 0 . 
ZL 39 HOH 5713 9867 462  HOH HOH 0 . 
ZL 39 HOH 5714 9868 463  HOH HOH 0 . 
ZL 39 HOH 5715 9869 464  HOH HOH 0 . 
ZL 39 HOH 5716 9870 465  HOH HOH 0 . 
ZL 39 HOH 5717 9871 467  HOH HOH 0 . 
ZL 39 HOH 5718 9872 469  HOH HOH 0 . 
ZL 39 HOH 5719 9873 470  HOH HOH 0 . 
ZL 39 HOH 5720 9874 471  HOH HOH 0 . 
ZL 39 HOH 5721 9875 472  HOH HOH 0 . 
ZL 39 HOH 5722 9876 473  HOH HOH 0 . 
ZL 39 HOH 5723 9877 474  HOH HOH 0 . 
ZL 39 HOH 5724 9878 475  HOH HOH 0 . 
ZL 39 HOH 5725 9879 476  HOH HOH 0 . 
ZL 39 HOH 5726 9880 477  HOH HOH 0 . 
ZL 39 HOH 5727 9881 478  HOH HOH 0 . 
ZL 39 HOH 5728 9882 479  HOH HOH 0 . 
ZL 39 HOH 5729 9883 480  HOH HOH 0 . 
ZL 39 HOH 5730 9884 481  HOH HOH 0 . 
ZL 39 HOH 5731 9885 482  HOH HOH 0 . 
ZL 39 HOH 5732 9886 483  HOH HOH 0 . 
ZL 39 HOH 5733 9887 484  HOH HOH 0 . 
ZL 39 HOH 5734 9888 485  HOH HOH 0 . 
ZL 39 HOH 5735 9889 486  HOH HOH 0 . 
ZL 39 HOH 5736 9890 487  HOH HOH 0 . 
ZL 39 HOH 5737 9891 488  HOH HOH 0 . 
ZL 39 HOH 5738 9892 489  HOH HOH 0 . 
ZL 39 HOH 5739 9893 490  HOH HOH 0 . 
ZL 39 HOH 5740 9894 492  HOH HOH 0 . 
ZL 39 HOH 5741 9895 493  HOH HOH 0 . 
ZL 39 HOH 5742 9896 494  HOH HOH 0 . 
ZL 39 HOH 5743 9897 495  HOH HOH 0 . 
ZL 39 HOH 5744 9898 496  HOH HOH 0 . 
ZL 39 HOH 5745 9899 497  HOH HOH 0 . 
ZL 39 HOH 5746 9900 499  HOH HOH 0 . 
ZL 39 HOH 5747 9901 500  HOH HOH 0 . 
ZL 39 HOH 5748 9902 501  HOH HOH 0 . 
ZL 39 HOH 5749 9903 502  HOH HOH 0 . 
ZL 39 HOH 5750 9904 503  HOH HOH 0 . 
ZL 39 HOH 5751 9905 505  HOH HOH 0 . 
ZL 39 HOH 5752 9906 506  HOH HOH 0 . 
ZL 39 HOH 5753 9907 508  HOH HOH 0 . 
ZL 39 HOH 5754 9908 509  HOH HOH 0 . 
ZL 39 HOH 5755 9909 511  HOH HOH 0 . 
ZL 39 HOH 5756 9910 512  HOH HOH 0 . 
ZL 39 HOH 5757 9911 514  HOH HOH 0 . 
ZL 39 HOH 5758 9912 515  HOH HOH 0 . 
ZL 39 HOH 5759 9913 516  HOH HOH 0 . 
ZL 39 HOH 5760 9914 517  HOH HOH 0 . 
ZL 39 HOH 5761 9915 518  HOH HOH 0 . 
ZL 39 HOH 5762 9916 519  HOH HOH 0 . 
ZL 39 HOH 5763 9917 520  HOH HOH 0 . 
ZL 39 HOH 5764 9918 521  HOH HOH 0 . 
ZL 39 HOH 5765 9919 522  HOH HOH 0 . 
ZL 39 HOH 5766 9920 523  HOH HOH 0 . 
ZL 39 HOH 5767 9921 524  HOH HOH 0 . 
ZL 39 HOH 5768 9922 526  HOH HOH 0 . 
ZL 39 HOH 5769 9923 527  HOH HOH 0 . 
ZL 39 HOH 5770 9924 528  HOH HOH 0 . 
ZL 39 HOH 5771 9925 529  HOH HOH 0 . 
ZL 39 HOH 5772 9926 530  HOH HOH 0 . 
ZL 39 HOH 5773 9927 531  HOH HOH 0 . 
ZL 39 HOH 5774 9928 532  HOH HOH 0 . 
ZL 39 HOH 5775 9929 534  HOH HOH 0 . 
ZL 39 HOH 5776 9930 535  HOH HOH 0 . 
ZL 39 HOH 5777 9931 537  HOH HOH 0 . 
ZL 39 HOH 5778 9932 539  HOH HOH 0 . 
ZL 39 HOH 5779 9933 540  HOH HOH 0 . 
ZL 39 HOH 5780 9934 541  HOH HOH 0 . 
ZL 39 HOH 5781 9935 542  HOH HOH 0 . 
ZL 39 HOH 5782 9936 543  HOH HOH 0 . 
ZL 39 HOH 5783 9937 544  HOH HOH 0 . 
ZL 39 HOH 5784 9938 545  HOH HOH 0 . 
ZL 39 HOH 5785 9939 546  HOH HOH 0 . 
ZL 39 HOH 5786 9940 547  HOH HOH 0 . 
ZL 39 HOH 5787 9941 548  HOH HOH 0 . 
ZL 39 HOH 5788 9942 549  HOH HOH 0 . 
ZL 39 HOH 5789 9943 550  HOH HOH 0 . 
ZL 39 HOH 5790 9944 551  HOH HOH 0 . 
ZL 39 HOH 5791 9945 552  HOH HOH 0 . 
ZL 39 HOH 5792 9946 554  HOH HOH 0 . 
ZL 39 HOH 5793 9947 555  HOH HOH 0 . 
ZL 39 HOH 5794 9948 556  HOH HOH 0 . 
ZL 39 HOH 5795 9949 557  HOH HOH 0 . 
ZL 39 HOH 5796 9950 558  HOH HOH 0 . 
ZL 39 HOH 5797 9951 560  HOH HOH 0 . 
ZL 39 HOH 5798 9952 561  HOH HOH 0 . 
ZL 39 HOH 5799 9953 563  HOH HOH 0 . 
ZL 39 HOH 5800 9954 564  HOH HOH 0 . 
ZL 39 HOH 5801 9955 565  HOH HOH 0 . 
ZL 39 HOH 5802 9956 566  HOH HOH 0 . 
ZL 39 HOH 5803 9957 567  HOH HOH 0 . 
ZL 39 HOH 5804 9958 568  HOH HOH 0 . 
ZL 39 HOH 5805 9959 569  HOH HOH 0 . 
ZL 39 HOH 5806 9960 570  HOH HOH 0 . 
ZL 39 HOH 5807 9961 571  HOH HOH 0 . 
ZL 39 HOH 5808 9962 572  HOH HOH 0 . 
ZL 39 HOH 5809 9963 573  HOH HOH 0 . 
ZL 39 HOH 5810 9964 574  HOH HOH 0 . 
ZL 39 HOH 5811 9965 575  HOH HOH 0 . 
ZL 39 HOH 5812 9966 576  HOH HOH 0 . 
ZL 39 HOH 5813 9967 577  HOH HOH 0 . 
ZL 39 HOH 5814 9968 578  HOH HOH 0 . 
ZL 39 HOH 5815 9969 579  HOH HOH 0 . 
ZL 39 HOH 5816 9970 580  HOH HOH 0 . 
ZL 39 HOH 5817 9971 583  HOH HOH 0 . 
ZL 39 HOH 5818 9972 589  HOH HOH 0 . 
ZL 39 HOH 5819 9973 590  HOH HOH 0 . 
ZL 39 HOH 5820 9974 592  HOH HOH 0 . 
ZL 39 HOH 5821 9975 593  HOH HOH 0 . 
ZL 39 HOH 5822 9976 595  HOH HOH 0 . 
ZL 39 HOH 5823 9977 596  HOH HOH 0 . 
ZL 39 HOH 5824 9978 597  HOH HOH 0 . 
ZL 39 HOH 5825 9979 598  HOH HOH 0 . 
ZL 39 HOH 5826 9980 599  HOH HOH 0 . 
ZL 39 HOH 5827 9981 600  HOH HOH 0 . 
ZL 39 HOH 5828 9982 601  HOH HOH 0 . 
ZL 39 HOH 5829 9983 602  HOH HOH 0 . 
ZL 39 HOH 5830 9984 603  HOH HOH 0 . 
ZL 39 HOH 5831 9985 604  HOH HOH 0 . 
ZL 39 HOH 5832 9986 605  HOH HOH 0 . 
ZL 39 HOH 5833 9987 606  HOH HOH 0 . 
ZL 39 HOH 5834 9988 608  HOH HOH 0 . 
ZL 39 HOH 5835 9989 609  HOH HOH 0 . 
ZL 39 HOH 5836 9990 610  HOH HOH 0 . 
ZL 39 HOH 5837 9991 611  HOH HOH 0 . 
ZL 39 HOH 5838 9992 612  HOH HOH 0 . 
ZL 39 HOH 5839 9993 613  HOH HOH 0 . 
ZL 39 HOH 5840 9994 614  HOH HOH 0 . 
ZL 39 HOH 5841 9995 615  HOH HOH 0 . 
ZL 39 HOH 5842 9996 616  HOH HOH 0 . 
ZL 39 HOH 5843 9997 617  HOH HOH 0 . 
ZL 39 HOH 5844 9998 618  HOH HOH 0 . 
ZL 39 HOH 5845 9999 619  HOH HOH 0 . 
AM 39 HOH 1    9004 120  HOH HOH 9 . 
AM 39 HOH 2    9005 194  HOH HOH 9 . 
AM 39 HOH 3    9006 466  HOH HOH 9 . 
AM 39 HOH 4    9007 504  HOH HOH 9 . 
AM 39 HOH 5    9008 562  HOH HOH 9 . 
AM 39 HOH 6    9009 622  HOH HOH 9 . 
AM 39 HOH 7    9010 737  HOH HOH 9 . 
AM 39 HOH 8    9011 1051 HOH HOH 9 . 
AM 39 HOH 9    9012 1056 HOH HOH 9 . 
AM 39 HOH 10   9013 1068 HOH HOH 9 . 
AM 39 HOH 11   9014 1137 HOH HOH 9 . 
AM 39 HOH 12   9015 1140 HOH HOH 9 . 
AM 39 HOH 13   9016 1197 HOH HOH 9 . 
AM 39 HOH 14   9017 1220 HOH HOH 9 . 
AM 39 HOH 15   9018 1228 HOH HOH 9 . 
AM 39 HOH 16   9019 1307 HOH HOH 9 . 
AM 39 HOH 17   9020 1361 HOH HOH 9 . 
AM 39 HOH 18   9021 1391 HOH HOH 9 . 
AM 39 HOH 19   9022 1441 HOH HOH 9 . 
AM 39 HOH 20   9023 1450 HOH HOH 9 . 
AM 39 HOH 21   9024 1538 HOH HOH 9 . 
AM 39 HOH 22   9025 1569 HOH HOH 9 . 
AM 39 HOH 23   9026 1832 HOH HOH 9 . 
AM 39 HOH 24   9027 1867 HOH HOH 9 . 
AM 39 HOH 25   9028 1897 HOH HOH 9 . 
AM 39 HOH 26   9029 1987 HOH HOH 9 . 
AM 39 HOH 27   9030 2118 HOH HOH 9 . 
AM 39 HOH 28   9031 2167 HOH HOH 9 . 
AM 39 HOH 29   9032 2274 HOH HOH 9 . 
AM 39 HOH 30   9033 2278 HOH HOH 9 . 
AM 39 HOH 31   9034 2285 HOH HOH 9 . 
AM 39 HOH 32   9035 2295 HOH HOH 9 . 
AM 39 HOH 33   9036 2305 HOH HOH 9 . 
AM 39 HOH 34   9037 2320 HOH HOH 9 . 
AM 39 HOH 35   9038 2343 HOH HOH 9 . 
AM 39 HOH 36   9039 2357 HOH HOH 9 . 
AM 39 HOH 37   9040 2358 HOH HOH 9 . 
AM 39 HOH 38   9041 2395 HOH HOH 9 . 
AM 39 HOH 39   9042 2423 HOH HOH 9 . 
AM 39 HOH 40   9043 2430 HOH HOH 9 . 
AM 39 HOH 41   9044 2487 HOH HOH 9 . 
AM 39 HOH 42   9045 2522 HOH HOH 9 . 
AM 39 HOH 43   9046 2536 HOH HOH 9 . 
AM 39 HOH 44   9047 2549 HOH HOH 9 . 
AM 39 HOH 45   9048 2577 HOH HOH 9 . 
AM 39 HOH 46   9049 2660 HOH HOH 9 . 
AM 39 HOH 47   9050 2663 HOH HOH 9 . 
AM 39 HOH 48   9051 2665 HOH HOH 9 . 
AM 39 HOH 49   9052 2710 HOH HOH 9 . 
AM 39 HOH 50   9053 2730 HOH HOH 9 . 
AM 39 HOH 51   9054 2772 HOH HOH 9 . 
AM 39 HOH 52   9055 2796 HOH HOH 9 . 
AM 39 HOH 53   9056 2881 HOH HOH 9 . 
AM 39 HOH 54   9057 2984 HOH HOH 9 . 
AM 39 HOH 55   9058 3167 HOH HOH 9 . 
AM 39 HOH 56   9059 3241 HOH HOH 9 . 
AM 39 HOH 57   9060 3340 HOH HOH 9 . 
AM 39 HOH 58   9061 3445 HOH HOH 9 . 
AM 39 HOH 59   9062 3472 HOH HOH 9 . 
AM 39 HOH 60   9063 3502 HOH HOH 9 . 
AM 39 HOH 61   9064 3535 HOH HOH 9 . 
AM 39 HOH 62   9065 3547 HOH HOH 9 . 
AM 39 HOH 63   9066 3714 HOH HOH 9 . 
AM 39 HOH 64   9067 3723 HOH HOH 9 . 
AM 39 HOH 65   9068 3797 HOH HOH 9 . 
AM 39 HOH 66   9069 3818 HOH HOH 9 . 
AM 39 HOH 67   9070 3839 HOH HOH 9 . 
AM 39 HOH 68   9071 3843 HOH HOH 9 . 
AM 39 HOH 69   9072 3870 HOH HOH 9 . 
AM 39 HOH 70   9073 3894 HOH HOH 9 . 
AM 39 HOH 71   9074 3911 HOH HOH 9 . 
AM 39 HOH 72   9075 3970 HOH HOH 9 . 
AM 39 HOH 73   9076 3978 HOH HOH 9 . 
AM 39 HOH 74   9077 4028 HOH HOH 9 . 
AM 39 HOH 75   9078 4078 HOH HOH 9 . 
AM 39 HOH 76   9079 4108 HOH HOH 9 . 
AM 39 HOH 77   9080 4250 HOH HOH 9 . 
AM 39 HOH 78   9081 4320 HOH HOH 9 . 
AM 39 HOH 79   9082 4351 HOH HOH 9 . 
AM 39 HOH 80   9083 4382 HOH HOH 9 . 
AM 39 HOH 81   9084 4454 HOH HOH 9 . 
AM 39 HOH 82   9085 4558 HOH HOH 9 . 
AM 39 HOH 83   9086 4586 HOH HOH 9 . 
AM 39 HOH 84   9087 4590 HOH HOH 9 . 
AM 39 HOH 85   9088 4627 HOH HOH 9 . 
AM 39 HOH 86   9089 4688 HOH HOH 9 . 
AM 39 HOH 87   9090 4718 HOH HOH 9 . 
AM 39 HOH 88   9091 4791 HOH HOH 9 . 
AM 39 HOH 89   9092 4902 HOH HOH 9 . 
AM 39 HOH 90   9093 4918 HOH HOH 9 . 
AM 39 HOH 91   9094 4932 HOH HOH 9 . 
AM 39 HOH 92   9095 4974 HOH HOH 9 . 
AM 39 HOH 93   9096 4975 HOH HOH 9 . 
AM 39 HOH 94   9097 5019 HOH HOH 9 . 
AM 39 HOH 95   9098 5071 HOH HOH 9 . 
AM 39 HOH 96   9099 5174 HOH HOH 9 . 
AM 39 HOH 97   9100 5233 HOH HOH 9 . 
AM 39 HOH 98   9101 5271 HOH HOH 9 . 
AM 39 HOH 99   9102 5298 HOH HOH 9 . 
AM 39 HOH 100  9103 5321 HOH HOH 9 . 
AM 39 HOH 101  9104 5537 HOH HOH 9 . 
AM 39 HOH 102  9105 5558 HOH HOH 9 . 
AM 39 HOH 103  9106 5727 HOH HOH 9 . 
AM 39 HOH 104  9107 5767 HOH HOH 9 . 
AM 39 HOH 105  9108 5822 HOH HOH 9 . 
AM 39 HOH 106  9109 5851 HOH HOH 9 . 
AM 39 HOH 107  9110 5983 HOH HOH 9 . 
AM 39 HOH 108  9111 5990 HOH HOH 9 . 
AM 39 HOH 109  9112 6053 HOH HOH 9 . 
AM 39 HOH 110  9113 6064 HOH HOH 9 . 
AM 39 HOH 111  9114 6156 HOH HOH 9 . 
AM 39 HOH 112  9115 6192 HOH HOH 9 . 
AM 39 HOH 113  9116 6206 HOH HOH 9 . 
AM 39 HOH 114  9117 6276 HOH HOH 9 . 
AM 39 HOH 115  9118 6374 HOH HOH 9 . 
AM 39 HOH 116  9119 6392 HOH HOH 9 . 
AM 39 HOH 117  9120 6412 HOH HOH 9 . 
AM 39 HOH 118  9121 6437 HOH HOH 9 . 
AM 39 HOH 119  9122 6474 HOH HOH 9 . 
AM 39 HOH 120  9123 6546 HOH HOH 9 . 
AM 39 HOH 121  9124 6578 HOH HOH 9 . 
AM 39 HOH 122  9125 6647 HOH HOH 9 . 
AM 39 HOH 123  9126 6669 HOH HOH 9 . 
AM 39 HOH 124  9127 6798 HOH HOH 9 . 
AM 39 HOH 125  9128 6806 HOH HOH 9 . 
AM 39 HOH 126  9129 6827 HOH HOH 9 . 
AM 39 HOH 127  9130 6867 HOH HOH 9 . 
AM 39 HOH 128  9131 6901 HOH HOH 9 . 
AM 39 HOH 129  9132 7073 HOH HOH 9 . 
AM 39 HOH 130  9133 7111 HOH HOH 9 . 
AM 39 HOH 131  9134 7164 HOH HOH 9 . 
AM 39 HOH 132  9135 7218 HOH HOH 9 . 
AM 39 HOH 133  9136 7289 HOH HOH 9 . 
AM 39 HOH 134  9137 7294 HOH HOH 9 . 
AM 39 HOH 135  9138 7361 HOH HOH 9 . 
AM 39 HOH 136  9139 7426 HOH HOH 9 . 
AM 39 HOH 137  9140 7454 HOH HOH 9 . 
AM 39 HOH 138  9141 7519 HOH HOH 9 . 
AM 39 HOH 139  9142 7531 HOH HOH 9 . 
AM 39 HOH 140  9143 7568 HOH HOH 9 . 
AM 39 HOH 141  9144 7637 HOH HOH 9 . 
AM 39 HOH 142  9145 7685 HOH HOH 9 . 
AM 39 HOH 143  9146 7713 HOH HOH 9 . 
AM 39 HOH 144  9147 7857 HOH HOH 9 . 
AM 39 HOH 145  9148 7892 HOH HOH 9 . 
BM 39 HOH 1    8978 13   HOH HOH A . 
BM 39 HOH 2    8979 18   HOH HOH A . 
BM 39 HOH 3    8980 23   HOH HOH A . 
BM 39 HOH 4    8981 43   HOH HOH A . 
BM 39 HOH 5    8982 77   HOH HOH A . 
BM 39 HOH 6    8983 250  HOH HOH A . 
BM 39 HOH 7    8984 265  HOH HOH A . 
BM 39 HOH 8    8985 292  HOH HOH A . 
BM 39 HOH 9    8986 306  HOH HOH A . 
BM 39 HOH 10   8987 389  HOH HOH A . 
BM 39 HOH 11   8988 396  HOH HOH A . 
BM 39 HOH 12   8989 491  HOH HOH A . 
BM 39 HOH 13   8990 582  HOH HOH A . 
BM 39 HOH 14   8991 607  HOH HOH A . 
BM 39 HOH 15   8992 635  HOH HOH A . 
BM 39 HOH 16   8993 666  HOH HOH A . 
BM 39 HOH 17   8994 829  HOH HOH A . 
BM 39 HOH 18   8995 830  HOH HOH A . 
BM 39 HOH 19   8996 854  HOH HOH A . 
BM 39 HOH 20   8997 927  HOH HOH A . 
BM 39 HOH 21   8998 1017 HOH HOH A . 
BM 39 HOH 22   8999 1054 HOH HOH A . 
BM 39 HOH 23   9000 1066 HOH HOH A . 
BM 39 HOH 24   9001 1076 HOH HOH A . 
BM 39 HOH 25   9002 1178 HOH HOH A . 
BM 39 HOH 26   9003 1188 HOH HOH A . 
BM 39 HOH 27   9004 1259 HOH HOH A . 
BM 39 HOH 28   9005 1276 HOH HOH A . 
BM 39 HOH 29   9006 1373 HOH HOH A . 
BM 39 HOH 30   9007 1437 HOH HOH A . 
BM 39 HOH 31   9008 1509 HOH HOH A . 
BM 39 HOH 32   9009 1517 HOH HOH A . 
BM 39 HOH 33   9010 1550 HOH HOH A . 
BM 39 HOH 34   9011 1745 HOH HOH A . 
BM 39 HOH 35   9012 1764 HOH HOH A . 
BM 39 HOH 36   9013 1883 HOH HOH A . 
BM 39 HOH 37   9014 1902 HOH HOH A . 
BM 39 HOH 38   9015 2172 HOH HOH A . 
BM 39 HOH 39   9016 2191 HOH HOH A . 
BM 39 HOH 40   9017 2279 HOH HOH A . 
BM 39 HOH 41   9018 2329 HOH HOH A . 
BM 39 HOH 42   9019 2431 HOH HOH A . 
BM 39 HOH 43   9020 2580 HOH HOH A . 
BM 39 HOH 44   9021 2618 HOH HOH A . 
BM 39 HOH 45   9022 2643 HOH HOH A . 
BM 39 HOH 46   9023 2675 HOH HOH A . 
BM 39 HOH 47   9024 2908 HOH HOH A . 
BM 39 HOH 48   9025 3069 HOH HOH A . 
BM 39 HOH 49   9026 3121 HOH HOH A . 
BM 39 HOH 50   9027 3142 HOH HOH A . 
BM 39 HOH 51   9028 3156 HOH HOH A . 
BM 39 HOH 52   9029 3203 HOH HOH A . 
BM 39 HOH 53   9030 3204 HOH HOH A . 
BM 39 HOH 54   9031 3369 HOH HOH A . 
BM 39 HOH 55   9032 3377 HOH HOH A . 
BM 39 HOH 56   9033 3459 HOH HOH A . 
BM 39 HOH 57   9034 3484 HOH HOH A . 
BM 39 HOH 58   9035 3496 HOH HOH A . 
BM 39 HOH 59   9036 3523 HOH HOH A . 
BM 39 HOH 60   9037 3548 HOH HOH A . 
BM 39 HOH 61   9038 3602 HOH HOH A . 
BM 39 HOH 62   9039 3762 HOH HOH A . 
BM 39 HOH 63   9040 3827 HOH HOH A . 
BM 39 HOH 64   9041 3891 HOH HOH A . 
BM 39 HOH 65   9042 3896 HOH HOH A . 
BM 39 HOH 66   9043 4026 HOH HOH A . 
BM 39 HOH 67   9044 4033 HOH HOH A . 
BM 39 HOH 68   9045 4053 HOH HOH A . 
BM 39 HOH 69   9046 4097 HOH HOH A . 
BM 39 HOH 70   9047 4204 HOH HOH A . 
BM 39 HOH 71   9048 4245 HOH HOH A . 
BM 39 HOH 72   9049 4286 HOH HOH A . 
BM 39 HOH 73   9050 4437 HOH HOH A . 
BM 39 HOH 74   9051 4502 HOH HOH A . 
BM 39 HOH 75   9052 4549 HOH HOH A . 
BM 39 HOH 76   9053 4567 HOH HOH A . 
BM 39 HOH 77   9054 4589 HOH HOH A . 
BM 39 HOH 78   9055 4768 HOH HOH A . 
BM 39 HOH 79   9056 4780 HOH HOH A . 
BM 39 HOH 80   9057 4870 HOH HOH A . 
BM 39 HOH 81   9058 4877 HOH HOH A . 
BM 39 HOH 82   9059 4884 HOH HOH A . 
BM 39 HOH 83   9060 4933 HOH HOH A . 
BM 39 HOH 84   9061 5133 HOH HOH A . 
BM 39 HOH 85   9062 5222 HOH HOH A . 
BM 39 HOH 86   9063 5306 HOH HOH A . 
BM 39 HOH 87   9064 5482 HOH HOH A . 
BM 39 HOH 88   9065 5534 HOH HOH A . 
BM 39 HOH 89   9066 5628 HOH HOH A . 
BM 39 HOH 90   9067 5671 HOH HOH A . 
BM 39 HOH 91   9068 5706 HOH HOH A . 
BM 39 HOH 92   9069 6046 HOH HOH A . 
BM 39 HOH 93   9070 6136 HOH HOH A . 
BM 39 HOH 94   9071 6339 HOH HOH A . 
BM 39 HOH 95   9072 6402 HOH HOH A . 
BM 39 HOH 96   9073 6599 HOH HOH A . 
BM 39 HOH 97   9074 6746 HOH HOH A . 
BM 39 HOH 98   9075 6780 HOH HOH A . 
BM 39 HOH 99   9076 6879 HOH HOH A . 
BM 39 HOH 100  9077 6886 HOH HOH A . 
BM 39 HOH 101  9078 7017 HOH HOH A . 
BM 39 HOH 102  9079 7019 HOH HOH A . 
BM 39 HOH 103  9080 7110 HOH HOH A . 
BM 39 HOH 104  9081 7249 HOH HOH A . 
BM 39 HOH 105  9082 7267 HOH HOH A . 
BM 39 HOH 106  9083 7273 HOH HOH A . 
BM 39 HOH 107  9084 7306 HOH HOH A . 
BM 39 HOH 108  9085 7315 HOH HOH A . 
BM 39 HOH 109  9086 7411 HOH HOH A . 
BM 39 HOH 110  9087 7427 HOH HOH A . 
BM 39 HOH 111  9088 7603 HOH HOH A . 
BM 39 HOH 112  9089 7752 HOH HOH A . 
BM 39 HOH 113  9090 7773 HOH HOH A . 
BM 39 HOH 114  9091 7792 HOH HOH A . 
BM 39 HOH 115  9092 7810 HOH HOH A . 
BM 39 HOH 116  9093 7868 HOH HOH A . 
BM 39 HOH 117  9094 7887 HOH HOH A . 
BM 39 HOH 118  9095 7899 HOH HOH A . 
CM 39 HOH 1    8988 55   HOH HOH B . 
CM 39 HOH 2    8989 56   HOH HOH B . 
CM 39 HOH 3    8990 89   HOH HOH B . 
CM 39 HOH 4    8991 140  HOH HOH B . 
CM 39 HOH 5    8992 169  HOH HOH B . 
CM 39 HOH 6    8993 255  HOH HOH B . 
CM 39 HOH 7    8994 343  HOH HOH B . 
CM 39 HOH 8    8995 460  HOH HOH B . 
CM 39 HOH 9    8996 689  HOH HOH B . 
CM 39 HOH 10   8997 738  HOH HOH B . 
CM 39 HOH 11   8998 779  HOH HOH B . 
CM 39 HOH 12   8999 824  HOH HOH B . 
CM 39 HOH 13   9000 860  HOH HOH B . 
CM 39 HOH 14   9001 882  HOH HOH B . 
CM 39 HOH 15   9002 972  HOH HOH B . 
CM 39 HOH 16   9003 986  HOH HOH B . 
CM 39 HOH 17   9004 1004 HOH HOH B . 
CM 39 HOH 18   9005 1136 HOH HOH B . 
CM 39 HOH 19   9006 1139 HOH HOH B . 
CM 39 HOH 20   9007 1155 HOH HOH B . 
CM 39 HOH 21   9008 1185 HOH HOH B . 
CM 39 HOH 22   9009 1236 HOH HOH B . 
CM 39 HOH 23   9010 1254 HOH HOH B . 
CM 39 HOH 24   9011 1376 HOH HOH B . 
CM 39 HOH 25   9012 1524 HOH HOH B . 
CM 39 HOH 26   9013 1581 HOH HOH B . 
CM 39 HOH 27   9014 1690 HOH HOH B . 
CM 39 HOH 28   9015 1714 HOH HOH B . 
CM 39 HOH 29   9016 1779 HOH HOH B . 
CM 39 HOH 30   9017 1923 HOH HOH B . 
CM 39 HOH 31   9018 1955 HOH HOH B . 
CM 39 HOH 32   9019 1991 HOH HOH B . 
CM 39 HOH 33   9020 1996 HOH HOH B . 
CM 39 HOH 34   9021 2267 HOH HOH B . 
CM 39 HOH 35   9022 2286 HOH HOH B . 
CM 39 HOH 36   9023 2345 HOH HOH B . 
CM 39 HOH 37   9024 2548 HOH HOH B . 
CM 39 HOH 38   9025 2557 HOH HOH B . 
CM 39 HOH 39   9026 2613 HOH HOH B . 
CM 39 HOH 40   9027 2644 HOH HOH B . 
CM 39 HOH 41   9028 2649 HOH HOH B . 
CM 39 HOH 42   9029 2694 HOH HOH B . 
CM 39 HOH 43   9030 2782 HOH HOH B . 
CM 39 HOH 44   9031 2831 HOH HOH B . 
CM 39 HOH 45   9032 2889 HOH HOH B . 
CM 39 HOH 46   9033 2907 HOH HOH B . 
CM 39 HOH 47   9034 2941 HOH HOH B . 
CM 39 HOH 48   9035 2997 HOH HOH B . 
CM 39 HOH 49   9036 3056 HOH HOH B . 
CM 39 HOH 50   9037 3084 HOH HOH B . 
CM 39 HOH 51   9038 3108 HOH HOH B . 
CM 39 HOH 52   9039 3179 HOH HOH B . 
CM 39 HOH 53   9040 3223 HOH HOH B . 
CM 39 HOH 54   9041 3278 HOH HOH B . 
CM 39 HOH 55   9042 3326 HOH HOH B . 
CM 39 HOH 56   9043 3511 HOH HOH B . 
CM 39 HOH 57   9044 3529 HOH HOH B . 
CM 39 HOH 58   9045 3554 HOH HOH B . 
CM 39 HOH 59   9046 3587 HOH HOH B . 
CM 39 HOH 60   9047 3655 HOH HOH B . 
CM 39 HOH 61   9048 3693 HOH HOH B . 
CM 39 HOH 62   9049 3713 HOH HOH B . 
CM 39 HOH 63   9050 3719 HOH HOH B . 
CM 39 HOH 64   9051 3765 HOH HOH B . 
CM 39 HOH 65   9052 3866 HOH HOH B . 
CM 39 HOH 66   9053 3923 HOH HOH B . 
CM 39 HOH 67   9054 4067 HOH HOH B . 
CM 39 HOH 68   9055 4117 HOH HOH B . 
CM 39 HOH 69   9056 4121 HOH HOH B . 
CM 39 HOH 70   9057 4128 HOH HOH B . 
CM 39 HOH 71   9058 4243 HOH HOH B . 
CM 39 HOH 72   9059 4249 HOH HOH B . 
CM 39 HOH 73   9060 4304 HOH HOH B . 
CM 39 HOH 74   9061 4327 HOH HOH B . 
CM 39 HOH 75   9062 4357 HOH HOH B . 
CM 39 HOH 76   9063 4370 HOH HOH B . 
CM 39 HOH 77   9064 4402 HOH HOH B . 
CM 39 HOH 78   9065 4483 HOH HOH B . 
CM 39 HOH 79   9066 4531 HOH HOH B . 
CM 39 HOH 80   9067 4538 HOH HOH B . 
CM 39 HOH 81   9068 4544 HOH HOH B . 
CM 39 HOH 82   9069 4612 HOH HOH B . 
CM 39 HOH 83   9070 4673 HOH HOH B . 
CM 39 HOH 84   9071 4730 HOH HOH B . 
CM 39 HOH 85   9072 4804 HOH HOH B . 
CM 39 HOH 86   9073 4810 HOH HOH B . 
CM 39 HOH 87   9074 4887 HOH HOH B . 
CM 39 HOH 88   9075 4899 HOH HOH B . 
CM 39 HOH 89   9076 5008 HOH HOH B . 
CM 39 HOH 90   9077 5020 HOH HOH B . 
CM 39 HOH 91   9078 5127 HOH HOH B . 
CM 39 HOH 92   9079 5132 HOH HOH B . 
CM 39 HOH 93   9080 5136 HOH HOH B . 
CM 39 HOH 94   9081 5151 HOH HOH B . 
CM 39 HOH 95   9082 5204 HOH HOH B . 
CM 39 HOH 96   9083 5366 HOH HOH B . 
CM 39 HOH 97   9084 5367 HOH HOH B . 
CM 39 HOH 98   9085 5379 HOH HOH B . 
CM 39 HOH 99   9086 5400 HOH HOH B . 
CM 39 HOH 100  9087 5430 HOH HOH B . 
CM 39 HOH 101  9088 5491 HOH HOH B . 
CM 39 HOH 102  9089 5551 HOH HOH B . 
CM 39 HOH 103  9090 5561 HOH HOH B . 
CM 39 HOH 104  9091 5592 HOH HOH B . 
CM 39 HOH 105  9092 5621 HOH HOH B . 
CM 39 HOH 106  9093 5754 HOH HOH B . 
CM 39 HOH 107  9094 5778 HOH HOH B . 
CM 39 HOH 108  9095 5816 HOH HOH B . 
CM 39 HOH 109  9096 5908 HOH HOH B . 
CM 39 HOH 110  9097 5936 HOH HOH B . 
CM 39 HOH 111  9098 5943 HOH HOH B . 
CM 39 HOH 112  9099 5986 HOH HOH B . 
CM 39 HOH 113  9100 6023 HOH HOH B . 
CM 39 HOH 114  9101 6052 HOH HOH B . 
CM 39 HOH 115  9102 6089 HOH HOH B . 
CM 39 HOH 116  9103 6116 HOH HOH B . 
CM 39 HOH 117  9104 6210 HOH HOH B . 
CM 39 HOH 118  9105 6216 HOH HOH B . 
CM 39 HOH 119  9106 6221 HOH HOH B . 
CM 39 HOH 120  9107 6230 HOH HOH B . 
CM 39 HOH 121  9108 6234 HOH HOH B . 
CM 39 HOH 122  9109 6296 HOH HOH B . 
CM 39 HOH 123  9110 6418 HOH HOH B . 
CM 39 HOH 124  9111 6432 HOH HOH B . 
CM 39 HOH 125  9112 6459 HOH HOH B . 
CM 39 HOH 126  9113 6542 HOH HOH B . 
CM 39 HOH 127  9114 6588 HOH HOH B . 
CM 39 HOH 128  9115 6889 HOH HOH B . 
CM 39 HOH 129  9116 6906 HOH HOH B . 
CM 39 HOH 130  9117 6940 HOH HOH B . 
CM 39 HOH 131  9118 6946 HOH HOH B . 
CM 39 HOH 132  9119 7088 HOH HOH B . 
CM 39 HOH 133  9120 7123 HOH HOH B . 
CM 39 HOH 134  9121 7139 HOH HOH B . 
CM 39 HOH 135  9122 7141 HOH HOH B . 
CM 39 HOH 136  9123 7148 HOH HOH B . 
CM 39 HOH 137  9124 7157 HOH HOH B . 
CM 39 HOH 138  9125 7268 HOH HOH B . 
CM 39 HOH 139  9126 7358 HOH HOH B . 
CM 39 HOH 140  9127 7384 HOH HOH B . 
CM 39 HOH 141  9128 7424 HOH HOH B . 
CM 39 HOH 142  9129 7428 HOH HOH B . 
CM 39 HOH 143  9130 7492 HOH HOH B . 
CM 39 HOH 144  9131 7494 HOH HOH B . 
CM 39 HOH 145  9132 7551 HOH HOH B . 
CM 39 HOH 146  9133 7611 HOH HOH B . 
CM 39 HOH 147  9134 7661 HOH HOH B . 
CM 39 HOH 148  9135 7791 HOH HOH B . 
CM 39 HOH 149  9136 7867 HOH HOH B . 
CM 39 HOH 150  9137 7895 HOH HOH B . 
CM 39 HOH 151  9138 7908 HOH HOH B . 
DM 39 HOH 1    8504 66   HOH HOH C . 
DM 39 HOH 2    8505 133  HOH HOH C . 
DM 39 HOH 3    8506 134  HOH HOH C . 
DM 39 HOH 4    8507 143  HOH HOH C . 
DM 39 HOH 5    8508 215  HOH HOH C . 
DM 39 HOH 6    8509 223  HOH HOH C . 
DM 39 HOH 7    8510 249  HOH HOH C . 
DM 39 HOH 8    8511 286  HOH HOH C . 
DM 39 HOH 9    8512 327  HOH HOH C . 
DM 39 HOH 10   8513 328  HOH HOH C . 
DM 39 HOH 11   8514 401  HOH HOH C . 
DM 39 HOH 12   8515 421  HOH HOH C . 
DM 39 HOH 13   8516 458  HOH HOH C . 
DM 39 HOH 14   8517 587  HOH HOH C . 
DM 39 HOH 15   8518 629  HOH HOH C . 
DM 39 HOH 16   8519 637  HOH HOH C . 
DM 39 HOH 17   8520 652  HOH HOH C . 
DM 39 HOH 18   8521 721  HOH HOH C . 
DM 39 HOH 19   8522 726  HOH HOH C . 
DM 39 HOH 20   8523 823  HOH HOH C . 
DM 39 HOH 21   8524 828  HOH HOH C . 
DM 39 HOH 22   8525 863  HOH HOH C . 
DM 39 HOH 23   8526 892  HOH HOH C . 
DM 39 HOH 24   8527 898  HOH HOH C . 
DM 39 HOH 25   8528 930  HOH HOH C . 
DM 39 HOH 26   8529 937  HOH HOH C . 
DM 39 HOH 27   8530 941  HOH HOH C . 
DM 39 HOH 28   8531 948  HOH HOH C . 
DM 39 HOH 29   8532 981  HOH HOH C . 
DM 39 HOH 30   8533 995  HOH HOH C . 
DM 39 HOH 31   8534 998  HOH HOH C . 
DM 39 HOH 32   8535 1019 HOH HOH C . 
DM 39 HOH 33   8536 1026 HOH HOH C . 
DM 39 HOH 34   8537 1133 HOH HOH C . 
DM 39 HOH 35   8538 1193 HOH HOH C . 
DM 39 HOH 36   8539 1198 HOH HOH C . 
DM 39 HOH 37   8540 1269 HOH HOH C . 
DM 39 HOH 38   8541 1281 HOH HOH C . 
DM 39 HOH 39   8542 1329 HOH HOH C . 
DM 39 HOH 40   8543 1360 HOH HOH C . 
DM 39 HOH 41   8544 1416 HOH HOH C . 
DM 39 HOH 42   8545 1563 HOH HOH C . 
DM 39 HOH 43   8546 1585 HOH HOH C . 
DM 39 HOH 44   8547 1644 HOH HOH C . 
DM 39 HOH 45   8548 1648 HOH HOH C . 
DM 39 HOH 46   8549 1687 HOH HOH C . 
DM 39 HOH 47   8550 1692 HOH HOH C . 
DM 39 HOH 48   8551 1699 HOH HOH C . 
DM 39 HOH 49   8552 1726 HOH HOH C . 
DM 39 HOH 50   8553 1815 HOH HOH C . 
DM 39 HOH 51   8554 1825 HOH HOH C . 
DM 39 HOH 52   8555 1830 HOH HOH C . 
DM 39 HOH 53   8556 1894 HOH HOH C . 
DM 39 HOH 54   8557 1907 HOH HOH C . 
DM 39 HOH 55   8558 1919 HOH HOH C . 
DM 39 HOH 56   8559 1979 HOH HOH C . 
DM 39 HOH 57   8560 2028 HOH HOH C . 
DM 39 HOH 58   8561 2040 HOH HOH C . 
DM 39 HOH 59   8562 2051 HOH HOH C . 
DM 39 HOH 60   8563 2064 HOH HOH C . 
DM 39 HOH 61   8564 2293 HOH HOH C . 
DM 39 HOH 62   8565 2396 HOH HOH C . 
DM 39 HOH 63   8566 2518 HOH HOH C . 
DM 39 HOH 64   8567 2669 HOH HOH C . 
DM 39 HOH 65   8568 2686 HOH HOH C . 
DM 39 HOH 66   8569 2711 HOH HOH C . 
DM 39 HOH 67   8570 2759 HOH HOH C . 
DM 39 HOH 68   8571 2770 HOH HOH C . 
DM 39 HOH 69   8572 2822 HOH HOH C . 
DM 39 HOH 70   8573 2853 HOH HOH C . 
DM 39 HOH 71   8574 2866 HOH HOH C . 
DM 39 HOH 72   8575 2903 HOH HOH C . 
DM 39 HOH 73   8576 2963 HOH HOH C . 
DM 39 HOH 74   8577 2972 HOH HOH C . 
DM 39 HOH 75   8578 2986 HOH HOH C . 
DM 39 HOH 76   8579 3033 HOH HOH C . 
DM 39 HOH 77   8580 3043 HOH HOH C . 
DM 39 HOH 78   8581 3065 HOH HOH C . 
DM 39 HOH 79   8582 3073 HOH HOH C . 
DM 39 HOH 80   8583 3100 HOH HOH C . 
DM 39 HOH 81   8584 3122 HOH HOH C . 
DM 39 HOH 82   8585 3126 HOH HOH C . 
DM 39 HOH 83   8586 3133 HOH HOH C . 
DM 39 HOH 84   8587 3159 HOH HOH C . 
DM 39 HOH 85   8588 3207 HOH HOH C . 
DM 39 HOH 86   8589 3249 HOH HOH C . 
DM 39 HOH 87   8590 3250 HOH HOH C . 
DM 39 HOH 88   8591 3332 HOH HOH C . 
DM 39 HOH 89   8592 3391 HOH HOH C . 
DM 39 HOH 90   8593 3471 HOH HOH C . 
DM 39 HOH 91   8594 3549 HOH HOH C . 
DM 39 HOH 92   8595 3562 HOH HOH C . 
DM 39 HOH 93   8596 3575 HOH HOH C . 
DM 39 HOH 94   8597 3588 HOH HOH C . 
DM 39 HOH 95   8598 3662 HOH HOH C . 
DM 39 HOH 96   8599 3666 HOH HOH C . 
DM 39 HOH 97   8600 3698 HOH HOH C . 
DM 39 HOH 98   8601 3711 HOH HOH C . 
DM 39 HOH 99   8602 3779 HOH HOH C . 
DM 39 HOH 100  8603 3782 HOH HOH C . 
DM 39 HOH 101  8604 3887 HOH HOH C . 
DM 39 HOH 102  8605 3917 HOH HOH C . 
DM 39 HOH 103  8606 3924 HOH HOH C . 
DM 39 HOH 104  8607 3925 HOH HOH C . 
DM 39 HOH 105  8608 3929 HOH HOH C . 
DM 39 HOH 106  8609 3999 HOH HOH C . 
DM 39 HOH 107  8610 4009 HOH HOH C . 
DM 39 HOH 108  8611 4208 HOH HOH C . 
DM 39 HOH 109  8612 4318 HOH HOH C . 
DM 39 HOH 110  8613 4494 HOH HOH C . 
DM 39 HOH 111  8614 4540 HOH HOH C . 
DM 39 HOH 112  8615 4569 HOH HOH C . 
DM 39 HOH 113  8616 4596 HOH HOH C . 
DM 39 HOH 114  8617 4626 HOH HOH C . 
DM 39 HOH 115  8618 4641 HOH HOH C . 
DM 39 HOH 116  8619 4664 HOH HOH C . 
DM 39 HOH 117  8620 4687 HOH HOH C . 
DM 39 HOH 118  8621 4690 HOH HOH C . 
DM 39 HOH 119  8622 4700 HOH HOH C . 
DM 39 HOH 120  8623 4719 HOH HOH C . 
DM 39 HOH 121  8624 4775 HOH HOH C . 
DM 39 HOH 122  8625 4920 HOH HOH C . 
DM 39 HOH 123  8626 4988 HOH HOH C . 
DM 39 HOH 124  8627 5025 HOH HOH C . 
DM 39 HOH 125  8628 5031 HOH HOH C . 
DM 39 HOH 126  8629 5064 HOH HOH C . 
DM 39 HOH 127  8630 5065 HOH HOH C . 
DM 39 HOH 128  8631 5079 HOH HOH C . 
DM 39 HOH 129  8632 5086 HOH HOH C . 
DM 39 HOH 130  8633 5158 HOH HOH C . 
DM 39 HOH 131  8634 5165 HOH HOH C . 
DM 39 HOH 132  8635 5175 HOH HOH C . 
DM 39 HOH 133  8636 5218 HOH HOH C . 
DM 39 HOH 134  8637 5237 HOH HOH C . 
DM 39 HOH 135  8638 5255 HOH HOH C . 
DM 39 HOH 136  8639 5435 HOH HOH C . 
DM 39 HOH 137  8640 5487 HOH HOH C . 
DM 39 HOH 138  8641 5505 HOH HOH C . 
DM 39 HOH 139  8642 5519 HOH HOH C . 
DM 39 HOH 140  8643 5535 HOH HOH C . 
DM 39 HOH 141  8644 5578 HOH HOH C . 
DM 39 HOH 142  8645 5730 HOH HOH C . 
DM 39 HOH 143  8646 5810 HOH HOH C . 
DM 39 HOH 144  8647 5832 HOH HOH C . 
DM 39 HOH 145  8648 5855 HOH HOH C . 
DM 39 HOH 146  8649 5892 HOH HOH C . 
DM 39 HOH 147  8650 6056 HOH HOH C . 
DM 39 HOH 148  8651 6097 HOH HOH C . 
DM 39 HOH 149  8652 6144 HOH HOH C . 
DM 39 HOH 150  8653 6251 HOH HOH C . 
DM 39 HOH 151  8654 6262 HOH HOH C . 
DM 39 HOH 152  8655 6325 HOH HOH C . 
DM 39 HOH 153  8656 6502 HOH HOH C . 
DM 39 HOH 154  8657 6593 HOH HOH C . 
DM 39 HOH 155  8658 6670 HOH HOH C . 
DM 39 HOH 156  8659 6744 HOH HOH C . 
DM 39 HOH 157  8660 6804 HOH HOH C . 
DM 39 HOH 158  8661 6849 HOH HOH C . 
DM 39 HOH 159  8662 6994 HOH HOH C . 
DM 39 HOH 160  8663 7042 HOH HOH C . 
DM 39 HOH 161  8664 7070 HOH HOH C . 
DM 39 HOH 162  8665 7089 HOH HOH C . 
DM 39 HOH 163  8666 7146 HOH HOH C . 
DM 39 HOH 164  8667 7195 HOH HOH C . 
DM 39 HOH 165  8668 7223 HOH HOH C . 
DM 39 HOH 166  8669 7245 HOH HOH C . 
DM 39 HOH 167  8670 7287 HOH HOH C . 
DM 39 HOH 168  8671 7387 HOH HOH C . 
DM 39 HOH 169  8672 7436 HOH HOH C . 
DM 39 HOH 170  8673 7482 HOH HOH C . 
DM 39 HOH 171  8674 7488 HOH HOH C . 
DM 39 HOH 172  8675 7569 HOH HOH C . 
DM 39 HOH 173  8676 7576 HOH HOH C . 
DM 39 HOH 174  8677 7641 HOH HOH C . 
DM 39 HOH 175  8678 7650 HOH HOH C . 
DM 39 HOH 176  8679 7684 HOH HOH C . 
EM 39 HOH 1    293  293  HOH HOH D . 
EM 39 HOH 2    1154 1154 HOH HOH D . 
EM 39 HOH 3    1492 1492 HOH HOH D . 
EM 39 HOH 4    1655 1655 HOH HOH D . 
EM 39 HOH 5    1796 1796 HOH HOH D . 
EM 39 HOH 6    2768 2768 HOH HOH D . 
EM 39 HOH 7    3066 3066 HOH HOH D . 
EM 39 HOH 8    3279 3279 HOH HOH D . 
EM 39 HOH 9    3349 3349 HOH HOH D . 
EM 39 HOH 10   3359 3359 HOH HOH D . 
EM 39 HOH 11   3572 3572 HOH HOH D . 
EM 39 HOH 12   3862 3862 HOH HOH D . 
EM 39 HOH 13   4057 4057 HOH HOH D . 
EM 39 HOH 14   4069 4069 HOH HOH D . 
EM 39 HOH 15   4233 4233 HOH HOH D . 
EM 39 HOH 16   4886 4886 HOH HOH D . 
EM 39 HOH 17   5146 5146 HOH HOH D . 
EM 39 HOH 18   5198 5198 HOH HOH D . 
EM 39 HOH 19   5210 5210 HOH HOH D . 
EM 39 HOH 20   5234 5234 HOH HOH D . 
EM 39 HOH 21   5484 5484 HOH HOH D . 
EM 39 HOH 22   5495 5495 HOH HOH D . 
EM 39 HOH 23   5576 5576 HOH HOH D . 
EM 39 HOH 24   5583 5583 HOH HOH D . 
EM 39 HOH 25   5675 5675 HOH HOH D . 
EM 39 HOH 26   5708 5708 HOH HOH D . 
EM 39 HOH 27   5728 5728 HOH HOH D . 
EM 39 HOH 28   5828 5828 HOH HOH D . 
EM 39 HOH 29   5858 5858 HOH HOH D . 
EM 39 HOH 30   5950 5950 HOH HOH D . 
EM 39 HOH 31   6007 6007 HOH HOH D . 
EM 39 HOH 32   6165 6165 HOH HOH D . 
EM 39 HOH 33   6326 6326 HOH HOH D . 
EM 39 HOH 34   6555 6555 HOH HOH D . 
EM 39 HOH 35   6716 6716 HOH HOH D . 
EM 39 HOH 36   6752 6752 HOH HOH D . 
EM 39 HOH 37   6848 6848 HOH HOH D . 
EM 39 HOH 38   6936 6936 HOH HOH D . 
EM 39 HOH 39   7345 7345 HOH HOH D . 
EM 39 HOH 40   7400 7400 HOH HOH D . 
EM 39 HOH 41   7404 7404 HOH HOH D . 
EM 39 HOH 42   7475 7475 HOH HOH D . 
EM 39 HOH 43   7477 7477 HOH HOH D . 
EM 39 HOH 44   7500 7500 HOH HOH D . 
EM 39 HOH 45   7502 7502 HOH HOH D . 
EM 39 HOH 46   7580 7580 HOH HOH D . 
EM 39 HOH 47   7597 7597 HOH HOH D . 
EM 39 HOH 48   7625 7625 HOH HOH D . 
EM 39 HOH 49   7636 7636 HOH HOH D . 
FM 39 HOH 1    1053 1053 HOH HOH E . 
FM 39 HOH 2    1750 1750 HOH HOH E . 
FM 39 HOH 3    1861 1861 HOH HOH E . 
FM 39 HOH 4    2227 2227 HOH HOH E . 
FM 39 HOH 5    2401 2401 HOH HOH E . 
FM 39 HOH 6    2769 2769 HOH HOH E . 
FM 39 HOH 7    2781 2781 HOH HOH E . 
FM 39 HOH 8    2789 2789 HOH HOH E . 
FM 39 HOH 9    2857 2857 HOH HOH E . 
FM 39 HOH 10   3134 3134 HOH HOH E . 
FM 39 HOH 11   3388 3388 HOH HOH E . 
FM 39 HOH 12   3478 3478 HOH HOH E . 
FM 39 HOH 13   3707 3707 HOH HOH E . 
FM 39 HOH 14   3881 3881 HOH HOH E . 
FM 39 HOH 15   3940 3940 HOH HOH E . 
FM 39 HOH 16   4098 4098 HOH HOH E . 
FM 39 HOH 17   4154 4154 HOH HOH E . 
FM 39 HOH 18   4191 4191 HOH HOH E . 
FM 39 HOH 19   4572 4572 HOH HOH E . 
FM 39 HOH 20   4761 4761 HOH HOH E . 
FM 39 HOH 21   4917 4917 HOH HOH E . 
FM 39 HOH 22   5240 5240 HOH HOH E . 
FM 39 HOH 23   5281 5281 HOH HOH E . 
FM 39 HOH 24   5404 5404 HOH HOH E . 
FM 39 HOH 25   5751 5751 HOH HOH E . 
FM 39 HOH 26   5864 5864 HOH HOH E . 
FM 39 HOH 27   5899 5899 HOH HOH E . 
FM 39 HOH 28   5919 5919 HOH HOH E . 
FM 39 HOH 29   6017 6017 HOH HOH E . 
FM 39 HOH 30   6341 6341 HOH HOH E . 
FM 39 HOH 31   6399 6399 HOH HOH E . 
FM 39 HOH 32   6457 6457 HOH HOH E . 
FM 39 HOH 33   6476 6476 HOH HOH E . 
FM 39 HOH 34   6772 6772 HOH HOH E . 
FM 39 HOH 35   6887 6887 HOH HOH E . 
FM 39 HOH 36   6931 6931 HOH HOH E . 
FM 39 HOH 37   7046 7046 HOH HOH E . 
FM 39 HOH 38   7544 7544 HOH HOH E . 
FM 39 HOH 39   7565 7565 HOH HOH E . 
FM 39 HOH 40   7590 7590 HOH HOH E . 
GM 39 HOH 1    2466 2466 HOH HOH F . 
GM 39 HOH 2    2563 2563 HOH HOH F . 
GM 39 HOH 3    2623 2623 HOH HOH F . 
GM 39 HOH 4    2630 2630 HOH HOH F . 
GM 39 HOH 5    2695 2695 HOH HOH F . 
GM 39 HOH 6    2750 2750 HOH HOH F . 
GM 39 HOH 7    3111 3111 HOH HOH F . 
GM 39 HOH 8    3303 3303 HOH HOH F . 
GM 39 HOH 9    3461 3461 HOH HOH F . 
GM 39 HOH 10   4016 4016 HOH HOH F . 
GM 39 HOH 11   4682 4682 HOH HOH F . 
GM 39 HOH 12   4807 4807 HOH HOH F . 
GM 39 HOH 13   4995 4995 HOH HOH F . 
GM 39 HOH 14   4999 4999 HOH HOH F . 
GM 39 HOH 15   5163 5163 HOH HOH F . 
GM 39 HOH 16   5413 5413 HOH HOH F . 
GM 39 HOH 17   5498 5498 HOH HOH F . 
GM 39 HOH 18   5691 5691 HOH HOH F . 
GM 39 HOH 19   5719 5719 HOH HOH F . 
GM 39 HOH 20   5897 5897 HOH HOH F . 
GM 39 HOH 21   5966 5966 HOH HOH F . 
GM 39 HOH 22   6403 6403 HOH HOH F . 
GM 39 HOH 23   6617 6617 HOH HOH F . 
GM 39 HOH 24   6800 6800 HOH HOH F . 
GM 39 HOH 25   6909 6909 HOH HOH F . 
GM 39 HOH 26   6926 6926 HOH HOH F . 
HM 39 HOH 1    692  692  HOH HOH G . 
HM 39 HOH 2    2209 2209 HOH HOH G . 
HM 39 HOH 3    2218 2218 HOH HOH G . 
HM 39 HOH 4    2569 2569 HOH HOH G . 
HM 39 HOH 5    2994 2994 HOH HOH G . 
HM 39 HOH 6    3117 3117 HOH HOH G . 
HM 39 HOH 7    3513 3513 HOH HOH G . 
HM 39 HOH 8    3903 3903 HOH HOH G . 
HM 39 HOH 9    4173 4173 HOH HOH G . 
HM 39 HOH 10   4619 4619 HOH HOH G . 
HM 39 HOH 11   4714 4714 HOH HOH G . 
HM 39 HOH 12   5661 5661 HOH HOH G . 
HM 39 HOH 13   5923 5923 HOH HOH G . 
HM 39 HOH 14   6201 6201 HOH HOH G . 
HM 39 HOH 15   6464 6464 HOH HOH G . 
HM 39 HOH 16   6833 6833 HOH HOH G . 
HM 39 HOH 17   7244 7244 HOH HOH G . 
HM 39 HOH 18   7246 7246 HOH HOH G . 
IM 39 HOH 1    8973 124  HOH HOH H . 
IM 39 HOH 2    8974 668  HOH HOH H . 
IM 39 HOH 3    8975 673  HOH HOH H . 
IM 39 HOH 4    8976 687  HOH HOH H . 
IM 39 HOH 5    8977 887  HOH HOH H . 
IM 39 HOH 6    8978 1336 HOH HOH H . 
IM 39 HOH 7    8979 1428 HOH HOH H . 
IM 39 HOH 8    8980 1594 HOH HOH H . 
IM 39 HOH 9    8981 1607 HOH HOH H . 
IM 39 HOH 10   8982 1639 HOH HOH H . 
IM 39 HOH 11   8983 1681 HOH HOH H . 
IM 39 HOH 12   8984 1716 HOH HOH H . 
IM 39 HOH 13   8985 1981 HOH HOH H . 
IM 39 HOH 14   8986 2161 HOH HOH H . 
IM 39 HOH 15   8987 2194 HOH HOH H . 
IM 39 HOH 16   8988 2205 HOH HOH H . 
IM 39 HOH 17   8989 2353 HOH HOH H . 
IM 39 HOH 18   8990 2408 HOH HOH H . 
IM 39 HOH 19   8991 2609 HOH HOH H . 
IM 39 HOH 20   8992 2679 HOH HOH H . 
IM 39 HOH 21   8993 2687 HOH HOH H . 
IM 39 HOH 22   8994 2934 HOH HOH H . 
IM 39 HOH 23   8995 2990 HOH HOH H . 
IM 39 HOH 24   8996 3102 HOH HOH H . 
IM 39 HOH 25   8997 3135 HOH HOH H . 
IM 39 HOH 26   8998 3157 HOH HOH H . 
IM 39 HOH 27   8999 3176 HOH HOH H . 
IM 39 HOH 28   9000 3236 HOH HOH H . 
IM 39 HOH 29   9001 3722 HOH HOH H . 
IM 39 HOH 30   9002 3789 HOH HOH H . 
IM 39 HOH 31   9003 3996 HOH HOH H . 
IM 39 HOH 32   9004 4237 HOH HOH H . 
IM 39 HOH 33   9005 4273 HOH HOH H . 
IM 39 HOH 34   9006 4333 HOH HOH H . 
IM 39 HOH 35   9007 4498 HOH HOH H . 
IM 39 HOH 36   9008 4760 HOH HOH H . 
IM 39 HOH 37   9009 4963 HOH HOH H . 
IM 39 HOH 38   9010 5035 HOH HOH H . 
IM 39 HOH 39   9011 5037 HOH HOH H . 
IM 39 HOH 40   9012 5062 HOH HOH H . 
IM 39 HOH 41   9013 5111 HOH HOH H . 
IM 39 HOH 42   9014 5170 HOH HOH H . 
IM 39 HOH 43   9015 5242 HOH HOH H . 
IM 39 HOH 44   9016 5466 HOH HOH H . 
IM 39 HOH 45   9017 5594 HOH HOH H . 
IM 39 HOH 46   9018 5622 HOH HOH H . 
IM 39 HOH 47   9019 5646 HOH HOH H . 
IM 39 HOH 48   9020 5690 HOH HOH H . 
IM 39 HOH 49   9021 5702 HOH HOH H . 
IM 39 HOH 50   9022 5707 HOH HOH H . 
IM 39 HOH 51   9023 5834 HOH HOH H . 
IM 39 HOH 52   9024 5873 HOH HOH H . 
IM 39 HOH 53   9025 5913 HOH HOH H . 
IM 39 HOH 54   9026 5915 HOH HOH H . 
IM 39 HOH 55   9027 6238 HOH HOH H . 
IM 39 HOH 56   9028 6268 HOH HOH H . 
IM 39 HOH 57   9029 6292 HOH HOH H . 
IM 39 HOH 58   9030 6308 HOH HOH H . 
IM 39 HOH 59   9031 6314 HOH HOH H . 
IM 39 HOH 60   9032 6351 HOH HOH H . 
IM 39 HOH 61   9033 6531 HOH HOH H . 
IM 39 HOH 62   9034 6571 HOH HOH H . 
IM 39 HOH 63   9035 6659 HOH HOH H . 
IM 39 HOH 64   9036 6717 HOH HOH H . 
IM 39 HOH 65   9037 6773 HOH HOH H . 
IM 39 HOH 66   9038 6822 HOH HOH H . 
IM 39 HOH 67   9039 6932 HOH HOH H . 
IM 39 HOH 68   9040 7183 HOH HOH H . 
IM 39 HOH 69   9041 7229 HOH HOH H . 
IM 39 HOH 70   9042 7374 HOH HOH H . 
IM 39 HOH 71   9043 7682 HOH HOH H . 
IM 39 HOH 72   9044 7902 HOH HOH H . 
JM 39 HOH 1    5128 5128 HOH HOH I . 
JM 39 HOH 2    5331 5331 HOH HOH I . 
JM 39 HOH 3    5371 5371 HOH HOH I . 
JM 39 HOH 4    6825 6825 HOH HOH I . 
JM 39 HOH 5    7210 7210 HOH HOH I . 
JM 39 HOH 6    7224 7224 HOH HOH I . 
JM 39 HOH 7    7330 7330 HOH HOH I . 
JM 39 HOH 8    7439 7439 HOH HOH I . 
KM 39 HOH 1    247  247  HOH HOH J . 
KM 39 HOH 2    267  267  HOH HOH J . 
KM 39 HOH 3    383  383  HOH HOH J . 
KM 39 HOH 4    982  982  HOH HOH J . 
KM 39 HOH 5    1018 1018 HOH HOH J . 
KM 39 HOH 6    1123 1123 HOH HOH J . 
KM 39 HOH 7    1405 1405 HOH HOH J . 
KM 39 HOH 8    1596 1596 HOH HOH J . 
KM 39 HOH 9    1652 1652 HOH HOH J . 
KM 39 HOH 10   1727 1727 HOH HOH J . 
KM 39 HOH 11   1886 1886 HOH HOH J . 
KM 39 HOH 12   2238 2238 HOH HOH J . 
KM 39 HOH 13   2333 2333 HOH HOH J . 
KM 39 HOH 14   2664 2664 HOH HOH J . 
KM 39 HOH 15   2828 2828 HOH HOH J . 
KM 39 HOH 16   2858 2858 HOH HOH J . 
KM 39 HOH 17   2886 2886 HOH HOH J . 
KM 39 HOH 18   3338 3338 HOH HOH J . 
KM 39 HOH 19   3422 3422 HOH HOH J . 
KM 39 HOH 20   3517 3517 HOH HOH J . 
KM 39 HOH 21   3615 3615 HOH HOH J . 
KM 39 HOH 22   3694 3694 HOH HOH J . 
KM 39 HOH 23   3705 3705 HOH HOH J . 
KM 39 HOH 24   3726 3726 HOH HOH J . 
KM 39 HOH 25   3750 3750 HOH HOH J . 
KM 39 HOH 26   3772 3772 HOH HOH J . 
KM 39 HOH 27   3795 3795 HOH HOH J . 
KM 39 HOH 28   4038 4038 HOH HOH J . 
KM 39 HOH 29   4041 4041 HOH HOH J . 
KM 39 HOH 30   4193 4193 HOH HOH J . 
KM 39 HOH 31   4199 4199 HOH HOH J . 
KM 39 HOH 32   4367 4367 HOH HOH J . 
KM 39 HOH 33   4561 4561 HOH HOH J . 
KM 39 HOH 34   4650 4650 HOH HOH J . 
KM 39 HOH 35   4712 4712 HOH HOH J . 
KM 39 HOH 36   4746 4746 HOH HOH J . 
KM 39 HOH 37   4908 4908 HOH HOH J . 
KM 39 HOH 38   5036 5036 HOH HOH J . 
KM 39 HOH 39   5061 5061 HOH HOH J . 
KM 39 HOH 40   5249 5249 HOH HOH J . 
KM 39 HOH 41   5290 5290 HOH HOH J . 
KM 39 HOH 42   5361 5361 HOH HOH J . 
KM 39 HOH 43   5448 5448 HOH HOH J . 
KM 39 HOH 44   5590 5590 HOH HOH J . 
KM 39 HOH 45   5750 5750 HOH HOH J . 
KM 39 HOH 46   5758 5758 HOH HOH J . 
KM 39 HOH 47   5907 5907 HOH HOH J . 
KM 39 HOH 48   6256 6256 HOH HOH J . 
KM 39 HOH 49   6706 6706 HOH HOH J . 
KM 39 HOH 50   6807 6807 HOH HOH J . 
KM 39 HOH 51   6835 6835 HOH HOH J . 
KM 39 HOH 52   6836 6836 HOH HOH J . 
KM 39 HOH 53   6869 6869 HOH HOH J . 
KM 39 HOH 54   7003 7003 HOH HOH J . 
KM 39 HOH 55   7004 7004 HOH HOH J . 
KM 39 HOH 56   7282 7282 HOH HOH J . 
KM 39 HOH 57   7377 7377 HOH HOH J . 
KM 39 HOH 58   7546 7546 HOH HOH J . 
KM 39 HOH 59   7556 7556 HOH HOH J . 
LM 39 HOH 1    581  581  HOH HOH K . 
LM 39 HOH 2    782  782  HOH HOH K . 
LM 39 HOH 3    805  805  HOH HOH K . 
LM 39 HOH 4    1163 1163 HOH HOH K . 
LM 39 HOH 5    1334 1334 HOH HOH K . 
LM 39 HOH 6    1387 1387 HOH HOH K . 
LM 39 HOH 7    1433 1433 HOH HOH K . 
LM 39 HOH 8    1454 1454 HOH HOH K . 
LM 39 HOH 9    1762 1762 HOH HOH K . 
LM 39 HOH 10   1765 1765 HOH HOH K . 
LM 39 HOH 11   1799 1799 HOH HOH K . 
LM 39 HOH 12   1841 1841 HOH HOH K . 
LM 39 HOH 13   1986 1986 HOH HOH K . 
LM 39 HOH 14   2121 2121 HOH HOH K . 
LM 39 HOH 15   2247 2247 HOH HOH K . 
LM 39 HOH 16   2499 2499 HOH HOH K . 
LM 39 HOH 17   2591 2591 HOH HOH K . 
LM 39 HOH 18   2659 2659 HOH HOH K . 
LM 39 HOH 19   2777 2777 HOH HOH K . 
LM 39 HOH 20   2914 2914 HOH HOH K . 
LM 39 HOH 21   3160 3160 HOH HOH K . 
LM 39 HOH 22   3385 3385 HOH HOH K . 
LM 39 HOH 23   3442 3442 HOH HOH K . 
LM 39 HOH 24   3492 3492 HOH HOH K . 
LM 39 HOH 25   3709 3709 HOH HOH K . 
LM 39 HOH 26   3739 3739 HOH HOH K . 
LM 39 HOH 27   3919 3919 HOH HOH K . 
LM 39 HOH 28   3955 3955 HOH HOH K . 
LM 39 HOH 29   4003 4003 HOH HOH K . 
LM 39 HOH 30   4066 4066 HOH HOH K . 
LM 39 HOH 31   4172 4172 HOH HOH K . 
LM 39 HOH 32   4183 4183 HOH HOH K . 
LM 39 HOH 33   4288 4288 HOH HOH K . 
LM 39 HOH 34   4747 4747 HOH HOH K . 
LM 39 HOH 35   5029 5029 HOH HOH K . 
LM 39 HOH 36   5264 5264 HOH HOH K . 
LM 39 HOH 37   5358 5358 HOH HOH K . 
LM 39 HOH 38   5632 5632 HOH HOH K . 
LM 39 HOH 39   5638 5638 HOH HOH K . 
LM 39 HOH 40   5696 5696 HOH HOH K . 
LM 39 HOH 41   5729 5729 HOH HOH K . 
LM 39 HOH 42   5780 5780 HOH HOH K . 
LM 39 HOH 43   6100 6100 HOH HOH K . 
LM 39 HOH 44   6313 6313 HOH HOH K . 
LM 39 HOH 45   6344 6344 HOH HOH K . 
LM 39 HOH 46   6456 6456 HOH HOH K . 
LM 39 HOH 47   6513 6513 HOH HOH K . 
LM 39 HOH 48   6646 6646 HOH HOH K . 
LM 39 HOH 49   6707 6707 HOH HOH K . 
LM 39 HOH 50   6972 6972 HOH HOH K . 
LM 39 HOH 51   7064 7064 HOH HOH K . 
LM 39 HOH 52   7075 7075 HOH HOH K . 
LM 39 HOH 53   7143 7143 HOH HOH K . 
LM 39 HOH 54   7169 7169 HOH HOH K . 
LM 39 HOH 55   7408 7408 HOH HOH K . 
LM 39 HOH 56   7438 7438 HOH HOH K . 
LM 39 HOH 57   7579 7579 HOH HOH K . 
LM 39 HOH 58   7871 7871 HOH HOH K . 
MM 39 HOH 1    8811 42   HOH HOH L . 
MM 39 HOH 2    8812 88   HOH HOH L . 
MM 39 HOH 3    8813 177  HOH HOH L . 
MM 39 HOH 4    8814 200  HOH HOH L . 
MM 39 HOH 5    8815 750  HOH HOH L . 
MM 39 HOH 6    8816 766  HOH HOH L . 
MM 39 HOH 7    8817 799  HOH HOH L . 
MM 39 HOH 8    8818 907  HOH HOH L . 
MM 39 HOH 9    8819 1132 HOH HOH L . 
MM 39 HOH 10   8820 1200 HOH HOH L . 
MM 39 HOH 11   8821 1617 HOH HOH L . 
MM 39 HOH 12   8822 1754 HOH HOH L . 
MM 39 HOH 13   8823 1940 HOH HOH L . 
MM 39 HOH 14   8824 2029 HOH HOH L . 
MM 39 HOH 15   8825 2166 HOH HOH L . 
MM 39 HOH 16   8826 2203 HOH HOH L . 
MM 39 HOH 17   8827 2289 HOH HOH L . 
MM 39 HOH 18   8828 2614 HOH HOH L . 
MM 39 HOH 19   8829 2670 HOH HOH L . 
MM 39 HOH 20   8830 2798 HOH HOH L . 
MM 39 HOH 21   8831 3032 HOH HOH L . 
MM 39 HOH 22   8832 3080 HOH HOH L . 
MM 39 HOH 23   8833 3132 HOH HOH L . 
MM 39 HOH 24   8834 3306 HOH HOH L . 
MM 39 HOH 25   8835 3392 HOH HOH L . 
MM 39 HOH 26   8836 3507 HOH HOH L . 
MM 39 HOH 27   8837 3766 HOH HOH L . 
MM 39 HOH 28   8838 3793 HOH HOH L . 
MM 39 HOH 29   8839 3807 HOH HOH L . 
MM 39 HOH 30   8840 3855 HOH HOH L . 
MM 39 HOH 31   8841 3949 HOH HOH L . 
MM 39 HOH 32   8842 4080 HOH HOH L . 
MM 39 HOH 33   8843 4163 HOH HOH L . 
MM 39 HOH 34   8844 4311 HOH HOH L . 
MM 39 HOH 35   8845 4312 HOH HOH L . 
MM 39 HOH 36   8846 4360 HOH HOH L . 
MM 39 HOH 37   8847 4463 HOH HOH L . 
MM 39 HOH 38   8848 4698 HOH HOH L . 
MM 39 HOH 39   8849 4812 HOH HOH L . 
MM 39 HOH 40   8850 4967 HOH HOH L . 
MM 39 HOH 41   8851 4970 HOH HOH L . 
MM 39 HOH 42   8852 5201 HOH HOH L . 
MM 39 HOH 43   8853 5274 HOH HOH L . 
MM 39 HOH 44   8854 5364 HOH HOH L . 
MM 39 HOH 45   8855 5398 HOH HOH L . 
MM 39 HOH 46   8856 5553 HOH HOH L . 
MM 39 HOH 47   8857 5599 HOH HOH L . 
MM 39 HOH 48   8858 5614 HOH HOH L . 
MM 39 HOH 49   8859 5795 HOH HOH L . 
MM 39 HOH 50   8860 5871 HOH HOH L . 
MM 39 HOH 51   8861 5929 HOH HOH L . 
MM 39 HOH 52   8862 5949 HOH HOH L . 
MM 39 HOH 53   8863 5971 HOH HOH L . 
MM 39 HOH 54   8864 6153 HOH HOH L . 
MM 39 HOH 55   8865 6166 HOH HOH L . 
MM 39 HOH 56   8866 6209 HOH HOH L . 
MM 39 HOH 57   8867 6242 HOH HOH L . 
MM 39 HOH 58   8868 6260 HOH HOH L . 
MM 39 HOH 59   8869 6273 HOH HOH L . 
MM 39 HOH 60   8870 6440 HOH HOH L . 
MM 39 HOH 61   8871 6545 HOH HOH L . 
MM 39 HOH 62   8872 6605 HOH HOH L . 
MM 39 HOH 63   8873 6658 HOH HOH L . 
MM 39 HOH 64   8874 7016 HOH HOH L . 
MM 39 HOH 65   8875 7121 HOH HOH L . 
MM 39 HOH 66   8876 7279 HOH HOH L . 
MM 39 HOH 67   8877 7425 HOH HOH L . 
MM 39 HOH 68   8878 7471 HOH HOH L . 
MM 39 HOH 69   8879 7606 HOH HOH L . 
MM 39 HOH 70   8880 7681 HOH HOH L . 
MM 39 HOH 71   8881 7901 HOH HOH L . 
MM 39 HOH 72   8882 7907 HOH HOH L . 
NM 39 HOH 1    8819 57   HOH HOH M . 
NM 39 HOH 2    8820 90   HOH HOH M . 
NM 39 HOH 3    8821 98   HOH HOH M . 
NM 39 HOH 4    8822 115  HOH HOH M . 
NM 39 HOH 5    8823 128  HOH HOH M . 
NM 39 HOH 6    8824 304  HOH HOH M . 
NM 39 HOH 7    8825 309  HOH HOH M . 
NM 39 HOH 8    8826 336  HOH HOH M . 
NM 39 HOH 9    8827 436  HOH HOH M . 
NM 39 HOH 10   8828 444  HOH HOH M . 
NM 39 HOH 11   8829 450  HOH HOH M . 
NM 39 HOH 12   8830 498  HOH HOH M . 
NM 39 HOH 13   8831 507  HOH HOH M . 
NM 39 HOH 14   8832 525  HOH HOH M . 
NM 39 HOH 15   8833 533  HOH HOH M . 
NM 39 HOH 16   8834 594  HOH HOH M . 
NM 39 HOH 17   8835 674  HOH HOH M . 
NM 39 HOH 18   8836 795  HOH HOH M . 
NM 39 HOH 19   8837 847  HOH HOH M . 
NM 39 HOH 20   8838 935  HOH HOH M . 
NM 39 HOH 21   8839 936  HOH HOH M . 
NM 39 HOH 22   8840 938  HOH HOH M . 
NM 39 HOH 23   8841 973  HOH HOH M . 
NM 39 HOH 24   8842 991  HOH HOH M . 
NM 39 HOH 25   8843 1031 HOH HOH M . 
NM 39 HOH 26   8844 1165 HOH HOH M . 
NM 39 HOH 27   8845 1179 HOH HOH M . 
NM 39 HOH 28   8846 1238 HOH HOH M . 
NM 39 HOH 29   8847 1293 HOH HOH M . 
NM 39 HOH 30   8848 1372 HOH HOH M . 
NM 39 HOH 31   8849 1488 HOH HOH M . 
NM 39 HOH 32   8850 1489 HOH HOH M . 
NM 39 HOH 33   8851 1629 HOH HOH M . 
NM 39 HOH 34   8852 1656 HOH HOH M . 
NM 39 HOH 35   8853 1685 HOH HOH M . 
NM 39 HOH 36   8854 1705 HOH HOH M . 
NM 39 HOH 37   8855 1822 HOH HOH M . 
NM 39 HOH 38   8856 1852 HOH HOH M . 
NM 39 HOH 39   8857 1916 HOH HOH M . 
NM 39 HOH 40   8858 1933 HOH HOH M . 
NM 39 HOH 41   8859 1951 HOH HOH M . 
NM 39 HOH 42   8860 2041 HOH HOH M . 
NM 39 HOH 43   8861 2079 HOH HOH M . 
NM 39 HOH 44   8862 2081 HOH HOH M . 
NM 39 HOH 45   8863 2174 HOH HOH M . 
NM 39 HOH 46   8864 2188 HOH HOH M . 
NM 39 HOH 47   8865 2263 HOH HOH M . 
NM 39 HOH 48   8866 2306 HOH HOH M . 
NM 39 HOH 49   8867 2316 HOH HOH M . 
NM 39 HOH 50   8868 2371 HOH HOH M . 
NM 39 HOH 51   8869 2651 HOH HOH M . 
NM 39 HOH 52   8870 2788 HOH HOH M . 
NM 39 HOH 53   8871 2850 HOH HOH M . 
NM 39 HOH 54   8872 2929 HOH HOH M . 
NM 39 HOH 55   8873 2961 HOH HOH M . 
NM 39 HOH 56   8874 2993 HOH HOH M . 
NM 39 HOH 57   8875 3015 HOH HOH M . 
NM 39 HOH 58   8876 3107 HOH HOH M . 
NM 39 HOH 59   8877 3155 HOH HOH M . 
NM 39 HOH 60   8878 3196 HOH HOH M . 
NM 39 HOH 61   8879 3198 HOH HOH M . 
NM 39 HOH 62   8880 3219 HOH HOH M . 
NM 39 HOH 63   8881 3234 HOH HOH M . 
NM 39 HOH 64   8882 3244 HOH HOH M . 
NM 39 HOH 65   8883 3245 HOH HOH M . 
NM 39 HOH 66   8884 3347 HOH HOH M . 
NM 39 HOH 67   8885 3401 HOH HOH M . 
NM 39 HOH 68   8886 3443 HOH HOH M . 
NM 39 HOH 69   8887 3463 HOH HOH M . 
NM 39 HOH 70   8888 3589 HOH HOH M . 
NM 39 HOH 71   8889 3603 HOH HOH M . 
NM 39 HOH 72   8890 3686 HOH HOH M . 
NM 39 HOH 73   8891 3690 HOH HOH M . 
NM 39 HOH 74   8892 3720 HOH HOH M . 
NM 39 HOH 75   8893 3824 HOH HOH M . 
NM 39 HOH 76   8894 3833 HOH HOH M . 
NM 39 HOH 77   8895 3890 HOH HOH M . 
NM 39 HOH 78   8896 3900 HOH HOH M . 
NM 39 HOH 79   8897 4196 HOH HOH M . 
NM 39 HOH 80   8898 4211 HOH HOH M . 
NM 39 HOH 81   8899 4219 HOH HOH M . 
NM 39 HOH 82   8900 4265 HOH HOH M . 
NM 39 HOH 83   8901 4334 HOH HOH M . 
NM 39 HOH 84   8902 4405 HOH HOH M . 
NM 39 HOH 85   8903 4420 HOH HOH M . 
NM 39 HOH 86   8904 4577 HOH HOH M . 
NM 39 HOH 87   8905 4600 HOH HOH M . 
NM 39 HOH 88   8906 4610 HOH HOH M . 
NM 39 HOH 89   8907 4696 HOH HOH M . 
NM 39 HOH 90   8908 4846 HOH HOH M . 
NM 39 HOH 91   8909 4847 HOH HOH M . 
NM 39 HOH 92   8910 5102 HOH HOH M . 
NM 39 HOH 93   8911 5159 HOH HOH M . 
NM 39 HOH 94   8912 5294 HOH HOH M . 
NM 39 HOH 95   8913 5360 HOH HOH M . 
NM 39 HOH 96   8914 5442 HOH HOH M . 
NM 39 HOH 97   8915 5483 HOH HOH M . 
NM 39 HOH 98   8916 5504 HOH HOH M . 
NM 39 HOH 99   8917 5686 HOH HOH M . 
NM 39 HOH 100  8918 5769 HOH HOH M . 
NM 39 HOH 101  8919 5842 HOH HOH M . 
NM 39 HOH 102  8920 5942 HOH HOH M . 
NM 39 HOH 103  8921 5961 HOH HOH M . 
NM 39 HOH 104  8922 6198 HOH HOH M . 
NM 39 HOH 105  8923 6220 HOH HOH M . 
NM 39 HOH 106  8924 6250 HOH HOH M . 
NM 39 HOH 107  8925 6368 HOH HOH M . 
NM 39 HOH 108  8926 6484 HOH HOH M . 
NM 39 HOH 109  8927 6536 HOH HOH M . 
NM 39 HOH 110  8928 6645 HOH HOH M . 
NM 39 HOH 111  8929 6702 HOH HOH M . 
NM 39 HOH 112  8930 6704 HOH HOH M . 
NM 39 HOH 113  8931 6719 HOH HOH M . 
NM 39 HOH 114  8932 6960 HOH HOH M . 
NM 39 HOH 115  8933 6979 HOH HOH M . 
NM 39 HOH 116  8934 7058 HOH HOH M . 
NM 39 HOH 117  8935 7208 HOH HOH M . 
NM 39 HOH 118  8936 7281 HOH HOH M . 
NM 39 HOH 119  8937 7301 HOH HOH M . 
NM 39 HOH 120  8938 7419 HOH HOH M . 
NM 39 HOH 121  8939 7525 HOH HOH M . 
NM 39 HOH 122  8940 7613 HOH HOH M . 
NM 39 HOH 123  8941 7854 HOH HOH M . 
NM 39 HOH 124  8942 7855 HOH HOH M . 
OM 39 HOH 1    8808 125  HOH HOH N . 
OM 39 HOH 2    8809 553  HOH HOH N . 
OM 39 HOH 3    8810 588  HOH HOH N . 
OM 39 HOH 4    8811 853  HOH HOH N . 
OM 39 HOH 5    8812 922  HOH HOH N . 
OM 39 HOH 6    8813 1310 HOH HOH N . 
OM 39 HOH 7    8814 1934 HOH HOH N . 
OM 39 HOH 8    8815 1968 HOH HOH N . 
OM 39 HOH 9    8816 2052 HOH HOH N . 
OM 39 HOH 10   8817 2385 HOH HOH N . 
OM 39 HOH 11   8818 2480 HOH HOH N . 
OM 39 HOH 12   8819 2537 HOH HOH N . 
OM 39 HOH 13   8820 2714 HOH HOH N . 
OM 39 HOH 14   8821 2874 HOH HOH N . 
OM 39 HOH 15   8822 2904 HOH HOH N . 
OM 39 HOH 16   8823 2957 HOH HOH N . 
OM 39 HOH 17   8824 3051 HOH HOH N . 
OM 39 HOH 18   8825 3251 HOH HOH N . 
OM 39 HOH 19   8826 3364 HOH HOH N . 
OM 39 HOH 20   8827 3371 HOH HOH N . 
OM 39 HOH 21   8828 3480 HOH HOH N . 
OM 39 HOH 22   8829 3490 HOH HOH N . 
OM 39 HOH 23   8830 3505 HOH HOH N . 
OM 39 HOH 24   8831 3534 HOH HOH N . 
OM 39 HOH 25   8832 3863 HOH HOH N . 
OM 39 HOH 26   8833 4034 HOH HOH N . 
OM 39 HOH 27   8834 4109 HOH HOH N . 
OM 39 HOH 28   8835 4257 HOH HOH N . 
OM 39 HOH 29   8836 4363 HOH HOH N . 
OM 39 HOH 30   8837 4391 HOH HOH N . 
OM 39 HOH 31   8838 4394 HOH HOH N . 
OM 39 HOH 32   8839 4398 HOH HOH N . 
OM 39 HOH 33   8840 4604 HOH HOH N . 
OM 39 HOH 34   8841 4624 HOH HOH N . 
OM 39 HOH 35   8842 4678 HOH HOH N . 
OM 39 HOH 36   8843 4695 HOH HOH N . 
OM 39 HOH 37   8844 4701 HOH HOH N . 
OM 39 HOH 38   8845 4707 HOH HOH N . 
OM 39 HOH 39   8846 4713 HOH HOH N . 
OM 39 HOH 40   8847 5137 HOH HOH N . 
OM 39 HOH 41   8848 5317 HOH HOH N . 
OM 39 HOH 42   8849 5408 HOH HOH N . 
OM 39 HOH 43   8850 5528 HOH HOH N . 
OM 39 HOH 44   8851 5572 HOH HOH N . 
OM 39 HOH 45   8852 5627 HOH HOH N . 
OM 39 HOH 46   8853 6069 HOH HOH N . 
OM 39 HOH 47   8854 6189 HOH HOH N . 
OM 39 HOH 48   8855 6239 HOH HOH N . 
OM 39 HOH 49   8856 6448 HOH HOH N . 
OM 39 HOH 50   8857 6497 HOH HOH N . 
OM 39 HOH 51   8858 6665 HOH HOH N . 
OM 39 HOH 52   8859 6762 HOH HOH N . 
OM 39 HOH 53   8860 6783 HOH HOH N . 
OM 39 HOH 54   8861 6795 HOH HOH N . 
OM 39 HOH 55   8862 6913 HOH HOH N . 
OM 39 HOH 56   8863 6988 HOH HOH N . 
OM 39 HOH 57   8864 7103 HOH HOH N . 
OM 39 HOH 58   8865 7167 HOH HOH N . 
OM 39 HOH 59   8866 7474 HOH HOH N . 
OM 39 HOH 60   8867 7552 HOH HOH N . 
OM 39 HOH 61   8868 7678 HOH HOH N . 
PM 39 HOH 1    510  510  HOH HOH O . 
PM 39 HOH 2    1484 1484 HOH HOH O . 
PM 39 HOH 3    1623 1623 HOH HOH O . 
PM 39 HOH 4    1937 1937 HOH HOH O . 
PM 39 HOH 5    2176 2176 HOH HOH O . 
PM 39 HOH 6    2336 2336 HOH HOH O . 
PM 39 HOH 7    2823 2823 HOH HOH O . 
PM 39 HOH 8    3062 3062 HOH HOH O . 
PM 39 HOH 9    3240 3240 HOH HOH O . 
PM 39 HOH 10   3352 3352 HOH HOH O . 
PM 39 HOH 11   3360 3360 HOH HOH O . 
PM 39 HOH 12   4171 4171 HOH HOH O . 
PM 39 HOH 13   4258 4258 HOH HOH O . 
PM 39 HOH 14   4297 4297 HOH HOH O . 
PM 39 HOH 15   4490 4490 HOH HOH O . 
PM 39 HOH 16   4656 4656 HOH HOH O . 
PM 39 HOH 17   4770 4770 HOH HOH O . 
PM 39 HOH 18   4826 4826 HOH HOH O . 
PM 39 HOH 19   5083 5083 HOH HOH O . 
PM 39 HOH 20   5104 5104 HOH HOH O . 
PM 39 HOH 21   5191 5191 HOH HOH O . 
PM 39 HOH 22   6006 6006 HOH HOH O . 
PM 39 HOH 23   6044 6044 HOH HOH O . 
PM 39 HOH 24   6111 6111 HOH HOH O . 
PM 39 HOH 25   6142 6142 HOH HOH O . 
PM 39 HOH 26   6147 6147 HOH HOH O . 
PM 39 HOH 27   6194 6194 HOH HOH O . 
PM 39 HOH 28   6252 6252 HOH HOH O . 
PM 39 HOH 29   6661 6661 HOH HOH O . 
PM 39 HOH 30   6754 6754 HOH HOH O . 
PM 39 HOH 31   6810 6810 HOH HOH O . 
PM 39 HOH 32   6939 6939 HOH HOH O . 
PM 39 HOH 33   7061 7061 HOH HOH O . 
PM 39 HOH 34   7077 7077 HOH HOH O . 
PM 39 HOH 35   7481 7481 HOH HOH O . 
PM 39 HOH 36   7521 7521 HOH HOH O . 
PM 39 HOH 37   7543 7543 HOH HOH O . 
PM 39 HOH 38   7674 7674 HOH HOH O . 
QM 39 HOH 1    149  82   HOH HOH P . 
QM 39 HOH 2    150  311  HOH HOH P . 
QM 39 HOH 3    151  340  HOH HOH P . 
QM 39 HOH 4    152  584  HOH HOH P . 
QM 39 HOH 5    153  641  HOH HOH P . 
QM 39 HOH 6    154  773  HOH HOH P . 
QM 39 HOH 7    155  804  HOH HOH P . 
QM 39 HOH 8    156  1048 HOH HOH P . 
QM 39 HOH 9    157  1226 HOH HOH P . 
QM 39 HOH 10   158  1406 HOH HOH P . 
QM 39 HOH 11   159  1458 HOH HOH P . 
QM 39 HOH 12   160  1715 HOH HOH P . 
QM 39 HOH 13   161  1778 HOH HOH P . 
QM 39 HOH 14   162  1865 HOH HOH P . 
QM 39 HOH 15   163  1926 HOH HOH P . 
QM 39 HOH 16   164  1932 HOH HOH P . 
QM 39 HOH 17   165  2133 HOH HOH P . 
QM 39 HOH 18   166  2178 HOH HOH P . 
QM 39 HOH 19   167  2495 HOH HOH P . 
QM 39 HOH 20   168  2520 HOH HOH P . 
QM 39 HOH 21   169  2633 HOH HOH P . 
QM 39 HOH 22   170  2641 HOH HOH P . 
QM 39 HOH 23   171  3221 HOH HOH P . 
QM 39 HOH 24   172  3319 HOH HOH P . 
QM 39 HOH 25   173  3748 HOH HOH P . 
QM 39 HOH 26   174  3969 HOH HOH P . 
QM 39 HOH 27   175  4043 HOH HOH P . 
QM 39 HOH 28   176  4299 HOH HOH P . 
QM 39 HOH 29   177  4372 HOH HOH P . 
QM 39 HOH 30   178  4563 HOH HOH P . 
QM 39 HOH 31   179  4637 HOH HOH P . 
QM 39 HOH 32   180  4661 HOH HOH P . 
QM 39 HOH 33   181  4744 HOH HOH P . 
QM 39 HOH 34   182  4763 HOH HOH P . 
QM 39 HOH 35   183  4818 HOH HOH P . 
QM 39 HOH 36   184  5004 HOH HOH P . 
QM 39 HOH 37   185  5319 HOH HOH P . 
QM 39 HOH 38   186  5440 HOH HOH P . 
QM 39 HOH 39   187  5478 HOH HOH P . 
QM 39 HOH 40   188  5511 HOH HOH P . 
QM 39 HOH 41   189  5521 HOH HOH P . 
QM 39 HOH 42   190  5597 HOH HOH P . 
QM 39 HOH 43   191  5642 HOH HOH P . 
QM 39 HOH 44   192  5725 HOH HOH P . 
QM 39 HOH 45   193  5836 HOH HOH P . 
QM 39 HOH 46   194  5891 HOH HOH P . 
QM 39 HOH 47   195  6001 HOH HOH P . 
QM 39 HOH 48   196  6020 HOH HOH P . 
QM 39 HOH 49   197  6051 HOH HOH P . 
QM 39 HOH 50   198  6072 HOH HOH P . 
QM 39 HOH 51   199  6099 HOH HOH P . 
QM 39 HOH 52   200  6187 HOH HOH P . 
QM 39 HOH 53   201  6315 HOH HOH P . 
QM 39 HOH 54   202  6486 HOH HOH P . 
QM 39 HOH 55   203  6525 HOH HOH P . 
QM 39 HOH 56   204  6585 HOH HOH P . 
QM 39 HOH 57   205  6687 HOH HOH P . 
QM 39 HOH 58   206  6904 HOH HOH P . 
QM 39 HOH 59   207  7156 HOH HOH P . 
QM 39 HOH 60   208  7186 HOH HOH P . 
QM 39 HOH 61   209  7381 HOH HOH P . 
QM 39 HOH 62   210  7503 HOH HOH P . 
QM 39 HOH 63   211  7545 HOH HOH P . 
QM 39 HOH 64   212  7575 HOH HOH P . 
QM 39 HOH 65   213  7699 HOH HOH P . 
QM 39 HOH 66   214  7890 HOH HOH P . 
RM 39 HOH 1    245  245  HOH HOH Q . 
RM 39 HOH 2    1242 1242 HOH HOH Q . 
RM 39 HOH 3    1295 1295 HOH HOH Q . 
RM 39 HOH 4    1356 1356 HOH HOH Q . 
RM 39 HOH 5    1571 1571 HOH HOH Q . 
RM 39 HOH 6    1795 1795 HOH HOH Q . 
RM 39 HOH 7    2018 2018 HOH HOH Q . 
RM 39 HOH 8    2309 2309 HOH HOH Q . 
RM 39 HOH 9    2847 2847 HOH HOH Q . 
RM 39 HOH 10   2875 2875 HOH HOH Q . 
RM 39 HOH 11   2999 2999 HOH HOH Q . 
RM 39 HOH 12   3082 3082 HOH HOH Q . 
RM 39 HOH 13   3224 3224 HOH HOH Q . 
RM 39 HOH 14   3294 3294 HOH HOH Q . 
RM 39 HOH 15   3458 3458 HOH HOH Q . 
RM 39 HOH 16   3550 3550 HOH HOH Q . 
RM 39 HOH 17   3595 3595 HOH HOH Q . 
RM 39 HOH 18   3671 3671 HOH HOH Q . 
RM 39 HOH 19   3700 3700 HOH HOH Q . 
RM 39 HOH 20   3971 3971 HOH HOH Q . 
RM 39 HOH 21   4350 4350 HOH HOH Q . 
RM 39 HOH 22   4709 4709 HOH HOH Q . 
RM 39 HOH 23   4785 4785 HOH HOH Q . 
RM 39 HOH 24   4792 4792 HOH HOH Q . 
RM 39 HOH 25   4808 4808 HOH HOH Q . 
RM 39 HOH 26   4956 4956 HOH HOH Q . 
RM 39 HOH 27   5096 5096 HOH HOH Q . 
RM 39 HOH 28   5227 5227 HOH HOH Q . 
RM 39 HOH 29   5247 5247 HOH HOH Q . 
RM 39 HOH 30   5427 5427 HOH HOH Q . 
RM 39 HOH 31   5518 5518 HOH HOH Q . 
RM 39 HOH 32   5620 5620 HOH HOH Q . 
RM 39 HOH 33   5641 5641 HOH HOH Q . 
RM 39 HOH 34   5665 5665 HOH HOH Q . 
RM 39 HOH 35   5840 5840 HOH HOH Q . 
RM 39 HOH 36   5853 5853 HOH HOH Q . 
RM 39 HOH 37   5870 5870 HOH HOH Q . 
RM 39 HOH 38   5903 5903 HOH HOH Q . 
RM 39 HOH 39   5998 5998 HOH HOH Q . 
RM 39 HOH 40   6092 6092 HOH HOH Q . 
RM 39 HOH 41   6110 6110 HOH HOH Q . 
RM 39 HOH 42   6213 6213 HOH HOH Q . 
RM 39 HOH 43   6286 6286 HOH HOH Q . 
RM 39 HOH 44   6470 6470 HOH HOH Q . 
RM 39 HOH 45   6559 6559 HOH HOH Q . 
RM 39 HOH 46   6597 6597 HOH HOH Q . 
RM 39 HOH 47   6976 6976 HOH HOH Q . 
RM 39 HOH 48   6982 6982 HOH HOH Q . 
RM 39 HOH 49   7161 7161 HOH HOH Q . 
RM 39 HOH 50   7270 7270 HOH HOH Q . 
RM 39 HOH 51   7328 7328 HOH HOH Q . 
RM 39 HOH 52   7505 7505 HOH HOH Q . 
RM 39 HOH 53   7617 7617 HOH HOH Q . 
SM 39 HOH 1    8913 24   HOH HOH R . 
SM 39 HOH 2    8914 382  HOH HOH R . 
SM 39 HOH 3    8915 559  HOH HOH R . 
SM 39 HOH 4    8916 591  HOH HOH R . 
SM 39 HOH 5    8917 760  HOH HOH R . 
SM 39 HOH 6    8918 1215 HOH HOH R . 
SM 39 HOH 7    8919 1316 HOH HOH R . 
SM 39 HOH 8    8920 1317 HOH HOH R . 
SM 39 HOH 9    8921 1370 HOH HOH R . 
SM 39 HOH 10   8922 1417 HOH HOH R . 
SM 39 HOH 11   8923 1664 HOH HOH R . 
SM 39 HOH 12   8924 1701 HOH HOH R . 
SM 39 HOH 13   8925 1753 HOH HOH R . 
SM 39 HOH 14   8926 2015 HOH HOH R . 
SM 39 HOH 15   8927 2106 HOH HOH R . 
SM 39 HOH 16   8928 2207 HOH HOH R . 
SM 39 HOH 17   8929 2222 HOH HOH R . 
SM 39 HOH 18   8930 2224 HOH HOH R . 
SM 39 HOH 19   8931 2259 HOH HOH R . 
SM 39 HOH 20   8932 2434 HOH HOH R . 
SM 39 HOH 21   8933 2815 HOH HOH R . 
SM 39 HOH 22   8934 2824 HOH HOH R . 
SM 39 HOH 23   8935 2879 HOH HOH R . 
SM 39 HOH 24   8936 2943 HOH HOH R . 
SM 39 HOH 25   8937 3034 HOH HOH R . 
SM 39 HOH 26   8938 3180 HOH HOH R . 
SM 39 HOH 27   8939 3193 HOH HOH R . 
SM 39 HOH 28   8940 3273 HOH HOH R . 
SM 39 HOH 29   8941 3328 HOH HOH R . 
SM 39 HOH 30   8942 3421 HOH HOH R . 
SM 39 HOH 31   8943 3504 HOH HOH R . 
SM 39 HOH 32   8944 3508 HOH HOH R . 
SM 39 HOH 33   8945 3532 HOH HOH R . 
SM 39 HOH 34   8946 3539 HOH HOH R . 
SM 39 HOH 35   8947 3859 HOH HOH R . 
SM 39 HOH 36   8948 3878 HOH HOH R . 
SM 39 HOH 37   8949 3905 HOH HOH R . 
SM 39 HOH 38   8950 3909 HOH HOH R . 
SM 39 HOH 39   8951 3973 HOH HOH R . 
SM 39 HOH 40   8952 3991 HOH HOH R . 
SM 39 HOH 41   8953 4011 HOH HOH R . 
SM 39 HOH 42   8954 4223 HOH HOH R . 
SM 39 HOH 43   8955 4608 HOH HOH R . 
SM 39 HOH 44   8956 4819 HOH HOH R . 
SM 39 HOH 45   8957 4865 HOH HOH R . 
SM 39 HOH 46   8958 4893 HOH HOH R . 
SM 39 HOH 47   8959 4990 HOH HOH R . 
SM 39 HOH 48   8960 4997 HOH HOH R . 
SM 39 HOH 49   8961 5069 HOH HOH R . 
SM 39 HOH 50   8962 5075 HOH HOH R . 
SM 39 HOH 51   8963 5106 HOH HOH R . 
SM 39 HOH 52   8964 5181 HOH HOH R . 
SM 39 HOH 53   8965 5357 HOH HOH R . 
SM 39 HOH 54   8966 5386 HOH HOH R . 
SM 39 HOH 55   8967 5471 HOH HOH R . 
SM 39 HOH 56   8968 5591 HOH HOH R . 
SM 39 HOH 57   8969 5684 HOH HOH R . 
SM 39 HOH 58   8970 5766 HOH HOH R . 
SM 39 HOH 59   8971 5814 HOH HOH R . 
SM 39 HOH 60   8972 5996 HOH HOH R . 
SM 39 HOH 61   8973 6038 HOH HOH R . 
SM 39 HOH 62   8974 6041 HOH HOH R . 
SM 39 HOH 63   8975 6263 HOH HOH R . 
SM 39 HOH 64   8976 6346 HOH HOH R . 
SM 39 HOH 65   8977 6372 HOH HOH R . 
SM 39 HOH 66   8978 6439 HOH HOH R . 
SM 39 HOH 67   8979 6478 HOH HOH R . 
SM 39 HOH 68   8980 6558 HOH HOH R . 
SM 39 HOH 69   8981 6616 HOH HOH R . 
SM 39 HOH 70   8982 6618 HOH HOH R . 
SM 39 HOH 71   8983 6628 HOH HOH R . 
SM 39 HOH 72   8984 6682 HOH HOH R . 
SM 39 HOH 73   8985 6683 HOH HOH R . 
SM 39 HOH 74   8986 6756 HOH HOH R . 
SM 39 HOH 75   8987 6779 HOH HOH R . 
SM 39 HOH 76   8988 7029 HOH HOH R . 
SM 39 HOH 77   8989 7181 HOH HOH R . 
SM 39 HOH 78   8990 7234 HOH HOH R . 
SM 39 HOH 79   8991 7274 HOH HOH R . 
SM 39 HOH 80   8992 7375 HOH HOH R . 
SM 39 HOH 81   8993 7396 HOH HOH R . 
SM 39 HOH 82   8994 7413 HOH HOH R . 
SM 39 HOH 83   8995 7535 HOH HOH R . 
SM 39 HOH 84   8996 7555 HOH HOH R . 
SM 39 HOH 85   8997 7630 HOH HOH R . 
SM 39 HOH 86   8998 7631 HOH HOH R . 
SM 39 HOH 87   8999 7785 HOH HOH R . 
TM 39 HOH 1    8962 4    HOH HOH S . 
TM 39 HOH 2    8963 86   HOH HOH S . 
TM 39 HOH 3    8964 157  HOH HOH S . 
TM 39 HOH 4    8965 924  HOH HOH S . 
TM 39 HOH 5    8966 1168 HOH HOH S . 
TM 39 HOH 6    8967 1504 HOH HOH S . 
TM 39 HOH 7    8968 1758 HOH HOH S . 
TM 39 HOH 8    8969 1910 HOH HOH S . 
TM 39 HOH 9    8970 2190 HOH HOH S . 
TM 39 HOH 10   8971 2334 HOH HOH S . 
TM 39 HOH 11   8972 2485 HOH HOH S . 
TM 39 HOH 12   8973 2519 HOH HOH S . 
TM 39 HOH 13   8974 2625 HOH HOH S . 
TM 39 HOH 14   8975 2672 HOH HOH S . 
TM 39 HOH 15   8976 2901 HOH HOH S . 
TM 39 HOH 16   8977 3146 HOH HOH S . 
TM 39 HOH 17   8978 3228 HOH HOH S . 
TM 39 HOH 18   8979 3243 HOH HOH S . 
TM 39 HOH 19   8980 3563 HOH HOH S . 
TM 39 HOH 20   8981 3566 HOH HOH S . 
TM 39 HOH 21   8982 3649 HOH HOH S . 
TM 39 HOH 22   8983 4472 HOH HOH S . 
TM 39 HOH 23   8984 4527 HOH HOH S . 
TM 39 HOH 24   8985 4895 HOH HOH S . 
TM 39 HOH 25   8986 6511 HOH HOH S . 
TM 39 HOH 26   8987 6594 HOH HOH S . 
TM 39 HOH 27   8988 6771 HOH HOH S . 
TM 39 HOH 28   8989 6969 HOH HOH S . 
TM 39 HOH 29   8990 7106 HOH HOH S . 
TM 39 HOH 30   8991 7263 HOH HOH S . 
TM 39 HOH 31   8992 7716 HOH HOH S . 
TM 39 HOH 32   8993 7764 HOH HOH S . 
UM 39 HOH 1    191  191  HOH HOH T . 
UM 39 HOH 2    772  772  HOH HOH T . 
UM 39 HOH 3    1124 1124 HOH HOH T . 
UM 39 HOH 4    2331 2331 HOH HOH T . 
UM 39 HOH 5    2510 2510 HOH HOH T . 
UM 39 HOH 6    2868 2868 HOH HOH T . 
UM 39 HOH 7    2876 2876 HOH HOH T . 
UM 39 HOH 8    2885 2885 HOH HOH T . 
UM 39 HOH 9    3035 3035 HOH HOH T . 
UM 39 HOH 10   3254 3254 HOH HOH T . 
UM 39 HOH 11   3784 3784 HOH HOH T . 
UM 39 HOH 12   3851 3851 HOH HOH T . 
UM 39 HOH 13   4052 4052 HOH HOH T . 
UM 39 HOH 14   4056 4056 HOH HOH T . 
UM 39 HOH 15   4403 4403 HOH HOH T . 
UM 39 HOH 16   4584 4584 HOH HOH T . 
UM 39 HOH 17   4606 4606 HOH HOH T . 
UM 39 HOH 18   4772 4772 HOH HOH T . 
UM 39 HOH 19   4913 4913 HOH HOH T . 
UM 39 HOH 20   5014 5014 HOH HOH T . 
UM 39 HOH 21   5058 5058 HOH HOH T . 
UM 39 HOH 22   5160 5160 HOH HOH T . 
UM 39 HOH 23   5241 5241 HOH HOH T . 
UM 39 HOH 24   5545 5545 HOH HOH T . 
UM 39 HOH 25   5837 5837 HOH HOH T . 
UM 39 HOH 26   6109 6109 HOH HOH T . 
UM 39 HOH 27   6163 6163 HOH HOH T . 
UM 39 HOH 28   6320 6320 HOH HOH T . 
UM 39 HOH 29   6384 6384 HOH HOH T . 
UM 39 HOH 30   6498 6498 HOH HOH T . 
UM 39 HOH 31   6519 6519 HOH HOH T . 
UM 39 HOH 32   6653 6653 HOH HOH T . 
UM 39 HOH 33   6703 6703 HOH HOH T . 
UM 39 HOH 34   6711 6711 HOH HOH T . 
UM 39 HOH 35   6905 6905 HOH HOH T . 
UM 39 HOH 36   7031 7031 HOH HOH T . 
UM 39 HOH 37   7276 7276 HOH HOH T . 
UM 39 HOH 38   7379 7379 HOH HOH T . 
UM 39 HOH 39   7462 7462 HOH HOH T . 
UM 39 HOH 40   7470 7470 HOH HOH T . 
UM 39 HOH 41   7653 7653 HOH HOH T . 
VM 39 HOH 1    151  151  HOH HOH U . 
VM 39 HOH 2    310  310  HOH HOH U . 
VM 39 HOH 3    408  408  HOH HOH U . 
VM 39 HOH 4    774  774  HOH HOH U . 
VM 39 HOH 5    1257 1257 HOH HOH U . 
VM 39 HOH 6    1703 1703 HOH HOH U . 
VM 39 HOH 7    1711 1711 HOH HOH U . 
VM 39 HOH 8    2453 2453 HOH HOH U . 
VM 39 HOH 9    3104 3104 HOH HOH U . 
VM 39 HOH 10   3194 3194 HOH HOH U . 
VM 39 HOH 11   3564 3564 HOH HOH U . 
VM 39 HOH 12   3805 3805 HOH HOH U . 
VM 39 HOH 13   4195 4195 HOH HOH U . 
VM 39 HOH 14   4381 4381 HOH HOH U . 
VM 39 HOH 15   4632 4632 HOH HOH U . 
VM 39 HOH 16   5334 5334 HOH HOH U . 
VM 39 HOH 17   5529 5529 HOH HOH U . 
VM 39 HOH 18   5600 5600 HOH HOH U . 
VM 39 HOH 19   6030 6030 HOH HOH U . 
VM 39 HOH 20   6067 6067 HOH HOH U . 
VM 39 HOH 21   6115 6115 HOH HOH U . 
VM 39 HOH 22   6215 6215 HOH HOH U . 
VM 39 HOH 23   6493 6493 HOH HOH U . 
VM 39 HOH 24   6532 6532 HOH HOH U . 
VM 39 HOH 25   6603 6603 HOH HOH U . 
VM 39 HOH 26   6621 6621 HOH HOH U . 
VM 39 HOH 27   6796 6796 HOH HOH U . 
VM 39 HOH 28   7131 7131 HOH HOH U . 
WM 39 HOH 1    341  341  HOH HOH V . 
WM 39 HOH 2    874  874  HOH HOH V . 
WM 39 HOH 3    1680 1680 HOH HOH V . 
WM 39 HOH 4    2271 2271 HOH HOH V . 
WM 39 HOH 5    2551 2551 HOH HOH V . 
WM 39 HOH 6    2682 2682 HOH HOH V . 
WM 39 HOH 7    2761 2761 HOH HOH V . 
WM 39 HOH 8    2786 2786 HOH HOH V . 
WM 39 HOH 9    2826 2826 HOH HOH V . 
WM 39 HOH 10   6622 6622 HOH HOH V . 
WM 39 HOH 11   7083 7083 HOH HOH V . 
WM 39 HOH 12   7247 7247 HOH HOH V . 
XM 39 HOH 1    321  321  HOH HOH W . 
XM 39 HOH 2    705  705  HOH HOH W . 
XM 39 HOH 3    768  768  HOH HOH W . 
XM 39 HOH 4    808  808  HOH HOH W . 
XM 39 HOH 5    914  914  HOH HOH W . 
XM 39 HOH 6    943  943  HOH HOH W . 
XM 39 HOH 7    978  978  HOH HOH W . 
XM 39 HOH 8    1099 1099 HOH HOH W . 
XM 39 HOH 9    1266 1266 HOH HOH W . 
XM 39 HOH 10   1436 1436 HOH HOH W . 
XM 39 HOH 11   1466 1466 HOH HOH W . 
XM 39 HOH 12   1675 1675 HOH HOH W . 
XM 39 HOH 13   1760 1760 HOH HOH W . 
XM 39 HOH 14   1990 1990 HOH HOH W . 
XM 39 HOH 15   2229 2229 HOH HOH W . 
XM 39 HOH 16   2359 2359 HOH HOH W . 
XM 39 HOH 17   2374 2374 HOH HOH W . 
XM 39 HOH 18   2497 2497 HOH HOH W . 
XM 39 HOH 19   2729 2729 HOH HOH W . 
XM 39 HOH 20   2749 2749 HOH HOH W . 
XM 39 HOH 21   2756 2756 HOH HOH W . 
XM 39 HOH 22   2935 2935 HOH HOH W . 
XM 39 HOH 23   3071 3071 HOH HOH W . 
XM 39 HOH 24   3312 3312 HOH HOH W . 
XM 39 HOH 25   3483 3483 HOH HOH W . 
XM 39 HOH 26   3520 3520 HOH HOH W . 
XM 39 HOH 27   3580 3580 HOH HOH W . 
XM 39 HOH 28   3583 3583 HOH HOH W . 
XM 39 HOH 29   3734 3734 HOH HOH W . 
XM 39 HOH 30   3741 3741 HOH HOH W . 
XM 39 HOH 31   3899 3899 HOH HOH W . 
XM 39 HOH 32   3920 3920 HOH HOH W . 
XM 39 HOH 33   4031 4031 HOH HOH W . 
XM 39 HOH 34   4203 4203 HOH HOH W . 
XM 39 HOH 35   4301 4301 HOH HOH W . 
XM 39 HOH 36   4471 4471 HOH HOH W . 
XM 39 HOH 37   4578 4578 HOH HOH W . 
XM 39 HOH 38   4681 4681 HOH HOH W . 
XM 39 HOH 39   4771 4771 HOH HOH W . 
XM 39 HOH 40   4859 4859 HOH HOH W . 
XM 39 HOH 41   4944 4944 HOH HOH W . 
XM 39 HOH 42   4971 4971 HOH HOH W . 
XM 39 HOH 43   5084 5084 HOH HOH W . 
XM 39 HOH 44   5093 5093 HOH HOH W . 
XM 39 HOH 45   5390 5390 HOH HOH W . 
XM 39 HOH 46   5420 5420 HOH HOH W . 
XM 39 HOH 47   5425 5425 HOH HOH W . 
XM 39 HOH 48   5458 5458 HOH HOH W . 
XM 39 HOH 49   5460 5460 HOH HOH W . 
XM 39 HOH 50   5640 5640 HOH HOH W . 
XM 39 HOH 51   5763 5763 HOH HOH W . 
XM 39 HOH 52   5817 5817 HOH HOH W . 
XM 39 HOH 53   5862 5862 HOH HOH W . 
XM 39 HOH 54   5904 5904 HOH HOH W . 
XM 39 HOH 55   5934 5934 HOH HOH W . 
XM 39 HOH 56   6015 6015 HOH HOH W . 
XM 39 HOH 57   6182 6182 HOH HOH W . 
XM 39 HOH 58   6373 6373 HOH HOH W . 
XM 39 HOH 59   6679 6679 HOH HOH W . 
XM 39 HOH 60   6690 6690 HOH HOH W . 
XM 39 HOH 61   6694 6694 HOH HOH W . 
XM 39 HOH 62   6784 6784 HOH HOH W . 
XM 39 HOH 63   6871 6871 HOH HOH W . 
XM 39 HOH 64   6877 6877 HOH HOH W . 
XM 39 HOH 65   7093 7093 HOH HOH W . 
XM 39 HOH 66   7539 7539 HOH HOH W . 
XM 39 HOH 67   7673 7673 HOH HOH W . 
XM 39 HOH 68   7874 7874 HOH HOH W . 
YM 39 HOH 1    1449 1449 HOH HOH X . 
YM 39 HOH 2    2171 2171 HOH HOH X . 
YM 39 HOH 3    2479 2479 HOH HOH X . 
YM 39 HOH 4    2645 2645 HOH HOH X . 
YM 39 HOH 5    2982 2982 HOH HOH X . 
YM 39 HOH 6    3348 3348 HOH HOH X . 
YM 39 HOH 7    3419 3419 HOH HOH X . 
YM 39 HOH 8    3820 3820 HOH HOH X . 
YM 39 HOH 9    3861 3861 HOH HOH X . 
YM 39 HOH 10   4132 4132 HOH HOH X . 
YM 39 HOH 11   4522 4522 HOH HOH X . 
YM 39 HOH 12   4862 4862 HOH HOH X . 
YM 39 HOH 13   5356 5356 HOH HOH X . 
YM 39 HOH 14   5564 5564 HOH HOH X . 
YM 39 HOH 15   5849 5849 HOH HOH X . 
YM 39 HOH 16   6177 6177 HOH HOH X . 
YM 39 HOH 17   6178 6178 HOH HOH X . 
YM 39 HOH 18   6179 6179 HOH HOH X . 
YM 39 HOH 19   6514 6514 HOH HOH X . 
YM 39 HOH 20   6590 6590 HOH HOH X . 
YM 39 HOH 21   6893 6893 HOH HOH X . 
YM 39 HOH 22   7020 7020 HOH HOH X . 
YM 39 HOH 23   7303 7303 HOH HOH X . 
YM 39 HOH 24   7542 7542 HOH HOH X . 
ZM 39 HOH 1    8821 59   HOH HOH Y . 
ZM 39 HOH 2    8822 100  HOH HOH Y . 
ZM 39 HOH 3    8823 148  HOH HOH Y . 
ZM 39 HOH 4    8824 163  HOH HOH Y . 
ZM 39 HOH 5    8825 239  HOH HOH Y . 
ZM 39 HOH 6    8826 301  HOH HOH Y . 
ZM 39 HOH 7    8827 398  HOH HOH Y . 
ZM 39 HOH 8    8828 651  HOH HOH Y . 
ZM 39 HOH 9    8829 845  HOH HOH Y . 
ZM 39 HOH 10   8830 865  HOH HOH Y . 
ZM 39 HOH 11   8831 960  HOH HOH Y . 
ZM 39 HOH 12   8832 1007 HOH HOH Y . 
ZM 39 HOH 13   8833 1118 HOH HOH Y . 
ZM 39 HOH 14   8834 1120 HOH HOH Y . 
ZM 39 HOH 15   8835 1240 HOH HOH Y . 
ZM 39 HOH 16   8836 1559 HOH HOH Y . 
ZM 39 HOH 17   8837 1597 HOH HOH Y . 
ZM 39 HOH 18   8838 1835 HOH HOH Y . 
ZM 39 HOH 19   8839 1969 HOH HOH Y . 
ZM 39 HOH 20   8840 2323 HOH HOH Y . 
ZM 39 HOH 21   8841 2361 HOH HOH Y . 
ZM 39 HOH 22   8842 2486 HOH HOH Y . 
ZM 39 HOH 23   8843 2632 HOH HOH Y . 
ZM 39 HOH 24   8844 2991 HOH HOH Y . 
ZM 39 HOH 25   8845 3013 HOH HOH Y . 
ZM 39 HOH 26   8846 3026 HOH HOH Y . 
ZM 39 HOH 27   8847 3088 HOH HOH Y . 
ZM 39 HOH 28   8848 3164 HOH HOH Y . 
ZM 39 HOH 29   8849 3299 HOH HOH Y . 
ZM 39 HOH 30   8850 3314 HOH HOH Y . 
ZM 39 HOH 31   8851 3363 HOH HOH Y . 
ZM 39 HOH 32   8852 3428 HOH HOH Y . 
ZM 39 HOH 33   8853 3456 HOH HOH Y . 
ZM 39 HOH 34   8854 3482 HOH HOH Y . 
ZM 39 HOH 35   8855 3573 HOH HOH Y . 
ZM 39 HOH 36   8856 3604 HOH HOH Y . 
ZM 39 HOH 37   8857 3806 HOH HOH Y . 
ZM 39 HOH 38   8858 3810 HOH HOH Y . 
ZM 39 HOH 39   8859 3892 HOH HOH Y . 
ZM 39 HOH 40   8860 3939 HOH HOH Y . 
ZM 39 HOH 41   8861 3947 HOH HOH Y . 
ZM 39 HOH 42   8862 4064 HOH HOH Y . 
ZM 39 HOH 43   8863 4140 HOH HOH Y . 
ZM 39 HOH 44   8864 4280 HOH HOH Y . 
ZM 39 HOH 45   8865 4317 HOH HOH Y . 
ZM 39 HOH 46   8866 4341 HOH HOH Y . 
ZM 39 HOH 47   8867 4368 HOH HOH Y . 
ZM 39 HOH 48   8868 4408 HOH HOH Y . 
ZM 39 HOH 49   8869 4524 HOH HOH Y . 
ZM 39 HOH 50   8870 4541 HOH HOH Y . 
ZM 39 HOH 51   8871 4547 HOH HOH Y . 
ZM 39 HOH 52   8872 4646 HOH HOH Y . 
ZM 39 HOH 53   8873 4879 HOH HOH Y . 
ZM 39 HOH 54   8874 4892 HOH HOH Y . 
ZM 39 HOH 55   8875 4909 HOH HOH Y . 
ZM 39 HOH 56   8876 5021 HOH HOH Y . 
ZM 39 HOH 57   8877 5056 HOH HOH Y . 
ZM 39 HOH 58   8878 5164 HOH HOH Y . 
ZM 39 HOH 59   8879 5256 HOH HOH Y . 
ZM 39 HOH 60   8880 5308 HOH HOH Y . 
ZM 39 HOH 61   8881 5499 HOH HOH Y . 
ZM 39 HOH 62   8882 5530 HOH HOH Y . 
ZM 39 HOH 63   8883 5648 HOH HOH Y . 
ZM 39 HOH 64   8884 5865 HOH HOH Y . 
ZM 39 HOH 65   8885 5888 HOH HOH Y . 
ZM 39 HOH 66   8886 5940 HOH HOH Y . 
ZM 39 HOH 67   8887 5981 HOH HOH Y . 
ZM 39 HOH 68   8888 6127 HOH HOH Y . 
ZM 39 HOH 69   8889 6139 HOH HOH Y . 
ZM 39 HOH 70   8890 6207 HOH HOH Y . 
ZM 39 HOH 71   8891 6247 HOH HOH Y . 
ZM 39 HOH 72   8892 6352 HOH HOH Y . 
ZM 39 HOH 73   8893 6357 HOH HOH Y . 
ZM 39 HOH 74   8894 6413 HOH HOH Y . 
ZM 39 HOH 75   8895 6479 HOH HOH Y . 
ZM 39 HOH 76   8896 6482 HOH HOH Y . 
ZM 39 HOH 77   8897 6553 HOH HOH Y . 
ZM 39 HOH 78   8898 6554 HOH HOH Y . 
ZM 39 HOH 79   8899 6564 HOH HOH Y . 
ZM 39 HOH 80   8900 6589 HOH HOH Y . 
ZM 39 HOH 81   8901 6613 HOH HOH Y . 
ZM 39 HOH 82   8902 6630 HOH HOH Y . 
ZM 39 HOH 83   8903 6749 HOH HOH Y . 
ZM 39 HOH 84   8904 6866 HOH HOH Y . 
ZM 39 HOH 85   8905 6881 HOH HOH Y . 
ZM 39 HOH 86   8906 6899 HOH HOH Y . 
ZM 39 HOH 87   8907 6958 HOH HOH Y . 
ZM 39 HOH 88   8908 7018 HOH HOH Y . 
ZM 39 HOH 89   8909 7163 HOH HOH Y . 
ZM 39 HOH 90   8910 7277 HOH HOH Y . 
ZM 39 HOH 91   8911 7376 HOH HOH Y . 
ZM 39 HOH 92   8912 7378 HOH HOH Y . 
ZM 39 HOH 93   8913 7444 HOH HOH Y . 
ZM 39 HOH 94   8914 7561 HOH HOH Y . 
ZM 39 HOH 95   8915 7863 HOH HOH Y . 
AN 39 HOH 1    8704 53   HOH HOH Z . 
AN 39 HOH 2    8705 395  HOH HOH Z . 
AN 39 HOH 3    8706 585  HOH HOH Z . 
AN 39 HOH 4    8707 2257 HOH HOH Z . 
AN 39 HOH 5    8708 2272 HOH HOH Z . 
AN 39 HOH 6    8709 2375 HOH HOH Z . 
AN 39 HOH 7    8710 2448 HOH HOH Z . 
AN 39 HOH 8    8711 2606 HOH HOH Z . 
AN 39 HOH 9    8712 2738 HOH HOH Z . 
AN 39 HOH 10   8713 2758 HOH HOH Z . 
AN 39 HOH 11   8714 3188 HOH HOH Z . 
AN 39 HOH 12   8715 3466 HOH HOH Z . 
AN 39 HOH 13   8716 3477 HOH HOH Z . 
AN 39 HOH 14   8717 3716 HOH HOH Z . 
AN 39 HOH 15   8718 4006 HOH HOH Z . 
AN 39 HOH 16   8719 4400 HOH HOH Z . 
AN 39 HOH 17   8720 4921 HOH HOH Z . 
AN 39 HOH 18   8721 5030 HOH HOH Z . 
AN 39 HOH 19   8722 5108 HOH HOH Z . 
AN 39 HOH 20   8723 5337 HOH HOH Z . 
AN 39 HOH 21   8724 5752 HOH HOH Z . 
AN 39 HOH 22   8725 5979 HOH HOH Z . 
AN 39 HOH 23   8726 6008 HOH HOH Z . 
AN 39 HOH 24   8727 6016 HOH HOH Z . 
AN 39 HOH 25   8728 6168 HOH HOH Z . 
AN 39 HOH 26   8729 6190 HOH HOH Z . 
AN 39 HOH 27   8730 6299 HOH HOH Z . 
AN 39 HOH 28   8731 6317 HOH HOH Z . 
AN 39 HOH 29   8732 7354 HOH HOH Z . 
AN 39 HOH 30   8733 7463 HOH HOH Z . 
AN 39 HOH 31   8734 7607 HOH HOH Z . 
AN 39 HOH 32   8735 7714 HOH HOH Z . 
BN 39 HOH 1    8953 28   HOH HOH 1 . 
BN 39 HOH 2    8954 122  HOH HOH 1 . 
BN 39 HOH 3    8955 246  HOH HOH 1 . 
BN 39 HOH 4    8956 275  HOH HOH 1 . 
BN 39 HOH 5    8957 354  HOH HOH 1 . 
BN 39 HOH 6    8958 370  HOH HOH 1 . 
BN 39 HOH 7    8959 440  HOH HOH 1 . 
BN 39 HOH 8    8960 513  HOH HOH 1 . 
BN 39 HOH 9    8961 586  HOH HOH 1 . 
BN 39 HOH 10   8962 639  HOH HOH 1 . 
BN 39 HOH 11   8963 840  HOH HOH 1 . 
BN 39 HOH 12   8964 902  HOH HOH 1 . 
BN 39 HOH 13   8965 933  HOH HOH 1 . 
BN 39 HOH 14   8966 988  HOH HOH 1 . 
BN 39 HOH 15   8967 1020 HOH HOH 1 . 
BN 39 HOH 16   8968 1243 HOH HOH 1 . 
BN 39 HOH 17   8969 1309 HOH HOH 1 . 
BN 39 HOH 18   8970 1314 HOH HOH 1 . 
BN 39 HOH 19   8971 1422 HOH HOH 1 . 
BN 39 HOH 20   8972 1803 HOH HOH 1 . 
BN 39 HOH 21   8973 1838 HOH HOH 1 . 
BN 39 HOH 22   8974 2086 HOH HOH 1 . 
BN 39 HOH 23   8975 2417 HOH HOH 1 . 
BN 39 HOH 24   8976 2545 HOH HOH 1 . 
BN 39 HOH 25   8977 2846 HOH HOH 1 . 
BN 39 HOH 26   8978 2852 HOH HOH 1 . 
BN 39 HOH 27   8979 2979 HOH HOH 1 . 
BN 39 HOH 28   8980 3205 HOH HOH 1 . 
BN 39 HOH 29   8981 3370 HOH HOH 1 . 
BN 39 HOH 30   8982 3416 HOH HOH 1 . 
BN 39 HOH 31   8983 3601 HOH HOH 1 . 
BN 39 HOH 32   8984 4039 HOH HOH 1 . 
BN 39 HOH 33   8985 4074 HOH HOH 1 . 
BN 39 HOH 34   8986 4200 HOH HOH 1 . 
BN 39 HOH 35   8987 4242 HOH HOH 1 . 
BN 39 HOH 36   8988 4514 HOH HOH 1 . 
BN 39 HOH 37   8989 4539 HOH HOH 1 . 
BN 39 HOH 38   8990 5026 HOH HOH 1 . 
BN 39 HOH 39   8991 5052 HOH HOH 1 . 
BN 39 HOH 40   8992 5055 HOH HOH 1 . 
BN 39 HOH 41   8993 5231 HOH HOH 1 . 
BN 39 HOH 42   8994 5279 HOH HOH 1 . 
BN 39 HOH 43   8995 5333 HOH HOH 1 . 
BN 39 HOH 44   8996 5389 HOH HOH 1 . 
BN 39 HOH 45   8997 5663 HOH HOH 1 . 
BN 39 HOH 46   8998 6146 HOH HOH 1 . 
BN 39 HOH 47   8999 6638 HOH HOH 1 . 
BN 39 HOH 48   9000 7145 HOH HOH 1 . 
BN 39 HOH 49   9001 7292 HOH HOH 1 . 
BN 39 HOH 50   9002 7770 HOH HOH 1 . 
CN 39 HOH 1    131  131  HOH HOH 2 . 
CN 39 HOH 2    352  352  HOH HOH 2 . 
CN 39 HOH 3    468  468  HOH HOH 2 . 
CN 39 HOH 4    710  710  HOH HOH 2 . 
CN 39 HOH 5    719  719  HOH HOH 2 . 
CN 39 HOH 6    1006 1006 HOH HOH 2 . 
CN 39 HOH 7    1094 1094 HOH HOH 2 . 
CN 39 HOH 8    1100 1100 HOH HOH 2 . 
CN 39 HOH 9    1413 1413 HOH HOH 2 . 
CN 39 HOH 10   1972 1972 HOH HOH 2 . 
CN 39 HOH 11   2555 2555 HOH HOH 2 . 
CN 39 HOH 12   2691 2691 HOH HOH 2 . 
CN 39 HOH 13   2697 2697 HOH HOH 2 . 
CN 39 HOH 14   2890 2890 HOH HOH 2 . 
CN 39 HOH 15   3012 3012 HOH HOH 2 . 
CN 39 HOH 16   3138 3138 HOH HOH 2 . 
CN 39 HOH 17   3143 3143 HOH HOH 2 . 
CN 39 HOH 18   3600 3600 HOH HOH 2 . 
CN 39 HOH 19   3614 3614 HOH HOH 2 . 
CN 39 HOH 20   3665 3665 HOH HOH 2 . 
CN 39 HOH 21   4135 4135 HOH HOH 2 . 
CN 39 HOH 22   4144 4144 HOH HOH 2 . 
CN 39 HOH 23   4202 4202 HOH HOH 2 . 
CN 39 HOH 24   4479 4479 HOH HOH 2 . 
CN 39 HOH 25   4575 4575 HOH HOH 2 . 
CN 39 HOH 26   4595 4595 HOH HOH 2 . 
CN 39 HOH 27   5203 5203 HOH HOH 2 . 
CN 39 HOH 28   5293 5293 HOH HOH 2 . 
CN 39 HOH 29   5416 5416 HOH HOH 2 . 
CN 39 HOH 30   5444 5444 HOH HOH 2 . 
CN 39 HOH 31   5616 5616 HOH HOH 2 . 
CN 39 HOH 32   5639 5639 HOH HOH 2 . 
CN 39 HOH 33   5747 5747 HOH HOH 2 . 
CN 39 HOH 34   5861 5861 HOH HOH 2 . 
CN 39 HOH 35   6289 6289 HOH HOH 2 . 
CN 39 HOH 36   6312 6312 HOH HOH 2 . 
CN 39 HOH 37   6391 6391 HOH HOH 2 . 
CN 39 HOH 38   6863 6863 HOH HOH 2 . 
CN 39 HOH 39   7177 7177 HOH HOH 2 . 
CN 39 HOH 40   7213 7213 HOH HOH 2 . 
CN 39 HOH 41   7225 7225 HOH HOH 2 . 
CN 39 HOH 42   7658 7658 HOH HOH 2 . 
CN 39 HOH 43   7692 7692 HOH HOH 2 . 
CN 39 HOH 44   7875 7875 HOH HOH 2 . 
DN 39 HOH 1    8933 72   HOH HOH 3 . 
DN 39 HOH 2    8934 536  HOH HOH 3 . 
DN 39 HOH 3    8935 538  HOH HOH 3 . 
DN 39 HOH 4    8936 636  HOH HOH 3 . 
DN 39 HOH 5    8937 895  HOH HOH 3 . 
DN 39 HOH 6    8938 1047 HOH HOH 3 . 
DN 39 HOH 7    8939 1069 HOH HOH 3 . 
DN 39 HOH 8    8940 1074 HOH HOH 3 . 
DN 39 HOH 9    8941 1141 HOH HOH 3 . 
DN 39 HOH 10   8942 1234 HOH HOH 3 . 
DN 39 HOH 11   8943 1324 HOH HOH 3 . 
DN 39 HOH 12   8944 1536 HOH HOH 3 . 
DN 39 HOH 13   8945 1589 HOH HOH 3 . 
DN 39 HOH 14   8946 1812 HOH HOH 3 . 
DN 39 HOH 15   8947 1898 HOH HOH 3 . 
DN 39 HOH 16   8948 1943 HOH HOH 3 . 
DN 39 HOH 17   8949 1993 HOH HOH 3 . 
DN 39 HOH 18   8950 2104 HOH HOH 3 . 
DN 39 HOH 19   8951 2317 HOH HOH 3 . 
DN 39 HOH 20   8952 2471 HOH HOH 3 . 
DN 39 HOH 21   8953 2491 HOH HOH 3 . 
DN 39 HOH 22   8954 2621 HOH HOH 3 . 
DN 39 HOH 23   8955 2916 HOH HOH 3 . 
DN 39 HOH 24   8956 2922 HOH HOH 3 . 
DN 39 HOH 25   8957 3045 HOH HOH 3 . 
DN 39 HOH 26   8958 3063 HOH HOH 3 . 
DN 39 HOH 27   8959 3106 HOH HOH 3 . 
DN 39 HOH 28   8960 3274 HOH HOH 3 . 
DN 39 HOH 29   8961 3465 HOH HOH 3 . 
DN 39 HOH 30   8962 3538 HOH HOH 3 . 
DN 39 HOH 31   8963 3597 HOH HOH 3 . 
DN 39 HOH 32   8964 3785 HOH HOH 3 . 
DN 39 HOH 33   8965 4189 HOH HOH 3 . 
DN 39 HOH 34   8966 4294 HOH HOH 3 . 
DN 39 HOH 35   8967 4450 HOH HOH 3 . 
DN 39 HOH 36   8968 4485 HOH HOH 3 . 
DN 39 HOH 37   8969 4642 HOH HOH 3 . 
DN 39 HOH 38   8970 4680 HOH HOH 3 . 
DN 39 HOH 39   8971 4797 HOH HOH 3 . 
DN 39 HOH 40   8972 4869 HOH HOH 3 . 
DN 39 HOH 41   8973 4985 HOH HOH 3 . 
DN 39 HOH 42   8974 5208 HOH HOH 3 . 
DN 39 HOH 43   8975 5212 HOH HOH 3 . 
DN 39 HOH 44   8976 5316 HOH HOH 3 . 
DN 39 HOH 45   8977 5318 HOH HOH 3 . 
DN 39 HOH 46   8978 5618 HOH HOH 3 . 
DN 39 HOH 47   8979 5737 HOH HOH 3 . 
DN 39 HOH 48   8980 5866 HOH HOH 3 . 
DN 39 HOH 49   8981 5885 HOH HOH 3 . 
DN 39 HOH 50   8982 6027 HOH HOH 3 . 
DN 39 HOH 51   8983 6150 HOH HOH 3 . 
DN 39 HOH 52   8984 6302 HOH HOH 3 . 
DN 39 HOH 53   8985 6359 HOH HOH 3 . 
DN 39 HOH 54   8986 6429 HOH HOH 3 . 
DN 39 HOH 55   8987 6741 HOH HOH 3 . 
DN 39 HOH 56   8988 6839 HOH HOH 3 . 
DN 39 HOH 57   8989 6937 HOH HOH 3 . 
DN 39 HOH 58   8990 6956 HOH HOH 3 . 
DN 39 HOH 59   8991 7084 HOH HOH 3 . 
DN 39 HOH 60   8992 7149 HOH HOH 3 . 
DN 39 HOH 61   8993 7151 HOH HOH 3 . 
DN 39 HOH 62   8994 7176 HOH HOH 3 . 
DN 39 HOH 63   8995 7236 HOH HOH 3 . 
DN 39 HOH 64   8996 7322 HOH HOH 3 . 
DN 39 HOH 65   8997 7370 HOH HOH 3 . 
DN 39 HOH 66   8998 7401 HOH HOH 3 . 
DN 39 HOH 67   8999 7465 HOH HOH 3 . 
DN 39 HOH 68   9000 7549 HOH HOH 3 . 
DN 39 HOH 69   9001 7572 HOH HOH 3 . 
DN 39 HOH 70   9002 7577 HOH HOH 3 . 
DN 39 HOH 71   9003 7697 HOH HOH 3 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 0 U 10   ? P   ? A U 10   P   
2  1 Y 1 0 U 10   ? OP1 ? A U 10   OP1 
3  1 Y 1 0 U 10   ? OP2 ? A U 10   OP2 
4  1 Y 1 0 A 128  ? P   ? A A 128  P   
5  1 Y 1 0 A 128  ? OP1 ? A A 128  OP1 
6  1 Y 1 0 A 128  ? OP2 ? A A 128  OP2 
7  1 Y 1 0 G 716  ? P   ? A G 716  P   
8  1 Y 1 0 G 716  ? OP1 ? A G 716  OP1 
9  1 Y 1 0 G 716  ? OP2 ? A G 716  OP2 
10 1 Y 1 0 C 999  ? P   ? A C 999  P   
11 1 Y 1 0 C 999  ? OP1 ? A C 999  OP1 
12 1 Y 1 0 C 999  ? OP2 ? A C 999  OP2 
13 1 Y 1 0 U 1561 ? P   ? A U 1561 P   
14 1 Y 1 0 U 1561 ? OP1 ? A U 1561 OP1 
15 1 Y 1 0 U 1561 ? OP2 ? A U 1561 OP2 
16 1 Y 1 0 U 1964 ? P   ? A U 1964 P   
17 1 Y 1 0 U 1964 ? OP1 ? A U 1964 OP1 
18 1 Y 1 0 U 1964 ? OP2 ? A U 1964 OP2 
19 1 Y 1 0 G 2237 ? P   ? A G 2237 P   
20 1 Y 1 0 G 2237 ? OP1 ? A G 2237 OP1 
21 1 Y 1 0 G 2237 ? OP2 ? A G 2237 OP2 
22 1 Y 1 0 G 2344 ? P   ? A G 2344 P   
23 1 Y 1 0 G 2344 ? OP1 ? A G 2344 OP1 
24 1 Y 1 0 G 2344 ? OP2 ? A G 2344 OP2 
25 1 Y 1 0 G 2667 ? P   ? A G 2667 P   
26 1 Y 1 0 G 2667 ? OP1 ? A G 2667 OP1 
27 1 Y 1 0 G 2667 ? OP2 ? A G 2667 OP2 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.0 ? 1 
HKL-2000  'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
CNS       phasing          .   ? 4 
# 
_cell.entry_id           1YHQ 
_cell.length_a           212.081 
_cell.length_b           298.910 
_cell.length_c           574.815 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1YHQ 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
_exptl.entry_id          1YHQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.1 
_exptl_crystal.density_percent_sol   60.0 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pdbx_details    
'PEG 6000, KCl, NH4Cl, MgCl2, Kacetate, pH 5.8, VAPOR DIFFUSION, SITTING DROP, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1  1 'PEG 6000' ? ? ? 
1 2  1 KCl        ? ? ? 
1 3  1 NH4Cl      ? ? ? 
1 4  1 MgCl2      ? ? ? 
1 5  1 Kacetate   ? ? ? 
1 6  1 H2O        ? ? ? 
1 7  2 'PEG 6000' ? ? ? 
1 8  2 KCl        ? ? ? 
1 9  2 NH4Cl      ? ? ? 
1 10 2 MgCl2      ? ? ? 
1 11 2 Kacetate   ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2004-10-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.10 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.10 
# 
_reflns.entry_id                     1YHQ 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.40 
_reflns.number_obs                   672764 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            0.062 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.6 
_reflns.B_iso_Wilson_estimate        41.9 
_reflns.pdbx_redundancy              4.8 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.49 
_reflns_shell.percent_possible_all   72.1 
_reflns_shell.Rmerge_I_obs           0.71 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.8 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      50400 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1YHQ 
_refine.ls_number_reflns_obs                     633741 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               359492.31 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.96 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    90.2 
_refine.ls_R_factor_obs                          0.19 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19 
_refine.ls_R_factor_R_free                       0.229 
_refine.ls_R_factor_R_free_error                 0.003 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 1.0 
_refine.ls_number_reflns_R_free                  6149 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               47.3 
_refine.aniso_B[1][1]                            -0.15 
_refine.aniso_B[2][2]                            3.74 
_refine.aniso_B[3][3]                            -3.59 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.336224 
_refine.solvent_model_param_bsol                 35.2122 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1YHQ 
_refine_analyze.Luzzati_coordinate_error_obs    0.29 
_refine_analyze.Luzzati_sigma_a_obs             0.40 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.36 
_refine_analyze.Luzzati_sigma_a_free            0.47 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        29377 
_refine_hist.pdbx_number_atoms_nucleic_acid   61619 
_refine_hist.pdbx_number_atoms_ligand         357 
_refine_hist.number_atoms_solvent             7763 
_refine_hist.number_atoms_total               99116 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        29.96 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.005 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.0   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      15.4  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.35  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.22  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.08  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.64  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.39  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.40 
_refine_ls_shell.d_res_low                        2.55 
_refine_ls_shell.number_reflns_R_work             73885 
_refine_ls_shell.R_factor_R_work                  0.341 
_refine_ls_shell.percent_reflns_obs               64.0 
_refine_ls_shell.R_factor_R_free                  0.383 
_refine_ls_shell.R_factor_R_free_error            0.015 
_refine_ls_shell.percent_reflns_R_free            0.9 
_refine_ls_shell.number_reflns_R_free             687 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM     PROTEIN.TOP             'X-RAY DIFFRACTION' 
2 RNA_RIBO_MODNTS.PARAM RNA_RIBO_MODNTS_DRUGS.T 'X-RAY DIFFRACTION' 
3 ION.PARAM             ION.TOP                 'X-RAY DIFFRACTION' 
4 WATER_REP.PARAM       WATER.TOP               'X-RAY DIFFRACTION' 
5 QUC.PA                QUC.TO                  'X-RAY DIFFRACTION' 
# 
_database_PDB_matrix.entry_id          1YHQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1YHQ 
_struct.title                     
'Crystal Structure Of Azithromycin Bound To The G2099A Mutant 50S Ribosomal Subunit Of Haloarcula Marismortui' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1YHQ 
_struct_keywords.pdbx_keywords   RIBOSOME 
_struct_keywords.text            'azithromycin, antibiotic complexes, mutated 50S subunits, RIBOSOME' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 16 ? 
Q  N N 17 ? 
R  N N 18 ? 
S  N N 19 ? 
T  N N 20 ? 
U  N N 21 ? 
V  N N 22 ? 
W  N N 23 ? 
X  N N 24 ? 
Y  N N 25 ? 
Z  N N 26 ? 
AA N N 27 ? 
BA N N 28 ? 
CA N N 29 ? 
DA N N 30 ? 
EA N N 31 ? 
FA N N 32 ? 
GA N N 33 ? 
HA N N 33 ? 
IA N N 33 ? 
JA N N 33 ? 
KA N N 33 ? 
LA N N 33 ? 
MA N N 33 ? 
NA N N 33 ? 
OA N N 33 ? 
PA N N 33 ? 
QA N N 33 ? 
RA N N 33 ? 
SA N N 33 ? 
TA N N 33 ? 
UA N N 33 ? 
VA N N 33 ? 
WA N N 33 ? 
XA N N 33 ? 
YA N N 33 ? 
ZA N N 33 ? 
AB N N 33 ? 
BB N N 33 ? 
CB N N 33 ? 
DB N N 33 ? 
EB N N 33 ? 
FB N N 33 ? 
GB N N 33 ? 
HB N N 33 ? 
IB N N 33 ? 
JB N N 33 ? 
KB N N 33 ? 
LB N N 33 ? 
MB N N 33 ? 
NB N N 33 ? 
OB N N 33 ? 
PB N N 33 ? 
QB N N 33 ? 
RB N N 33 ? 
SB N N 33 ? 
TB N N 33 ? 
UB N N 33 ? 
VB N N 33 ? 
WB N N 33 ? 
XB N N 33 ? 
YB N N 33 ? 
ZB N N 33 ? 
AC N N 33 ? 
BC N N 33 ? 
CC N N 33 ? 
DC N N 33 ? 
EC N N 33 ? 
FC N N 33 ? 
GC N N 33 ? 
HC N N 33 ? 
IC N N 33 ? 
JC N N 33 ? 
KC N N 33 ? 
LC N N 33 ? 
MC N N 33 ? 
NC N N 33 ? 
OC N N 33 ? 
PC N N 33 ? 
QC N N 33 ? 
RC N N 33 ? 
SC N N 33 ? 
TC N N 33 ? 
UC N N 33 ? 
VC N N 33 ? 
WC N N 33 ? 
XC N N 33 ? 
YC N N 33 ? 
ZC N N 33 ? 
AD N N 33 ? 
BD N N 33 ? 
CD N N 33 ? 
DD N N 33 ? 
ED N N 33 ? 
FD N N 33 ? 
GD N N 33 ? 
HD N N 33 ? 
ID N N 33 ? 
JD N N 33 ? 
KD N N 33 ? 
LD N N 33 ? 
MD N N 33 ? 
ND N N 33 ? 
OD N N 34 ? 
PD N N 34 ? 
QD N N 35 ? 
RD N N 35 ? 
SD N N 35 ? 
TD N N 35 ? 
UD N N 35 ? 
VD N N 35 ? 
WD N N 35 ? 
XD N N 35 ? 
YD N N 35 ? 
ZD N N 35 ? 
AE N N 35 ? 
BE N N 35 ? 
CE N N 35 ? 
DE N N 35 ? 
EE N N 35 ? 
FE N N 35 ? 
GE N N 35 ? 
HE N N 35 ? 
IE N N 35 ? 
JE N N 35 ? 
KE N N 35 ? 
LE N N 35 ? 
ME N N 35 ? 
NE N N 35 ? 
OE N N 35 ? 
PE N N 35 ? 
QE N N 35 ? 
RE N N 35 ? 
SE N N 35 ? 
TE N N 35 ? 
UE N N 35 ? 
VE N N 35 ? 
WE N N 35 ? 
XE N N 35 ? 
YE N N 35 ? 
ZE N N 35 ? 
AF N N 35 ? 
BF N N 35 ? 
CF N N 35 ? 
DF N N 35 ? 
EF N N 35 ? 
FF N N 35 ? 
GF N N 35 ? 
HF N N 35 ? 
IF N N 35 ? 
JF N N 35 ? 
KF N N 35 ? 
LF N N 35 ? 
MF N N 35 ? 
NF N N 35 ? 
OF N N 35 ? 
PF N N 35 ? 
QF N N 35 ? 
RF N N 35 ? 
SF N N 35 ? 
TF N N 35 ? 
UF N N 35 ? 
VF N N 35 ? 
WF N N 35 ? 
XF N N 35 ? 
YF N N 35 ? 
ZF N N 35 ? 
AG N N 35 ? 
BG N N 35 ? 
CG N N 35 ? 
DG N N 36 ? 
EG N N 36 ? 
FG N N 36 ? 
GG N N 36 ? 
HG N N 36 ? 
IG N N 36 ? 
JG N N 36 ? 
KG N N 36 ? 
LG N N 36 ? 
MG N N 36 ? 
NG N N 37 ? 
OG N N 37 ? 
PG N N 37 ? 
QG N N 37 ? 
RG N N 37 ? 
SG N N 37 ? 
TG N N 37 ? 
UG N N 37 ? 
VG N N 37 ? 
WG N N 37 ? 
XG N N 37 ? 
YG N N 37 ? 
ZG N N 37 ? 
AH N N 37 ? 
BH N N 37 ? 
CH N N 37 ? 
DH N N 37 ? 
EH N N 37 ? 
FH N N 37 ? 
GH N N 37 ? 
HH N N 37 ? 
IH N N 37 ? 
JH N N 37 ? 
KH N N 37 ? 
LH N N 37 ? 
MH N N 37 ? 
NH N N 37 ? 
OH N N 37 ? 
PH N N 37 ? 
QH N N 37 ? 
RH N N 37 ? 
SH N N 37 ? 
TH N N 37 ? 
UH N N 37 ? 
VH N N 37 ? 
WH N N 37 ? 
XH N N 37 ? 
YH N N 37 ? 
ZH N N 37 ? 
AI N N 37 ? 
BI N N 37 ? 
CI N N 37 ? 
DI N N 37 ? 
EI N N 37 ? 
FI N N 37 ? 
GI N N 37 ? 
HI N N 37 ? 
II N N 37 ? 
JI N N 37 ? 
KI N N 37 ? 
LI N N 37 ? 
MI N N 37 ? 
NI N N 37 ? 
OI N N 37 ? 
PI N N 37 ? 
QI N N 37 ? 
RI N N 37 ? 
SI N N 37 ? 
TI N N 37 ? 
UI N N 37 ? 
VI N N 37 ? 
WI N N 37 ? 
XI N N 37 ? 
YI N N 37 ? 
ZI N N 37 ? 
AJ N N 37 ? 
BJ N N 37 ? 
CJ N N 37 ? 
DJ N N 37 ? 
EJ N N 37 ? 
FJ N N 37 ? 
GJ N N 37 ? 
HJ N N 37 ? 
IJ N N 37 ? 
JJ N N 37 ? 
KJ N N 37 ? 
LJ N N 37 ? 
MJ N N 37 ? 
NJ N N 37 ? 
OJ N N 37 ? 
PJ N N 37 ? 
QJ N N 37 ? 
RJ N N 37 ? 
SJ N N 37 ? 
TJ N N 37 ? 
UJ N N 37 ? 
VJ N N 37 ? 
WJ N N 37 ? 
XJ N N 37 ? 
YJ N N 37 ? 
ZJ N N 37 ? 
AK N N 37 ? 
BK N N 37 ? 
CK N N 37 ? 
DK N N 33 ? 
EK N N 35 ? 
FK N N 35 ? 
GK N N 37 ? 
HK N N 37 ? 
IK N N 33 ? 
JK N N 33 ? 
KK N N 36 ? 
LK N N 37 ? 
MK N N 37 ? 
NK N N 37 ? 
OK N N 33 ? 
PK N N 36 ? 
QK N N 37 ? 
RK N N 37 ? 
SK N N 35 ? 
TK N N 37 ? 
UK N N 35 ? 
VK N N 37 ? 
WK N N 35 ? 
XK N N 36 ? 
YK N N 36 ? 
ZK N N 36 ? 
AL N N 33 ? 
BL N N 36 ? 
CL N N 35 ? 
DL N N 36 ? 
EL N N 36 ? 
FL N N 38 ? 
GL N N 36 ? 
HL N N 35 ? 
IL N N 35 ? 
JL N N 35 ? 
KL N N 36 ? 
LL N N 37 ? 
ML N N 35 ? 
NL N N 37 ? 
OL N N 33 ? 
PL N N 38 ? 
QL N N 33 ? 
RL N N 36 ? 
SL N N 38 ? 
TL N N 38 ? 
UL N N 37 ? 
VL N N 37 ? 
WL N N 38 ? 
XL N N 36 ? 
YL N N 37 ? 
ZL N N 39 ? 
AM N N 39 ? 
BM N N 39 ? 
CM N N 39 ? 
DM N N 39 ? 
EM N N 39 ? 
FM N N 39 ? 
GM N N 39 ? 
HM N N 39 ? 
IM N N 39 ? 
JM N N 39 ? 
KM N N 39 ? 
LM N N 39 ? 
MM N N 39 ? 
NM N N 39 ? 
OM N N 39 ? 
PM N N 39 ? 
QM N N 39 ? 
RM N N 39 ? 
SM N N 39 ? 
TM N N 39 ? 
UM N N 39 ? 
VM N N 39 ? 
WM N N 39 ? 
XM N N 39 ? 
YM N N 39 ? 
ZM N N 39 ? 
AN N N 39 ? 
BN N N 39 ? 
CN N N 39 ? 
DN N N 39 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1  GB  AY596297   55229667 1  
;GUUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCUGUGGGGA
GCCGCACGGAGGCGAAGAACCACAGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGA
ACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAACGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCC
AAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUUCACGAAGUCUCUUGGAAUAG
AGCGUGAUACAGGGUGACAACCCCGUACUGAAGACCAGUACGCUGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCC
CUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGC
UGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUU
GACGAAUGACCGAGACGCGAGUCUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAG
GGAGUGUGUCUGUAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCG
AGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCG
UGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCC
CAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCG
ACCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCUGUUUGACGCGGGGA
UUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGU
GUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAA
CAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUA
CUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGCAGGGGCGAGAGCUCCUGUGGACCGAUUAGUGACGAAAAUC
CUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCU
GAGGGUUAGCCGGUCCUAAGUCUCACCGCAACUCGACUGAGACGAAAUGGGAAACAGGUUAAUAUUCCUGUGCCAUCAUG
CAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCCGGGCAUUCGCCCGGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUG
GCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUGAUGUCCGUACC
GAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAG
UCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAA
CAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUAC
AAGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCG
GCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGG
AGACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUA
GGUAGGAGUCGUUACAGAGGUACCCGCGCUAGCGGGCCACCCAGACAACAGUGAAAUACUACCCGUCGGUGACUGCGACU
CUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCU
AUGGUCAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUGACUUGACAGUGUUCUUCCCAACGAGG
AACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAG
GGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCC
CGUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGU
CGGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCAC
UGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAA
ACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAA
CGAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCA
;
0    ? 
2  GB  AF034619   3377778  2  
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCAGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAAUCCGGUUCGCCGCCACC
;
5581 ? 
3  UNP RL2_HALMA  P20276   3  
;MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDE
LQVGVDAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVV
GGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE

;
0    ? 
4  GB  YP_136234  55378384 4  
;MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPM
RAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKP
DVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPND
QPRLDPEVRYVSNESNQG
;
1    ? 
5  UNP RL4_HALMA  P12735   5  
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
1    ? 
6  UNP RL5_HALMA  P14124   6  
;MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEM
AEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNP
ADAVAFIESTYDVEVSE
;
0    ? 
7  UNP RL6_HALMA  P14135   7  
;MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
WEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDV
RVFQDGVYITRKPNRGDA
;
0    ? 
8  UNP RL7A_HALMA P12743   8  
;MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQ
QDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
;
0    ? 
9  UNP RLA0_HALMA P15825   9  
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
1    ? 
10 GB  AAV47175   55231756 10 
;MSDKPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKEL
GEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKI
TPSCRIKVERGEELLIA
;
1    ? 
11 GB  P14122     132647   11 
;MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAG
FETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEA
QA
;
1    ? 
12 UNP RL13_HALMA P29198   12 
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
1    ? 
13 UNP RL14_HALMA P22450   13 
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
1    ? 
14 UNP RL15_HALMA P12737   14 
;MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAAD
DVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDA
DADEE
;
0    ? 
15 GB  AAV46920   55231501 15 
;MARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKA
GRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRV
FRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKGK
;
1    ? 
16 UNP RL18_HALMA P14123   16 
;MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMP
SAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLY
SGDFDAADLPEHFDELRETLLDGDIEL
;
0    ? 
17 UNP R18E_HALMA P12733   17 
;MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAV
DFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
0    ? 
18 UNP RL19_HALMA P14119   18 
;MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGS
RKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
0    ? 
19 UNP RL21_HALMA P12734   19 
;MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGG
KEKTIIVTAAHLRRQE
;
0    ? 
20 UNP RL22_HALMA P10970   20 
;MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGR
YPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
0    ? 
21 UNP RL23_HALMA P12732   21 
;MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVAS
RIGVF
;
0    ? 
22 UNP RL24_HALMA P10972   22 
;MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTL
EKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
0    ? 
23 UNP R24E_HALMA P14116   23 PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA 1    ? 
24 UNP RL29_HALMA P10971   24 MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE 1    ? 
25 UNP RL30_HALMA P14121   25 
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
1    ? 
26 UNP RL31_HALMA P18138   26 
;MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEE
EGEAIVEAETAE
;
0    ? 
27 UNP RL32_HALMA P12736   27 
;MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAE
VEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKG
KGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVS
E
;
0    ? 
28 GB  AAV46581   55231162 28 
;SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRSIRAALSE
DEE
;
34   ? 
29 UNP RL37_HALMA P32410   29 MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 0    ? 
30 UNP RL39_HALMA P22452   30 MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE 0    ? 
31 UNP RL44_HALMA P32411   31 
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
1    ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  1YHQ 0 1 ? 2922 ? 55229667 0    ? 2921 ? 1  2922 
2  2  1YHQ 9 1 ? 122  ? 3377778  5581 ? 5702 ? 1  122  
3  3  1YHQ A 1 ? 240  ? P20276   0    ? 239  ? 0  239  
4  4  1YHQ B 1 ? 338  ? 55378384 1    ? 338  ? 0  337  
5  5  1YHQ C 1 ? 246  ? P12735   1    ? 246  ? 1  246  
6  6  1YHQ D 1 ? 177  ? P14124   0    ? 176  ? 0  176  
7  7  1YHQ E 1 ? 178  ? P14135   0    ? 177  ? 0  177  
8  8  1YHQ F 1 ? 120  ? P12743   0    ? 119  ? 0  119  
9  9  1YHQ G 1 ? 348  ? P15825   1    ? 348  ? 1  348  
10 10 1YHQ H 1 ? 177  ? 55231756 1    ? 177  ? 1  177  
11 11 1YHQ I 1 ? 162  ? 132647   1    ? 162  ? 0  161  
12 12 1YHQ J 1 ? 145  ? P29198   1    ? 145  ? 1  145  
13 13 1YHQ K 1 ? 132  ? P22450   1    ? 132  ? 1  132  
14 14 1YHQ L 1 ? 165  ? P12737   0    ? 164  ? 0  164  
15 15 1YHQ M 1 ? 194  ? 55231501 2    ? 195  ? 1  194  
16 16 1YHQ N 1 ? 187  ? P14123   0    ? 186  ? 0  186  
17 17 1YHQ O 1 ? 116  ? P12733   0    ? 115  ? 0  115  
18 18 1YHQ P 1 ? 149  ? P14119   0    ? 148  ? 0  148  
19 19 1YHQ Q 1 ? 96   ? P12734   0    ? 95   ? 0  95   
20 20 1YHQ R 1 ? 155  ? P10970   0    ? 154  ? 0  154  
21 21 1YHQ S 1 ? 85   ? P12732   0    ? 84   ? 0  84   
22 22 1YHQ T 1 ? 120  ? P10972   0    ? 119  ? 0  119  
23 23 1YHQ U 1 ? 66   ? P14116   1    ? 66   ? 1  66   
24 24 1YHQ V 1 ? 71   ? P10971   1    ? 71   ? 0  70   
25 25 1YHQ W 1 ? 154  ? P14121   1    ? 154  ? 1  154  
26 26 1YHQ X 1 ? 92   ? P18138   0    ? 91   ? 0  91   
27 27 1YHQ Y 1 ? 241  ? P12736   0    ? 240  ? 0  240  
28 28 1YHQ Z 1 ? 83   ? 55231162 34   ? 116  ? 10 92   
29 29 1YHQ 1 1 ? 57   ? P32410   0    ? 56   ? 0  56   
30 30 1YHQ 2 1 ? 50   ? P22452   0    ? 49   ? 0  49   
31 31 1YHQ 3 1 ? 92   ? P32411   1    ? 92   ? 1  92   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  1YHQ 1MA 0 628  ? GB  55229667 A   627  'modified residue'    628  1 
1  1YHQ A   0 2099 ? GB  55229667 G   2098 'engineered mutation' 2099 2 
1  1YHQ OMU 0 2587 ? GB  55229667 U   2586 'modified residue'    2587 3 
1  1YHQ OMG 0 2588 ? GB  55229667 G   2587 'modified residue'    2588 4 
1  1YHQ UR3 0 2619 ? GB  55229667 U   2618 'modified residue'    2619 5 
1  1YHQ PSU 0 2621 ? GB  55229667 U   2620 'modified residue'    2621 6 
13 1YHQ LEU K 44   ? UNP P22450   HIS 44   conflict              44   7 
15 1YHQ GLU M 13   ? GB  55231501 LYS 14   conflict              13   8 
28 1YHQ ARG Z 1    ? GB  55231162 SER 34   conflict              10   9 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   31-meric 
_pdbx_struct_assembly.oligomeric_count     31 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      
;A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA,FA,GA,HA,IA,JA,KA,LA,MA,NA,OA,PA,QA,RA,SA,TA,UA,VA,WA,XA,YA,ZA,AB,BB,CB,DB,EB,FB,GB,HB,IB,JB,KB,LB,MB,NB,OB,PB,QB,RB,SB,TB,UB,VB,WB,XB,YB,ZB,AC,BC,CC,DC,EC,FC,GC,HC,IC,JC,KC,LC,MC,NC,OC,PC,QC,RC,SC,TC,UC,VC,WC,XC,YC,ZC,AD,BD,CD,DD,ED,FD,GD,HD,ID,JD,KD,LD,MD,ND,OD,PD,QD,RD,SD,TD,UD,VD,WD,XD,YD,ZD,AE,BE,CE,DE,EE,FE,GE,HE,IE,JE,KE,LE,ME,NE,OE,PE,QE,RE,SE,TE,UE,VE,WE,XE,YE,ZE,AF,BF,CF,DF,EF,FF,GF,HF,IF,JF,KF,LF,MF,NF,OF,PF,QF,RF,SF,TF,UF,VF,WF,XF,YF,ZF,AG,BG,CG,DG,EG,FG,GG,HG,IG,JG,KG,LG,MG,NG,OG,PG,QG,RG,SG,TG,UG,VG,WG,XG,YG,ZG,AH,BH,CH,DH,EH,FH,GH,HH,IH,JH,KH,LH,MH,NH,OH,PH,QH,RH,SH,TH,UH,VH,WH,XH,YH,ZH,AI,BI,CI,DI,EI,FI,GI,HI,II,JI,KI,LI,MI,NI,OI,PI,QI,RI,SI,TI,UI,VI,WI,XI,YI,ZI,AJ,BJ,CJ,DJ,EJ,FJ,GJ,HJ,IJ,JJ,KJ,LJ,MJ,NJ,OJ,PJ,QJ,RJ,SJ,TJ,UJ,VJ,WJ,XJ,YJ,ZJ,AK,BK,CK,DK,EK,FK,GK,HK,IK,JK,KK,LK,MK,NK,OK,PK,QK,RK,SK,TK,UK,VK,WK,XK,YK,ZK,AL,BL,CL,DL,EL,FL,GL,HL,IL,JL,KL,LL,ML,NL,OL,PL,QL,RL,SL,TL,UL,VL,WL,XL,YL,ZL,AM,BM,CM,DM,EM,FM,GM,HM,IM,JM,KM,LM,MM,NM,OM,PM,QM,RM,SM,TM,UM,VM,WM,XM,YM,ZM,AN,BN,CN,DN
;
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ILE C  5   ? ARG C  12  ? ILE A 4   ARG A 11  1 ? 8  
HELX_P HELX_P2   2   GLY C  13  ? ARG C  18  ? GLY A 12  ARG A 17  5 ? 6  
HELX_P HELX_P3   3   PRO C  20  ? TYR C  24  ? PRO A 19  TYR A 23  5 ? 5  
HELX_P HELX_P4   4   ALA C  98  ? ILE C  100 ? ALA A 97  ILE A 99  5 ? 3  
HELX_P HELX_P5   5   GLY C  164 ? LYS C  168 ? GLY A 163 LYS A 167 5 ? 5  
HELX_P HELX_P6   6   LYS C  172 ? LYS C  181 ? LYS A 171 LYS A 180 1 ? 10 
HELX_P HELX_P7   7   ARG C  191 ? MET C  195 ? ARG A 190 MET A 194 5 ? 5  
HELX_P HELX_P8   8   ASN C  196 ? HIS C  200 ? ASN A 195 HIS A 199 5 ? 5  
HELX_P HELX_P9   9   GLU D  109 ? THR D  113 ? GLU B 108 THR B 112 5 ? 5  
HELX_P HELX_P10  10  ASP D  121 ? GLY D  136 ? ASP B 120 GLY B 135 1 ? 16 
HELX_P HELX_P11  11  VAL D  148 ? VAL D  152 ? VAL B 147 VAL B 151 5 ? 5  
HELX_P HELX_P12  12  SER D  171 ? GLY D  186 ? SER B 170 GLY B 185 1 ? 16 
HELX_P HELX_P13  13  ALA D  190 ? PHE D  195 ? ALA B 189 PHE B 194 1 ? 6  
HELX_P HELX_P14  14  GLY D  214 ? GLY D  220 ? GLY B 213 GLY B 219 1 ? 7  
HELX_P HELX_P15  15  LYS D  225 ? GLN D  231 ? LYS B 224 GLN B 230 5 ? 7  
HELX_P HELX_P16  16  PRO E  19  ? THR E  24  ? PRO C 19  THR C 24  5 ? 6  
HELX_P HELX_P17  17  ARG E  27  ? ARG E  42  ? ARG C 27  ARG C 42  1 ? 16 
HELX_P HELX_P18  18  ASN E  103 ? THR E  118 ? ASN C 103 THR C 118 1 ? 16 
HELX_P HELX_P19  19  ASP E  120 ? GLY E  128 ? ASP C 120 GLY C 128 1 ? 9  
HELX_P HELX_P20  20  ASP E  142 ? LEU E  147 ? ASP C 142 LEU C 147 5 ? 6  
HELX_P HELX_P21  21  LYS E  149 ? LEU E  160 ? LYS C 149 LEU C 160 1 ? 12 
HELX_P HELX_P22  22  HIS E  163 ? ALA E  169 ? HIS C 163 ALA C 169 1 ? 7  
HELX_P HELX_P23  23  GLY E  177 ? GLY E  183 ? GLY C 177 GLY C 183 5 ? 7  
HELX_P HELX_P24  24  SER E  201 ? ASN E  206 ? SER C 201 ASN C 206 1 ? 6  
HELX_P HELX_P25  25  ASN E  219 ? ALA E  224 ? ASN C 219 ALA C 224 1 ? 6  
HELX_P HELX_P26  26  PRO E  225 ? ALA E  228 ? PRO C 225 ALA C 228 5 ? 4  
HELX_P HELX_P27  27  GLU E  237 ? ALA E  244 ? GLU C 237 ALA C 244 1 ? 8  
HELX_P HELX_P28  28  ALA F  38  ? GLY F  47  ? ALA D 37  GLY D 46  1 ? 10 
HELX_P HELX_P29  29  ASP F  78  ? LEU F  89  ? ASP D 77  LEU D 88  1 ? 12 
HELX_P HELX_P30  30  PRO F  90  ? ALA F  92  ? PRO D 89  ALA D 91  5 ? 3  
HELX_P HELX_P31  31  GLY F  139 ? LYS F  144 ? GLY D 138 LYS D 143 5 ? 6  
HELX_P HELX_P32  32  PRO F  153 ? ARG F  157 ? PRO D 152 ARG D 156 5 ? 5  
HELX_P HELX_P33  33  ASN F  159 ? SER F  169 ? ASN D 158 SER D 168 1 ? 11 
HELX_P HELX_P34  34  ASN G  56  ? THR G  78  ? ASN E 55  THR E 77  1 ? 23 
HELX_P HELX_P35  35  ASN G  107 ? GLU G  111 ? ASN E 106 GLU E 110 5 ? 5  
HELX_P HELX_P36  36  ASP G  138 ? LEU G  152 ? ASP E 137 LEU E 151 1 ? 15 
HELX_P HELX_P37  37  PRO H  10  ? THR H  27  ? PRO F 9   THR F 26  1 ? 18 
HELX_P HELX_P38  38  GLY H  33  ? GLY H  44  ? GLY F 32  GLY F 43  1 ? 12 
HELX_P HELX_P39  39  GLU H  58  ? HIS H  63  ? GLU F 57  HIS F 62  1 ? 6  
HELX_P HELX_P40  40  HIS H  63  ? GLU H  70  ? HIS F 62  GLU F 69  1 ? 8  
HELX_P HELX_P41  41  GLN H  80  ? ALA H  88  ? GLN F 79  ALA F 87  1 ? 9  
HELX_P HELX_P42  42  ALA H  105 ? ARG H  120 ? ALA F 104 ARG F 119 1 ? 16 
HELX_P HELX_P43  43  PRO I  13  ? SER I  29  ? PRO G 13  SER G 29  1 ? 17 
HELX_P HELX_P44  44  ARG I  63  ? ASP I  72  ? ARG G 63  ASP G 72  1 ? 10 
HELX_P HELX_P45  45  PRO J  5   ? TYR J  9   ? PRO H 5   TYR H 9   5 ? 5  
HELX_P HELX_P46  46  HIS J  62  ? GLY J  81  ? HIS H 62  GLY H 81  1 ? 20 
HELX_P HELX_P47  47  ASN J  142 ? GLU J  144 ? ASN H 142 GLU H 144 5 ? 3  
HELX_P HELX_P48  48  ASP J  145 ? TYR J  157 ? ASP H 145 TYR H 157 1 ? 13 
HELX_P HELX_P49  49  PRO K  70  ? ALA K  79  ? PRO I 69  ALA I 78  1 ? 10 
HELX_P HELX_P50  50  SER K  97  ? LYS K  108 ? SER I 96  LYS I 107 1 ? 12 
HELX_P HELX_P51  51  ASP K  116 ? VAL K  125 ? ASP I 115 VAL I 124 1 ? 10 
HELX_P HELX_P52  52  ILE L  18  ? ASP L  32  ? ILE J 18  ASP J 32  1 ? 15 
HELX_P HELX_P53  53  ASN L  40  ? ARG L  43  ? ASN J 40  ARG J 43  5 ? 4  
HELX_P HELX_P54  54  ARG L  49  ? ILE L  63  ? ARG J 49  ILE J 63  1 ? 15 
HELX_P HELX_P55  55  ARG L  74  ? GLY L  85  ? ARG J 74  GLY J 85  1 ? 12 
HELX_P HELX_P56  56  LYS L  91  ? SER L  100 ? LYS J 91  SER J 100 1 ? 10 
HELX_P HELX_P57  57  LEU L  132 ? GLY L  140 ? LEU J 132 GLY J 140 1 ? 9  
HELX_P HELX_P58  58  ARG M  115 ? PHE M  121 ? ARG K 115 PHE K 121 1 ? 7  
HELX_P HELX_P59  59  PHE M  121 ? SER M  126 ? PHE K 121 SER K 126 1 ? 6  
HELX_P HELX_P60  60  LYS N  4   ? GLN N  8   ? LYS L 3   GLN L 7   5 ? 5  
HELX_P HELX_P61  61  GLY N  24  ? GLY N  29  ? GLY L 23  GLY L 28  5 ? 6  
HELX_P HELX_P62  62  PRO N  55  ? GLN N  59  ? PRO L 54  GLN L 58  5 ? 5  
HELX_P HELX_P63  63  VAL N  67  ? ASN N  73  ? VAL L 66  ASN L 72  1 ? 7  
HELX_P HELX_P64  64  ARG N  95  ? VAL N  97  ? ARG L 94  VAL L 96  5 ? 3  
HELX_P HELX_P65  65  SER N  127 ? ALA N  137 ? SER L 126 ALA L 136 1 ? 11 
HELX_P HELX_P66  66  ALA O  4   ? TRP O  12  ? ALA M 4   TRP M 12  1 ? 9  
HELX_P HELX_P67  67  ASP O  17  ? ARG O  32  ? ASP M 17  ARG M 32  1 ? 16 
HELX_P HELX_P68  68  ARG O  45  ? GLY O  53  ? ARG M 45  GLY M 53  1 ? 9  
HELX_P HELX_P69  69  ARG O  82  ? GLN O  86  ? ARG M 82  GLN M 86  5 ? 5  
HELX_P HELX_P70  70  ASP O  96  ? PHE O  109 ? ASP M 96  PHE M 109 1 ? 14 
HELX_P HELX_P71  71  HIS O  138 ? ASN O  143 ? HIS M 138 ASN M 143 1 ? 6  
HELX_P HELX_P72  72  LEU O  147 ? ALA O  156 ? LEU M 147 ALA M 156 5 ? 10 
HELX_P HELX_P73  73  ASP O  157 ? GLY O  162 ? ASP M 157 GLY M 162 5 ? 6  
HELX_P HELX_P74  74  THR O  164 ? ARG O  171 ? THR M 164 ARG M 171 1 ? 8  
HELX_P HELX_P75  75  MET P  11  ? GLU P  16  ? MET N 10  GLU N 15  1 ? 6  
HELX_P HELX_P76  76  ASP P  20  ? LYS P  29  ? ASP N 19  LYS N 28  1 ? 10 
HELX_P HELX_P77  77  SER P  65  ? GLY P  71  ? SER N 64  GLY N 70  5 ? 7  
HELX_P HELX_P78  78  ASN P  78  ? ALA P  96  ? ASN N 77  ALA N 95  1 ? 19 
HELX_P HELX_P79  79  SER P  114 ? ALA P  126 ? SER N 113 ALA N 125 1 ? 13 
HELX_P HELX_P80  80  ASN P  133 ? LEU P  137 ? ASN N 132 LEU N 136 5 ? 5  
HELX_P HELX_P81  81  ASP P  139 ? GLY P  145 ? ASP N 138 GLY N 144 1 ? 7  
HELX_P HELX_P82  82  GLY P  145 ? GLN P  154 ? GLY N 144 GLN N 153 1 ? 10 
HELX_P HELX_P83  83  LEU P  169 ? ASP P  182 ? LEU N 168 ASP N 181 1 ? 14 
HELX_P HELX_P84  84  ASN Q  5   ? SER Q  22  ? ASN O 4   SER O 21  1 ? 18 
HELX_P HELX_P85  85  ALA Q  25  ? LYS Q  36  ? ALA O 24  LYS O 35  1 ? 12 
HELX_P HELX_P86  86  PRO Q  37  ? HIS Q  41  ? PRO O 36  HIS O 40  5 ? 5  
HELX_P HELX_P87  87  LEU Q  46  ? ALA Q  53  ? LEU O 45  ALA O 52  1 ? 8  
HELX_P HELX_P88  88  SER Q  83  ? GLY Q  94  ? SER O 82  GLY O 93  1 ? 12 
HELX_P HELX_P89  89  LEU Q  99  ? ASN Q  106 ? LEU O 98  ASN O 105 1 ? 8  
HELX_P HELX_P90  90  LEU R  4   ? LEU R  15  ? LEU P 3   LEU P 14  1 ? 12 
HELX_P HELX_P91  91  GLY R  18  ? ASN R  20  ? GLY P 17  ASN P 19  5 ? 3  
HELX_P HELX_P92  92  ARG R  28  ? ALA R  35  ? ARG P 27  ALA P 34  1 ? 8  
HELX_P HELX_P93  93  THR R  37  ? GLU R  47  ? THR P 36  GLU P 46  1 ? 11 
HELX_P HELX_P94  94  ARG R  60  ? TYR R  72  ? ARG P 59  TYR P 71  1 ? 13 
HELX_P HELX_P95  95  GLY R  77  ? ARG R  81  ? GLY P 76  ARG P 80  5 ? 5  
HELX_P HELX_P96  96  LYS R  84  ? GLN R  89  ? LYS P 83  GLN P 88  1 ? 6  
HELX_P HELX_P97  97  ASN R  90  ? GLU R  112 ? ASN P 89  GLU P 111 1 ? 23 
HELX_P HELX_P98  98  SER R  116 ? GLY R  129 ? SER P 115 GLY P 128 1 ? 14 
HELX_P HELX_P99  99  SER R  134 ? ASP R  143 ? SER P 133 ASP P 142 1 ? 10 
HELX_P HELX_P100 100 LYS S  18  ? ARG S  22  ? LYS Q 17  ARG Q 21  5 ? 5  
HELX_P HELX_P101 101 PRO S  27  ? VAL S  31  ? PRO Q 26  VAL Q 30  5 ? 5  
HELX_P HELX_P102 102 HIS S  54  ? ASP S  58  ? HIS Q 53  ASP Q 57  5 ? 5  
HELX_P HELX_P103 103 THR S  88  ? ALA S  90  ? THR Q 87  ALA Q 89  5 ? 3  
HELX_P HELX_P104 104 ASP T  10  ? ASP T  12  ? ASP R 9   ASP R 11  5 ? 3  
HELX_P HELX_P105 105 SER T  25  ? LYS T  37  ? SER R 24  LYS R 36  1 ? 13 
HELX_P HELX_P106 106 THR T  40  ? GLU T  53  ? THR R 39  GLU R 52  1 ? 14 
HELX_P HELX_P107 107 PRO T  82  ? GLN T  103 ? PRO R 81  GLN R 102 1 ? 22 
HELX_P HELX_P108 108 ASP T  106 ? MET T  110 ? ASP R 105 MET R 109 5 ? 5  
HELX_P HELX_P109 109 THR U  12  ? ASN U  23  ? THR S 11  ASN S 22  1 ? 12 
HELX_P HELX_P110 110 SER U  34  ? ASP U  47  ? SER S 33  ASP S 46  1 ? 14 
HELX_P HELX_P111 111 ASP U  74  ? ARG U  81  ? ASP S 73  ARG S 80  1 ? 8  
HELX_P HELX_P112 112 GLN V  4   ? ARG V  14  ? GLN T 3   ARG T 13  1 ? 11 
HELX_P HELX_P113 113 PRO V  16  ? GLN V  23  ? PRO T 15  GLN T 22  5 ? 8  
HELX_P HELX_P114 114 SER V  29  ? GLY V  37  ? SER T 28  GLY T 36  1 ? 9  
HELX_P HELX_P115 115 ASP V  93  ? SER V  95  ? ASP T 92  SER T 94  5 ? 3  
HELX_P HELX_P116 116 ASP V  106 ? SER V  115 ? ASP T 105 SER T 114 1 ? 10 
HELX_P HELX_P117 117 SER W  33  ? LEU W  42  ? SER U 33  LEU U 42  1 ? 10 
HELX_P HELX_P118 118 GLU W  45  ? LEU W  49  ? GLU U 45  LEU U 49  5 ? 5  
HELX_P HELX_P119 119 HIS X  5   ? MET X  12  ? HIS V 4   MET V 11  1 ? 8  
HELX_P HELX_P120 120 THR X  13  ? ALA X  37  ? THR V 12  ALA V 36  1 ? 25 
HELX_P HELX_P121 121 PRO X  44  ? GLU X  64  ? PRO V 43  GLU V 63  1 ? 21 
HELX_P HELX_P122 122 HIS Y  14  ? LEU Y  24  ? HIS W 14  LEU W 24  1 ? 11 
HELX_P HELX_P123 123 THR Y  38  ? ASN Y  49  ? THR W 38  ASN W 49  1 ? 12 
HELX_P HELX_P124 124 SER Y  58  ? ALA Y  70  ? SER W 58  ALA W 70  1 ? 13 
HELX_P HELX_P125 125 ASP Y  80  ? THR Y  88  ? ASP W 80  THR W 88  1 ? 9  
HELX_P HELX_P126 126 ASP Y  92  ? SER Y  102 ? ASP W 92  SER W 102 1 ? 11 
HELX_P HELX_P127 127 PRO Y  131 ? GLY Y  135 ? PRO W 131 GLY W 135 5 ? 5  
HELX_P HELX_P128 128 ASP Y  142 ? MET Y  153 ? ASP W 142 MET W 153 1 ? 12 
HELX_P HELX_P129 129 ARG Z  16  ? GLU Z  21  ? ARG X 15  GLU X 20  5 ? 6  
HELX_P HELX_P130 130 PRO Z  22  ? HIS Z  24  ? PRO X 21  HIS X 23  5 ? 3  
HELX_P HELX_P131 131 LYS Z  25  ? PHE Z  42  ? LYS X 24  PHE X 41  1 ? 18 
HELX_P HELX_P132 132 ASP Z  45  ? ASP Z  47  ? ASP X 44  ASP X 46  5 ? 3  
HELX_P HELX_P133 133 ASP Z  52  ? ALA Z  61  ? ASP X 51  ALA X 60  1 ? 10 
HELX_P HELX_P134 134 SER AA 111 ? GLY AA 125 ? SER Y 110 GLY Y 124 1 ? 15 
HELX_P HELX_P135 135 GLU AA 166 ? ARG AA 170 ? GLU Y 165 ARG Y 169 5 ? 5  
HELX_P HELX_P136 136 ASN AA 190 ? GLU AA 195 ? ASN Y 189 GLU Y 194 5 ? 6  
HELX_P HELX_P137 137 GLY AA 211 ? ALA AA 225 ? GLY Y 210 ALA Y 224 1 ? 15 
HELX_P HELX_P138 138 ARG BA 1   ? GLY BA 6   ? ARG Z 10  GLY Z 15  5 ? 6  
HELX_P HELX_P139 139 GLY BA 10  ? GLU BA 26  ? GLY Z 19  GLU Z 35  1 ? 17 
HELX_P HELX_P140 140 GLY BA 66  ? SER BA 73  ? GLY Z 75  SER Z 82  1 ? 8  
HELX_P HELX_P141 141 GLY CA 5   ? GLY CA 10  ? GLY 1 4   GLY 1 9   1 ? 6  
HELX_P HELX_P142 142 TYR CA 49  ? SER CA 53  ? TYR 1 48  SER 1 52  5 ? 5  
HELX_P HELX_P143 143 SER DA 5   ? ASN DA 19  ? SER 2 4   ASN 2 18  1 ? 15 
HELX_P HELX_P144 144 PRO DA 23  ? THR DA 30  ? PRO 2 22  THR 2 29  1 ? 8  
HELX_P HELX_P145 145 LYS EA 34  ? SER EA 44  ? LYS 3 34  SER 3 44  1 ? 11 
HELX_P HELX_P146 146 ASP EA 49  ? LYS EA 54  ? ASP 3 49  LYS 3 54  5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1    covale both ? A  G   627  "O3'" ? ? ? 1_555 A  1MA 628  P     ? ? 0 G   627  0 1MA 628  1_555 ? ? ? ? ? ? ? 1.609 ? ? 
covale2    covale both ? A  1MA 628  "O3'" ? ? ? 1_555 A  A   629  P     ? ? 0 1MA 628  0 A   629  1_555 ? ? ? ? ? ? ? 1.605 ? ? 
covale3    covale both ? A  U   2586 "O3'" ? ? ? 1_555 A  OMU 2587 P     ? ? 0 U   2586 0 OMU 2587 1_555 ? ? ? ? ? ? ? 1.607 ? ? 
covale4    covale both ? A  OMU 2587 "O3'" ? ? ? 1_555 A  OMG 2588 P     ? ? 0 OMU 2587 0 OMG 2588 1_555 ? ? ? ? ? ? ? 1.608 ? ? 
covale5    covale both ? A  OMG 2588 "O3'" ? ? ? 1_555 A  U   2589 P     ? ? 0 OMG 2588 0 U   2589 1_555 ? ? ? ? ? ? ? 1.613 ? ? 
covale6    covale both ? A  G   2618 "O3'" ? ? ? 1_555 A  UR3 2619 P     ? ? 0 G   2618 0 UR3 2619 1_555 ? ? ? ? ? ? ? 1.604 ? ? 
covale7    covale both ? A  UR3 2619 "O3'" ? ? ? 1_555 A  U   2620 P     ? ? 0 UR3 2619 0 U   2620 1_555 ? ? ? ? ? ? ? 1.602 ? ? 
covale8    covale both ? A  U   2620 "O3'" ? ? ? 1_555 A  PSU 2621 P     ? ? 0 U   2620 0 PSU 2621 1_555 ? ? ? ? ? ? ? 1.602 ? ? 
covale9    covale both ? A  PSU 2621 "O3'" ? ? ? 1_555 A  A   2622 P     ? ? 0 PSU 2621 0 A   2622 1_555 ? ? ? ? ? ? ? 1.611 ? ? 
metalc1    metalc ?    ? A  G   28   OP1   ? ? ? 1_555 NA MG  .    MG    ? ? 0 G   28   0 MG  8008 1_555 ? ? ? ? ? ? ? 2.117 ? ? 
metalc2    metalc ?    ? A  C   40   "O2'" ? ? ? 1_555 UD NA  .    NA    ? ? 0 C   40   0 NA  8506 1_555 ? ? ? ? ? ? ? 2.744 ? ? 
metalc3    metalc ?    ? A  C   40   O2    ? ? ? 1_555 UD NA  .    NA    ? ? 0 C   40   0 NA  8506 1_555 ? ? ? ? ? ? ? 2.676 ? ? 
metalc4    metalc ?    ? A  G   56   O6    ? ? ? 1_555 KE NA  .    NA    ? ? 0 G   56   0 NA  8524 1_555 ? ? ? ? ? ? ? 2.728 ? ? 
metalc5    metalc ?    ? A  A   59   N3    ? ? ? 1_555 KE NA  .    NA    ? ? 0 A   59   0 NA  8524 1_555 ? ? ? ? ? ? ? 2.795 ? ? 
metalc6    metalc ?    ? A  G   61   N7    ? ? ? 1_555 KE NA  .    NA    ? ? 0 G   61   0 NA  8524 1_555 ? ? ? ? ? ? ? 2.893 ? ? 
metalc7    metalc ?    ? A  G   84   "O3'" ? ? ? 1_555 UH SR  .    SR    ? ? 0 G   84   0 SR  8939 1_555 ? ? ? ? ? ? ? 3.355 ? ? 
metalc8    metalc ?    ? A  C   85   OP1   ? ? ? 1_555 XG SR  .    SR    ? ? 0 C   85   0 SR  8911 1_555 ? ? ? ? ? ? ? 2.714 ? ? 
metalc9    metalc ?    ? A  C   85   OP1   ? ? ? 1_555 UH SR  .    SR    ? ? 0 C   85   0 SR  8939 1_555 ? ? ? ? ? ? ? 2.753 ? ? 
metalc10   metalc ?    ? A  A   86   OP2   ? ? ? 1_555 XG SR  .    SR    ? ? 0 A   86   0 SR  8911 1_555 ? ? ? ? ? ? ? 2.548 ? ? 
metalc11   metalc ?    ? A  C   87   OP1   ? ? ? 1_555 XG SR  .    SR    ? ? 0 C   87   0 SR  8911 1_555 ? ? ? ? ? ? ? 2.908 ? ? 
metalc12   metalc ?    ? A  U   108  O2    ? ? ? 1_555 LE NA  .    NA    ? ? 0 U   108  0 NA  8525 1_555 ? ? ? ? ? ? ? 2.723 ? ? 
metalc13   metalc ?    ? A  U   115  OP2   ? ? ? 1_555 IB MG  .    MG    ? ? 0 U   115  0 MG  8029 1_555 ? ? ? ? ? ? ? 1.945 ? ? 
metalc14   metalc ?    ? A  C   141  "O4'" ? ? ? 1_555 ME NA  .    NA    ? ? 0 C   141  0 NA  8526 1_555 ? ? ? ? ? ? ? 2.800 ? ? 
metalc15   metalc ?    ? A  C   141  O2    ? ? ? 1_555 ME NA  .    NA    ? ? 0 C   141  0 NA  8526 1_555 ? ? ? ? ? ? ? 2.767 ? ? 
metalc16   metalc ?    ? A  U   146  O4    ? ? ? 1_555 GE NA  .    NA    ? ? 0 U   146  0 NA  8520 1_555 ? ? ? ? ? ? ? 2.633 ? ? 
metalc17   metalc ?    ? A  G   147  OP1   ? ? ? 1_555 UG SR  .    SR    ? ? 0 G   147  0 SR  8908 1_555 ? ? ? ? ? ? ? 2.713 ? ? 
metalc18   metalc ?    ? A  C   162  OP1   ? ? ? 1_555 UB MG  .    MG    ? ? 0 C   162  0 MG  8041 1_555 ? ? ? ? ? ? ? 1.948 ? ? 
metalc19   metalc ?    ? A  C   162  OP2   ? ? ? 1_555 PD K   .    K     ? ? 0 C   162  0 K   8402 1_555 ? ? ? ? ? ? ? 3.204 ? ? 
metalc20   metalc ?    ? A  U   163  O4    ? ? ? 1_555 PD K   .    K     ? ? 0 U   163  0 K   8402 1_555 ? ? ? ? ? ? ? 2.984 ? ? 
metalc21   metalc ?    ? A  A   165  N7    ? ? ? 1_555 JC MG  .    MG    ? ? 0 A   165  0 MG  8061 1_555 ? ? ? ? ? ? ? 2.284 ? ? 
metalc22   metalc ?    ? A  A   165  OP2   ? ? ? 1_555 AE NA  .    NA    ? ? 0 A   165  0 NA  8513 1_555 ? ? ? ? ? ? ? 2.762 ? ? 
metalc23   metalc ?    ? A  A   166  OP1   ? ? ? 1_555 EC MG  .    MG    ? ? 0 A   166  0 MG  8055 1_555 ? ? ? ? ? ? ? 2.254 ? ? 
metalc24   metalc ?    ? A  A   166  "O3'" ? ? ? 1_555 AE NA  .    NA    ? ? 0 A   166  0 NA  8513 1_555 ? ? ? ? ? ? ? 2.560 ? ? 
metalc25   metalc ?    ? A  A   166  "O2'" ? ? ? 1_555 AE NA  .    NA    ? ? 0 A   166  0 NA  8513 1_555 ? ? ? ? ? ? ? 2.803 ? ? 
metalc26   metalc ?    ? A  A   167  OP1   ? ? ? 1_555 JC MG  .    MG    ? ? 0 A   167  0 MG  8061 1_555 ? ? ? ? ? ? ? 1.930 ? ? 
metalc27   metalc ?    ? A  A   167  OP1   ? ? ? 1_555 AE NA  .    NA    ? ? 0 A   167  0 NA  8513 1_555 ? ? ? ? ? ? ? 2.842 ? ? 
metalc28   metalc ?    ? A  C   168  OP2   ? ? ? 1_555 JC MG  .    MG    ? ? 0 C   168  0 MG  8061 1_555 ? ? ? ? ? ? ? 1.928 ? ? 
metalc29   metalc ?    ? A  U   170  O2    ? ? ? 1_555 NE NA  .    NA    ? ? 0 U   170  0 NA  8527 1_555 ? ? ? ? ? ? ? 2.813 ? ? 
metalc30   metalc ?    ? A  U   172  O4    ? ? ? 1_555 PD K   .    K     ? ? 0 U   172  0 K   8402 1_555 ? ? ? ? ? ? ? 2.921 ? ? 
metalc31   metalc ?    ? A  G   175  OP2   ? ? ? 1_555 ZB MG  .    MG    ? ? 0 G   175  0 MG  8047 1_555 ? ? ? ? ? ? ? 2.556 ? ? 
metalc32   metalc ?    ? A  G   182  "O3'" ? ? ? 1_555 UG SR  .    SR    ? ? 0 G   182  0 SR  8908 1_555 ? ? ? ? ? ? ? 3.396 ? ? 
metalc33   metalc ?    ? A  A   183  OP1   ? ? ? 1_555 UG SR  .    SR    ? ? 0 A   183  0 SR  8908 1_555 ? ? ? ? ? ? ? 2.550 ? ? 
metalc34   metalc ?    ? A  A   187  N1    ? ? ? 1_555 ID MG  .    MG    ? ? 0 A   187  0 MG  8088 1_555 ? ? ? ? ? ? ? 2.621 ? ? 
metalc35   metalc ?    ? A  G   196  OP1   ? ? ? 1_555 KB MG  .    MG    ? ? 0 G   196  0 MG  8031 1_555 ? ? ? ? ? ? ? 2.486 ? ? 
metalc36   metalc ?    ? A  G   196  N7    ? ? ? 1_555 UF NA  .    NA    ? ? 0 G   196  0 NA  8565 1_555 ? ? ? ? ? ? ? 2.859 ? ? 
metalc37   metalc ?    ? A  C   197  N3    ? ? ? 1_555 BG NA  .    NA    ? ? 0 C   197  0 NA  8573 1_555 ? ? ? ? ? ? ? 2.695 ? ? 
metalc38   metalc ?    ? A  C   218  "O2'" ? ? ? 1_555 NE NA  .    NA    ? ? 0 C   218  0 NA  8527 1_555 ? ? ? ? ? ? ? 2.716 ? ? 
metalc39   metalc ?    ? A  G   219  O6    ? ? ? 1_555 EC MG  .    MG    ? ? 0 G   219  0 MG  8055 1_555 ? ? ? ? ? ? ? 2.719 ? ? 
metalc40   metalc ?    ? A  A   227  "O2'" ? ? ? 1_555 KB MG  .    MG    ? ? 0 A   227  0 MG  8031 1_555 ? ? ? ? ? ? ? 2.627 ? ? 
metalc41   metalc ?    ? A  C   228  "O4'" ? ? ? 1_555 KB MG  .    MG    ? ? 0 C   228  0 MG  8031 1_555 ? ? ? ? ? ? ? 2.743 ? ? 
metalc42   metalc ?    ? A  C   235  O2    ? ? ? 1_555 SI SR  .    SR    ? ? 0 C   235  0 SR  8966 1_555 ? ? ? ? ? ? ? 2.369 ? ? 
metalc43   metalc ?    ? A  C   240  OP1   ? ? ? 1_555 ZA MG  .    MG    ? ? 0 C   240  0 MG  8020 1_555 ? ? ? ? ? ? ? 2.008 ? ? 
metalc44   metalc ?    ? A  G   269  O6    ? ? ? 1_555 ZA MG  .    MG    ? ? 0 G   269  0 MG  8020 1_555 ? ? ? ? ? ? ? 2.145 ? ? 
metalc45   metalc ?    ? A  U   308  O4    ? ? ? 1_555 WE NA  .    NA    ? ? 0 U   308  0 NA  8537 1_555 ? ? ? ? ? ? ? 2.781 ? ? 
metalc46   metalc ?    ? A  U   335  O2    ? ? ? 1_555 WE NA  .    NA    ? ? 0 U   335  0 NA  8537 1_555 ? ? ? ? ? ? ? 2.972 ? ? 
metalc47   metalc ?    ? A  C   342  O2    ? ? ? 1_555 WE NA  .    NA    ? ? 0 C   342  0 NA  8537 1_555 ? ? ? ? ? ? ? 2.861 ? ? 
metalc48   metalc ?    ? A  A   378  "O2'" ? ? ? 1_555 HJ SR  .    SR    ? ? 0 A   378  0 SR  8984 1_555 ? ? ? ? ? ? ? 3.103 ? ? 
metalc49   metalc ?    ? A  G   379  OP2   ? ? ? 1_555 HJ SR  .    SR    ? ? 0 G   379  0 SR  8984 1_555 ? ? ? ? ? ? ? 3.138 ? ? 
metalc50   metalc ?    ? A  G   379  N7    ? ? ? 1_555 HJ SR  .    SR    ? ? 0 G   379  0 SR  8984 1_555 ? ? ? ? ? ? ? 2.770 ? ? 
metalc51   metalc ?    ? A  G   387  O6    ? ? ? 1_555 OE NA  .    NA    ? ? 0 G   387  0 NA  8528 1_555 ? ? ? ? ? ? ? 2.568 ? ? 
metalc52   metalc ?    ? A  U   391  "O2'" ? ? ? 1_555 LF NA  .    NA    ? ? 0 U   391  0 NA  8556 1_555 ? ? ? ? ? ? ? 2.754 ? ? 
metalc53   metalc ?    ? A  U   391  O4    ? ? ? 1_555 GI SR  .    SR    ? ? 0 U   391  0 SR  8953 1_555 ? ? ? ? ? ? ? 2.754 ? ? 
metalc54   metalc ?    ? A  U   392  OP2   ? ? ? 1_555 JB MG  .    MG    ? ? 0 U   392  0 MG  8030 1_555 ? ? ? ? ? ? ? 2.447 ? ? 
metalc55   metalc ?    ? A  U   392  O4    ? ? ? 1_555 PF NA  .    NA    ? ? 0 U   392  0 NA  8560 1_555 ? ? ? ? ? ? ? 2.654 ? ? 
metalc56   metalc ?    ? A  A   395  OP1   ? ? ? 1_555 PF NA  .    NA    ? ? 0 A   395  0 NA  8560 1_555 ? ? ? ? ? ? ? 2.905 ? ? 
metalc57   metalc ?    ? A  U   402  O4    ? ? ? 1_555 OE NA  .    NA    ? ? 0 U   402  0 NA  8528 1_555 ? ? ? ? ? ? ? 2.891 ? ? 
metalc58   metalc ?    ? A  A   415  "O2'" ? ? ? 1_555 UF NA  .    NA    ? ? 0 A   415  0 NA  8565 1_555 ? ? ? ? ? ? ? 2.980 ? ? 
metalc59   metalc ?    ? A  A   429  OP2   ? ? ? 1_555 HJ SR  .    SR    ? ? 0 A   429  0 SR  8984 1_555 ? ? ? ? ? ? ? 2.633 ? ? 
metalc60   metalc ?    ? A  C   443  O2    ? ? ? 1_555 UD NA  .    NA    ? ? 0 C   443  0 NA  8506 1_555 ? ? ? ? ? ? ? 2.796 ? ? 
metalc61   metalc ?    ? A  A   453  "O3'" ? ? ? 1_555 GF NA  .    NA    ? ? 0 A   453  0 NA  8551 1_555 ? ? ? ? ? ? ? 2.984 ? ? 
metalc62   metalc ?    ? A  A   453  "O2'" ? ? ? 1_555 GF NA  .    NA    ? ? 0 A   453  0 NA  8551 1_555 ? ? ? ? ? ? ? 2.853 ? ? 
metalc63   metalc ?    ? A  U   454  OP2   ? ? ? 1_555 GF NA  .    NA    ? ? 0 U   454  0 NA  8551 1_555 ? ? ? ? ? ? ? 2.875 ? ? 
metalc64   metalc ?    ? A  U   454  OP2   ? ? ? 1_555 BH SR  .    SR    ? ? 0 U   454  0 SR  8917 1_555 ? ? ? ? ? ? ? 2.627 ? ? 
metalc65   metalc ?    ? A  G   456  O6    ? ? ? 1_555 JA MG  .    MG    ? ? 0 G   456  0 MG  8004 1_555 ? ? ? ? ? ? ? 2.134 ? ? 
metalc66   metalc ?    ? A  G   456  OP2   ? ? ? 1_555 RA MG  .    MG    ? ? 0 G   456  0 MG  8012 1_555 ? ? ? ? ? ? ? 1.981 ? ? 
metalc67   metalc ?    ? A  A   459  OP1   ? ? ? 1_555 JA MG  .    MG    ? ? 0 A   459  0 MG  8004 1_555 ? ? ? ? ? ? ? 1.834 ? ? 
metalc68   metalc ?    ? A  G   464  O6    ? ? ? 1_555 NF NA  .    NA    ? ? 0 G   464  0 NA  8558 1_555 ? ? ? ? ? ? ? 2.825 ? ? 
metalc69   metalc ?    ? A  G   471  O6    ? ? ? 1_555 GH SR  .    SR    ? ? 0 G   471  0 SR  8922 1_555 ? ? ? ? ? ? ? 2.569 ? ? 
metalc70   metalc ?    ? A  C   478  OP1   ? ? ? 1_555 GF NA  .    NA    ? ? 0 C   478  0 NA  8551 1_555 ? ? ? ? ? ? ? 2.964 ? ? 
metalc71   metalc ?    ? A  C   478  OP1   ? ? ? 1_555 BH SR  .    SR    ? ? 0 C   478  0 SR  8917 1_555 ? ? ? ? ? ? ? 2.407 ? ? 
metalc72   metalc ?    ? A  G   503  N7    ? ? ? 1_555 JH SR  .    SR    ? ? 0 G   503  0 SR  8925 1_555 ? ? ? ? ? ? ? 2.752 ? ? 
metalc73   metalc ?    ? A  G   503  O6    ? ? ? 1_555 JH SR  .    SR    ? ? 0 G   503  0 SR  8925 1_555 ? ? ? ? ? ? ? 2.950 ? ? 
metalc74   metalc ?    ? A  C   515  "O3'" ? ? ? 1_555 QC MG  .    MG    ? ? 0 C   515  0 MG  8068 1_555 ? ? ? ? ? ? ? 2.987 ? ? 
metalc75   metalc ?    ? A  A   516  OP1   ? ? ? 1_555 QC MG  .    MG    ? ? 0 A   516  0 MG  8068 1_555 ? ? ? ? ? ? ? 2.545 ? ? 
metalc76   metalc ?    ? A  A   516  "O5'" ? ? ? 1_555 QC MG  .    MG    ? ? 0 A   516  0 MG  8068 1_555 ? ? ? ? ? ? ? 3.053 ? ? 
metalc77   metalc ?    ? A  U   517  OP2   ? ? ? 1_555 QC MG  .    MG    ? ? 0 U   517  0 MG  8068 1_555 ? ? ? ? ? ? ? 2.359 ? ? 
metalc78   metalc ?    ? A  G   518  N7    ? ? ? 1_555 QC MG  .    MG    ? ? 0 G   518  0 MG  8068 1_555 ? ? ? ? ? ? ? 3.037 ? ? 
metalc79   metalc ?    ? A  A   532  OP1   ? ? ? 1_555 OH SR  .    SR    ? ? 0 A   532  0 SR  8933 1_555 ? ? ? ? ? ? ? 2.473 ? ? 
metalc80   metalc ?    ? A  U   533  OP1   ? ? ? 1_555 OH SR  .    SR    ? ? 0 U   533  0 SR  8933 1_555 ? ? ? ? ? ? ? 2.470 ? ? 
metalc81   metalc ?    ? A  G   545  O6    ? ? ? 1_555 MF NA  .    NA    ? ? 0 G   545  0 NA  8557 1_555 ? ? ? ? ? ? ? 2.652 ? ? 
metalc82   metalc ?    ? A  A   565  OP2   ? ? ? 1_555 WI SR  .    SR    ? ? 0 A   565  0 SR  8970 1_555 ? ? ? ? ? ? ? 3.168 ? ? 
metalc83   metalc ?    ? A  G   592  O6    ? ? ? 1_555 WI SR  .    SR    ? ? 0 G   592  0 SR  8970 1_555 ? ? ? ? ? ? ? 2.699 ? ? 
metalc84   metalc ?    ? A  G   622  O6    ? ? ? 1_555 QE NA  .    NA    ? ? 0 G   622  0 NA  8530 1_555 ? ? ? ? ? ? ? 2.937 ? ? 
metalc85   metalc ?    ? A  U   623  O4    ? ? ? 1_555 QE NA  .    NA    ? ? 0 U   623  0 NA  8530 1_555 ? ? ? ? ? ? ? 2.804 ? ? 
metalc86   metalc ?    ? A  U   623  "O2'" ? ? ? 1_555 YE NA  .    NA    ? ? 0 U   623  0 NA  8542 1_555 ? ? ? ? ? ? ? 2.980 ? ? 
metalc87   metalc ?    ? A  G   627  O6    ? ? ? 1_555 HA MG  .    MG    ? ? 0 G   627  0 MG  8002 1_555 ? ? ? ? ? ? ? 1.948 ? ? 
metalc88   metalc ?    ? A  A   630  "O2'" ? ? ? 1_555 SD NA  .    NA    ? ? 0 A   630  0 NA  8504 1_555 ? ? ? ? ? ? ? 2.718 ? ? 
metalc89   metalc ?    ? A  A   630  N3    ? ? ? 1_555 SD NA  .    NA    ? ? 0 A   630  0 NA  8504 1_555 ? ? ? ? ? ? ? 2.652 ? ? 
metalc90   metalc ?    ? A  A   631  "O2'" ? ? ? 1_555 SD NA  .    NA    ? ? 0 A   631  0 NA  8504 1_555 ? ? ? ? ? ? ? 2.820 ? ? 
metalc91   metalc ?    ? A  G   641  OP2   ? ? ? 1_555 SB MG  .    MG    ? ? 0 G   641  0 MG  8039 1_555 ? ? ? ? ? ? ? 2.161 ? ? 
metalc92   metalc ?    ? A  A   643  OP2   ? ? ? 1_555 QG SR  .    SR    ? ? 0 A   643  0 SR  8904 1_555 ? ? ? ? ? ? ? 2.804 ? ? 
metalc93   metalc ?    ? A  U   664  OP2   ? ? ? 1_555 ZG SR  .    SR    ? ? 0 U   664  0 SR  8915 1_555 ? ? ? ? ? ? ? 3.002 ? ? 
metalc94   metalc ?    ? A  G   681  "O3'" ? ? ? 1_555 VE NA  .    NA    ? ? 0 G   681  0 NA  8536 1_555 ? ? ? ? ? ? ? 2.972 ? ? 
metalc95   metalc ?    ? A  G   681  O6    ? ? ? 1_555 ZG SR  .    SR    ? ? 0 G   681  0 SR  8915 1_555 ? ? ? ? ? ? ? 2.815 ? ? 
metalc96   metalc ?    ? A  A   682  OP2   ? ? ? 1_555 JI SR  .    SR    ? ? 0 A   682  0 SR  8956 1_555 ? ? ? ? ? ? ? 2.402 ? ? 
metalc97   metalc ?    ? A  G   683  N7    ? ? ? 1_555 VE NA  .    NA    ? ? 0 G   683  0 NA  8536 1_555 ? ? ? ? ? ? ? 2.895 ? ? 
metalc98   metalc ?    ? A  G   683  O6    ? ? ? 1_555 VE NA  .    NA    ? ? 0 G   683  0 NA  8536 1_555 ? ? ? ? ? ? ? 2.620 ? ? 
metalc99   metalc ?    ? A  G   683  OP2   ? ? ? 1_555 JI SR  .    SR    ? ? 0 G   683  0 SR  8956 1_555 ? ? ? ? ? ? ? 2.500 ? ? 
metalc100  metalc ?    ? A  A   776  "O3'" ? ? ? 1_555 HE NA  .    NA    ? ? 0 A   776  0 NA  8521 1_555 ? ? ? ? ? ? ? 2.410 ? ? 
metalc101  metalc ?    ? A  A   776  "O2'" ? ? ? 1_555 HE NA  .    NA    ? ? 0 A   776  0 NA  8521 1_555 ? ? ? ? ? ? ? 2.556 ? ? 
metalc102  metalc ?    ? A  U   777  OP2   ? ? ? 1_555 DB MG  .    MG    ? ? 0 U   777  0 MG  8024 1_555 ? ? ? ? ? ? ? 2.258 ? ? 
metalc103  metalc ?    ? A  U   777  OP2   ? ? ? 1_555 PH SR  .    SR    ? ? 0 U   777  0 SR  8934 1_555 ? ? ? ? ? ? ? 2.529 ? ? 
metalc104  metalc ?    ? A  C   778  OP2   ? ? ? 1_555 DB MG  .    MG    ? ? 0 C   778  0 MG  8024 1_555 ? ? ? ? ? ? ? 1.998 ? ? 
metalc105  metalc ?    ? A  U   779  O4    ? ? ? 1_555 HE NA  .    NA    ? ? 0 U   779  0 NA  8521 1_555 ? ? ? ? ? ? ? 2.456 ? ? 
metalc106  metalc ?    ? A  A   791  N7    ? ? ? 1_555 TJ SR  .    SR    ? ? 0 A   791  0 SR  8997 1_555 ? ? ? ? ? ? ? 3.329 ? ? 
metalc107  metalc ?    ? A  U   815  O4    ? ? ? 1_555 OF NA  .    NA    ? ? 0 U   815  0 NA  8559 1_555 ? ? ? ? ? ? ? 2.679 ? ? 
metalc108  metalc ?    ? A  G   816  O6    ? ? ? 1_555 MB MG  .    MG    ? ? 0 G   816  0 MG  8033 1_555 ? ? ? ? ? ? ? 2.468 ? ? 
metalc109  metalc ?    ? A  G   817  O6    ? ? ? 1_555 MB MG  .    MG    ? ? 0 G   817  0 MG  8033 1_555 ? ? ? ? ? ? ? 2.567 ? ? 
metalc110  metalc ?    ? A  G   817  O6    ? ? ? 1_555 ED MG  .    MG    ? ? 0 G   817  0 MG  8083 1_555 ? ? ? ? ? ? ? 2.539 ? ? 
metalc111  metalc ?    ? A  U   821  OP2   ? ? ? 1_555 EI SR  .    SR    ? ? 0 U   821  0 SR  8949 1_555 ? ? ? ? ? ? ? 2.406 ? ? 
metalc112  metalc ?    ? A  C   822  OP2   ? ? ? 1_555 EI SR  .    SR    ? ? 0 C   822  0 SR  8949 1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc113  metalc ?    ? A  G   824  N7    ? ? ? 1_555 NG SR  .    SR    ? ? 0 G   824  0 SR  8901 1_555 ? ? ? ? ? ? ? 2.319 ? ? 
metalc114  metalc ?    ? A  G   834  OP2   ? ? ? 1_555 UJ SR  .    SR    ? ? 0 G   834  0 SR  8998 1_555 ? ? ? ? ? ? ? 2.946 ? ? 
metalc115  metalc ?    ? A  U   835  O2    ? ? ? 1_555 UJ SR  .    SR    ? ? 0 U   835  0 SR  8998 1_555 ? ? ? ? ? ? ? 2.993 ? ? 
metalc116  metalc ?    ? A  G   836  OP1   ? ? ? 1_555 OG SR  .    SR    ? ? 0 G   836  0 SR  8902 1_555 ? ? ? ? ? ? ? 2.195 ? ? 
metalc117  metalc ?    ? A  A   844  OP1   ? ? ? 1_555 QA MG  .    MG    ? ? 0 A   844  0 MG  8011 1_555 ? ? ? ? ? ? ? 1.843 ? ? 
metalc118  metalc ?    ? A  A   846  OP1   ? ? ? 1_555 QJ SR  .    SR    ? ? 0 A   846  0 SR  8994 1_555 ? ? ? ? ? ? ? 2.841 ? ? 
metalc119  metalc ?    ? A  G   854  OP1   ? ? ? 1_555 JE NA  .    NA    ? ? 0 G   854  0 NA  8523 1_555 ? ? ? ? ? ? ? 2.693 ? ? 
metalc120  metalc ?    ? A  G   854  N7    ? ? ? 1_555 NG SR  .    SR    ? ? 0 G   854  0 SR  8901 1_555 ? ? ? ? ? ? ? 2.336 ? ? 
metalc121  metalc ?    ? A  G   854  OP1   ? ? ? 1_555 EI SR  .    SR    ? ? 0 G   854  0 SR  8949 1_555 ? ? ? ? ? ? ? 2.276 ? ? 
metalc122  metalc ?    ? A  U   862  OP1   ? ? ? 1_555 UL SR  .    SR    ? ? 0 U   862  1 SR  8913 1_555 ? ? ? ? ? ? ? 2.695 ? ? 
metalc123  metalc ?    ? A  G   863  O6    ? ? ? 1_555 XC MG  .    MG    ? ? 0 G   863  0 MG  8076 1_555 ? ? ? ? ? ? ? 2.405 ? ? 
metalc124  metalc ?    ? A  U   864  O4    ? ? ? 1_555 XC MG  .    MG    ? ? 0 U   864  0 MG  8076 1_555 ? ? ? ? ? ? ? 2.563 ? ? 
metalc125  metalc ?    ? A  G   868  "O2'" ? ? ? 1_555 VF NA  .    NA    ? ? 0 G   868  0 NA  8566 1_555 ? ? ? ? ? ? ? 2.974 ? ? 
metalc126  metalc ?    ? A  A   876  OP2   ? ? ? 1_555 IA MG  .    MG    ? ? 0 A   876  0 MG  8003 1_555 ? ? ? ? ? ? ? 2.102 ? ? 
metalc127  metalc ?    ? A  G   877  OP2   ? ? ? 1_555 IA MG  .    MG    ? ? 0 G   877  0 MG  8003 1_555 ? ? ? ? ? ? ? 2.098 ? ? 
metalc128  metalc ?    ? A  G   877  OP1   ? ? ? 1_555 OA MG  .    MG    ? ? 0 G   877  0 MG  8009 1_555 ? ? ? ? ? ? ? 1.904 ? ? 
metalc129  metalc ?    ? A  G   887  OP2   ? ? ? 1_555 VF NA  .    NA    ? ? 0 G   887  0 NA  8566 1_555 ? ? ? ? ? ? ? 2.846 ? ? 
metalc130  metalc ?    ? A  C   893  O2    ? ? ? 1_555 SG SR  .    SR    ? ? 0 C   893  0 SR  8906 1_555 ? ? ? ? ? ? ? 2.578 ? ? 
metalc131  metalc ?    ? A  C   893  "O2'" ? ? ? 1_555 SG SR  .    SR    ? ? 0 C   893  0 SR  8906 1_555 ? ? ? ? ? ? ? 2.667 ? ? 
metalc132  metalc ?    ? A  C   896  "O2'" ? ? ? 1_555 BE NA  .    NA    ? ? 0 C   896  0 NA  8514 1_555 ? ? ? ? ? ? ? 2.955 ? ? 
metalc133  metalc ?    ? A  C   896  O2    ? ? ? 1_555 BE NA  .    NA    ? ? 0 C   896  0 NA  8514 1_555 ? ? ? ? ? ? ? 2.845 ? ? 
metalc134  metalc ?    ? A  A   897  "O4'" ? ? ? 1_555 BE NA  .    NA    ? ? 0 A   897  0 NA  8514 1_555 ? ? ? ? ? ? ? 2.950 ? ? 
metalc135  metalc ?    ? A  G   902  O6    ? ? ? 1_555 XF NA  .    NA    ? ? 0 G   902  0 NA  8568 1_555 ? ? ? ? ? ? ? 2.947 ? ? 
metalc136  metalc ?    ? A  U   903  OP1   ? ? ? 1_555 HD MG  .    MG    ? ? 0 U   903  0 MG  8087 1_555 ? ? ? ? ? ? ? 2.366 ? ? 
metalc137  metalc ?    ? A  U   903  O4    ? ? ? 1_555 XF NA  .    NA    ? ? 0 U   903  0 NA  8568 1_555 ? ? ? ? ? ? ? 2.879 ? ? 
metalc138  metalc ?    ? A  A   907  "O2'" ? ? ? 1_555 HC MG  .    MG    ? ? 0 A   907  0 MG  8059 1_555 ? ? ? ? ? ? ? 2.632 ? ? 
metalc139  metalc ?    ? A  A   907  N7    ? ? ? 1_555 YC MG  .    MG    ? ? 0 A   907  0 MG  8077 1_555 ? ? ? ? ? ? ? 2.558 ? ? 
metalc140  metalc ?    ? A  A   908  "O4'" ? ? ? 1_555 HC MG  .    MG    ? ? 0 A   908  0 MG  8059 1_555 ? ? ? ? ? ? ? 2.545 ? ? 
metalc141  metalc ?    ? A  A   914  "O3'" ? ? ? 1_555 XE NA  .    NA    ? ? 0 A   914  0 NA  8541 1_555 ? ? ? ? ? ? ? 2.559 ? ? 
metalc142  metalc ?    ? A  A   914  "O2'" ? ? ? 1_555 XE NA  .    NA    ? ? 0 A   914  0 NA  8541 1_555 ? ? ? ? ? ? ? 2.817 ? ? 
metalc143  metalc ?    ? A  C   915  OP2   ? ? ? 1_555 XE NA  .    NA    ? ? 0 C   915  0 NA  8541 1_555 ? ? ? ? ? ? ? 2.878 ? ? 
metalc144  metalc ?    ? A  G   918  OP1   ? ? ? 1_555 SC MG  .    MG    ? ? 0 G   918  0 MG  8070 1_555 ? ? ? ? ? ? ? 2.321 ? ? 
metalc145  metalc ?    ? A  U   919  OP1   ? ? ? 1_555 LA MG  .    MG    ? ? 0 U   919  0 MG  8006 1_555 ? ? ? ? ? ? ? 2.189 ? ? 
metalc146  metalc ?    ? A  U   919  O4    ? ? ? 1_555 SF NA  .    NA    ? ? 0 U   919  0 NA  8563 1_555 ? ? ? ? ? ? ? 2.829 ? ? 
metalc147  metalc ?    ? A  C   920  N3    ? ? ? 1_555 CF NA  .    NA    ? ? 0 C   920  0 NA  8547 1_555 ? ? ? ? ? ? ? 2.879 ? ? 
metalc148  metalc ?    ? A  A   922  OP1   ? ? ? 1_555 FF NA  .    NA    ? ? 0 A   922  0 NA  8550 1_555 ? ? ? ? ? ? ? 2.801 ? ? 
metalc149  metalc ?    ? A  G   941  O6    ? ? ? 1_555 DF NA  .    NA    ? ? 0 G   941  0 NA  8548 1_555 ? ? ? ? ? ? ? 2.965 ? ? 
metalc150  metalc ?    ? A  U   942  O4    ? ? ? 1_555 DF NA  .    NA    ? ? 0 U   942  0 NA  8548 1_555 ? ? ? ? ? ? ? 2.284 ? ? 
metalc151  metalc ?    ? A  U   954  OP1   ? ? ? 1_555 FC MG  .    MG    ? ? 0 U   954  0 MG  8056 1_555 ? ? ? ? ? ? ? 2.570 ? ? 
metalc152  metalc ?    ? A  A   955  "O2'" ? ? ? 1_555 ZE NA  .    NA    ? ? 0 A   955  0 NA  8544 1_555 ? ? ? ? ? ? ? 2.824 ? ? 
metalc153  metalc ?    ? A  G   956  OP2   ? ? ? 1_555 FB MG  .    MG    ? ? 0 G   956  0 MG  8026 1_555 ? ? ? ? ? ? ? 1.993 ? ? 
metalc154  metalc ?    ? A  A   1040 "O2'" ? ? ? 1_555 VI SR  .    SR    ? ? 0 A   1040 0 SR  8969 1_555 ? ? ? ? ? ? ? 3.139 ? ? 
metalc155  metalc ?    ? A  G   1045 OP2   ? ? ? 1_555 XE NA  .    NA    ? ? 0 G   1045 0 NA  8541 1_555 ? ? ? ? ? ? ? 2.288 ? ? 
metalc156  metalc ?    ? A  G   1055 O6    ? ? ? 1_555 TG SR  .    SR    ? ? 0 G   1055 0 SR  8907 1_555 ? ? ? ? ? ? ? 2.576 ? ? 
metalc157  metalc ?    ? A  G   1059 O6    ? ? ? 1_555 HH SR  .    SR    ? ? 0 G   1059 0 SR  8923 1_555 ? ? ? ? ? ? ? 3.079 ? ? 
metalc158  metalc ?    ? A  C   1069 OP2   ? ? ? 1_555 QD NA  .    NA    ? ? 0 C   1069 0 NA  8501 1_555 ? ? ? ? ? ? ? 2.169 ? ? 
metalc159  metalc ?    ? A  A   1070 "O2'" ? ? ? 1_555 UC MG  .    MG    ? ? 0 A   1070 0 MG  8072 1_555 ? ? ? ? ? ? ? 2.867 ? ? 
metalc160  metalc ?    ? A  G   1071 OP1   ? ? ? 1_555 UC MG  .    MG    ? ? 0 G   1071 0 MG  8072 1_555 ? ? ? ? ? ? ? 2.504 ? ? 
metalc161  metalc ?    ? A  G   1072 N7    ? ? ? 1_555 QD NA  .    NA    ? ? 0 G   1072 0 NA  8501 1_555 ? ? ? ? ? ? ? 2.364 ? ? 
metalc162  metalc ?    ? A  G   1077 N7    ? ? ? 1_555 CG NA  .    NA    ? ? 0 G   1077 0 NA  8574 1_555 ? ? ? ? ? ? ? 2.571 ? ? 
metalc163  metalc ?    ? A  A   1079 OP1   ? ? ? 1_555 CG NA  .    NA    ? ? 0 A   1079 0 NA  8574 1_555 ? ? ? ? ? ? ? 2.652 ? ? 
metalc164  metalc ?    ? A  U   1096 OP2   ? ? ? 1_555 VC MG  .    MG    ? ? 0 U   1096 0 MG  8073 1_555 ? ? ? ? ? ? ? 2.363 ? ? 
metalc165  metalc ?    ? A  A   1098 OP2   ? ? ? 1_555 QB MG  .    MG    ? ? 0 A   1098 0 MG  8037 1_555 ? ? ? ? ? ? ? 2.542 ? ? 
metalc166  metalc ?    ? A  C   1103 OP1   ? ? ? 1_555 JJ SR  .    SR    ? ? 0 C   1103 0 SR  8986 1_555 ? ? ? ? ? ? ? 2.906 ? ? 
metalc167  metalc ?    ? A  A   1106 OP2   ? ? ? 1_555 FD MG  .    MG    ? ? 0 A   1106 0 MG  8084 1_555 ? ? ? ? ? ? ? 2.058 ? ? 
metalc168  metalc ?    ? A  A   1107 OP2   ? ? ? 1_555 FD MG  .    MG    ? ? 0 A   1107 0 MG  8084 1_555 ? ? ? ? ? ? ? 1.908 ? ? 
metalc169  metalc ?    ? A  G   1110 OP2   ? ? ? 1_555 MH SR  .    SR    ? ? 0 G   1110 0 SR  8928 1_555 ? ? ? ? ? ? ? 2.723 ? ? 
metalc170  metalc ?    ? A  G   1113 N7    ? ? ? 1_555 NI SR  .    SR    ? ? 0 G   1113 0 SR  8960 1_555 ? ? ? ? ? ? ? 3.201 ? ? 
metalc171  metalc ?    ? A  G   1119 "O2'" ? ? ? 1_555 RD NA  .    NA    ? ? 0 G   1119 0 NA  8502 1_555 ? ? ? ? ? ? ? 2.779 ? ? 
metalc172  metalc ?    ? A  G   1119 O6    ? ? ? 1_555 BF NA  .    NA    ? ? 0 G   1119 0 NA  8546 1_555 ? ? ? ? ? ? ? 2.788 ? ? 
metalc173  metalc ?    ? A  U   1120 OP2   ? ? ? 1_555 XA MG  .    MG    ? ? 0 U   1120 0 MG  8018 1_555 ? ? ? ? ? ? ? 2.105 ? ? 
metalc174  metalc ?    ? A  G   1121 OP2   ? ? ? 1_555 XA MG  .    MG    ? ? 0 G   1121 0 MG  8018 1_555 ? ? ? ? ? ? ? 2.007 ? ? 
metalc175  metalc ?    ? A  G   1121 O6    ? ? ? 1_555 RD NA  .    NA    ? ? 0 G   1121 0 NA  8502 1_555 ? ? ? ? ? ? ? 2.924 ? ? 
metalc176  metalc ?    ? A  U   1125 OP1   ? ? ? 1_555 TB MG  .    MG    ? ? 0 U   1125 0 MG  8040 1_555 ? ? ? ? ? ? ? 2.028 ? ? 
metalc177  metalc ?    ? A  C   1127 N3    ? ? ? 1_555 HH SR  .    SR    ? ? 0 C   1127 0 SR  8923 1_555 ? ? ? ? ? ? ? 2.884 ? ? 
metalc178  metalc ?    ? A  C   1127 O2    ? ? ? 1_555 HH SR  .    SR    ? ? 0 C   1127 0 SR  8923 1_555 ? ? ? ? ? ? ? 2.823 ? ? 
metalc179  metalc ?    ? A  C   1129 O2    ? ? ? 1_555 CJ SR  .    SR    ? ? 0 C   1129 0 SR  8978 1_555 ? ? ? ? ? ? ? 3.286 ? ? 
metalc180  metalc ?    ? A  C   1129 N3    ? ? ? 1_555 CJ SR  .    SR    ? ? 0 C   1129 0 SR  8978 1_555 ? ? ? ? ? ? ? 2.809 ? ? 
metalc181  metalc ?    ? A  A   1133 OP2   ? ? ? 1_555 LI SR  .    SR    ? ? 0 A   1133 0 SR  8958 1_555 ? ? ? ? ? ? ? 2.512 ? ? 
metalc182  metalc ?    ? A  A   1133 "O2'" ? ? ? 1_555 VK SR  .    SR    ? ? 0 A   1133 H SR  8972 1_555 ? ? ? ? ? ? ? 3.076 ? ? 
metalc183  metalc ?    ? A  A   1133 "O3'" ? ? ? 1_555 VK SR  .    SR    ? ? 0 A   1133 H SR  8972 1_555 ? ? ? ? ? ? ? 2.537 ? ? 
metalc184  metalc ?    ? A  G   1134 N7    ? ? ? 1_555 LI SR  .    SR    ? ? 0 G   1134 0 SR  8958 1_555 ? ? ? ? ? ? ? 2.925 ? ? 
metalc185  metalc ?    ? A  G   1134 O6    ? ? ? 1_555 LI SR  .    SR    ? ? 0 G   1134 0 SR  8958 1_555 ? ? ? ? ? ? ? 2.784 ? ? 
metalc186  metalc ?    ? A  G   1134 OP1   ? ? ? 1_555 VK SR  .    SR    ? ? 0 G   1134 H SR  8972 1_555 ? ? ? ? ? ? ? 2.994 ? ? 
metalc187  metalc ?    ? A  C   1243 OP2   ? ? ? 1_555 BF NA  .    NA    ? ? 0 C   1243 0 NA  8546 1_555 ? ? ? ? ? ? ? 2.885 ? ? 
metalc188  metalc ?    ? A  A   1247 OP2   ? ? ? 1_555 MH SR  .    SR    ? ? 0 A   1247 0 SR  8928 1_555 ? ? ? ? ? ? ? 2.759 ? ? 
metalc189  metalc ?    ? A  C   1257 OP2   ? ? ? 1_555 VC MG  .    MG    ? ? 0 C   1257 0 MG  8073 1_555 ? ? ? ? ? ? ? 2.395 ? ? 
metalc190  metalc ?    ? A  A   1286 OP1   ? ? ? 1_555 GC MG  .    MG    ? ? 0 A   1286 0 MG  8058 1_555 ? ? ? ? ? ? ? 1.865 ? ? 
metalc191  metalc ?    ? A  A   1287 OP1   ? ? ? 1_555 GC MG  .    MG    ? ? 0 A   1287 0 MG  8058 1_555 ? ? ? ? ? ? ? 2.286 ? ? 
metalc192  metalc ?    ? A  A   1291 OP1   ? ? ? 1_555 RH SR  .    SR    ? ? 0 A   1291 0 SR  8936 1_555 ? ? ? ? ? ? ? 2.438 ? ? 
metalc193  metalc ?    ? A  A   1291 OP1   ? ? ? 1_555 EJ SR  .    SR    ? ? 0 A   1291 0 SR  8981 1_555 ? ? ? ? ? ? ? 2.797 ? ? 
metalc194  metalc ?    ? A  G   1292 OP2   ? ? ? 1_555 RH SR  .    SR    ? ? 0 G   1292 0 SR  8936 1_555 ? ? ? ? ? ? ? 2.301 ? ? 
metalc195  metalc ?    ? A  G   1292 O6    ? ? ? 1_555 GJ SR  .    SR    ? ? 0 G   1292 0 SR  8983 1_555 ? ? ? ? ? ? ? 3.345 ? ? 
metalc196  metalc ?    ? A  U   1293 OP2   ? ? ? 1_555 WF NA  .    NA    ? ? 0 U   1293 0 NA  8567 1_555 ? ? ? ? ? ? ? 2.658 ? ? 
metalc197  metalc ?    ? A  G   1295 O6    ? ? ? 1_555 WF NA  .    NA    ? ? 0 G   1295 0 NA  8567 1_555 ? ? ? ? ? ? ? 2.762 ? ? 
metalc198  metalc ?    ? A  G   1295 "O3'" ? ? ? 1_555 VI SR  .    SR    ? ? 0 G   1295 0 SR  8969 1_555 ? ? ? ? ? ? ? 3.368 ? ? 
metalc199  metalc ?    ? A  A   1296 OP1   ? ? ? 1_555 VI SR  .    SR    ? ? 0 A   1296 0 SR  8969 1_555 ? ? ? ? ? ? ? 2.686 ? ? 
metalc200  metalc ?    ? A  U   1309 O2    ? ? ? 1_555 LB MG  .    MG    ? ? 0 U   1309 0 MG  8032 1_555 ? ? ? ? ? ? ? 2.486 ? ? 
metalc201  metalc ?    ? A  A   1317 OP1   ? ? ? 1_555 YJ SR  .    SR    ? ? 0 A   1317 0 SR  9002 1_555 ? ? ? ? ? ? ? 3.112 ? ? 
metalc202  metalc ?    ? A  U   1346 O2    ? ? ? 1_555 LB MG  .    MG    ? ? 0 U   1346 0 MG  8032 1_555 ? ? ? ? ? ? ? 2.529 ? ? 
metalc203  metalc ?    ? A  C   1353 OP1   ? ? ? 1_555 QG SR  .    SR    ? ? 0 C   1353 0 SR  8904 1_555 ? ? ? ? ? ? ? 2.994 ? ? 
metalc204  metalc ?    ? A  G   1354 OP1   ? ? ? 1_555 QG SR  .    SR    ? ? 0 G   1354 0 SR  8904 1_555 ? ? ? ? ? ? ? 2.588 ? ? 
metalc205  metalc ?    ? A  A   1357 N7    ? ? ? 1_555 HD MG  .    MG    ? ? 0 A   1357 0 MG  8087 1_555 ? ? ? ? ? ? ? 2.495 ? ? 
metalc206  metalc ?    ? A  C   1360 OP1   ? ? ? 1_555 JF NA  .    NA    ? ? 0 C   1360 0 NA  8554 1_555 ? ? ? ? ? ? ? 2.540 ? ? 
metalc207  metalc ?    ? A  U   1368 O4    ? ? ? 1_555 CK SR  .    SR    ? ? 0 U   1368 0 SR  9008 1_555 ? ? ? ? ? ? ? 2.671 ? ? 
metalc208  metalc ?    ? A  A   1369 OP2   ? ? ? 1_555 AC MG  .    MG    ? ? 0 A   1369 0 MG  8048 1_555 ? ? ? ? ? ? ? 2.145 ? ? 
metalc209  metalc ?    ? A  G   1376 "O2'" ? ? ? 1_555 BK SR  .    SR    ? ? 0 G   1376 0 SR  9007 1_555 ? ? ? ? ? ? ? 3.386 ? ? 
metalc210  metalc ?    ? A  A   1381 N7    ? ? ? 1_555 WA MG  .    MG    ? ? 0 A   1381 0 MG  8017 1_555 ? ? ? ? ? ? ? 2.334 ? ? 
metalc211  metalc ?    ? A  C   1394 O2    ? ? ? 1_555 VD NA  .    NA    ? ? 0 C   1394 0 NA  8507 1_555 ? ? ? ? ? ? ? 2.365 ? ? 
metalc212  metalc ?    ? A  G   1416 "O3'" ? ? ? 1_555 CE NA  .    NA    ? ? 0 G   1416 0 NA  8515 1_555 ? ? ? ? ? ? ? 2.554 ? ? 
metalc213  metalc ?    ? A  G   1417 OP1   ? ? ? 1_555 CE NA  .    NA    ? ? 0 G   1417 0 NA  8515 1_555 ? ? ? ? ? ? ? 2.814 ? ? 
metalc214  metalc ?    ? A  C   1420 OP1   ? ? ? 1_555 AH SR  .    SR    ? ? 0 C   1420 0 SR  8916 1_555 ? ? ? ? ? ? ? 2.373 ? ? 
metalc215  metalc ?    ? A  C   1421 OP2   ? ? ? 1_555 AH SR  .    SR    ? ? 0 C   1421 0 SR  8916 1_555 ? ? ? ? ? ? ? 2.478 ? ? 
metalc216  metalc ?    ? A  U   1432 O4    ? ? ? 1_555 VD NA  .    NA    ? ? 0 U   1432 0 NA  8507 1_555 ? ? ? ? ? ? ? 2.482 ? ? 
metalc217  metalc ?    ? A  U   1432 O4    ? ? ? 1_555 OI SR  .    SR    ? ? 0 U   1432 0 SR  8962 1_555 ? ? ? ? ? ? ? 2.765 ? ? 
metalc218  metalc ?    ? A  G   1433 O6    ? ? ? 1_555 OI SR  .    SR    ? ? 0 G   1433 0 SR  8962 1_555 ? ? ? ? ? ? ? 2.896 ? ? 
metalc219  metalc ?    ? A  A   1437 OP2   ? ? ? 1_555 LC MG  .    MG    ? ? 0 A   1437 0 MG  8063 1_555 ? ? ? ? ? ? ? 2.867 ? ? 
metalc220  metalc ?    ? A  G   1438 OP1   ? ? ? 1_555 AH SR  .    SR    ? ? 0 G   1438 0 SR  8916 1_555 ? ? ? ? ? ? ? 2.556 ? ? 
metalc221  metalc ?    ? A  A   1448 OP2   ? ? ? 1_555 AB MG  .    MG    ? ? 0 A   1448 0 MG  8021 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
metalc222  metalc ?    ? A  C   1462 "O3'" ? ? ? 1_555 KI SR  .    SR    ? ? 0 C   1462 0 SR  8957 1_555 ? ? ? ? ? ? ? 3.305 ? ? 
metalc223  metalc ?    ? A  U   1463 OP1   ? ? ? 1_555 KI SR  .    SR    ? ? 0 U   1463 0 SR  8957 1_555 ? ? ? ? ? ? ? 2.309 ? ? 
metalc224  metalc ?    ? A  G   1484 OP2   ? ? ? 1_555 AI SR  .    SR    ? ? 0 G   1484 0 SR  8945 1_555 ? ? ? ? ? ? ? 2.282 ? ? 
metalc225  metalc ?    ? A  G   1489 OP2   ? ? ? 1_555 PG SR  .    SR    ? ? 0 G   1489 0 SR  8903 1_555 ? ? ? ? ? ? ? 2.561 ? ? 
metalc226  metalc ?    ? A  G   1491 O6    ? ? ? 1_555 PG SR  .    SR    ? ? 0 G   1491 0 SR  8903 1_555 ? ? ? ? ? ? ? 2.450 ? ? 
metalc227  metalc ?    ? A  U   1503 OP1   ? ? ? 1_555 BB MG  .    MG    ? ? 0 U   1503 0 MG  8022 1_555 ? ? ? ? ? ? ? 1.945 ? ? 
metalc228  metalc ?    ? A  A   1504 OP2   ? ? ? 1_555 BB MG  .    MG    ? ? 0 A   1504 0 MG  8022 1_555 ? ? ? ? ? ? ? 2.958 ? ? 
metalc229  metalc ?    ? A  A   1504 OP1   ? ? ? 1_555 CH SR  .    SR    ? ? 0 A   1504 0 SR  8918 1_555 ? ? ? ? ? ? ? 2.582 ? ? 
metalc230  metalc ?    ? A  G   1543 O6    ? ? ? 1_555 NH SR  .    SR    ? ? 0 G   1543 0 SR  8931 1_555 ? ? ? ? ? ? ? 2.428 ? ? 
metalc231  metalc ?    ? A  G   1576 O6    ? ? ? 1_555 TF NA  .    NA    ? ? 0 G   1576 0 NA  8564 1_555 ? ? ? ? ? ? ? 2.781 ? ? 
metalc232  metalc ?    ? A  U   1577 O4    ? ? ? 1_555 TF NA  .    NA    ? ? 0 U   1577 0 NA  8564 1_555 ? ? ? ? ? ? ? 2.974 ? ? 
metalc233  metalc ?    ? A  G   1619 O6    ? ? ? 1_555 TF NA  .    NA    ? ? 0 G   1619 0 NA  8564 1_555 ? ? ? ? ? ? ? 2.842 ? ? 
metalc234  metalc ?    ? A  U   1677 O4    ? ? ? 1_555 AB MG  .    MG    ? ? 0 U   1677 0 MG  8021 1_555 ? ? ? ? ? ? ? 2.148 ? ? 
metalc235  metalc ?    ? A  A   1678 OP1   ? ? ? 1_555 CH SR  .    SR    ? ? 0 A   1678 0 SR  8918 1_555 ? ? ? ? ? ? ? 2.431 ? ? 
metalc236  metalc ?    ? A  C   1679 OP1   ? ? ? 1_555 BB MG  .    MG    ? ? 0 C   1679 0 MG  8022 1_555 ? ? ? ? ? ? ? 2.119 ? ? 
metalc237  metalc ?    ? A  C   1679 OP2   ? ? ? 1_555 CH SR  .    SR    ? ? 0 C   1679 0 SR  8918 1_555 ? ? ? ? ? ? ? 2.429 ? ? 
metalc238  metalc ?    ? A  A   1682 OP1   ? ? ? 1_555 SJ SR  .    SR    ? ? 0 A   1682 0 SR  8996 1_555 ? ? ? ? ? ? ? 3.057 ? ? 
metalc239  metalc ?    ? A  G   1683 OP2   ? ? ? 1_555 WH SR  .    SR    ? ? 0 G   1683 0 SR  8941 1_555 ? ? ? ? ? ? ? 2.528 ? ? 
metalc240  metalc ?    ? A  A   1684 OP2   ? ? ? 1_555 KC MG  .    MG    ? ? 0 A   1684 0 MG  8062 1_555 ? ? ? ? ? ? ? 2.253 ? ? 
metalc241  metalc ?    ? A  A   1689 OP1   ? ? ? 1_555 QA MG  .    MG    ? ? 0 A   1689 0 MG  8011 1_555 ? ? ? ? ? ? ? 2.195 ? ? 
metalc242  metalc ?    ? A  C   1690 OP1   ? ? ? 1_555 CI SR  .    SR    ? ? 0 C   1690 0 SR  8947 1_555 ? ? ? ? ? ? ? 2.907 ? ? 
metalc243  metalc ?    ? A  A   1693 N6    ? ? ? 1_555 BK SR  .    SR    ? ? 0 A   1693 0 SR  9007 1_555 ? ? ? ? ? ? ? 2.848 ? ? 
metalc244  metalc ?    ? A  G   1694 "O2'" ? ? ? 1_555 QJ SR  .    SR    ? ? 0 G   1694 0 SR  8994 1_555 ? ? ? ? ? ? ? 2.909 ? ? 
metalc245  metalc ?    ? A  G   1694 "O3'" ? ? ? 1_555 QJ SR  .    SR    ? ? 0 G   1694 0 SR  8994 1_555 ? ? ? ? ? ? ? 3.325 ? ? 
metalc246  metalc ?    ? A  U   1696 O4    ? ? ? 1_555 WH SR  .    SR    ? ? 0 U   1696 0 SR  8941 1_555 ? ? ? ? ? ? ? 2.760 ? ? 
metalc247  metalc ?    ? A  G   1706 O6    ? ? ? 1_555 RE NA  .    NA    ? ? 0 G   1706 0 NA  8531 1_555 ? ? ? ? ? ? ? 2.428 ? ? 
metalc248  metalc ?    ? A  G   1707 O6    ? ? ? 1_555 RE NA  .    NA    ? ? 0 G   1707 0 NA  8531 1_555 ? ? ? ? ? ? ? 2.528 ? ? 
metalc249  metalc ?    ? A  A   1717 OP2   ? ? ? 1_555 FH SR  .    SR    ? ? 0 A   1717 0 SR  8921 1_555 ? ? ? ? ? ? ? 2.478 ? ? 
metalc250  metalc ?    ? A  G   1718 N7    ? ? ? 1_555 FH SR  .    SR    ? ? 0 G   1718 0 SR  8921 1_555 ? ? ? ? ? ? ? 3.010 ? ? 
metalc251  metalc ?    ? A  G   1718 O6    ? ? ? 1_555 FH SR  .    SR    ? ? 0 G   1718 0 SR  8921 1_555 ? ? ? ? ? ? ? 2.982 ? ? 
metalc252  metalc ?    ? A  U   1724 OP2   ? ? ? 1_555 KC MG  .    MG    ? ? 0 U   1724 0 MG  8062 1_555 ? ? ? ? ? ? ? 2.208 ? ? 
metalc253  metalc ?    ? A  U   1724 O2    ? ? ? 1_555 VD NA  .    NA    ? ? 0 U   1724 0 NA  8507 1_555 ? ? ? ? ? ? ? 2.196 ? ? 
metalc254  metalc ?    ? A  U   1724 O2    ? ? ? 1_555 OI SR  .    SR    ? ? 0 U   1724 0 SR  8962 1_555 ? ? ? ? ? ? ? 2.995 ? ? 
metalc255  metalc ?    ? A  G   1726 OP2   ? ? ? 1_555 BJ SR  .    SR    ? ? 0 G   1726 0 SR  8976 1_555 ? ? ? ? ? ? ? 3.164 ? ? 
metalc256  metalc ?    ? A  U   1740 O4    ? ? ? 1_555 UE NA  .    NA    ? ? 0 U   1740 0 NA  8535 1_555 ? ? ? ? ? ? ? 2.932 ? ? 
metalc257  metalc ?    ? A  U   1741 O4    ? ? ? 1_555 UE NA  .    NA    ? ? 0 U   1741 0 NA  8535 1_555 ? ? ? ? ? ? ? 2.816 ? ? 
metalc258  metalc ?    ? A  A   1742 OP2   ? ? ? 1_555 NC MG  .    MG    ? ? 0 A   1742 0 MG  8065 1_555 ? ? ? ? ? ? ? 1.979 ? ? 
metalc259  metalc ?    ? A  A   1746 "O3'" ? ? ? 1_555 FJ SR  .    SR    ? ? 0 A   1746 0 SR  8982 1_555 ? ? ? ? ? ? ? 3.078 ? ? 
metalc260  metalc ?    ? A  A   1746 "O2'" ? ? ? 1_555 FJ SR  .    SR    ? ? 0 A   1746 0 SR  8982 1_555 ? ? ? ? ? ? ? 3.124 ? ? 
metalc261  metalc ?    ? A  A   1747 OP2   ? ? ? 1_555 WG SR  .    SR    ? ? 0 A   1747 0 SR  8910 1_555 ? ? ? ? ? ? ? 2.322 ? ? 
metalc262  metalc ?    ? A  A   1747 OP2   ? ? ? 1_555 FJ SR  .    SR    ? ? 0 A   1747 0 SR  8982 1_555 ? ? ? ? ? ? ? 3.168 ? ? 
metalc263  metalc ?    ? A  U   1748 OP1   ? ? ? 1_555 CB MG  .    MG    ? ? 0 U   1748 0 MG  8023 1_555 ? ? ? ? ? ? ? 2.075 ? ? 
metalc264  metalc ?    ? A  U   1748 OP2   ? ? ? 1_555 WG SR  .    SR    ? ? 0 U   1748 0 SR  8910 1_555 ? ? ? ? ? ? ? 2.391 ? ? 
metalc265  metalc ?    ? A  U   1748 O4    ? ? ? 1_555 FJ SR  .    SR    ? ? 0 U   1748 0 SR  8982 1_555 ? ? ? ? ? ? ? 2.905 ? ? 
metalc266  metalc ?    ? A  U   1749 OP2   ? ? ? 1_555 CB MG  .    MG    ? ? 0 U   1749 0 MG  8023 1_555 ? ? ? ? ? ? ? 1.959 ? ? 
metalc267  metalc ?    ? A  U   1749 O4    ? ? ? 1_555 WG SR  .    SR    ? ? 0 U   1749 0 SR  8910 1_555 ? ? ? ? ? ? ? 2.357 ? ? 
metalc268  metalc ?    ? A  U   1749 O4    ? ? ? 1_555 FJ SR  .    SR    ? ? 0 U   1749 0 SR  8982 1_555 ? ? ? ? ? ? ? 2.926 ? ? 
metalc269  metalc ?    ? A  G   1752 OP2   ? ? ? 1_555 FJ SR  .    SR    ? ? 0 G   1752 0 SR  8982 1_555 ? ? ? ? ? ? ? 3.043 ? ? 
metalc270  metalc ?    ? A  A   1754 OP2   ? ? ? 1_555 MC MG  .    MG    ? ? 0 A   1754 0 MG  8064 1_555 ? ? ? ? ? ? ? 2.364 ? ? 
metalc271  metalc ?    ? A  A   1755 OP1   ? ? ? 1_555 RG SR  .    SR    ? ? 0 A   1755 0 SR  8905 1_555 ? ? ? ? ? ? ? 2.709 ? ? 
metalc272  metalc ?    ? A  G   1794 N7    ? ? ? 1_555 PB MG  .    MG    ? ? 0 G   1794 0 MG  8036 1_555 ? ? ? ? ? ? ? 2.643 ? ? 
metalc273  metalc ?    ? A  A   1815 OP1   ? ? ? 1_555 RI SR  .    SR    ? ? 0 A   1815 0 SR  8965 1_555 ? ? ? ? ? ? ? 3.180 ? ? 
metalc274  metalc ?    ? A  C   1830 OP1   ? ? ? 1_555 TA MG  .    MG    ? ? 0 C   1830 0 MG  8014 1_555 ? ? ? ? ? ? ? 1.905 ? ? 
metalc275  metalc ?    ? A  U   1831 "O2'" ? ? ? 1_555 JE NA  .    NA    ? ? 0 U   1831 0 NA  8523 1_555 ? ? ? ? ? ? ? 2.508 ? ? 
metalc276  metalc ?    ? A  G   1832 OP2   ? ? ? 1_555 QF NA  .    NA    ? ? 0 G   1832 0 NA  8561 1_555 ? ? ? ? ? ? ? 2.537 ? ? 
metalc277  metalc ?    ? A  U   1835 OP1   ? ? ? 1_555 ZI SR  .    SR    ? ? 0 U   1835 0 SR  8974 1_555 ? ? ? ? ? ? ? 3.380 ? ? 
metalc278  metalc ?    ? A  U   1835 OP2   ? ? ? 1_555 ZI SR  .    SR    ? ? 0 U   1835 0 SR  8974 1_555 ? ? ? ? ? ? ? 2.865 ? ? 
metalc279  metalc ?    ? A  A   1836 OP1   ? ? ? 1_555 KA MG  .    MG    ? ? 0 A   1836 0 MG  8005 1_555 ? ? ? ? ? ? ? 2.184 ? ? 
metalc280  metalc ?    ? A  U   1838 OP1   ? ? ? 1_555 KA MG  .    MG    ? ? 0 U   1838 0 MG  8005 1_555 ? ? ? ? ? ? ? 1.945 ? ? 
metalc281  metalc ?    ? A  A   1839 OP2   ? ? ? 1_555 KA MG  .    MG    ? ? 0 A   1839 0 MG  8005 1_555 ? ? ? ? ? ? ? 1.988 ? ? 
metalc282  metalc ?    ? A  A   1840 "O2'" ? ? ? 1_555 ND MG  .    MG    ? ? 0 A   1840 0 MG  8093 1_555 ? ? ? ? ? ? ? 2.654 ? ? 
metalc283  metalc ?    ? A  A   1840 "O3'" ? ? ? 1_555 ND MG  .    MG    ? ? 0 A   1840 0 MG  8093 1_555 ? ? ? ? ? ? ? 2.500 ? ? 
metalc284  metalc ?    ? A  C   1841 OP2   ? ? ? 1_555 ND MG  .    MG    ? ? 0 C   1841 0 MG  8093 1_555 ? ? ? ? ? ? ? 3.035 ? ? 
metalc285  metalc ?    ? A  A   1843 OP1   ? ? ? 1_555 TC MG  .    MG    ? ? 0 A   1843 0 MG  8071 1_555 ? ? ? ? ? ? ? 2.927 ? ? 
metalc286  metalc ?    ? A  C   1844 OP2   ? ? ? 1_555 TC MG  .    MG    ? ? 0 C   1844 0 MG  8071 1_555 ? ? ? ? ? ? ? 2.555 ? ? 
metalc287  metalc ?    ? A  A   1845 OP1   ? ? ? 1_555 CC MG  .    MG    ? ? 0 A   1845 0 MG  8052 1_555 ? ? ? ? ? ? ? 2.340 ? ? 
metalc288  metalc ?    ? A  U   1846 OP2   ? ? ? 1_555 CC MG  .    MG    ? ? 0 U   1846 0 MG  8052 1_555 ? ? ? ? ? ? ? 2.475 ? ? 
metalc289  metalc ?    ? A  G   1848 O6    ? ? ? 1_555 WC MG  .    MG    ? ? 0 G   1848 0 MG  8075 1_555 ? ? ? ? ? ? ? 2.405 ? ? 
metalc290  metalc ?    ? A  G   1849 O6    ? ? ? 1_555 WC MG  .    MG    ? ? 0 G   1849 0 MG  8075 1_555 ? ? ? ? ? ? ? 2.281 ? ? 
metalc291  metalc ?    ? A  U   1850 O4    ? ? ? 1_555 MD MG  .    MG    ? ? 0 U   1850 0 MG  8092 1_555 ? ? ? ? ? ? ? 2.642 ? ? 
metalc292  metalc ?    ? A  U   1883 OP1   ? ? ? 1_555 WB MG  .    MG    ? ? 0 U   1883 0 MG  8044 1_555 ? ? ? ? ? ? ? 2.405 ? ? 
metalc293  metalc ?    ? A  G   1884 O6    ? ? ? 1_555 CC MG  .    MG    ? ? 0 G   1884 0 MG  8052 1_555 ? ? ? ? ? ? ? 2.366 ? ? 
metalc294  metalc ?    ? A  A   1885 OP1   ? ? ? 1_555 YH SR  .    SR    ? ? 0 A   1885 0 SR  8943 1_555 ? ? ? ? ? ? ? 2.931 ? ? 
metalc295  metalc ?    ? A  A   1886 OP2   ? ? ? 1_555 YH SR  .    SR    ? ? 0 A   1886 0 SR  8943 1_555 ? ? ? ? ? ? ? 2.657 ? ? 
metalc296  metalc ?    ? A  U   1887 O4    ? ? ? 1_555 YH SR  .    SR    ? ? 0 U   1887 0 SR  8943 1_555 ? ? ? ? ? ? ? 3.238 ? ? 
metalc297  metalc ?    ? A  C   1894 O2    ? ? ? 1_555 PE NA  .    NA    ? ? 0 C   1894 0 NA  8529 1_555 ? ? ? ? ? ? ? 2.738 ? ? 
metalc298  metalc ?    ? A  C   1894 O2    ? ? ? 1_555 AJ SR  .    SR    ? ? 0 C   1894 0 SR  8975 1_555 ? ? ? ? ? ? ? 2.752 ? ? 
metalc299  metalc ?    ? A  G   1896 N7    ? ? ? 1_555 PE NA  .    NA    ? ? 0 G   1896 0 NA  8529 1_555 ? ? ? ? ? ? ? 2.747 ? ? 
metalc300  metalc ?    ? A  G   1896 O6    ? ? ? 1_555 PE NA  .    NA    ? ? 0 G   1896 0 NA  8529 1_555 ? ? ? ? ? ? ? 2.695 ? ? 
metalc301  metalc ?    ? A  U   1897 O4    ? ? ? 1_555 AJ SR  .    SR    ? ? 0 U   1897 0 SR  8975 1_555 ? ? ? ? ? ? ? 2.833 ? ? 
metalc302  metalc ?    ? A  G   1898 O6    ? ? ? 1_555 AJ SR  .    SR    ? ? 0 G   1898 0 SR  8975 1_555 ? ? ? ? ? ? ? 2.823 ? ? 
metalc303  metalc ?    ? A  U   1939 O4    ? ? ? 1_555 AJ SR  .    SR    ? ? 0 U   1939 0 SR  8975 1_555 ? ? ? ? ? ? ? 2.974 ? ? 
metalc304  metalc ?    ? A  U   1972 OP2   ? ? ? 1_555 MI SR  .    SR    ? ? 0 U   1972 0 SR  8959 1_555 ? ? ? ? ? ? ? 2.530 ? ? 
metalc305  metalc ?    ? A  G   1979 OP2   ? ? ? 1_555 OB MG  .    MG    ? ? 0 G   1979 0 MG  8035 1_555 ? ? ? ? ? ? ? 2.298 ? ? 
metalc306  metalc ?    ? A  A   2010 OP2   ? ? ? 1_555 IE NA  .    NA    ? ? 0 A   2010 0 NA  8522 1_555 ? ? ? ? ? ? ? 2.747 ? ? 
metalc307  metalc ?    ? A  A   2011 OP1   ? ? ? 1_555 SA MG  .    MG    ? ? 0 A   2011 0 MG  8013 1_555 ? ? ? ? ? ? ? 2.799 ? ? 
metalc308  metalc ?    ? A  A   2011 OP2   ? ? ? 1_555 SA MG  .    MG    ? ? 0 A   2011 0 MG  8013 1_555 ? ? ? ? ? ? ? 2.357 ? ? 
metalc309  metalc ?    ? A  U   2012 "O2'" ? ? ? 1_555 WB MG  .    MG    ? ? 0 U   2012 0 MG  8044 1_555 ? ? ? ? ? ? ? 2.364 ? ? 
metalc310  metalc ?    ? A  U   2012 "O3'" ? ? ? 1_555 WB MG  .    MG    ? ? 0 U   2012 0 MG  8044 1_555 ? ? ? ? ? ? ? 3.003 ? ? 
metalc311  metalc ?    ? A  U   2012 O4    ? ? ? 1_555 IE NA  .    NA    ? ? 0 U   2012 0 NA  8522 1_555 ? ? ? ? ? ? ? 2.444 ? ? 
metalc312  metalc ?    ? A  G   2013 OP2   ? ? ? 1_555 XB MG  .    MG    ? ? 0 G   2013 0 MG  8045 1_555 ? ? ? ? ? ? ? 1.991 ? ? 
metalc313  metalc ?    ? A  U   2016 O4    ? ? ? 1_555 ZH SR  .    SR    ? ? 0 U   2016 0 SR  8944 1_555 ? ? ? ? ? ? ? 2.672 ? ? 
metalc314  metalc ?    ? A  A   2022 N7    ? ? ? 1_555 ND MG  .    MG    ? ? 0 A   2022 0 MG  8093 1_555 ? ? ? ? ? ? ? 2.499 ? ? 
metalc315  metalc ?    ? A  G   2033 "O2'" ? ? ? 1_555 UE NA  .    NA    ? ? 0 G   2033 0 NA  8535 1_555 ? ? ? ? ? ? ? 2.906 ? ? 
metalc316  metalc ?    ? A  C   2048 OP1   ? ? ? 1_555 NB MG  .    MG    ? ? 0 C   2048 0 MG  8034 1_555 ? ? ? ? ? ? ? 2.309 ? ? 
metalc317  metalc ?    ? A  U   2057 O4    ? ? ? 1_555 KF NA  .    NA    ? ? 0 U   2057 0 NA  8555 1_555 ? ? ? ? ? ? ? 2.896 ? ? 
metalc318  metalc ?    ? A  G   2058 O6    ? ? ? 1_555 KF NA  .    NA    ? ? 0 G   2058 0 NA  8555 1_555 ? ? ? ? ? ? ? 2.848 ? ? 
metalc319  metalc ?    ? A  A   2089 OP1   ? ? ? 1_555 NB MG  .    MG    ? ? 0 A   2089 0 MG  8034 1_555 ? ? ? ? ? ? ? 2.495 ? ? 
metalc320  metalc ?    ? A  G   2091 OP2   ? ? ? 1_555 BI SR  .    SR    ? ? 0 G   2091 0 SR  8946 1_555 ? ? ? ? ? ? ? 2.803 ? ? 
metalc321  metalc ?    ? A  G   2094 N7    ? ? ? 1_555 TD NA  .    NA    ? ? 0 G   2094 0 NA  8505 1_555 ? ? ? ? ? ? ? 2.786 ? ? 
metalc322  metalc ?    ? A  G   2097 OP2   ? ? ? 1_555 VA MG  .    MG    ? ? 0 G   2097 0 MG  8016 1_555 ? ? ? ? ? ? ? 2.154 ? ? 
metalc323  metalc ?    ? A  G   2102 OP2   ? ? ? 1_555 PA MG  .    MG    ? ? 0 G   2102 0 MG  8010 1_555 ? ? ? ? ? ? ? 2.687 ? ? 
metalc324  metalc ?    ? A  G   2102 "O5'" ? ? ? 1_555 PA MG  .    MG    ? ? 0 G   2102 0 MG  8010 1_555 ? ? ? ? ? ? ? 2.723 ? ? 
metalc325  metalc ?    ? A  G   2102 N7    ? ? ? 1_555 OD K   .    K     ? ? 0 G   2102 0 K   8401 1_555 ? ? ? ? ? ? ? 3.467 ? ? 
metalc326  metalc ?    ? A  G   2102 O6    ? ? ? 1_555 OD K   .    K     ? ? 0 G   2102 0 K   8401 1_555 ? ? ? ? ? ? ? 2.872 ? ? 
metalc327  metalc ?    ? A  G   2102 OP1   ? ? ? 1_555 ZJ SR  .    SR    ? ? 0 G   2102 0 SR  9004 1_555 ? ? ? ? ? ? ? 3.130 ? ? 
metalc328  metalc ?    ? A  A   2103 OP2   ? ? ? 1_555 RC MG  .    MG    ? ? 0 A   2103 0 MG  8069 1_555 ? ? ? ? ? ? ? 2.912 ? ? 
metalc329  metalc ?    ? A  A   2103 OP1   ? ? ? 1_555 RC MG  .    MG    ? ? 0 A   2103 0 MG  8069 1_555 ? ? ? ? ? ? ? 2.867 ? ? 
metalc330  metalc ?    ? A  A   2103 OP1   ? ? ? 1_555 ZJ SR  .    SR    ? ? 0 A   2103 0 SR  9004 1_555 ? ? ? ? ? ? ? 2.793 ? ? 
metalc331  metalc ?    ? A  C   2104 OP2   ? ? ? 1_555 DD MG  .    MG    ? ? 0 C   2104 0 MG  8082 1_555 ? ? ? ? ? ? ? 2.875 ? ? 
metalc332  metalc ?    ? A  C   2105 OP2   ? ? ? 1_555 DD MG  .    MG    ? ? 0 C   2105 0 MG  8082 1_555 ? ? ? ? ? ? ? 2.630 ? ? 
metalc333  metalc ?    ? A  U   2109 OP2   ? ? ? 1_555 FF NA  .    NA    ? ? 0 U   2109 0 NA  8550 1_555 ? ? ? ? ? ? ? 2.606 ? ? 
metalc334  metalc ?    ? A  G   2110 OP2   ? ? ? 1_555 IF NA  .    NA    ? ? 0 G   2110 0 NA  8553 1_555 ? ? ? ? ? ? ? 2.737 ? ? 
metalc335  metalc ?    ? A  A   2112 N7    ? ? ? 1_555 JD MG  .    MG    ? ? 0 A   2112 0 MG  8089 1_555 ? ? ? ? ? ? ? 2.481 ? ? 
metalc336  metalc ?    ? A  A   2112 N3    ? ? ? 1_555 FE NA  .    NA    ? ? 0 A   2112 0 NA  8519 1_555 ? ? ? ? ? ? ? 2.694 ? ? 
metalc337  metalc ?    ? A  U   2115 OP1   ? ? ? 1_555 EB MG  .    MG    ? ? 0 U   2115 0 MG  8025 1_555 ? ? ? ? ? ? ? 1.923 ? ? 
metalc338  metalc ?    ? A  C   2248 OP2   ? ? ? 1_555 RB MG  .    MG    ? ? 0 C   2248 0 MG  8038 1_555 ? ? ? ? ? ? ? 2.492 ? ? 
metalc339  metalc ?    ? A  U   2276 OP1   ? ? ? 1_555 UB MG  .    MG    ? ? 0 U   2276 0 MG  8041 1_555 ? ? ? ? ? ? ? 2.047 ? ? 
metalc340  metalc ?    ? A  U   2277 O4    ? ? ? 1_555 OJ SR  .    SR    ? ? 0 U   2277 0 SR  8992 1_555 ? ? ? ? ? ? ? 3.046 ? ? 
metalc341  metalc ?    ? A  U   2278 OP1   ? ? ? 1_555 CF NA  .    NA    ? ? 0 U   2278 0 NA  8547 1_555 ? ? ? ? ? ? ? 2.800 ? ? 
metalc342  metalc ?    ? A  U   2278 O4    ? ? ? 1_555 OJ SR  .    SR    ? ? 0 U   2278 0 SR  8992 1_555 ? ? ? ? ? ? ? 2.766 ? ? 
metalc343  metalc ?    ? A  C   2281 OP2   ? ? ? 1_555 AD MG  .    MG    ? ? 0 C   2281 0 MG  8079 1_555 ? ? ? ? ? ? ? 2.671 ? ? 
metalc344  metalc ?    ? A  U   2282 O4    ? ? ? 1_555 AD MG  .    MG    ? ? 0 U   2282 0 MG  8079 1_555 ? ? ? ? ? ? ? 2.542 ? ? 
metalc345  metalc ?    ? A  G   2284 N7    ? ? ? 1_555 PI SR  .    SR    ? ? 0 G   2284 0 SR  8963 1_555 ? ? ? ? ? ? ? 2.941 ? ? 
metalc346  metalc ?    ? A  G   2284 O6    ? ? ? 1_555 PI SR  .    SR    ? ? 0 G   2284 0 SR  8963 1_555 ? ? ? ? ? ? ? 3.141 ? ? 
metalc347  metalc ?    ? A  A   2302 OP1   ? ? ? 1_555 DI SR  .    SR    ? ? 0 A   2302 0 SR  8948 1_555 ? ? ? ? ? ? ? 2.294 ? ? 
metalc348  metalc ?    ? A  A   2303 OP1   ? ? ? 1_555 DI SR  .    SR    ? ? 0 A   2303 0 SR  8948 1_555 ? ? ? ? ? ? ? 2.444 ? ? 
metalc349  metalc ?    ? A  G   2304 OP2   ? ? ? 1_555 UA MG  .    MG    ? ? 0 G   2304 0 MG  8015 1_555 ? ? ? ? ? ? ? 2.045 ? ? 
metalc350  metalc ?    ? A  G   2399 O6    ? ? ? 1_555 YD NA  .    NA    ? ? 0 G   2399 0 NA  8511 1_555 ? ? ? ? ? ? ? 2.621 ? ? 
metalc351  metalc ?    ? A  G   2421 OP1   ? ? ? 1_555 QH SR  .    SR    ? ? 0 G   2421 0 SR  8935 1_555 ? ? ? ? ? ? ? 2.454 ? ? 
metalc352  metalc ?    ? A  U   2422 "O3'" ? ? ? 1_555 QH SR  .    SR    ? ? 0 U   2422 0 SR  8935 1_555 ? ? ? ? ? ? ? 3.074 ? ? 
metalc353  metalc ?    ? A  C   2423 OP1   ? ? ? 1_555 QH SR  .    SR    ? ? 0 C   2423 0 SR  8935 1_555 ? ? ? ? ? ? ? 2.789 ? ? 
metalc354  metalc ?    ? A  A   2430 N1    ? ? ? 1_555 KD MG  .    MG    ? ? 0 A   2430 0 MG  8090 1_555 ? ? ? ? ? ? ? 2.713 ? ? 
metalc355  metalc ?    ? A  A   2434 N3    ? ? ? 1_555 BD MG  .    MG    ? ? 0 A   2434 0 MG  8080 1_555 ? ? ? ? ? ? ? 2.780 ? ? 
metalc356  metalc ?    ? A  U   2458 O2    ? ? ? 1_555 BD MG  .    MG    ? ? 0 U   2458 0 MG  8080 1_555 ? ? ? ? ? ? ? 2.622 ? ? 
metalc357  metalc ?    ? A  U   2461 OP1   ? ? ? 1_555 VJ SR  .    SR    ? ? 0 U   2461 0 SR  8999 1_555 ? ? ? ? ? ? ? 3.346 ? ? 
metalc358  metalc ?    ? A  C   2464 OP1   ? ? ? 1_555 LA MG  .    MG    ? ? 0 C   2464 0 MG  8006 1_555 ? ? ? ? ? ? ? 1.965 ? ? 
metalc359  metalc ?    ? A  A   2465 OP1   ? ? ? 1_555 LA MG  .    MG    ? ? 0 A   2465 0 MG  8006 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
metalc360  metalc ?    ? A  A   2465 "O3'" ? ? ? 1_555 VH SR  .    SR    ? ? 0 A   2465 0 SR  8940 1_555 ? ? ? ? ? ? ? 3.392 ? ? 
metalc361  metalc ?    ? A  G   2466 N7    ? ? ? 1_555 VH SR  .    SR    ? ? 0 G   2466 0 SR  8940 1_555 ? ? ? ? ? ? ? 3.038 ? ? 
metalc362  metalc ?    ? A  G   2466 OP2   ? ? ? 1_555 VH SR  .    SR    ? ? 0 G   2466 0 SR  8940 1_555 ? ? ? ? ? ? ? 2.454 ? ? 
metalc363  metalc ?    ? A  G   2471 O6    ? ? ? 1_555 OJ SR  .    SR    ? ? 0 G   2471 0 SR  8992 1_555 ? ? ? ? ? ? ? 2.837 ? ? 
metalc364  metalc ?    ? A  C   2475 N4    ? ? ? 1_555 FE NA  .    NA    ? ? 0 C   2475 0 NA  8519 1_555 ? ? ? ? ? ? ? 2.822 ? ? 
metalc365  metalc ?    ? A  G   2482 N7    ? ? ? 1_555 OD K   .    K     ? ? 0 G   2482 0 K   8401 1_555 ? ? ? ? ? ? ? 2.865 ? ? 
metalc366  metalc ?    ? A  G   2482 O6    ? ? ? 1_555 OD K   .    K     ? ? 0 G   2482 0 K   8401 1_555 ? ? ? ? ? ? ? 2.845 ? ? 
metalc367  metalc ?    ? A  A   2483 OP2   ? ? ? 1_555 GA MG  .    MG    ? ? 0 A   2483 0 MG  8001 1_555 ? ? ? ? ? ? ? 2.094 ? ? 
metalc368  metalc ?    ? A  A   2483 OP1   ? ? ? 1_555 HA MG  .    MG    ? ? 0 A   2483 0 MG  8002 1_555 ? ? ? ? ? ? ? 1.978 ? ? 
metalc369  metalc ?    ? A  U   2492 O4    ? ? ? 1_555 RF NA  .    NA    ? ? 0 U   2492 0 NA  8562 1_555 ? ? ? ? ? ? ? 2.892 ? ? 
metalc370  metalc ?    ? A  G   2522 OP1   ? ? ? 1_555 UI SR  .    SR    ? ? 0 G   2522 0 SR  8968 1_555 ? ? ? ? ? ? ? 3.287 ? ? 
metalc371  metalc ?    ? A  G   2524 N7    ? ? ? 1_555 XD NA  .    NA    ? ? 0 G   2524 0 NA  8509 1_555 ? ? ? ? ? ? ? 2.688 ? ? 
metalc372  metalc ?    ? A  G   2525 O6    ? ? ? 1_555 XD NA  .    NA    ? ? 0 G   2525 0 NA  8509 1_555 ? ? ? ? ? ? ? 2.502 ? ? 
metalc373  metalc ?    ? A  G   2529 O6    ? ? ? 1_555 RF NA  .    NA    ? ? 0 G   2529 0 NA  8562 1_555 ? ? ? ? ? ? ? 2.586 ? ? 
metalc374  metalc ?    ? A  C   2533 OP2   ? ? ? 1_555 GA MG  .    MG    ? ? 0 C   2533 0 MG  8001 1_555 ? ? ? ? ? ? ? 2.091 ? ? 
metalc375  metalc ?    ? A  C   2534 OP2   ? ? ? 1_555 GA MG  .    MG    ? ? 0 C   2534 0 MG  8001 1_555 ? ? ? ? ? ? ? 1.938 ? ? 
metalc376  metalc ?    ? A  C   2534 OP1   ? ? ? 1_555 HA MG  .    MG    ? ? 0 C   2534 0 MG  8002 1_555 ? ? ? ? ? ? ? 2.099 ? ? 
metalc377  metalc ?    ? A  C   2536 "O4'" ? ? ? 1_555 OD K   .    K     ? ? 0 C   2536 0 K   8401 1_555 ? ? ? ? ? ? ? 3.046 ? ? 
metalc378  metalc ?    ? A  C   2536 N1    ? ? ? 1_555 OD K   .    K     ? ? 0 C   2536 0 K   8401 1_555 ? ? ? ? ? ? ? 3.686 ? ? 
metalc379  metalc ?    ? A  C   2536 O2    ? ? ? 1_555 OD K   .    K     ? ? 0 C   2536 0 K   8401 1_555 ? ? ? ? ? ? ? 2.840 ? ? 
metalc380  metalc ?    ? A  G   2537 OP2   ? ? ? 1_555 PA MG  .    MG    ? ? 0 G   2537 0 MG  8010 1_555 ? ? ? ? ? ? ? 2.062 ? ? 
metalc381  metalc ?    ? A  G   2540 OP1   ? ? ? 1_555 VA MG  .    MG    ? ? 0 G   2540 0 MG  8016 1_555 ? ? ? ? ? ? ? 2.257 ? ? 
metalc382  metalc ?    ? A  G   2540 O6    ? ? ? 1_555 PC MG  .    MG    ? ? 0 G   2540 0 MG  8067 1_555 ? ? ? ? ? ? ? 2.592 ? ? 
metalc383  metalc ?    ? A  G   2540 O6    ? ? ? 1_555 TE NA  .    NA    ? ? 0 G   2540 0 NA  8534 1_555 ? ? ? ? ? ? ? 2.640 ? ? 
metalc384  metalc ?    ? A  G   2543 N7    ? ? ? 1_555 DE NA  .    NA    ? ? 0 G   2543 0 NA  8516 1_555 ? ? ? ? ? ? ? 2.944 ? ? 
metalc385  metalc ?    ? A  G   2543 O6    ? ? ? 1_555 EE NA  .    NA    ? ? 0 G   2543 0 NA  8517 1_555 ? ? ? ? ? ? ? 2.897 ? ? 
metalc386  metalc ?    ? A  G   2543 OP1   ? ? ? 1_555 DH SR  .    SR    ? ? 0 G   2543 0 SR  8919 1_555 ? ? ? ? ? ? ? 2.769 ? ? 
metalc387  metalc ?    ? A  G   2544 N7    ? ? ? 1_555 DE NA  .    NA    ? ? 0 G   2544 0 NA  8516 1_555 ? ? ? ? ? ? ? 2.933 ? ? 
metalc388  metalc ?    ? A  A   2553 OP2   ? ? ? 1_555 GB MG  .    MG    ? ? 0 A   2553 0 MG  8027 1_555 ? ? ? ? ? ? ? 2.168 ? ? 
metalc389  metalc ?    ? A  A   2553 OP2   ? ? ? 1_555 LH SR  .    SR    ? ? 0 A   2553 0 SR  8927 1_555 ? ? ? ? ? ? ? 2.686 ? ? 
metalc390  metalc ?    ? A  U   2557 OP2   ? ? ? 1_555 II SR  .    SR    ? ? 0 U   2557 0 SR  8955 1_555 ? ? ? ? ? ? ? 3.161 ? ? 
metalc391  metalc ?    ? A  A   2568 OP2   ? ? ? 1_555 DC MG  .    MG    ? ? 0 A   2568 0 MG  8053 1_555 ? ? ? ? ? ? ? 3.140 ? ? 
metalc392  metalc ?    ? A  A   2577 N3    ? ? ? 1_555 WD NA  .    NA    ? ? 0 A   2577 0 NA  8508 1_555 ? ? ? ? ? ? ? 2.932 ? ? 
metalc393  metalc ?    ? A  G   2578 OP2   ? ? ? 1_555 CD MG  .    MG    ? ? 0 G   2578 0 MG  8081 1_555 ? ? ? ? ? ? ? 2.369 ? ? 
metalc394  metalc ?    ? A  G   2579 OP2   ? ? ? 1_555 CD MG  .    MG    ? ? 0 G   2579 0 MG  8081 1_555 ? ? ? ? ? ? ? 2.725 ? ? 
metalc395  metalc ?    ? A  G   2579 O6    ? ? ? 1_555 WD NA  .    NA    ? ? 0 G   2579 0 NA  8508 1_555 ? ? ? ? ? ? ? 2.820 ? ? 
metalc396  metalc ?    ? A  G   2585 OP1   ? ? ? 1_555 WG SR  .    SR    ? ? 0 G   2585 0 SR  8910 1_555 ? ? ? ? ? ? ? 2.248 ? ? 
metalc397  metalc ?    ? A  U   2586 O4    ? ? ? 1_555 ZF NA  .    NA    ? ? 0 U   2586 0 NA  8570 1_555 ? ? ? ? ? ? ? 2.444 ? ? 
metalc398  metalc ?    ? A  C   2591 O2    ? ? ? 1_555 XJ SR  .    SR    ? ? 0 C   2591 0 SR  9001 1_555 ? ? ? ? ? ? ? 3.121 ? ? 
metalc399  metalc ?    ? A  G   2592 O6    ? ? ? 1_555 ZF NA  .    NA    ? ? 0 G   2592 0 NA  8570 1_555 ? ? ? ? ? ? ? 2.659 ? ? 
metalc400  metalc ?    ? A  U   2607 "O2'" ? ? ? 1_555 ZD NA  .    NA    ? ? 0 U   2607 0 NA  8512 1_555 ? ? ? ? ? ? ? 2.405 ? ? 
metalc401  metalc ?    ? A  U   2607 O2    ? ? ? 1_555 ZD NA  .    NA    ? ? 0 U   2607 0 NA  8512 1_555 ? ? ? ? ? ? ? 2.631 ? ? 
metalc402  metalc ?    ? A  C   2608 OP1   ? ? ? 1_555 YA MG  .    MG    ? ? 0 C   2608 0 MG  8019 1_555 ? ? ? ? ? ? ? 2.181 ? ? 
metalc403  metalc ?    ? A  C   2608 O2    ? ? ? 1_555 DH SR  .    SR    ? ? 0 C   2608 0 SR  8919 1_555 ? ? ? ? ? ? ? 3.257 ? ? 
metalc404  metalc ?    ? A  G   2609 OP1   ? ? ? 1_555 YA MG  .    MG    ? ? 0 G   2609 0 MG  8019 1_555 ? ? ? ? ? ? ? 1.914 ? ? 
metalc405  metalc ?    ? A  G   2609 N7    ? ? ? 1_555 RJ SR  .    SR    ? ? 0 G   2609 0 SR  8995 1_555 ? ? ? ? ? ? ? 2.641 ? ? 
metalc406  metalc ?    ? A  U   2610 OP2   ? ? ? 1_555 YA MG  .    MG    ? ? 0 U   2610 0 MG  8019 1_555 ? ? ? ? ? ? ? 1.905 ? ? 
metalc407  metalc ?    ? A  G   2611 OP1   ? ? ? 1_555 MA MG  .    MG    ? ? 0 G   2611 0 MG  8007 1_555 ? ? ? ? ? ? ? 2.101 ? ? 
metalc408  metalc ?    ? A  G   2611 "O2'" ? ? ? 1_555 PC MG  .    MG    ? ? 0 G   2611 0 MG  8067 1_555 ? ? ? ? ? ? ? 2.481 ? ? 
metalc409  metalc ?    ? A  G   2611 OP1   ? ? ? 1_555 EF NA  .    NA    ? ? 0 G   2611 0 NA  8549 1_555 ? ? ? ? ? ? ? 2.725 ? ? 
metalc410  metalc ?    ? A  G   2611 OP2   ? ? ? 1_555 EF NA  .    NA    ? ? 0 G   2611 0 NA  8549 1_555 ? ? ? ? ? ? ? 2.899 ? ? 
metalc411  metalc ?    ? A  A   2612 OP1   ? ? ? 1_555 MA MG  .    MG    ? ? 0 A   2612 0 MG  8007 1_555 ? ? ? ? ? ? ? 1.983 ? ? 
metalc412  metalc ?    ? A  A   2612 "O3'" ? ? ? 1_555 ZC MG  .    MG    ? ? 0 A   2612 0 MG  8078 1_555 ? ? ? ? ? ? ? 3.077 ? ? 
metalc413  metalc ?    ? A  A   2612 "O2'" ? ? ? 1_555 ZC MG  .    MG    ? ? 0 A   2612 0 MG  8078 1_555 ? ? ? ? ? ? ? 2.612 ? ? 
metalc414  metalc ?    ? A  U   2615 O4    ? ? ? 1_555 EE NA  .    NA    ? ? 0 U   2615 0 NA  8517 1_555 ? ? ? ? ? ? ? 2.748 ? ? 
metalc415  metalc ?    ? A  U   2615 OP1   ? ? ? 1_555 OG SR  .    SR    ? ? 0 U   2615 0 SR  8902 1_555 ? ? ? ? ? ? ? 2.275 ? ? 
metalc416  metalc ?    ? A  G   2617 "O3'" ? ? ? 1_555 OC MG  .    MG    ? ? 0 G   2617 0 MG  8066 1_555 ? ? ? ? ? ? ? 3.012 ? ? 
metalc417  metalc ?    ? A  G   2617 OP2   ? ? ? 1_555 MJ SR  .    SR    ? ? 0 G   2617 0 SR  8990 1_555 ? ? ? ? ? ? ? 2.449 ? ? 
metalc418  metalc ?    ? A  G   2618 OP1   ? ? ? 1_555 YB MG  .    MG    ? ? 0 G   2618 0 MG  8046 1_555 ? ? ? ? ? ? ? 2.254 ? ? 
metalc419  metalc ?    ? A  G   2618 OP1   ? ? ? 1_555 OC MG  .    MG    ? ? 0 G   2618 0 MG  8066 1_555 ? ? ? ? ? ? ? 2.447 ? ? 
metalc420  metalc ?    ? A  G   2618 OP2   ? ? ? 1_555 MJ SR  .    SR    ? ? 0 G   2618 0 SR  8990 1_555 ? ? ? ? ? ? ? 2.347 ? ? 
metalc421  metalc ?    ? A  A   2622 OP1   ? ? ? 1_555 LJ SR  .    SR    ? ? 0 A   2622 0 SR  8989 1_555 ? ? ? ? ? ? ? 3.011 ? ? 
metalc422  metalc ?    ? A  G   2623 OP1   ? ? ? 1_555 OA MG  .    MG    ? ? 0 G   2623 0 MG  8009 1_555 ? ? ? ? ? ? ? 1.971 ? ? 
metalc423  metalc ?    ? A  G   2623 OP2   ? ? ? 1_555 LJ SR  .    SR    ? ? 0 G   2623 0 SR  8989 1_555 ? ? ? ? ? ? ? 2.543 ? ? 
metalc424  metalc ?    ? A  A   2624 OP1   ? ? ? 1_555 IA MG  .    MG    ? ? 0 A   2624 0 MG  8003 1_555 ? ? ? ? ? ? ? 1.968 ? ? 
metalc425  metalc ?    ? A  G   2632 O6    ? ? ? 1_555 EH SR  .    SR    ? ? 0 G   2632 0 SR  8920 1_555 ? ? ? ? ? ? ? 2.458 ? ? 
metalc426  metalc ?    ? A  A   2633 OP1   ? ? ? 1_555 LK SR  .    SR    ? ? 0 A   2633 A SR  8929 1_555 ? ? ? ? ? ? ? 3.188 ? ? 
metalc427  metalc ?    ? A  U   2645 "O2'" ? ? ? 1_555 TE NA  .    NA    ? ? 0 U   2645 0 NA  8534 1_555 ? ? ? ? ? ? ? 2.958 ? ? 
metalc428  metalc ?    ? A  U   2645 O2    ? ? ? 1_555 TE NA  .    NA    ? ? 0 U   2645 0 NA  8534 1_555 ? ? ? ? ? ? ? 2.899 ? ? 
metalc429  metalc ?    ? A  A   2649 N1    ? ? ? 1_555 TD NA  .    NA    ? ? 0 A   2649 0 NA  8505 1_555 ? ? ? ? ? ? ? 2.889 ? ? 
metalc430  metalc ?    ? A  U   2650 OP1   ? ? ? 1_555 AC MG  .    MG    ? ? 0 U   2650 0 MG  8048 1_555 ? ? ? ? ? ? ? 2.013 ? ? 
metalc431  metalc ?    ? A  U   2659 "O3'" ? ? ? 1_555 SE NA  .    NA    ? ? 0 U   2659 0 NA  8533 1_555 ? ? ? ? ? ? ? 2.523 ? ? 
metalc432  metalc ?    ? A  G   2660 OP1   ? ? ? 1_555 SE NA  .    NA    ? ? 0 G   2660 0 NA  8533 1_555 ? ? ? ? ? ? ? 2.639 ? ? 
metalc433  metalc ?    ? A  U   2663 O2    ? ? ? 1_555 IJ SR  .    SR    ? ? 0 U   2663 0 SR  8985 1_555 ? ? ? ? ? ? ? 2.771 ? ? 
metalc434  metalc ?    ? A  C   2672 OP1   ? ? ? 1_555 RK SR  .    SR    ? ? 0 C   2672 B SR  8987 1_555 ? ? ? ? ? ? ? 3.003 ? ? 
metalc435  metalc ?    ? A  U   2690 O4    ? ? ? 1_555 TI SR  .    SR    ? ? 0 U   2690 0 SR  8967 1_555 ? ? ? ? ? ? ? 2.970 ? ? 
metalc436  metalc ?    ? A  G   2696 O6    ? ? ? 1_555 FI SR  .    SR    ? ? 0 G   2696 0 SR  8951 1_555 ? ? ? ? ? ? ? 2.448 ? ? 
metalc437  metalc ?    ? A  G   2700 OP2   ? ? ? 1_555 KJ SR  .    SR    ? ? 0 G   2700 0 SR  8988 1_555 ? ? ? ? ? ? ? 2.809 ? ? 
metalc438  metalc ?    ? A  G   2725 OP2   ? ? ? 1_555 IH SR  .    SR    ? ? 0 G   2725 0 SR  8924 1_555 ? ? ? ? ? ? ? 3.344 ? ? 
metalc439  metalc ?    ? A  A   2746 OP2   ? ? ? 1_555 XH SR  .    SR    ? ? 0 A   2746 0 SR  8942 1_555 ? ? ? ? ? ? ? 2.507 ? ? 
metalc440  metalc ?    ? A  G   2750 OP2   ? ? ? 1_555 XH SR  .    SR    ? ? 0 G   2750 0 SR  8942 1_555 ? ? ? ? ? ? ? 2.404 ? ? 
metalc441  metalc ?    ? A  G   2755 O6    ? ? ? 1_555 IH SR  .    SR    ? ? 0 G   2755 0 SR  8924 1_555 ? ? ? ? ? ? ? 2.684 ? ? 
metalc442  metalc ?    ? A  A   2757 OP1   ? ? ? 1_555 VB MG  .    MG    ? ? 0 A   2757 0 MG  8043 1_555 ? ? ? ? ? ? ? 1.991 ? ? 
metalc443  metalc ?    ? A  G   2772 O6    ? ? ? 1_555 AG NA  .    NA    ? ? 0 G   2772 0 NA  8571 1_555 ? ? ? ? ? ? ? 2.372 ? ? 
metalc444  metalc ?    ? A  G   2773 O6    ? ? ? 1_555 AG NA  .    NA    ? ? 0 G   2773 0 NA  8571 1_555 ? ? ? ? ? ? ? 2.779 ? ? 
metalc445  metalc ?    ? A  G   2777 O6    ? ? ? 1_555 QI SR  .    SR    ? ? 0 G   2777 0 SR  8964 1_555 ? ? ? ? ? ? ? 2.876 ? ? 
metalc446  metalc ?    ? A  G   2810 O6    ? ? ? 1_555 HI SR  .    SR    ? ? 0 G   2810 0 SR  8954 1_555 ? ? ? ? ? ? ? 2.499 ? ? 
metalc447  metalc ?    ? A  A   2811 "O2'" ? ? ? 1_555 IJ SR  .    SR    ? ? 0 A   2811 0 SR  8985 1_555 ? ? ? ? ? ? ? 2.846 ? ? 
metalc448  metalc ?    ? A  A   2811 "O3'" ? ? ? 1_555 IJ SR  .    SR    ? ? 0 A   2811 0 SR  8985 1_555 ? ? ? ? ? ? ? 2.834 ? ? 
metalc449  metalc ?    ? A  A   2812 OP2   ? ? ? 1_555 IJ SR  .    SR    ? ? 0 A   2812 0 SR  8985 1_555 ? ? ? ? ? ? ? 3.221 ? ? 
metalc450  metalc ?    ? A  A   2816 "O2'" ? ? ? 1_555 IJ SR  .    SR    ? ? 0 A   2816 0 SR  8985 1_555 ? ? ? ? ? ? ? 2.915 ? ? 
metalc451  metalc ?    ? A  G   2817 OP2   ? ? ? 1_555 IJ SR  .    SR    ? ? 0 G   2817 0 SR  8985 1_555 ? ? ? ? ? ? ? 2.973 ? ? 
metalc452  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 SC MG  .    MG    ? ? 0 HOH 3049 0 MG  8070 1_555 ? ? ? ? ? ? ? 2.403 ? ? 
metalc453  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ID MG  .    MG    ? ? 0 HOH 3071 0 MG  8088 1_555 ? ? ? ? ? ? ? 2.321 ? ? 
metalc454  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 JD MG  .    MG    ? ? 0 HOH 3092 0 MG  8089 1_555 ? ? ? ? ? ? ? 2.313 ? ? 
metalc455  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HE NA  .    NA    ? ? 0 HOH 3127 0 NA  8521 1_555 ? ? ? ? ? ? ? 2.254 ? ? 
metalc456  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NA MG  .    MG    ? ? 0 HOH 3139 0 MG  8008 1_555 ? ? ? ? ? ? ? 2.030 ? ? 
metalc457  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MI SR  .    SR    ? ? 0 HOH 3172 0 SR  8959 1_555 ? ? ? ? ? ? ? 2.340 ? ? 
metalc458  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 WG SR  .    SR    ? ? 0 HOH 3179 0 SR  8910 1_555 ? ? ? ? ? ? ? 2.489 ? ? 
metalc459  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AE NA  .    NA    ? ? 0 HOH 3189 0 NA  8513 1_555 ? ? ? ? ? ? ? 2.880 ? ? 
metalc460  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 JE NA  .    NA    ? ? 0 HOH 3231 0 NA  8523 1_555 ? ? ? ? ? ? ? 2.855 ? ? 
metalc461  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 DC MG  .    MG    ? ? 0 HOH 3235 0 MG  8053 1_555 ? ? ? ? ? ? ? 2.362 ? ? 
metalc462  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 EE NA  .    NA    ? ? 0 HOH 3245 0 NA  8517 1_555 ? ? ? ? ? ? ? 2.547 ? ? 
metalc463  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NC MG  .    MG    ? ? 0 HOH 3254 0 MG  8065 1_555 ? ? ? ? ? ? ? 1.989 ? ? 
metalc464  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 VL SR  .    SR    ? ? 0 HOH 3278 1 SR  8952 1_555 ? ? ? ? ? ? ? 2.767 ? ? 
metalc465  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 JA MG  .    MG    ? ? 0 HOH 3279 0 MG  8004 1_555 ? ? ? ? ? ? ? 2.074 ? ? 
metalc466  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 WH SR  .    SR    ? ? 0 HOH 3288 0 SR  8941 1_555 ? ? ? ? ? ? ? 2.793 ? ? 
metalc467  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 EI SR  .    SR    ? ? 0 HOH 3310 0 SR  8949 1_555 ? ? ? ? ? ? ? 2.476 ? ? 
metalc468  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MB MG  .    MG    ? ? 0 HOH 3315 0 MG  8033 1_555 ? ? ? ? ? ? ? 2.462 ? ? 
metalc469  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 KF NA  .    NA    ? ? 0 HOH 3318 0 NA  8555 1_555 ? ? ? ? ? ? ? 2.621 ? ? 
metalc470  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AC MG  .    MG    ? ? 0 HOH 3322 0 MG  8048 1_555 ? ? ? ? ? ? ? 2.161 ? ? 
metalc471  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NF NA  .    NA    ? ? 0 HOH 3332 0 NA  8558 1_555 ? ? ? ? ? ? ? 2.550 ? ? 
metalc472  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 QE NA  .    NA    ? ? 0 HOH 3375 0 NA  8530 1_555 ? ? ? ? ? ? ? 2.573 ? ? 
metalc473  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MF NA  .    NA    ? ? 0 HOH 3388 0 NA  8557 1_555 ? ? ? ? ? ? ? 2.733 ? ? 
metalc474  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 IB MG  .    MG    ? ? 0 HOH 3413 0 MG  8029 1_555 ? ? ? ? ? ? ? 2.411 ? ? 
metalc475  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RE NA  .    NA    ? ? 0 HOH 3427 0 NA  8531 1_555 ? ? ? ? ? ? ? 2.474 ? ? 
metalc476  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 WA MG  .    MG    ? ? 0 HOH 3438 0 MG  8017 1_555 ? ? ? ? ? ? ? 2.286 ? ? 
metalc477  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 QK SR  .    SR    ? ? 0 HOH 3451 B SR  8950 1_555 ? ? ? ? ? ? ? 2.620 ? ? 
metalc478  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YD NA  .    NA    ? ? 0 HOH 3455 0 NA  8511 1_555 ? ? ? ? ? ? ? 2.596 ? ? 
metalc479  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 UA MG  .    MG    ? ? 0 HOH 3467 0 MG  8015 1_555 ? ? ? ? ? ? ? 2.166 ? ? 
metalc480  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 EB MG  .    MG    ? ? 0 HOH 3492 0 MG  8025 1_555 ? ? ? ? ? ? ? 2.153 ? ? 
metalc481  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ZC MG  .    MG    ? ? 0 HOH 3515 0 MG  8078 1_555 ? ? ? ? ? ? ? 2.475 ? ? 
metalc482  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 TE NA  .    NA    ? ? 0 HOH 3530 0 NA  8534 1_555 ? ? ? ? ? ? ? 2.860 ? ? 
metalc483  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 UE NA  .    NA    ? ? 0 HOH 3538 0 NA  8535 1_555 ? ? ? ? ? ? ? 2.612 ? ? 
metalc484  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 GH SR  .    SR    ? ? 0 HOH 3542 0 SR  8922 1_555 ? ? ? ? ? ? ? 2.555 ? ? 
metalc485  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 TI SR  .    SR    ? ? 0 HOH 3554 0 SR  8967 1_555 ? ? ? ? ? ? ? 2.586 ? ? 
metalc486  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 II SR  .    SR    ? ? 0 HOH 3559 0 SR  8955 1_555 ? ? ? ? ? ? ? 2.412 ? ? 
metalc487  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ZD NA  .    NA    ? ? 0 HOH 3632 0 NA  8512 1_555 ? ? ? ? ? ? ? 2.713 ? ? 
metalc488  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 GB MG  .    MG    ? ? 0 HOH 3637 0 MG  8027 1_555 ? ? ? ? ? ? ? 2.132 ? ? 
metalc489  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 QD NA  .    NA    ? ? 0 HOH 3671 0 NA  8501 1_555 ? ? ? ? ? ? ? 2.444 ? ? 
metalc490  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 QD NA  .    NA    ? ? 0 HOH 3702 0 NA  8501 1_555 ? ? ? ? ? ? ? 2.678 ? ? 
metalc491  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 JE NA  .    NA    ? ? 0 HOH 3707 0 NA  8523 1_555 ? ? ? ? ? ? ? 2.934 ? ? 
metalc492  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 GB MG  .    MG    ? ? 0 HOH 3713 0 MG  8027 1_555 ? ? ? ? ? ? ? 2.167 ? ? 
metalc493  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NA MG  .    MG    ? ? 0 HOH 3729 0 MG  8008 1_555 ? ? ? ? ? ? ? 2.256 ? ? 
metalc494  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HE NA  .    NA    ? ? 0 HOH 3777 0 NA  8521 1_555 ? ? ? ? ? ? ? 2.574 ? ? 
metalc495  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 PH SR  .    SR    ? ? 0 HOH 3777 0 SR  8934 1_555 ? ? ? ? ? ? ? 2.624 ? ? 
metalc496  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NB MG  .    MG    ? ? 0 HOH 3796 0 MG  8034 1_555 ? ? ? ? ? ? ? 2.496 ? ? 
metalc497  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RJ SR  .    SR    ? ? 0 HOH 3800 0 SR  8995 1_555 ? ? ? ? ? ? ? 2.622 ? ? 
metalc498  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MI SR  .    SR    ? ? 0 HOH 3803 0 SR  8959 1_555 ? ? ? ? ? ? ? 2.691 ? ? 
metalc499  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 SC MG  .    MG    ? ? 0 HOH 3824 0 MG  8070 1_555 ? ? ? ? ? ? ? 2.268 ? ? 
metalc500  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 XC MG  .    MG    ? ? 0 HOH 3840 0 MG  8076 1_555 ? ? ? ? ? ? ? 2.407 ? ? 
metalc501  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 KH SR  .    SR    ? ? 0 HOH 3841 0 SR  8926 1_555 ? ? ? ? ? ? ? 2.451 ? ? 
metalc502  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YC MG  .    MG    ? ? 0 HOH 3868 0 MG  8077 1_555 ? ? ? ? ? ? ? 2.453 ? ? 
metalc503  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 VD NA  .    NA    ? ? 0 HOH 3909 0 NA  8507 1_555 ? ? ? ? ? ? ? 2.487 ? ? 
metalc504  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AL MG  .    MG    ? ? 0 HOH 3919 K MG  8054 1_555 ? ? ? ? ? ? ? 2.338 ? ? 
metalc505  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MH SR  .    SR    ? ? 0 HOH 3950 0 SR  8928 1_555 ? ? ? ? ? ? ? 2.627 ? ? 
metalc506  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 DE NA  .    NA    ? ? 0 HOH 3961 0 NA  8516 1_555 ? ? ? ? ? ? ? 2.525 ? ? 
metalc507  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 JF NA  .    NA    ? ? 0 HOH 3974 0 NA  8554 1_555 ? ? ? ? ? ? ? 2.690 ? ? 
metalc508  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 XD NA  .    NA    ? ? 0 HOH 4072 0 NA  8509 1_555 ? ? ? ? ? ? ? 2.263 ? ? 
metalc509  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ED MG  .    MG    ? ? 0 HOH 4096 0 MG  8083 1_555 ? ? ? ? ? ? ? 2.271 ? ? 
metalc510  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 JC MG  .    MG    ? ? 0 HOH 4107 0 MG  8061 1_555 ? ? ? ? ? ? ? 2.155 ? ? 
metalc511  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 KA MG  .    MG    ? ? 0 HOH 4108 0 MG  8005 1_555 ? ? ? ? ? ? ? 2.058 ? ? 
metalc512  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RH SR  .    SR    ? ? 0 HOH 4109 0 SR  8936 1_555 ? ? ? ? ? ? ? 2.798 ? ? 
metalc513  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 GA MG  .    MG    ? ? 0 HOH 4111 0 MG  8001 1_555 ? ? ? ? ? ? ? 2.133 ? ? 
metalc514  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 JC MG  .    MG    ? ? 0 HOH 4112 0 MG  8061 1_555 ? ? ? ? ? ? ? 2.146 ? ? 
metalc515  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 EI SR  .    SR    ? ? 0 HOH 4113 0 SR  8949 1_555 ? ? ? ? ? ? ? 2.344 ? ? 
metalc516  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 QA MG  .    MG    ? ? 0 HOH 4117 0 MG  8011 1_555 ? ? ? ? ? ? ? 1.956 ? ? 
metalc517  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 CJ SR  .    SR    ? ? 0 HOH 4119 0 SR  8978 1_555 ? ? ? ? ? ? ? 2.415 ? ? 
metalc518  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HB MG  .    MG    ? ? 0 HOH 4121 0 MG  8028 1_555 ? ? ? ? ? ? ? 2.023 ? ? 
metalc519  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MJ SR  .    SR    ? ? 0 HOH 4123 0 SR  8990 1_555 ? ? ? ? ? ? ? 2.383 ? ? 
metalc520  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 JC MG  .    MG    ? ? 0 HOH 4124 0 MG  8061 1_555 ? ? ? ? ? ? ? 2.198 ? ? 
metalc521  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 LA MG  .    MG    ? ? 0 HOH 4125 0 MG  8006 1_555 ? ? ? ? ? ? ? 2.104 ? ? 
metalc522  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 PG SR  .    SR    ? ? 0 HOH 4128 0 SR  8903 1_555 ? ? ? ? ? ? ? 2.689 ? ? 
metalc523  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NC MG  .    MG    ? ? 0 HOH 4130 0 MG  8065 1_555 ? ? ? ? ? ? ? 2.009 ? ? 
metalc524  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HC MG  .    MG    ? ? 0 HOH 4133 0 MG  8059 1_555 ? ? ? ? ? ? ? 2.170 ? ? 
metalc525  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 UA MG  .    MG    ? ? 0 HOH 4134 0 MG  8015 1_555 ? ? ? ? ? ? ? 2.075 ? ? 
metalc526  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 UA MG  .    MG    ? ? 0 HOH 4135 0 MG  8015 1_555 ? ? ? ? ? ? ? 2.005 ? ? 
metalc527  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 CB MG  .    MG    ? ? 0 HOH 4136 0 MG  8023 1_555 ? ? ? ? ? ? ? 2.138 ? ? 
metalc528  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 OA MG  .    MG    ? ? 0 HOH 4138 0 MG  8009 1_555 ? ? ? ? ? ? ? 2.215 ? ? 
metalc529  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 DI SR  .    SR    ? ? 0 HOH 4139 0 SR  8948 1_555 ? ? ? ? ? ? ? 2.726 ? ? 
metalc530  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NA MG  .    MG    ? ? 0 HOH 4144 0 MG  8008 1_555 ? ? ? ? ? ? ? 2.334 ? ? 
metalc531  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 GB MG  .    MG    ? ? 0 HOH 4145 0 MG  8027 1_555 ? ? ? ? ? ? ? 2.431 ? ? 
metalc532  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HB MG  .    MG    ? ? 0 HOH 4146 0 MG  8028 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
metalc533  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 UC MG  .    MG    ? ? 0 HOH 4147 0 MG  8072 1_555 ? ? ? ? ? ? ? 2.312 ? ? 
metalc534  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 OA MG  .    MG    ? ? 0 HOH 4151 0 MG  8009 1_555 ? ? ? ? ? ? ? 1.969 ? ? 
metalc535  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 LB MG  .    MG    ? ? 0 HOH 4154 0 MG  8032 1_555 ? ? ? ? ? ? ? 2.499 ? ? 
metalc536  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 PA MG  .    MG    ? ? 0 HOH 4156 0 MG  8010 1_555 ? ? ? ? ? ? ? 2.233 ? ? 
metalc537  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 WC MG  .    MG    ? ? 0 HOH 4160 0 MG  8075 1_555 ? ? ? ? ? ? ? 2.333 ? ? 
metalc538  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 IA MG  .    MG    ? ? 0 HOH 4163 0 MG  8003 1_555 ? ? ? ? ? ? ? 2.173 ? ? 
metalc539  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ZC MG  .    MG    ? ? 0 HOH 4164 0 MG  8078 1_555 ? ? ? ? ? ? ? 2.363 ? ? 
metalc540  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 VB MG  .    MG    ? ? 0 HOH 4165 0 MG  8043 1_555 ? ? ? ? ? ? ? 2.011 ? ? 
metalc541  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 FB MG  .    MG    ? ? 0 HOH 4167 0 MG  8026 1_555 ? ? ? ? ? ? ? 2.167 ? ? 
metalc542  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HB MG  .    MG    ? ? 0 HOH 4168 0 MG  8028 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
metalc543  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 XC MG  .    MG    ? ? 0 HOH 4169 0 MG  8076 1_555 ? ? ? ? ? ? ? 2.142 ? ? 
metalc544  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HB MG  .    MG    ? ? 0 HOH 4170 0 MG  8028 1_555 ? ? ? ? ? ? ? 2.091 ? ? 
metalc545  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 XC MG  .    MG    ? ? 0 HOH 4173 0 MG  8076 1_555 ? ? ? ? ? ? ? 2.458 ? ? 
metalc546  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AB MG  .    MG    ? ? 0 HOH 4175 0 MG  8021 1_555 ? ? ? ? ? ? ? 2.131 ? ? 
metalc547  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ZC MG  .    MG    ? ? 0 HOH 4176 0 MG  8078 1_555 ? ? ? ? ? ? ? 2.137 ? ? 
metalc548  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 TF NA  .    NA    ? ? 0 HOH 4177 0 NA  8564 1_555 ? ? ? ? ? ? ? 2.836 ? ? 
metalc549  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 UC MG  .    MG    ? ? 0 HOH 4179 0 MG  8072 1_555 ? ? ? ? ? ? ? 2.273 ? ? 
metalc550  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MD MG  .    MG    ? ? 0 HOH 4186 0 MG  8092 1_555 ? ? ? ? ? ? ? 2.427 ? ? 
metalc551  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ZF NA  .    NA    ? ? 0 HOH 4188 0 NA  8570 1_555 ? ? ? ? ? ? ? 2.421 ? ? 
metalc552  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NI SR  .    SR    ? ? 0 HOH 4191 0 SR  8960 1_555 ? ? ? ? ? ? ? 2.612 ? ? 
metalc553  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AB MG  .    MG    ? ? 0 HOH 4196 0 MG  8021 1_555 ? ? ? ? ? ? ? 2.271 ? ? 
metalc554  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 WC MG  .    MG    ? ? 0 HOH 4197 0 MG  8075 1_555 ? ? ? ? ? ? ? 2.237 ? ? 
metalc555  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MC MG  .    MG    ? ? 0 HOH 4204 0 MG  8064 1_555 ? ? ? ? ? ? ? 2.016 ? ? 
metalc556  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AB MG  .    MG    ? ? 0 HOH 4207 0 MG  8021 1_555 ? ? ? ? ? ? ? 2.009 ? ? 
metalc557  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YF NA  .    NA    ? ? 0 HOH 4210 0 NA  8569 1_555 ? ? ? ? ? ? ? 2.383 ? ? 
metalc558  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AI SR  .    SR    ? ? 0 HOH 4212 0 SR  8945 1_555 ? ? ? ? ? ? ? 2.697 ? ? 
metalc559  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RJ SR  .    SR    ? ? 0 HOH 4217 0 SR  8995 1_555 ? ? ? ? ? ? ? 2.606 ? ? 
metalc560  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YB MG  .    MG    ? ? 0 HOH 4218 0 MG  8046 1_555 ? ? ? ? ? ? ? 2.175 ? ? 
metalc561  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 UC MG  .    MG    ? ? 0 HOH 4219 0 MG  8072 1_555 ? ? ? ? ? ? ? 2.374 ? ? 
metalc562  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ID MG  .    MG    ? ? 0 HOH 4222 0 MG  8088 1_555 ? ? ? ? ? ? ? 2.207 ? ? 
metalc563  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 OH SR  .    SR    ? ? 0 HOH 4228 0 SR  8933 1_555 ? ? ? ? ? ? ? 2.575 ? ? 
metalc564  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MA MG  .    MG    ? ? 0 HOH 4234 0 MG  8007 1_555 ? ? ? ? ? ? ? 2.130 ? ? 
metalc565  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YC MG  .    MG    ? ? 0 HOH 4243 0 MG  8077 1_555 ? ? ? ? ? ? ? 2.237 ? ? 
metalc566  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 EI SR  .    SR    ? ? 0 HOH 4249 0 SR  8949 1_555 ? ? ? ? ? ? ? 2.659 ? ? 
metalc567  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 OK MG  .    MG    ? ? 0 HOH 4253 B MG  8042 1_555 ? ? ? ? ? ? ? 2.064 ? ? 
metalc568  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 OJ SR  .    SR    ? ? 0 HOH 4256 0 SR  8992 1_555 ? ? ? ? ? ? ? 2.728 ? ? 
metalc569  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 XB MG  .    MG    ? ? 0 HOH 4259 0 MG  8045 1_555 ? ? ? ? ? ? ? 2.098 ? ? 
metalc570  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 VG SR  .    SR    ? ? 0 HOH 4262 0 SR  8909 1_555 ? ? ? ? ? ? ? 2.308 ? ? 
metalc571  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ID MG  .    MG    ? ? 0 HOH 4263 0 MG  8088 1_555 ? ? ? ? ? ? ? 2.235 ? ? 
metalc572  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 DI SR  .    SR    ? ? 0 HOH 4265 0 SR  8948 1_555 ? ? ? ? ? ? ? 2.685 ? ? 
metalc573  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 JA MG  .    MG    ? ? 0 HOH 4278 0 MG  8004 1_555 ? ? ? ? ? ? ? 2.006 ? ? 
metalc574  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 OC MG  .    MG    ? ? 0 HOH 4283 0 MG  8066 1_555 ? ? ? ? ? ? ? 2.132 ? ? 
metalc575  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 EB MG  .    MG    ? ? 0 HOH 4284 0 MG  8025 1_555 ? ? ? ? ? ? ? 2.359 ? ? 
metalc576  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RC MG  .    MG    ? ? 0 HOH 4290 0 MG  8069 1_555 ? ? ? ? ? ? ? 2.056 ? ? 
metalc577  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 IH SR  .    SR    ? ? 0 HOH 4308 0 SR  8924 1_555 ? ? ? ? ? ? ? 2.787 ? ? 
metalc578  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 EC MG  .    MG    ? ? 0 HOH 4310 0 MG  8055 1_555 ? ? ? ? ? ? ? 2.437 ? ? 
metalc579  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MJ SR  .    SR    ? ? 0 HOH 4314 0 SR  8990 1_555 ? ? ? ? ? ? ? 2.244 ? ? 
metalc580  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HH SR  .    SR    ? ? 0 HOH 4317 0 SR  8923 1_555 ? ? ? ? ? ? ? 2.602 ? ? 
metalc581  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 TG SR  .    SR    ? ? 0 HOH 4321 0 SR  8907 1_555 ? ? ? ? ? ? ? 2.674 ? ? 
metalc582  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 WC MG  .    MG    ? ? 0 HOH 4328 0 MG  8075 1_555 ? ? ? ? ? ? ? 2.276 ? ? 
metalc583  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YD NA  .    NA    ? ? 0 HOH 4329 0 NA  8511 1_555 ? ? ? ? ? ? ? 2.389 ? ? 
metalc584  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 OG SR  .    SR    ? ? 0 HOH 4333 0 SR  8902 1_555 ? ? ? ? ? ? ? 2.468 ? ? 
metalc585  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MD MG  .    MG    ? ? 0 HOH 4359 0 MG  8092 1_555 ? ? ? ? ? ? ? 2.412 ? ? 
metalc586  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ZA MG  .    MG    ? ? 0 HOH 4367 0 MG  8020 1_555 ? ? ? ? ? ? ? 2.185 ? ? 
metalc587  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MF NA  .    NA    ? ? 0 HOH 4375 0 NA  8557 1_555 ? ? ? ? ? ? ? 2.806 ? ? 
metalc588  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 VL SR  .    SR    ? ? 0 HOH 4376 1 SR  8952 1_555 ? ? ? ? ? ? ? 2.754 ? ? 
metalc589  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HC MG  .    MG    ? ? 0 HOH 4408 0 MG  8059 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc590  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 JD MG  .    MG    ? ? 0 HOH 4416 0 MG  8089 1_555 ? ? ? ? ? ? ? 2.479 ? ? 
metalc591  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HD MG  .    MG    ? ? 0 HOH 4418 0 MG  8087 1_555 ? ? ? ? ? ? ? 2.409 ? ? 
metalc592  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 DE NA  .    NA    ? ? 0 HOH 4422 0 NA  8516 1_555 ? ? ? ? ? ? ? 2.234 ? ? 
metalc593  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RA MG  .    MG    ? ? 0 HOH 4435 0 MG  8012 1_555 ? ? ? ? ? ? ? 1.988 ? ? 
metalc594  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 PG SR  .    SR    ? ? 0 HOH 4449 0 SR  8903 1_555 ? ? ? ? ? ? ? 2.498 ? ? 
metalc595  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YL SR  .    SR    ? ? 0 HOH 4450 3 SR  8932 1_555 ? ? ? ? ? ? ? 2.533 ? ? 
metalc596  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NG SR  .    SR    ? ? 0 HOH 4451 0 SR  8901 1_555 ? ? ? ? ? ? ? 2.216 ? ? 
metalc597  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 IB MG  .    MG    ? ? 0 HOH 4458 0 MG  8029 1_555 ? ? ? ? ? ? ? 2.139 ? ? 
metalc598  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 IK MG  .    MG    ? ? 0 HOH 4462 A MG  8050 1_555 ? ? ? ? ? ? ? 1.888 ? ? 
metalc599  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 VB MG  .    MG    ? ? 0 HOH 4467 0 MG  8043 1_555 ? ? ? ? ? ? ? 2.214 ? ? 
metalc600  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 OH SR  .    SR    ? ? 0 HOH 4468 0 SR  8933 1_555 ? ? ? ? ? ? ? 2.557 ? ? 
metalc601  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 FC MG  .    MG    ? ? 0 HOH 4490 0 MG  8056 1_555 ? ? ? ? ? ? ? 2.140 ? ? 
metalc602  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ZA MG  .    MG    ? ? 0 HOH 4508 0 MG  8020 1_555 ? ? ? ? ? ? ? 2.010 ? ? 
metalc603  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YB MG  .    MG    ? ? 0 HOH 4545 0 MG  8046 1_555 ? ? ? ? ? ? ? 2.039 ? ? 
metalc604  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 SD NA  .    NA    ? ? 0 HOH 4580 0 NA  8504 1_555 ? ? ? ? ? ? ? 2.642 ? ? 
metalc605  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 QF NA  .    NA    ? ? 0 HOH 4593 0 NA  8561 1_555 ? ? ? ? ? ? ? 2.511 ? ? 
metalc606  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 KB MG  .    MG    ? ? 0 HOH 4599 0 MG  8031 1_555 ? ? ? ? ? ? ? 2.459 ? ? 
metalc607  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 GE NA  .    NA    ? ? 0 HOH 4620 0 NA  8520 1_555 ? ? ? ? ? ? ? 2.476 ? ? 
metalc608  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 SA MG  .    MG    ? ? 0 HOH 4643 0 MG  8013 1_555 ? ? ? ? ? ? ? 2.104 ? ? 
metalc609  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MC MG  .    MG    ? ? 0 HOH 4644 0 MG  8064 1_555 ? ? ? ? ? ? ? 2.159 ? ? 
metalc610  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ZA MG  .    MG    ? ? 0 HOH 4648 0 MG  8020 1_555 ? ? ? ? ? ? ? 2.491 ? ? 
metalc611  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 PA MG  .    MG    ? ? 0 HOH 4656 0 MG  8010 1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc612  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 XA MG  .    MG    ? ? 0 HOH 4661 0 MG  8018 1_555 ? ? ? ? ? ? ? 2.170 ? ? 
metalc613  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 BC MG  .    MG    ? ? 0 HOH 4673 0 MG  8049 1_555 ? ? ? ? ? ? ? 2.191 ? ? 
metalc614  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 EB MG  .    MG    ? ? 0 HOH 4682 0 MG  8025 1_555 ? ? ? ? ? ? ? 2.068 ? ? 
metalc615  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 KB MG  .    MG    ? ? 0 HOH 4693 0 MG  8031 1_555 ? ? ? ? ? ? ? 2.421 ? ? 
metalc616  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AL MG  .    MG    ? ? 0 HOH 4731 K MG  8054 1_555 ? ? ? ? ? ? ? 2.341 ? ? 
metalc617  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 VG SR  .    SR    ? ? 0 HOH 4739 0 SR  8909 1_555 ? ? ? ? ? ? ? 2.619 ? ? 
metalc618  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 VH SR  .    SR    ? ? 0 HOH 4749 0 SR  8940 1_555 ? ? ? ? ? ? ? 2.623 ? ? 
metalc619  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 LD MG  .    MG    ? ? 0 HOH 4774 0 MG  8091 1_555 ? ? ? ? ? ? ? 2.269 ? ? 
metalc620  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NG SR  .    SR    ? ? 0 HOH 4779 0 SR  8901 1_555 ? ? ? ? ? ? ? 2.254 ? ? 
metalc621  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 TE NA  .    NA    ? ? 0 HOH 4781 0 NA  8534 1_555 ? ? ? ? ? ? ? 2.863 ? ? 
metalc622  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 SH SR  .    SR    ? ? 0 HOH 4782 0 SR  8937 1_555 ? ? ? ? ? ? ? 2.643 ? ? 
metalc623  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 LD MG  .    MG    ? ? 0 HOH 4790 0 MG  8091 1_555 ? ? ? ? ? ? ? 2.492 ? ? 
metalc624  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HA MG  .    MG    ? ? 0 HOH 4813 0 MG  8002 1_555 ? ? ? ? ? ? ? 1.994 ? ? 
metalc625  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MK SR  .    SR    ? ? 0 HOH 4840 A SR  8930 1_555 ? ? ? ? ? ? ? 2.627 ? ? 
metalc626  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NG SR  .    SR    ? ? 0 HOH 4913 0 SR  8901 1_555 ? ? ? ? ? ? ? 2.403 ? ? 
metalc627  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YF NA  .    NA    ? ? 0 HOH 4917 0 NA  8569 1_555 ? ? ? ? ? ? ? 2.253 ? ? 
metalc628  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 FE NA  .    NA    ? ? 0 HOH 4968 0 NA  8519 1_555 ? ? ? ? ? ? ? 2.265 ? ? 
metalc629  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 WD NA  .    NA    ? ? 0 HOH 4993 0 NA  8508 1_555 ? ? ? ? ? ? ? 2.984 ? ? 
metalc630  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NG SR  .    SR    ? ? 0 HOH 5018 0 SR  8901 1_555 ? ? ? ? ? ? ? 2.483 ? ? 
metalc631  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 FH SR  .    SR    ? ? 0 HOH 5042 0 SR  8921 1_555 ? ? ? ? ? ? ? 2.519 ? ? 
metalc632  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HJ SR  .    SR    ? ? 0 HOH 5055 0 SR  8984 1_555 ? ? ? ? ? ? ? 2.785 ? ? 
metalc633  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NF NA  .    NA    ? ? 0 HOH 5092 0 NA  8558 1_555 ? ? ? ? ? ? ? 2.772 ? ? 
metalc634  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AD MG  .    MG    ? ? 0 HOH 5111 0 MG  8079 1_555 ? ? ? ? ? ? ? 2.331 ? ? 
metalc635  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 XD NA  .    NA    ? ? 0 HOH 5144 0 NA  8509 1_555 ? ? ? ? ? ? ? 2.428 ? ? 
metalc636  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 SD NA  .    NA    ? ? 0 HOH 5190 0 NA  8504 1_555 ? ? ? ? ? ? ? 2.524 ? ? 
metalc637  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 SI SR  .    SR    ? ? 0 HOH 5191 0 SR  8966 1_555 ? ? ? ? ? ? ? 2.770 ? ? 
metalc638  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 BF NA  .    NA    ? ? 0 HOH 5298 0 NA  8546 1_555 ? ? ? ? ? ? ? 2.183 ? ? 
metalc639  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AF NA  .    NA    ? ? 0 HOH 5306 0 NA  8545 1_555 ? ? ? ? ? ? ? 2.423 ? ? 
metalc640  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 DC MG  .    MG    ? ? 0 HOH 5309 0 MG  8053 1_555 ? ? ? ? ? ? ? 1.998 ? ? 
metalc641  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 TG SR  .    SR    ? ? 0 HOH 5315 0 SR  8907 1_555 ? ? ? ? ? ? ? 2.688 ? ? 
metalc642  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 DI SR  .    SR    ? ? 0 HOH 5351 0 SR  8948 1_555 ? ? ? ? ? ? ? 2.611 ? ? 
metalc643  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 CK SR  .    SR    ? ? 0 HOH 5359 0 SR  9008 1_555 ? ? ? ? ? ? ? 2.797 ? ? 
metalc644  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 UL SR  .    SR    ? ? 0 HOH 5368 1 SR  8913 1_555 ? ? ? ? ? ? ? 2.785 ? ? 
metalc645  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HF NA  .    NA    ? ? 0 HOH 5388 0 NA  8552 1_555 ? ? ? ? ? ? ? 2.780 ? ? 
metalc646  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HC MG  .    MG    ? ? 0 HOH 5418 0 MG  8059 1_555 ? ? ? ? ? ? ? 2.428 ? ? 
metalc647  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 QD NA  .    NA    ? ? 0 HOH 5452 0 NA  8501 1_555 ? ? ? ? ? ? ? 2.369 ? ? 
metalc648  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 TH SR  .    SR    ? ? 0 HOH 5499 0 SR  8938 1_555 ? ? ? ? ? ? ? 2.747 ? ? 
metalc649  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 BG NA  .    NA    ? ? 0 HOH 5500 0 NA  8573 1_555 ? ? ? ? ? ? ? 2.677 ? ? 
metalc650  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YD NA  .    NA    ? ? 0 HOH 5552 0 NA  8511 1_555 ? ? ? ? ? ? ? 2.741 ? ? 
metalc651  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 IB MG  .    MG    ? ? 0 HOH 5579 0 MG  8029 1_555 ? ? ? ? ? ? ? 2.493 ? ? 
metalc652  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 TK SR  .    SR    ? ? 0 HOH 5583 F SR  9005 1_555 ? ? ? ? ? ? ? 2.617 ? ? 
metalc653  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YD NA  .    NA    ? ? 0 HOH 5599 0 NA  8511 1_555 ? ? ? ? ? ? ? 2.375 ? ? 
metalc654  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 TH SR  .    SR    ? ? 0 HOH 5661 0 SR  8938 1_555 ? ? ? ? ? ? ? 2.594 ? ? 
metalc655  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 KE NA  .    NA    ? ? 0 HOH 5693 0 NA  8524 1_555 ? ? ? ? ? ? ? 2.899 ? ? 
metalc656  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YG SR  .    SR    ? ? 0 HOH 5697 0 SR  8914 1_555 ? ? ? ? ? ? ? 2.715 ? ? 
metalc657  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 LC MG  .    MG    ? ? 0 HOH 5721 0 MG  8063 1_555 ? ? ? ? ? ? ? 2.471 ? ? 
metalc658  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 PE NA  .    NA    ? ? 0 HOH 5727 0 NA  8529 1_555 ? ? ? ? ? ? ? 2.481 ? ? 
metalc659  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 BG NA  .    NA    ? ? 0 HOH 5730 0 NA  8573 1_555 ? ? ? ? ? ? ? 2.775 ? ? 
metalc660  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RE NA  .    NA    ? ? 0 HOH 5818 0 NA  8531 1_555 ? ? ? ? ? ? ? 2.187 ? ? 
metalc661  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HD MG  .    MG    ? ? 0 HOH 5880 0 MG  8087 1_555 ? ? ? ? ? ? ? 2.195 ? ? 
metalc662  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 VG SR  .    SR    ? ? 0 HOH 5986 0 SR  8909 1_555 ? ? ? ? ? ? ? 2.451 ? ? 
metalc663  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 TI SR  .    SR    ? ? 0 HOH 6016 0 SR  8967 1_555 ? ? ? ? ? ? ? 2.645 ? ? 
metalc664  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 XC MG  .    MG    ? ? 0 HOH 6033 0 MG  8076 1_555 ? ? ? ? ? ? ? 2.437 ? ? 
metalc665  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RJ SR  .    SR    ? ? 0 HOH 6083 0 SR  8995 1_555 ? ? ? ? ? ? ? 2.296 ? ? 
metalc666  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 GH SR  .    SR    ? ? 0 HOH 6097 0 SR  8922 1_555 ? ? ? ? ? ? ? 2.552 ? ? 
metalc667  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RJ SR  .    SR    ? ? 0 HOH 6228 0 SR  8995 1_555 ? ? ? ? ? ? ? 2.744 ? ? 
metalc668  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 WK NA  .    NA    ? ? 0 HOH 6237 J NA  8538 1_555 ? ? ? ? ? ? ? 2.687 ? ? 
metalc669  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 KH SR  .    SR    ? ? 0 HOH 6261 0 SR  8926 1_555 ? ? ? ? ? ? ? 2.767 ? ? 
metalc670  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 SD NA  .    NA    ? ? 0 HOH 6265 0 NA  8504 1_555 ? ? ? ? ? ? ? 2.696 ? ? 
metalc671  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 XH SR  .    SR    ? ? 0 HOH 6355 0 SR  8942 1_555 ? ? ? ? ? ? ? 2.799 ? ? 
metalc672  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MK SR  .    SR    ? ? 0 HOH 6411 A SR  8930 1_555 ? ? ? ? ? ? ? 2.756 ? ? 
metalc673  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 GF NA  .    NA    ? ? 0 HOH 6433 0 NA  8551 1_555 ? ? ? ? ? ? ? 2.527 ? ? 
metalc674  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HD MG  .    MG    ? ? 0 HOH 6508 0 MG  8087 1_555 ? ? ? ? ? ? ? 2.103 ? ? 
metalc675  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AL MG  .    MG    ? ? 0 HOH 6519 K MG  8054 1_555 ? ? ? ? ? ? ? 2.447 ? ? 
metalc676  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RI SR  .    SR    ? ? 0 HOH 6526 0 SR  8965 1_555 ? ? ? ? ? ? ? 2.649 ? ? 
metalc677  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NH SR  .    SR    ? ? 0 HOH 6557 0 SR  8931 1_555 ? ? ? ? ? ? ? 2.720 ? ? 
metalc678  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NH SR  .    SR    ? ? 0 HOH 6569 0 SR  8931 1_555 ? ? ? ? ? ? ? 2.597 ? ? 
metalc679  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 GD MG  .    MG    ? ? 0 HOH 6570 0 MG  8085 1_555 ? ? ? ? ? ? ? 2.321 ? ? 
metalc680  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 BI SR  .    SR    ? ? 0 HOH 6578 0 SR  8946 1_555 ? ? ? ? ? ? ? 2.761 ? ? 
metalc681  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 JD MG  .    MG    ? ? 0 HOH 6602 0 MG  8089 1_555 ? ? ? ? ? ? ? 2.284 ? ? 
metalc682  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 VG SR  .    SR    ? ? 0 HOH 6625 0 SR  8909 1_555 ? ? ? ? ? ? ? 2.798 ? ? 
metalc683  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 SI SR  .    SR    ? ? 0 HOH 6626 0 SR  8966 1_555 ? ? ? ? ? ? ? 2.305 ? ? 
metalc684  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 PG SR  .    SR    ? ? 0 HOH 6644 0 SR  8903 1_555 ? ? ? ? ? ? ? 2.669 ? ? 
metalc685  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 FL CD  .    CD    ? ? 0 HOH 6721 O CD  8705 1_555 ? ? ? ? ? ? ? 2.336 ? ? 
metalc686  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 DF NA  .    NA    ? ? 0 HOH 6747 0 NA  8548 1_555 ? ? ? ? ? ? ? 2.176 ? ? 
metalc687  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 BE NA  .    NA    ? ? 0 HOH 6786 0 NA  8514 1_555 ? ? ? ? ? ? ? 2.279 ? ? 
metalc688  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 TG SR  .    SR    ? ? 0 HOH 6803 0 SR  8907 1_555 ? ? ? ? ? ? ? 2.608 ? ? 
metalc689  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 IH SR  .    SR    ? ? 0 HOH 6813 0 SR  8924 1_555 ? ? ? ? ? ? ? 2.664 ? ? 
metalc690  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 WF NA  .    NA    ? ? 0 HOH 6815 0 NA  8567 1_555 ? ? ? ? ? ? ? 2.408 ? ? 
metalc691  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MC MG  .    MG    ? ? 0 HOH 6828 0 MG  8064 1_555 ? ? ? ? ? ? ? 2.209 ? ? 
metalc692  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 FH SR  .    SR    ? ? 0 HOH 6855 0 SR  8921 1_555 ? ? ? ? ? ? ? 2.792 ? ? 
metalc693  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 OK MG  .    MG    ? ? 0 HOH 6886 B MG  8042 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
metalc694  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YI SR  .    SR    ? ? 0 HOH 6920 0 SR  8973 1_555 ? ? ? ? ? ? ? 2.512 ? ? 
metalc695  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 KE NA  .    NA    ? ? 0 HOH 6945 0 NA  8524 1_555 ? ? ? ? ? ? ? 2.747 ? ? 
metalc696  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 SC MG  .    MG    ? ? 0 HOH 6950 0 MG  8070 1_555 ? ? ? ? ? ? ? 2.150 ? ? 
metalc697  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 SH SR  .    SR    ? ? 0 HOH 6967 0 SR  8937 1_555 ? ? ? ? ? ? ? 2.582 ? ? 
metalc698  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 BG NA  .    NA    ? ? 0 HOH 7037 0 NA  8573 1_555 ? ? ? ? ? ? ? 2.524 ? ? 
metalc699  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 PF NA  .    NA    ? ? 0 HOH 7038 0 NA  8560 1_555 ? ? ? ? ? ? ? 2.752 ? ? 
metalc700  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 LE NA  .    NA    ? ? 0 HOH 7044 0 NA  8525 1_555 ? ? ? ? ? ? ? 2.972 ? ? 
metalc701  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 QG SR  .    SR    ? ? 0 HOH 7047 0 SR  8904 1_555 ? ? ? ? ? ? ? 2.473 ? ? 
metalc702  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RG SR  .    SR    ? ? 0 HOH 7055 0 SR  8905 1_555 ? ? ? ? ? ? ? 2.543 ? ? 
metalc703  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 LD MG  .    MG    ? ? 0 HOH 7066 0 MG  8091 1_555 ? ? ? ? ? ? ? 2.382 ? ? 
metalc704  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ZE NA  .    NA    ? ? 0 HOH 7070 0 NA  8544 1_555 ? ? ? ? ? ? ? 2.642 ? ? 
metalc705  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 II SR  .    SR    ? ? 0 HOH 7127 0 SR  8955 1_555 ? ? ? ? ? ? ? 2.509 ? ? 
metalc706  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AD MG  .    MG    ? ? 0 HOH 7369 0 MG  8079 1_555 ? ? ? ? ? ? ? 2.389 ? ? 
metalc707  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YE NA  .    NA    ? ? 0 HOH 7423 0 NA  8542 1_555 ? ? ? ? ? ? ? 2.923 ? ? 
metalc708  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MH SR  .    SR    ? ? 0 HOH 7433 0 SR  8928 1_555 ? ? ? ? ? ? ? 2.781 ? ? 
metalc709  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 BC MG  .    MG    ? ? 0 HOH 7468 0 MG  8049 1_555 ? ? ? ? ? ? ? 2.299 ? ? 
metalc710  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 OE NA  .    NA    ? ? 0 HOH 7534 0 NA  8528 1_555 ? ? ? ? ? ? ? 2.842 ? ? 
metalc711  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RG SR  .    SR    ? ? 0 HOH 7625 0 SR  8905 1_555 ? ? ? ? ? ? ? 2.743 ? ? 
metalc712  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 SA MG  .    MG    ? ? 0 HOH 7691 0 MG  8013 1_555 ? ? ? ? ? ? ? 2.134 ? ? 
metalc713  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 TF NA  .    NA    ? ? 0 HOH 7754 0 NA  8564 1_555 ? ? ? ? ? ? ? 2.936 ? ? 
metalc714  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HF NA  .    NA    ? ? 0 HOH 7792 0 NA  8552 1_555 ? ? ? ? ? ? ? 2.838 ? ? 
metalc715  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RE NA  .    NA    ? ? 0 HOH 7803 0 NA  8531 1_555 ? ? ? ? ? ? ? 2.575 ? ? 
metalc716  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RA MG  .    MG    ? ? 0 HOH 7845 0 MG  8012 1_555 ? ? ? ? ? ? ? 2.085 ? ? 
metalc717  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ED MG  .    MG    ? ? 0 HOH 7864 0 MG  8083 1_555 ? ? ? ? ? ? ? 2.489 ? ? 
metalc718  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MB MG  .    MG    ? ? 0 HOH 7869 0 MG  8033 1_555 ? ? ? ? ? ? ? 2.261 ? ? 
metalc719  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ED MG  .    MG    ? ? 0 HOH 7869 0 MG  8083 1_555 ? ? ? ? ? ? ? 2.258 ? ? 
metalc720  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MA MG  .    MG    ? ? 0 HOH 7878 0 MG  8007 1_555 ? ? ? ? ? ? ? 2.152 ? ? 
metalc721  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RH SR  .    SR    ? ? 0 HOH 7912 0 SR  8936 1_555 ? ? ? ? ? ? ? 2.645 ? ? 
metalc722  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HJ SR  .    SR    ? ? 0 HOH 7932 0 SR  8984 1_555 ? ? ? ? ? ? ? 2.562 ? ? 
metalc723  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 DE NA  .    NA    ? ? 0 HOH 7949 0 NA  8516 1_555 ? ? ? ? ? ? ? 2.331 ? ? 
metalc724  metalc ?    ? GA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8001 0 HOH 8293 1_555 ? ? ? ? ? ? ? 2.096 ? ? 
metalc725  metalc ?    ? GA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8001 0 HOH 9675 1_555 ? ? ? ? ? ? ? 2.117 ? ? 
metalc726  metalc ?    ? HA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8002 0 HOH 8271 1_555 ? ? ? ? ? ? ? 2.014 ? ? 
metalc727  metalc ?    ? HA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8002 0 HOH 8272 1_555 ? ? ? ? ? ? ? 2.184 ? ? 
metalc728  metalc ?    ? IA MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? 0 MG  8003 A HOH 8980 1_555 ? ? ? ? ? ? ? 2.197 ? ? 
metalc729  metalc ?    ? IA MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? 0 MG  8003 A HOH 8999 1_555 ? ? ? ? ? ? ? 2.299 ? ? 
metalc730  metalc ?    ? JA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8004 0 HOH 8278 1_555 ? ? ? ? ? ? ? 2.086 ? ? 
metalc731  metalc ?    ? JA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8004 0 HOH 9545 1_555 ? ? ? ? ? ? ? 1.992 ? ? 
metalc732  metalc ?    ? KA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8005 0 HOH 8294 1_555 ? ? ? ? ? ? ? 2.061 ? ? 
metalc733  metalc ?    ? KA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8005 0 HOH 8295 1_555 ? ? ? ? ? ? ? 2.050 ? ? 
metalc734  metalc ?    ? LA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8006 0 HOH 8287 1_555 ? ? ? ? ? ? ? 2.041 ? ? 
metalc735  metalc ?    ? LA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8006 0 HOH 8367 1_555 ? ? ? ? ? ? ? 1.945 ? ? 
metalc736  metalc ?    ? MA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8007 0 HOH 8288 1_555 ? ? ? ? ? ? ? 2.153 ? ? 
metalc737  metalc ?    ? MA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8007 0 HOH 8289 1_555 ? ? ? ? ? ? ? 2.015 ? ? 
metalc738  metalc ?    ? NA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8008 0 HOH 8368 1_555 ? ? ? ? ? ? ? 2.002 ? ? 
metalc739  metalc ?    ? NA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8008 0 HOH 9537 1_555 ? ? ? ? ? ? ? 2.068 ? ? 
metalc740  metalc ?    ? OA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8009 0 HOH 9519 1_555 ? ? ? ? ? ? ? 1.879 ? ? 
metalc741  metalc ?    ? OA MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? 0 MG  8009 A HOH 9089 1_555 ? ? ? ? ? ? ? 2.091 ? ? 
metalc742  metalc ?    ? PA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8010 0 HOH 8269 1_555 ? ? ? ? ? ? ? 1.946 ? ? 
metalc743  metalc ?    ? PA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8010 0 HOH 9531 1_555 ? ? ? ? ? ? ? 2.081 ? ? 
metalc744  metalc ?    ? QA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8011 0 HOH 8303 1_555 ? ? ? ? ? ? ? 2.007 ? ? 
metalc745  metalc ?    ? QA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8011 0 HOH 9504 1_555 ? ? ? ? ? ? ? 2.001 ? ? 
metalc746  metalc ?    ? QA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8011 0 HOH 9522 1_555 ? ? ? ? ? ? ? 2.264 ? ? 
metalc747  metalc ?    ? RA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8012 0 HOH 8279 1_555 ? ? ? ? ? ? ? 2.075 ? ? 
metalc748  metalc ?    ? RA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8012 0 HOH 9915 1_555 ? ? ? ? ? ? ? 2.038 ? ? 
metalc749  metalc ?    ? RA MG  .    MG    ? ? ? 1_555 DM HOH .    O     ? ? 0 MG  8012 C HOH 8562 1_555 ? ? ? ? ? ? ? 2.171 ? ? 
metalc750  metalc ?    ? SA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8013 0 HOH 8298 1_555 ? ? ? ? ? ? ? 1.985 ? ? 
metalc751  metalc ?    ? SA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8013 0 HOH 8299 1_555 ? ? ? ? ? ? ? 2.335 ? ? 
metalc752  metalc ?    ? SA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8013 0 HOH 8300 1_555 ? ? ? ? ? ? ? 2.085 ? ? 
metalc753  metalc ?    ? TA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8014 0 HOH 8282 1_555 ? ? ? ? ? ? ? 2.006 ? ? 
metalc754  metalc ?    ? TA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8014 0 HOH 8301 1_555 ? ? ? ? ? ? ? 1.893 ? ? 
metalc755  metalc ?    ? TA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8014 0 HOH 9619 1_555 ? ? ? ? ? ? ? 1.990 ? ? 
metalc756  metalc ?    ? TA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8014 0 HOH 9622 1_555 ? ? ? ? ? ? ? 1.989 ? ? 
metalc757  metalc ?    ? TA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8014 0 HOH 9696 1_555 ? ? ? ? ? ? ? 2.162 ? ? 
metalc758  metalc ?    ? UA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8015 0 HOH 8285 1_555 ? ? ? ? ? ? ? 1.844 ? ? 
metalc759  metalc ?    ? UA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8015 0 HOH 8286 1_555 ? ? ? ? ? ? ? 1.998 ? ? 
metalc760  metalc ?    ? VA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8016 0 HOH 8290 1_555 ? ? ? ? ? ? ? 2.249 ? ? 
metalc761  metalc ?    ? VA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8016 0 HOH 9607 1_555 ? ? ? ? ? ? ? 1.935 ? ? 
metalc762  metalc ?    ? VA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8016 0 HOH 9957 1_555 ? ? ? ? ? ? ? 2.431 ? ? 
metalc763  metalc ?    ? XA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8018 0 HOH 8306 1_555 ? ? ? ? ? ? ? 1.997 ? ? 
metalc764  metalc ?    ? XA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8018 0 HOH 8307 1_555 ? ? ? ? ? ? ? 1.990 ? ? 
metalc765  metalc ?    ? XA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8018 0 HOH 8372 1_555 ? ? ? ? ? ? ? 2.063 ? ? 
metalc766  metalc ?    ? YA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8019 0 HOH 8308 1_555 ? ? ? ? ? ? ? 2.195 ? ? 
metalc767  metalc ?    ? YA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8019 0 HOH 8309 1_555 ? ? ? ? ? ? ? 2.079 ? ? 
metalc768  metalc ?    ? YA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8019 0 HOH 9894 1_555 ? ? ? ? ? ? ? 2.373 ? ? 
metalc769  metalc ?    ? ZA MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8020 0 HOH 8373 1_555 ? ? ? ? ? ? ? 2.019 ? ? 
metalc770  metalc ?    ? AB MG  .    MG    ? ? ? 1_555 TM HOH .    O     ? ? 0 MG  8021 S HOH 8993 1_555 ? ? ? ? ? ? ? 1.917 ? ? 
metalc771  metalc ?    ? BB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8022 0 HOH 8313 1_555 ? ? ? ? ? ? ? 2.053 ? ? 
metalc772  metalc ?    ? BB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8022 0 HOH 8314 1_555 ? ? ? ? ? ? ? 2.283 ? ? 
metalc773  metalc ?    ? CB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8023 0 HOH 8280 1_555 ? ? ? ? ? ? ? 2.030 ? ? 
metalc774  metalc ?    ? CB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8023 0 HOH 8281 1_555 ? ? ? ? ? ? ? 1.995 ? ? 
metalc775  metalc ?    ? CB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8023 0 HOH 8291 1_555 ? ? ? ? ? ? ? 2.075 ? ? 
metalc776  metalc ?    ? DB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8024 0 HOH 8317 1_555 ? ? ? ? ? ? ? 2.102 ? ? 
metalc777  metalc ?    ? DB MG  .    MG    ? ? ? 1_555 PH SR  .    SR    ? ? 0 MG  8024 0 SR  8934 1_555 ? ? ? ? ? ? ? 1.772 ? ? 
metalc778  metalc ?    ? DB MG  .    MG    ? ? ? 1_555 BN HOH .    O     ? ? 0 MG  8024 1 HOH 9002 1_555 ? ? ? ? ? ? ? 2.549 ? ? 
metalc779  metalc ?    ? EB MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? 0 MG  8025 A HOH 9015 1_555 ? ? ? ? ? ? ? 2.128 ? ? 
metalc780  metalc ?    ? EB MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? 0 MG  8025 A HOH 9090 1_555 ? ? ? ? ? ? ? 1.971 ? ? 
metalc781  metalc ?    ? FB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8026 0 HOH 8321 1_555 ? ? ? ? ? ? ? 2.049 ? ? 
metalc782  metalc ?    ? FB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8026 0 HOH 8322 1_555 ? ? ? ? ? ? ? 1.808 ? ? 
metalc783  metalc ?    ? FB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8026 0 HOH 8323 1_555 ? ? ? ? ? ? ? 2.024 ? ? 
metalc784  metalc ?    ? FB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8026 0 HOH 9866 1_555 ? ? ? ? ? ? ? 2.129 ? ? 
metalc785  metalc ?    ? GB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8027 0 HOH 8377 1_555 ? ? ? ? ? ? ? 2.098 ? ? 
metalc786  metalc ?    ? GB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8027 0 HOH 9574 1_555 ? ? ? ? ? ? ? 2.225 ? ? 
metalc787  metalc ?    ? HB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8028 0 HOH 8325 1_555 ? ? ? ? ? ? ? 1.880 ? ? 
metalc788  metalc ?    ? HB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8028 0 HOH 9780 1_555 ? ? ? ? ? ? ? 2.152 ? ? 
metalc789  metalc ?    ? IB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8029 0 HOH 8326 1_555 ? ? ? ? ? ? ? 1.942 ? ? 
metalc790  metalc ?    ? JB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8030 0 HOH 8379 1_555 ? ? ? ? ? ? ? 2.067 ? ? 
metalc791  metalc ?    ? LB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8032 0 HOH 8328 1_555 ? ? ? ? ? ? ? 2.257 ? ? 
metalc792  metalc ?    ? LB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8032 0 HOH 9937 1_555 ? ? ? ? ? ? ? 2.667 ? ? 
metalc793  metalc ?    ? MB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8033 0 HOH 8381 1_555 ? ? ? ? ? ? ? 2.235 ? ? 
metalc794  metalc ?    ? NB MG  .    MG    ? ? ? 1_555 T  GLY 66   O     ? ? 0 MG  8034 R GLY 65   1_555 ? ? ? ? ? ? ? 2.179 ? ? 
metalc795  metalc ?    ? NB MG  .    MG    ? ? ? 1_555 SM HOH .    O     ? ? 0 MG  8034 R HOH 8999 1_555 ? ? ? ? ? ? ? 2.438 ? ? 
metalc796  metalc ?    ? OB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8035 0 HOH 8329 1_555 ? ? ? ? ? ? ? 2.337 ? ? 
metalc797  metalc ?    ? OB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8035 0 HOH 8384 1_555 ? ? ? ? ? ? ? 2.075 ? ? 
metalc798  metalc ?    ? PB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8036 0 HOH 8385 1_555 ? ? ? ? ? ? ? 2.277 ? ? 
metalc799  metalc ?    ? PB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8036 0 HOH 8386 1_555 ? ? ? ? ? ? ? 2.223 ? ? 
metalc800  metalc ?    ? QB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8037 0 HOH 8400 1_555 ? ? ? ? ? ? ? 1.986 ? ? 
metalc801  metalc ?    ? SB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8039 0 HOH 8330 1_555 ? ? ? ? ? ? ? 1.826 ? ? 
metalc802  metalc ?    ? SB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8039 0 HOH 8331 1_555 ? ? ? ? ? ? ? 2.160 ? ? 
metalc803  metalc ?    ? TB MG  .    MG    ? ? ? 1_555 AM HOH .    O     ? ? 0 MG  8040 9 HOH 9010 1_555 ? ? ? ? ? ? ? 2.447 ? ? 
metalc804  metalc ?    ? TB MG  .    MG    ? ? ? 1_555 AM HOH .    O     ? ? 0 MG  8040 9 HOH 9039 1_555 ? ? ? ? ? ? ? 2.396 ? ? 
metalc805  metalc ?    ? UB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8041 0 HOH 8284 1_555 ? ? ? ? ? ? ? 1.942 ? ? 
metalc806  metalc ?    ? UB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8041 0 HOH 8332 1_555 ? ? ? ? ? ? ? 2.241 ? ? 
metalc807  metalc ?    ? UB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8041 0 HOH 8333 1_555 ? ? ? ? ? ? ? 1.989 ? ? 
metalc808  metalc ?    ? UB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8041 0 HOH 9933 1_555 ? ? ? ? ? ? ? 2.158 ? ? 
metalc809  metalc ?    ? VB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8043 0 HOH 8351 1_555 ? ? ? ? ? ? ? 1.877 ? ? 
metalc810  metalc ?    ? VB MG  .    MG    ? ? ? 1_555 D  ASN 336  O     ? ? 0 MG  8043 B ASN 335  1_555 ? ? ? ? ? ? ? 2.215 ? ? 
metalc811  metalc ?    ? VB MG  .    MG    ? ? ? 1_555 CM HOH .    O     ? ? 0 MG  8043 B HOH 9010 1_555 ? ? ? ? ? ? ? 1.986 ? ? 
metalc812  metalc ?    ? WB MG  .    MG    ? ? ? 1_555 C  GLN 208  O     ? ? 0 MG  8044 A GLN 207  1_555 ? ? ? ? ? ? ? 2.925 ? ? 
metalc813  metalc ?    ? WB MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? 0 MG  8044 A HOH 9093 1_555 ? ? ? ? ? ? ? 2.715 ? ? 
metalc814  metalc ?    ? XB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8045 0 HOH 8334 1_555 ? ? ? ? ? ? ? 2.150 ? ? 
metalc815  metalc ?    ? XB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8045 0 HOH 8335 1_555 ? ? ? ? ? ? ? 2.161 ? ? 
metalc816  metalc ?    ? XB MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? 0 MG  8045 A HOH 9091 1_555 ? ? ? ? ? ? ? 2.088 ? ? 
metalc817  metalc ?    ? XB MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? 0 MG  8045 A HOH 9093 1_555 ? ? ? ? ? ? ? 2.313 ? ? 
metalc818  metalc ?    ? YB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8046 0 HOH 9536 1_555 ? ? ? ? ? ? ? 2.390 ? ? 
metalc819  metalc ?    ? YB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8046 0 HOH 9540 1_555 ? ? ? ? ? ? ? 2.567 ? ? 
metalc820  metalc ?    ? ZB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8047 0 HOH 8337 1_555 ? ? ? ? ? ? ? 1.992 ? ? 
metalc821  metalc ?    ? ZB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8047 0 HOH 8338 1_555 ? ? ? ? ? ? ? 1.967 ? ? 
metalc822  metalc ?    ? ZB MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8047 0 HOH 9668 1_555 ? ? ? ? ? ? ? 1.919 ? ? 
metalc823  metalc ?    ? AC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8048 0 HOH 8339 1_555 ? ? ? ? ? ? ? 2.152 ? ? 
metalc824  metalc ?    ? AC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8048 0 HOH 8340 1_555 ? ? ? ? ? ? ? 2.296 ? ? 
metalc825  metalc ?    ? AC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8048 0 HOH 8341 1_555 ? ? ? ? ? ? ? 2.149 ? ? 
metalc826  metalc ?    ? BC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8049 0 HOH 8277 1_555 ? ? ? ? ? ? ? 2.415 ? ? 
metalc827  metalc ?    ? BC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8049 0 HOH 8350 1_555 ? ? ? ? ? ? ? 2.193 ? ? 
metalc828  metalc ?    ? CC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8052 0 HOH 8343 1_555 ? ? ? ? ? ? ? 2.249 ? ? 
metalc829  metalc ?    ? CC MG  .    MG    ? ? ? 1_555 C  ASN 189  O     ? ? 0 MG  8052 A ASN 188  1_555 ? ? ? ? ? ? ? 2.222 ? ? 
metalc830  metalc ?    ? DC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8053 0 HOH 8406 1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc831  metalc ?    ? EC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8055 0 HOH 9620 1_555 ? ? ? ? ? ? ? 2.616 ? ? 
metalc832  metalc ?    ? FC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8056 0 HOH 8347 1_555 ? ? ? ? ? ? ? 2.429 ? ? 
metalc833  metalc ?    ? FC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8056 0 HOH 8407 1_555 ? ? ? ? ? ? ? 2.262 ? ? 
metalc834  metalc ?    ? GC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8058 0 HOH 8344 1_555 ? ? ? ? ? ? ? 2.108 ? ? 
metalc835  metalc ?    ? GC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8058 0 HOH 8345 1_555 ? ? ? ? ? ? ? 1.961 ? ? 
metalc836  metalc ?    ? GC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8058 0 HOH 8408 1_555 ? ? ? ? ? ? ? 2.048 ? ? 
metalc837  metalc ?    ? GC MG  .    MG    ? ? ? 1_555 XM HOH .    O     ? ? 0 MG  8058 W HOH 7874 1_555 ? ? ? ? ? ? ? 2.505 ? ? 
metalc838  metalc ?    ? IC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8060 0 HOH 8353 1_555 ? ? ? ? ? ? ? 2.327 ? ? 
metalc839  metalc ?    ? IC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8060 0 HOH 8410 1_555 ? ? ? ? ? ? ? 2.021 ? ? 
metalc840  metalc ?    ? IC MG  .    MG    ? ? ? 1_555 CN HOH .    O     ? ? 0 MG  8060 2 HOH 7875 1_555 ? ? ? ? ? ? ? 2.801 ? ? 
metalc841  metalc ?    ? KC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8062 0 HOH 8356 1_555 ? ? ? ? ? ? ? 2.137 ? ? 
metalc842  metalc ?    ? KC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8062 0 HOH 8413 1_555 ? ? ? ? ? ? ? 2.282 ? ? 
metalc843  metalc ?    ? LC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8063 0 HOH 8421 1_555 ? ? ? ? ? ? ? 2.043 ? ? 
metalc844  metalc ?    ? MC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8064 0 HOH 8357 1_555 ? ? ? ? ? ? ? 2.189 ? ? 
metalc845  metalc ?    ? MC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8064 0 HOH 8414 1_555 ? ? ? ? ? ? ? 2.370 ? ? 
metalc846  metalc ?    ? NC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8065 0 HOH 8358 1_555 ? ? ? ? ? ? ? 1.981 ? ? 
metalc847  metalc ?    ? NC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8065 0 HOH 9749 1_555 ? ? ? ? ? ? ? 2.312 ? ? 
metalc848  metalc ?    ? NC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8065 0 HOH 9873 1_555 ? ? ? ? ? ? ? 2.299 ? ? 
metalc849  metalc ?    ? OC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8066 0 HOH 9536 1_555 ? ? ? ? ? ? ? 2.869 ? ? 
metalc850  metalc ?    ? PC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8067 0 HOH 9561 1_555 ? ? ? ? ? ? ? 2.474 ? ? 
metalc851  metalc ?    ? QC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8068 0 HOH 8416 1_555 ? ? ? ? ? ? ? 2.116 ? ? 
metalc852  metalc ?    ? SC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8070 0 HOH 8362 1_555 ? ? ? ? ? ? ? 2.310 ? ? 
metalc853  metalc ?    ? SC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8070 0 HOH 9588 1_555 ? ? ? ? ? ? ? 2.447 ? ? 
metalc854  metalc ?    ? VC MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8073 0 HOH 8363 1_555 ? ? ? ? ? ? ? 2.248 ? ? 
metalc855  metalc ?    ? YC MG  .    MG    ? ? ? 1_555 ZM HOH .    O     ? ? 0 MG  8077 Y HOH 8867 1_555 ? ? ? ? ? ? ? 2.720 ? ? 
metalc856  metalc ?    ? BD MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8080 0 HOH 8426 1_555 ? ? ? ? ? ? ? 2.460 ? ? 
metalc857  metalc ?    ? BD MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8080 0 HOH 9752 1_555 ? ? ? ? ? ? ? 2.504 ? ? 
metalc858  metalc ?    ? BD MG  .    MG    ? ? ? 1_555 DN HOH .    O     ? ? 0 MG  8080 3 HOH 8950 1_555 ? ? ? ? ? ? ? 2.530 ? ? 
metalc859  metalc ?    ? CD MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8081 0 HOH 8419 1_555 ? ? ? ? ? ? ? 2.400 ? ? 
metalc860  metalc ?    ? ED MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8083 0 HOH 8381 1_555 ? ? ? ? ? ? ? 2.325 ? ? 
metalc861  metalc ?    ? ED MG  .    MG    ? ? ? 1_555 QM HOH .    O     ? ? 0 MG  8083 P HOH 185  1_555 ? ? ? ? ? ? ? 2.260 ? ? 
metalc862  metalc ?    ? FD MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8084 0 HOH 8390 1_555 ? ? ? ? ? ? ? 2.178 ? ? 
metalc863  metalc ?    ? FD MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8084 0 HOH 8391 1_555 ? ? ? ? ? ? ? 2.083 ? ? 
metalc864  metalc ?    ? FD MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8084 0 HOH 8392 1_555 ? ? ? ? ? ? ? 1.926 ? ? 
metalc865  metalc ?    ? FD MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8084 0 HOH 8393 1_555 ? ? ? ? ? ? ? 2.188 ? ? 
metalc866  metalc ?    ? GD MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8085 0 HOH 8395 1_555 ? ? ? ? ? ? ? 2.092 ? ? 
metalc867  metalc ?    ? GD MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8085 0 HOH 8396 1_555 ? ? ? ? ? ? ? 2.081 ? ? 
metalc868  metalc ?    ? GD MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8085 0 HOH 8397 1_555 ? ? ? ? ? ? ? 2.480 ? ? 
metalc869  metalc ?    ? ID MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8088 0 HOH 9626 1_555 ? ? ? ? ? ? ? 2.415 ? ? 
metalc870  metalc ?    ? ID MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8088 0 HOH 9828 1_555 ? ? ? ? ? ? ? 2.244 ? ? 
metalc871  metalc ?    ? KD MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8090 0 HOH 9848 1_555 ? ? ? ? ? ? ? 2.466 ? ? 
metalc872  metalc ?    ? KD MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8090 0 HOH 9951 1_555 ? ? ? ? ? ? ? 2.248 ? ? 
metalc873  metalc ?    ? LD MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? 0 MG  8091 A HOH 9019 1_555 ? ? ? ? ? ? ? 2.586 ? ? 
metalc874  metalc ?    ? LD MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? 0 MG  8091 A HOH 9094 1_555 ? ? ? ? ? ? ? 2.948 ? ? 
metalc875  metalc ?    ? MD MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? 0 MG  8092 A HOH 9019 1_555 ? ? ? ? ? ? ? 2.420 ? ? 
metalc876  metalc ?    ? ND MG  .    MG    ? ? ? 1_555 ZL HOH .    O     ? ? 0 MG  8093 0 HOH 9725 1_555 ? ? ? ? ? ? ? 2.555 ? ? 
metalc877  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HI SR  .    SR    ? ? 0 HOH 8126 0 SR  8954 1_555 ? ? ? ? ? ? ? 2.373 ? ? 
metalc878  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 ZI SR  .    SR    ? ? 0 HOH 8130 0 SR  8974 1_555 ? ? ? ? ? ? ? 2.682 ? ? 
metalc879  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 HE NA  .    NA    ? ? 0 HOH 8186 0 NA  8521 1_555 ? ? ? ? ? ? ? 2.791 ? ? 
metalc880  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 CG NA  .    NA    ? ? 0 HOH 8205 0 NA  8574 1_555 ? ? ? ? ? ? ? 2.642 ? ? 
metalc881  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 BE NA  .    NA    ? ? 0 HOH 8209 0 NA  8514 1_555 ? ? ? ? ? ? ? 2.975 ? ? 
metalc882  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RE NA  .    NA    ? ? 0 HOH 8212 0 NA  8531 1_555 ? ? ? ? ? ? ? 2.393 ? ? 
metalc883  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 OK MG  .    MG    ? ? 0 HOH 8236 B MG  8042 1_555 ? ? ? ? ? ? ? 2.017 ? ? 
metalc884  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 NJ SR  .    SR    ? ? 0 HOH 8266 0 SR  8991 1_555 ? ? ? ? ? ? ? 2.620 ? ? 
metalc885  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 CH SR  .    SR    ? ? 0 HOH 8296 0 SR  8918 1_555 ? ? ? ? ? ? ? 2.297 ? ? 
metalc886  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RD NA  .    NA    ? ? 0 HOH 8307 0 NA  8502 1_555 ? ? ? ? ? ? ? 2.899 ? ? 
metalc887  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 CH SR  .    SR    ? ? 0 HOH 8315 0 SR  8918 1_555 ? ? ? ? ? ? ? 2.754 ? ? 
metalc888  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 PH SR  .    SR    ? ? 0 HOH 8317 0 SR  8934 1_555 ? ? ? ? ? ? ? 2.596 ? ? 
metalc889  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 DI SR  .    SR    ? ? 0 HOH 8318 0 SR  8948 1_555 ? ? ? ? ? ? ? 2.790 ? ? 
metalc890  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AI SR  .    SR    ? ? 0 HOH 8319 0 SR  8945 1_555 ? ? ? ? ? ? ? 2.740 ? ? 
metalc891  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AI SR  .    SR    ? ? 0 HOH 8320 0 SR  8945 1_555 ? ? ? ? ? ? ? 2.735 ? ? 
metalc892  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RI SR  .    SR    ? ? 0 HOH 8348 0 SR  8965 1_555 ? ? ? ? ? ? ? 2.509 ? ? 
metalc893  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 OH SR  .    SR    ? ? 0 HOH 8360 0 SR  8933 1_555 ? ? ? ? ? ? ? 2.539 ? ? 
metalc894  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 RH SR  .    SR    ? ? 0 HOH 8369 0 SR  8936 1_555 ? ? ? ? ? ? ? 2.775 ? ? 
metalc895  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AI SR  .    SR    ? ? 0 HOH 8375 0 SR  8945 1_555 ? ? ? ? ? ? ? 2.459 ? ? 
metalc896  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 AI SR  .    SR    ? ? 0 HOH 8376 0 SR  8945 1_555 ? ? ? ? ? ? ? 2.799 ? ? 
metalc897  metalc ?    ? PD K   .    K     ? ? ? 1_555 ZL HOH .    O     ? ? 0 K   8402 0 HOH 9513 1_555 ? ? ? ? ? ? ? 2.753 ? ? 
metalc898  metalc ?    ? PD K   .    K     ? ? ? 1_555 ZL HOH .    O     ? ? 0 K   8402 0 HOH 9608 1_555 ? ? ? ? ? ? ? 2.845 ? ? 
metalc899  metalc ?    ? PD K   .    K     ? ? ? 1_555 ZL HOH .    O     ? ? 0 K   8402 0 HOH 9644 1_555 ? ? ? ? ? ? ? 3.139 ? ? 
metalc900  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YL SR  .    SR    ? ? 0 HOH 8411 3 SR  8932 1_555 ? ? ? ? ? ? ? 2.732 ? ? 
metalc901  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 YL SR  .    SR    ? ? 0 HOH 8412 3 SR  8932 1_555 ? ? ? ? ? ? ? 2.603 ? ? 
metalc902  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 MK SR  .    SR    ? ? 0 HOH 8420 A SR  8930 1_555 ? ? ? ? ? ? ? 2.617 ? ? 
metalc903  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 VE NA  .    NA    ? ? 0 HOH 8422 0 NA  8536 1_555 ? ? ? ? ? ? ? 2.878 ? ? 
metalc904  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 JI SR  .    SR    ? ? 0 HOH 8422 0 SR  8956 1_555 ? ? ? ? ? ? ? 2.438 ? ? 
metalc905  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 XH SR  .    SR    ? ? 0 HOH 8425 0 SR  8942 1_555 ? ? ? ? ? ? ? 2.523 ? ? 
metalc906  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 PE NA  .    NA    ? ? 0 HOH 8429 0 NA  8529 1_555 ? ? ? ? ? ? ? 2.761 ? ? 
metalc907  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 SG SR  .    SR    ? ? 0 HOH 8431 0 SR  8906 1_555 ? ? ? ? ? ? ? 2.754 ? ? 
metalc908  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 QG SR  .    SR    ? ? 0 HOH 8432 0 SR  8904 1_555 ? ? ? ? ? ? ? 2.545 ? ? 
metalc909  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 JI SR  .    SR    ? ? 0 HOH 8434 0 SR  8956 1_555 ? ? ? ? ? ? ? 2.570 ? ? 
metalc910  metalc ?    ? TD NA  .    NA    ? ? ? 1_555 ZL HOH .    O     ? ? 0 NA  8505 0 HOH 9624 1_555 ? ? ? ? ? ? ? 2.988 ? ? 
metalc911  metalc ?    ? ZD NA  .    NA    ? ? ? 1_555 ZL HOH .    O     ? ? 0 NA  8512 0 HOH 9829 1_555 ? ? ? ? ? ? ? 2.438 ? ? 
metalc912  metalc ?    ? CE NA  .    NA    ? ? ? 1_555 ZL HOH .    O     ? ? 0 NA  8515 0 HOH 9775 1_555 ? ? ? ? ? ? ? 2.521 ? ? 
metalc913  metalc ?    ? CE NA  .    NA    ? ? ? 1_555 DA TRP 43   O     ? ? 0 NA  8515 2 TRP 42   1_555 ? ? ? ? ? ? ? 2.557 ? ? 
metalc914  metalc ?    ? CE NA  .    NA    ? ? ? 1_555 DA ASN 46   O     ? ? 0 NA  8515 2 ASN 45   1_555 ? ? ? ? ? ? ? 2.926 ? ? 
metalc915  metalc ?    ? CE NA  .    NA    ? ? ? 1_555 CN HOH .    O     ? ? 0 NA  8515 2 HOH 4135 1_555 ? ? ? ? ? ? ? 2.533 ? ? 
metalc916  metalc ?    ? DE NA  .    NA    ? ? ? 1_555 ZL HOH .    O     ? ? 0 NA  8516 0 HOH 9711 1_555 ? ? ? ? ? ? ? 2.814 ? ? 
metalc917  metalc ?    ? GE NA  .    NA    ? ? ? 1_555 ZL HOH .    O     ? ? 0 NA  8520 0 HOH 9994 1_555 ? ? ? ? ? ? ? 2.905 ? ? 
metalc918  metalc ?    ? JE NA  .    NA    ? ? ? 1_555 ZL HOH .    O     ? ? 0 NA  8523 0 HOH 9535 1_555 ? ? ? ? ? ? ? 2.471 ? ? 
metalc919  metalc ?    ? ME NA  .    NA    ? ? ? 1_555 ZL HOH .    O     ? ? 0 NA  8526 0 HOH 9735 1_555 ? ? ? ? ? ? ? 2.622 ? ? 
metalc920  metalc ?    ? NE NA  .    NA    ? ? ? 1_555 ZL HOH .    O     ? ? 0 NA  8527 0 HOH 9798 1_555 ? ? ? ? ? ? ? 2.735 ? ? 
metalc921  metalc ?    ? SE NA  .    NA    ? ? ? 1_555 T  VAL 73   O     ? ? 0 NA  8533 R VAL 72   1_555 ? ? ? ? ? ? ? 2.374 ? ? 
metalc922  metalc ?    ? SE NA  .    NA    ? ? ? 1_555 T  TRP 76   O     ? ? 0 NA  8533 R TRP 75   1_555 ? ? ? ? ? ? ? 2.367 ? ? 
metalc923  metalc ?    ? SE NA  .    NA    ? ? ? 1_555 SM HOH .    O     ? ? 0 NA  8533 R HOH 8919 1_555 ? ? ? ? ? ? ? 2.413 ? ? 
metalc924  metalc ?    ? SE NA  .    NA    ? ? ? 1_555 SM HOH .    O     ? ? 0 NA  8533 R HOH 8930 1_555 ? ? ? ? ? ? ? 2.370 ? ? 
metalc925  metalc ?    ? WE NA  .    NA    ? ? ? 1_555 V  SER 95   OG    ? ? 0 NA  8537 T SER 94   1_555 ? ? ? ? ? ? ? 2.306 ? ? 
metalc926  metalc ?    ? WE NA  .    NA    ? ? ? 1_555 V  ASN 96   OD1   ? ? 0 NA  8537 T ASN 95   1_555 ? ? ? ? ? ? ? 2.599 ? ? 
metalc927  metalc ?    ? WE NA  .    NA    ? ? ? 1_555 UM HOH .    O     ? ? 0 NA  8537 T HOH 1124 1_555 ? ? ? ? ? ? ? 2.751 ? ? 
metalc928  metalc ?    ? ZE NA  .    NA    ? ? ? 1_555 B  U   82   OP1   ? ? 0 NA  8544 9 U   82   1_555 ? ? ? ? ? ? ? 2.870 ? ? 
metalc929  metalc ?    ? EF NA  .    NA    ? ? ? 1_555 ZL HOH .    O     ? ? 0 NA  8549 0 HOH 9985 1_555 ? ? ? ? ? ? ? 2.295 ? ? 
metalc930  metalc ?    ? HF NA  .    NA    ? ? ? 1_555 D  GLN 231  O     ? ? 0 NA  8552 B GLN 230  1_555 ? ? ? ? ? ? ? 2.721 ? ? 
metalc931  metalc ?    ? LF NA  .    NA    ? ? ? 1_555 O  LYS 193  O     ? ? 0 NA  8556 M LYS 193  1_555 ? ? ? ? ? ? ? 2.875 ? ? 
metalc932  metalc ?    ? NF NA  .    NA    ? ? ? 1_555 E  ARG 55   O     ? ? 0 NA  8558 C ARG 55   1_555 ? ? ? ? ? ? ? 2.965 ? ? 
metalc933  metalc ?    ? NF NA  .    NA    ? ? ? 1_555 DM HOH .    O     ? ? 0 NA  8558 C HOH 8588 1_555 ? ? ? ? ? ? ? 2.685 ? ? 
metalc934  metalc ?    ? QF NA  .    NA    ? ? ? 1_555 ZL HOH .    O     ? ? 0 NA  8561 0 HOH 9600 1_555 ? ? ? ? ? ? ? 2.757 ? ? 
metalc935  metalc ?    ? SF NA  .    NA    ? ? ? 1_555 ZL HOH .    O     ? ? 0 NA  8563 0 HOH 9771 1_555 ? ? ? ? ? ? ? 2.854 ? ? 
metalc936  metalc ?    ? XF NA  .    NA    ? ? ? 1_555 N  HIS 19   O     ? ? 0 NA  8568 L HIS 18   1_555 ? ? ? ? ? ? ? 2.867 ? ? 
metalc937  metalc ?    ? XF NA  .    NA    ? ? ? 1_555 MM HOH .    O     ? ? 0 NA  8568 L HOH 8826 1_555 ? ? ? ? ? ? ? 2.363 ? ? 
metalc938  metalc ?    ? XF NA  .    NA    ? ? ? 1_555 MM HOH .    O     ? ? 0 NA  8568 L HOH 8844 1_555 ? ? ? ? ? ? ? 2.754 ? ? 
metalc939  metalc ?    ? ZF NA  .    NA    ? ? ? 1_555 ZL HOH .    O     ? ? 0 NA  8570 0 HOH 9827 1_555 ? ? ? ? ? ? ? 2.557 ? ? 
metalc940  metalc ?    ? OG SR  .    SR    ? ? ? 1_555 ZL HOH .    O     ? ? 0 SR  8902 0 HOH 9861 1_555 ? ? ? ? ? ? ? 2.613 ? ? 
metalc941  metalc ?    ? OG SR  .    SR    ? ? ? 1_555 D  GLN 231  OE1   ? ? 0 SR  8902 B GLN 230  1_555 ? ? ? ? ? ? ? 2.584 ? ? 
metalc942  metalc ?    ? OG SR  .    SR    ? ? ? 1_555 CM HOH .    O     ? ? 0 SR  8902 B HOH 8994 1_555 ? ? ? ? ? ? ? 2.310 ? ? 
metalc943  metalc ?    ? PG SR  .    SR    ? ? ? 1_555 ZL HOH .    O     ? ? 0 SR  8903 0 HOH 9897 1_555 ? ? ? ? ? ? ? 2.652 ? ? 
metalc944  metalc ?    ? QG SR  .    SR    ? ? ? 1_555 ZL HOH .    O     ? ? 0 SR  8904 0 HOH 9931 1_555 ? ? ? ? ? ? ? 2.437 ? ? 
metalc945  metalc ?    ? SG SR  .    SR    ? ? ? 1_555 DM HOH .    O     ? ? 0 SR  8906 C HOH 8547 1_555 ? ? ? ? ? ? ? 2.604 ? ? 
metalc946  metalc ?    ? TG SR  .    SR    ? ? ? 1_555 J  ASP 13   O     ? ? 0 SR  8907 H ASP 13   1_555 ? ? ? ? ? ? ? 2.503 ? ? 
metalc947  metalc ?    ? TG SR  .    SR    ? ? ? 1_555 IM HOH .    O     ? ? 0 SR  8907 H HOH 8991 1_555 ? ? ? ? ? ? ? 2.862 ? ? 
metalc948  metalc ?    ? UG SR  .    SR    ? ? ? 1_555 O  ASP 157  OD2   ? ? 0 SR  8908 M ASP 157  1_555 ? ? ? ? ? ? ? 2.798 ? ? 
metalc949  metalc ?    ? UG SR  .    SR    ? ? ? 1_555 NM HOH .    O     ? ? 0 SR  8908 M HOH 8939 1_555 ? ? ? ? ? ? ? 2.982 ? ? 
metalc950  metalc ?    ? XG SR  .    SR    ? ? ? 1_555 V  ASP 69   OD1   ? ? 0 SR  8911 T ASP 68   1_555 ? ? ? ? ? ? ? 3.201 ? ? 
metalc951  metalc ?    ? XG SR  .    SR    ? ? ? 1_555 V  ASP 69   OD2   ? ? 0 SR  8911 T ASP 68   1_555 ? ? ? ? ? ? ? 2.803 ? ? 
metalc952  metalc ?    ? XG SR  .    SR    ? ? ? 1_555 UM HOH .    O     ? ? 0 SR  8911 T HOH 4403 1_555 ? ? ? ? ? ? ? 2.466 ? ? 
metalc953  metalc ?    ? ZG SR  .    SR    ? ? ? 1_555 DM HOH .    O     ? ? 0 SR  8915 C HOH 8540 1_555 ? ? ? ? ? ? ? 2.925 ? ? 
metalc954  metalc ?    ? GH SR  .    SR    ? ? ? 1_555 ZL HOH .    O     ? ? 0 SR  8922 0 HOH 9702 1_555 ? ? ? ? ? ? ? 2.636 ? ? 
metalc955  metalc ?    ? GH SR  .    SR    ? ? ? 1_555 ZL HOH .    O     ? ? 0 SR  8922 0 HOH 9742 1_555 ? ? ? ? ? ? ? 2.830 ? ? 
metalc956  metalc ?    ? HH SR  .    SR    ? ? ? 1_555 ZL HOH .    O     ? ? 0 SR  8923 0 HOH 9612 1_555 ? ? ? ? ? ? ? 2.688 ? ? 
metalc957  metalc ?    ? PH SR  .    SR    ? ? ? 1_555 BN HOH .    O     ? ? 0 SR  8934 1 HOH 9002 1_555 ? ? ? ? ? ? ? 3.389 ? ? 
metalc958  metalc ?    ? UH SR  .    SR    ? ? ? 1_555 V  ASP 69   OD2   ? ? 0 SR  8939 T ASP 68   1_555 ? ? ? ? ? ? ? 3.277 ? ? 
metalc959  metalc ?    ? UH SR  .    SR    ? ? ? 1_555 UM HOH .    O     ? ? 0 SR  8939 T HOH 4403 1_555 ? ? ? ? ? ? ? 2.926 ? ? 
metalc960  metalc ?    ? VH SR  .    SR    ? ? ? 1_555 ZL HOH .    O     ? ? 0 SR  8940 0 HOH 9558 1_555 ? ? ? ? ? ? ? 3.171 ? ? 
metalc961  metalc ?    ? VH SR  .    SR    ? ? ? 1_555 N  ASP 37   O     ? ? 0 SR  8940 L ASP 36   1_555 ? ? ? ? ? ? ? 2.642 ? ? 
metalc962  metalc ?    ? VH SR  .    SR    ? ? ? 1_555 MM HOH .    O     ? ? 0 SR  8940 L HOH 8831 1_555 ? ? ? ? ? ? ? 3.352 ? ? 
metalc963  metalc ?    ? CI SR  .    SR    ? ? ? 1_555 ZL HOH .    O     ? ? 0 SR  8947 0 HOH 9946 1_555 ? ? ? ? ? ? ? 2.746 ? ? 
metalc964  metalc ?    ? GI SR  .    SR    ? ? ? 1_555 EA ARG 42   O     ? ? 0 SR  8953 3 ARG 42   1_555 ? ? ? ? ? ? ? 2.801 ? ? 
metalc965  metalc ?    ? GI SR  .    SR    ? ? ? 1_555 DN HOH .    O     ? ? 0 SR  8953 3 HOH 8970 1_555 ? ? ? ? ? ? ? 2.753 ? ? 
metalc966  metalc ?    ? KI SR  .    SR    ? ? ? 1_555 CA GLY 41   O     ? ? 0 SR  8957 1 GLY 40   1_555 ? ? ? ? ? ? ? 2.510 ? ? 
metalc967  metalc ?    ? LI SR  .    SR    ? ? ? 1_555 ZL HOH .    O     ? ? 0 SR  8958 0 HOH 9927 1_555 ? ? ? ? ? ? ? 2.332 ? ? 
metalc968  metalc ?    ? UI SR  .    SR    ? ? ? 1_555 B  C   91   O2    ? ? 0 SR  8968 9 C   91   1_555 ? ? ? ? ? ? ? 2.885 ? ? 
metalc969  metalc ?    ? UI SR  .    SR    ? ? ? 1_555 IM HOH .    O     ? ? 0 SR  8968 H HOH 9012 1_555 ? ? ? ? ? ? ? 2.651 ? ? 
metalc970  metalc ?    ? VI SR  .    SR    ? ? ? 1_555 ZL HOH .    O     ? ? 0 SR  8969 0 HOH 9713 1_555 ? ? ? ? ? ? ? 3.059 ? ? 
metalc971  metalc ?    ? VI SR  .    SR    ? ? ? 1_555 N  GLY 15   O     ? ? 0 SR  8969 L GLY 14   1_555 ? ? ? ? ? ? ? 3.097 ? ? 
metalc972  metalc ?    ? VI SR  .    SR    ? ? ? 1_555 MM HOH .    O     ? ? 0 SR  8969 L HOH 8881 1_555 ? ? ? ? ? ? ? 2.489 ? ? 
metalc973  metalc ?    ? CJ SR  .    SR    ? ? ? 1_555 B  C   91   "O3'" ? ? 0 SR  8978 9 C   91   1_555 ? ? ? ? ? ? ? 3.102 ? ? 
metalc974  metalc ?    ? CJ SR  .    SR    ? ? ? 1_555 B  G   92   OP1   ? ? 0 SR  8978 9 G   92   1_555 ? ? ? ? ? ? ? 2.540 ? ? 
metalc975  metalc ?    ? CJ SR  .    SR    ? ? ? 1_555 AM HOH .    O     ? ? 0 SR  8978 9 HOH 9071 1_555 ? ? ? ? ? ? ? 2.834 ? ? 
metalc976  metalc ?    ? IJ SR  .    SR    ? ? ? 1_555 ZL HOH .    O     ? ? 0 SR  8985 0 HOH 9724 1_555 ? ? ? ? ? ? ? 3.330 ? ? 
metalc977  metalc ?    ? JJ SR  .    SR    ? ? ? 1_555 L  GLU 28   OE2   ? ? 0 SR  8986 J GLU 28   1_555 ? ? ? ? ? ? ? 2.735 ? ? 
metalc978  metalc ?    ? VJ SR  .    SR    ? ? ? 1_555 EA ASP 59   O     ? ? 0 SR  8999 3 ASP 59   1_555 ? ? ? ? ? ? ? 2.420 ? ? 
metalc979  metalc ?    ? YJ SR  .    SR    ? ? ? 1_555 AA SER 208  O     ? ? 0 SR  9002 Y SER 207  1_555 ? ? ? ? ? ? ? 3.225 ? ? 
metalc980  metalc ?    ? CK SR  .    SR    ? ? ? 1_555 SM HOH .    O     ? ? 0 SR  9008 R HOH 8959 1_555 ? ? ? ? ? ? ? 2.823 ? ? 
metalc981  metalc ?    ? CK SR  .    SR    ? ? ? 1_555 SM HOH .    O     ? ? 0 SR  9008 R HOH 8960 1_555 ? ? ? ? ? ? ? 2.716 ? ? 
metalc982  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 UL SR  .    SR    ? ? 0 HOH 9666 1 SR  8913 1_555 ? ? ? ? ? ? ? 2.733 ? ? 
metalc983  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 VL SR  .    SR    ? ? 0 HOH 9799 1 SR  8952 1_555 ? ? ? ? ? ? ? 2.813 ? ? 
metalc984  metalc ?    ? ZL HOH .    O     ? ? ? 1_555 WK NA  .    NA    ? ? 0 HOH 9984 J NA  8538 1_555 ? ? ? ? ? ? ? 2.574 ? ? 
metalc985  metalc ?    ? B  C   40   N3    ? ? ? 1_555 EK NA  .    NA    ? ? 9 C   40   9 NA  8543 1_555 ? ? ? ? ? ? ? 2.481 ? ? 
metalc986  metalc ?    ? B  C   40   O2    ? ? ? 1_555 EK NA  .    NA    ? ? 9 C   40   9 NA  8543 1_555 ? ? ? ? ? ? ? 2.994 ? ? 
metalc987  metalc ?    ? B  A   44   OP2   ? ? ? 1_555 HK SR  .    SR    ? ? 9 A   44   9 SR  9003 1_555 ? ? ? ? ? ? ? 2.647 ? ? 
metalc988  metalc ?    ? B  A   56   OP2   ? ? ? 1_555 DK MG  .    MG    ? ? 9 A   56   9 MG  8074 1_555 ? ? ? ? ? ? ? 2.082 ? ? 
metalc989  metalc ?    ? B  A   57   OP2   ? ? ? 1_555 DK MG  .    MG    ? ? 9 A   57   9 MG  8074 1_555 ? ? ? ? ? ? ? 2.410 ? ? 
metalc990  metalc ?    ? B  G   78   O6    ? ? ? 1_555 GK SR  .    SR    ? ? 9 G   78   9 SR  8980 1_555 ? ? ? ? ? ? ? 3.034 ? ? 
metalc991  metalc ?    ? B  G   102  OP2   ? ? ? 1_555 GK SR  .    SR    ? ? 9 G   102  9 SR  8980 1_555 ? ? ? ? ? ? ? 2.725 ? ? 
metalc992  metalc ?    ? DK MG  .    MG    ? ? ? 1_555 AM HOH .    O     ? ? 9 MG  8074 9 HOH 9138 1_555 ? ? ? ? ? ? ? 2.215 ? ? 
metalc993  metalc ?    ? HK SR  .    SR    ? ? ? 1_555 AM HOH .    O     ? ? 9 SR  9003 9 HOH 9032 1_555 ? ? ? ? ? ? ? 3.053 ? ? 
metalc994  metalc ?    ? HK SR  .    SR    ? ? ? 1_555 AM HOH .    O     ? ? 9 SR  9003 9 HOH 9082 1_555 ? ? ? ? ? ? ? 2.670 ? ? 
metalc995  metalc ?    ? HK SR  .    SR    ? ? ? 1_555 AM HOH .    O     ? ? 9 SR  9003 9 HOH 9107 1_555 ? ? ? ? ? ? ? 2.474 ? ? 
metalc996  metalc ?    ? C  ASP 27   OD2   ? ? ? 1_555 MK SR  .    SR    ? ? A ASP 26   A SR  8930 1_555 ? ? ? ? ? ? ? 3.240 ? ? 
metalc997  metalc ?    ? C  LEU 28   N     ? ? ? 1_555 JK MG  .    MG    ? ? A LEU 27   A MG  8051 1_555 ? ? ? ? ? ? ? 1.797 ? ? 
metalc998  metalc ?    ? C  GLU 29   OE1   ? ? ? 1_555 MK SR  .    SR    ? ? A GLU 28   A SR  8930 1_555 ? ? ? ? ? ? ? 2.807 ? ? 
metalc999  metalc ?    ? C  GLU 29   OE1   ? ? ? 1_555 NK SR  .    SR    ? ? A GLU 28   A SR  8977 1_555 ? ? ? ? ? ? ? 3.257 ? ? 
metalc1000 metalc ?    ? C  GLU 29   OE2   ? ? ? 1_555 NK SR  .    SR    ? ? A GLU 28   A SR  8977 1_555 ? ? ? ? ? ? ? 2.882 ? ? 
metalc1001 metalc ?    ? C  ARG 121  NH2   ? ? ? 1_555 JK MG  .    MG    ? ? A ARG 120  A MG  8051 1_555 ? ? ? ? ? ? ? 3.055 ? ? 
metalc1002 metalc ?    ? C  PHE 202  O     ? ? ? 1_555 LK SR  .    SR    ? ? A PHE 201  A SR  8929 1_555 ? ? ? ? ? ? ? 2.628 ? ? 
metalc1003 metalc ?    ? C  GLY 203  O     ? ? ? 1_555 LK SR  .    SR    ? ? A GLY 202  A SR  8929 1_555 ? ? ? ? ? ? ? 2.999 ? ? 
metalc1004 metalc ?    ? C  GLY 204  O     ? ? ? 1_555 LK SR  .    SR    ? ? A GLY 203  A SR  8929 1_555 ? ? ? ? ? ? ? 3.040 ? ? 
metalc1005 metalc ?    ? C  HIS 209  O     ? ? ? 1_555 LK SR  .    SR    ? ? A HIS 208  A SR  8929 1_555 ? ? ? ? ? ? ? 2.988 ? ? 
metalc1006 metalc ?    ? IK MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? A MG  8050 A HOH 8988 1_555 ? ? ? ? ? ? ? 1.995 ? ? 
metalc1007 metalc ?    ? IK MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? A MG  8050 A HOH 9002 1_555 ? ? ? ? ? ? ? 2.680 ? ? 
metalc1008 metalc ?    ? IK MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? A MG  8050 A HOH 9016 1_555 ? ? ? ? ? ? ? 2.488 ? ? 
metalc1009 metalc ?    ? IK MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? A MG  8050 A HOH 9063 1_555 ? ? ? ? ? ? ? 2.237 ? ? 
metalc1010 metalc ?    ? IK MG  .    MG    ? ? ? 1_555 BM HOH .    O     ? ? A MG  8050 A HOH 9092 1_555 ? ? ? ? ? ? ? 2.307 ? ? 
metalc1011 metalc ?    ? LK SR  .    SR    ? ? ? 1_555 BM HOH .    O     ? ? A SR  8929 A HOH 9022 1_555 ? ? ? ? ? ? ? 3.091 ? ? 
metalc1012 metalc ?    ? LK SR  .    SR    ? ? ? 1_555 BM HOH .    O     ? ? A SR  8929 A HOH 9062 1_555 ? ? ? ? ? ? ? 3.260 ? ? 
metalc1013 metalc ?    ? LK SR  .    SR    ? ? ? 1_555 BM HOH .    O     ? ? A SR  8929 A HOH 9095 1_555 ? ? ? ? ? ? ? 2.999 ? ? 
metalc1014 metalc ?    ? D  ASN 244  OD1   ? ? ? 1_555 QK SR  .    SR    ? ? B ASN 243  B SR  8950 1_555 ? ? ? ? ? ? ? 2.762 ? ? 
metalc1015 metalc ?    ? D  SER 246  OG    ? ? ? 1_555 QK SR  .    SR    ? ? B SER 245  B SR  8950 1_555 ? ? ? ? ? ? ? 2.834 ? ? 
metalc1016 metalc ?    ? D  ARG 311  NH2   ? ? ? 1_555 RK SR  .    SR    ? ? B ARG 310  B SR  8987 1_555 ? ? ? ? ? ? ? 2.357 ? ? 
metalc1017 metalc ?    ? OK MG  .    MG    ? ? ? 1_555 CM HOH .    O     ? ? B MG  8042 B HOH 9021 1_555 ? ? ? ? ? ? ? 2.062 ? ? 
metalc1018 metalc ?    ? OK MG  .    MG    ? ? ? 1_555 CM HOH .    O     ? ? B MG  8042 B HOH 9135 1_555 ? ? ? ? ? ? ? 2.026 ? ? 
metalc1019 metalc ?    ? OK MG  .    MG    ? ? ? 1_555 CM HOH .    O     ? ? B MG  8042 B HOH 9136 1_555 ? ? ? ? ? ? ? 2.388 ? ? 
metalc1020 metalc ?    ? E  ASP 45   OD1   ? ? ? 1_555 SK NA  .    NA    ? ? C ASP 45   C NA  8503 1_555 ? ? ? ? ? ? ? 2.506 ? ? 
metalc1021 metalc ?    ? E  THR 94   O     ? ? ? 1_555 SK NA  .    NA    ? ? C THR 94   C NA  8503 1_555 ? ? ? ? ? ? ? 2.921 ? ? 
metalc1022 metalc ?    ? E  LYS 96   O     ? ? ? 1_555 SK NA  .    NA    ? ? C LYS 96   C NA  8503 1_555 ? ? ? ? ? ? ? 2.642 ? ? 
metalc1023 metalc ?    ? GM HOH .    O     ? ? ? 1_555 TK SR  .    SR    ? ? F HOH 6403 F SR  9005 1_555 ? ? ? ? ? ? ? 3.320 ? ? 
metalc1024 metalc ?    ? J  TYR 157  O     ? ? ? 1_555 VK SR  .    SR    ? ? H TYR 157  H SR  8972 1_555 ? ? ? ? ? ? ? 3.027 ? ? 
metalc1025 metalc ?    ? J  ILE 160  O     ? ? ? 1_555 VK SR  .    SR    ? ? H ILE 160  H SR  8972 1_555 ? ? ? ? ? ? ? 3.006 ? ? 
metalc1026 metalc ?    ? J  THR 161  O     ? ? ? 1_555 VK SR  .    SR    ? ? H THR 161  H SR  8972 1_555 ? ? ? ? ? ? ? 3.326 ? ? 
metalc1027 metalc ?    ? J  PRO 162  O     ? ? ? 1_555 VK SR  .    SR    ? ? H PRO 162  H SR  8972 1_555 ? ? ? ? ? ? ? 2.799 ? ? 
metalc1028 metalc ?    ? L  ARG 60   O     ? ? ? 1_555 WK NA  .    NA    ? ? J ARG 60   J NA  8538 1_555 ? ? ? ? ? ? ? 2.737 ? ? 
metalc1029 metalc ?    ? L  VAL 61   O     ? ? ? 1_555 WK NA  .    NA    ? ? J VAL 61   J NA  8538 1_555 ? ? ? ? ? ? ? 2.669 ? ? 
metalc1030 metalc ?    ? L  ILE 63   O     ? ? ? 1_555 WK NA  .    NA    ? ? J ILE 63   J NA  8538 1_555 ? ? ? ? ? ? ? 2.605 ? ? 
metalc1031 metalc ?    ? L  TYR 69   O     ? ? ? 1_555 WK NA  .    NA    ? ? J TYR 69   J NA  8538 1_555 ? ? ? ? ? ? ? 2.589 ? ? 
metalc1032 metalc ?    ? M  ASN 42   OD1   ? ? ? 1_555 AL MG  .    MG    ? ? K ASN 42   K MG  8054 1_555 ? ? ? ? ? ? ? 2.569 ? ? 
metalc1033 metalc ?    ? LM HOH .    O     ? ? ? 1_555 AL MG  .    MG    ? ? K HOH 2121 K MG  8054 1_555 ? ? ? ? ? ? ? 2.167 ? ? 
metalc1034 metalc ?    ? LM HOH .    O     ? ? ? 1_555 AL MG  .    MG    ? ? K HOH 7871 K MG  8054 1_555 ? ? ? ? ? ? ? 1.928 ? ? 
metalc1035 metalc ?    ? O  SER 106  O     ? ? ? 1_555 CL NA  .    NA    ? ? M SER 106  M NA  8539 1_555 ? ? ? ? ? ? ? 2.612 ? ? 
metalc1036 metalc ?    ? O  SER 106  OG    ? ? ? 1_555 CL NA  .    NA    ? ? M SER 106  M NA  8539 1_555 ? ? ? ? ? ? ? 2.616 ? ? 
metalc1037 metalc ?    ? O  PHE 109  O     ? ? ? 1_555 CL NA  .    NA    ? ? M PHE 109  M NA  8539 1_555 ? ? ? ? ? ? ? 2.732 ? ? 
metalc1038 metalc ?    ? O  LEU 112  O     ? ? ? 1_555 CL NA  .    NA    ? ? M LEU 112  M NA  8539 1_555 ? ? ? ? ? ? ? 2.656 ? ? 
metalc1039 metalc ?    ? CL NA  .    NA    ? ? ? 1_555 NM HOH .    O     ? ? M NA  8539 M HOH 8924 1_555 ? ? ? ? ? ? ? 2.749 ? ? 
metalc1040 metalc ?    ? Q  HIS 41   ND1   ? ? ? 1_555 FL CD  .    CD    ? ? O HIS 40   O CD  8705 1_555 ? ? ? ? ? ? ? 2.427 ? ? 
metalc1041 metalc ?    ? S  ASP 21   O     ? ? ? 1_555 HL NA  .    NA    ? ? Q ASP 20   Q NA  8540 1_555 ? ? ? ? ? ? ? 2.574 ? ? 
metalc1042 metalc ?    ? S  GLY 23   O     ? ? ? 1_555 HL NA  .    NA    ? ? Q GLY 22   Q NA  8540 1_555 ? ? ? ? ? ? ? 2.513 ? ? 
metalc1043 metalc ?    ? S  SER 25   OG    ? ? ? 1_555 HL NA  .    NA    ? ? Q SER 24   Q NA  8540 1_555 ? ? ? ? ? ? ? 2.867 ? ? 
metalc1044 metalc ?    ? S  SER 47   OG    ? ? ? 1_555 HL NA  .    NA    ? ? Q SER 46   Q NA  8540 1_555 ? ? ? ? ? ? ? 2.570 ? ? 
metalc1045 metalc ?    ? RM HOH .    O     ? ? ? 1_555 HL NA  .    NA    ? ? Q HOH 1795 Q NA  8540 1_555 ? ? ? ? ? ? ? 2.442 ? ? 
metalc1046 metalc ?    ? RM HOH .    O     ? ? ? 1_555 HL NA  .    NA    ? ? Q HOH 5427 Q NA  8540 1_555 ? ? ? ? ? ? ? 2.922 ? ? 
metalc1047 metalc ?    ? T  LYS 61   O     ? ? ? 1_555 JL NA  .    NA    ? ? R LYS 60   R NA  8575 1_555 ? ? ? ? ? ? ? 2.618 ? ? 
metalc1048 metalc ?    ? T  GLN 62   O     ? ? ? 1_555 LL SR  .    SR    ? ? R GLN 61   R SR  8912 1_555 ? ? ? ? ? ? ? 2.659 ? ? 
metalc1049 metalc ?    ? T  ASN 64   OD1   ? ? ? 1_555 LL SR  .    SR    ? ? R ASN 63   R SR  8912 1_555 ? ? ? ? ? ? ? 3.043 ? ? 
metalc1050 metalc ?    ? T  SER 71   O     ? ? ? 1_555 IL NA  .    NA    ? ? R SER 70   R NA  8532 1_555 ? ? ? ? ? ? ? 2.523 ? ? 
metalc1051 metalc ?    ? T  VAL 73   O     ? ? ? 1_555 IL NA  .    NA    ? ? R VAL 72   R NA  8532 1_555 ? ? ? ? ? ? ? 2.711 ? ? 
metalc1052 metalc ?    ? IL NA  .    NA    ? ? ? 1_555 SM HOH .    O     ? ? R NA  8532 R HOH 8928 1_555 ? ? ? ? ? ? ? 2.461 ? ? 
metalc1053 metalc ?    ? IL NA  .    NA    ? ? ? 1_555 SM HOH .    O     ? ? R NA  8532 R HOH 8930 1_555 ? ? ? ? ? ? ? 2.693 ? ? 
metalc1054 metalc ?    ? IL NA  .    NA    ? ? ? 1_555 SM HOH .    O     ? ? R NA  8532 R HOH 8964 1_555 ? ? ? ? ? ? ? 2.484 ? ? 
metalc1055 metalc ?    ? JL NA  .    NA    ? ? ? 1_555 LL SR  .    SR    ? ? R NA  8575 R SR  8912 1_555 ? ? ? ? ? ? ? 2.976 ? ? 
metalc1056 metalc ?    ? U  HIS 8    NE2   ? ? ? 1_555 ML NA  .    NA    ? ? S HIS 7    S NA  8510 1_555 ? ? ? ? ? ? ? 2.483 ? ? 
metalc1057 metalc ?    ? U  ASP 60   OD2   ? ? ? 1_555 NL SR  .    SR    ? ? S ASP 59   S SR  8961 1_555 ? ? ? ? ? ? ? 2.801 ? ? 
metalc1058 metalc ?    ? U  ASP 60   OD1   ? ? ? 1_555 NL SR  .    SR    ? ? S ASP 59   S SR  8961 1_555 ? ? ? ? ? ? ? 3.212 ? ? 
metalc1059 metalc ?    ? U  GLU 62   OE2   ? ? ? 1_555 ML NA  .    NA    ? ? S GLU 61   S NA  8510 1_555 ? ? ? ? ? ? ? 2.169 ? ? 
metalc1060 metalc ?    ? U  GLU 62   OE1   ? ? ? 1_555 ML NA  .    NA    ? ? S GLU 61   S NA  8510 1_555 ? ? ? ? ? ? ? 2.562 ? ? 
metalc1061 metalc ?    ? ML NA  .    NA    ? ? ? 1_555 TM HOH .    O     ? ? S NA  8510 S HOH 8973 1_555 ? ? ? ? ? ? ? 2.390 ? ? 
metalc1062 metalc ?    ? V  GLN 38   OE1   ? ? ? 1_555 OL MG  .    MG    ? ? T GLN 37   T MG  8057 1_555 ? ? ? ? ? ? ? 3.066 ? ? 
metalc1063 metalc ?    ? V  LEU 113  O     ? ? ? 1_555 OL MG  .    MG    ? ? T LEU 112  T MG  8057 1_555 ? ? ? ? ? ? ? 2.763 ? ? 
metalc1064 metalc ?    ? V  SER 115  O     ? ? ? 1_555 OL MG  .    MG    ? ? T SER 114  T MG  8057 1_555 ? ? ? ? ? ? ? 2.363 ? ? 
metalc1065 metalc ?    ? V  ASP 118  O     ? ? ? 1_555 OL MG  .    MG    ? ? T ASP 117  T MG  8057 1_555 ? ? ? ? ? ? ? 2.174 ? ? 
metalc1066 metalc ?    ? UM HOH .    O     ? ? ? 1_555 OL MG  .    MG    ? ? T HOH 2868 T MG  8057 1_555 ? ? ? ? ? ? ? 2.460 ? ? 
metalc1067 metalc ?    ? W  CYS 6    SG    ? ? ? 1_555 PL CD  .    CD    ? ? U CYS 6    U CD  8701 1_555 ? ? ? ? ? ? ? 2.471 ? ? 
metalc1068 metalc ?    ? W  CYS 9    SG    ? ? ? 1_555 PL CD  .    CD    ? ? U CYS 9    U CD  8701 1_555 ? ? ? ? ? ? ? 2.487 ? ? 
metalc1069 metalc ?    ? W  CYS 32   SG    ? ? ? 1_555 PL CD  .    CD    ? ? U CYS 32   U CD  8701 1_555 ? ? ? ? ? ? ? 2.469 ? ? 
metalc1070 metalc ?    ? W  CYS 36   SG    ? ? ? 1_555 PL CD  .    CD    ? ? U CYS 36   U CD  8701 1_555 ? ? ? ? ? ? ? 2.507 ? ? 
metalc1071 metalc ?    ? AA HIS 134  O     ? ? ? 1_555 QL MG  .    MG    ? ? Y HIS 133  Y MG  8086 1_555 ? ? ? ? ? ? ? 2.275 ? ? 
metalc1072 metalc ?    ? AA LYS 137  O     ? ? ? 1_555 QL MG  .    MG    ? ? Y LYS 136  Y MG  8086 1_555 ? ? ? ? ? ? ? 2.637 ? ? 
metalc1073 metalc ?    ? AA VAL 140  O     ? ? ? 1_555 QL MG  .    MG    ? ? Y VAL 139  Y MG  8086 1_555 ? ? ? ? ? ? ? 2.437 ? ? 
metalc1074 metalc ?    ? QL MG  .    MG    ? ? ? 1_555 ZM HOH .    O     ? ? Y MG  8086 Y HOH 8859 1_555 ? ? ? ? ? ? ? 2.502 ? ? 
metalc1075 metalc ?    ? QL MG  .    MG    ? ? ? 1_555 ZM HOH .    O     ? ? Y MG  8086 Y HOH 8880 1_555 ? ? ? ? ? ? ? 2.448 ? ? 
metalc1076 metalc ?    ? QL MG  .    MG    ? ? ? 1_555 ZM HOH .    O     ? ? Y MG  8086 Y HOH 8915 1_555 ? ? ? ? ? ? ? 2.610 ? ? 
metalc1077 metalc ?    ? BA CYS 30   SG    ? ? ? 1_555 SL CD  .    CD    ? ? Z CYS 39   Z CD  8703 1_555 ? ? ? ? ? ? ? 2.407 ? ? 
metalc1078 metalc ?    ? BA CYS 33   SG    ? ? ? 1_555 SL CD  .    CD    ? ? Z CYS 42   Z CD  8703 1_555 ? ? ? ? ? ? ? 2.659 ? ? 
metalc1079 metalc ?    ? BA CYS 48   SG    ? ? ? 1_555 SL CD  .    CD    ? ? Z CYS 57   Z CD  8703 1_555 ? ? ? ? ? ? ? 2.473 ? ? 
metalc1080 metalc ?    ? BA CYS 51   SG    ? ? ? 1_555 SL CD  .    CD    ? ? Z CYS 60   Z CD  8703 1_555 ? ? ? ? ? ? ? 2.222 ? ? 
metalc1081 metalc ?    ? CA LYS 11   O     ? ? ? 1_555 UL SR  .    SR    ? ? 1 LYS 10   1 SR  8913 1_555 ? ? ? ? ? ? ? 2.640 ? ? 
metalc1082 metalc ?    ? CA ASN 13   OD1   ? ? ? 1_555 UL SR  .    SR    ? ? 1 ASN 12   1 SR  8913 1_555 ? ? ? ? ? ? ? 2.680 ? ? 
metalc1083 metalc ?    ? CA CYS 20   SG    ? ? ? 1_555 TL CD  .    CD    ? ? 1 CYS 19   1 CD  8702 1_555 ? ? ? ? ? ? ? 2.526 ? ? 
metalc1084 metalc ?    ? CA CYS 23   SG    ? ? ? 1_555 TL CD  .    CD    ? ? 1 CYS 22   1 CD  8702 1_555 ? ? ? ? ? ? ? 2.447 ? ? 
metalc1085 metalc ?    ? CA CYS 35   SG    ? ? ? 1_555 TL CD  .    CD    ? ? 1 CYS 34   1 CD  8702 1_555 ? ? ? ? ? ? ? 2.471 ? ? 
metalc1086 metalc ?    ? CA CYS 38   SG    ? ? ? 1_555 TL CD  .    CD    ? ? 1 CYS 37   1 CD  8702 1_555 ? ? ? ? ? ? ? 2.408 ? ? 
metalc1087 metalc ?    ? CA ASP 48   O     ? ? ? 1_555 VL SR  .    SR    ? ? 1 ASP 47   1 SR  8952 1_555 ? ? ? ? ? ? ? 2.517 ? ? 
metalc1088 metalc ?    ? UL SR  .    SR    ? ? ? 1_555 BN HOH .    O     ? ? 1 SR  8913 1 HOH 8990 1_555 ? ? ? ? ? ? ? 3.077 ? ? 
metalc1089 metalc ?    ? VL SR  .    SR    ? ? ? 1_555 BN HOH .    O     ? ? 1 SR  8952 1 HOH 8976 1_555 ? ? ? ? ? ? ? 3.045 ? ? 
metalc1090 metalc ?    ? EA CYS 11   SG    ? ? ? 1_555 WL CD  .    CD    ? ? 3 CYS 11   3 CD  8704 1_555 ? ? ? ? ? ? ? 2.417 ? ? 
metalc1091 metalc ?    ? EA CYS 14   SG    ? ? ? 1_555 WL CD  .    CD    ? ? 3 CYS 14   3 CD  8704 1_555 ? ? ? ? ? ? ? 2.488 ? ? 
metalc1092 metalc ?    ? EA GLY 45   O     ? ? ? 1_555 YL SR  .    SR    ? ? 3 GLY 45   3 SR  8932 1_555 ? ? ? ? ? ? ? 2.459 ? ? 
metalc1093 metalc ?    ? EA GLY 47   O     ? ? ? 1_555 YL SR  .    SR    ? ? 3 GLY 47   3 SR  8932 1_555 ? ? ? ? ? ? ? 2.739 ? ? 
metalc1094 metalc ?    ? EA ASP 49   OD2   ? ? ? 1_555 YL SR  .    SR    ? ? 3 ASP 49   3 SR  8932 1_555 ? ? ? ? ? ? ? 2.825 ? ? 
metalc1095 metalc ?    ? EA ASP 49   OD1   ? ? ? 1_555 YL SR  .    SR    ? ? 3 ASP 49   3 SR  8932 1_555 ? ? ? ? ? ? ? 2.864 ? ? 
metalc1096 metalc ?    ? EA CYS 71   SG    ? ? ? 1_555 WL CD  .    CD    ? ? 3 CYS 71   3 CD  8704 1_555 ? ? ? ? ? ? ? 2.306 ? ? 
metalc1097 metalc ?    ? EA CYS 74   SG    ? ? ? 1_555 WL CD  .    CD    ? ? 3 CYS 74   3 CD  8704 1_555 ? ? ? ? ? ? ? 2.396 ? ? 
hydrog1    hydrog ?    ? A  U   12   O4    ? ? ? 1_555 A  G   531  N2    ? ? 0 U   12   0 G   531  1_555 ? ? ? ? ? ? 'U-G MISPAIR' 
?     ? ? 
hydrog2    hydrog ?    ? A  G   13   N1    ? ? ? 1_555 A  C   530  N3    ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog3    hydrog ?    ? A  G   13   N2    ? ? ? 1_555 A  C   530  O2    ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog4    hydrog ?    ? A  G   13   O6    ? ? ? 1_555 A  C   530  N4    ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog5    hydrog ?    ? A  C   14   N3    ? ? ? 1_555 A  G   529  N1    ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog6    hydrog ?    ? A  C   14   N4    ? ? ? 1_555 A  G   529  O6    ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog7    hydrog ?    ? A  C   14   O2    ? ? ? 1_555 A  G   529  N2    ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog8    hydrog ?    ? A  C   15   N3    ? ? ? 1_555 A  G   528  N1    ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog9    hydrog ?    ? A  C   15   N4    ? ? ? 1_555 A  G   528  O6    ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog10   hydrog ?    ? A  C   15   O2    ? ? ? 1_555 A  G   528  N2    ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog11   hydrog ?    ? A  A   16   N1    ? ? ? 1_555 A  U   527  N3    ? ? 0 A   16   0 U   527  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog12   hydrog ?    ? A  A   16   N6    ? ? ? 1_555 A  U   527  O4    ? ? 0 A   16   0 U   527  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog13   hydrog ?    ? A  G   17   N1    ? ? ? 1_555 A  U   526  O2    ? ? 0 G   17   0 U   526  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog14   hydrog ?    ? A  G   17   O6    ? ? ? 1_555 A  U   526  N3    ? ? 0 G   17   0 U   526  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog15   hydrog ?    ? A  C   18   N3    ? ? ? 1_555 A  G   525  N1    ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog16   hydrog ?    ? A  C   18   N4    ? ? ? 1_555 A  G   525  O6    ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog17   hydrog ?    ? A  C   18   O2    ? ? ? 1_555 A  G   525  N2    ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog18   hydrog ?    ? A  U   19   N3    ? ? ? 1_555 A  A   524  N1    ? ? 0 U   19   0 A   524  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog19   hydrog ?    ? A  U   19   O4    ? ? ? 1_555 A  A   524  N6    ? ? 0 U   19   0 A   524  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog20   hydrog ?    ? A  G   20   N1    ? ? ? 1_555 A  C   523  N3    ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog21   hydrog ?    ? A  G   20   N2    ? ? ? 1_555 A  C   523  O2    ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog22   hydrog ?    ? A  G   20   O6    ? ? ? 1_555 A  C   523  N4    ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog23   hydrog ?    ? A  G   21   N1    ? ? ? 1_555 A  U   522  O2    ? ? 0 G   21   0 U   522  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog24   hydrog ?    ? A  G   21   O6    ? ? ? 1_555 A  U   522  N3    ? ? 0 G   21   0 U   522  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog25   hydrog ?    ? A  U   22   O2    ? ? ? 1_555 A  A   521  N6    ? ? 0 U   22   0 A   521  1_555 ? ? ? ? ? ? 'U-A PAIR' ? 
? ? 
hydrog26   hydrog ?    ? A  G   23   N2    ? ? ? 1_555 A  A   520  N7    ? ? 0 G   23   0 A   520  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog27   hydrog ?    ? A  G   23   N3    ? ? ? 1_555 A  A   520  N6    ? ? 0 G   23   0 A   520  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog28   hydrog ?    ? A  G   24   N2    ? ? ? 1_555 A  A   519  N7    ? ? 0 G   24   0 A   519  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog29   hydrog ?    ? A  G   24   N3    ? ? ? 1_555 A  A   519  N6    ? ? 0 G   24   0 A   519  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog30   hydrog ?    ? A  A   25   N6    ? ? ? 1_555 A  G   518  N3    ? ? 0 A   25   0 G   518  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog31   hydrog ?    ? A  A   25   N7    ? ? ? 1_555 A  G   518  N2    ? ? 0 A   25   0 G   518  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog32   hydrog ?    ? A  U   26   N3    ? ? ? 1_555 A  U   517  O2    ? ? 0 U   26   0 U   517  1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog33   hydrog ?    ? A  U   26   O4    ? ? ? 1_555 A  U   517  N3    ? ? 0 U   26   0 U   517  1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog34   hydrog ?    ? A  U   27   N3    ? ? ? 1_555 A  A   516  N1    ? ? 0 U   27   0 A   516  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog35   hydrog ?    ? A  U   27   O4    ? ? ? 1_555 A  A   516  N6    ? ? 0 U   27   0 A   516  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog36   hydrog ?    ? A  G   28   N1    ? ? ? 1_555 A  C   480  N3    ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog37   hydrog ?    ? A  G   28   N2    ? ? ? 1_555 A  C   480  O2    ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog38   hydrog ?    ? A  G   28   O6    ? ? ? 1_555 A  C   480  N4    ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog39   hydrog ?    ? A  C   29   N3    ? ? ? 1_555 A  G   479  N1    ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog40   hydrog ?    ? A  C   29   N4    ? ? ? 1_555 A  G   479  O6    ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog41   hydrog ?    ? A  C   29   O2    ? ? ? 1_555 A  G   479  N2    ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog42   hydrog ?    ? A  U   30   N3    ? ? ? 1_555 A  A   453  N7    ? ? 0 U   30   0 A   453  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog43   hydrog ?    ? A  U   30   O2    ? ? ? 1_555 A  A   453  N6    ? ? 0 U   30   0 A   453  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog44   hydrog ?    ? A  G   32   N1    ? ? ? 1_555 A  C   451  N3    ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog45   hydrog ?    ? A  G   32   N2    ? ? ? 1_555 A  C   451  O2    ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog46   hydrog ?    ? A  G   32   O6    ? ? ? 1_555 A  C   451  N4    ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog47   hydrog ?    ? A  G   32   N2    ? ? ? 1_555 A  A   455  N1    ? ? 0 G   32   0 A   455  1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog48   hydrog ?    ? A  G   32   N2    ? ? ? 1_555 A  G   456  N3    ? ? 0 G   32   0 G   456  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? 
? ? 
hydrog49   hydrog ?    ? A  G   32   N3    ? ? ? 1_555 A  G   456  N2    ? ? 0 G   32   0 G   456  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? 
? ? 
hydrog50   hydrog ?    ? A  G   33   N1    ? ? ? 1_555 A  C   450  N3    ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog51   hydrog ?    ? A  G   33   N2    ? ? ? 1_555 A  C   450  O2    ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog52   hydrog ?    ? A  G   33   O6    ? ? ? 1_555 A  C   450  N4    ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog53   hydrog ?    ? A  C   34   N3    ? ? ? 1_555 A  G   448  N1    ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog54   hydrog ?    ? A  C   34   N4    ? ? ? 1_555 A  G   448  O6    ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog55   hydrog ?    ? A  C   34   O2    ? ? ? 1_555 A  G   448  N2    ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog56   hydrog ?    ? A  U   35   N3    ? ? ? 1_555 A  A   447  N1    ? ? 0 U   35   0 A   447  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog57   hydrog ?    ? A  U   35   O4    ? ? ? 1_555 A  A   447  N6    ? ? 0 U   35   0 A   447  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog58   hydrog ?    ? A  C   36   N3    ? ? ? 1_555 A  G   446  N1    ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog59   hydrog ?    ? A  C   36   N4    ? ? ? 1_555 A  G   446  O6    ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog60   hydrog ?    ? A  C   36   O2    ? ? ? 1_555 A  G   446  N2    ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog61   hydrog ?    ? A  C   36   O2    ? ? ? 1_555 A  A   674  N6    ? ? 0 C   36   0 A   674  1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog62   hydrog ?    ? A  A   37   N1    ? ? ? 1_555 A  U   445  N3    ? ? 0 A   37   0 U   445  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog63   hydrog ?    ? A  A   37   N6    ? ? ? 1_555 A  U   445  O4    ? ? 0 A   37   0 U   445  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog64   hydrog ?    ? A  G   38   N1    ? ? ? 1_555 A  C   444  N3    ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog65   hydrog ?    ? A  G   38   N2    ? ? ? 1_555 A  C   444  O2    ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog66   hydrog ?    ? A  G   38   O6    ? ? ? 1_555 A  C   444  N4    ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog67   hydrog ?    ? A  G   39   N1    ? ? ? 1_555 A  C   443  N3    ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog68   hydrog ?    ? A  G   39   N2    ? ? ? 1_555 A  C   443  O2    ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog69   hydrog ?    ? A  G   39   O6    ? ? ? 1_555 A  C   443  N4    ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog70   hydrog ?    ? A  C   40   N4    ? ? ? 1_555 A  A   441  N1    ? ? 0 C   40   0 A   441  1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog71   hydrog ?    ? A  C   40   O2    ? ? ? 1_555 A  A   442  N6    ? ? 0 C   40   0 A   442  1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog72   hydrog ?    ? A  G   41   N2    ? ? ? 1_555 A  A   151  N1    ? ? 0 G   41   0 A   151  1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog73   hydrog ?    ? A  G   41   N1    ? ? ? 1_555 A  C   440  N3    ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog74   hydrog ?    ? A  G   41   N2    ? ? ? 1_555 A  C   440  O2    ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog75   hydrog ?    ? A  G   41   O6    ? ? ? 1_555 A  C   440  N4    ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog76   hydrog ?    ? A  C   42   N3    ? ? ? 1_555 A  G   149  N1    ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog77   hydrog ?    ? A  C   42   N4    ? ? ? 1_555 A  G   149  O6    ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog78   hydrog ?    ? A  C   42   O2    ? ? ? 1_555 A  G   149  N2    ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog79   hydrog ?    ? A  U   43   N3    ? ? ? 1_555 A  A   148  N1    ? ? 0 U   43   0 A   148  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog80   hydrog ?    ? A  U   43   O4    ? ? ? 1_555 A  A   148  N6    ? ? 0 U   43   0 A   148  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog81   hydrog ?    ? A  G   44   N2    ? ? ? 1_555 A  A   45   N1    ? ? 0 G   44   0 A   45   1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog82   hydrog ?    ? A  A   45   N6    ? ? ? 1_555 A  U   115  O4    ? ? 0 A   45   0 U   115  1_555 ? ? ? ? ? ? HOOGSTEEN ? ? 
? 
hydrog83   hydrog ?    ? A  A   45   N7    ? ? ? 1_555 A  U   115  N3    ? ? 0 A   45   0 U   115  1_555 ? ? ? ? ? ? HOOGSTEEN ? ? 
? 
hydrog84   hydrog ?    ? A  G   47   N2    ? ? ? 1_555 A  A   113  N7    ? ? 0 G   47   0 A   113  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog85   hydrog ?    ? A  G   47   N3    ? ? ? 1_555 A  A   113  N6    ? ? 0 G   47   0 A   113  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog86   hydrog ?    ? A  A   48   N6    ? ? ? 1_555 A  A   114  N7    ? ? 0 A   48   0 A   114  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog87   hydrog ?    ? A  A   48   N7    ? ? ? 1_555 A  A   114  N6    ? ? 0 A   48   0 A   114  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog88   hydrog ?    ? A  A   49   N6    ? ? ? 1_555 A  G   112  N3    ? ? 0 A   49   0 G   112  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog89   hydrog ?    ? A  A   49   N7    ? ? ? 1_555 A  G   112  N2    ? ? 0 A   49   0 G   112  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog90   hydrog ?    ? A  G   50   N1    ? ? ? 1_555 A  C   111  N3    ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog91   hydrog ?    ? A  G   50   N2    ? ? ? 1_555 A  C   111  O2    ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog92   hydrog ?    ? A  G   50   O6    ? ? ? 1_555 A  C   111  N4    ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog93   hydrog ?    ? A  G   51   N1    ? ? ? 1_555 A  C   110  N3    ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog94   hydrog ?    ? A  G   51   N2    ? ? ? 1_555 A  C   110  O2    ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog95   hydrog ?    ? A  G   51   O6    ? ? ? 1_555 A  C   110  N4    ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog96   hydrog ?    ? A  G   51   N2    ? ? ? 1_555 A  U   121  O2    ? ? 0 G   51   0 U   121  1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog97   hydrog ?    ? A  A   52   N1    ? ? ? 1_555 A  U   109  N3    ? ? 0 A   52   0 U   109  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog98   hydrog ?    ? A  A   52   N6    ? ? ? 1_555 A  U   109  O4    ? ? 0 A   52   0 U   109  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog99   hydrog ?    ? A  C   53   N3    ? ? ? 1_555 A  G   66   N1    ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog100  hydrog ?    ? A  C   53   N4    ? ? ? 1_555 A  G   66   O6    ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog101  hydrog ?    ? A  C   53   O2    ? ? ? 1_555 A  G   66   N2    ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog102  hydrog ?    ? A  G   54   N1    ? ? ? 1_555 A  C   65   N3    ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog103  hydrog ?    ? A  G   54   N2    ? ? ? 1_555 A  C   65   O2    ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog104  hydrog ?    ? A  G   54   O6    ? ? ? 1_555 A  C   65   N4    ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog105  hydrog ?    ? A  G   54   N2    ? ? ? 1_555 A  A   69   N3    ? ? 0 G   54   0 A   69   1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog106  hydrog ?    ? A  U   55   N3    ? ? ? 1_555 A  G   64   O6    ? ? 0 U   55   0 G   64   1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog107  hydrog ?    ? A  U   55   O2    ? ? ? 1_555 A  G   64   N1    ? ? 0 U   55   0 G   64   1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog108  hydrog ?    ? A  G   56   O6    ? ? ? 1_555 A  C   62   N4    ? ? 0 G   56   0 C   62   1_555 ? ? ? ? ? ? 'G-C PAIR' ? 
? ? 
hydrog109  hydrog ?    ? A  G   56   N1    ? ? ? 1_555 A  G   84   O6    ? ? 0 G   56   0 G   84   1_555 ? ? ? ? ? ? TYPE_6_PAIR ? 
? ? 
hydrog110  hydrog ?    ? A  G   56   N2    ? ? ? 1_555 A  G   84   N7    ? ? 0 G   56   0 G   84   1_555 ? ? ? ? ? ? TYPE_6_PAIR ? 
? ? 
hydrog111  hydrog ?    ? A  C   57   N3    ? ? ? 1_555 A  G   89   N1    ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog112  hydrog ?    ? A  C   57   N4    ? ? ? 1_555 A  G   89   O6    ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog113  hydrog ?    ? A  C   57   O2    ? ? ? 1_555 A  G   89   N2    ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog114  hydrog ?    ? A  C   58   N3    ? ? ? 1_555 A  G   88   N1    ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog115  hydrog ?    ? A  C   58   N4    ? ? ? 1_555 A  G   88   O6    ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog116  hydrog ?    ? A  C   58   O2    ? ? ? 1_555 A  G   88   N2    ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog117  hydrog ?    ? A  A   59   N3    ? ? ? 1_555 A  A   60   N6    ? ? 0 A   59   0 A   60   1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog118  hydrog ?    ? A  A   59   N1    ? ? ? 1_555 A  C   85   N4    ? ? 0 A   59   0 C   85   1_555 ? ? ? ? ? ? 'A-C MISPAIR' 
?     ? ? 
hydrog119  hydrog ?    ? A  A   60   N1    ? ? ? 1_555 A  A   86   N6    ? ? 0 A   60   0 A   86   1_555 ? ? ? ? ? ? TYPE_1_PAIR ? 
? ? 
hydrog120  hydrog ?    ? A  A   60   N6    ? ? ? 1_555 A  A   86   N1    ? ? 0 A   60   0 A   86   1_555 ? ? ? ? ? ? TYPE_1_PAIR ? 
? ? 
hydrog121  hydrog ?    ? A  G   61   N1    ? ? ? 1_555 A  C   85   N3    ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog122  hydrog ?    ? A  G   61   N2    ? ? ? 1_555 A  C   85   O2    ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog123  hydrog ?    ? A  G   61   O6    ? ? ? 1_555 A  C   85   N4    ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog124  hydrog ?    ? A  C   62   N3    ? ? ? 1_555 A  G   84   N1    ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog125  hydrog ?    ? A  C   62   N4    ? ? ? 1_555 A  G   84   O6    ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog126  hydrog ?    ? A  C   62   O2    ? ? ? 1_555 A  G   84   N2    ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog127  hydrog ?    ? A  U   63   N3    ? ? ? 1_555 A  A   70   N7    ? ? 0 U   63   0 A   70   1_555 ? ? ? ? ? ? HOOGSTEEN ? ? 
? 
hydrog128  hydrog ?    ? A  U   63   O4    ? ? ? 1_555 A  A   70   N6    ? ? 0 U   63   0 A   70   1_555 ? ? ? ? ? ? HOOGSTEEN ? ? 
? 
hydrog129  hydrog ?    ? A  G   66   N2    ? ? ? 1_555 A  A   67   N1    ? ? 0 G   66   0 A   67   1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog130  hydrog ?    ? A  G   71   N1    ? ? ? 1_555 A  A   106  N1    ? ? 0 G   71   0 A   106  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? 
? ? 
hydrog131  hydrog ?    ? A  G   71   O6    ? ? ? 1_555 A  A   106  N6    ? ? 0 G   71   0 A   106  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? 
? ? 
hydrog132  hydrog ?    ? A  G   71   N1    ? ? ? 1_555 A  U   107  O2    ? ? 0 G   71   0 U   107  1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog133  hydrog ?    ? A  C   72   N3    ? ? ? 1_555 A  G   105  N1    ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog134  hydrog ?    ? A  C   72   N4    ? ? ? 1_555 A  G   105  O6    ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog135  hydrog ?    ? A  C   72   O2    ? ? ? 1_555 A  G   105  N2    ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog136  hydrog ?    ? A  U   73   N3    ? ? ? 1_555 A  A   104  N1    ? ? 0 U   73   0 A   104  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog137  hydrog ?    ? A  U   73   O4    ? ? ? 1_555 A  A   104  N6    ? ? 0 U   73   0 A   104  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog138  hydrog ?    ? A  G   74   N1    ? ? ? 1_555 A  C   103  N3    ? ? 0 G   74   0 C   103  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog139  hydrog ?    ? A  G   74   N2    ? ? ? 1_555 A  C   103  O2    ? ? 0 G   74   0 C   103  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog140  hydrog ?    ? A  G   74   O6    ? ? ? 1_555 A  C   103  N4    ? ? 0 G   74   0 C   103  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog141  hydrog ?    ? A  U   75   N3    ? ? ? 1_555 A  A   102  N1    ? ? 0 U   75   0 A   102  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog142  hydrog ?    ? A  U   75   O4    ? ? ? 1_555 A  A   102  N6    ? ? 0 U   75   0 A   102  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog143  hydrog ?    ? A  G   76   N1    ? ? ? 1_555 A  C   101  N3    ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog144  hydrog ?    ? A  G   76   N2    ? ? ? 1_555 A  C   101  O2    ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog145  hydrog ?    ? A  G   76   O6    ? ? ? 1_555 A  C   101  N4    ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog146  hydrog ?    ? A  G   77   N1    ? ? ? 1_555 A  C   100  N3    ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog147  hydrog ?    ? A  G   77   N2    ? ? ? 1_555 A  C   100  O2    ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog148  hydrog ?    ? A  G   77   O6    ? ? ? 1_555 A  C   100  N4    ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog149  hydrog ?    ? A  G   78   N2    ? ? ? 1_555 A  A   99   N7    ? ? 0 G   78   0 A   99   1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog150  hydrog ?    ? A  G   78   N3    ? ? ? 1_555 A  A   99   N6    ? ? 0 G   78   0 A   99   1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog151  hydrog ?    ? A  G   79   N2    ? ? ? 1_555 A  A   98   N7    ? ? 0 G   79   0 A   98   1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog152  hydrog ?    ? A  A   80   N3    ? ? ? 1_555 A  G   94   N2    ? ? 0 A   80   0 G   94   1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog153  hydrog ?    ? A  A   80   N6    ? ? ? 1_555 A  G   97   N3    ? ? 0 A   80   0 G   97   1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog154  hydrog ?    ? A  A   80   N7    ? ? ? 1_555 A  G   97   N2    ? ? 0 A   80   0 G   97   1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog155  hydrog ?    ? A  G   81   N1    ? ? ? 1_555 A  C   93   N3    ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog156  hydrog ?    ? A  G   81   N2    ? ? ? 1_555 A  C   93   O2    ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog157  hydrog ?    ? A  G   81   O6    ? ? ? 1_555 A  C   93   N4    ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog158  hydrog ?    ? A  G   81   N2    ? ? ? 1_555 A  A   98   N3    ? ? 0 G   81   0 A   98   1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog159  hydrog ?    ? A  C   82   N3    ? ? ? 1_555 A  G   92   N1    ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog160  hydrog ?    ? A  C   82   N4    ? ? ? 1_555 A  G   92   O6    ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog161  hydrog ?    ? A  C   82   O2    ? ? ? 1_555 A  G   92   N2    ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog162  hydrog ?    ? A  C   83   N3    ? ? ? 1_555 A  G   91   N1    ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog163  hydrog ?    ? A  C   83   N4    ? ? ? 1_555 A  G   91   O6    ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog164  hydrog ?    ? A  C   83   O2    ? ? ? 1_555 A  G   91   N2    ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog165  hydrog ?    ? A  G   116  N1    ? ? ? 1_555 A  C   124  N3    ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog166  hydrog ?    ? A  G   116  N2    ? ? ? 1_555 A  C   124  O2    ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog167  hydrog ?    ? A  G   116  O6    ? ? ? 1_555 A  C   124  N4    ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog168  hydrog ?    ? A  A   117  N1    ? ? ? 1_555 A  U   123  N3    ? ? 0 A   117  0 U   123  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog169  hydrog ?    ? A  A   117  N6    ? ? ? 1_555 A  U   123  O4    ? ? 0 A   117  0 U   123  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog170  hydrog ?    ? A  G   118  N1    ? ? ? 1_555 A  C   122  N3    ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog171  hydrog ?    ? A  G   118  N2    ? ? ? 1_555 A  C   122  O2    ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog172  hydrog ?    ? A  G   118  O6    ? ? ? 1_555 A  C   122  N4    ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog173  hydrog ?    ? A  U   125  N3    ? ? ? 1_555 A  A   129  N1    ? ? 0 U   125  0 A   129  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog174  hydrog ?    ? A  U   125  O4    ? ? ? 1_555 A  A   129  N6    ? ? 0 U   125  0 A   129  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog175  hydrog ?    ? A  C   130  N4    ? ? ? 1_555 A  A   144  N7    ? ? 0 C   130  0 A   144  1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog176  hydrog ?    ? A  A   131  N6    ? ? ? 1_555 A  G   147  N7    ? ? 0 A   131  0 G   147  1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog177  hydrog ?    ? A  A   132  N1    ? ? ? 1_555 A  U   146  N3    ? ? 0 A   132  0 U   146  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog178  hydrog ?    ? A  A   132  N6    ? ? ? 1_555 A  U   146  O4    ? ? 0 A   132  0 U   146  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog179  hydrog ?    ? A  U   133  N3    ? ? ? 1_555 A  A   145  N1    ? ? 0 U   133  0 A   145  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog180  hydrog ?    ? A  U   133  O4    ? ? ? 1_555 A  A   145  N6    ? ? 0 U   133  0 A   145  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog181  hydrog ?    ? A  U   134  N3    ? ? ? 1_555 A  A   144  N1    ? ? 0 U   134  0 A   144  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog182  hydrog ?    ? A  U   134  O4    ? ? ? 1_555 A  A   144  N6    ? ? 0 U   134  0 A   144  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog183  hydrog ?    ? A  G   135  N1    ? ? ? 1_555 A  C   143  N3    ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog184  hydrog ?    ? A  G   135  N2    ? ? ? 1_555 A  C   143  O2    ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog185  hydrog ?    ? A  G   135  O6    ? ? ? 1_555 A  C   143  N4    ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog186  hydrog ?    ? A  C   136  N3    ? ? ? 1_555 A  G   142  N1    ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog187  hydrog ?    ? A  C   136  N4    ? ? ? 1_555 A  G   142  O6    ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog188  hydrog ?    ? A  C   136  O2    ? ? ? 1_555 A  G   142  N2    ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog189  hydrog ?    ? A  U   137  O2    ? ? ? 1_555 A  G   140  N1    ? ? 0 U   137  0 G   140  1_555 ? ? ? ? ? ? 'U-G MISPAIR' 
?     ? ? 
hydrog190  hydrog ?    ? A  C   141  O2    ? ? ? 1_555 A  C   143  N4    ? ? 0 C   141  0 C   143  1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog191  hydrog ?    ? A  C   141  N3    ? ? ? 1_555 A  A   144  N6    ? ? 0 C   141  0 A   144  1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog192  hydrog ?    ? A  A   152  N1    ? ? ? 1_555 A  G   185  N1    ? ? 0 A   152  0 G   185  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? 
? ? 
hydrog193  hydrog ?    ? A  A   152  N6    ? ? ? 1_555 A  G   185  O6    ? ? 0 A   152  0 G   185  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? 
? ? 
hydrog194  hydrog ?    ? A  C   153  N3    ? ? ? 1_555 A  G   184  N1    ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog195  hydrog ?    ? A  C   153  N4    ? ? ? 1_555 A  G   184  O6    ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog196  hydrog ?    ? A  C   153  O2    ? ? ? 1_555 A  G   184  N2    ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog197  hydrog ?    ? A  C   154  N3    ? ? ? 1_555 A  G   182  N1    ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog198  hydrog ?    ? A  C   154  N4    ? ? ? 1_555 A  G   182  O6    ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog199  hydrog ?    ? A  C   154  O2    ? ? ? 1_555 A  G   182  N2    ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog200  hydrog ?    ? A  C   155  N3    ? ? ? 1_555 A  G   181  N1    ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog201  hydrog ?    ? A  C   155  N4    ? ? ? 1_555 A  G   181  O6    ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog202  hydrog ?    ? A  C   155  O2    ? ? ? 1_555 A  G   181  N2    ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog203  hydrog ?    ? A  C   156  N3    ? ? ? 1_555 A  G   180  N1    ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog204  hydrog ?    ? A  C   156  N4    ? ? ? 1_555 A  G   180  O6    ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog205  hydrog ?    ? A  C   156  O2    ? ? ? 1_555 A  G   180  N2    ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog206  hydrog ?    ? A  G   157  N1    ? ? ? 1_555 A  C   179  N3    ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog207  hydrog ?    ? A  G   157  N2    ? ? ? 1_555 A  C   179  O2    ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog208  hydrog ?    ? A  G   157  O6    ? ? ? 1_555 A  C   179  N4    ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog209  hydrog ?    ? A  G   157  N2    ? ? ? 1_555 A  A   1470 N1    ? ? 0 G   157  0 A   1470 1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog210  hydrog ?    ? A  A   158  N1    ? ? ? 1_555 A  U   178  N3    ? ? 0 A   158  0 U   178  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog211  hydrog ?    ? A  A   158  N6    ? ? ? 1_555 A  U   178  O4    ? ? 0 A   158  0 U   178  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog212  hydrog ?    ? A  G   159  N2    ? ? ? 1_555 A  A   177  N7    ? ? 0 G   159  0 A   177  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog213  hydrog ?    ? A  G   159  N3    ? ? ? 1_555 A  A   177  N6    ? ? 0 G   159  0 A   177  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog214  hydrog ?    ? A  G   159  N2    ? ? ? 1_555 A  U   178  O4    ? ? 0 G   159  0 U   178  1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog215  hydrog ?    ? A  A   160  N6    ? ? ? 1_555 A  U   176  O2    ? ? 0 A   160  0 U   176  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog216  hydrog ?    ? A  A   160  N7    ? ? ? 1_555 A  U   176  N3    ? ? 0 A   160  0 U   176  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog217  hydrog ?    ? A  A   161  N6    ? ? ? 1_555 A  A   174  N7    ? ? 0 A   161  0 A   174  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog218  hydrog ?    ? A  A   161  N7    ? ? ? 1_555 A  A   174  N6    ? ? 0 A   161  0 A   174  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog219  hydrog ?    ? A  A   161  N3    ? ? ? 1_555 A  G   892  N2    ? ? 0 A   161  0 G   892  1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog220  hydrog ?    ? A  C   162  N4    ? ? ? 1_555 A  C   173  O2    ? ? 0 C   162  0 C   173  1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog221  hydrog ?    ? A  C   162  O2    ? ? ? 1_555 A  C   893  N4    ? ? 0 C   162  0 C   893  1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog222  hydrog ?    ? A  U   163  N3    ? ? ? 1_555 A  U   172  O2    ? ? 0 U   163  0 U   172  1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog223  hydrog ?    ? A  U   163  O4    ? ? ? 1_555 A  U   172  N3    ? ? 0 U   163  0 U   172  1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog224  hydrog ?    ? A  G   164  N1    ? ? ? 1_555 A  C   171  N3    ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog225  hydrog ?    ? A  G   164  N2    ? ? ? 1_555 A  C   171  O2    ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog226  hydrog ?    ? A  G   164  O6    ? ? ? 1_555 A  C   171  N4    ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog227  hydrog ?    ? A  G   164  N2    ? ? ? 1_555 A  A   222  N3    ? ? 0 G   164  0 A   222  1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog228  hydrog ?    ? A  A   165  N3    ? ? ? 1_555 A  G   221  N2    ? ? 0 A   165  0 G   221  1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog229  hydrog ?    ? A  A   166  N1    ? ? ? 1_555 A  G   924  N2    ? ? 0 A   166  0 G   924  1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog230  hydrog ?    ? A  A   166  N6    ? ? ? 1_555 A  G   924  N3    ? ? 0 A   166  0 G   924  1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog231  hydrog ?    ? A  C   168  N3    ? ? ? 1_555 A  G   219  N1    ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog232  hydrog ?    ? A  C   168  N4    ? ? ? 1_555 A  G   219  O6    ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog233  hydrog ?    ? A  C   168  O2    ? ? ? 1_555 A  G   219  N2    ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog234  hydrog ?    ? A  U   170  N3    ? ? ? 1_555 A  G   221  O6    ? ? 0 U   170  0 G   221  1_555 ? ? ? ? ? ? TYPE_27_PAIR 
?     ? ? 
hydrog235  hydrog ?    ? A  U   170  O4    ? ? ? 1_555 A  G   221  N1    ? ? 0 U   170  0 G   221  1_555 ? ? ? ? ? ? TYPE_27_PAIR 
?     ? ? 
hydrog236  hydrog ?    ? A  C   171  O2    ? ? ? 1_555 A  G   221  N1    ? ? 0 C   171  0 G   221  1_555 ? ? ? ? ? ? 'C-G PAIR' ? 
? ? 
hydrog237  hydrog ?    ? A  G   175  N2    ? ? ? 1_555 A  U   176  O4    ? ? 0 G   175  0 U   176  1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog238  hydrog ?    ? A  G   185  N2    ? ? ? 1_555 A  A   439  N1    ? ? 0 G   185  0 A   439  1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog239  hydrog ?    ? A  G   190  N2    ? ? ? 1_555 A  A   435  N7    ? ? 0 G   190  0 A   435  1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog240  hydrog ?    ? A  A   191  N6    ? ? ? 1_555 A  A   236  N3    ? ? 0 A   191  0 A   236  1_555 ? ? ? ? ? ? 'A-A MISPAIR' 
?     ? ? 
hydrog241  hydrog ?    ? A  A   191  N6    ? ? ? 1_555 A  U   434  O2    ? ? 0 A   191  0 U   434  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog242  hydrog ?    ? A  A   191  N7    ? ? ? 1_555 A  U   434  N3    ? ? 0 A   191  0 U   434  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog243  hydrog ?    ? A  A   192  N6    ? ? ? 1_555 A  G   203  N3    ? ? 0 A   192  0 G   203  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog244  hydrog ?    ? A  A   192  N7    ? ? ? 1_555 A  G   203  N2    ? ? 0 A   192  0 G   203  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog245  hydrog ?    ? A  A   193  N3    ? ? ? 1_555 A  G   413  N2    ? ? 0 A   193  0 G   413  1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog246  hydrog ?    ? A  A   194  N1    ? ? ? 1_555 A  U   202  N3    ? ? 0 A   194  0 U   202  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog247  hydrog ?    ? A  A   194  N6    ? ? ? 1_555 A  U   202  O4    ? ? 0 A   194  0 U   202  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog248  hydrog ?    ? A  C   195  N3    ? ? ? 1_555 A  G   201  N1    ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog249  hydrog ?    ? A  C   195  N4    ? ? ? 1_555 A  G   201  O6    ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog250  hydrog ?    ? A  C   195  O2    ? ? ? 1_555 A  G   201  N2    ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog251  hydrog ?    ? A  G   196  N2    ? ? ? 1_555 A  A   199  N7    ? ? 0 G   196  0 A   199  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog252  hydrog ?    ? A  G   196  N3    ? ? ? 1_555 A  A   199  N6    ? ? 0 G   196  0 A   199  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog253  hydrog ?    ? A  G   196  N1    ? ? ? 1_555 A  U   425  O2    ? ? 0 G   196  0 U   425  1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog254  hydrog ?    ? A  A   198  N1    ? ? ? 1_555 A  G   416  N2    ? ? 0 A   198  0 G   416  1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog255  hydrog ?    ? A  A   198  N6    ? ? ? 1_555 A  G   416  N3    ? ? 0 A   198  0 G   416  1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog256  hydrog ?    ? A  A   204  N1    ? ? ? 1_555 A  A   436  N6    ? ? 0 A   204  0 A   436  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? 
? ? 
hydrog257  hydrog ?    ? A  A   204  N6    ? ? ? 1_555 A  A   436  N1    ? ? 0 A   204  0 A   436  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? 
? ? 
hydrog258  hydrog ?    ? A  U   205  N3    ? ? ? 1_555 A  A   437  N1    ? ? 0 U   205  0 A   437  1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog259  hydrog ?    ? A  U   205  O2    ? ? ? 1_555 A  A   437  N6    ? ? 0 U   205  0 A   437  1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog260  hydrog ?    ? A  G   206  N1    ? ? ? 1_555 A  U   233  O2    ? ? 0 G   206  0 U   233  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog261  hydrog ?    ? A  G   206  O6    ? ? ? 1_555 A  U   233  N3    ? ? 0 G   206  0 U   233  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog262  hydrog ?    ? A  U   207  N3    ? ? ? 1_555 A  A   232  N1    ? ? 0 U   207  0 A   232  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog263  hydrog ?    ? A  U   207  O4    ? ? ? 1_555 A  A   232  N6    ? ? 0 U   207  0 A   232  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog264  hydrog ?    ? A  C   208  N3    ? ? ? 1_555 A  G   231  N1    ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog265  hydrog ?    ? A  C   208  N4    ? ? ? 1_555 A  G   231  O6    ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog266  hydrog ?    ? A  C   208  O2    ? ? ? 1_555 A  G   231  N2    ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog267  hydrog ?    ? A  G   209  N1    ? ? ? 1_555 A  C   230  N3    ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog268  hydrog ?    ? A  G   209  N2    ? ? ? 1_555 A  C   230  O2    ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog269  hydrog ?    ? A  G   209  O6    ? ? ? 1_555 A  C   230  N4    ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog270  hydrog ?    ? A  U   210  N3    ? ? ? 1_555 A  G   229  O6    ? ? 0 U   210  0 G   229  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog271  hydrog ?    ? A  U   210  O2    ? ? ? 1_555 A  G   229  N1    ? ? 0 U   210  0 G   229  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog272  hydrog ?    ? A  U   211  O2    ? ? ? 1_555 A  C   228  N4    ? ? 0 U   211  0 C   228  1_555 ? ? ? ? ? ? 'U-C MISPAIR' 
?     ? ? 
hydrog273  hydrog ?    ? A  A   212  N6    ? ? ? 1_555 A  A   227  N7    ? ? 0 A   212  0 A   227  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog274  hydrog ?    ? A  A   212  N7    ? ? ? 1_555 A  A   227  N6    ? ? 0 A   212  0 A   227  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog275  hydrog ?    ? A  G   213  N2    ? ? ? 1_555 A  U   214  O4    ? ? 0 G   213  0 U   214  1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog276  hydrog ?    ? A  U   214  N3    ? ? ? 1_555 A  A   226  N7    ? ? 0 U   214  0 A   226  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog277  hydrog ?    ? A  U   214  O2    ? ? ? 1_555 A  A   226  N6    ? ? 0 U   214  0 A   226  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog278  hydrog ?    ? A  A   215  N6    ? ? ? 1_555 A  G   225  N3    ? ? 0 A   215  0 G   225  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog279  hydrog ?    ? A  A   215  N7    ? ? ? 1_555 A  G   225  N2    ? ? 0 A   215  0 G   225  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog280  hydrog ?    ? A  A   216  N1    ? ? ? 1_555 A  U   224  N3    ? ? 0 A   216  0 U   224  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog281  hydrog ?    ? A  A   216  N6    ? ? ? 1_555 A  U   224  O4    ? ? 0 A   216  0 U   224  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog282  hydrog ?    ? A  C   217  N3    ? ? ? 1_555 A  G   223  N1    ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog283  hydrog ?    ? A  C   217  N4    ? ? ? 1_555 A  G   223  O6    ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog284  hydrog ?    ? A  C   217  O2    ? ? ? 1_555 A  G   223  N2    ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog285  hydrog ?    ? A  C   218  O2    ? ? ? 1_555 A  A   222  N6    ? ? 0 C   218  0 A   222  1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog286  hydrog ?    ? A  G   231  N2    ? ? ? 1_555 A  A   666  N3    ? ? 0 G   231  0 A   666  1_555 ? ? ? ? ? ? 'G-A MISPAIR' 
?     ? ? 
hydrog287  hydrog ?    ? A  G   237  N1    ? ? ? 1_555 A  C   433  N3    ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog288  hydrog ?    ? A  G   237  N2    ? ? ? 1_555 A  C   433  O2    ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog289  hydrog ?    ? A  G   237  O6    ? ? ? 1_555 A  C   433  N4    ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog290  hydrog ?    ? A  C   238  N3    ? ? ? 1_555 A  G   432  N1    ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog291  hydrog ?    ? A  C   238  N4    ? ? ? 1_555 A  G   432  O6    ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog292  hydrog ?    ? A  C   238  O2    ? ? ? 1_555 A  G   432  N2    ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog293  hydrog ?    ? A  C   239  N3    ? ? ? 1_555 A  G   431  N1    ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog294  hydrog ?    ? A  C   239  N4    ? ? ? 1_555 A  G   431  O6    ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog295  hydrog ?    ? A  C   239  O2    ? ? ? 1_555 A  G   431  N2    ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog296  hydrog ?    ? A  C   240  N3    ? ? ? 1_555 A  G   379  N1    ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog297  hydrog ?    ? A  C   240  N4    ? ? ? 1_555 A  G   379  O6    ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog298  hydrog ?    ? A  C   240  O2    ? ? ? 1_555 A  G   379  N2    ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog299  hydrog ?    ? A  A   241  N6    ? ? ? 1_555 A  U   270  O2    ? ? 0 A   241  0 U   270  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog300  hydrog ?    ? A  A   241  N7    ? ? ? 1_555 A  U   270  N3    ? ? 0 A   241  0 U   270  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog301  hydrog ?    ? A  A   242  N6    ? ? ? 1_555 A  G   269  N3    ? ? 0 A   242  0 G   269  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog302  hydrog ?    ? A  A   242  N7    ? ? ? 1_555 A  G   269  N2    ? ? 0 A   242  0 G   269  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog303  hydrog ?    ? A  A   243  N6    ? ? ? 1_555 A  U   268  O2    ? ? 0 A   243  0 U   268  1_555 ? ? ? ? ? ? 'A-U PAIR' ? 
? ? 
hydrog304  hydrog ?    ? A  A   243  N3    ? ? ? 1_555 A  G   274  N2    ? ? 0 A   243  0 G   274  1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog305  hydrog ?    ? A  C   244  N3    ? ? ? 1_555 A  G   267  N1    ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog306  hydrog ?    ? A  C   244  N4    ? ? ? 1_555 A  G   267  O6    ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog307  hydrog ?    ? A  C   244  O2    ? ? ? 1_555 A  G   267  N2    ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog308  hydrog ?    ? A  C   245  N3    ? ? ? 1_555 A  G   266  N1    ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog309  hydrog ?    ? A  C   245  N4    ? ? ? 1_555 A  G   266  O6    ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog310  hydrog ?    ? A  C   245  O2    ? ? ? 1_555 A  G   266  N2    ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog311  hydrog ?    ? A  G   246  N2    ? ? ? 1_555 A  U   265  O4    ? ? 0 G   246  0 U   265  1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog312  hydrog ?    ? A  A   247  N6    ? ? ? 1_555 A  G   264  N3    ? ? 0 A   247  0 G   264  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog313  hydrog ?    ? A  A   247  N7    ? ? ? 1_555 A  G   264  N2    ? ? 0 A   247  0 G   264  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog314  hydrog ?    ? A  A   248  N1    ? ? ? 1_555 A  U   265  N3    ? ? 0 A   248  0 U   265  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog315  hydrog ?    ? A  A   248  N6    ? ? ? 1_555 A  U   265  O4    ? ? 0 A   248  0 U   265  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog316  hydrog ?    ? A  G   249  N1    ? ? ? 1_555 A  C   260  N3    ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog317  hydrog ?    ? A  G   249  N2    ? ? ? 1_555 A  C   260  O2    ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog318  hydrog ?    ? A  G   249  O6    ? ? ? 1_555 A  C   260  N4    ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog319  hydrog ?    ? A  C   250  N3    ? ? ? 1_555 A  G   259  N1    ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog320  hydrog ?    ? A  C   250  N4    ? ? ? 1_555 A  G   259  O6    ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog321  hydrog ?    ? A  C   250  O2    ? ? ? 1_555 A  G   259  N2    ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog322  hydrog ?    ? A  C   251  N3    ? ? ? 1_555 A  G   258  N1    ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog323  hydrog ?    ? A  C   251  N4    ? ? ? 1_555 A  G   258  O6    ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog324  hydrog ?    ? A  C   251  O2    ? ? ? 1_555 A  G   258  N2    ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog325  hydrog ?    ? A  C   252  N3    ? ? ? 1_555 A  G   257  N1    ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog326  hydrog ?    ? A  C   252  N4    ? ? ? 1_555 A  G   257  O6    ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog327  hydrog ?    ? A  C   252  O2    ? ? ? 1_555 A  G   257  N2    ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog328  hydrog ?    ? A  U   253  O2    ? ? ? 1_555 A  C   256  N4    ? ? 0 U   253  0 C   256  1_555 ? ? ? ? ? ? 'U-C MISPAIR' 
?     ? ? 
hydrog329  hydrog ?    ? A  U   253  N3    ? ? ? 1_555 A  G   257  O6    ? ? 0 U   253  0 G   257  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog330  hydrog ?    ? A  U   253  O2    ? ? ? 1_555 A  G   257  N1    ? ? 0 U   253  0 G   257  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog331  hydrog ?    ? A  C   271  N4    ? ? ? 1_555 A  A   378  N1    ? ? 0 C   271  0 A   378  1_555 ? ? ? ? ? ? 'C-A MISPAIR' 
?     ? ? 
hydrog332  hydrog ?    ? A  G   273  N1    ? ? ? 1_555 A  C   377  N3    ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog333  hydrog ?    ? A  G   273  N2    ? ? ? 1_555 A  C   377  O2    ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog334  hydrog ?    ? A  G   273  O6    ? ? ? 1_555 A  C   377  N4    ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog335  hydrog ?    ? A  G   274  N1    ? ? ? 1_555 A  C   376  N3    ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog336  hydrog ?    ? A  G   274  N2    ? ? ? 1_555 A  C   376  O2    ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog337  hydrog ?    ? A  G   274  O6    ? ? ? 1_555 A  C   376  N4    ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog338  hydrog ?    ? A  G   275  N1    ? ? ? 1_555 A  U   374  O2    ? ? 0 G   275  0 U   374  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog339  hydrog ?    ? A  G   275  O6    ? ? ? 1_555 A  U   374  N3    ? ? 0 G   275  0 U   374  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog340  hydrog ?    ? A  C   276  N3    ? ? ? 1_555 A  G   373  N1    ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog341  hydrog ?    ? A  C   276  N4    ? ? ? 1_555 A  G   373  O6    ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog342  hydrog ?    ? A  C   276  O2    ? ? ? 1_555 A  G   373  N2    ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog343  hydrog ?    ? A  U   277  N3    ? ? ? 1_555 A  A   372  N1    ? ? 0 U   277  0 A   372  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog344  hydrog ?    ? A  U   277  O4    ? ? ? 1_555 A  A   372  N6    ? ? 0 U   277  0 A   372  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog345  hydrog ?    ? A  A   278  N1    ? ? ? 1_555 A  U   371  N3    ? ? 0 A   278  0 U   371  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog346  hydrog ?    ? A  A   278  N6    ? ? ? 1_555 A  U   371  O4    ? ? 0 A   278  0 U   371  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog347  hydrog ?    ? A  C   279  N3    ? ? ? 1_555 A  G   370  N1    ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog348  hydrog ?    ? A  C   279  N4    ? ? ? 1_555 A  G   370  O6    ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog349  hydrog ?    ? A  C   279  O2    ? ? ? 1_555 A  G   370  N2    ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog350  hydrog ?    ? A  C   280  N3    ? ? ? 1_555 A  G   369  N1    ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog351  hydrog ?    ? A  C   280  N4    ? ? ? 1_555 A  G   369  O6    ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog352  hydrog ?    ? A  C   280  O2    ? ? ? 1_555 A  G   369  N2    ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog353  hydrog ?    ? A  U   281  O2    ? ? ? 1_555 A  C   368  N4    ? ? 0 U   281  0 C   368  1_555 ? ? ? ? ? ? 'U-C MISPAIR' 
?     ? ? 
hydrog354  hydrog ?    ? A  C   282  O2    ? ? ? 1_555 A  C   368  N4    ? ? 0 C   282  0 C   368  1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog355  hydrog ?    ? A  A   285  N6    ? ? ? 1_555 A  G   367  N3    ? ? 0 A   285  0 G   367  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog356  hydrog ?    ? A  A   285  N7    ? ? ? 1_555 A  G   367  N2    ? ? 0 A   285  0 G   367  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog357  hydrog ?    ? A  U   286  N3    ? ? ? 1_555 A  U   366  O2    ? ? 0 U   286  0 U   366  1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog358  hydrog ?    ? A  U   286  O4    ? ? ? 1_555 A  U   366  N3    ? ? 0 U   286  0 U   366  1_555 ? ? ? ? ? ? TYPE_16_PAIR 
?     ? ? 
hydrog359  hydrog ?    ? A  C   287  N3    ? ? ? 1_555 A  G   365  N1    ? ? 0 C   287  0 G   365  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog360  hydrog ?    ? A  C   287  N4    ? ? ? 1_555 A  G   365  O6    ? ? 0 C   287  0 G   365  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog361  hydrog ?    ? A  C   287  O2    ? ? ? 1_555 A  G   365  N2    ? ? 0 C   287  0 G   365  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog362  hydrog ?    ? A  A   288  N1    ? ? ? 1_555 A  U   364  N3    ? ? 0 A   288  0 U   364  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog363  hydrog ?    ? A  A   288  N6    ? ? ? 1_555 A  U   364  O4    ? ? 0 A   288  0 U   364  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog364  hydrog ?    ? A  G   289  N1    ? ? ? 1_555 A  C   363  N3    ? ? 0 G   289  0 C   363  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog365  hydrog ?    ? A  G   289  N2    ? ? ? 1_555 A  C   363  O2    ? ? 0 G   289  0 C   363  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog366  hydrog ?    ? A  G   289  O6    ? ? ? 1_555 A  C   363  N4    ? ? 0 G   289  0 C   363  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog367  hydrog ?    ? A  C   290  N3    ? ? ? 1_555 A  G   362  N1    ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog368  hydrog ?    ? A  C   290  N4    ? ? ? 1_555 A  G   362  O6    ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog369  hydrog ?    ? A  C   290  O2    ? ? ? 1_555 A  G   362  N2    ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog370  hydrog ?    ? A  C   291  N3    ? ? ? 1_555 A  C   361  N4    ? ? 0 C   291  0 C   361  1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog371  hydrog ?    ? A  G   292  N2    ? ? ? 1_555 A  A   360  N7    ? ? 0 G   292  0 A   360  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog372  hydrog ?    ? A  G   292  N3    ? ? ? 1_555 A  A   360  N6    ? ? 0 G   292  0 A   360  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog373  hydrog ?    ? A  A   293  N6    ? ? ? 1_555 A  U   359  O2    ? ? 0 A   293  0 U   359  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog374  hydrog ?    ? A  A   293  N7    ? ? ? 1_555 A  U   359  N3    ? ? 0 A   293  0 U   359  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog375  hydrog ?    ? A  C   295  N4    ? ? ? 1_555 A  C   356  O2    ? ? 0 C   295  0 C   356  1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog376  hydrog ?    ? A  G   296  N1    ? ? ? 1_555 A  C   355  N3    ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog377  hydrog ?    ? A  G   296  N2    ? ? ? 1_555 A  C   355  O2    ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog378  hydrog ?    ? A  G   296  O6    ? ? ? 1_555 A  C   355  N4    ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog379  hydrog ?    ? A  U   297  N3    ? ? ? 1_555 A  A   354  N1    ? ? 0 U   297  0 A   354  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog380  hydrog ?    ? A  U   297  O4    ? ? ? 1_555 A  A   354  N6    ? ? 0 U   297  0 A   354  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog381  hydrog ?    ? A  C   298  N3    ? ? ? 1_555 A  G   353  N1    ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog382  hydrog ?    ? A  C   298  N4    ? ? ? 1_555 A  G   353  O6    ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog383  hydrog ?    ? A  C   298  O2    ? ? ? 1_555 A  G   353  N2    ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog384  hydrog ?    ? A  U   299  N3    ? ? ? 1_555 A  A   352  N1    ? ? 0 U   299  0 A   352  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog385  hydrog ?    ? A  U   299  O4    ? ? ? 1_555 A  A   352  N6    ? ? 0 U   299  0 A   352  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog386  hydrog ?    ? A  U   300  N3    ? ? ? 1_555 A  A   351  N1    ? ? 0 U   300  0 A   351  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog387  hydrog ?    ? A  U   300  O4    ? ? ? 1_555 A  A   351  N6    ? ? 0 U   300  0 A   351  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog388  hydrog ?    ? A  C   301  N3    ? ? ? 1_555 A  G   350  N1    ? ? 0 C   301  0 G   350  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog389  hydrog ?    ? A  C   301  N4    ? ? ? 1_555 A  G   350  O6    ? ? 0 C   301  0 G   350  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog390  hydrog ?    ? A  C   301  O2    ? ? ? 1_555 A  G   350  N2    ? ? 0 C   301  0 G   350  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog391  hydrog ?    ? A  A   302  N1    ? ? ? 1_555 A  U   349  N3    ? ? 0 A   302  0 U   349  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog392  hydrog ?    ? A  A   302  N6    ? ? ? 1_555 A  U   349  O4    ? ? 0 A   302  0 U   349  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog393  hydrog ?    ? A  C   303  N3    ? ? ? 1_555 A  C   348  N4    ? ? 0 C   303  0 C   348  1_555 ? ? ? ? ? ? 'C-C MISPAIR' 
?     ? ? 
hydrog394  hydrog ?    ? A  G   304  N2    ? ? ? 1_555 A  A   347  N7    ? ? 0 G   304  0 A   347  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog395  hydrog ?    ? A  G   304  N3    ? ? ? 1_555 A  A   347  N6    ? ? 0 G   304  0 A   347  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog396  hydrog ?    ? A  A   305  N6    ? ? ? 1_555 A  G   345  O6    ? ? 0 A   305  0 G   345  1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog397  hydrog ?    ? A  A   306  N6    ? ? ? 1_555 A  G   345  O6    ? ? 0 A   306  0 G   345  1_555 ? ? ? ? ? ? 'A-G MISPAIR' 
?     ? ? 
hydrog398  hydrog ?    ? A  G   307  N1    ? ? ? 1_555 A  C   323  N3    ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog399  hydrog ?    ? A  G   307  N2    ? ? ? 1_555 A  C   323  O2    ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog400  hydrog ?    ? A  G   307  O6    ? ? ? 1_555 A  C   323  N4    ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog401  hydrog ?    ? A  U   308  N3    ? ? ? 1_555 A  A   339  N1    ? ? 0 U   308  0 A   339  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog402  hydrog ?    ? A  U   308  O4    ? ? ? 1_555 A  A   339  N6    ? ? 0 U   308  0 A   339  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog403  hydrog ?    ? A  C   309  N3    ? ? ? 1_555 A  G   322  N1    ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog404  hydrog ?    ? A  C   309  N4    ? ? ? 1_555 A  G   322  O6    ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog405  hydrog ?    ? A  C   309  O2    ? ? ? 1_555 A  G   322  N2    ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog406  hydrog ?    ? A  U   310  N3    ? ? ? 1_555 A  A   321  N1    ? ? 0 U   310  0 A   321  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog407  hydrog ?    ? A  U   310  O4    ? ? ? 1_555 A  A   321  N6    ? ? 0 U   310  0 A   321  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog408  hydrog ?    ? A  C   311  N3    ? ? ? 1_555 A  G   320  N1    ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog409  hydrog ?    ? A  C   311  N4    ? ? ? 1_555 A  G   320  O6    ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog410  hydrog ?    ? A  C   311  O2    ? ? ? 1_555 A  G   320  N2    ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog411  hydrog ?    ? A  U   312  N3    ? ? ? 1_555 A  A   319  N1    ? ? 0 U   312  0 A   319  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog412  hydrog ?    ? A  U   312  O4    ? ? ? 1_555 A  A   319  N6    ? ? 0 U   312  0 A   319  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog413  hydrog ?    ? A  U   313  N3    ? ? ? 1_555 A  A   317  N7    ? ? 0 U   313  0 A   317  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog414  hydrog ?    ? A  U   313  O2    ? ? ? 1_555 A  A   317  N6    ? ? 0 U   313  0 A   317  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog415  hydrog ?    ? A  G   314  N2    ? ? ? 1_555 A  A   337  N1    ? ? 0 G   314  0 A   337  1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog416  hydrog ?    ? A  G   314  N3    ? ? ? 1_555 A  A   337  N6    ? ? 0 G   314  0 A   337  1_555 ? ? ? ? ? ? TYPE_10_PAIR 
?     ? ? 
hydrog417  hydrog ?    ? A  G   315  N2    ? ? ? 1_555 A  G   336  N3    ? ? 0 G   315  0 G   336  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? 
? ? 
hydrog418  hydrog ?    ? A  G   315  N3    ? ? ? 1_555 A  G   336  N2    ? ? 0 G   315  0 G   336  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? 
? ? 
hydrog419  hydrog ?    ? A  A   316  N6    ? ? ? 1_555 A  U   1314 O2    ? ? 0 A   316  0 U   1314 1_555 ? ? ? ? ? ? 'A-U PAIR' ? 
? ? 
hydrog420  hydrog ?    ? A  G   324  N1    ? ? ? 1_555 A  C   341  N3    ? ? 0 G   324  0 C   341  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog421  hydrog ?    ? A  G   324  N2    ? ? ? 1_555 A  C   341  O2    ? ? 0 G   324  0 C   341  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog422  hydrog ?    ? A  G   324  O6    ? ? ? 1_555 A  C   341  N4    ? ? 0 G   324  0 C   341  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog423  hydrog ?    ? A  U   325  N3    ? ? ? 1_555 A  A   340  N1    ? ? 0 U   325  0 A   340  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog424  hydrog ?    ? A  U   325  O4    ? ? ? 1_555 A  A   340  N6    ? ? 0 U   325  0 A   340  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog425  hydrog ?    ? A  G   326  N1    ? ? ? 1_555 A  C   330  N3    ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog426  hydrog ?    ? A  G   326  N2    ? ? ? 1_555 A  C   330  O2    ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog427  hydrog ?    ? A  G   326  O6    ? ? ? 1_555 A  C   330  N4    ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog428  hydrog ?    ? A  A   329  N3    ? ? ? 1_555 A  U   346  N3    ? ? 0 A   329  0 U   346  1_555 ? ? ? ? ? ? 'A-U PAIR' ? 
? ? 
hydrog429  hydrog ?    ? A  A   331  N6    ? ? ? 1_555 A  G   345  N3    ? ? 0 A   331  0 G   345  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog430  hydrog ?    ? A  A   331  N7    ? ? ? 1_555 A  G   345  N2    ? ? 0 A   331  0 G   345  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog431  hydrog ?    ? A  G   332  N1    ? ? ? 1_555 A  C   344  N3    ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog432  hydrog ?    ? A  G   332  N2    ? ? ? 1_555 A  C   344  O2    ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog433  hydrog ?    ? A  G   332  O6    ? ? ? 1_555 A  C   344  N4    ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog434  hydrog ?    ? A  G   333  N1    ? ? ? 1_555 A  C   343  N3    ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog435  hydrog ?    ? A  G   333  N2    ? ? ? 1_555 A  C   343  O2    ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog436  hydrog ?    ? A  G   333  O6    ? ? ? 1_555 A  C   343  N4    ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog437  hydrog ?    ? A  G   334  N1    ? ? ? 1_555 A  C   342  N3    ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog438  hydrog ?    ? A  G   334  N2    ? ? ? 1_555 A  C   342  O2    ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog439  hydrog ?    ? A  G   334  O6    ? ? ? 1_555 A  C   342  N4    ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog440  hydrog ?    ? A  U   335  N3    ? ? ? 1_555 A  A   339  N7    ? ? 0 U   335  0 A   339  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog441  hydrog ?    ? A  U   335  O2    ? ? ? 1_555 A  A   339  N6    ? ? 0 U   335  0 A   339  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog442  hydrog ?    ? A  G   358  N2    ? ? ? 1_555 A  U   359  O4    ? ? 0 G   358  0 U   359  1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog443  hydrog ?    ? A  A   380  N6    ? ? ? 1_555 A  A   408  N7    ? ? 0 A   380  0 A   408  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog444  hydrog ?    ? A  A   380  N7    ? ? ? 1_555 A  A   408  N6    ? ? 0 A   380  0 A   408  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? 
? ? 
hydrog445  hydrog ?    ? A  G   381  N2    ? ? ? 1_555 A  U   382  O4    ? ? 0 G   381  0 U   382  1_555 ? ? ? ? ? ? 'G-U MISPAIR' 
?     ? ? 
hydrog446  hydrog ?    ? A  U   382  N3    ? ? ? 1_555 A  A   407  N7    ? ? 0 U   382  0 A   407  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog447  hydrog ?    ? A  U   382  O2    ? ? ? 1_555 A  A   407  N6    ? ? 0 U   382  0 A   407  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog448  hydrog ?    ? A  A   383  N6    ? ? ? 1_555 A  G   406  N3    ? ? 0 A   383  0 G   406  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog449  hydrog ?    ? A  A   383  N7    ? ? ? 1_555 A  G   406  N2    ? ? 0 A   383  0 G   406  1_555 ? ? ? ? ? ? TYPE_11_PAIR 
?     ? ? 
hydrog450  hydrog ?    ? A  G   384  N1    ? ? ? 1_555 A  C   405  N3    ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog451  hydrog ?    ? A  G   384  N2    ? ? ? 1_555 A  C   405  O2    ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog452  hydrog ?    ? A  G   384  O6    ? ? ? 1_555 A  C   405  N4    ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog453  hydrog ?    ? A  C   385  N3    ? ? ? 1_555 A  G   404  N1    ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog454  hydrog ?    ? A  C   385  N4    ? ? ? 1_555 A  G   404  O6    ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog455  hydrog ?    ? A  C   385  O2    ? ? ? 1_555 A  G   404  N2    ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog456  hydrog ?    ? A  G   386  N1    ? ? ? 1_555 A  C   403  N3    ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog457  hydrog ?    ? A  G   386  N2    ? ? ? 1_555 A  C   403  O2    ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog458  hydrog ?    ? A  G   386  O6    ? ? ? 1_555 A  C   403  N4    ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog459  hydrog ?    ? A  G   387  N1    ? ? ? 1_555 A  U   402  O2    ? ? 0 G   387  0 U   402  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog460  hydrog ?    ? A  G   387  O6    ? ? ? 1_555 A  U   402  N3    ? ? 0 G   387  0 U   402  1_555 ? ? ? ? ? ? TYPE_28_PAIR 
?     ? ? 
hydrog461  hydrog ?    ? A  G   388  N1    ? ? ? 1_555 A  C   401  N3    ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog462  hydrog ?    ? A  G   388  N2    ? ? ? 1_555 A  C   401  O2    ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog463  hydrog ?    ? A  G   388  O6    ? ? ? 1_555 A  C   401  N4    ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK 
?     ? ? 
hydrog464  hydrog ?    ?